data_4MQW
# 
_entry.id   4MQW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4MQW         
RCSB  RCSB082253   
WWPDB D_1000082253 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4ay9 
_pdbx_database_related.details        
'Structure of follicle-stimulating hormone in complex with the entire ectodomain of its receptor' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4MQW 
_pdbx_database_status.recvd_initial_deposition_date   2013-09-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Jiang, X.' 1 
'Liu, H.'   2 
'Chen, X.'  3 
'He, X.'    4 
# 
_citation.id                        primary 
_citation.title                     'Evidence for Follicle-stimulating Hormone Receptor as a Functional Trimer.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            289 
_citation.page_first                14273 
_citation.page_last                 14282 
_citation.year                      2014 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24692546 
_citation.pdbx_database_id_DOI      10.1074/jbc.M114.549592 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Jiang, X.'       1  ? 
primary 'Fischer, D.'     2  ? 
primary 'Chen, X.'        3  ? 
primary 'McKenna, S.D.'   4  ? 
primary 'Liu, H.'         5  ? 
primary 'Sriraman, V.'    6  ? 
primary 'Yu, H.N.'        7  ? 
primary 'Goutopoulos, A.' 8  ? 
primary 'Arkinstall, S.'  9  ? 
primary 'He, X.'          10 ? 
# 
_cell.entry_id           4MQW 
_cell.length_a           95.900 
_cell.length_b           95.900 
_cell.length_c           204.281 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              9 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4MQW 
_symmetry.space_group_name_H-M             'P 31' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                144 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glycoprotein hormones, alpha polypeptide'                          11364.014 3   ? ?     ? ? 
2 polymer     man 'Follitropin subunit beta'                                          12500.208 3   ? ?     ? ? 
3 polymer     man 'Follicle-stimulating hormone receptor'                             41332.734 3   ? C188S ? ? 
4 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                            221.208   15  ? ?     ? ? 
5 non-polymer syn 1,2-ETHANEDIOL                                                      62.068    5   ? ?     ? ? 
6 non-polymer syn 
;O-(O-(2-AMINOPROPYL)-O'-(2-METHOXYETHYL)POLYPROPYLENE GLYCOL 500)
;
597.822   1   ? ?     ? ? 
7 water       nat water                                                               18.015    155 ? ?     ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
2 'Follicle-stimulating hormone beta subunit, FSH-B, FSH-beta, Follitropin beta chain' 
3 'FSH-R, Follitropin receptor'                                                        
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;APDVQDCPECTLQENPLFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHT
ACHCSTCYYHKSAAAHHHHHHH
;
;APDVQDCPECTLQENPLFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHT
ACHCSTCYYHKSAAAHHHHHHH
;
A,D,G ? 
2 'polypeptide(L)' no no  
;NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVAT
QCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
;
;NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVAT
QCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
;
B,E,H ? 
3 'polypeptide(L)' no yes 
;SGCHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLP
KLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVIL
WLNKNGIQEIHNSAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKL
PTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFD
(TYS)DLCNEVVDVTCSPKPDAFNPCEDIMGYNILRAAAHHHHHHH
;
;SGCHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLP
KLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVIL
WLNKNGIQEIHNSAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKL
PTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDY
DLCNEVVDVTCSPKPDAFNPCEDIMGYNILRAAAHHHHHHH
;
X,Y,Z ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   PRO n 
1 3   ASP n 
1 4   VAL n 
1 5   GLN n 
1 6   ASP n 
1 7   CYS n 
1 8   PRO n 
1 9   GLU n 
1 10  CYS n 
1 11  THR n 
1 12  LEU n 
1 13  GLN n 
1 14  GLU n 
1 15  ASN n 
1 16  PRO n 
1 17  LEU n 
1 18  PHE n 
1 19  SER n 
1 20  GLN n 
1 21  PRO n 
1 22  GLY n 
1 23  ALA n 
1 24  PRO n 
1 25  ILE n 
1 26  LEU n 
1 27  GLN n 
1 28  CYS n 
1 29  MET n 
1 30  GLY n 
1 31  CYS n 
1 32  CYS n 
1 33  PHE n 
1 34  SER n 
1 35  ARG n 
1 36  ALA n 
1 37  TYR n 
1 38  PRO n 
1 39  THR n 
1 40  PRO n 
1 41  LEU n 
1 42  ARG n 
1 43  SER n 
1 44  LYS n 
1 45  LYS n 
1 46  THR n 
1 47  MET n 
1 48  LEU n 
1 49  VAL n 
1 50  GLN n 
1 51  LYS n 
1 52  ASN n 
1 53  VAL n 
1 54  THR n 
1 55  SER n 
1 56  GLU n 
1 57  SER n 
1 58  THR n 
1 59  CYS n 
1 60  CYS n 
1 61  VAL n 
1 62  ALA n 
1 63  LYS n 
1 64  SER n 
1 65  TYR n 
1 66  ASN n 
1 67  ARG n 
1 68  VAL n 
1 69  THR n 
1 70  VAL n 
1 71  MET n 
1 72  GLY n 
1 73  GLY n 
1 74  PHE n 
1 75  LYS n 
1 76  VAL n 
1 77  GLU n 
1 78  ASN n 
1 79  HIS n 
1 80  THR n 
1 81  ALA n 
1 82  CYS n 
1 83  HIS n 
1 84  CYS n 
1 85  SER n 
1 86  THR n 
1 87  CYS n 
1 88  TYR n 
1 89  TYR n 
1 90  HIS n 
1 91  LYS n 
1 92  SER n 
1 93  ALA n 
1 94  ALA n 
1 95  ALA n 
1 96  HIS n 
1 97  HIS n 
1 98  HIS n 
1 99  HIS n 
1 100 HIS n 
1 101 HIS n 
1 102 HIS n 
2 1   ASN n 
2 2   SER n 
2 3   CYS n 
2 4   GLU n 
2 5   LEU n 
2 6   THR n 
2 7   ASN n 
2 8   ILE n 
2 9   THR n 
2 10  ILE n 
2 11  ALA n 
2 12  ILE n 
2 13  GLU n 
2 14  LYS n 
2 15  GLU n 
2 16  GLU n 
2 17  CYS n 
2 18  ARG n 
2 19  PHE n 
2 20  CYS n 
2 21  ILE n 
2 22  SER n 
2 23  ILE n 
2 24  ASN n 
2 25  THR n 
2 26  THR n 
2 27  TRP n 
2 28  CYS n 
2 29  ALA n 
2 30  GLY n 
2 31  TYR n 
2 32  CYS n 
2 33  TYR n 
2 34  THR n 
2 35  ARG n 
2 36  ASP n 
2 37  LEU n 
2 38  VAL n 
2 39  TYR n 
2 40  LYS n 
2 41  ASP n 
2 42  PRO n 
2 43  ALA n 
2 44  ARG n 
2 45  PRO n 
2 46  LYS n 
2 47  ILE n 
2 48  GLN n 
2 49  LYS n 
2 50  THR n 
2 51  CYS n 
2 52  THR n 
2 53  PHE n 
2 54  LYS n 
2 55  GLU n 
2 56  LEU n 
2 57  VAL n 
2 58  TYR n 
2 59  GLU n 
2 60  THR n 
2 61  VAL n 
2 62  ARG n 
2 63  VAL n 
2 64  PRO n 
2 65  GLY n 
2 66  CYS n 
2 67  ALA n 
2 68  HIS n 
2 69  HIS n 
2 70  ALA n 
2 71  ASP n 
2 72  SER n 
2 73  LEU n 
2 74  TYR n 
2 75  THR n 
2 76  TYR n 
2 77  PRO n 
2 78  VAL n 
2 79  ALA n 
2 80  THR n 
2 81  GLN n 
2 82  CYS n 
2 83  HIS n 
2 84  CYS n 
2 85  GLY n 
2 86  LYS n 
2 87  CYS n 
2 88  ASP n 
2 89  SER n 
2 90  ASP n 
2 91  SER n 
2 92  THR n 
2 93  ASP n 
2 94  CYS n 
2 95  THR n 
2 96  VAL n 
2 97  ARG n 
2 98  GLY n 
2 99  LEU n 
2 100 GLY n 
2 101 PRO n 
2 102 SER n 
2 103 TYR n 
2 104 CYS n 
2 105 SER n 
2 106 PHE n 
2 107 GLY n 
2 108 GLU n 
2 109 MET n 
2 110 LYS n 
2 111 GLU n 
3 1   SER n 
3 2   GLY n 
3 3   CYS n 
3 4   HIS n 
3 5   HIS n 
3 6   ARG n 
3 7   ILE n 
3 8   CYS n 
3 9   HIS n 
3 10  CYS n 
3 11  SER n 
3 12  ASN n 
3 13  ARG n 
3 14  VAL n 
3 15  PHE n 
3 16  LEU n 
3 17  CYS n 
3 18  GLN n 
3 19  GLU n 
3 20  SER n 
3 21  LYS n 
3 22  VAL n 
3 23  THR n 
3 24  GLU n 
3 25  ILE n 
3 26  PRO n 
3 27  SER n 
3 28  ASP n 
3 29  LEU n 
3 30  PRO n 
3 31  ARG n 
3 32  ASN n 
3 33  ALA n 
3 34  ILE n 
3 35  GLU n 
3 36  LEU n 
3 37  ARG n 
3 38  PHE n 
3 39  VAL n 
3 40  LEU n 
3 41  THR n 
3 42  LYS n 
3 43  LEU n 
3 44  ARG n 
3 45  VAL n 
3 46  ILE n 
3 47  GLN n 
3 48  LYS n 
3 49  GLY n 
3 50  ALA n 
3 51  PHE n 
3 52  SER n 
3 53  GLY n 
3 54  PHE n 
3 55  GLY n 
3 56  ASP n 
3 57  LEU n 
3 58  GLU n 
3 59  LYS n 
3 60  ILE n 
3 61  GLU n 
3 62  ILE n 
3 63  SER n 
3 64  GLN n 
3 65  ASN n 
3 66  ASP n 
3 67  VAL n 
3 68  LEU n 
3 69  GLU n 
3 70  VAL n 
3 71  ILE n 
3 72  GLU n 
3 73  ALA n 
3 74  ASP n 
3 75  VAL n 
3 76  PHE n 
3 77  SER n 
3 78  ASN n 
3 79  LEU n 
3 80  PRO n 
3 81  LYS n 
3 82  LEU n 
3 83  HIS n 
3 84  GLU n 
3 85  ILE n 
3 86  ARG n 
3 87  ILE n 
3 88  GLU n 
3 89  LYS n 
3 90  ALA n 
3 91  ASN n 
3 92  ASN n 
3 93  LEU n 
3 94  LEU n 
3 95  TYR n 
3 96  ILE n 
3 97  ASN n 
3 98  PRO n 
3 99  GLU n 
3 100 ALA n 
3 101 PHE n 
3 102 GLN n 
3 103 ASN n 
3 104 LEU n 
3 105 PRO n 
3 106 ASN n 
3 107 LEU n 
3 108 GLN n 
3 109 TYR n 
3 110 LEU n 
3 111 LEU n 
3 112 ILE n 
3 113 SER n 
3 114 ASN n 
3 115 THR n 
3 116 GLY n 
3 117 ILE n 
3 118 LYS n 
3 119 HIS n 
3 120 LEU n 
3 121 PRO n 
3 122 ASP n 
3 123 VAL n 
3 124 HIS n 
3 125 LYS n 
3 126 ILE n 
3 127 HIS n 
3 128 SER n 
3 129 LEU n 
3 130 GLN n 
3 131 LYS n 
3 132 VAL n 
3 133 LEU n 
3 134 LEU n 
3 135 ASP n 
3 136 ILE n 
3 137 GLN n 
3 138 ASP n 
3 139 ASN n 
3 140 ILE n 
3 141 ASN n 
3 142 ILE n 
3 143 HIS n 
3 144 THR n 
3 145 ILE n 
3 146 GLU n 
3 147 ARG n 
3 148 ASN n 
3 149 SER n 
3 150 PHE n 
3 151 VAL n 
3 152 GLY n 
3 153 LEU n 
3 154 SER n 
3 155 PHE n 
3 156 GLU n 
3 157 SER n 
3 158 VAL n 
3 159 ILE n 
3 160 LEU n 
3 161 TRP n 
3 162 LEU n 
3 163 ASN n 
3 164 LYS n 
3 165 ASN n 
3 166 GLY n 
3 167 ILE n 
3 168 GLN n 
3 169 GLU n 
3 170 ILE n 
3 171 HIS n 
3 172 ASN n 
3 173 SER n 
3 174 ALA n 
3 175 PHE n 
3 176 ASN n 
3 177 GLY n 
3 178 THR n 
3 179 GLN n 
3 180 LEU n 
3 181 ASP n 
3 182 GLU n 
3 183 LEU n 
3 184 ASN n 
3 185 LEU n 
3 186 SER n 
3 187 ASP n 
3 188 ASN n 
3 189 ASN n 
3 190 ASN n 
3 191 LEU n 
3 192 GLU n 
3 193 GLU n 
3 194 LEU n 
3 195 PRO n 
3 196 ASN n 
3 197 ASP n 
3 198 VAL n 
3 199 PHE n 
3 200 HIS n 
3 201 GLY n 
3 202 ALA n 
3 203 SER n 
3 204 GLY n 
3 205 PRO n 
3 206 VAL n 
3 207 ILE n 
3 208 LEU n 
3 209 ASP n 
3 210 ILE n 
3 211 SER n 
3 212 ARG n 
3 213 THR n 
3 214 ARG n 
3 215 ILE n 
3 216 HIS n 
3 217 SER n 
3 218 LEU n 
3 219 PRO n 
3 220 SER n 
3 221 TYR n 
3 222 GLY n 
3 223 LEU n 
3 224 GLU n 
3 225 ASN n 
3 226 LEU n 
3 227 LYS n 
3 228 LYS n 
3 229 LEU n 
3 230 ARG n 
3 231 ALA n 
3 232 ARG n 
3 233 SER n 
3 234 THR n 
3 235 TYR n 
3 236 ASN n 
3 237 LEU n 
3 238 LYS n 
3 239 LYS n 
3 240 LEU n 
3 241 PRO n 
3 242 THR n 
3 243 LEU n 
3 244 GLU n 
3 245 LYS n 
3 246 LEU n 
3 247 VAL n 
3 248 ALA n 
3 249 LEU n 
3 250 MET n 
3 251 GLU n 
3 252 ALA n 
3 253 SER n 
3 254 LEU n 
3 255 THR n 
3 256 TYR n 
3 257 PRO n 
3 258 SER n 
3 259 HIS n 
3 260 CYS n 
3 261 CYS n 
3 262 ALA n 
3 263 PHE n 
3 264 ALA n 
3 265 ASN n 
3 266 TRP n 
3 267 ARG n 
3 268 ARG n 
3 269 GLN n 
3 270 ILE n 
3 271 SER n 
3 272 GLU n 
3 273 LEU n 
3 274 HIS n 
3 275 PRO n 
3 276 ILE n 
3 277 CYS n 
3 278 ASN n 
3 279 LYS n 
3 280 SER n 
3 281 ILE n 
3 282 LEU n 
3 283 ARG n 
3 284 GLN n 
3 285 GLU n 
3 286 VAL n 
3 287 ASP n 
3 288 TYR n 
3 289 MET n 
3 290 THR n 
3 291 GLN n 
3 292 ALA n 
3 293 ARG n 
3 294 GLY n 
3 295 GLN n 
3 296 ARG n 
3 297 SER n 
3 298 SER n 
3 299 LEU n 
3 300 ALA n 
3 301 GLU n 
3 302 ASP n 
3 303 ASN n 
3 304 GLU n 
3 305 SER n 
3 306 SER n 
3 307 TYR n 
3 308 SER n 
3 309 ARG n 
3 310 GLY n 
3 311 PHE n 
3 312 ASP n 
3 313 MET n 
3 314 THR n 
3 315 TYR n 
3 316 THR n 
3 317 GLU n 
3 318 PHE n 
3 319 ASP n 
3 320 TYS n 
3 321 ASP n 
3 322 LEU n 
3 323 CYS n 
3 324 ASN n 
3 325 GLU n 
3 326 VAL n 
3 327 VAL n 
3 328 ASP n 
3 329 VAL n 
3 330 THR n 
3 331 CYS n 
3 332 SER n 
3 333 PRO n 
3 334 LYS n 
3 335 PRO n 
3 336 ASP n 
3 337 ALA n 
3 338 PHE n 
3 339 ASN n 
3 340 PRO n 
3 341 CYS n 
3 342 GLU n 
3 343 ASP n 
3 344 ILE n 
3 345 MET n 
3 346 GLY n 
3 347 TYR n 
3 348 ASN n 
3 349 ILE n 
3 350 LEU n 
3 351 ARG n 
3 352 ALA n 
3 353 ALA n 
3 354 ALA n 
3 355 HIS n 
3 356 HIS n 
3 357 HIS n 
3 358 HIS n 
3 359 HIS n 
3 360 HIS n 
3 361 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? CGA          ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? HEK293 ? 
? ? ? ? PLASMID ? ? ? PVLAD6 ? ? 
2 1 sample ? ? ? human ? FSHB         ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? HEK293 ? 
? ? ? ? PLASMID ? ? ? PVLAD6 ? ? 
3 1 sample ? ? ? human ? 'FSHR, LGR1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? HEK293 ? 
? ? ? ? PLASMID ? ? ? PVLAD6 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q96QJ4_HUMAN Q96QJ4 1 
;APDVQDCPECTLQENPLFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHT
ACHCSTCYYHKS
;
25 ? 
2 UNP FSHB_HUMAN   P01225 2 
;NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVAT
QCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
;
19 ? 
3 UNP FSHR_HUMAN   P23945 3 
;SGCHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLP
KLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVIL
WLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKL
PTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDY
DLCNEVVDVTCSPKPDAFNPCEDIMGYNILR
;
16 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4MQW A 1 ? 92  ? Q96QJ4 25 ? 116 ? 1  92  
2 2 4MQW B 1 ? 111 ? P01225 19 ? 129 ? 1  111 
3 3 4MQW X 1 ? 351 ? P23945 16 ? 366 ? 16 366 
4 1 4MQW D 1 ? 92  ? Q96QJ4 25 ? 116 ? 1  92  
5 2 4MQW E 1 ? 111 ? P01225 19 ? 129 ? 1  111 
6 3 4MQW Y 1 ? 351 ? P23945 16 ? 366 ? 16 366 
7 1 4MQW G 1 ? 92  ? Q96QJ4 25 ? 116 ? 1  92  
8 2 4MQW H 1 ? 111 ? P01225 19 ? 129 ? 1  111 
9 3 4MQW Z 1 ? 351 ? P23945 16 ? 366 ? 16 366 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4MQW ALA A 93  ? UNP Q96QJ4 ?   ?   'expression tag'      93  1  
1 4MQW ALA A 94  ? UNP Q96QJ4 ?   ?   'expression tag'      94  2  
1 4MQW ALA A 95  ? UNP Q96QJ4 ?   ?   'expression tag'      95  3  
1 4MQW HIS A 96  ? UNP Q96QJ4 ?   ?   'expression tag'      96  4  
1 4MQW HIS A 97  ? UNP Q96QJ4 ?   ?   'expression tag'      97  5  
1 4MQW HIS A 98  ? UNP Q96QJ4 ?   ?   'expression tag'      98  6  
1 4MQW HIS A 99  ? UNP Q96QJ4 ?   ?   'expression tag'      99  7  
1 4MQW HIS A 100 ? UNP Q96QJ4 ?   ?   'expression tag'      100 8  
1 4MQW HIS A 101 ? UNP Q96QJ4 ?   ?   'expression tag'      101 9  
1 4MQW HIS A 102 ? UNP Q96QJ4 ?   ?   'expression tag'      102 10 
3 4MQW SER X 173 ? UNP P23945 CYS 188 'engineered mutation' 188 11 
3 4MQW ALA X 352 ? UNP P23945 ?   ?   'expression tag'      367 12 
3 4MQW ALA X 353 ? UNP P23945 ?   ?   'expression tag'      368 13 
3 4MQW ALA X 354 ? UNP P23945 ?   ?   'expression tag'      369 14 
3 4MQW HIS X 355 ? UNP P23945 ?   ?   'expression tag'      370 15 
3 4MQW HIS X 356 ? UNP P23945 ?   ?   'expression tag'      371 16 
3 4MQW HIS X 357 ? UNP P23945 ?   ?   'expression tag'      372 17 
3 4MQW HIS X 358 ? UNP P23945 ?   ?   'expression tag'      373 18 
3 4MQW HIS X 359 ? UNP P23945 ?   ?   'expression tag'      374 19 
3 4MQW HIS X 360 ? UNP P23945 ?   ?   'expression tag'      375 20 
3 4MQW HIS X 361 ? UNP P23945 ?   ?   'expression tag'      376 21 
4 4MQW ALA D 93  ? UNP Q96QJ4 ?   ?   'expression tag'      93  22 
4 4MQW ALA D 94  ? UNP Q96QJ4 ?   ?   'expression tag'      94  23 
4 4MQW ALA D 95  ? UNP Q96QJ4 ?   ?   'expression tag'      95  24 
4 4MQW HIS D 96  ? UNP Q96QJ4 ?   ?   'expression tag'      96  25 
4 4MQW HIS D 97  ? UNP Q96QJ4 ?   ?   'expression tag'      97  26 
4 4MQW HIS D 98  ? UNP Q96QJ4 ?   ?   'expression tag'      98  27 
4 4MQW HIS D 99  ? UNP Q96QJ4 ?   ?   'expression tag'      99  28 
4 4MQW HIS D 100 ? UNP Q96QJ4 ?   ?   'expression tag'      100 29 
4 4MQW HIS D 101 ? UNP Q96QJ4 ?   ?   'expression tag'      101 30 
4 4MQW HIS D 102 ? UNP Q96QJ4 ?   ?   'expression tag'      102 31 
6 4MQW SER Y 173 ? UNP P23945 CYS 188 'engineered mutation' 188 32 
6 4MQW ALA Y 352 ? UNP P23945 ?   ?   'expression tag'      367 33 
6 4MQW ALA Y 353 ? UNP P23945 ?   ?   'expression tag'      368 34 
6 4MQW ALA Y 354 ? UNP P23945 ?   ?   'expression tag'      369 35 
6 4MQW HIS Y 355 ? UNP P23945 ?   ?   'expression tag'      370 36 
6 4MQW HIS Y 356 ? UNP P23945 ?   ?   'expression tag'      371 37 
6 4MQW HIS Y 357 ? UNP P23945 ?   ?   'expression tag'      372 38 
6 4MQW HIS Y 358 ? UNP P23945 ?   ?   'expression tag'      373 39 
6 4MQW HIS Y 359 ? UNP P23945 ?   ?   'expression tag'      374 40 
6 4MQW HIS Y 360 ? UNP P23945 ?   ?   'expression tag'      375 41 
6 4MQW HIS Y 361 ? UNP P23945 ?   ?   'expression tag'      376 42 
7 4MQW ALA G 93  ? UNP Q96QJ4 ?   ?   'expression tag'      93  43 
7 4MQW ALA G 94  ? UNP Q96QJ4 ?   ?   'expression tag'      94  44 
7 4MQW ALA G 95  ? UNP Q96QJ4 ?   ?   'expression tag'      95  45 
7 4MQW HIS G 96  ? UNP Q96QJ4 ?   ?   'expression tag'      96  46 
7 4MQW HIS G 97  ? UNP Q96QJ4 ?   ?   'expression tag'      97  47 
7 4MQW HIS G 98  ? UNP Q96QJ4 ?   ?   'expression tag'      98  48 
7 4MQW HIS G 99  ? UNP Q96QJ4 ?   ?   'expression tag'      99  49 
7 4MQW HIS G 100 ? UNP Q96QJ4 ?   ?   'expression tag'      100 50 
7 4MQW HIS G 101 ? UNP Q96QJ4 ?   ?   'expression tag'      101 51 
7 4MQW HIS G 102 ? UNP Q96QJ4 ?   ?   'expression tag'      102 52 
9 4MQW SER Z 173 ? UNP P23945 CYS 188 'engineered mutation' 188 53 
9 4MQW ALA Z 352 ? UNP P23945 ?   ?   'expression tag'      367 54 
9 4MQW ALA Z 353 ? UNP P23945 ?   ?   'expression tag'      368 55 
9 4MQW ALA Z 354 ? UNP P23945 ?   ?   'expression tag'      369 56 
9 4MQW HIS Z 355 ? UNP P23945 ?   ?   'expression tag'      370 57 
9 4MQW HIS Z 356 ? UNP P23945 ?   ?   'expression tag'      371 58 
9 4MQW HIS Z 357 ? UNP P23945 ?   ?   'expression tag'      372 59 
9 4MQW HIS Z 358 ? UNP P23945 ?   ?   'expression tag'      373 60 
9 4MQW HIS Z 359 ? UNP P23945 ?   ?   'expression tag'      374 61 
9 4MQW HIS Z 360 ? UNP P23945 ?   ?   'expression tag'      375 62 
9 4MQW HIS Z 361 ? UNP P23945 ?   ?   'expression tag'      376 63 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                                             ?                 
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                                            ?                 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                          ?                 
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                     ?                 
'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                                            ?                 
'C3 H7 N O2 S'   121.158 
EDO non-polymer                  . 1,2-ETHANEDIOL                                                      'ETHYLENE GLYCOL' 
'C2 H6 O2'       62.068  
GLN 'L-peptide linking'          y GLUTAMINE                                                           ?                 
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                     ?                 
'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                                             ?                 
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                                           ?                 
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                                               ?                 'H2 O' 
18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                          ?                 
'C6 H13 N O2'    131.173 
JEF non-polymer                  . 
;O-(O-(2-AMINOPROPYL)-O'-(2-METHOXYETHYL)POLYPROPYLENE GLYCOL 500)
;
JEFFAMINE         'C30 H63 N O10'  597.822 
LEU 'L-peptide linking'          y LEUCINE                                                             ?                 
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                                              ?                 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                                                          ?                 
'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                            ?                 
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                                                       ?                 
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                                             ?                 
'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                                              ?                 
'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                                           ?                 
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                          ?                 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                                            ?                 
'C9 H11 N O3'    181.189 
TYS 'L-peptide linking'          n O-SULFO-L-TYROSINE                                                  ?                 
'C9 H11 N O6 S'  261.252 
VAL 'L-peptide linking'          y VALINE                                                              ?                 
'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4MQW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.77 
_exptl_crystal.density_percent_sol   55.64 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;The FSH-FSHRED complex was concentrated by ultrafiltration to about 10 mg/ml in HBS. 0.1M imidazole and 20% Jeffamine M-600, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-05-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Kohzu 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 21-ID-D' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-D 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.979 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4MQW 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.9 
_reflns.number_obs                   43220 
_reflns.number_all                   46705 
_reflns.percent_possible_obs         95.5 
_reflns.pdbx_Rmerge_I_obs            0.079 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        19.9 
_reflns.B_iso_Wilson_estimate        65.88 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_chi_squared 
1 1 2.9  2.95 70   ? ? ? ? ? ? ? ? ? ? 
1 2 2.95 3    78.1 ? ? ? ? ? ? ? ? ? ? 
1 3 3    3.06 84   ? ? ? ? ? ? ? ? ? ? 
1 4 3.06 3.12 90.1 ? ? ? ? ? ? ? ? ? ? 
1 5 3.12 3.19 94   ? ? ? ? ? ? ? ? ? ? 
1 6 3.19 3.27 97.2 ? ? ? ? ? ? ? ? ? ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4MQW 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     42207 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             24.93 
_refine.ls_d_res_high                            2.90 
_refine.ls_percent_reflns_obs                    95.56 
_refine.ls_R_factor_obs                          0.1769 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1737 
_refine.ls_R_factor_R_free                       0.2369 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.02 
_refine.ls_number_reflns_R_free                  2233 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9573 
_refine.correlation_coeff_Fo_to_Fc_free          0.9172 
_refine.B_iso_mean                               86.61 
_refine.aniso_B[1][1]                            2.0752 
_refine.aniso_B[2][2]                            2.0752 
_refine.aniso_B[3][3]                            -4.1503 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'pdb entry 4ay9' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.443 
_refine.overall_SU_ML                            0.379 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             45.932 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        4MQW 
_refine_analyze.Luzzati_coordinate_error_obs    0.471 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        11405 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         238 
_refine_hist.number_atoms_solvent             155 
_refine_hist.number_atoms_total               11798 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        24.93 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.009 ? 2.00  11928 'X-RAY DIFFRACTION' HARMONIC   
t_angle_deg               1.21  ? 2.00  16216 'X-RAY DIFFRACTION' HARMONIC   
t_dihedral_angle_d        ?     ? 2.00  4160  'X-RAY DIFFRACTION' SINUSOIDAL 
t_incorr_chiral_ct        ?     ? ?     ?     'X-RAY DIFFRACTION' ?          
t_pseud_angle             ?     ? ?     ?     'X-RAY DIFFRACTION' ?          
t_trig_c_planes           ?     ? 2.00  299   'X-RAY DIFFRACTION' HARMONIC   
t_gen_planes              ?     ? 5.00  1706  'X-RAY DIFFRACTION' HARMONIC   
t_it                      ?     ? 20.00 11928 'X-RAY DIFFRACTION' HARMONIC   
t_nbd                     ?     ? ?     ?     'X-RAY DIFFRACTION' ?          
t_omega_torsion           ?     ? ?     ?     'X-RAY DIFFRACTION' ?          
t_other_torsion           ?     ? ?     ?     'X-RAY DIFFRACTION' ?          
t_improper_torsion        ?     ? ?     ?     'X-RAY DIFFRACTION' ?          
t_chiral_improper_torsion ?     ? ?     ?     'X-RAY DIFFRACTION' ?          
t_sum_occupancies         ?     ? ?     ?     'X-RAY DIFFRACTION' ?          
t_utility_distance        ?     ? ?     ?     'X-RAY DIFFRACTION' ?          
t_utility_angle           ?     ? ?     ?     'X-RAY DIFFRACTION' ?          
t_utility_torsion         ?     ? ?     ?     'X-RAY DIFFRACTION' ?          
t_ideal_dist_contact      ?     ? ?     ?     'X-RAY DIFFRACTION' ?          
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.90 
_refine_ls_shell.d_res_low                        2.98 
_refine_ls_shell.number_reflns_R_work             2334 
_refine_ls_shell.R_factor_R_work                  0.2551 
_refine_ls_shell.percent_reflns_obs               95.56 
_refine_ls_shell.R_factor_R_free                  0.2908 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            6.04 
_refine_ls_shell.number_reflns_R_free             150 
_refine_ls_shell.number_reflns_all                2484 
_refine_ls_shell.R_factor_all                     0.2573 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 X 1 
2 Y 1 
3 Z 1 
1 A 2 
2 D 2 
3 G 2 
1 B 3 
2 E 3 
3 H 3 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 X 15 X 279 1 5 ? ? ? ? ? ? ? ? 1 ? 
2 Y 15 Y 279 1 5 ? ? ? ? ? ? ? ? 1 ? 
3 Z 15 Z 279 1 5 ? ? ? ? ? ? ? ? 1 ? 
1 A 1  A 200 1 5 ? ? ? ? ? ? ? ? 2 ? 
2 D 1  D 200 1 5 ? ? ? ? ? ? ? ? 2 ? 
3 G 1  G 200 1 5 ? ? ? ? ? ? ? ? 2 ? 
1 B 1  B 200 1 5 ? ? ? ? ? ? ? ? 3 ? 
2 E 1  E 200 1 5 ? ? ? ? ? ? ? ? 3 ? 
3 H 1  H 200 1 5 ? ? ? ? ? ? ? ? 3 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
# 
_struct.entry_id                  4MQW 
_struct.title                     
'Structure of follicle-stimulating hormone in complex with the entire ectodomain of its receptor (P31)' 
_struct.pdbx_descriptor           
'Glycoprotein hormones, alpha polypeptide, Follitropin subunit beta, Follicle-stimulating hormone receptor' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4MQW 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'cystine-knot, leucine-rich repeats, Glycoprotein hormone, GPCR, Sulfation, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 3 ? 
D  N N 1 ? 
E  N N 2 ? 
F  N N 3 ? 
G  N N 1 ? 
H  N N 2 ? 
I  N N 3 ? 
J  N N 4 ? 
K  N N 4 ? 
L  N N 4 ? 
M  N N 4 ? 
N  N N 5 ? 
O  N N 5 ? 
P  N N 5 ? 
Q  N N 5 ? 
R  N N 4 ? 
S  N N 4 ? 
T  N N 4 ? 
U  N N 4 ? 
V  N N 4 ? 
W  N N 5 ? 
X  N N 4 ? 
Y  N N 4 ? 
Z  N N 4 ? 
AA N N 4 ? 
BA N N 4 ? 
CA N N 6 ? 
DA N N 4 ? 
EA N N 7 ? 
FA N N 7 ? 
GA N N 7 ? 
HA N N 7 ? 
IA N N 7 ? 
JA N N 7 ? 
KA N N 7 ? 
LA N N 7 ? 
MA N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 40  ? LYS A 45  ? PRO A 40  LYS A 45  1 ? 6  
HELX_P HELX_P2  2  GLU B 15  ? ARG B 18  ? GLU B 15  ARG B 18  5 ? 4  
HELX_P HELX_P3  7  TYR C 256 ? ALA C 264 ? TYR X 271 ALA X 279 1 ? 9  
HELX_P HELX_P4  3  PRO D 40  ? LYS D 45  ? PRO D 40  LYS D 45  1 ? 6  
HELX_P HELX_P5  4  GLU E 15  ? ARG E 18  ? GLU E 15  ARG E 18  5 ? 4  
HELX_P HELX_P6  8  PRO F 195 ? PHE F 199 ? PRO Y 210 PHE Y 214 5 ? 5  
HELX_P HELX_P7  9  GLY F 222 ? LEU F 226 ? GLY Y 237 LEU Y 241 5 ? 5  
HELX_P HELX_P8  10 PRO F 257 ? ASN F 265 ? PRO Y 272 ASN Y 280 1 ? 9  
HELX_P HELX_P9  5  PRO G 40  ? LYS G 45  ? PRO G 40  LYS G 45  1 ? 6  
HELX_P HELX_P10 6  GLU H 15  ? ARG H 18  ? GLU H 15  ARG H 18  5 ? 4  
HELX_P HELX_P11 11 PRO I 98  ? PHE I 101 ? PRO Z 113 PHE Z 116 5 ? 4  
HELX_P HELX_P12 12 PRO I 257 ? TRP I 266 ? PRO Z 272 TRP Z 281 1 ? 10 
HELX_P HELX_P13 13 LYS I 334 ? PHE I 338 ? LYS Z 349 PHE Z 353 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 7   SG  ? ? ? 1_555 A  CYS 31  SG ? ? A CYS 7   A CYS 31  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf2  disulf ?    ? A CYS 10  SG  ? ? ? 1_555 A  CYS 60  SG ? ? A CYS 10  A CYS 60  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf3  disulf ?    ? A CYS 28  SG  ? ? ? 1_555 A  CYS 82  SG ? ? A CYS 28  A CYS 82  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf4  disulf ?    ? A CYS 32  SG  ? ? ? 1_555 A  CYS 84  SG ? ? A CYS 32  A CYS 84  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf5  disulf ?    ? A CYS 59  SG  ? ? ? 1_555 A  CYS 87  SG ? ? A CYS 59  A CYS 87  1_555 ? ? ? ? ? ? ? 2.019 ? ?               
disulf6  disulf ?    ? B CYS 3   SG  ? ? ? 1_555 B  CYS 51  SG ? ? B CYS 3   B CYS 51  1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf7  disulf ?    ? B CYS 17  SG  ? ? ? 1_555 B  CYS 66  SG ? ? B CYS 17  B CYS 66  1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf8  disulf ?    ? B CYS 20  SG  ? ? ? 1_555 B  CYS 104 SG ? ? B CYS 20  B CYS 104 1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf9  disulf ?    ? B CYS 28  SG  ? ? ? 1_555 B  CYS 82  SG ? ? B CYS 28  B CYS 82  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf10 disulf ?    ? B CYS 32  SG  ? ? ? 1_555 B  CYS 84  SG ? ? B CYS 32  B CYS 84  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf11 disulf ?    ? B CYS 87  SG  ? ? ? 1_555 B  CYS 94  SG ? ? B CYS 87  B CYS 94  1_555 ? ? ? ? ? ? ? 2.017 ? ?               
disulf12 disulf ?    ? C CYS 3   SG  ? ? ? 1_555 C  CYS 10  SG ? ? X CYS 18  X CYS 25  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf13 disulf ?    ? C CYS 8   SG  ? ? ? 1_555 C  CYS 17  SG ? ? X CYS 23  X CYS 32  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf14 disulf ?    ? C CYS 260 SG  ? ? ? 1_555 C  CYS 331 SG ? ? X CYS 275 X CYS 346 1_555 ? ? ? ? ? ? ? 2.669 ? ?               
disulf15 disulf ?    ? C CYS 261 SG  ? ? ? 1_555 C  CYS 341 SG ? ? X CYS 276 X CYS 356 1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf16 disulf ?    ? C CYS 277 SG  ? ? ? 1_555 C  CYS 323 SG ? ? X CYS 292 X CYS 338 1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf17 disulf ?    ? D CYS 7   SG  ? ? ? 1_555 D  CYS 31  SG ? ? D CYS 7   D CYS 31  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf18 disulf ?    ? D CYS 10  SG  ? ? ? 1_555 D  CYS 60  SG ? ? D CYS 10  D CYS 60  1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf19 disulf ?    ? D CYS 28  SG  ? ? ? 1_555 D  CYS 82  SG ? ? D CYS 28  D CYS 82  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf20 disulf ?    ? D CYS 32  SG  ? ? ? 1_555 D  CYS 84  SG ? ? D CYS 32  D CYS 84  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf21 disulf ?    ? D CYS 59  SG  ? ? ? 1_555 D  CYS 87  SG ? ? D CYS 59  D CYS 87  1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf22 disulf ?    ? E CYS 3   SG  ? ? ? 1_555 E  CYS 51  SG ? ? E CYS 3   E CYS 51  1_555 ? ? ? ? ? ? ? 2.044 ? ?               
disulf23 disulf ?    ? E CYS 17  SG  ? ? ? 1_555 E  CYS 66  SG ? ? E CYS 17  E CYS 66  1_555 ? ? ? ? ? ? ? 2.043 ? ?               
disulf24 disulf ?    ? E CYS 20  SG  ? ? ? 1_555 E  CYS 104 SG ? ? E CYS 20  E CYS 104 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf25 disulf ?    ? E CYS 28  SG  ? ? ? 1_555 E  CYS 82  SG ? ? E CYS 28  E CYS 82  1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf26 disulf ?    ? E CYS 32  SG  ? ? ? 1_555 E  CYS 84  SG ? ? E CYS 32  E CYS 84  1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf27 disulf ?    ? E CYS 87  SG  ? ? ? 1_555 E  CYS 94  SG ? ? E CYS 87  E CYS 94  1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf28 disulf ?    ? F CYS 3   SG  ? ? ? 1_555 F  CYS 10  SG ? ? Y CYS 18  Y CYS 25  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf29 disulf ?    ? F CYS 8   SG  ? ? ? 1_555 F  CYS 17  SG ? ? Y CYS 23  Y CYS 32  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf30 disulf ?    ? F CYS 260 SG  ? ? ? 1_555 F  CYS 331 SG ? ? Y CYS 275 Y CYS 346 1_555 ? ? ? ? ? ? ? 2.799 ? ?               
disulf31 disulf ?    ? F CYS 261 SG  ? ? ? 1_555 F  CYS 341 SG ? ? Y CYS 276 Y CYS 356 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf32 disulf ?    ? G CYS 7   SG  ? ? ? 1_555 G  CYS 31  SG ? ? G CYS 7   G CYS 31  1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf33 disulf ?    ? G CYS 10  SG  ? ? ? 1_555 G  CYS 60  SG ? ? G CYS 10  G CYS 60  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf34 disulf ?    ? G CYS 28  SG  ? ? ? 1_555 G  CYS 82  SG ? ? G CYS 28  G CYS 82  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf35 disulf ?    ? G CYS 32  SG  ? ? ? 1_555 G  CYS 84  SG ? ? G CYS 32  G CYS 84  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf36 disulf ?    ? G CYS 59  SG  ? ? ? 1_555 G  CYS 87  SG ? ? G CYS 59  G CYS 87  1_555 ? ? ? ? ? ? ? 2.023 ? ?               
disulf37 disulf ?    ? H CYS 3   SG  ? ? ? 1_555 H  CYS 51  SG ? ? H CYS 3   H CYS 51  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf38 disulf ?    ? H CYS 17  SG  ? ? ? 1_555 H  CYS 66  SG ? ? H CYS 17  H CYS 66  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf39 disulf ?    ? H CYS 20  SG  ? ? ? 1_555 H  CYS 104 SG ? ? H CYS 20  H CYS 104 1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf40 disulf ?    ? H CYS 28  SG  ? ? ? 1_555 H  CYS 82  SG ? ? H CYS 28  H CYS 82  1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf41 disulf ?    ? H CYS 32  SG  ? ? ? 1_555 H  CYS 84  SG ? ? H CYS 32  H CYS 84  1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf42 disulf ?    ? H CYS 87  SG  ? ? ? 1_555 H  CYS 94  SG ? ? H CYS 87  H CYS 94  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf43 disulf ?    ? I CYS 3   SG  ? ? ? 1_555 I  CYS 10  SG ? ? Z CYS 18  Z CYS 25  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf44 disulf ?    ? I CYS 8   SG  ? ? ? 1_555 I  CYS 17  SG ? ? Z CYS 23  Z CYS 32  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf45 disulf ?    ? I CYS 260 SG  ? ? ? 1_555 I  CYS 331 SG ? ? Z CYS 275 Z CYS 346 1_555 ? ? ? ? ? ? ? 2.743 ? ?               
disulf46 disulf ?    ? I CYS 261 SG  ? ? ? 1_555 I  CYS 341 SG ? ? Z CYS 276 Z CYS 356 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf47 disulf ?    ? I CYS 277 SG  ? ? ? 1_555 I  CYS 323 SG ? ? Z CYS 292 Z CYS 338 1_555 ? ? ? ? ? ? ? 2.038 ? ?               
covale1  covale one  ? A ASN 52  ND2 ? ? ? 1_555 J  NAG .   C1 ? ? A ASN 52  A NAG 201 1_555 ? ? ? ? ? ? ? 1.429 ? N-Glycosylation 
covale2  covale one  ? A ASN 78  ND2 ? ? ? 1_555 K  NAG .   C1 ? ? A ASN 78  A NAG 202 1_555 ? ? ? ? ? ? ? 1.434 ? N-Glycosylation 
covale3  covale one  ? B ASN 7   ND2 ? ? ? 1_555 L  NAG .   C1 ? ? B ASN 7   B NAG 201 1_555 ? ? ? ? ? ? ? 1.432 ? N-Glycosylation 
covale4  covale one  ? B ASN 24  ND2 ? ? ? 1_555 M  NAG .   C1 ? ? B ASN 24  B NAG 202 1_555 ? ? ? ? ? ? ? 1.434 ? N-Glycosylation 
covale5  covale one  ? C ASN 176 ND2 ? ? ? 1_555 R  NAG .   C1 ? ? X ASN 191 X NAG 403 1_555 ? ? ? ? ? ? ? 1.432 ? N-Glycosylation 
covale6  covale none ? C CYS 261 SG  ? ? ? 1_555 C  CYS 341 SG ? ? X CYS 276 X CYS 356 1_555 ? ? ? ? ? ? ? 2.039 ? ?               
covale7  covale none ? C CYS 277 SG  ? ? ? 1_555 C  CYS 323 SG ? ? X CYS 292 X CYS 338 1_555 ? ? ? ? ? ? ? 2.036 ? ?               
covale8  covale both ? C ASP 319 C   ? ? ? 1_555 C  TYS 320 N  ? ? X ASP 334 X TYS 335 1_555 ? ? ? ? ? ? ? 1.361 ? ?               
covale9  covale both ? C TYS 320 C   ? ? ? 1_555 C  ASP 321 N  ? ? X TYS 335 X ASP 336 1_555 ? ? ? ? ? ? ? 1.354 ? ?               
covale10 covale one  ? D ASN 52  ND2 ? ? ? 1_555 S  NAG .   C1 ? ? D ASN 52  D NAG 201 1_555 ? ? ? ? ? ? ? 1.428 ? N-Glycosylation 
covale11 covale one  ? D ASN 78  ND2 ? ? ? 1_555 T  NAG .   C1 ? ? D ASN 78  D NAG 202 1_555 ? ? ? ? ? ? ? 1.437 ? N-Glycosylation 
covale12 covale one  ? E ASN 7   ND2 ? ? ? 1_555 U  NAG .   C1 ? ? E ASN 7   E NAG 201 1_555 ? ? ? ? ? ? ? 1.435 ? N-Glycosylation 
covale13 covale one  ? E ASN 24  ND2 ? ? ? 1_555 V  NAG .   C1 ? ? E ASN 24  E NAG 202 1_555 ? ? ? ? ? ? ? 1.431 ? N-Glycosylation 
covale14 covale one  ? F ASN 176 ND2 ? ? ? 1_555 X  NAG .   C1 ? ? Y ASN 191 Y NAG 402 1_555 ? ? ? ? ? ? ? 1.437 ? N-Glycosylation 
covale15 covale none ? F CYS 261 SG  ? ? ? 1_555 F  CYS 341 SG ? ? Y CYS 276 Y CYS 356 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
covale16 covale both ? F ASP 319 C   ? ? ? 1_555 F  TYS 320 N  ? ? Y ASP 334 Y TYS 335 1_555 ? ? ? ? ? ? ? 1.357 ? ?               
covale17 covale both ? F TYS 320 C   ? ? ? 1_555 F  ASP 321 N  ? ? Y TYS 335 Y ASP 336 1_555 ? ? ? ? ? ? ? 1.347 ? ?               
covale18 covale one  ? G ASN 52  ND2 ? ? ? 1_555 Y  NAG .   C1 ? ? G ASN 52  G NAG 201 1_555 ? ? ? ? ? ? ? 1.431 ? N-Glycosylation 
covale19 covale one  ? G ASN 78  ND2 ? ? ? 1_555 Z  NAG .   C1 ? ? G ASN 78  G NAG 202 1_555 ? ? ? ? ? ? ? 1.432 ? N-Glycosylation 
covale20 covale one  ? H ASN 7   ND2 ? ? ? 1_555 AA NAG .   C1 ? ? H ASN 7   H NAG 201 1_555 ? ? ? ? ? ? ? 1.434 ? N-Glycosylation 
covale21 covale one  ? H ASN 24  ND2 ? ? ? 1_555 BA NAG .   C1 ? ? H ASN 24  H NAG 202 1_555 ? ? ? ? ? ? ? 1.432 ? N-Glycosylation 
covale22 covale one  ? I ASN 176 ND2 ? ? ? 1_555 DA NAG .   C1 ? ? Z ASN 191 Z NAG 402 1_555 ? ? ? ? ? ? ? 1.437 ? N-Glycosylation 
covale23 covale none ? I CYS 261 SG  ? ? ? 1_555 I  CYS 341 SG ? ? Z CYS 276 Z CYS 356 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
covale24 covale both ? I ASP 319 C   ? ? ? 1_555 I  TYS 320 N  ? ? Z ASP 334 Z TYS 335 1_555 ? ? ? ? ? ? ? 1.358 ? ?               
covale25 covale both ? I TYS 320 C   ? ? ? 1_555 I  ASP 321 N  ? ? Z TYS 335 Z ASP 336 1_555 ? ? ? ? ? ? ? 1.350 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 204 C . ? GLY 219 X PRO 205 C ? PRO 220 X 1 0.99  
2 SER 332 C . ? SER 347 X PRO 333 C ? PRO 348 X 1 1.48  
3 ASN 339 C . ? ASN 354 X PRO 340 C ? PRO 355 X 1 1.80  
4 GLY 204 F . ? GLY 219 Y PRO 205 F ? PRO 220 Y 1 2.90  
5 SER 332 F . ? SER 347 Y PRO 333 F ? PRO 348 Y 1 -0.06 
6 GLY 204 I . ? GLY 219 Z PRO 205 I ? PRO 220 Z 1 2.48  
7 SER 332 I . ? SER 347 Z PRO 333 I ? PRO 348 Z 1 5.21  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4  ? 
B ? 4  ? 
C ? 2  ? 
D ? 2  ? 
E ? 5  ? 
F ? 4  ? 
G ? 2  ? 
H ? 4  ? 
I ? 4  ? 
J ? 2  ? 
K ? 2  ? 
L ? 10 ? 
M ? 13 ? 
N ? 3  ? 
O ? 2  ? 
P ? 10 ? 
Q ? 13 ? 
R ? 3  ? 
S ? 2  ? 
T ? 13 ? 
U ? 3  ? 
V ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
A 3  4  ? anti-parallel 
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? parallel      
C 1  2  ? anti-parallel 
D 1  2  ? anti-parallel 
E 1  2  ? anti-parallel 
E 2  3  ? anti-parallel 
E 4  5  ? anti-parallel 
F 1  2  ? anti-parallel 
F 2  3  ? anti-parallel 
G 1  2  ? anti-parallel 
H 1  2  ? anti-parallel 
H 2  3  ? anti-parallel 
H 3  4  ? anti-parallel 
I 1  2  ? anti-parallel 
I 2  3  ? anti-parallel 
I 3  4  ? parallel      
J 1  2  ? anti-parallel 
K 1  2  ? anti-parallel 
L 1  2  ? anti-parallel 
L 2  3  ? parallel      
L 3  4  ? parallel      
L 4  5  ? parallel      
L 5  6  ? parallel      
L 6  7  ? parallel      
L 7  8  ? parallel      
L 8  9  ? parallel      
L 9  10 ? parallel      
M 1  2  ? anti-parallel 
M 2  3  ? parallel      
M 3  4  ? parallel      
M 4  5  ? parallel      
M 5  6  ? parallel      
M 6  7  ? parallel      
M 7  8  ? parallel      
M 8  9  ? parallel      
M 9  10 ? parallel      
M 10 11 ? parallel      
M 11 12 ? parallel      
M 12 13 ? parallel      
N 1  2  ? parallel      
N 2  3  ? parallel      
O 1  2  ? parallel      
P 1  2  ? anti-parallel 
P 2  3  ? parallel      
P 3  4  ? parallel      
P 4  5  ? parallel      
P 5  6  ? parallel      
P 6  7  ? parallel      
P 7  8  ? parallel      
P 8  9  ? parallel      
P 9  10 ? parallel      
Q 1  2  ? anti-parallel 
Q 2  3  ? parallel      
Q 3  4  ? parallel      
Q 4  5  ? parallel      
Q 5  6  ? parallel      
Q 6  7  ? parallel      
Q 7  8  ? parallel      
Q 8  9  ? parallel      
Q 9  10 ? parallel      
Q 10 11 ? parallel      
Q 11 12 ? parallel      
Q 12 13 ? parallel      
R 1  2  ? parallel      
R 2  3  ? parallel      
S 1  2  ? parallel      
T 1  2  ? anti-parallel 
T 2  3  ? parallel      
T 3  4  ? parallel      
T 4  5  ? parallel      
T 5  6  ? parallel      
T 6  7  ? parallel      
T 7  8  ? parallel      
T 8  9  ? parallel      
T 9  10 ? parallel      
T 10 11 ? parallel      
T 11 12 ? parallel      
T 12 13 ? parallel      
U 1  2  ? parallel      
U 2  3  ? parallel      
V 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  THR A 11  ? GLU A 14  ? THR A 11  GLU A 14  
A 2  LEU A 26  ? PRO A 38  ? LEU A 26  PRO A 38  
A 3  PHE B 19  ? ARG B 35  ? PHE B 19  ARG B 35  
A 4  GLU B 4   ? LYS B 14  ? GLU B 4   LYS B 14  
B 1  THR A 11  ? GLU A 14  ? THR A 11  GLU A 14  
B 2  LEU A 26  ? PRO A 38  ? LEU A 26  PRO A 38  
B 3  VAL A 53  ? GLU A 56  ? VAL A 53  GLU A 56  
B 4  THR B 92  ? THR B 95  ? THR B 92  THR B 95  
C 1  CYS A 59  ? VAL A 70  ? CYS A 59  VAL A 70  
C 2  PHE A 74  ? SER A 85  ? PHE A 74  SER A 85  
D 1  THR B 50  ? VAL B 63  ? THR B 50  VAL B 63  
D 2  SER B 72  ? GLY B 85  ? SER B 72  GLY B 85  
E 1  THR D 11  ? GLU D 14  ? THR D 11  GLU D 14  
E 2  LEU D 26  ? PRO D 38  ? LEU D 26  PRO D 38  
E 3  VAL D 53  ? VAL D 70  ? VAL D 53  VAL D 70  
E 4  PHE E 19  ? ARG E 35  ? PHE E 19  ARG E 35  
E 5  CYS E 3   ? LYS E 14  ? CYS E 3   LYS E 14  
F 1  PHE D 74  ? THR D 86  ? PHE D 74  THR D 86  
F 2  VAL D 53  ? VAL D 70  ? VAL D 53  VAL D 70  
F 3  LEU D 26  ? PRO D 38  ? LEU D 26  PRO D 38  
F 4  THR E 92  ? THR E 95  ? THR E 92  THR E 95  
G 1  THR E 50  ? VAL E 63  ? THR E 50  VAL E 63  
G 2  SER E 72  ? GLY E 85  ? SER E 72  GLY E 85  
H 1  THR G 11  ? GLU G 14  ? THR G 11  GLU G 14  
H 2  LEU G 26  ? PRO G 38  ? LEU G 26  PRO G 38  
H 3  PHE H 19  ? ARG H 35  ? PHE H 19  ARG H 35  
H 4  CYS H 3   ? LYS H 14  ? CYS H 3   LYS H 14  
I 1  THR G 11  ? GLU G 14  ? THR G 11  GLU G 14  
I 2  LEU G 26  ? PRO G 38  ? LEU G 26  PRO G 38  
I 3  VAL G 53  ? SER G 57  ? VAL G 53  SER G 57  
I 4  THR H 92  ? THR H 95  ? THR H 92  THR H 95  
J 1  CYS G 59  ? VAL G 70  ? CYS G 59  VAL G 70  
J 2  PHE G 74  ? SER G 85  ? PHE G 74  SER G 85  
K 1  THR H 50  ? VAL H 63  ? THR H 50  VAL H 63  
K 2  SER H 72  ? GLY H 85  ? SER H 72  GLY H 85  
L 1  HIS C 9   ? CYS C 10  ? HIS X 24  CYS X 25  
L 2  VAL C 14  ? GLN C 18  ? VAL X 29  GLN X 33  
L 3  GLU C 35  ? VAL C 39  ? GLU X 50  VAL X 54  
L 4  LYS C 59  ? SER C 63  ? LYS X 74  SER X 78  
L 5  GLU C 84  ? ALA C 90  ? GLU X 99  ALA X 105 
L 6  TYR C 109 ? THR C 115 ? TYR X 124 THR X 130 
L 7  VAL C 132 ? GLN C 137 ? VAL X 147 GLN X 152 
L 8  VAL C 158 ? TRP C 161 ? VAL X 173 TRP X 176 
L 9  THR C 178 ? ASN C 184 ? THR X 193 ASN X 199 
L 10 ALA C 202 ? SER C 203 ? ALA X 217 SER X 218 
M 1  HIS C 9   ? CYS C 10  ? HIS X 24  CYS X 25  
M 2  VAL C 14  ? GLN C 18  ? VAL X 29  GLN X 33  
M 3  GLU C 35  ? VAL C 39  ? GLU X 50  VAL X 54  
M 4  LYS C 59  ? SER C 63  ? LYS X 74  SER X 78  
M 5  GLU C 84  ? ALA C 90  ? GLU X 99  ALA X 105 
M 6  TYR C 109 ? THR C 115 ? TYR X 124 THR X 130 
M 7  VAL C 132 ? GLN C 137 ? VAL X 147 GLN X 152 
M 8  VAL C 158 ? TRP C 161 ? VAL X 173 TRP X 176 
M 9  THR C 178 ? ASN C 184 ? THR X 193 ASN X 199 
M 10 ILE C 207 ? ASP C 209 ? ILE X 222 ASP X 224 
M 11 LYS C 228 ? ARG C 230 ? LYS X 243 ARG X 245 
M 12 GLU C 251 ? SER C 253 ? GLU X 266 SER X 268 
M 13 THR C 330 ? SER C 332 ? THR X 345 SER X 347 
N 1  VAL C 45  ? ILE C 46  ? VAL X 60  ILE X 61  
N 2  VAL C 70  ? ILE C 71  ? VAL X 85  ILE X 86  
N 3  TYR C 95  ? ILE C 96  ? TYR X 110 ILE X 111 
O 1  THR C 144 ? ILE C 145 ? THR X 159 ILE X 160 
O 2  GLU C 169 ? ILE C 170 ? GLU X 184 ILE X 185 
P 1  HIS F 9   ? CYS F 10  ? HIS Y 24  CYS Y 25  
P 2  VAL F 14  ? GLN F 18  ? VAL Y 29  GLN Y 33  
P 3  GLU F 35  ? VAL F 39  ? GLU Y 50  VAL Y 54  
P 4  LYS F 59  ? SER F 63  ? LYS Y 74  SER Y 78  
P 5  GLU F 84  ? ALA F 90  ? GLU Y 99  ALA Y 105 
P 6  TYR F 109 ? THR F 115 ? TYR Y 124 THR Y 130 
P 7  VAL F 132 ? GLN F 137 ? VAL Y 147 GLN Y 152 
P 8  VAL F 158 ? TRP F 161 ? VAL Y 173 TRP Y 176 
P 9  THR F 178 ? ASN F 184 ? THR Y 193 ASN Y 199 
P 10 ALA F 202 ? SER F 203 ? ALA Y 217 SER Y 218 
Q 1  HIS F 9   ? CYS F 10  ? HIS Y 24  CYS Y 25  
Q 2  VAL F 14  ? GLN F 18  ? VAL Y 29  GLN Y 33  
Q 3  GLU F 35  ? VAL F 39  ? GLU Y 50  VAL Y 54  
Q 4  LYS F 59  ? SER F 63  ? LYS Y 74  SER Y 78  
Q 5  GLU F 84  ? ALA F 90  ? GLU Y 99  ALA Y 105 
Q 6  TYR F 109 ? THR F 115 ? TYR Y 124 THR Y 130 
Q 7  VAL F 132 ? GLN F 137 ? VAL Y 147 GLN Y 152 
Q 8  VAL F 158 ? TRP F 161 ? VAL Y 173 TRP Y 176 
Q 9  THR F 178 ? ASN F 184 ? THR Y 193 ASN Y 199 
Q 10 ILE F 207 ? ASP F 209 ? ILE Y 222 ASP Y 224 
Q 11 LYS F 228 ? ARG F 230 ? LYS Y 243 ARG Y 245 
Q 12 GLU F 251 ? SER F 253 ? GLU Y 266 SER Y 268 
Q 13 THR F 330 ? SER F 332 ? THR Y 345 SER Y 347 
R 1  VAL F 45  ? ILE F 46  ? VAL Y 60  ILE Y 61  
R 2  VAL F 70  ? ILE F 71  ? VAL Y 85  ILE Y 86  
R 3  TYR F 95  ? ILE F 96  ? TYR Y 110 ILE Y 111 
S 1  THR F 144 ? ILE F 145 ? THR Y 159 ILE Y 160 
S 2  GLU F 169 ? ILE F 170 ? GLU Y 184 ILE Y 185 
T 1  HIS I 9   ? CYS I 10  ? HIS Z 24  CYS Z 25  
T 2  VAL I 14  ? GLN I 18  ? VAL Z 29  GLN Z 33  
T 3  GLU I 35  ? VAL I 39  ? GLU Z 50  VAL Z 54  
T 4  LYS I 59  ? SER I 63  ? LYS Z 74  SER Z 78  
T 5  GLU I 84  ? ALA I 90  ? GLU Z 99  ALA Z 105 
T 6  TYR I 109 ? THR I 115 ? TYR Z 124 THR Z 130 
T 7  VAL I 132 ? GLN I 137 ? VAL Z 147 GLN Z 152 
T 8  VAL I 158 ? TRP I 161 ? VAL Z 173 TRP Z 176 
T 9  LEU I 180 ? ASN I 184 ? LEU Z 195 ASN Z 199 
T 10 ILE I 207 ? ASP I 209 ? ILE Z 222 ASP Z 224 
T 11 LYS I 228 ? ARG I 230 ? LYS Z 243 ARG Z 245 
T 12 GLU I 251 ? SER I 253 ? GLU Z 266 SER Z 268 
T 13 THR I 330 ? SER I 332 ? THR Z 345 SER Z 347 
U 1  VAL I 45  ? ILE I 46  ? VAL Z 60  ILE Z 61  
U 2  VAL I 70  ? ILE I 71  ? VAL Z 85  ILE Z 86  
U 3  TYR I 95  ? ILE I 96  ? TYR Z 110 ILE Z 111 
V 1  THR I 144 ? ILE I 145 ? THR Z 159 ILE Z 160 
V 2  GLU I 169 ? ILE I 170 ? GLU Z 184 ILE Z 185 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N GLN A 13  ? N GLN A 13  O GLN A 27  ? O GLN A 27  
A 2  3  N SER A 34  ? N SER A 34  O GLY B 30  ? O GLY B 30  
A 3  4  O THR B 25  ? O THR B 25  N ILE B 8   ? N ILE B 8   
B 1  2  N GLN A 13  ? N GLN A 13  O GLN A 27  ? O GLN A 27  
B 2  3  N ARG A 35  ? N ARG A 35  O GLU A 56  ? O GLU A 56  
B 3  4  N SER A 55  ? N SER A 55  O ASP B 93  ? O ASP B 93  
C 1  2  N CYS A 59  ? N CYS A 59  O SER A 85  ? O SER A 85  
D 1  2  N LYS B 54  ? N LYS B 54  O GLN B 81  ? O GLN B 81  
E 1  2  N GLN D 13  ? N GLN D 13  O GLN D 27  ? O GLN D 27  
E 2  3  N TYR D 37  ? N TYR D 37  O THR D 54  ? O THR D 54  
E 4  5  O ILE E 21  ? O ILE E 21  N ILE E 12  ? N ILE E 12  
F 1  2  O SER D 85  ? O SER D 85  N CYS D 59  ? N CYS D 59  
F 2  3  O THR D 54  ? O THR D 54  N TYR D 37  ? N TYR D 37  
G 1  2  N VAL E 57  ? N VAL E 57  O VAL E 78  ? O VAL E 78  
H 1  2  N THR G 11  ? N THR G 11  O MET G 29  ? O MET G 29  
H 2  3  N SER G 34  ? N SER G 34  O GLY H 30  ? O GLY H 30  
H 3  4  O ILE H 23  ? O ILE H 23  N ILE H 10  ? N ILE H 10  
I 1  2  N THR G 11  ? N THR G 11  O MET G 29  ? O MET G 29  
I 2  3  N TYR G 37  ? N TYR G 37  O THR G 54  ? O THR G 54  
I 3  4  N SER G 55  ? N SER G 55  O ASP H 93  ? O ASP H 93  
J 1  2  N CYS G 59  ? N CYS G 59  O SER G 85  ? O SER G 85  
K 1  2  N VAL H 57  ? N VAL H 57  O VAL H 78  ? O VAL H 78  
L 1  2  N HIS C 9   ? N HIS X 24  O LEU C 16  ? O LEU X 31  
L 2  3  N PHE C 15  ? N PHE X 30  O ARG C 37  ? O ARG X 52  
L 3  4  N PHE C 38  ? N PHE X 53  O GLU C 61  ? O GLU X 76  
L 4  5  N ILE C 62  ? N ILE X 77  O ARG C 86  ? O ARG X 101 
L 5  6  N ILE C 87  ? N ILE X 102 O LEU C 111 ? O LEU X 126 
L 6  7  N LEU C 110 ? N LEU X 125 O ASP C 135 ? O ASP X 150 
L 7  8  N ILE C 136 ? N ILE X 151 O TRP C 161 ? O TRP X 176 
L 8  9  N LEU C 160 ? N LEU X 175 O GLU C 182 ? O GLU X 197 
L 9  10 N THR C 178 ? N THR X 193 O SER C 203 ? O SER X 218 
M 1  2  N HIS C 9   ? N HIS X 24  O LEU C 16  ? O LEU X 31  
M 2  3  N PHE C 15  ? N PHE X 30  O ARG C 37  ? O ARG X 52  
M 3  4  N PHE C 38  ? N PHE X 53  O GLU C 61  ? O GLU X 76  
M 4  5  N ILE C 62  ? N ILE X 77  O ARG C 86  ? O ARG X 101 
M 5  6  N ILE C 87  ? N ILE X 102 O LEU C 111 ? O LEU X 126 
M 6  7  N LEU C 110 ? N LEU X 125 O ASP C 135 ? O ASP X 150 
M 7  8  N ILE C 136 ? N ILE X 151 O TRP C 161 ? O TRP X 176 
M 8  9  N LEU C 160 ? N LEU X 175 O GLU C 182 ? O GLU X 197 
M 9  10 N LEU C 183 ? N LEU X 198 O ASP C 209 ? O ASP X 224 
M 10 11 N LEU C 208 ? N LEU X 223 O ARG C 230 ? O ARG X 245 
M 11 12 N LEU C 229 ? N LEU X 244 O SER C 253 ? O SER X 268 
M 12 13 N ALA C 252 ? N ALA X 267 O THR C 330 ? O THR X 345 
N 1  2  N ILE C 46  ? N ILE X 61  O VAL C 70  ? O VAL X 85  
N 2  3  N ILE C 71  ? N ILE X 86  O TYR C 95  ? O TYR X 110 
O 1  2  N ILE C 145 ? N ILE X 160 O GLU C 169 ? O GLU X 184 
P 1  2  N HIS F 9   ? N HIS Y 24  O LEU F 16  ? O LEU Y 31  
P 2  3  N PHE F 15  ? N PHE Y 30  O ARG F 37  ? O ARG Y 52  
P 3  4  N PHE F 38  ? N PHE Y 53  O GLU F 61  ? O GLU Y 76  
P 4  5  N ILE F 62  ? N ILE Y 77  O ARG F 86  ? O ARG Y 101 
P 5  6  N ILE F 87  ? N ILE Y 102 O LEU F 111 ? O LEU Y 126 
P 6  7  N ILE F 112 ? N ILE Y 127 O ASP F 135 ? O ASP Y 150 
P 7  8  N ILE F 136 ? N ILE Y 151 O TRP F 161 ? O TRP Y 176 
P 8  9  N VAL F 158 ? N VAL Y 173 O GLN F 179 ? O GLN Y 194 
P 9  10 N LEU F 180 ? N LEU Y 195 O SER F 203 ? O SER Y 218 
Q 1  2  N HIS F 9   ? N HIS Y 24  O LEU F 16  ? O LEU Y 31  
Q 2  3  N PHE F 15  ? N PHE Y 30  O ARG F 37  ? O ARG Y 52  
Q 3  4  N PHE F 38  ? N PHE Y 53  O GLU F 61  ? O GLU Y 76  
Q 4  5  N ILE F 62  ? N ILE Y 77  O ARG F 86  ? O ARG Y 101 
Q 5  6  N ILE F 87  ? N ILE Y 102 O LEU F 111 ? O LEU Y 126 
Q 6  7  N ILE F 112 ? N ILE Y 127 O ASP F 135 ? O ASP Y 150 
Q 7  8  N ILE F 136 ? N ILE Y 151 O TRP F 161 ? O TRP Y 176 
Q 8  9  N VAL F 158 ? N VAL Y 173 O GLN F 179 ? O GLN Y 194 
Q 9  10 N LEU F 183 ? N LEU Y 198 O ASP F 209 ? O ASP Y 224 
Q 10 11 N LEU F 208 ? N LEU Y 223 O ARG F 230 ? O ARG Y 245 
Q 11 12 N LEU F 229 ? N LEU Y 244 O SER F 253 ? O SER Y 268 
Q 12 13 N ALA F 252 ? N ALA Y 267 O THR F 330 ? O THR Y 345 
R 1  2  N ILE F 46  ? N ILE Y 61  O VAL F 70  ? O VAL Y 85  
R 2  3  N ILE F 71  ? N ILE Y 86  O TYR F 95  ? O TYR Y 110 
S 1  2  N ILE F 145 ? N ILE Y 160 O GLU F 169 ? O GLU Y 184 
T 1  2  N HIS I 9   ? N HIS Z 24  O LEU I 16  ? O LEU Z 31  
T 2  3  N PHE I 15  ? N PHE Z 30  O ARG I 37  ? O ARG Z 52  
T 3  4  N LEU I 36  ? N LEU Z 51  O GLU I 61  ? O GLU Z 76  
T 4  5  N ILE I 60  ? N ILE Z 75  O ARG I 86  ? O ARG Z 101 
T 5  6  N ILE I 87  ? N ILE Z 102 O LEU I 111 ? O LEU Z 126 
T 6  7  N LEU I 110 ? N LEU Z 125 O ASP I 135 ? O ASP Z 150 
T 7  8  N ILE I 136 ? N ILE Z 151 O TRP I 161 ? O TRP Z 176 
T 8  9  N LEU I 160 ? N LEU Z 175 O ASN I 184 ? O ASN Z 199 
T 9  10 N LEU I 183 ? N LEU Z 198 O ASP I 209 ? O ASP Z 224 
T 10 11 N LEU I 208 ? N LEU Z 223 O ARG I 230 ? O ARG Z 245 
T 11 12 N LEU I 229 ? N LEU Z 244 O GLU I 251 ? O GLU Z 266 
T 12 13 N ALA I 252 ? N ALA Z 267 O THR I 330 ? O THR Z 345 
U 1  2  N ILE I 46  ? N ILE Z 61  O VAL I 70  ? O VAL Z 85  
U 2  3  N ILE I 71  ? N ILE Z 86  O TYR I 95  ? O TYR Z 110 
V 1  2  N ILE I 145 ? N ILE Z 160 O GLU I 169 ? O GLU Z 184 
# 
_database_PDB_matrix.entry_id          4MQW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4MQW 
_atom_sites.fract_transf_matrix[1][1]   0.010428 
_atom_sites.fract_transf_matrix[1][2]   0.006020 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012041 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004895 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . GLN A  1 5   ? 26.693  -28.352 4.470   1.00 133.13 ? 5   GLN A N   1 
ATOM   2     C CA  . GLN A  1 5   ? 26.692  -27.446 3.317   1.00 130.91 ? 5   GLN A CA  1 
ATOM   3     C C   . GLN A  1 5   ? 25.696  -27.928 2.240   1.00 128.05 ? 5   GLN A C   1 
ATOM   4     O O   . GLN A  1 5   ? 24.964  -27.113 1.668   1.00 123.09 ? 5   GLN A O   1 
ATOM   5     C CB  . GLN A  1 5   ? 28.115  -27.282 2.731   1.00 139.84 ? 5   GLN A CB  1 
ATOM   6     C CG  . GLN A  1 5   ? 29.193  -26.795 3.722   1.00 159.25 ? 5   GLN A CG  1 
ATOM   7     C CD  . GLN A  1 5   ? 29.170  -25.303 3.982   1.00 174.04 ? 5   GLN A CD  1 
ATOM   8     O OE1 . GLN A  1 5   ? 29.511  -24.484 3.121   1.00 169.98 ? 5   GLN A OE1 1 
ATOM   9     N NE2 . GLN A  1 5   ? 28.821  -24.920 5.201   1.00 164.20 ? 5   GLN A NE2 1 
ATOM   10    N N   . ASP A  1 6   ? 25.660  -29.257 1.991   1.00 124.18 ? 6   ASP A N   1 
ATOM   11    C CA  . ASP A  1 6   ? 24.783  -29.929 1.023   1.00 118.96 ? 6   ASP A CA  1 
ATOM   12    C C   . ASP A  1 6   ? 23.317  -29.952 1.504   1.00 112.18 ? 6   ASP A C   1 
ATOM   13    O O   . ASP A  1 6   ? 23.033  -29.601 2.654   1.00 111.60 ? 6   ASP A O   1 
ATOM   14    C CB  . ASP A  1 6   ? 25.289  -31.362 0.778   1.00 125.62 ? 6   ASP A CB  1 
ATOM   15    C CG  . ASP A  1 6   ? 24.921  -31.933 -0.575  1.00 137.26 ? 6   ASP A CG  1 
ATOM   16    O OD1 . ASP A  1 6   ? 23.751  -32.350 -0.746  1.00 131.75 ? 6   ASP A OD1 1 
ATOM   17    O OD2 . ASP A  1 6   ? 25.816  -32.005 -1.453  1.00 149.79 ? 6   ASP A OD2 1 
ATOM   18    N N   . CYS A  1 7   ? 22.385  -30.362 0.627   1.00 100.30 ? 7   CYS A N   1 
ATOM   19    C CA  . CYS A  1 7   ? 20.973  -30.418 0.986   1.00 91.90  ? 7   CYS A CA  1 
ATOM   20    C C   . CYS A  1 7   ? 20.307  -31.785 0.649   1.00 92.44  ? 7   CYS A C   1 
ATOM   21    O O   . CYS A  1 7   ? 19.873  -31.994 -0.491  1.00 90.32  ? 7   CYS A O   1 
ATOM   22    C CB  . CYS A  1 7   ? 20.220  -29.241 0.376   1.00 87.06  ? 7   CYS A CB  1 
ATOM   23    S SG  . CYS A  1 7   ? 19.021  -28.475 1.495   1.00 85.39  ? 7   CYS A SG  1 
ATOM   24    N N   . PRO A  1 8   ? 20.205  -32.715 1.639   1.00 88.63  ? 8   PRO A N   1 
ATOM   25    C CA  . PRO A  1 8   ? 19.614  -34.041 1.362   1.00 87.74  ? 8   PRO A CA  1 
ATOM   26    C C   . PRO A  1 8   ? 18.190  -33.982 0.832   1.00 87.14  ? 8   PRO A C   1 
ATOM   27    O O   . PRO A  1 8   ? 17.402  -33.185 1.330   1.00 83.68  ? 8   PRO A O   1 
ATOM   28    C CB  . PRO A  1 8   ? 19.682  -34.755 2.718   1.00 90.95  ? 8   PRO A CB  1 
ATOM   29    C CG  . PRO A  1 8   ? 19.847  -33.676 3.725   1.00 94.81  ? 8   PRO A CG  1 
ATOM   30    C CD  . PRO A  1 8   ? 20.660  -32.625 3.041   1.00 92.03  ? 8   PRO A CD  1 
ATOM   31    N N   . GLU A  1 9   ? 17.870  -34.812 -0.179  1.00 84.03  ? 9   GLU A N   1 
ATOM   32    C CA  . GLU A  1 9   ? 16.550  -34.848 -0.823  1.00 80.18  ? 9   GLU A CA  1 
ATOM   33    C C   . GLU A  1 9   ? 15.405  -35.200 0.115   1.00 77.62  ? 9   GLU A C   1 
ATOM   34    O O   . GLU A  1 9   ? 15.605  -35.927 1.090   1.00 78.35  ? 9   GLU A O   1 
ATOM   35    C CB  . GLU A  1 9   ? 16.544  -35.786 -2.045  1.00 84.82  ? 9   GLU A CB  1 
ATOM   36    C CG  . GLU A  1 9   ? 15.646  -35.307 -3.179  1.00 97.96  ? 9   GLU A CG  1 
ATOM   37    C CD  . GLU A  1 9   ? 14.988  -36.411 -3.985  1.00 124.71 ? 9   GLU A CD  1 
ATOM   38    O OE1 . GLU A  1 9   ? 13.923  -36.908 -3.549  1.00 116.33 ? 9   GLU A OE1 1 
ATOM   39    O OE2 . GLU A  1 9   ? 15.519  -36.759 -5.064  1.00 122.92 ? 9   GLU A OE2 1 
ATOM   40    N N   . CYS A  1 10  ? 14.202  -34.671 -0.199  1.00 68.47  ? 10  CYS A N   1 
ATOM   41    C CA  . CYS A  1 10  ? 12.945  -34.894 0.523   1.00 64.45  ? 10  CYS A CA  1 
ATOM   42    C C   . CYS A  1 10  ? 12.555  -36.372 0.514   1.00 67.83  ? 10  CYS A C   1 
ATOM   43    O O   . CYS A  1 10  ? 12.157  -36.924 -0.526  1.00 66.59  ? 10  CYS A O   1 
ATOM   44    C CB  . CYS A  1 10  ? 11.837  -34.015 -0.045  1.00 61.26  ? 10  CYS A CB  1 
ATOM   45    S SG  . CYS A  1 10  ? 10.184  -34.419 0.562   1.00 62.77  ? 10  CYS A SG  1 
ATOM   46    N N   . THR A  1 11  ? 12.699  -37.008 1.688   1.00 65.24  ? 11  THR A N   1 
ATOM   47    C CA  . THR A  1 11  ? 12.409  -38.425 1.887   1.00 66.72  ? 11  THR A CA  1 
ATOM   48    C C   . THR A  1 11  ? 11.868  -38.725 3.296   1.00 67.31  ? 11  THR A C   1 
ATOM   49    O O   . THR A  1 11  ? 11.819  -37.848 4.156   1.00 64.20  ? 11  THR A O   1 
ATOM   50    C CB  . THR A  1 11  ? 13.644  -39.279 1.515   1.00 85.49  ? 11  THR A CB  1 
ATOM   51    O OG1 . THR A  1 11  ? 13.279  -40.660 1.497   1.00 90.61  ? 11  THR A OG1 1 
ATOM   52    C CG2 . THR A  1 11  ? 14.842  -39.049 2.448   1.00 88.13  ? 11  THR A CG2 1 
ATOM   53    N N   . LEU A  1 12  ? 11.457  -39.977 3.508   1.00 65.23  ? 12  LEU A N   1 
ATOM   54    C CA  . LEU A  1 12  ? 10.932  -40.468 4.773   1.00 64.61  ? 12  LEU A CA  1 
ATOM   55    C C   . LEU A  1 12  ? 12.036  -40.704 5.773   1.00 71.37  ? 12  LEU A C   1 
ATOM   56    O O   . LEU A  1 12  ? 12.997  -41.425 5.483   1.00 74.39  ? 12  LEU A O   1 
ATOM   57    C CB  . LEU A  1 12  ? 10.157  -41.776 4.570   1.00 65.23  ? 12  LEU A CB  1 
ATOM   58    C CG  . LEU A  1 12  ? 8.688   -41.665 4.256   1.00 66.11  ? 12  LEU A CG  1 
ATOM   59    C CD1 . LEU A  1 12  ? 8.065   -43.041 4.153   1.00 68.08  ? 12  LEU A CD1 1 
ATOM   60    C CD2 . LEU A  1 12  ? 7.982   -40.864 5.298   1.00 65.03  ? 12  LEU A CD2 1 
ATOM   61    N N   . GLN A  1 13  ? 11.875  -40.106 6.959   1.00 67.21  ? 13  GLN A N   1 
ATOM   62    C CA  . GLN A  1 13  ? 12.779  -40.226 8.097   1.00 70.84  ? 13  GLN A CA  1 
ATOM   63    C C   . GLN A  1 13  ? 11.951  -40.572 9.330   1.00 76.24  ? 13  GLN A C   1 
ATOM   64    O O   . GLN A  1 13  ? 10.731  -40.376 9.339   1.00 73.00  ? 13  GLN A O   1 
ATOM   65    C CB  . GLN A  1 13  ? 13.575  -38.930 8.321   1.00 72.49  ? 13  GLN A CB  1 
ATOM   66    C CG  . GLN A  1 13  ? 14.483  -38.514 7.153   1.00 93.46  ? 13  GLN A CG  1 
ATOM   67    C CD  . GLN A  1 13  ? 15.835  -39.173 7.168   1.00 124.03 ? 13  GLN A CD  1 
ATOM   68    O OE1 . GLN A  1 13  ? 16.584  -39.095 8.146   1.00 127.15 ? 13  GLN A OE1 1 
ATOM   69    N NE2 . GLN A  1 13  ? 16.204  -39.791 6.058   1.00 116.82 ? 13  GLN A NE2 1 
ATOM   70    N N   . GLU A  1 14  ? 12.602  -41.123 10.355  1.00 77.38  ? 14  GLU A N   1 
ATOM   71    C CA  . GLU A  1 14  ? 11.946  -41.528 11.595  1.00 78.22  ? 14  GLU A CA  1 
ATOM   72    C C   . GLU A  1 14  ? 11.715  -40.296 12.457  1.00 80.19  ? 14  GLU A C   1 
ATOM   73    O O   . GLU A  1 14  ? 12.650  -39.516 12.630  1.00 81.18  ? 14  GLU A O   1 
ATOM   74    C CB  . GLU A  1 14  ? 12.871  -42.503 12.325  1.00 84.99  ? 14  GLU A CB  1 
ATOM   75    C CG  . GLU A  1 14  ? 12.180  -43.700 12.939  1.00 98.26  ? 14  GLU A CG  1 
ATOM   76    C CD  . GLU A  1 14  ? 13.149  -44.616 13.658  1.00 123.52 ? 14  GLU A CD  1 
ATOM   77    O OE1 . GLU A  1 14  ? 13.414  -44.368 14.856  1.00 126.48 ? 14  GLU A OE1 1 
ATOM   78    O OE2 . GLU A  1 14  ? 13.685  -45.546 13.013  1.00 116.71 ? 14  GLU A OE2 1 
ATOM   79    N N   . ASN A  1 15  ? 10.485  -40.098 12.979  1.00 74.64  ? 15  ASN A N   1 
ATOM   80    C CA  . ASN A  1 15  ? 10.173  -38.960 13.862  1.00 74.07  ? 15  ASN A CA  1 
ATOM   81    C C   . ASN A  1 15  ? 10.760  -39.245 15.251  1.00 83.63  ? 15  ASN A C   1 
ATOM   82    O O   . ASN A  1 15  ? 10.444  -40.274 15.834  1.00 85.31  ? 15  ASN A O   1 
ATOM   83    C CB  . ASN A  1 15  ? 8.665   -38.706 13.964  1.00 71.44  ? 15  ASN A CB  1 
ATOM   84    C CG  . ASN A  1 15  ? 8.292   -37.520 14.838  1.00 83.67  ? 15  ASN A CG  1 
ATOM   85    O OD1 . ASN A  1 15  ? 8.263   -37.593 16.067  1.00 77.07  ? 15  ASN A OD1 1 
ATOM   86    N ND2 . ASN A  1 15  ? 7.981   -36.400 14.222  1.00 67.97  ? 15  ASN A ND2 1 
ATOM   87    N N   . PRO A  1 16  ? 11.614  -38.368 15.813  1.00 83.16  ? 16  PRO A N   1 
ATOM   88    C CA  . PRO A  1 16  ? 12.214  -38.686 17.125  1.00 88.70  ? 16  PRO A CA  1 
ATOM   89    C C   . PRO A  1 16  ? 11.222  -38.759 18.288  1.00 93.20  ? 16  PRO A C   1 
ATOM   90    O O   . PRO A  1 16  ? 11.320  -39.670 19.119  1.00 96.28  ? 16  PRO A O   1 
ATOM   91    C CB  . PRO A  1 16  ? 13.253  -37.577 17.319  1.00 92.58  ? 16  PRO A CB  1 
ATOM   92    C CG  . PRO A  1 16  ? 12.785  -36.455 16.443  1.00 91.43  ? 16  PRO A CG  1 
ATOM   93    C CD  . PRO A  1 16  ? 12.128  -37.093 15.269  1.00 82.48  ? 16  PRO A CD  1 
ATOM   94    N N   . LEU A  1 17  ? 10.262  -37.806 18.325  1.00 86.65  ? 17  LEU A N   1 
ATOM   95    C CA  . LEU A  1 17  ? 9.253   -37.685 19.371  1.00 88.34  ? 17  LEU A CA  1 
ATOM   96    C C   . LEU A  1 17  ? 8.216   -38.821 19.383  1.00 91.75  ? 17  LEU A C   1 
ATOM   97    O O   . LEU A  1 17  ? 8.115   -39.542 20.384  1.00 96.47  ? 17  LEU A O   1 
ATOM   98    C CB  . LEU A  1 17  ? 8.566   -36.315 19.299  1.00 86.17  ? 17  LEU A CB  1 
ATOM   99    C CG  . LEU A  1 17  ? 7.903   -35.863 20.597  1.00 95.23  ? 17  LEU A CG  1 
ATOM   100   C CD1 . LEU A  1 17  ? 8.278   -34.428 20.945  1.00 96.98  ? 17  LEU A CD1 1 
ATOM   101   C CD2 . LEU A  1 17  ? 6.394   -36.082 20.563  1.00 96.06  ? 17  LEU A CD2 1 
ATOM   102   N N   . PHE A  1 18  ? 7.442   -38.965 18.288  1.00 81.65  ? 18  PHE A N   1 
ATOM   103   C CA  . PHE A  1 18  ? 6.377   -39.955 18.169  1.00 79.86  ? 18  PHE A CA  1 
ATOM   104   C C   . PHE A  1 18  ? 6.851   -41.386 17.902  1.00 84.79  ? 18  PHE A C   1 
ATOM   105   O O   . PHE A  1 18  ? 6.112   -42.320 18.230  1.00 85.69  ? 18  PHE A O   1 
ATOM   106   C CB  . PHE A  1 18  ? 5.349   -39.510 17.130  1.00 76.52  ? 18  PHE A CB  1 
ATOM   107   C CG  . PHE A  1 18  ? 4.624   -38.271 17.587  1.00 77.08  ? 18  PHE A CG  1 
ATOM   108   C CD1 . PHE A  1 18  ? 3.693   -38.332 18.618  1.00 82.37  ? 18  PHE A CD1 1 
ATOM   109   C CD2 . PHE A  1 18  ? 4.923   -37.032 17.039  1.00 76.19  ? 18  PHE A CD2 1 
ATOM   110   C CE1 . PHE A  1 18  ? 3.058   -37.182 19.074  1.00 83.37  ? 18  PHE A CE1 1 
ATOM   111   C CE2 . PHE A  1 18  ? 4.280   -35.883 17.489  1.00 78.90  ? 18  PHE A CE2 1 
ATOM   112   C CZ  . PHE A  1 18  ? 3.341   -35.968 18.493  1.00 80.04  ? 18  PHE A CZ  1 
ATOM   113   N N   . SER A  1 19  ? 8.069   -41.575 17.345  1.00 80.92  ? 19  SER A N   1 
ATOM   114   C CA  . SER A  1 19  ? 8.572   -42.924 17.103  1.00 82.52  ? 19  SER A CA  1 
ATOM   115   C C   . SER A  1 19  ? 8.837   -43.657 18.416  1.00 93.30  ? 19  SER A C   1 
ATOM   116   O O   . SER A  1 19  ? 9.175   -43.035 19.433  1.00 95.73  ? 19  SER A O   1 
ATOM   117   C CB  . SER A  1 19  ? 9.832   -42.916 16.244  1.00 83.69  ? 19  SER A CB  1 
ATOM   118   O OG  . SER A  1 19  ? 9.559   -42.622 14.885  1.00 82.84  ? 19  SER A OG  1 
ATOM   119   N N   . GLN A  1 20  ? 8.639   -44.978 18.380  1.00 92.26  ? 20  GLN A N   1 
ATOM   120   C CA  . GLN A  1 20  ? 8.861   -45.908 19.480  1.00 98.12  ? 20  GLN A CA  1 
ATOM   121   C C   . GLN A  1 20  ? 9.421   -47.220 18.885  1.00 103.52 ? 20  GLN A C   1 
ATOM   122   O O   . GLN A  1 20  ? 9.163   -47.476 17.704  1.00 100.12 ? 20  GLN A O   1 
ATOM   123   C CB  . GLN A  1 20  ? 7.539   -46.166 20.229  1.00 100.65 ? 20  GLN A CB  1 
ATOM   124   C CG  . GLN A  1 20  ? 7.154   -45.085 21.244  1.00 117.55 ? 20  GLN A CG  1 
ATOM   125   C CD  . GLN A  1 20  ? 8.090   -45.019 22.433  1.00 143.37 ? 20  GLN A CD  1 
ATOM   126   O OE1 . GLN A  1 20  ? 8.828   -44.043 22.613  1.00 139.80 ? 20  GLN A OE1 1 
ATOM   127   N NE2 . GLN A  1 20  ? 8.087   -46.056 23.268  1.00 139.13 ? 20  GLN A NE2 1 
ATOM   128   N N   . PRO A  1 21  ? 10.187  -48.067 19.624  1.00 104.74 ? 21  PRO A N   1 
ATOM   129   C CA  . PRO A  1 21  ? 10.689  -49.314 19.004  1.00 105.89 ? 21  PRO A CA  1 
ATOM   130   C C   . PRO A  1 21  ? 9.536   -50.205 18.544  1.00 107.38 ? 21  PRO A C   1 
ATOM   131   O O   . PRO A  1 21  ? 8.464   -50.195 19.163  1.00 106.83 ? 21  PRO A O   1 
ATOM   132   C CB  . PRO A  1 21  ? 11.521  -49.966 20.114  1.00 114.10 ? 21  PRO A CB  1 
ATOM   133   C CG  . PRO A  1 21  ? 11.823  -48.872 21.065  1.00 120.14 ? 21  PRO A CG  1 
ATOM   134   C CD  . PRO A  1 21  ? 10.630  -47.962 21.027  1.00 111.28 ? 21  PRO A CD  1 
ATOM   135   N N   . GLY A  1 22  ? 9.728   -50.875 17.410  1.00 102.18 ? 22  GLY A N   1 
ATOM   136   C CA  . GLY A  1 22  ? 8.709   -51.727 16.804  1.00 100.69 ? 22  GLY A CA  1 
ATOM   137   C C   . GLY A  1 22  ? 7.644   -50.944 16.055  1.00 99.15  ? 22  GLY A C   1 
ATOM   138   O O   . GLY A  1 22  ? 7.135   -51.413 15.029  1.00 97.35  ? 22  GLY A O   1 
ATOM   139   N N   . ALA A  1 23  ? 7.309   -49.728 16.555  1.00 92.27  ? 23  ALA A N   1 
ATOM   140   C CA  . ALA A  1 23  ? 6.309   -48.851 15.959  1.00 86.85  ? 23  ALA A CA  1 
ATOM   141   C C   . ALA A  1 23  ? 6.865   -47.433 15.650  1.00 89.44  ? 23  ALA A C   1 
ATOM   142   O O   . ALA A  1 23  ? 6.473   -46.435 16.290  1.00 88.57  ? 23  ALA A O   1 
ATOM   143   C CB  . ALA A  1 23  ? 5.071   -48.790 16.841  1.00 87.89  ? 23  ALA A CB  1 
ATOM   144   N N   . PRO A  1 24  ? 7.791   -47.306 14.661  1.00 84.42  ? 24  PRO A N   1 
ATOM   145   C CA  . PRO A  1 24  ? 8.293   -45.955 14.326  1.00 80.90  ? 24  PRO A CA  1 
ATOM   146   C C   . PRO A  1 24  ? 7.232   -45.113 13.613  1.00 78.63  ? 24  PRO A C   1 
ATOM   147   O O   . PRO A  1 24  ? 6.253   -45.661 13.112  1.00 77.50  ? 24  PRO A O   1 
ATOM   148   C CB  . PRO A  1 24  ? 9.488   -46.234 13.406  1.00 83.42  ? 24  PRO A CB  1 
ATOM   149   C CG  . PRO A  1 24  ? 9.217   -47.590 12.809  1.00 89.25  ? 24  PRO A CG  1 
ATOM   150   C CD  . PRO A  1 24  ? 8.376   -48.351 13.784  1.00 86.80  ? 24  PRO A CD  1 
ATOM   151   N N   . ILE A  1 25  ? 7.402   -43.788 13.593  1.00 71.54  ? 25  ILE A N   1 
ATOM   152   C CA  . ILE A  1 25  ? 6.518   -42.901 12.844  1.00 66.39  ? 25  ILE A CA  1 
ATOM   153   C C   . ILE A  1 25  ? 7.360   -42.267 11.773  1.00 66.79  ? 25  ILE A C   1 
ATOM   154   O O   . ILE A  1 25  ? 8.443   -41.732 12.059  1.00 68.01  ? 25  ILE A O   1 
ATOM   155   C CB  . ILE A  1 25  ? 5.686   -41.931 13.697  1.00 68.97  ? 25  ILE A CB  1 
ATOM   156   C CG1 . ILE A  1 25  ? 4.368   -42.596 14.066  1.00 70.71  ? 25  ILE A CG1 1 
ATOM   157   C CG2 . ILE A  1 25  ? 5.388   -40.643 12.956  1.00 66.91  ? 25  ILE A CG2 1 
ATOM   158   C CD1 . ILE A  1 25  ? 4.247   -42.850 15.471  1.00 85.27  ? 25  ILE A CD1 1 
ATOM   159   N N   . LEU A  1 26  ? 6.918   -42.417 10.523  1.00 59.08  ? 26  LEU A N   1 
ATOM   160   C CA  . LEU A  1 26  ? 7.703   -41.937 9.397   1.00 56.68  ? 26  LEU A CA  1 
ATOM   161   C C   . LEU A  1 26  ? 7.198   -40.568 8.921   1.00 59.63  ? 26  LEU A C   1 
ATOM   162   O O   . LEU A  1 26  ? 5.990   -40.338 8.837   1.00 56.61  ? 26  LEU A O   1 
ATOM   163   C CB  . LEU A  1 26  ? 7.797   -43.009 8.297   1.00 56.35  ? 26  LEU A CB  1 
ATOM   164   C CG  . LEU A  1 26  ? 8.171   -44.425 8.799   1.00 62.89  ? 26  LEU A CG  1 
ATOM   165   C CD1 . LEU A  1 26  ? 8.237   -45.396 7.680   1.00 64.07  ? 26  LEU A CD1 1 
ATOM   166   C CD2 . LEU A  1 26  ? 9.481   -44.441 9.580   1.00 64.84  ? 26  LEU A CD2 1 
ATOM   167   N N   . GLN A  1 27  ? 8.144   -39.638 8.715   1.00 57.84  ? 27  GLN A N   1 
ATOM   168   C CA  . GLN A  1 27  ? 7.882   -38.246 8.367   1.00 56.28  ? 27  GLN A CA  1 
ATOM   169   C C   . GLN A  1 27  ? 8.659   -37.759 7.144   1.00 62.58  ? 27  GLN A C   1 
ATOM   170   O O   . GLN A  1 27  ? 9.861   -38.013 7.028   1.00 65.33  ? 27  GLN A O   1 
ATOM   171   C CB  . GLN A  1 27  ? 8.233   -37.366 9.582   1.00 58.29  ? 27  GLN A CB  1 
ATOM   172   C CG  . GLN A  1 27  ? 7.915   -35.895 9.415   1.00 61.97  ? 27  GLN A CG  1 
ATOM   173   C CD  . GLN A  1 27  ? 8.122   -35.116 10.682  1.00 79.92  ? 27  GLN A CD  1 
ATOM   174   O OE1 . GLN A  1 27  ? 8.685   -35.612 11.666  1.00 73.81  ? 27  GLN A OE1 1 
ATOM   175   N NE2 . GLN A  1 27  ? 7.700   -33.855 10.669  1.00 72.37  ? 27  GLN A NE2 1 
ATOM   176   N N   . CYS A  1 28  ? 7.984   -36.985 6.283   1.00 57.65  ? 28  CYS A N   1 
ATOM   177   C CA  . CYS A  1 28  ? 8.599   -36.383 5.110   1.00 57.69  ? 28  CYS A CA  1 
ATOM   178   C C   . CYS A  1 28  ? 9.415   -35.193 5.491   1.00 63.25  ? 28  CYS A C   1 
ATOM   179   O O   . CYS A  1 28  ? 8.897   -34.258 6.097   1.00 62.93  ? 28  CYS A O   1 
ATOM   180   C CB  . CYS A  1 28  ? 7.552   -36.028 4.069   1.00 56.10  ? 28  CYS A CB  1 
ATOM   181   S SG  . CYS A  1 28  ? 6.725   -37.473 3.384   1.00 61.64  ? 28  CYS A SG  1 
ATOM   182   N N   . MET A  1 29  ? 10.698  -35.234 5.164   1.00 61.47  ? 29  MET A N   1 
ATOM   183   C CA  . MET A  1 29  ? 11.616  -34.147 5.449   1.00 62.12  ? 29  MET A CA  1 
ATOM   184   C C   . MET A  1 29  ? 12.799  -34.183 4.524   1.00 66.54  ? 29  MET A C   1 
ATOM   185   O O   . MET A  1 29  ? 13.306  -35.252 4.162   1.00 67.86  ? 29  MET A O   1 
ATOM   186   C CB  . MET A  1 29  ? 12.043  -34.102 6.919   1.00 67.22  ? 29  MET A CB  1 
ATOM   187   C CG  . MET A  1 29  ? 12.641  -35.388 7.405   1.00 75.09  ? 29  MET A CG  1 
ATOM   188   S SD  . MET A  1 29  ? 13.170  -35.283 9.111   1.00 83.78  ? 29  MET A SD  1 
ATOM   189   C CE  . MET A  1 29  ? 11.611  -35.392 9.924   1.00 78.81  ? 29  MET A CE  1 
ATOM   190   N N   . GLY A  1 30  ? 13.208  -33.002 4.121   1.00 62.16  ? 30  GLY A N   1 
ATOM   191   C CA  . GLY A  1 30  ? 14.338  -32.865 3.231   1.00 64.49  ? 30  GLY A CA  1 
ATOM   192   C C   . GLY A  1 30  ? 14.304  -31.594 2.435   1.00 66.97  ? 30  GLY A C   1 
ATOM   193   O O   . GLY A  1 30  ? 13.525  -30.690 2.715   1.00 62.91  ? 30  GLY A O   1 
ATOM   194   N N   . CYS A  1 31  ? 15.138  -31.547 1.424   1.00 67.91  ? 31  CYS A N   1 
ATOM   195   C CA  . CYS A  1 31  ? 15.295  -30.380 0.600   1.00 68.30  ? 31  CYS A CA  1 
ATOM   196   C C   . CYS A  1 31  ? 14.557  -30.462 -0.695  1.00 70.00  ? 31  CYS A C   1 
ATOM   197   O O   . CYS A  1 31  ? 14.383  -31.547 -1.253  1.00 71.10  ? 31  CYS A O   1 
ATOM   198   C CB  . CYS A  1 31  ? 16.773  -30.090 0.391   1.00 73.93  ? 31  CYS A CB  1 
ATOM   199   S SG  . CYS A  1 31  ? 17.715  -29.971 1.932   1.00 81.68  ? 31  CYS A SG  1 
ATOM   200   N N   . CYS A  1 32  ? 14.122  -29.291 -1.171  1.00 63.70  ? 32  CYS A N   1 
ATOM   201   C CA  . CYS A  1 32  ? 13.394  -29.088 -2.417  1.00 61.48  ? 32  CYS A CA  1 
ATOM   202   C C   . CYS A  1 32  ? 13.877  -27.789 -3.117  1.00 63.53  ? 32  CYS A C   1 
ATOM   203   O O   . CYS A  1 32  ? 14.401  -26.894 -2.450  1.00 63.55  ? 32  CYS A O   1 
ATOM   204   C CB  . CYS A  1 32  ? 11.898  -29.075 -2.137  1.00 58.45  ? 32  CYS A CB  1 
ATOM   205   S SG  . CYS A  1 32  ? 11.271  -30.627 -1.440  1.00 62.35  ? 32  CYS A SG  1 
ATOM   206   N N   . PHE A  1 33  ? 13.779  -27.722 -4.458  1.00 58.52  ? 33  PHE A N   1 
ATOM   207   C CA  . PHE A  1 33  ? 14.259  -26.559 -5.191  1.00 58.20  ? 33  PHE A CA  1 
ATOM   208   C C   . PHE A  1 33  ? 13.312  -25.377 -5.150  1.00 60.61  ? 33  PHE A C   1 
ATOM   209   O O   . PHE A  1 33  ? 12.147  -25.471 -5.551  1.00 58.77  ? 33  PHE A O   1 
ATOM   210   C CB  . PHE A  1 33  ? 14.641  -26.891 -6.640  1.00 62.50  ? 33  PHE A CB  1 
ATOM   211   C CG  . PHE A  1 33  ? 15.201  -25.699 -7.393  1.00 65.07  ? 33  PHE A CG  1 
ATOM   212   C CD1 . PHE A  1 33  ? 16.542  -25.339 -7.264  1.00 70.24  ? 33  PHE A CD1 1 
ATOM   213   C CD2 . PHE A  1 33  ? 14.383  -24.921 -8.208  1.00 65.00  ? 33  PHE A CD2 1 
ATOM   214   C CE1 . PHE A  1 33  ? 17.047  -24.228 -7.931  1.00 72.04  ? 33  PHE A CE1 1 
ATOM   215   C CE2 . PHE A  1 33  ? 14.896  -23.817 -8.883  1.00 68.85  ? 33  PHE A CE2 1 
ATOM   216   C CZ  . PHE A  1 33  ? 16.225  -23.481 -8.744  1.00 69.75  ? 33  PHE A CZ  1 
ATOM   217   N N   . SER A  1 34  ? 13.847  -24.239 -4.730  1.00 57.04  ? 34  SER A N   1 
ATOM   218   C CA  . SER A  1 34  ? 13.098  -22.997 -4.680  1.00 54.41  ? 34  SER A CA  1 
ATOM   219   C C   . SER A  1 34  ? 13.972  -21.904 -5.277  1.00 61.96  ? 34  SER A C   1 
ATOM   220   O O   . SER A  1 34  ? 15.204  -21.935 -5.126  1.00 65.75  ? 34  SER A O   1 
ATOM   221   C CB  . SER A  1 34  ? 12.638  -22.664 -3.257  1.00 54.22  ? 34  SER A CB  1 
ATOM   222   O OG  . SER A  1 34  ? 13.505  -23.108 -2.220  1.00 61.43  ? 34  SER A OG  1 
ATOM   223   N N   . ARG A  1 35  ? 13.348  -20.973 -6.013  1.00 56.13  ? 35  ARG A N   1 
ATOM   224   C CA  . ARG A  1 35  ? 14.074  -19.870 -6.637  1.00 56.90  ? 35  ARG A CA  1 
ATOM   225   C C   . ARG A  1 35  ? 13.277  -18.537 -6.602  1.00 58.23  ? 35  ARG A C   1 
ATOM   226   O O   . ARG A  1 35  ? 12.096  -18.517 -6.185  1.00 56.04  ? 35  ARG A O   1 
ATOM   227   C CB  . ARG A  1 35  ? 14.555  -20.248 -8.058  1.00 55.46  ? 35  ARG A CB  1 
ATOM   228   C CG  . ARG A  1 35  ? 13.459  -20.471 -9.085  1.00 51.09  ? 35  ARG A CG  1 
ATOM   229   C CD  . ARG A  1 35  ? 13.938  -19.998 -10.434 1.00 47.77  ? 35  ARG A CD  1 
ATOM   230   N NE  . ARG A  1 35  ? 13.044  -20.403 -11.512 1.00 49.00  ? 35  ARG A NE  1 
ATOM   231   C CZ  . ARG A  1 35  ? 13.363  -20.380 -12.802 1.00 69.04  ? 35  ARG A CZ  1 
ATOM   232   N NH1 . ARG A  1 35  ? 14.562  -19.956 -13.191 1.00 54.76  ? 35  ARG A NH1 1 
ATOM   233   N NH2 . ARG A  1 35  ? 12.486  -20.777 -13.716 1.00 60.20  ? 35  ARG A NH2 1 
ATOM   234   N N   . ALA A  1 36  ? 13.972  -17.429 -6.969  1.00 53.41  ? 36  ALA A N   1 
ATOM   235   C CA  . ALA A  1 36  ? 13.430  -16.071 -7.050  1.00 51.70  ? 36  ALA A CA  1 
ATOM   236   C C   . ALA A  1 36  ? 14.056  -15.334 -8.220  1.00 58.00  ? 36  ALA A C   1 
ATOM   237   O O   . ALA A  1 36  ? 15.213  -15.598 -8.594  1.00 62.86  ? 36  ALA A O   1 
ATOM   238   C CB  . ALA A  1 36  ? 13.666  -15.305 -5.760  1.00 52.05  ? 36  ALA A CB  1 
ATOM   239   N N   . TYR A  1 37  ? 13.269  -14.439 -8.825  1.00 50.57  ? 37  TYR A N   1 
ATOM   240   C CA  . TYR A  1 37  ? 13.654  -13.647 -9.994  1.00 51.28  ? 37  TYR A CA  1 
ATOM   241   C C   . TYR A  1 37  ? 12.661  -12.496 -10.180 1.00 51.93  ? 37  TYR A C   1 
ATOM   242   O O   . TYR A  1 37  ? 11.557  -12.563 -9.625  1.00 47.71  ? 37  TYR A O   1 
ATOM   243   C CB  . TYR A  1 37  ? 13.724  -14.533 -11.261 1.00 53.60  ? 37  TYR A CB  1 
ATOM   244   C CG  . TYR A  1 37  ? 12.475  -15.330 -11.576 1.00 52.13  ? 37  TYR A CG  1 
ATOM   245   C CD1 . TYR A  1 37  ? 11.417  -14.758 -12.280 1.00 53.68  ? 37  TYR A CD1 1 
ATOM   246   C CD2 . TYR A  1 37  ? 12.376  -16.675 -11.231 1.00 51.67  ? 37  TYR A CD2 1 
ATOM   247   C CE1 . TYR A  1 37  ? 10.276  -15.496 -12.601 1.00 52.92  ? 37  TYR A CE1 1 
ATOM   248   C CE2 . TYR A  1 37  ? 11.235  -17.421 -11.535 1.00 51.16  ? 37  TYR A CE2 1 
ATOM   249   C CZ  . TYR A  1 37  ? 10.192  -16.829 -12.232 1.00 56.06  ? 37  TYR A CZ  1 
ATOM   250   O OH  . TYR A  1 37  ? 9.093   -17.564 -12.586 1.00 51.46  ? 37  TYR A OH  1 
ATOM   251   N N   . PRO A  1 38  ? 13.020  -11.413 -10.913 1.00 50.50  ? 38  PRO A N   1 
ATOM   252   C CA  . PRO A  1 38  ? 12.060  -10.317 -11.087 1.00 48.99  ? 38  PRO A CA  1 
ATOM   253   C C   . PRO A  1 38  ? 10.939  -10.793 -11.982 1.00 52.04  ? 38  PRO A C   1 
ATOM   254   O O   . PRO A  1 38  ? 11.172  -11.573 -12.917 1.00 53.74  ? 38  PRO A O   1 
ATOM   255   C CB  . PRO A  1 38  ? 12.879  -9.203  -11.761 1.00 53.92  ? 38  PRO A CB  1 
ATOM   256   C CG  . PRO A  1 38  ? 14.295  -9.638  -11.721 1.00 61.10  ? 38  PRO A CG  1 
ATOM   257   C CD  . PRO A  1 38  ? 14.271  -11.137 -11.646 1.00 56.12  ? 38  PRO A CD  1 
ATOM   258   N N   . THR A  1 39  ? 9.726   -10.337 -11.673 1.00 45.57  ? 39  THR A N   1 
ATOM   259   C CA  . THR A  1 39  ? 8.501   -10.691 -12.380 1.00 44.50  ? 39  THR A CA  1 
ATOM   260   C C   . THR A  1 39  ? 8.512   -10.207 -13.831 1.00 52.29  ? 39  THR A C   1 
ATOM   261   O O   . THR A  1 39  ? 8.676   -9.003  -14.077 1.00 52.34  ? 39  THR A O   1 
ATOM   262   C CB  . THR A  1 39  ? 7.325   -10.087 -11.642 1.00 42.90  ? 39  THR A CB  1 
ATOM   263   O OG1 . THR A  1 39  ? 7.469   -10.370 -10.261 1.00 46.58  ? 39  THR A OG1 1 
ATOM   264   C CG2 . THR A  1 39  ? 6.011   -10.589 -12.137 1.00 32.41  ? 39  THR A CG2 1 
ATOM   265   N N   . PRO A  1 40  ? 8.272   -11.119 -14.804 1.00 51.70  ? 40  PRO A N   1 
ATOM   266   C CA  . PRO A  1 40  ? 8.182   -10.676 -16.207 1.00 55.81  ? 40  PRO A CA  1 
ATOM   267   C C   . PRO A  1 40  ? 7.045   -9.675  -16.372 1.00 61.27  ? 40  PRO A C   1 
ATOM   268   O O   . PRO A  1 40  ? 6.063   -9.728  -15.628 1.00 57.97  ? 40  PRO A O   1 
ATOM   269   C CB  . PRO A  1 40  ? 7.889   -11.973 -16.974 1.00 59.04  ? 40  PRO A CB  1 
ATOM   270   C CG  . PRO A  1 40  ? 8.281   -13.076 -16.064 1.00 59.75  ? 40  PRO A CG  1 
ATOM   271   C CD  . PRO A  1 40  ? 8.046   -12.573 -14.683 1.00 51.57  ? 40  PRO A CD  1 
ATOM   272   N N   . LEU A  1 41  ? 7.182   -8.750  -17.323 1.00 64.21  ? 41  LEU A N   1 
ATOM   273   C CA  . LEU A  1 41  ? 6.137   -7.750  -17.562 1.00 66.81  ? 41  LEU A CA  1 
ATOM   274   C C   . LEU A  1 41  ? 4.808   -8.407  -17.951 1.00 73.26  ? 41  LEU A C   1 
ATOM   275   O O   . LEU A  1 41  ? 3.758   -8.024  -17.424 1.00 72.59  ? 41  LEU A O   1 
ATOM   276   C CB  . LEU A  1 41  ? 6.582   -6.665  -18.554 1.00 70.87  ? 41  LEU A CB  1 
ATOM   277   C CG  . LEU A  1 41  ? 7.528   -5.649  -17.935 1.00 75.76  ? 41  LEU A CG  1 
ATOM   278   C CD1 . LEU A  1 41  ? 8.412   -4.997  -18.971 1.00 80.05  ? 41  LEU A CD1 1 
ATOM   279   C CD2 . LEU A  1 41  ? 6.772   -4.626  -17.108 1.00 78.99  ? 41  LEU A CD2 1 
ATOM   280   N N   . ARG A  1 42  ? 4.872   -9.477  -18.759 1.00 71.55  ? 42  ARG A N   1 
ATOM   281   C CA  . ARG A  1 42  ? 3.694   -10.235 -19.141 1.00 73.23  ? 42  ARG A CA  1 
ATOM   282   C C   . ARG A  1 42  ? 2.871   -10.607 -17.890 1.00 74.56  ? 42  ARG A C   1 
ATOM   283   O O   . ARG A  1 42  ? 1.647   -10.458 -17.911 1.00 75.86  ? 42  ARG A O   1 
ATOM   284   C CB  . ARG A  1 42  ? 4.092   -11.479 -19.966 1.00 75.37  ? 42  ARG A CB  1 
ATOM   285   C CG  . ARG A  1 42  ? 2.915   -12.261 -20.564 1.00 85.44  ? 42  ARG A CG  1 
ATOM   286   C CD  . ARG A  1 42  ? 2.149   -11.486 -21.624 1.00 99.26  ? 42  ARG A CD  1 
ATOM   287   N NE  . ARG A  1 42  ? 0.873   -12.124 -21.937 1.00 108.35 ? 42  ARG A NE  1 
ATOM   288   C CZ  . ARG A  1 42  ? -0.273  -11.836 -21.331 1.00 122.98 ? 42  ARG A CZ  1 
ATOM   289   N NH1 . ARG A  1 42  ? -0.313  -10.913 -20.375 1.00 104.82 ? 42  ARG A NH1 1 
ATOM   290   N NH2 . ARG A  1 42  ? -1.388  -12.469 -21.671 1.00 115.70 ? 42  ARG A NH2 1 
ATOM   291   N N   . SER A  1 43  ? 3.551   -11.023 -16.791 1.00 67.24  ? 43  SER A N   1 
ATOM   292   C CA  . SER A  1 43  ? 2.904   -11.392 -15.530 1.00 63.65  ? 43  SER A CA  1 
ATOM   293   C C   . SER A  1 43  ? 2.311   -10.151 -14.879 1.00 66.13  ? 43  SER A C   1 
ATOM   294   O O   . SER A  1 43  ? 1.156   -10.184 -14.446 1.00 65.37  ? 43  SER A O   1 
ATOM   295   C CB  . SER A  1 43  ? 3.894   -12.054 -14.574 1.00 64.60  ? 43  SER A CB  1 
ATOM   296   O OG  . SER A  1 43  ? 4.415   -13.301 -15.008 1.00 75.67  ? 43  SER A OG  1 
ATOM   297   N N   . LYS A  1 44  ? 3.074   -9.037  -14.869 1.00 62.58  ? 44  LYS A N   1 
ATOM   298   C CA  . LYS A  1 44  ? 2.625   -7.774  -14.270 1.00 62.77  ? 44  LYS A CA  1 
ATOM   299   C C   . LYS A  1 44  ? 1.276   -7.275  -14.840 1.00 70.91  ? 44  LYS A C   1 
ATOM   300   O O   . LYS A  1 44  ? 0.508   -6.622  -14.122 1.00 70.73  ? 44  LYS A O   1 
ATOM   301   C CB  . LYS A  1 44  ? 3.713   -6.682  -14.347 1.00 65.26  ? 44  LYS A CB  1 
ATOM   302   C CG  . LYS A  1 44  ? 4.902   -6.880  -13.397 1.00 64.41  ? 44  LYS A CG  1 
ATOM   303   C CD  . LYS A  1 44  ? 5.884   -5.709  -13.522 1.00 69.26  ? 44  LYS A CD  1 
ATOM   304   C CE  . LYS A  1 44  ? 7.134   -5.851  -12.690 1.00 68.19  ? 44  LYS A CE  1 
ATOM   305   N NZ  . LYS A  1 44  ? 7.904   -4.578  -12.656 1.00 75.15  ? 44  LYS A NZ  1 
ATOM   306   N N   . LYS A  1 45  ? 0.974   -7.632  -16.107 1.00 70.47  ? 45  LYS A N   1 
ATOM   307   C CA  . LYS A  1 45  ? -0.272  -7.271  -16.785 1.00 73.97  ? 45  LYS A CA  1 
ATOM   308   C C   . LYS A  1 45  ? -1.504  -7.956  -16.158 1.00 77.74  ? 45  LYS A C   1 
ATOM   309   O O   . LYS A  1 45  ? -2.612  -7.416  -16.265 1.00 81.47  ? 45  LYS A O   1 
ATOM   310   C CB  . LYS A  1 45  ? -0.182  -7.567  -18.294 1.00 80.51  ? 45  LYS A CB  1 
ATOM   311   C CG  . LYS A  1 45  ? 0.807   -6.664  -19.053 1.00 101.14 ? 45  LYS A CG  1 
ATOM   312   C CD  . LYS A  1 45  ? 0.258   -6.162  -20.398 1.00 120.09 ? 45  LYS A CD  1 
ATOM   313   C CE  . LYS A  1 45  ? 0.330   -7.185  -21.511 1.00 139.94 ? 45  LYS A CE  1 
ATOM   314   N NZ  . LYS A  1 45  ? -0.380  -6.724  -22.734 1.00 156.52 ? 45  LYS A NZ  1 
ATOM   315   N N   . THR A  1 46  ? -1.305  -9.118  -15.482 1.00 69.33  ? 46  THR A N   1 
ATOM   316   C CA  . THR A  1 46  ? -2.374  -9.913  -14.852 1.00 68.35  ? 46  THR A CA  1 
ATOM   317   C C   . THR A  1 46  ? -2.483  -9.687  -13.336 1.00 68.34  ? 46  THR A C   1 
ATOM   318   O O   . THR A  1 46  ? -3.361  -10.258 -12.681 1.00 67.82  ? 46  THR A O   1 
ATOM   319   C CB  . THR A  1 46  ? -2.193  -11.427 -15.155 1.00 72.88  ? 46  THR A CB  1 
ATOM   320   O OG1 . THR A  1 46  ? -1.231  -11.997 -14.269 1.00 63.89  ? 46  THR A OG1 1 
ATOM   321   C CG2 . THR A  1 46  ? -1.812  -11.712 -16.603 1.00 75.49  ? 46  THR A CG2 1 
ATOM   322   N N   . MET A  1 47  ? -1.574  -8.892  -12.778 1.00 62.33  ? 47  MET A N   1 
ATOM   323   C CA  . MET A  1 47  ? -1.528  -8.647  -11.340 1.00 59.09  ? 47  MET A CA  1 
ATOM   324   C C   . MET A  1 47  ? -2.217  -7.351  -10.955 1.00 65.06  ? 47  MET A C   1 
ATOM   325   O O   . MET A  1 47  ? -1.735  -6.275  -11.321 1.00 65.62  ? 47  MET A O   1 
ATOM   326   C CB  . MET A  1 47  ? -0.075  -8.653  -10.847 1.00 57.72  ? 47  MET A CB  1 
ATOM   327   C CG  . MET A  1 47  ? 0.688   -9.909  -11.213 1.00 58.79  ? 47  MET A CG  1 
ATOM   328   S SD  . MET A  1 47  ? 2.302   -10.001 -10.420 1.00 59.08  ? 47  MET A SD  1 
ATOM   329   C CE  . MET A  1 47  ? 2.812   -8.333  -10.596 1.00 57.95  ? 47  MET A CE  1 
ATOM   330   N N   . LEU A  1 48  ? -3.354  -7.450  -10.224 1.00 62.78  ? 48  LEU A N   1 
ATOM   331   C CA  . LEU A  1 48  ? -4.106  -6.262  -9.773  1.00 64.84  ? 48  LEU A CA  1 
ATOM   332   C C   . LEU A  1 48  ? -3.321  -5.552  -8.673  1.00 64.80  ? 48  LEU A C   1 
ATOM   333   O O   . LEU A  1 48  ? -3.296  -4.327  -8.615  1.00 64.80  ? 48  LEU A O   1 
ATOM   334   C CB  . LEU A  1 48  ? -5.507  -6.639  -9.289  1.00 67.30  ? 48  LEU A CB  1 
ATOM   335   C CG  . LEU A  1 48  ? -6.666  -5.846  -9.895  1.00 76.08  ? 48  LEU A CG  1 
ATOM   336   C CD1 . LEU A  1 48  ? -7.955  -6.580  -9.699  1.00 78.48  ? 48  LEU A CD1 1 
ATOM   337   C CD2 . LEU A  1 48  ? -6.779  -4.462  -9.283  1.00 78.40  ? 48  LEU A CD2 1 
ATOM   338   N N   . VAL A  1 49  ? -2.651  -6.346  -7.823  1.00 57.99  ? 49  VAL A N   1 
ATOM   339   C CA  . VAL A  1 49  ? -1.715  -5.864  -6.816  1.00 55.21  ? 49  VAL A CA  1 
ATOM   340   C C   . VAL A  1 49  ? -0.356  -6.183  -7.454  1.00 57.33  ? 49  VAL A C   1 
ATOM   341   O O   . VAL A  1 49  ? -0.100  -7.334  -7.809  1.00 54.01  ? 49  VAL A O   1 
ATOM   342   C CB  . VAL A  1 49  ? -1.899  -6.530  -5.431  1.00 56.22  ? 49  VAL A CB  1 
ATOM   343   C CG1 . VAL A  1 49  ? -0.766  -6.153  -4.490  1.00 54.10  ? 49  VAL A CG1 1 
ATOM   344   C CG2 . VAL A  1 49  ? -3.233  -6.146  -4.819  1.00 58.89  ? 49  VAL A CG2 1 
ATOM   345   N N   . GLN A  1 50  ? 0.477   -5.163  -7.676  1.00 56.29  ? 50  GLN A N   1 
ATOM   346   C CA  . GLN A  1 50  ? 1.767   -5.399  -8.313  1.00 55.89  ? 50  GLN A CA  1 
ATOM   347   C C   . GLN A  1 50  ? 2.780   -6.027  -7.363  1.00 57.35  ? 50  GLN A C   1 
ATOM   348   O O   . GLN A  1 50  ? 2.862   -5.631  -6.197  1.00 57.48  ? 50  GLN A O   1 
ATOM   349   C CB  . GLN A  1 50  ? 2.322   -4.128  -8.976  1.00 60.15  ? 50  GLN A CB  1 
ATOM   350   C CG  . GLN A  1 50  ? 1.428   -3.517  -10.071 1.00 91.24  ? 50  GLN A CG  1 
ATOM   351   C CD  . GLN A  1 50  ? 1.254   -4.366  -11.312 1.00 116.97 ? 50  GLN A CD  1 
ATOM   352   O OE1 . GLN A  1 50  ? 2.149   -5.113  -11.730 1.00 111.10 ? 50  GLN A OE1 1 
ATOM   353   N NE2 . GLN A  1 50  ? 0.094   -4.240  -11.948 1.00 114.25 ? 50  GLN A NE2 1 
ATOM   354   N N   . LYS A  1 51  ? 3.511   -7.040  -7.860  1.00 51.73  ? 51  LYS A N   1 
ATOM   355   C CA  . LYS A  1 51  ? 4.566   -7.783  -7.165  1.00 49.69  ? 51  LYS A CA  1 
ATOM   356   C C   . LYS A  1 51  ? 5.777   -7.830  -8.119  1.00 56.19  ? 51  LYS A C   1 
ATOM   357   O O   . LYS A  1 51  ? 5.759   -8.599  -9.080  1.00 55.84  ? 51  LYS A O   1 
ATOM   358   C CB  . LYS A  1 51  ? 4.104   -9.215  -6.794  1.00 50.29  ? 51  LYS A CB  1 
ATOM   359   C CG  . LYS A  1 51  ? 2.721   -9.342  -6.125  1.00 60.50  ? 51  LYS A CG  1 
ATOM   360   C CD  . LYS A  1 51  ? 2.733   -9.114  -4.617  1.00 63.98  ? 51  LYS A CD  1 
ATOM   361   C CE  . LYS A  1 51  ? 1.349   -9.241  -4.035  1.00 68.07  ? 51  LYS A CE  1 
ATOM   362   N NZ  . LYS A  1 51  ? 1.195   -8.406  -2.814  1.00 78.75  ? 51  LYS A NZ  1 
ATOM   363   N N   . ASN A  1 52  ? 6.799   -6.955  -7.895  1.00 55.35  ? 52  ASN A N   1 
ATOM   364   C CA  . ASN A  1 52  ? 8.011   -6.837  -8.732  1.00 55.87  ? 52  ASN A CA  1 
ATOM   365   C C   . ASN A  1 52  ? 8.938   -8.069  -8.736  1.00 58.92  ? 52  ASN A C   1 
ATOM   366   O O   . ASN A  1 52  ? 9.621   -8.320  -9.732  1.00 60.81  ? 52  ASN A O   1 
ATOM   367   C CB  . ASN A  1 52  ? 8.777   -5.600  -8.354  1.00 55.00  ? 52  ASN A CB  1 
ATOM   368   C CG  . ASN A  1 52  ? 8.122   -4.346  -8.858  1.00 73.97  ? 52  ASN A CG  1 
ATOM   369   O OD1 . ASN A  1 52  ? 7.163   -4.393  -9.653  1.00 66.02  ? 52  ASN A OD1 1 
ATOM   370   N ND2 . ASN A  1 52  ? 8.622   -3.195  -8.413  1.00 66.43  ? 52  ASN A ND2 1 
ATOM   371   N N   . VAL A  1 53  ? 8.925   -8.846  -7.645  1.00 52.23  ? 53  VAL A N   1 
ATOM   372   C CA  . VAL A  1 53  ? 9.698   -10.077 -7.469  1.00 49.90  ? 53  VAL A CA  1 
ATOM   373   C C   . VAL A  1 53  ? 8.749   -11.277 -7.520  1.00 48.78  ? 53  VAL A C   1 
ATOM   374   O O   . VAL A  1 53  ? 7.582   -11.178 -7.137  1.00 45.32  ? 53  VAL A O   1 
ATOM   375   C CB  . VAL A  1 53  ? 10.525  -10.034 -6.156  1.00 53.05  ? 53  VAL A CB  1 
ATOM   376   C CG1 . VAL A  1 53  ? 11.361  -11.297 -5.973  1.00 52.37  ? 53  VAL A CG1 1 
ATOM   377   C CG2 . VAL A  1 53  ? 11.411  -8.796  -6.119  1.00 55.07  ? 53  VAL A CG2 1 
ATOM   378   N N   . THR A  1 54  ? 9.256   -12.397 -8.041  1.00 45.39  ? 54  THR A N   1 
ATOM   379   C CA  . THR A  1 54  ? 8.522   -13.644 -8.174  1.00 43.21  ? 54  THR A CA  1 
ATOM   380   C C   . THR A  1 54  ? 9.324   -14.750 -7.551  1.00 49.14  ? 54  THR A C   1 
ATOM   381   O O   . THR A  1 54  ? 10.502  -14.918 -7.885  1.00 51.30  ? 54  THR A O   1 
ATOM   382   C CB  . THR A  1 54  ? 8.182   -13.906 -9.639  1.00 38.30  ? 54  THR A CB  1 
ATOM   383   O OG1 . THR A  1 54  ? 7.089   -13.058 -9.968  1.00 41.74  ? 54  THR A OG1 1 
ATOM   384   C CG2 . THR A  1 54  ? 7.796   -15.348 -9.911  1.00 26.66  ? 54  THR A CG2 1 
ATOM   385   N N   . SER A  1 55  ? 8.686   -15.486 -6.623  1.00 43.73  ? 55  SER A N   1 
ATOM   386   C CA  . SER A  1 55  ? 9.272   -16.633 -5.964  1.00 42.93  ? 55  SER A CA  1 
ATOM   387   C C   . SER A  1 55  ? 8.598   -17.868 -6.497  1.00 47.35  ? 55  SER A C   1 
ATOM   388   O O   . SER A  1 55  ? 7.370   -17.989 -6.387  1.00 46.65  ? 55  SER A O   1 
ATOM   389   C CB  . SER A  1 55  ? 9.056   -16.561 -4.453  1.00 45.24  ? 55  SER A CB  1 
ATOM   390   O OG  . SER A  1 55  ? 9.491   -17.746 -3.796  1.00 58.35  ? 55  SER A OG  1 
ATOM   391   N N   . GLU A  1 56  ? 9.391   -18.802 -7.055  1.00 44.51  ? 56  GLU A N   1 
ATOM   392   C CA  . GLU A  1 56  ? 8.907   -20.134 -7.479  1.00 42.95  ? 56  GLU A CA  1 
ATOM   393   C C   . GLU A  1 56  ? 9.358   -21.092 -6.353  1.00 43.25  ? 56  GLU A C   1 
ATOM   394   O O   . GLU A  1 56  ? 10.560  -21.169 -6.082  1.00 44.00  ? 56  GLU A O   1 
ATOM   395   C CB  . GLU A  1 56  ? 9.532   -20.563 -8.823  1.00 46.57  ? 56  GLU A CB  1 
ATOM   396   C CG  . GLU A  1 56  ? 8.902   -19.936 -10.052 1.00 52.52  ? 56  GLU A CG  1 
ATOM   397   C CD  . GLU A  1 56  ? 9.417   -20.499 -11.360 1.00 82.78  ? 56  GLU A CD  1 
ATOM   398   O OE1 . GLU A  1 56  ? 10.437  -21.224 -11.340 1.00 76.19  ? 56  GLU A OE1 1 
ATOM   399   O OE2 . GLU A  1 56  ? 8.787   -20.235 -12.409 1.00 88.80  ? 56  GLU A OE2 1 
ATOM   400   N N   . SER A  1 57  ? 8.424   -21.738 -5.642  1.00 37.08  ? 57  SER A N   1 
ATOM   401   C CA  . SER A  1 57  ? 8.835   -22.640 -4.561  1.00 37.25  ? 57  SER A CA  1 
ATOM   402   C C   . SER A  1 57  ? 8.026   -23.960 -4.429  1.00 45.48  ? 57  SER A C   1 
ATOM   403   O O   . SER A  1 57  ? 6.812   -24.052 -4.688  1.00 43.04  ? 57  SER A O   1 
ATOM   404   C CB  . SER A  1 57  ? 8.889   -21.929 -3.209  1.00 37.81  ? 57  SER A CB  1 
ATOM   405   O OG  . SER A  1 57  ? 7.636   -21.759 -2.565  1.00 40.02  ? 57  SER A OG  1 
ATOM   406   N N   . THR A  1 58  ? 8.769   -24.981 -3.982  1.00 46.42  ? 58  THR A N   1 
ATOM   407   C CA  . THR A  1 58  ? 8.288   -26.302 -3.687  1.00 47.27  ? 58  THR A CA  1 
ATOM   408   C C   . THR A  1 58  ? 8.735   -26.678 -2.256  1.00 51.55  ? 58  THR A C   1 
ATOM   409   O O   . THR A  1 58  ? 9.760   -26.178 -1.776  1.00 51.13  ? 58  THR A O   1 
ATOM   410   C CB  . THR A  1 58  ? 8.649   -27.266 -4.815  1.00 64.77  ? 58  THR A CB  1 
ATOM   411   O OG1 . THR A  1 58  ? 7.851   -28.429 -4.673  1.00 74.67  ? 58  THR A OG1 1 
ATOM   412   C CG2 . THR A  1 58  ? 10.112  -27.644 -4.849  1.00 63.16  ? 58  THR A CG2 1 
ATOM   413   N N   . CYS A  1 59  ? 7.893   -27.454 -1.542  1.00 49.20  ? 59  CYS A N   1 
ATOM   414   C CA  . CYS A  1 59  ? 8.134   -27.899 -0.161  1.00 49.55  ? 59  CYS A CA  1 
ATOM   415   C C   . CYS A  1 59  ? 8.078   -29.416 -0.033  1.00 53.68  ? 59  CYS A C   1 
ATOM   416   O O   . CYS A  1 59  ? 7.380   -30.068 -0.808  1.00 52.17  ? 59  CYS A O   1 
ATOM   417   C CB  . CYS A  1 59  ? 7.161   -27.233 0.807   1.00 48.79  ? 59  CYS A CB  1 
ATOM   418   S SG  . CYS A  1 59  ? 7.418   -25.448 1.030   1.00 52.31  ? 59  CYS A SG  1 
ATOM   419   N N   . CYS A  1 60  ? 8.792   -29.970 0.972   1.00 51.45  ? 60  CYS A N   1 
ATOM   420   C CA  . CYS A  1 60  ? 8.805   -31.401 1.262   1.00 52.13  ? 60  CYS A CA  1 
ATOM   421   C C   . CYS A  1 60  ? 7.542   -31.834 2.016   1.00 53.79  ? 60  CYS A C   1 
ATOM   422   O O   . CYS A  1 60  ? 7.391   -31.525 3.201   1.00 52.37  ? 60  CYS A O   1 
ATOM   423   C CB  . CYS A  1 60  ? 10.061  -31.796 2.020   1.00 54.92  ? 60  CYS A CB  1 
ATOM   424   S SG  . CYS A  1 60  ? 10.130  -33.556 2.401   1.00 61.45  ? 60  CYS A SG  1 
ATOM   425   N N   . VAL A  1 61  ? 6.629   -32.544 1.324   1.00 50.59  ? 61  VAL A N   1 
ATOM   426   C CA  . VAL A  1 61  ? 5.332   -32.969 1.887   1.00 49.29  ? 61  VAL A CA  1 
ATOM   427   C C   . VAL A  1 61  ? 4.969   -34.442 1.561   1.00 51.72  ? 61  VAL A C   1 
ATOM   428   O O   . VAL A  1 61  ? 5.373   -34.961 0.526   1.00 50.48  ? 61  VAL A O   1 
ATOM   429   C CB  . VAL A  1 61  ? 4.187   -31.997 1.479   1.00 51.82  ? 61  VAL A CB  1 
ATOM   430   C CG1 . VAL A  1 61  ? 4.518   -30.550 1.829   1.00 50.20  ? 61  VAL A CG1 1 
ATOM   431   C CG2 . VAL A  1 61  ? 3.862   -32.112 -0.005  1.00 52.42  ? 61  VAL A CG2 1 
ATOM   432   N N   . ALA A  1 62  ? 4.165   -35.077 2.430   1.00 49.54  ? 62  ALA A N   1 
ATOM   433   C CA  . ALA A  1 62  ? 3.692   -36.452 2.254   1.00 51.83  ? 62  ALA A CA  1 
ATOM   434   C C   . ALA A  1 62  ? 2.778   -36.630 1.039   1.00 56.62  ? 62  ALA A C   1 
ATOM   435   O O   . ALA A  1 62  ? 1.728   -35.983 0.952   1.00 55.56  ? 62  ALA A O   1 
ATOM   436   C CB  . ALA A  1 62  ? 2.991   -36.951 3.517   1.00 53.22  ? 62  ALA A CB  1 
ATOM   437   N N   . LYS A  1 63  ? 3.187   -37.506 0.101   1.00 54.01  ? 63  LYS A N   1 
ATOM   438   C CA  . LYS A  1 63  ? 2.416   -37.843 -1.090  1.00 54.92  ? 63  LYS A CA  1 
ATOM   439   C C   . LYS A  1 63  ? 1.202   -38.687 -0.644  1.00 60.83  ? 63  LYS A C   1 
ATOM   440   O O   . LYS A  1 63  ? 0.134   -38.580 -1.240  1.00 61.66  ? 63  LYS A O   1 
ATOM   441   C CB  . LYS A  1 63  ? 3.297   -38.613 -2.089  1.00 59.29  ? 63  LYS A CB  1 
ATOM   442   C CG  . LYS A  1 63  ? 3.034   -38.295 -3.551  1.00 74.06  ? 63  LYS A CG  1 
ATOM   443   C CD  . LYS A  1 63  ? 1.979   -39.192 -4.196  1.00 86.02  ? 63  LYS A CD  1 
ATOM   444   C CE  . LYS A  1 63  ? 1.045   -38.427 -5.115  1.00 97.36  ? 63  LYS A CE  1 
ATOM   445   N NZ  . LYS A  1 63  ? 1.704   -37.983 -6.378  1.00 107.48 ? 63  LYS A NZ  1 
ATOM   446   N N   . SER A  1 64  ? 1.373   -39.490 0.433   1.00 58.50  ? 64  SER A N   1 
ATOM   447   C CA  . SER A  1 64  ? 0.354   -40.349 1.055   1.00 60.74  ? 64  SER A CA  1 
ATOM   448   C C   . SER A  1 64  ? 0.730   -40.666 2.501   1.00 66.44  ? 64  SER A C   1 
ATOM   449   O O   . SER A  1 64  ? 1.902   -40.548 2.866   1.00 65.95  ? 64  SER A O   1 
ATOM   450   C CB  . SER A  1 64  ? 0.169   -41.645 0.268   1.00 67.13  ? 64  SER A CB  1 
ATOM   451   O OG  . SER A  1 64  ? 1.388   -42.323 0.014   1.00 71.65  ? 64  SER A OG  1 
ATOM   452   N N   . TYR A  1 65  ? -0.258  -41.046 3.329   1.00 64.96  ? 65  TYR A N   1 
ATOM   453   C CA  . TYR A  1 65  ? -0.020  -41.404 4.733   1.00 66.23  ? 65  TYR A CA  1 
ATOM   454   C C   . TYR A  1 65  ? -1.104  -42.314 5.301   1.00 75.22  ? 65  TYR A C   1 
ATOM   455   O O   . TYR A  1 65  ? -2.016  -42.724 4.574   1.00 77.94  ? 65  TYR A O   1 
ATOM   456   C CB  . TYR A  1 65  ? 0.123   -40.159 5.617   1.00 65.41  ? 65  TYR A CB  1 
ATOM   457   C CG  . TYR A  1 65  ? -1.069  -39.229 5.577   1.00 67.72  ? 65  TYR A CG  1 
ATOM   458   C CD1 . TYR A  1 65  ? -2.154  -39.414 6.432   1.00 71.73  ? 65  TYR A CD1 1 
ATOM   459   C CD2 . TYR A  1 65  ? -1.078  -38.113 4.745   1.00 66.97  ? 65  TYR A CD2 1 
ATOM   460   C CE1 . TYR A  1 65  ? -3.246  -38.544 6.414   1.00 73.52  ? 65  TYR A CE1 1 
ATOM   461   C CE2 . TYR A  1 65  ? -2.151  -37.223 4.736   1.00 68.01  ? 65  TYR A CE2 1 
ATOM   462   C CZ  . TYR A  1 65  ? -3.233  -37.439 5.574   1.00 79.75  ? 65  TYR A CZ  1 
ATOM   463   O OH  . TYR A  1 65  ? -4.289  -36.558 5.546   1.00 83.75  ? 65  TYR A OH  1 
ATOM   464   N N   . ASN A  1 66  ? -1.016  -42.611 6.612   1.00 72.11  ? 66  ASN A N   1 
ATOM   465   C CA  . ASN A  1 66  ? -2.004  -43.405 7.336   1.00 74.76  ? 66  ASN A CA  1 
ATOM   466   C C   . ASN A  1 66  ? -2.128  -42.881 8.756   1.00 78.38  ? 66  ASN A C   1 
ATOM   467   O O   . ASN A  1 66  ? -1.135  -42.844 9.493   1.00 76.37  ? 66  ASN A O   1 
ATOM   468   C CB  . ASN A  1 66  ? -1.676  -44.911 7.309   1.00 78.94  ? 66  ASN A CB  1 
ATOM   469   C CG  . ASN A  1 66  ? -1.808  -45.558 5.947   1.00 98.78  ? 66  ASN A CG  1 
ATOM   470   O OD1 . ASN A  1 66  ? -0.850  -46.137 5.421   1.00 90.93  ? 66  ASN A OD1 1 
ATOM   471   N ND2 . ASN A  1 66  ? -2.985  -45.443 5.328   1.00 91.74  ? 66  ASN A ND2 1 
ATOM   472   N N   . ARG A  1 67  ? -3.351  -42.452 9.127   1.00 77.03  ? 67  ARG A N   1 
ATOM   473   C CA  . ARG A  1 67  ? -3.647  -41.904 10.445  1.00 78.28  ? 67  ARG A CA  1 
ATOM   474   C C   . ARG A  1 67  ? -3.555  -42.994 11.513  1.00 88.56  ? 67  ARG A C   1 
ATOM   475   O O   . ARG A  1 67  ? -4.180  -44.048 11.383  1.00 90.71  ? 67  ARG A O   1 
ATOM   476   C CB  . ARG A  1 67  ? -5.012  -41.221 10.446  1.00 78.15  ? 67  ARG A CB  1 
ATOM   477   C CG  . ARG A  1 67  ? -4.962  -39.827 11.028  1.00 86.66  ? 67  ARG A CG  1 
ATOM   478   C CD  . ARG A  1 67  ? -6.169  -39.012 10.610  1.00 101.56 ? 67  ARG A CD  1 
ATOM   479   N NE  . ARG A  1 67  ? -5.902  -38.196 9.419   1.00 110.18 ? 67  ARG A NE  1 
ATOM   480   C CZ  . ARG A  1 67  ? -6.554  -38.309 8.264   1.00 116.95 ? 67  ARG A CZ  1 
ATOM   481   N NH1 . ARG A  1 67  ? -7.525  -39.206 8.126   1.00 106.51 ? 67  ARG A NH1 1 
ATOM   482   N NH2 . ARG A  1 67  ? -6.248  -37.519 7.244   1.00 88.41  ? 67  ARG A NH2 1 
ATOM   483   N N   . VAL A  1 68  ? -2.695  -42.769 12.522  1.00 87.22  ? 68  VAL A N   1 
ATOM   484   C CA  . VAL A  1 68  ? -2.444  -43.707 13.625  1.00 90.53  ? 68  VAL A CA  1 
ATOM   485   C C   . VAL A  1 68  ? -2.577  -43.020 14.990  1.00 97.68  ? 68  VAL A C   1 
ATOM   486   O O   . VAL A  1 68  ? -2.642  -41.788 15.053  1.00 96.39  ? 68  VAL A O   1 
ATOM   487   C CB  . VAL A  1 68  ? -1.092  -44.466 13.483  1.00 94.13  ? 68  VAL A CB  1 
ATOM   488   C CG1 . VAL A  1 68  ? -1.088  -45.364 12.253  1.00 94.11  ? 68  VAL A CG1 1 
ATOM   489   C CG2 . VAL A  1 68  ? 0.109   -43.518 13.475  1.00 91.27  ? 68  VAL A CG2 1 
ATOM   490   N N   . THR A  1 69  ? -2.625  -43.817 16.075  1.00 98.17  ? 69  THR A N   1 
ATOM   491   C CA  . THR A  1 69  ? -2.713  -43.306 17.441  1.00 100.95 ? 69  THR A CA  1 
ATOM   492   C C   . THR A  1 69  ? -1.628  -43.952 18.295  1.00 107.13 ? 69  THR A C   1 
ATOM   493   O O   . THR A  1 69  ? -1.519  -45.178 18.333  1.00 108.81 ? 69  THR A O   1 
ATOM   494   C CB  . THR A  1 69  ? -4.134  -43.408 18.006  1.00 113.89 ? 69  THR A CB  1 
ATOM   495   O OG1 . THR A  1 69  ? -5.056  -42.942 17.018  1.00 113.05 ? 69  THR A OG1 1 
ATOM   496   C CG2 . THR A  1 69  ? -4.311  -42.587 19.289  1.00 115.49 ? 69  THR A CG2 1 
ATOM   497   N N   . VAL A  1 70  ? -0.806  -43.110 18.946  1.00 103.49 ? 70  VAL A N   1 
ATOM   498   C CA  . VAL A  1 70  ? 0.354   -43.497 19.762  1.00 105.48 ? 70  VAL A CA  1 
ATOM   499   C C   . VAL A  1 70  ? 0.345   -42.809 21.134  1.00 113.57 ? 70  VAL A C   1 
ATOM   500   O O   . VAL A  1 70  ? -0.545  -41.992 21.388  1.00 113.63 ? 70  VAL A O   1 
ATOM   501   C CB  . VAL A  1 70  ? 1.669   -43.173 18.991  1.00 105.94 ? 70  VAL A CB  1 
ATOM   502   C CG1 . VAL A  1 70  ? 1.767   -43.979 17.707  1.00 103.65 ? 70  VAL A CG1 1 
ATOM   503   C CG2 . VAL A  1 70  ? 1.812   -41.676 18.702  1.00 102.23 ? 70  VAL A CG2 1 
ATOM   504   N N   . MET A  1 71  ? 1.366   -43.108 21.989  1.00 113.77 ? 71  MET A N   1 
ATOM   505   C CA  . MET A  1 71  ? 1.617   -42.511 23.314  1.00 118.57 ? 71  MET A CA  1 
ATOM   506   C C   . MET A  1 71  ? 0.309   -42.202 24.059  1.00 125.38 ? 71  MET A C   1 
ATOM   507   O O   . MET A  1 71  ? -0.015  -41.040 24.349  1.00 124.27 ? 71  MET A O   1 
ATOM   508   C CB  . MET A  1 71  ? 2.506   -41.245 23.170  1.00 119.39 ? 71  MET A CB  1 
ATOM   509   C CG  . MET A  1 71  ? 3.257   -40.858 24.447  1.00 128.67 ? 71  MET A CG  1 
ATOM   510   S SD  . MET A  1 71  ? 3.327   -39.067 24.795  1.00 133.45 ? 71  MET A SD  1 
ATOM   511   C CE  . MET A  1 71  ? 2.076   -38.933 26.081  1.00 135.63 ? 71  MET A CE  1 
ATOM   512   N N   . GLY A  1 72  ? -0.469  -43.251 24.291  1.00 125.26 ? 72  GLY A N   1 
ATOM   513   C CA  . GLY A  1 72  ? -1.765  -43.116 24.940  1.00 128.79 ? 72  GLY A CA  1 
ATOM   514   C C   . GLY A  1 72  ? -2.837  -42.590 24.001  1.00 128.28 ? 72  GLY A C   1 
ATOM   515   O O   . GLY A  1 72  ? -3.736  -43.352 23.623  1.00 129.57 ? 72  GLY A O   1 
ATOM   516   N N   . GLY A  1 73  ? -2.740  -41.309 23.613  1.00 118.60 ? 73  GLY A N   1 
ATOM   517   C CA  . GLY A  1 73  ? -3.724  -40.703 22.723  1.00 114.33 ? 73  GLY A CA  1 
ATOM   518   C C   . GLY A  1 73  ? -3.266  -39.548 21.859  1.00 111.35 ? 73  GLY A C   1 
ATOM   519   O O   . GLY A  1 73  ? -3.592  -38.393 22.147  1.00 111.86 ? 73  GLY A O   1 
ATOM   520   N N   . PHE A  1 74  ? -2.552  -39.850 20.765  1.00 101.71 ? 74  PHE A N   1 
ATOM   521   C CA  . PHE A  1 74  ? -2.101  -38.832 19.813  1.00 96.06  ? 74  PHE A CA  1 
ATOM   522   C C   . PHE A  1 74  ? -2.385  -39.247 18.379  1.00 93.74  ? 74  PHE A C   1 
ATOM   523   O O   . PHE A  1 74  ? -1.808  -40.215 17.886  1.00 92.87  ? 74  PHE A O   1 
ATOM   524   C CB  . PHE A  1 74  ? -0.620  -38.458 20.006  1.00 97.03  ? 74  PHE A CB  1 
ATOM   525   C CG  . PHE A  1 74  ? -0.330  -37.536 21.164  1.00 101.99 ? 74  PHE A CG  1 
ATOM   526   C CD1 . PHE A  1 74  ? -0.982  -36.313 21.283  1.00 105.50 ? 74  PHE A CD1 1 
ATOM   527   C CD2 . PHE A  1 74  ? 0.632   -37.864 22.109  1.00 107.62 ? 74  PHE A CD2 1 
ATOM   528   C CE1 . PHE A  1 74  ? -0.708  -35.456 22.351  1.00 110.20 ? 74  PHE A CE1 1 
ATOM   529   C CE2 . PHE A  1 74  ? 0.909   -37.003 23.175  1.00 114.31 ? 74  PHE A CE2 1 
ATOM   530   C CZ  . PHE A  1 74  ? 0.235   -35.808 23.291  1.00 112.66 ? 74  PHE A CZ  1 
ATOM   531   N N   . LYS A  1 75  ? -3.287  -38.521 17.719  1.00 86.35  ? 75  LYS A N   1 
ATOM   532   C CA  . LYS A  1 75  ? -3.688  -38.788 16.343  1.00 82.06  ? 75  LYS A CA  1 
ATOM   533   C C   . LYS A  1 75  ? -2.622  -38.192 15.412  1.00 79.51  ? 75  LYS A C   1 
ATOM   534   O O   . LYS A  1 75  ? -2.705  -37.011 15.036  1.00 78.37  ? 75  LYS A O   1 
ATOM   535   C CB  . LYS A  1 75  ? -5.105  -38.225 16.051  1.00 85.71  ? 75  LYS A CB  1 
ATOM   536   C CG  . LYS A  1 75  ? -6.048  -38.191 17.258  1.00 106.37 ? 75  LYS A CG  1 
ATOM   537   C CD  . LYS A  1 75  ? -7.491  -37.892 16.886  1.00 119.31 ? 75  LYS A CD  1 
ATOM   538   C CE  . LYS A  1 75  ? -8.439  -38.465 17.920  1.00 135.59 ? 75  LYS A CE  1 
ATOM   539   N NZ  . LYS A  1 75  ? -9.860  -38.394 17.485  1.00 146.27 ? 75  LYS A NZ  1 
ATOM   540   N N   . VAL A  1 76  ? -1.596  -39.000 15.084  1.00 72.04  ? 76  VAL A N   1 
ATOM   541   C CA  . VAL A  1 76  ? -0.472  -38.591 14.224  1.00 67.27  ? 76  VAL A CA  1 
ATOM   542   C C   . VAL A  1 76  ? -0.494  -39.295 12.874  1.00 67.69  ? 76  VAL A C   1 
ATOM   543   O O   . VAL A  1 76  ? -1.033  -40.410 12.767  1.00 68.77  ? 76  VAL A O   1 
ATOM   544   C CB  . VAL A  1 76  ? 0.911   -38.759 14.904  1.00 71.53  ? 76  VAL A CB  1 
ATOM   545   C CG1 . VAL A  1 76  ? 1.029   -37.897 16.140  1.00 73.39  ? 76  VAL A CG1 1 
ATOM   546   C CG2 . VAL A  1 76  ? 1.211   -40.221 15.230  1.00 74.03  ? 76  VAL A CG2 1 
ATOM   547   N N   . GLU A  1 77  ? 0.137   -38.662 11.861  1.00 59.08  ? 77  GLU A N   1 
ATOM   548   C CA  . GLU A  1 77  ? 0.266   -39.231 10.519  1.00 57.36  ? 77  GLU A CA  1 
ATOM   549   C C   . GLU A  1 77  ? 1.538   -40.069 10.413  1.00 62.25  ? 77  GLU A C   1 
ATOM   550   O O   . GLU A  1 77  ? 2.580   -39.677 10.935  1.00 63.02  ? 77  GLU A O   1 
ATOM   551   C CB  . GLU A  1 77  ? 0.326   -38.136 9.463   1.00 55.95  ? 77  GLU A CB  1 
ATOM   552   C CG  . GLU A  1 77  ? -0.972  -37.386 9.264   1.00 68.29  ? 77  GLU A CG  1 
ATOM   553   C CD  . GLU A  1 77  ? -0.923  -36.188 8.332   1.00 84.87  ? 77  GLU A CD  1 
ATOM   554   O OE1 . GLU A  1 77  ? 0.151   -35.919 7.744   1.00 63.45  ? 77  GLU A OE1 1 
ATOM   555   O OE2 . GLU A  1 77  ? -1.974  -35.519 8.190   1.00 80.86  ? 77  GLU A OE2 1 
ATOM   556   N N   . ASN A  1 78  ? 1.449   -41.227 9.755   1.00 58.66  ? 78  ASN A N   1 
ATOM   557   C CA  . ASN A  1 78  ? 2.575   -42.110 9.491   1.00 58.20  ? 78  ASN A CA  1 
ATOM   558   C C   . ASN A  1 78  ? 2.679   -42.036 7.973   1.00 59.86  ? 78  ASN A C   1 
ATOM   559   O O   . ASN A  1 78  ? 1.861   -42.620 7.261   1.00 60.04  ? 78  ASN A O   1 
ATOM   560   C CB  . ASN A  1 78  ? 2.308   -43.523 10.019  1.00 60.98  ? 78  ASN A CB  1 
ATOM   561   C CG  . ASN A  1 78  ? 3.527   -44.410 10.219  1.00 86.81  ? 78  ASN A CG  1 
ATOM   562   O OD1 . ASN A  1 78  ? 4.679   -43.975 10.090  1.00 87.72  ? 78  ASN A OD1 1 
ATOM   563   N ND2 . ASN A  1 78  ? 3.278   -45.688 10.545  1.00 75.00  ? 78  ASN A ND2 1 
ATOM   564   N N   . HIS A  1 79  ? 3.589   -41.164 7.496   1.00 54.28  ? 79  HIS A N   1 
ATOM   565   C CA  . HIS A  1 79  ? 3.828   -40.860 6.090   1.00 52.75  ? 79  HIS A CA  1 
ATOM   566   C C   . HIS A  1 79  ? 4.354   -42.053 5.352   1.00 61.26  ? 79  HIS A C   1 
ATOM   567   O O   . HIS A  1 79  ? 5.227   -42.751 5.876   1.00 64.50  ? 79  HIS A O   1 
ATOM   568   C CB  . HIS A  1 79  ? 4.748   -39.644 5.956   1.00 51.68  ? 79  HIS A CB  1 
ATOM   569   C CG  . HIS A  1 79  ? 4.169   -38.397 6.551   1.00 53.74  ? 79  HIS A CG  1 
ATOM   570   N ND1 . HIS A  1 79  ? 4.950   -37.291 6.795   1.00 54.60  ? 79  HIS A ND1 1 
ATOM   571   C CD2 . HIS A  1 79  ? 2.890   -38.119 6.913   1.00 55.21  ? 79  HIS A CD2 1 
ATOM   572   C CE1 . HIS A  1 79  ? 4.133   -36.384 7.305   1.00 53.02  ? 79  HIS A CE1 1 
ATOM   573   N NE2 . HIS A  1 79  ? 2.883   -36.844 7.393   1.00 53.76  ? 79  HIS A NE2 1 
ATOM   574   N N   . THR A  1 80  ? 3.761   -42.352 4.177   1.00 57.85  ? 80  THR A N   1 
ATOM   575   C CA  . THR A  1 80  ? 4.119   -43.543 3.390   1.00 59.98  ? 80  THR A CA  1 
ATOM   576   C C   . THR A  1 80  ? 4.918   -43.172 2.136   1.00 63.04  ? 80  THR A C   1 
ATOM   577   O O   . THR A  1 80  ? 5.776   -43.950 1.699   1.00 65.40  ? 80  THR A O   1 
ATOM   578   C CB  . THR A  1 80  ? 2.883   -44.397 3.105   1.00 66.85  ? 80  THR A CB  1 
ATOM   579   O OG1 . THR A  1 80  ? 1.981   -43.639 2.308   1.00 70.51  ? 80  THR A OG1 1 
ATOM   580   C CG2 . THR A  1 80  ? 2.173   -44.844 4.385   1.00 63.30  ? 80  THR A CG2 1 
ATOM   581   N N   . ALA A  1 81  ? 4.663   -41.973 1.588   1.00 55.51  ? 81  ALA A N   1 
ATOM   582   C CA  . ALA A  1 81  ? 5.369   -41.439 0.428   1.00 55.04  ? 81  ALA A CA  1 
ATOM   583   C C   . ALA A  1 81  ? 5.627   -39.925 0.601   1.00 59.03  ? 81  ALA A C   1 
ATOM   584   O O   . ALA A  1 81  ? 4.910   -39.270 1.356   1.00 56.41  ? 81  ALA A O   1 
ATOM   585   C CB  . ALA A  1 81  ? 4.580   -41.725 -0.839  1.00 56.67  ? 81  ALA A CB  1 
ATOM   586   N N   . CYS A  1 82  ? 6.686   -39.394 -0.046  1.00 58.54  ? 82  CYS A N   1 
ATOM   587   C CA  . CYS A  1 82  ? 7.098   -37.979 -0.003  1.00 57.09  ? 82  CYS A CA  1 
ATOM   588   C C   . CYS A  1 82  ? 7.346   -37.452 -1.390  1.00 61.31  ? 82  CYS A C   1 
ATOM   589   O O   . CYS A  1 82  ? 7.761   -38.195 -2.279  1.00 63.82  ? 82  CYS A O   1 
ATOM   590   C CB  . CYS A  1 82  ? 8.349   -37.783 0.851   1.00 59.06  ? 82  CYS A CB  1 
ATOM   591   S SG  . CYS A  1 82  ? 8.255   -38.486 2.510   1.00 64.68  ? 82  CYS A SG  1 
ATOM   592   N N   . HIS A  1 83  ? 7.204   -36.138 -1.544  1.00 56.43  ? 83  HIS A N   1 
ATOM   593   C CA  . HIS A  1 83  ? 7.493   -35.417 -2.772  1.00 57.08  ? 83  HIS A CA  1 
ATOM   594   C C   . HIS A  1 83  ? 7.560   -33.968 -2.490  1.00 56.96  ? 83  HIS A C   1 
ATOM   595   O O   . HIS A  1 83  ? 7.020   -33.513 -1.484  1.00 52.98  ? 83  HIS A O   1 
ATOM   596   C CB  . HIS A  1 83  ? 6.500   -35.724 -3.928  1.00 59.88  ? 83  HIS A CB  1 
ATOM   597   C CG  . HIS A  1 83  ? 5.085   -35.269 -3.746  1.00 62.19  ? 83  HIS A CG  1 
ATOM   598   N ND1 . HIS A  1 83  ? 4.576   -34.913 -2.501  1.00 62.54  ? 83  HIS A ND1 1 
ATOM   599   C CD2 . HIS A  1 83  ? 4.095   -35.184 -4.662  1.00 65.44  ? 83  HIS A CD2 1 
ATOM   600   C CE1 . HIS A  1 83  ? 3.302   -34.612 -2.705  1.00 61.79  ? 83  HIS A CE1 1 
ATOM   601   N NE2 . HIS A  1 83  ? 2.963   -34.771 -3.986  1.00 63.98  ? 83  HIS A NE2 1 
ATOM   602   N N   . CYS A  1 84  ? 8.243   -33.240 -3.374  1.00 55.88  ? 84  CYS A N   1 
ATOM   603   C CA  . CYS A  1 84  ? 8.334   -31.799 -3.309  1.00 54.35  ? 84  CYS A CA  1 
ATOM   604   C C   . CYS A  1 84  ? 7.106   -31.289 -4.030  1.00 53.71  ? 84  CYS A C   1 
ATOM   605   O O   . CYS A  1 84  ? 6.913   -31.548 -5.222  1.00 53.82  ? 84  CYS A O   1 
ATOM   606   C CB  . CYS A  1 84  ? 9.628   -31.298 -3.938  1.00 57.79  ? 84  CYS A CB  1 
ATOM   607   S SG  . CYS A  1 84  ? 11.125  -31.835 -3.062  1.00 64.74  ? 84  CYS A SG  1 
ATOM   608   N N   . SER A  1 85  ? 6.220   -30.661 -3.267  1.00 47.49  ? 85  SER A N   1 
ATOM   609   C CA  . SER A  1 85  ? 4.961   -30.151 -3.777  1.00 46.56  ? 85  SER A CA  1 
ATOM   610   C C   . SER A  1 85  ? 4.689   -28.711 -3.334  1.00 48.44  ? 85  SER A C   1 
ATOM   611   O O   . SER A  1 85  ? 5.627   -27.964 -3.031  1.00 47.66  ? 85  SER A O   1 
ATOM   612   C CB  . SER A  1 85  ? 3.820   -31.094 -3.417  1.00 50.58  ? 85  SER A CB  1 
ATOM   613   O OG  . SER A  1 85  ? 2.685   -30.862 -4.234  1.00 64.73  ? 85  SER A OG  1 
ATOM   614   N N   . THR A  1 86  ? 3.418   -28.312 -3.337  1.00 43.43  ? 86  THR A N   1 
ATOM   615   C CA  . THR A  1 86  ? 2.991   -26.958 -3.035  1.00 42.22  ? 86  THR A CA  1 
ATOM   616   C C   . THR A  1 86  ? 3.272   -26.554 -1.565  1.00 46.59  ? 86  THR A C   1 
ATOM   617   O O   . THR A  1 86  ? 3.022   -27.304 -0.611  1.00 45.76  ? 86  THR A O   1 
ATOM   618   C CB  . THR A  1 86  ? 1.522   -26.809 -3.477  1.00 47.96  ? 86  THR A CB  1 
ATOM   619   O OG1 . THR A  1 86  ? 1.396   -27.321 -4.812  1.00 45.90  ? 86  THR A OG1 1 
ATOM   620   C CG2 . THR A  1 86  ? 1.016   -25.372 -3.424  1.00 43.40  ? 86  THR A CG2 1 
ATOM   621   N N   . CYS A  1 87  ? 3.812   -25.346 -1.416  1.00 45.24  ? 87  CYS A N   1 
ATOM   622   C CA  . CYS A  1 87  ? 4.095   -24.727 -0.124  1.00 45.75  ? 87  CYS A CA  1 
ATOM   623   C C   . CYS A  1 87  ? 2.887   -23.968 0.319   1.00 50.19  ? 87  CYS A C   1 
ATOM   624   O O   . CYS A  1 87  ? 2.417   -23.072 -0.405  1.00 50.11  ? 87  CYS A O   1 
ATOM   625   C CB  . CYS A  1 87  ? 5.296   -23.806 -0.225  1.00 46.42  ? 87  CYS A CB  1 
ATOM   626   S SG  . CYS A  1 87  ? 6.806   -24.645 -0.718  1.00 51.49  ? 87  CYS A SG  1 
ATOM   627   N N   . TYR A  1 88  ? 2.369   -24.326 1.500   1.00 46.46  ? 88  TYR A N   1 
ATOM   628   C CA  . TYR A  1 88  ? 1.188   -23.659 2.018   1.00 46.39  ? 88  TYR A CA  1 
ATOM   629   C C   . TYR A  1 88  ? 1.544   -22.573 3.066   1.00 50.41  ? 88  TYR A C   1 
ATOM   630   O O   . TYR A  1 88  ? 0.867   -21.543 3.127   1.00 51.36  ? 88  TYR A O   1 
ATOM   631   C CB  . TYR A  1 88  ? 0.173   -24.679 2.570   1.00 48.10  ? 88  TYR A CB  1 
ATOM   632   C CG  . TYR A  1 88  ? -0.419  -25.708 1.608   1.00 50.07  ? 88  TYR A CG  1 
ATOM   633   C CD1 . TYR A  1 88  ? -0.233  -25.603 0.229   1.00 51.88  ? 88  TYR A CD1 1 
ATOM   634   C CD2 . TYR A  1 88  ? -1.207  -26.761 2.079   1.00 51.52  ? 88  TYR A CD2 1 
ATOM   635   C CE1 . TYR A  1 88  ? -0.766  -26.553 -0.648  1.00 54.42  ? 88  TYR A CE1 1 
ATOM   636   C CE2 . TYR A  1 88  ? -1.762  -27.702 1.210   1.00 52.89  ? 88  TYR A CE2 1 
ATOM   637   C CZ  . TYR A  1 88  ? -1.542  -27.594 -0.154  1.00 63.02  ? 88  TYR A CZ  1 
ATOM   638   O OH  . TYR A  1 88  ? -2.100  -28.518 -1.016  1.00 67.88  ? 88  TYR A OH  1 
ATOM   639   N N   . TYR A  1 89  ? 2.646   -22.771 3.822   1.00 44.74  ? 89  TYR A N   1 
ATOM   640   C CA  . TYR A  1 89  ? 3.055   -21.921 4.944   1.00 44.23  ? 89  TYR A CA  1 
ATOM   641   C C   . TYR A  1 89  ? 4.424   -21.271 4.806   1.00 46.84  ? 89  TYR A C   1 
ATOM   642   O O   . TYR A  1 89  ? 5.155   -21.120 5.797   1.00 46.84  ? 89  TYR A O   1 
ATOM   643   C CB  . TYR A  1 89  ? 2.981   -22.731 6.252   1.00 46.00  ? 89  TYR A CB  1 
ATOM   644   C CG  . TYR A  1 89  ? 1.869   -23.755 6.281   1.00 46.25  ? 89  TYR A CG  1 
ATOM   645   C CD1 . TYR A  1 89  ? 0.579   -23.402 6.666   1.00 48.48  ? 89  TYR A CD1 1 
ATOM   646   C CD2 . TYR A  1 89  ? 2.102   -25.073 5.904   1.00 46.67  ? 89  TYR A CD2 1 
ATOM   647   C CE1 . TYR A  1 89  ? -0.453  -24.336 6.677   1.00 50.14  ? 89  TYR A CE1 1 
ATOM   648   C CE2 . TYR A  1 89  ? 1.079   -26.017 5.911   1.00 48.45  ? 89  TYR A CE2 1 
ATOM   649   C CZ  . TYR A  1 89  ? -0.195  -25.647 6.307   1.00 59.03  ? 89  TYR A CZ  1 
ATOM   650   O OH  . TYR A  1 89  ? -1.192  -26.590 6.314   1.00 64.78  ? 89  TYR A OH  1 
ATOM   651   N N   . HIS A  1 90  ? 4.752   -20.833 3.589   1.00 42.36  ? 90  HIS A N   1 
ATOM   652   C CA  . HIS A  1 90  ? 6.017   -20.155 3.292   1.00 41.49  ? 90  HIS A CA  1 
ATOM   653   C C   . HIS A  1 90  ? 5.871   -18.623 3.191   1.00 44.31  ? 90  HIS A C   1 
ATOM   654   O O   . HIS A  1 90  ? 6.882   -17.935 3.238   1.00 44.28  ? 90  HIS A O   1 
ATOM   655   C CB  . HIS A  1 90  ? 6.651   -20.744 2.023   1.00 41.32  ? 90  HIS A CB  1 
ATOM   656   C CG  . HIS A  1 90  ? 5.841   -20.504 0.787   1.00 44.79  ? 90  HIS A CG  1 
ATOM   657   N ND1 . HIS A  1 90  ? 4.451   -20.657 0.776   1.00 46.79  ? 90  HIS A ND1 1 
ATOM   658   C CD2 . HIS A  1 90  ? 6.250   -20.151 -0.453  1.00 47.49  ? 90  HIS A CD2 1 
ATOM   659   C CE1 . HIS A  1 90  ? 4.071   -20.369 -0.458  1.00 46.63  ? 90  HIS A CE1 1 
ATOM   660   N NE2 . HIS A  1 90  ? 5.119   -20.073 -1.238  1.00 47.29  ? 90  HIS A NE2 1 
ATOM   661   N N   . LYS A  1 91  ? 4.629   -18.093 3.044   1.00 40.47  ? 91  LYS A N   1 
ATOM   662   C CA  . LYS A  1 91  ? 4.386   -16.650 2.913   1.00 41.25  ? 91  LYS A CA  1 
ATOM   663   C C   . LYS A  1 91  ? 4.255   -15.940 4.282   1.00 47.11  ? 91  LYS A C   1 
ATOM   664   O O   . LYS A  1 91  ? 3.927   -16.575 5.287   1.00 46.62  ? 91  LYS A O   1 
ATOM   665   C CB  . LYS A  1 91  ? 3.195   -16.281 1.968   1.00 43.52  ? 91  LYS A CB  1 
ATOM   666   C CG  . LYS A  1 91  ? 2.552   -17.380 1.103   1.00 54.50  ? 91  LYS A CG  1 
ATOM   667   C CD  . LYS A  1 91  ? 1.073   -17.018 0.798   1.00 59.73  ? 91  LYS A CD  1 
ATOM   668   C CE  . LYS A  1 91  ? 0.300   -18.006 -0.054  1.00 59.79  ? 91  LYS A CE  1 
ATOM   669   N NZ  . LYS A  1 91  ? 0.647   -17.948 -1.506  1.00 60.24  ? 91  LYS A NZ  1 
ATOM   670   N N   . SER A  1 92  ? 4.515   -14.612 4.296   1.00 45.72  ? 92  SER A N   1 
ATOM   671   C CA  . SER A  1 92  ? 4.481   -13.725 5.464   1.00 74.33  ? 92  SER A CA  1 
ATOM   672   C C   . SER A  1 92  ? 3.065   -13.221 5.770   1.00 109.38 ? 92  SER A C   1 
ATOM   673   O O   . SER A  1 92  ? 2.379   -13.743 6.650   1.00 72.98  ? 92  SER A O   1 
ATOM   674   C CB  . SER A  1 92  ? 5.428   -12.542 5.255   1.00 78.53  ? 92  SER A CB  1 
ATOM   675   O OG  . SER A  1 92  ? 5.008   -11.675 4.210   1.00 84.50  ? 92  SER A OG  1 
ATOM   676   N N   . ASN B  2 1   ? 19.282  -25.123 2.946   1.00 88.13  ? 1   ASN B N   1 
ATOM   677   C CA  . ASN B  2 1   ? 20.704  -24.903 3.197   1.00 92.97  ? 1   ASN B CA  1 
ATOM   678   C C   . ASN B  2 1   ? 21.423  -24.275 2.001   1.00 96.74  ? 1   ASN B C   1 
ATOM   679   O O   . ASN B  2 1   ? 22.013  -23.201 2.151   1.00 98.88  ? 1   ASN B O   1 
ATOM   680   C CB  . ASN B  2 1   ? 21.439  -26.206 3.636   1.00 99.88  ? 1   ASN B CB  1 
ATOM   681   C CG  . ASN B  2 1   ? 20.779  -27.032 4.731   1.00 125.77 ? 1   ASN B CG  1 
ATOM   682   O OD1 . ASN B  2 1   ? 19.691  -26.712 5.248   1.00 118.84 ? 1   ASN B OD1 1 
ATOM   683   N ND2 . ASN B  2 1   ? 21.414  -28.149 5.084   1.00 116.90 ? 1   ASN B ND2 1 
ATOM   684   N N   . SER B  2 2   ? 21.376  -24.934 0.820   1.00 90.02  ? 2   SER B N   1 
ATOM   685   C CA  . SER B  2 2   ? 22.107  -24.490 -0.370  1.00 89.63  ? 2   SER B CA  1 
ATOM   686   C C   . SER B  2 2   ? 21.429  -23.343 -1.177  1.00 86.72  ? 2   SER B C   1 
ATOM   687   O O   . SER B  2 2   ? 21.443  -23.358 -2.411  1.00 86.23  ? 2   SER B O   1 
ATOM   688   C CB  . SER B  2 2   ? 22.454  -25.677 -1.267  1.00 94.22  ? 2   SER B CB  1 
ATOM   689   O OG  . SER B  2 2   ? 21.318  -26.325 -1.809  1.00 94.79  ? 2   SER B OG  1 
ATOM   690   N N   . CYS B  2 3   ? 20.933  -22.307 -0.479  1.00 78.37  ? 3   CYS B N   1 
ATOM   691   C CA  . CYS B  2 3   ? 20.356  -21.123 -1.123  1.00 73.96  ? 3   CYS B CA  1 
ATOM   692   C C   . CYS B  2 3   ? 21.470  -20.059 -1.296  1.00 81.78  ? 3   CYS B C   1 
ATOM   693   O O   . CYS B  2 3   ? 22.049  -19.593 -0.299  1.00 83.15  ? 3   CYS B O   1 
ATOM   694   C CB  . CYS B  2 3   ? 19.182  -20.579 -0.313  1.00 69.52  ? 3   CYS B CB  1 
ATOM   695   S SG  . CYS B  2 3   ? 18.469  -19.047 -0.965  1.00 69.31  ? 3   CYS B SG  1 
ATOM   696   N N   . GLU B  2 4   ? 21.772  -19.683 -2.556  1.00 78.88  ? 4   GLU B N   1 
ATOM   697   C CA  . GLU B  2 4   ? 22.815  -18.691 -2.800  1.00 81.83  ? 4   GLU B CA  1 
ATOM   698   C C   . GLU B  2 4   ? 22.564  -17.797 -4.025  1.00 81.68  ? 4   GLU B C   1 
ATOM   699   O O   . GLU B  2 4   ? 21.658  -18.052 -4.832  1.00 76.89  ? 4   GLU B O   1 
ATOM   700   C CB  . GLU B  2 4   ? 24.227  -19.337 -2.858  1.00 89.36  ? 4   GLU B CB  1 
ATOM   701   C CG  . GLU B  2 4   ? 24.308  -20.631 -3.653  1.00 103.10 ? 4   GLU B CG  1 
ATOM   702   C CD  . GLU B  2 4   ? 25.397  -21.568 -3.178  1.00 130.57 ? 4   GLU B CD  1 
ATOM   703   O OE1 . GLU B  2 4   ? 26.328  -21.848 -3.968  1.00 139.65 ? 4   GLU B OE1 1 
ATOM   704   O OE2 . GLU B  2 4   ? 25.327  -22.011 -2.009  1.00 119.79 ? 4   GLU B OE2 1 
ATOM   705   N N   . LEU B  2 5   ? 23.388  -16.722 -4.125  1.00 79.56  ? 5   LEU B N   1 
ATOM   706   C CA  . LEU B  2 5   ? 23.342  -15.745 -5.203  1.00 77.71  ? 5   LEU B CA  1 
ATOM   707   C C   . LEU B  2 5   ? 23.820  -16.395 -6.497  1.00 81.93  ? 5   LEU B C   1 
ATOM   708   O O   . LEU B  2 5   ? 25.002  -16.699 -6.648  1.00 86.69  ? 5   LEU B O   1 
ATOM   709   C CB  . LEU B  2 5   ? 24.174  -14.491 -4.858  1.00 79.93  ? 5   LEU B CB  1 
ATOM   710   C CG  . LEU B  2 5   ? 23.593  -13.537 -3.803  1.00 82.77  ? 5   LEU B CG  1 
ATOM   711   C CD1 . LEU B  2 5   ? 24.689  -12.909 -2.975  1.00 86.95  ? 5   LEU B CD1 1 
ATOM   712   C CD2 . LEU B  2 5   ? 22.722  -12.452 -4.439  1.00 81.66  ? 5   LEU B CD2 1 
ATOM   713   N N   . THR B  2 6   ? 22.879  -16.679 -7.390  1.00 73.81  ? 6   THR B N   1 
ATOM   714   C CA  . THR B  2 6   ? 23.161  -17.283 -8.682  1.00 74.67  ? 6   THR B CA  1 
ATOM   715   C C   . THR B  2 6   ? 22.979  -16.229 -9.771  1.00 77.16  ? 6   THR B C   1 
ATOM   716   O O   . THR B  2 6   ? 22.170  -15.304 -9.627  1.00 72.11  ? 6   THR B O   1 
ATOM   717   C CB  . THR B  2 6   ? 22.316  -18.561 -8.917  1.00 79.70  ? 6   THR B CB  1 
ATOM   718   O OG1 . THR B  2 6   ? 20.944  -18.227 -9.113  1.00 74.65  ? 6   THR B OG1 1 
ATOM   719   C CG2 . THR B  2 6   ? 22.437  -19.578 -7.784  1.00 79.90  ? 6   THR B CG2 1 
ATOM   720   N N   . ASN B  2 7   ? 23.766  -16.355 -10.844 1.00 78.69  ? 7   ASN B N   1 
ATOM   721   C CA  . ASN B  2 7   ? 23.700  -15.469 -11.999 1.00 78.46  ? 7   ASN B CA  1 
ATOM   722   C C   . ASN B  2 7   ? 22.548  -15.920 -12.876 1.00 79.33  ? 7   ASN B C   1 
ATOM   723   O O   . ASN B  2 7   ? 22.416  -17.114 -13.164 1.00 81.13  ? 7   ASN B O   1 
ATOM   724   C CB  . ASN B  2 7   ? 25.001  -15.517 -12.786 1.00 83.90  ? 7   ASN B CB  1 
ATOM   725   C CG  . ASN B  2 7   ? 25.996  -14.483 -12.360 1.00 121.13 ? 7   ASN B CG  1 
ATOM   726   O OD1 . ASN B  2 7   ? 25.748  -13.266 -12.428 1.00 113.08 ? 7   ASN B OD1 1 
ATOM   727   N ND2 . ASN B  2 7   ? 27.150  -14.980 -11.936 1.00 127.33 ? 7   ASN B ND2 1 
ATOM   728   N N   . ILE B  2 8   ? 21.691  -14.983 -13.269 1.00 71.18  ? 8   ILE B N   1 
ATOM   729   C CA  . ILE B  2 8   ? 20.542  -15.298 -14.113 1.00 68.75  ? 8   ILE B CA  1 
ATOM   730   C C   . ILE B  2 8   ? 20.444  -14.307 -15.271 1.00 72.99  ? 8   ILE B C   1 
ATOM   731   O O   . ILE B  2 8   ? 21.058  -13.247 -15.226 1.00 71.37  ? 8   ILE B O   1 
ATOM   732   C CB  . ILE B  2 8   ? 19.209  -15.427 -13.306 1.00 67.63  ? 8   ILE B CB  1 
ATOM   733   C CG1 . ILE B  2 8   ? 18.724  -14.076 -12.740 1.00 65.51  ? 8   ILE B CG1 1 
ATOM   734   C CG2 . ILE B  2 8   ? 19.301  -16.493 -12.210 1.00 67.97  ? 8   ILE B CG2 1 
ATOM   735   C CD1 . ILE B  2 8   ? 17.264  -13.997 -12.555 1.00 70.78  ? 8   ILE B CD1 1 
ATOM   736   N N   . THR B  2 9   ? 19.680  -14.670 -16.309 1.00 71.15  ? 9   THR B N   1 
ATOM   737   C CA  . THR B  2 9   ? 19.428  -13.843 -17.487 1.00 71.54  ? 9   THR B CA  1 
ATOM   738   C C   . THR B  2 9   ? 17.948  -13.508 -17.453 1.00 71.95  ? 9   THR B C   1 
ATOM   739   O O   . THR B  2 9   ? 17.131  -14.425 -17.359 1.00 71.64  ? 9   THR B O   1 
ATOM   740   C CB  . THR B  2 9   ? 19.835  -14.618 -18.751 1.00 79.46  ? 9   THR B CB  1 
ATOM   741   O OG1 . THR B  2 9   ? 21.259  -14.683 -18.798 1.00 81.36  ? 9   THR B OG1 1 
ATOM   742   C CG2 . THR B  2 9   ? 19.300  -13.994 -20.032 1.00 77.67  ? 9   THR B CG2 1 
ATOM   743   N N   . ILE B  2 10  ? 17.594  -12.216 -17.499 1.00 66.13  ? 10  ILE B N   1 
ATOM   744   C CA  . ILE B  2 10  ? 16.176  -11.821 -17.474 1.00 63.15  ? 10  ILE B CA  1 
ATOM   745   C C   . ILE B  2 10  ? 15.746  -11.141 -18.765 1.00 68.45  ? 10  ILE B C   1 
ATOM   746   O O   . ILE B  2 10  ? 16.575  -10.613 -19.521 1.00 69.52  ? 10  ILE B O   1 
ATOM   747   C CB  . ILE B  2 10  ? 15.726  -11.001 -16.227 1.00 62.72  ? 10  ILE B CB  1 
ATOM   748   C CG1 . ILE B  2 10  ? 16.607  -9.738  -15.983 1.00 62.68  ? 10  ILE B CG1 1 
ATOM   749   C CG2 . ILE B  2 10  ? 15.632  -11.879 -14.998 1.00 61.17  ? 10  ILE B CG2 1 
ATOM   750   C CD1 . ILE B  2 10  ? 15.837  -8.486  -15.862 1.00 53.90  ? 10  ILE B CD1 1 
ATOM   751   N N   . ALA B  2 11  ? 14.426  -11.161 -18.994 1.00 64.43  ? 11  ALA B N   1 
ATOM   752   C CA  . ALA B  2 11  ? 13.784  -10.572 -20.155 1.00 66.84  ? 11  ALA B CA  1 
ATOM   753   C C   . ALA B  2 11  ? 13.071  -9.281  -19.789 1.00 70.91  ? 11  ALA B C   1 
ATOM   754   O O   . ALA B  2 11  ? 12.228  -9.263  -18.880 1.00 69.03  ? 11  ALA B O   1 
ATOM   755   C CB  . ALA B  2 11  ? 12.793  -11.563 -20.755 1.00 68.76  ? 11  ALA B CB  1 
ATOM   756   N N   . ILE B  2 12  ? 13.423  -8.193  -20.484 1.00 69.42  ? 12  ILE B N   1 
ATOM   757   C CA  . ILE B  2 12  ? 12.756  -6.904  -20.321 1.00 68.86  ? 12  ILE B CA  1 
ATOM   758   C C   . ILE B  2 12  ? 12.006  -6.681  -21.643 1.00 77.73  ? 12  ILE B C   1 
ATOM   759   O O   . ILE B  2 12  ? 12.624  -6.567  -22.710 1.00 79.79  ? 12  ILE B O   1 
ATOM   760   C CB  . ILE B  2 12  ? 13.698  -5.759  -19.891 1.00 71.35  ? 12  ILE B CB  1 
ATOM   761   C CG1 . ILE B  2 12  ? 14.347  -6.069  -18.539 1.00 68.54  ? 12  ILE B CG1 1 
ATOM   762   C CG2 . ILE B  2 12  ? 12.935  -4.450  -19.819 1.00 73.07  ? 12  ILE B CG2 1 
ATOM   763   C CD1 . ILE B  2 12  ? 15.758  -5.633  -18.448 1.00 80.74  ? 12  ILE B CD1 1 
ATOM   764   N N   . GLU B  2 13  ? 10.664  -6.709  -21.555 1.00 75.40  ? 13  GLU B N   1 
ATOM   765   C CA  . GLU B  2 13  ? 9.705   -6.662  -22.658 1.00 78.66  ? 13  GLU B CA  1 
ATOM   766   C C   . GLU B  2 13  ? 9.190   -5.253  -23.037 1.00 84.87  ? 13  GLU B C   1 
ATOM   767   O O   . GLU B  2 13  ? 8.392   -4.660  -22.308 1.00 82.51  ? 13  GLU B O   1 
ATOM   768   C CB  . GLU B  2 13  ? 8.532   -7.601  -22.306 1.00 79.13  ? 13  GLU B CB  1 
ATOM   769   C CG  . GLU B  2 13  ? 7.574   -7.943  -23.433 1.00 94.26  ? 13  GLU B CG  1 
ATOM   770   C CD  . GLU B  2 13  ? 6.667   -9.121  -23.121 1.00 112.79 ? 13  GLU B CD  1 
ATOM   771   O OE1 . GLU B  2 13  ? 7.182   -10.257 -22.992 1.00 105.18 ? 13  GLU B OE1 1 
ATOM   772   O OE2 . GLU B  2 13  ? 5.436   -8.913  -23.020 1.00 102.80 ? 13  GLU B OE2 1 
ATOM   773   N N   . LYS B  2 14  ? 9.616   -4.750  -24.211 1.00 86.04  ? 14  LYS B N   1 
ATOM   774   C CA  . LYS B  2 14  ? 9.110   -3.489  -24.743 1.00 89.42  ? 14  LYS B CA  1 
ATOM   775   C C   . LYS B  2 14  ? 7.916   -3.883  -25.621 1.00 98.69  ? 14  LYS B C   1 
ATOM   776   O O   . LYS B  2 14  ? 8.088   -4.177  -26.808 1.00 101.99 ? 14  LYS B O   1 
ATOM   777   C CB  . LYS B  2 14  ? 10.183  -2.728  -25.542 1.00 93.92  ? 14  LYS B CB  1 
ATOM   778   C CG  . LYS B  2 14  ? 10.274  -1.256  -25.157 1.00 104.04 ? 14  LYS B CG  1 
ATOM   779   C CD  . LYS B  2 14  ? 10.118  -0.324  -26.344 1.00 115.42 ? 14  LYS B CD  1 
ATOM   780   C CE  . LYS B  2 14  ? 10.035  1.127   -25.927 1.00 125.08 ? 14  LYS B CE  1 
ATOM   781   N NZ  . LYS B  2 14  ? 11.373  1.704   -25.631 1.00 132.55 ? 14  LYS B NZ  1 
ATOM   782   N N   . GLU B  2 15  ? 6.717   -3.974  -24.994 1.00 95.49  ? 15  GLU B N   1 
ATOM   783   C CA  . GLU B  2 15  ? 5.433   -4.372  -25.599 1.00 98.94  ? 15  GLU B CA  1 
ATOM   784   C C   . GLU B  2 15  ? 5.143   -3.684  -26.954 1.00 108.05 ? 15  GLU B C   1 
ATOM   785   O O   . GLU B  2 15  ? 4.710   -4.339  -27.909 1.00 110.76 ? 15  GLU B O   1 
ATOM   786   C CB  . GLU B  2 15  ? 4.283   -4.110  -24.601 1.00 99.43  ? 15  GLU B CB  1 
ATOM   787   C CG  . GLU B  2 15  ? 3.057   -4.989  -24.815 1.00 114.00 ? 15  GLU B CG  1 
ATOM   788   C CD  . GLU B  2 15  ? 1.800   -4.607  -24.050 1.00 138.22 ? 15  GLU B CD  1 
ATOM   789   O OE1 . GLU B  2 15  ? 1.909   -4.164  -22.883 1.00 124.19 ? 15  GLU B OE1 1 
ATOM   790   O OE2 . GLU B  2 15  ? 0.696   -4.794  -24.611 1.00 140.85 ? 15  GLU B OE2 1 
ATOM   791   N N   . GLU B  2 16  ? 5.409   -2.367  -27.018 1.00 105.39 ? 16  GLU B N   1 
ATOM   792   C CA  . GLU B  2 16  ? 5.193   -1.496  -28.169 1.00 110.36 ? 16  GLU B CA  1 
ATOM   793   C C   . GLU B  2 16  ? 6.131   -1.765  -29.343 1.00 115.95 ? 16  GLU B C   1 
ATOM   794   O O   . GLU B  2 16  ? 5.775   -1.458  -30.477 1.00 121.05 ? 16  GLU B O   1 
ATOM   795   C CB  . GLU B  2 16  ? 5.235   -0.013  -27.757 1.00 112.44 ? 16  GLU B CB  1 
ATOM   796   C CG  . GLU B  2 16  ? 6.402   0.414   -26.874 1.00 119.07 ? 16  GLU B CG  1 
ATOM   797   C CD  . GLU B  2 16  ? 6.214   0.158   -25.390 1.00 139.72 ? 16  GLU B CD  1 
ATOM   798   O OE1 . GLU B  2 16  ? 5.322   0.790   -24.779 1.00 135.11 ? 16  GLU B OE1 1 
ATOM   799   O OE2 . GLU B  2 16  ? 6.954   -0.687  -24.839 1.00 134.95 ? 16  GLU B OE2 1 
ATOM   800   N N   . CYS B  2 17  ? 7.316   -2.326  -29.084 1.00 108.75 ? 17  CYS B N   1 
ATOM   801   C CA  . CYS B  2 17  ? 8.286   -2.628  -30.134 1.00 110.84 ? 17  CYS B CA  1 
ATOM   802   C C   . CYS B  2 17  ? 8.313   -4.108  -30.527 1.00 113.66 ? 17  CYS B C   1 
ATOM   803   O O   . CYS B  2 17  ? 9.069   -4.493  -31.425 1.00 115.97 ? 17  CYS B O   1 
ATOM   804   C CB  . CYS B  2 17  ? 9.668   -2.113  -29.756 1.00 109.15 ? 17  CYS B CB  1 
ATOM   805   S SG  . CYS B  2 17  ? 9.877   -0.334  -30.009 1.00 116.13 ? 17  CYS B SG  1 
ATOM   806   N N   . ARG B  2 18  ? 7.452   -4.921  -29.876 1.00 106.65 ? 18  ARG B N   1 
ATOM   807   C CA  . ARG B  2 18  ? 7.251   -6.355  -30.105 1.00 106.35 ? 18  ARG B CA  1 
ATOM   808   C C   . ARG B  2 18  ? 8.550   -7.195  -29.979 1.00 106.83 ? 18  ARG B C   1 
ATOM   809   O O   . ARG B  2 18  ? 8.774   -8.127  -30.759 1.00 109.08 ? 18  ARG B O   1 
ATOM   810   C CB  . ARG B  2 18  ? 6.523   -6.613  -31.451 1.00 113.58 ? 18  ARG B CB  1 
ATOM   811   C CG  . ARG B  2 18  ? 5.236   -5.798  -31.691 1.00 128.43 ? 18  ARG B CG  1 
ATOM   812   C CD  . ARG B  2 18  ? 4.040   -6.263  -30.868 1.00 135.18 ? 18  ARG B CD  1 
ATOM   813   N NE  . ARG B  2 18  ? 2.805   -6.241  -31.652 1.00 146.18 ? 18  ARG B NE  1 
ATOM   814   C CZ  . ARG B  2 18  ? 2.283   -7.302  -32.258 1.00 158.95 ? 18  ARG B CZ  1 
ATOM   815   N NH1 . ARG B  2 18  ? 2.869   -8.489  -32.158 1.00 137.88 ? 18  ARG B NH1 1 
ATOM   816   N NH2 . ARG B  2 18  ? 1.165   -7.186  -32.964 1.00 152.56 ? 18  ARG B NH2 1 
ATOM   817   N N   . PHE B  2 19  ? 9.378   -6.879  -28.960 1.00 98.25  ? 19  PHE B N   1 
ATOM   818   C CA  . PHE B  2 19  ? 10.631  -7.580  -28.645 1.00 95.59  ? 19  PHE B CA  1 
ATOM   819   C C   . PHE B  2 19  ? 11.000  -7.480  -27.164 1.00 93.39  ? 19  PHE B C   1 
ATOM   820   O O   . PHE B  2 19  ? 10.410  -6.688  -26.425 1.00 90.16  ? 19  PHE B O   1 
ATOM   821   C CB  . PHE B  2 19  ? 11.808  -7.120  -29.548 1.00 100.56 ? 19  PHE B CB  1 
ATOM   822   C CG  . PHE B  2 19  ? 12.280  -5.673  -29.497 1.00 102.33 ? 19  PHE B CG  1 
ATOM   823   C CD1 . PHE B  2 19  ? 12.844  -5.142  -28.337 1.00 101.46 ? 19  PHE B CD1 1 
ATOM   824   C CD2 . PHE B  2 19  ? 12.287  -4.887  -30.643 1.00 109.25 ? 19  PHE B CD2 1 
ATOM   825   C CE1 . PHE B  2 19  ? 13.309  -3.824  -28.298 1.00 102.51 ? 19  PHE B CE1 1 
ATOM   826   C CE2 . PHE B  2 19  ? 12.781  -3.578  -30.610 1.00 112.68 ? 19  PHE B CE2 1 
ATOM   827   C CZ  . PHE B  2 19  ? 13.277  -3.053  -29.433 1.00 106.45 ? 19  PHE B CZ  1 
ATOM   828   N N   . CYS B  2 20  ? 11.995  -8.268  -26.743 1.00 89.35  ? 20  CYS B N   1 
ATOM   829   C CA  . CYS B  2 20  ? 12.522  -8.259  -25.376 1.00 85.59  ? 20  CYS B CA  1 
ATOM   830   C C   . CYS B  2 20  ? 14.027  -8.067  -25.435 1.00 88.80  ? 20  CYS B C   1 
ATOM   831   O O   . CYS B  2 20  ? 14.632  -8.332  -26.473 1.00 92.23  ? 20  CYS B O   1 
ATOM   832   C CB  . CYS B  2 20  ? 12.166  -9.546  -24.633 1.00 84.22  ? 20  CYS B CB  1 
ATOM   833   S SG  . CYS B  2 20  ? 10.391  -9.904  -24.553 1.00 88.65  ? 20  CYS B SG  1 
ATOM   834   N N   . ILE B  2 21  ? 14.639  -7.622  -24.331 1.00 80.98  ? 21  ILE B N   1 
ATOM   835   C CA  . ILE B  2 21  ? 16.095  -7.487  -24.260 1.00 80.77  ? 21  ILE B CA  1 
ATOM   836   C C   . ILE B  2 21  ? 16.624  -8.325  -23.087 1.00 81.57  ? 21  ILE B C   1 
ATOM   837   O O   . ILE B  2 21  ? 16.031  -8.325  -22.004 1.00 77.83  ? 21  ILE B O   1 
ATOM   838   C CB  . ILE B  2 21  ? 16.657  -6.026  -24.297 1.00 84.13  ? 21  ILE B CB  1 
ATOM   839   C CG1 . ILE B  2 21  ? 16.092  -5.140  -23.178 1.00 81.45  ? 21  ILE B CG1 1 
ATOM   840   C CG2 . ILE B  2 21  ? 16.462  -5.385  -25.674 1.00 87.98  ? 21  ILE B CG2 1 
ATOM   841   C CD1 . ILE B  2 21  ? 16.970  -3.949  -22.846 1.00 89.97  ? 21  ILE B CD1 1 
ATOM   842   N N   . SER B  2 22  ? 17.702  -9.078  -23.331 1.00 79.83  ? 22  SER B N   1 
ATOM   843   C CA  . SER B  2 22  ? 18.317  -9.935  -22.326 1.00 78.40  ? 22  SER B CA  1 
ATOM   844   C C   . SER B  2 22  ? 19.320  -9.176  -21.499 1.00 83.03  ? 22  SER B C   1 
ATOM   845   O O   . SER B  2 22  ? 20.142  -8.443  -22.046 1.00 85.79  ? 22  SER B O   1 
ATOM   846   C CB  . SER B  2 22  ? 18.980  -11.139 -22.978 1.00 84.87  ? 22  SER B CB  1 
ATOM   847   O OG  . SER B  2 22  ? 18.000  -11.911 -23.652 1.00 97.73  ? 22  SER B OG  1 
ATOM   848   N N   . ILE B  2 23  ? 19.242  -9.345  -20.177 1.00 77.43  ? 23  ILE B N   1 
ATOM   849   C CA  . ILE B  2 23  ? 20.141  -8.726  -19.211 1.00 77.37  ? 23  ILE B CA  1 
ATOM   850   C C   . ILE B  2 23  ? 20.551  -9.752  -18.168 1.00 80.93  ? 23  ILE B C   1 
ATOM   851   O O   . ILE B  2 23  ? 19.687  -10.314 -17.486 1.00 77.71  ? 23  ILE B O   1 
ATOM   852   C CB  . ILE B  2 23  ? 19.547  -7.400  -18.615 1.00 78.98  ? 23  ILE B CB  1 
ATOM   853   C CG1 . ILE B  2 23  ? 19.970  -6.198  -19.454 1.00 82.61  ? 23  ILE B CG1 1 
ATOM   854   C CG2 . ILE B  2 23  ? 19.911  -7.148  -17.142 1.00 77.67  ? 23  ILE B CG2 1 
ATOM   855   C CD1 . ILE B  2 23  ? 18.949  -5.733  -20.387 1.00 94.82  ? 23  ILE B CD1 1 
ATOM   856   N N   . ASN B  2 24  ? 21.867  -10.032 -18.080 1.00 81.08  ? 24  ASN B N   1 
ATOM   857   C CA  . ASN B  2 24  ? 22.394  -10.921 -17.054 1.00 81.06  ? 24  ASN B CA  1 
ATOM   858   C C   . ASN B  2 24  ? 22.374  -10.094 -15.763 1.00 82.51  ? 24  ASN B C   1 
ATOM   859   O O   . ASN B  2 24  ? 22.795  -8.928  -15.747 1.00 82.88  ? 24  ASN B O   1 
ATOM   860   C CB  . ASN B  2 24  ? 23.829  -11.372 -17.322 1.00 88.11  ? 24  ASN B CB  1 
ATOM   861   C CG  . ASN B  2 24  ? 24.136  -12.127 -18.586 1.00 139.76 ? 24  ASN B CG  1 
ATOM   862   O OD1 . ASN B  2 24  ? 23.322  -12.899 -19.115 1.00 130.22 ? 24  ASN B OD1 1 
ATOM   863   N ND2 . ASN B  2 24  ? 25.389  -11.896 -19.021 1.00 156.21 ? 24  ASN B ND2 1 
ATOM   864   N N   . THR B  2 25  ? 21.834  -10.694 -14.703 1.00 75.49  ? 25  THR B N   1 
ATOM   865   C CA  . THR B  2 25  ? 21.713  -10.116 -13.374 1.00 72.50  ? 25  THR B CA  1 
ATOM   866   C C   . THR B  2 25  ? 21.993  -11.211 -12.317 1.00 75.59  ? 25  THR B C   1 
ATOM   867   O O   . THR B  2 25  ? 22.384  -12.337 -12.663 1.00 75.73  ? 25  THR B O   1 
ATOM   868   C CB  . THR B  2 25  ? 20.383  -9.354  -13.238 1.00 74.50  ? 25  THR B CB  1 
ATOM   869   O OG1 . THR B  2 25  ? 20.387  -8.620  -12.020 1.00 75.61  ? 25  THR B OG1 1 
ATOM   870   C CG2 . THR B  2 25  ? 19.170  -10.258 -13.280 1.00 71.98  ? 25  THR B CG2 1 
ATOM   871   N N   . THR B  2 26  ? 21.830  -10.860 -11.039 1.00 71.34  ? 26  THR B N   1 
ATOM   872   C CA  . THR B  2 26  ? 22.090  -11.758 -9.924  1.00 71.49  ? 26  THR B CA  1 
ATOM   873   C C   . THR B  2 26  ? 20.812  -11.982 -9.117  1.00 72.94  ? 26  THR B C   1 
ATOM   874   O O   . THR B  2 26  ? 20.237  -11.014 -8.600  1.00 71.26  ? 26  THR B O   1 
ATOM   875   C CB  . THR B  2 26  ? 23.202  -11.174 -9.056  1.00 79.04  ? 26  THR B CB  1 
ATOM   876   O OG1 . THR B  2 26  ? 24.254  -10.707 -9.893  1.00 85.24  ? 26  THR B OG1 1 
ATOM   877   C CG2 . THR B  2 26  ? 23.744  -12.169 -8.062  1.00 78.78  ? 26  THR B CG2 1 
ATOM   878   N N   . TRP B  2 27  ? 20.380  -13.251 -8.996  1.00 68.34  ? 27  TRP B N   1 
ATOM   879   C CA  . TRP B  2 27  ? 19.197  -13.555 -8.208  1.00 65.47  ? 27  TRP B CA  1 
ATOM   880   C C   . TRP B  2 27  ? 19.397  -14.782 -7.322  1.00 69.03  ? 27  TRP B C   1 
ATOM   881   O O   . TRP B  2 27  ? 20.538  -15.208 -7.120  1.00 70.69  ? 27  TRP B O   1 
ATOM   882   C CB  . TRP B  2 27  ? 17.920  -13.620 -9.060  1.00 62.30  ? 27  TRP B CB  1 
ATOM   883   C CG  . TRP B  2 27  ? 17.221  -12.295 -9.064  1.00 62.48  ? 27  TRP B CG  1 
ATOM   884   C CD1 . TRP B  2 27  ? 17.430  -11.263 -9.933  1.00 66.63  ? 27  TRP B CD1 1 
ATOM   885   C CD2 . TRP B  2 27  ? 16.368  -11.781 -8.031  1.00 60.58  ? 27  TRP B CD2 1 
ATOM   886   N NE1 . TRP B  2 27  ? 16.731  -10.149 -9.526  1.00 64.86  ? 27  TRP B NE1 1 
ATOM   887   C CE2 . TRP B  2 27  ? 16.039  -10.452 -8.381  1.00 64.57  ? 27  TRP B CE2 1 
ATOM   888   C CE3 . TRP B  2 27  ? 15.807  -12.330 -6.865  1.00 60.55  ? 27  TRP B CE3 1 
ATOM   889   C CZ2 . TRP B  2 27  ? 15.170  -9.671  -7.609  1.00 62.74  ? 27  TRP B CZ2 1 
ATOM   890   C CZ3 . TRP B  2 27  ? 14.979  -11.541 -6.081  1.00 60.50  ? 27  TRP B CZ3 1 
ATOM   891   C CH2 . TRP B  2 27  ? 14.675  -10.227 -6.451  1.00 61.35  ? 27  TRP B CH2 1 
ATOM   892   N N   . CYS B  2 28  ? 18.294  -15.283 -6.719  1.00 62.54  ? 28  CYS B N   1 
ATOM   893   C CA  . CYS B  2 28  ? 18.307  -16.417 -5.808  1.00 62.45  ? 28  CYS B CA  1 
ATOM   894   C C   . CYS B  2 28  ? 17.778  -17.686 -6.441  1.00 64.68  ? 28  CYS B C   1 
ATOM   895   O O   . CYS B  2 28  ? 16.846  -17.652 -7.258  1.00 62.21  ? 28  CYS B O   1 
ATOM   896   C CB  . CYS B  2 28  ? 17.557  -16.084 -4.525  1.00 61.27  ? 28  CYS B CB  1 
ATOM   897   S SG  . CYS B  2 28  ? 18.137  -14.581 -3.698  1.00 66.88  ? 28  CYS B SG  1 
ATOM   898   N N   . ALA B  2 29  ? 18.391  -18.813 -6.042  1.00 62.31  ? 29  ALA B N   1 
ATOM   899   C CA  . ALA B  2 29  ? 18.068  -20.184 -6.434  1.00 62.45  ? 29  ALA B CA  1 
ATOM   900   C C   . ALA B  2 29  ? 18.835  -21.157 -5.537  1.00 67.63  ? 29  ALA B C   1 
ATOM   901   O O   . ALA B  2 29  ? 19.918  -20.824 -5.039  1.00 70.50  ? 29  ALA B O   1 
ATOM   902   C CB  . ALA B  2 29  ? 18.428  -20.423 -7.892  1.00 65.47  ? 29  ALA B CB  1 
ATOM   903   N N   . GLY B  2 30  ? 18.268  -22.339 -5.334  1.00 61.94  ? 30  GLY B N   1 
ATOM   904   C CA  . GLY B  2 30  ? 18.875  -23.357 -4.496  1.00 63.88  ? 30  GLY B CA  1 
ATOM   905   C C   . GLY B  2 30  ? 17.869  -24.206 -3.762  1.00 67.18  ? 30  GLY B C   1 
ATOM   906   O O   . GLY B  2 30  ? 16.683  -24.254 -4.119  1.00 64.16  ? 30  GLY B O   1 
ATOM   907   N N   . TYR B  2 31  ? 18.349  -24.876 -2.714  1.00 65.99  ? 31  TYR B N   1 
ATOM   908   C CA  . TYR B  2 31  ? 17.546  -25.806 -1.918  1.00 64.97  ? 31  TYR B CA  1 
ATOM   909   C C   . TYR B  2 31  ? 17.380  -25.364 -0.448  1.00 68.38  ? 31  TYR B C   1 
ATOM   910   O O   . TYR B  2 31  ? 18.295  -24.760 0.118   1.00 70.29  ? 31  TYR B O   1 
ATOM   911   C CB  . TYR B  2 31  ? 18.171  -27.225 -2.011  1.00 69.86  ? 31  TYR B CB  1 
ATOM   912   C CG  . TYR B  2 31  ? 18.034  -27.884 -3.370  1.00 70.72  ? 31  TYR B CG  1 
ATOM   913   C CD1 . TYR B  2 31  ? 18.756  -27.423 -4.469  1.00 73.18  ? 31  TYR B CD1 1 
ATOM   914   C CD2 . TYR B  2 31  ? 17.180  -28.968 -3.558  1.00 70.88  ? 31  TYR B CD2 1 
ATOM   915   C CE1 . TYR B  2 31  ? 18.585  -27.983 -5.730  1.00 73.50  ? 31  TYR B CE1 1 
ATOM   916   C CE2 . TYR B  2 31  ? 17.017  -29.549 -4.812  1.00 72.69  ? 31  TYR B CE2 1 
ATOM   917   C CZ  . TYR B  2 31  ? 17.724  -29.053 -5.892  1.00 79.83  ? 31  TYR B CZ  1 
ATOM   918   O OH  . TYR B  2 31  ? 17.557  -29.614 -7.127  1.00 85.01  ? 31  TYR B OH  1 
ATOM   919   N N   . CYS B  2 32  ? 16.207  -25.668 0.154   1.00 62.31  ? 32  CYS B N   1 
ATOM   920   C CA  . CYS B  2 32  ? 15.873  -25.393 1.556   1.00 61.64  ? 32  CYS B CA  1 
ATOM   921   C C   . CYS B  2 32  ? 15.284  -26.662 2.152   1.00 66.40  ? 32  CYS B C   1 
ATOM   922   O O   . CYS B  2 32  ? 14.508  -27.362 1.483   1.00 64.71  ? 32  CYS B O   1 
ATOM   923   C CB  . CYS B  2 32  ? 14.888  -24.232 1.693   1.00 58.57  ? 32  CYS B CB  1 
ATOM   924   S SG  . CYS B  2 32  ? 15.461  -22.656 1.009   1.00 62.52  ? 32  CYS B SG  1 
ATOM   925   N N   . TYR B  2 33  ? 15.586  -26.914 3.435   1.00 65.00  ? 33  TYR B N   1 
ATOM   926   C CA  . TYR B  2 33  ? 15.069  -28.057 4.201   1.00 64.93  ? 33  TYR B CA  1 
ATOM   927   C C   . TYR B  2 33  ? 13.666  -27.743 4.691   1.00 63.71  ? 33  TYR B C   1 
ATOM   928   O O   . TYR B  2 33  ? 13.438  -26.656 5.213   1.00 62.75  ? 33  TYR B O   1 
ATOM   929   C CB  . TYR B  2 33  ? 15.977  -28.328 5.408   1.00 70.01  ? 33  TYR B CB  1 
ATOM   930   C CG  . TYR B  2 33  ? 15.767  -29.669 6.074   1.00 74.18  ? 33  TYR B CG  1 
ATOM   931   C CD1 . TYR B  2 33  ? 16.474  -30.793 5.659   1.00 79.31  ? 33  TYR B CD1 1 
ATOM   932   C CD2 . TYR B  2 33  ? 14.914  -29.801 7.167   1.00 74.31  ? 33  TYR B CD2 1 
ATOM   933   C CE1 . TYR B  2 33  ? 16.312  -32.023 6.288   1.00 81.56  ? 33  TYR B CE1 1 
ATOM   934   C CE2 . TYR B  2 33  ? 14.737  -31.030 7.800   1.00 77.58  ? 33  TYR B CE2 1 
ATOM   935   C CZ  . TYR B  2 33  ? 15.453  -32.136 7.367   1.00 88.63  ? 33  TYR B CZ  1 
ATOM   936   O OH  . TYR B  2 33  ? 15.323  -33.352 8.001   1.00 94.13  ? 33  TYR B OH  1 
ATOM   937   N N   . THR B  2 34  ? 12.727  -28.676 4.508   1.00 58.08  ? 34  THR B N   1 
ATOM   938   C CA  . THR B  2 34  ? 11.346  -28.553 4.990   1.00 54.37  ? 34  THR B CA  1 
ATOM   939   C C   . THR B  2 34  ? 10.951  -29.837 5.723   1.00 57.68  ? 34  THR B C   1 
ATOM   940   O O   . THR B  2 34  ? 11.633  -30.868 5.624   1.00 59.70  ? 34  THR B O   1 
ATOM   941   C CB  . THR B  2 34  ? 10.328  -28.069 3.927   1.00 59.99  ? 34  THR B CB  1 
ATOM   942   O OG1 . THR B  2 34  ? 10.637  -28.592 2.637   1.00 63.20  ? 34  THR B OG1 1 
ATOM   943   C CG2 . THR B  2 34  ? 10.270  -26.554 3.844   1.00 57.14  ? 34  THR B CG2 1 
ATOM   944   N N   . ARG B  2 35  ? 9.895   -29.730 6.535   1.00 50.75  ? 35  ARG B N   1 
ATOM   945   C CA  . ARG B  2 35  ? 9.389   -30.808 7.369   1.00 50.32  ? 35  ARG B CA  1 
ATOM   946   C C   . ARG B  2 35  ? 7.879   -30.766 7.289   1.00 50.99  ? 35  ARG B C   1 
ATOM   947   O O   . ARG B  2 35  ? 7.276   -29.699 7.477   1.00 48.86  ? 35  ARG B O   1 
ATOM   948   C CB  . ARG B  2 35  ? 9.845   -30.575 8.818   1.00 49.69  ? 35  ARG B CB  1 
ATOM   949   C CG  . ARG B  2 35  ? 10.544  -31.753 9.468   1.00 62.71  ? 35  ARG B CG  1 
ATOM   950   C CD  . ARG B  2 35  ? 11.077  -31.386 10.840  1.00 73.41  ? 35  ARG B CD  1 
ATOM   951   N NE  . ARG B  2 35  ? 12.322  -30.616 10.747  1.00 93.27  ? 35  ARG B NE  1 
ATOM   952   C CZ  . ARG B  2 35  ? 13.531  -31.082 11.058  1.00 112.21 ? 35  ARG B CZ  1 
ATOM   953   N NH1 . ARG B  2 35  ? 13.679  -32.322 11.512  1.00 101.79 ? 35  ARG B NH1 1 
ATOM   954   N NH2 . ARG B  2 35  ? 14.599  -30.305 10.933  1.00 97.41  ? 35  ARG B NH2 1 
ATOM   955   N N   . ASP B  2 36  ? 7.269   -31.889 6.935   1.00 48.17  ? 36  ASP B N   1 
ATOM   956   C CA  . ASP B  2 36  ? 5.814   -31.967 6.887   1.00 47.13  ? 36  ASP B CA  1 
ATOM   957   C C   . ASP B  2 36  ? 5.394   -32.545 8.225   1.00 54.16  ? 36  ASP B C   1 
ATOM   958   O O   . ASP B  2 36  ? 5.818   -33.641 8.584   1.00 58.31  ? 36  ASP B O   1 
ATOM   959   C CB  . ASP B  2 36  ? 5.299   -32.795 5.707   1.00 49.27  ? 36  ASP B CB  1 
ATOM   960   C CG  . ASP B  2 36  ? 3.807   -32.675 5.511   1.00 62.28  ? 36  ASP B CG  1 
ATOM   961   O OD1 . ASP B  2 36  ? 3.216   -31.669 5.996   1.00 61.89  ? 36  ASP B OD1 1 
ATOM   962   O OD2 . ASP B  2 36  ? 3.226   -33.563 4.852   1.00 72.68  ? 36  ASP B OD2 1 
ATOM   963   N N   . LEU B  2 37  ? 4.633   -31.779 9.002   1.00 47.49  ? 37  LEU B N   1 
ATOM   964   C CA  . LEU B  2 37  ? 4.303   -32.196 10.350  1.00 47.12  ? 37  LEU B CA  1 
ATOM   965   C C   . LEU B  2 37  ? 3.379   -33.385 10.397  1.00 53.23  ? 37  LEU B C   1 
ATOM   966   O O   . LEU B  2 37  ? 2.429   -33.518 9.626   1.00 50.67  ? 37  LEU B O   1 
ATOM   967   C CB  . LEU B  2 37  ? 3.796   -31.043 11.213  1.00 45.27  ? 37  LEU B CB  1 
ATOM   968   C CG  . LEU B  2 37  ? 4.680   -29.790 11.306  1.00 47.67  ? 37  LEU B CG  1 
ATOM   969   C CD1 . LEU B  2 37  ? 4.350   -29.037 12.523  1.00 48.32  ? 37  LEU B CD1 1 
ATOM   970   C CD2 . LEU B  2 37  ? 6.162   -30.120 11.360  1.00 50.95  ? 37  LEU B CD2 1 
ATOM   971   N N   . VAL B  2 38  ? 3.746   -34.294 11.283  1.00 55.13  ? 38  VAL B N   1 
ATOM   972   C CA  . VAL B  2 38  ? 3.111   -35.575 11.540  1.00 56.74  ? 38  VAL B CA  1 
ATOM   973   C C   . VAL B  2 38  ? 1.907   -35.392 12.464  1.00 60.05  ? 38  VAL B C   1 
ATOM   974   O O   . VAL B  2 38  ? 0.877   -36.003 12.199  1.00 60.49  ? 38  VAL B O   1 
ATOM   975   C CB  . VAL B  2 38  ? 4.223   -36.540 12.037  1.00 64.62  ? 38  VAL B CB  1 
ATOM   976   C CG1 . VAL B  2 38  ? 3.785   -37.436 13.181  1.00 67.40  ? 38  VAL B CG1 1 
ATOM   977   C CG2 . VAL B  2 38  ? 4.800   -37.345 10.886  1.00 65.57  ? 38  VAL B CG2 1 
ATOM   978   N N   . TYR B  2 39  ? 2.010   -34.503 13.490  1.00 57.06  ? 39  TYR B N   1 
ATOM   979   C CA  . TYR B  2 39  ? 0.944   -34.149 14.451  1.00 57.57  ? 39  TYR B CA  1 
ATOM   980   C C   . TYR B  2 39  ? 0.362   -32.774 14.093  1.00 58.55  ? 39  TYR B C   1 
ATOM   981   O O   . TYR B  2 39  ? 1.005   -31.741 14.309  1.00 55.85  ? 39  TYR B O   1 
ATOM   982   C CB  . TYR B  2 39  ? 1.513   -34.155 15.872  1.00 62.33  ? 39  TYR B CB  1 
ATOM   983   C CG  . TYR B  2 39  ? 0.529   -33.875 16.987  1.00 67.03  ? 39  TYR B CG  1 
ATOM   984   C CD1 . TYR B  2 39  ? -0.549  -34.724 17.224  1.00 70.43  ? 39  TYR B CD1 1 
ATOM   985   C CD2 . TYR B  2 39  ? 0.748   -32.838 17.889  1.00 69.27  ? 39  TYR B CD2 1 
ATOM   986   C CE1 . TYR B  2 39  ? -1.413  -34.517 18.300  1.00 73.86  ? 39  TYR B CE1 1 
ATOM   987   C CE2 . TYR B  2 39  ? -0.108  -32.621 18.969  1.00 72.04  ? 39  TYR B CE2 1 
ATOM   988   C CZ  . TYR B  2 39  ? -1.182  -33.467 19.177  1.00 82.50  ? 39  TYR B CZ  1 
ATOM   989   O OH  . TYR B  2 39  ? -2.017  -33.248 20.247  1.00 87.74  ? 39  TYR B OH  1 
ATOM   990   N N   . LYS B  2 40  ? -0.856  -32.773 13.525  1.00 56.04  ? 40  LYS B N   1 
ATOM   991   C CA  . LYS B  2 40  ? -1.531  -31.571 13.002  1.00 54.62  ? 40  LYS B CA  1 
ATOM   992   C C   . LYS B  2 40  ? -2.279  -30.737 14.078  1.00 61.25  ? 40  LYS B C   1 
ATOM   993   O O   . LYS B  2 40  ? -3.492  -30.520 13.965  1.00 61.57  ? 40  LYS B O   1 
ATOM   994   C CB  . LYS B  2 40  ? -2.469  -31.945 11.814  1.00 55.87  ? 40  LYS B CB  1 
ATOM   995   C CG  . LYS B  2 40  ? -1.831  -32.778 10.667  1.00 67.45  ? 40  LYS B CG  1 
ATOM   996   C CD  . LYS B  2 40  ? -0.690  -32.058 9.890   1.00 72.78  ? 40  LYS B CD  1 
ATOM   997   C CE  . LYS B  2 40  ? -0.461  -32.652 8.518   1.00 74.91  ? 40  LYS B CE  1 
ATOM   998   N NZ  . LYS B  2 40  ? 0.609   -31.949 7.767   1.00 79.93  ? 40  LYS B NZ  1 
ATOM   999   N N   . ASP B  2 41  ? -1.541  -30.233 15.095  1.00 59.46  ? 41  ASP B N   1 
ATOM   1000  C CA  . ASP B  2 41  ? -2.108  -29.430 16.188  1.00 61.16  ? 41  ASP B CA  1 
ATOM   1001  C C   . ASP B  2 41  ? -2.323  -27.956 15.765  1.00 63.67  ? 41  ASP B C   1 
ATOM   1002  O O   . ASP B  2 41  ? -1.401  -27.382 15.206  1.00 61.71  ? 41  ASP B O   1 
ATOM   1003  C CB  . ASP B  2 41  ? -1.219  -29.542 17.440  1.00 65.76  ? 41  ASP B CB  1 
ATOM   1004  C CG  . ASP B  2 41  ? -1.219  -28.337 18.369  1.00 81.11  ? 41  ASP B CG  1 
ATOM   1005  O OD1 . ASP B  2 41  ? -2.274  -28.056 18.984  1.00 83.56  ? 41  ASP B OD1 1 
ATOM   1006  O OD2 . ASP B  2 41  ? -0.151  -27.710 18.523  1.00 88.81  ? 41  ASP B OD2 1 
ATOM   1007  N N   . PRO B  2 42  ? -3.483  -27.296 16.040  1.00 60.29  ? 42  PRO B N   1 
ATOM   1008  C CA  . PRO B  2 42  ? -3.654  -25.889 15.606  1.00 59.52  ? 42  PRO B CA  1 
ATOM   1009  C C   . PRO B  2 42  ? -2.548  -24.906 16.016  1.00 66.40  ? 42  PRO B C   1 
ATOM   1010  O O   . PRO B  2 42  ? -2.289  -23.958 15.275  1.00 64.33  ? 42  PRO B O   1 
ATOM   1011  C CB  . PRO B  2 42  ? -5.001  -25.496 16.204  1.00 62.93  ? 42  PRO B CB  1 
ATOM   1012  C CG  . PRO B  2 42  ? -5.722  -26.770 16.337  1.00 67.65  ? 42  PRO B CG  1 
ATOM   1013  C CD  . PRO B  2 42  ? -4.706  -27.802 16.688  1.00 62.91  ? 42  PRO B CD  1 
ATOM   1014  N N   . ALA B  2 43  ? -1.874  -25.144 17.162  1.00 67.78  ? 43  ALA B N   1 
ATOM   1015  C CA  . ALA B  2 43  ? -0.775  -24.294 17.656  1.00 69.98  ? 43  ALA B CA  1 
ATOM   1016  C C   . ALA B  2 43  ? 0.633   -24.789 17.213  1.00 75.63  ? 43  ALA B C   1 
ATOM   1017  O O   . ALA B  2 43  ? 1.642   -24.202 17.597  1.00 76.01  ? 43  ALA B O   1 
ATOM   1018  C CB  . ALA B  2 43  ? -0.856  -24.164 19.173  1.00 74.31  ? 43  ALA B CB  1 
ATOM   1019  N N   . ARG B  2 44  ? 0.679   -25.838 16.371  1.00 73.58  ? 44  ARG B N   1 
ATOM   1020  C CA  . ARG B  2 44  ? 1.893   -26.447 15.831  1.00 74.56  ? 44  ARG B CA  1 
ATOM   1021  C C   . ARG B  2 44  ? 2.717   -25.430 15.036  1.00 80.94  ? 44  ARG B C   1 
ATOM   1022  O O   . ARG B  2 44  ? 2.147   -24.445 14.528  1.00 79.84  ? 44  ARG B O   1 
ATOM   1023  C CB  . ARG B  2 44  ? 1.546   -27.682 14.951  1.00 75.40  ? 44  ARG B CB  1 
ATOM   1024  C CG  . ARG B  2 44  ? 1.212   -27.366 13.477  1.00 87.02  ? 44  ARG B CG  1 
ATOM   1025  C CD  . ARG B  2 44  ? 0.368   -28.414 12.762  1.00 103.59 ? 44  ARG B CD  1 
ATOM   1026  N NE  . ARG B  2 44  ? -0.982  -27.906 12.484  1.00 115.27 ? 44  ARG B NE  1 
ATOM   1027  C CZ  . ARG B  2 44  ? -1.487  -27.700 11.269  1.00 126.23 ? 44  ARG B CZ  1 
ATOM   1028  N NH1 . ARG B  2 44  ? -2.717  -27.218 11.129  1.00 112.19 ? 44  ARG B NH1 1 
ATOM   1029  N NH2 . ARG B  2 44  ? -0.774  -27.989 10.185  1.00 109.25 ? 44  ARG B NH2 1 
ATOM   1030  N N   . PRO B  2 45  ? 4.044   -25.659 14.880  1.00 80.52  ? 45  PRO B N   1 
ATOM   1031  C CA  . PRO B  2 45  ? 4.848   -24.715 14.089  1.00 80.31  ? 45  PRO B CA  1 
ATOM   1032  C C   . PRO B  2 45  ? 4.822   -25.075 12.598  1.00 82.01  ? 45  PRO B C   1 
ATOM   1033  O O   . PRO B  2 45  ? 5.768   -25.670 12.068  1.00 82.69  ? 45  PRO B O   1 
ATOM   1034  C CB  . PRO B  2 45  ? 6.242   -24.825 14.722  1.00 85.13  ? 45  PRO B CB  1 
ATOM   1035  C CG  . PRO B  2 45  ? 6.279   -26.216 15.351  1.00 90.73  ? 45  PRO B CG  1 
ATOM   1036  C CD  . PRO B  2 45  ? 4.878   -26.766 15.403  1.00 84.38  ? 45  PRO B CD  1 
ATOM   1037  N N   . LYS B  2 46  ? 3.704   -24.757 11.928  1.00 75.53  ? 46  LYS B N   1 
ATOM   1038  C CA  . LYS B  2 46  ? 3.556   -25.006 10.490  1.00 72.48  ? 46  LYS B CA  1 
ATOM   1039  C C   . LYS B  2 46  ? 4.278   -23.857 9.745   1.00 74.78  ? 46  LYS B C   1 
ATOM   1040  O O   . LYS B  2 46  ? 3.686   -22.797 9.467   1.00 74.77  ? 46  LYS B O   1 
ATOM   1041  C CB  . LYS B  2 46  ? 2.076   -25.169 10.069  1.00 72.74  ? 46  LYS B CB  1 
ATOM   1042  C CG  . LYS B  2 46  ? 1.056   -24.674 11.089  1.00 81.44  ? 46  LYS B CG  1 
ATOM   1043  C CD  . LYS B  2 46  ? -0.178  -24.124 10.430  1.00 88.54  ? 46  LYS B CD  1 
ATOM   1044  C CE  . LYS B  2 46  ? -0.120  -22.623 10.419  1.00 98.46  ? 46  LYS B CE  1 
ATOM   1045  N NZ  . LYS B  2 46  ? -1.096  -22.062 9.462   1.00 106.50 ? 46  LYS B NZ  1 
ATOM   1046  N N   . ILE B  2 47  ? 5.590   -24.043 9.529   1.00 68.28  ? 47  ILE B N   1 
ATOM   1047  C CA  . ILE B  2 47  ? 6.434   -23.045 8.883   1.00 66.89  ? 47  ILE B CA  1 
ATOM   1048  C C   . ILE B  2 47  ? 7.373   -23.681 7.885   1.00 66.47  ? 47  ILE B C   1 
ATOM   1049  O O   . ILE B  2 47  ? 8.047   -24.673 8.198   1.00 68.55  ? 47  ILE B O   1 
ATOM   1050  C CB  . ILE B  2 47  ? 7.170   -22.118 9.877   1.00 72.82  ? 47  ILE B CB  1 
ATOM   1051  C CG1 . ILE B  2 47  ? 7.498   -22.833 11.229  1.00 77.09  ? 47  ILE B CG1 1 
ATOM   1052  C CG2 . ILE B  2 47  ? 6.372   -20.849 10.097  1.00 72.74  ? 47  ILE B CG2 1 
ATOM   1053  C CD1 . ILE B  2 47  ? 9.010   -23.354 11.414  1.00 88.04  ? 47  ILE B CD1 1 
ATOM   1054  N N   . GLN B  2 48  ? 7.391   -23.117 6.667   1.00 55.88  ? 48  GLN B N   1 
ATOM   1055  C CA  . GLN B  2 48  ? 8.191   -23.603 5.553   1.00 52.96  ? 48  GLN B CA  1 
ATOM   1056  C C   . GLN B  2 48  ? 9.029   -22.468 5.012   1.00 55.11  ? 48  GLN B C   1 
ATOM   1057  O O   . GLN B  2 48  ? 8.516   -21.364 4.848   1.00 55.18  ? 48  GLN B O   1 
ATOM   1058  C CB  . GLN B  2 48  ? 7.289   -24.148 4.443   1.00 51.51  ? 48  GLN B CB  1 
ATOM   1059  C CG  . GLN B  2 48  ? 6.506   -25.382 4.824   1.00 43.47  ? 48  GLN B CG  1 
ATOM   1060  C CD  . GLN B  2 48  ? 5.329   -25.611 3.912   1.00 66.81  ? 48  GLN B CD  1 
ATOM   1061  O OE1 . GLN B  2 48  ? 4.521   -24.710 3.651   1.00 60.11  ? 48  GLN B OE1 1 
ATOM   1062  N NE2 . GLN B  2 48  ? 5.174   -26.846 3.441   1.00 64.87  ? 48  GLN B NE2 1 
ATOM   1063  N N   . LYS B  2 49  ? 10.320  -22.718 4.760   1.00 50.08  ? 49  LYS B N   1 
ATOM   1064  C CA  . LYS B  2 49  ? 11.204  -21.694 4.220   1.00 49.11  ? 49  LYS B CA  1 
ATOM   1065  C C   . LYS B  2 49  ? 11.349  -21.911 2.718   1.00 51.87  ? 49  LYS B C   1 
ATOM   1066  O O   . LYS B  2 49  ? 11.199  -23.037 2.239   1.00 53.50  ? 49  LYS B O   1 
ATOM   1067  C CB  . LYS B  2 49  ? 12.591  -21.753 4.905   1.00 53.60  ? 49  LYS B CB  1 
ATOM   1068  C CG  . LYS B  2 49  ? 12.621  -21.145 6.290   1.00 54.75  ? 49  LYS B CG  1 
ATOM   1069  C CD  . LYS B  2 49  ? 13.829  -21.603 7.078   1.00 65.70  ? 49  LYS B CD  1 
ATOM   1070  C CE  . LYS B  2 49  ? 13.855  -20.994 8.468   1.00 75.70  ? 49  LYS B CE  1 
ATOM   1071  N NZ  . LYS B  2 49  ? 15.133  -21.270 9.178   1.00 83.40  ? 49  LYS B NZ  1 
ATOM   1072  N N   . THR B  2 50  ? 11.658  -20.846 1.985   1.00 45.62  ? 50  THR B N   1 
ATOM   1073  C CA  . THR B  2 50  ? 11.945  -20.884 0.555   1.00 44.59  ? 50  THR B CA  1 
ATOM   1074  C C   . THR B  2 50  ? 13.253  -20.103 0.289   1.00 49.12  ? 50  THR B C   1 
ATOM   1075  O O   . THR B  2 50  ? 13.675  -19.302 1.124   1.00 45.78  ? 50  THR B O   1 
ATOM   1076  C CB  . THR B  2 50  ? 10.720  -20.453 -0.300  1.00 53.15  ? 50  THR B CB  1 
ATOM   1077  O OG1 . THR B  2 50  ? 11.129  -20.232 -1.657  1.00 58.20  ? 50  THR B OG1 1 
ATOM   1078  C CG2 . THR B  2 50  ? 10.044  -19.178 0.213   1.00 50.77  ? 50  THR B CG2 1 
ATOM   1079  N N   . CYS B  2 51  ? 13.910  -20.378 -0.846  1.00 51.10  ? 51  CYS B N   1 
ATOM   1080  C CA  . CYS B  2 51  ? 15.119  -19.655 -1.240  1.00 55.03  ? 51  CYS B CA  1 
ATOM   1081  C C   . CYS B  2 51  ? 14.656  -18.352 -1.910  1.00 58.05  ? 51  CYS B C   1 
ATOM   1082  O O   . CYS B  2 51  ? 13.876  -18.390 -2.870  1.00 57.20  ? 51  CYS B O   1 
ATOM   1083  C CB  . CYS B  2 51  ? 16.007  -20.494 -2.155  1.00 58.87  ? 51  CYS B CB  1 
ATOM   1084  S SG  . CYS B  2 51  ? 17.532  -19.658 -2.673  1.00 66.78  ? 51  CYS B SG  1 
ATOM   1085  N N   . THR B  2 52  ? 15.034  -17.203 -1.321  1.00 54.84  ? 52  THR B N   1 
ATOM   1086  C CA  . THR B  2 52  ? 14.582  -15.870 -1.762  1.00 53.15  ? 52  THR B CA  1 
ATOM   1087  C C   . THR B  2 52  ? 15.492  -14.758 -1.291  1.00 58.18  ? 52  THR B C   1 
ATOM   1088  O O   . THR B  2 52  ? 16.318  -14.963 -0.400  1.00 60.03  ? 52  THR B O   1 
ATOM   1089  C CB  . THR B  2 52  ? 13.117  -15.604 -1.300  1.00 55.98  ? 52  THR B CB  1 
ATOM   1090  O OG1 . THR B  2 52  ? 12.629  -14.420 -1.928  1.00 53.40  ? 52  THR B OG1 1 
ATOM   1091  C CG2 . THR B  2 52  ? 12.975  -15.483 0.226   1.00 54.30  ? 52  THR B CG2 1 
ATOM   1092  N N   . PHE B  2 53  ? 15.295  -13.564 -1.856  1.00 55.01  ? 53  PHE B N   1 
ATOM   1093  C CA  . PHE B  2 53  ? 16.070  -12.376 -1.515  1.00 57.41  ? 53  PHE B CA  1 
ATOM   1094  C C   . PHE B  2 53  ? 15.952  -11.985 -0.041  1.00 60.82  ? 53  PHE B C   1 
ATOM   1095  O O   . PHE B  2 53  ? 14.852  -11.953 0.502   1.00 59.54  ? 53  PHE B O   1 
ATOM   1096  C CB  . PHE B  2 53  ? 15.728  -11.201 -2.455  1.00 58.97  ? 53  PHE B CB  1 
ATOM   1097  C CG  . PHE B  2 53  ? 14.463  -10.430 -2.174  1.00 59.59  ? 53  PHE B CG  1 
ATOM   1098  C CD1 . PHE B  2 53  ? 13.263  -10.786 -2.780  1.00 61.29  ? 53  PHE B CD1 1 
ATOM   1099  C CD2 . PHE B  2 53  ? 14.480  -9.304  -1.351  1.00 63.70  ? 53  PHE B CD2 1 
ATOM   1100  C CE1 . PHE B  2 53  ? 12.093  -10.046 -2.546  1.00 61.77  ? 53  PHE B CE1 1 
ATOM   1101  C CE2 . PHE B  2 53  ? 13.309  -8.572  -1.105  1.00 65.95  ? 53  PHE B CE2 1 
ATOM   1102  C CZ  . PHE B  2 53  ? 12.128  -8.937  -1.721  1.00 62.26  ? 53  PHE B CZ  1 
ATOM   1103  N N   . LYS B  2 54  ? 17.093  -11.763 0.605   1.00 59.39  ? 54  LYS B N   1 
ATOM   1104  C CA  . LYS B  2 54  ? 17.196  -11.320 1.989   1.00 61.20  ? 54  LYS B CA  1 
ATOM   1105  C C   . LYS B  2 54  ? 17.195  -9.777  1.959   1.00 66.98  ? 54  LYS B C   1 
ATOM   1106  O O   . LYS B  2 54  ? 16.563  -9.148  2.814   1.00 66.98  ? 54  LYS B O   1 
ATOM   1107  C CB  . LYS B  2 54  ? 18.467  -11.899 2.658   1.00 66.91  ? 54  LYS B CB  1 
ATOM   1108  C CG  . LYS B  2 54  ? 18.780  -11.305 4.032   1.00 80.96  ? 54  LYS B CG  1 
ATOM   1109  C CD  . LYS B  2 54  ? 19.242  -12.323 5.057   1.00 89.88  ? 54  LYS B CD  1 
ATOM   1110  C CE  . LYS B  2 54  ? 19.066  -11.792 6.466   1.00 100.67 ? 54  LYS B CE  1 
ATOM   1111  N NZ  . LYS B  2 54  ? 17.627  -11.586 6.826   1.00 100.20 ? 54  LYS B NZ  1 
ATOM   1112  N N   . GLU B  2 55  ? 17.912  -9.187  0.962   1.00 64.43  ? 55  GLU B N   1 
ATOM   1113  C CA  . GLU B  2 55  ? 18.054  -7.745  0.689   1.00 65.69  ? 55  GLU B CA  1 
ATOM   1114  C C   . GLU B  2 55  ? 18.158  -7.572  -0.831  1.00 66.53  ? 55  GLU B C   1 
ATOM   1115  O O   . GLU B  2 55  ? 18.702  -8.450  -1.519  1.00 65.66  ? 55  GLU B O   1 
ATOM   1116  C CB  . GLU B  2 55  ? 19.337  -7.146  1.318   1.00 71.96  ? 55  GLU B CB  1 
ATOM   1117  C CG  . GLU B  2 55  ? 19.635  -7.498  2.769   1.00 88.75  ? 55  GLU B CG  1 
ATOM   1118  C CD  . GLU B  2 55  ? 19.201  -6.484  3.808   1.00 116.62 ? 55  GLU B CD  1 
ATOM   1119  O OE1 . GLU B  2 55  ? 19.613  -5.306  3.696   1.00 122.95 ? 55  GLU B OE1 1 
ATOM   1120  O OE2 . GLU B  2 55  ? 18.509  -6.884  4.774   1.00 105.92 ? 55  GLU B OE2 1 
ATOM   1121  N N   . LEU B  2 56  ? 17.643  -6.449  -1.355  1.00 61.10  ? 56  LEU B N   1 
ATOM   1122  C CA  . LEU B  2 56  ? 17.705  -6.181  -2.788  1.00 59.64  ? 56  LEU B CA  1 
ATOM   1123  C C   . LEU B  2 56  ? 17.962  -4.709  -3.129  1.00 62.41  ? 56  LEU B C   1 
ATOM   1124  O O   . LEU B  2 56  ? 17.882  -3.832  -2.255  1.00 63.63  ? 56  LEU B O   1 
ATOM   1125  C CB  . LEU B  2 56  ? 16.462  -6.731  -3.551  1.00 56.75  ? 56  LEU B CB  1 
ATOM   1126  C CG  . LEU B  2 56  ? 15.032  -6.174  -3.303  1.00 60.37  ? 56  LEU B CG  1 
ATOM   1127  C CD1 . LEU B  2 56  ? 14.873  -4.699  -3.724  1.00 61.91  ? 56  LEU B CD1 1 
ATOM   1128  C CD2 . LEU B  2 56  ? 14.031  -6.949  -4.140  1.00 60.32  ? 56  LEU B CD2 1 
ATOM   1129  N N   . VAL B  2 57  ? 18.278  -4.451  -4.411  1.00 57.51  ? 57  VAL B N   1 
ATOM   1130  C CA  . VAL B  2 57  ? 18.497  -3.102  -4.957  1.00 59.63  ? 57  VAL B CA  1 
ATOM   1131  C C   . VAL B  2 57  ? 17.822  -2.969  -6.309  1.00 66.16  ? 57  VAL B C   1 
ATOM   1132  O O   . VAL B  2 57  ? 17.617  -3.973  -6.984  1.00 64.31  ? 57  VAL B O   1 
ATOM   1133  C CB  . VAL B  2 57  ? 19.964  -2.584  -4.982  1.00 64.79  ? 57  VAL B CB  1 
ATOM   1134  C CG1 . VAL B  2 57  ? 20.459  -2.260  -3.585  1.00 66.76  ? 57  VAL B CG1 1 
ATOM   1135  C CG2 . VAL B  2 57  ? 20.898  -3.558  -5.681  1.00 64.58  ? 57  VAL B CG2 1 
ATOM   1136  N N   . TYR B  2 58  ? 17.445  -1.740  -6.688  1.00 66.00  ? 58  TYR B N   1 
ATOM   1137  C CA  . TYR B  2 58  ? 16.819  -1.485  -7.978  1.00 65.73  ? 58  TYR B CA  1 
ATOM   1138  C C   . TYR B  2 58  ? 17.867  -0.912  -8.927  1.00 70.42  ? 58  TYR B C   1 
ATOM   1139  O O   . TYR B  2 58  ? 18.742  -0.159  -8.506  1.00 73.26  ? 58  TYR B O   1 
ATOM   1140  C CB  . TYR B  2 58  ? 15.550  -0.612  -7.839  1.00 68.21  ? 58  TYR B CB  1 
ATOM   1141  C CG  . TYR B  2 58  ? 14.287  -1.410  -7.544  1.00 68.98  ? 58  TYR B CG  1 
ATOM   1142  C CD1 . TYR B  2 58  ? 13.936  -1.743  -6.238  1.00 70.63  ? 58  TYR B CD1 1 
ATOM   1143  C CD2 . TYR B  2 58  ? 13.454  -1.848  -8.574  1.00 68.77  ? 58  TYR B CD2 1 
ATOM   1144  C CE1 . TYR B  2 58  ? 12.783  -2.483  -5.962  1.00 70.28  ? 58  TYR B CE1 1 
ATOM   1145  C CE2 . TYR B  2 58  ? 12.299  -2.589  -8.311  1.00 67.81  ? 58  TYR B CE2 1 
ATOM   1146  C CZ  . TYR B  2 58  ? 11.967  -2.905  -7.001  1.00 74.89  ? 58  TYR B CZ  1 
ATOM   1147  O OH  . TYR B  2 58  ? 10.831  -3.633  -6.725  1.00 71.42  ? 58  TYR B OH  1 
ATOM   1148  N N   . GLU B  2 59  ? 17.842  -1.363  -10.173 1.00 65.05  ? 59  GLU B N   1 
ATOM   1149  C CA  . GLU B  2 59  ? 18.783  -0.976  -11.206 1.00 66.55  ? 59  GLU B CA  1 
ATOM   1150  C C   . GLU B  2 59  ? 18.013  -0.510  -12.421 1.00 70.58  ? 59  GLU B C   1 
ATOM   1151  O O   . GLU B  2 59  ? 17.046  -1.153  -12.818 1.00 68.76  ? 59  GLU B O   1 
ATOM   1152  C CB  . GLU B  2 59  ? 19.701  -2.168  -11.555 1.00 68.02  ? 59  GLU B CB  1 
ATOM   1153  C CG  . GLU B  2 59  ? 21.169  -1.940  -11.204 1.00 84.65  ? 59  GLU B CG  1 
ATOM   1154  C CD  . GLU B  2 59  ? 22.027  -3.164  -10.918 1.00 102.77 ? 59  GLU B CD  1 
ATOM   1155  O OE1 . GLU B  2 59  ? 22.055  -4.092  -11.762 1.00 98.63  ? 59  GLU B OE1 1 
ATOM   1156  O OE2 . GLU B  2 59  ? 22.725  -3.163  -9.877  1.00 91.53  ? 59  GLU B OE2 1 
ATOM   1157  N N   . THR B  2 60  ? 18.418  0.620   -13.002 1.00 70.63  ? 60  THR B N   1 
ATOM   1158  C CA  . THR B  2 60  ? 17.756  1.141   -14.193 1.00 70.75  ? 60  THR B CA  1 
ATOM   1159  C C   . THR B  2 60  ? 18.656  0.948   -15.387 1.00 73.78  ? 60  THR B C   1 
ATOM   1160  O O   . THR B  2 60  ? 19.840  1.251   -15.336 1.00 74.23  ? 60  THR B O   1 
ATOM   1161  C CB  . THR B  2 60  ? 17.234  2.565   -13.996 1.00 78.45  ? 60  THR B CB  1 
ATOM   1162  O OG1 . THR B  2 60  ? 16.391  2.571   -12.836 1.00 77.43  ? 60  THR B OG1 1 
ATOM   1163  C CG2 . THR B  2 60  ? 16.434  3.064   -15.199 1.00 74.90  ? 60  THR B CG2 1 
ATOM   1164  N N   . VAL B  2 61  ? 18.073  0.376   -16.433 1.00 70.02  ? 61  VAL B N   1 
ATOM   1165  C CA  . VAL B  2 61  ? 18.685  0.032   -17.703 1.00 71.90  ? 61  VAL B CA  1 
ATOM   1166  C C   . VAL B  2 61  ? 17.914  0.728   -18.857 1.00 80.45  ? 61  VAL B C   1 
ATOM   1167  O O   . VAL B  2 61  ? 16.690  0.871   -18.781 1.00 79.25  ? 61  VAL B O   1 
ATOM   1168  C CB  . VAL B  2 61  ? 18.757  -1.521  -17.833 1.00 73.50  ? 61  VAL B CB  1 
ATOM   1169  C CG1 . VAL B  2 61  ? 17.366  -2.168  -17.864 1.00 71.22  ? 61  VAL B CG1 1 
ATOM   1170  C CG2 . VAL B  2 61  ? 19.597  -1.956  -19.027 1.00 75.47  ? 61  VAL B CG2 1 
ATOM   1171  N N   . ARG B  2 62  ? 18.635  1.195   -19.896 1.00 82.55  ? 62  ARG B N   1 
ATOM   1172  C CA  . ARG B  2 62  ? 17.997  1.842   -21.043 1.00 85.53  ? 62  ARG B CA  1 
ATOM   1173  C C   . ARG B  2 62  ? 17.562  0.799   -22.079 1.00 90.26  ? 62  ARG B C   1 
ATOM   1174  O O   . ARG B  2 62  ? 18.397  0.139   -22.708 1.00 91.21  ? 62  ARG B O   1 
ATOM   1175  C CB  . ARG B  2 62  ? 18.870  2.954   -21.652 1.00 90.22  ? 62  ARG B CB  1 
ATOM   1176  C CG  . ARG B  2 62  ? 18.076  3.878   -22.581 1.00 105.35 ? 62  ARG B CG  1 
ATOM   1177  C CD  . ARG B  2 62  ? 18.815  5.154   -22.958 1.00 116.05 ? 62  ARG B CD  1 
ATOM   1178  N NE  . ARG B  2 62  ? 18.694  6.186   -21.929 1.00 120.99 ? 62  ARG B NE  1 
ATOM   1179  C CZ  . ARG B  2 62  ? 17.682  7.043   -21.831 1.00 134.15 ? 62  ARG B CZ  1 
ATOM   1180  N NH1 . ARG B  2 62  ? 16.679  7.002   -22.701 1.00 123.31 ? 62  ARG B NH1 1 
ATOM   1181  N NH2 . ARG B  2 62  ? 17.659  7.940   -20.857 1.00 117.87 ? 62  ARG B NH2 1 
ATOM   1182  N N   . VAL B  2 63  ? 16.237  0.647   -22.215 1.00 85.59  ? 63  VAL B N   1 
ATOM   1183  C CA  . VAL B  2 63  ? 15.582  -0.287  -23.122 1.00 85.38  ? 63  VAL B CA  1 
ATOM   1184  C C   . VAL B  2 63  ? 15.412  0.379   -24.497 1.00 91.92  ? 63  VAL B C   1 
ATOM   1185  O O   . VAL B  2 63  ? 14.795  1.447   -24.574 1.00 93.34  ? 63  VAL B O   1 
ATOM   1186  C CB  . VAL B  2 63  ? 14.238  -0.742  -22.524 1.00 87.54  ? 63  VAL B CB  1 
ATOM   1187  C CG1 . VAL B  2 63  ? 13.582  -1.808  -23.391 1.00 88.29  ? 63  VAL B CG1 1 
ATOM   1188  C CG2 . VAL B  2 63  ? 14.433  -1.257  -21.105 1.00 83.96  ? 63  VAL B CG2 1 
ATOM   1189  N N   . PRO B  2 64  ? 15.955  -0.226  -25.587 1.00 89.11  ? 64  PRO B N   1 
ATOM   1190  C CA  . PRO B  2 64  ? 15.857  0.408   -26.917 1.00 92.77  ? 64  PRO B CA  1 
ATOM   1191  C C   . PRO B  2 64  ? 14.449  0.608   -27.470 1.00 98.88  ? 64  PRO B C   1 
ATOM   1192  O O   . PRO B  2 64  ? 13.497  -0.049  -27.047 1.00 96.75  ? 64  PRO B O   1 
ATOM   1193  C CB  . PRO B  2 64  ? 16.678  -0.525  -27.820 1.00 96.05  ? 64  PRO B CB  1 
ATOM   1194  C CG  . PRO B  2 64  ? 17.556  -1.291  -26.906 1.00 97.45  ? 64  PRO B CG  1 
ATOM   1195  C CD  . PRO B  2 64  ? 16.749  -1.469  -25.657 1.00 89.34  ? 64  PRO B CD  1 
ATOM   1196  N N   . GLY B  2 65  ? 14.345  1.535   -28.410 1.00 100.45 ? 65  GLY B N   1 
ATOM   1197  C CA  . GLY B  2 65  ? 13.115  1.832   -29.125 1.00 104.53 ? 65  GLY B CA  1 
ATOM   1198  C C   . GLY B  2 65  ? 13.128  1.089   -30.444 1.00 115.39 ? 65  GLY B C   1 
ATOM   1199  O O   . GLY B  2 65  ? 13.880  0.118   -30.598 1.00 114.99 ? 65  GLY B O   1 
ATOM   1200  N N   . CYS B  2 66  ? 12.305  1.530   -31.408 1.00 117.65 ? 66  CYS B N   1 
ATOM   1201  C CA  . CYS B  2 66  ? 12.243  0.901   -32.730 1.00 122.35 ? 66  CYS B CA  1 
ATOM   1202  C C   . CYS B  2 66  ? 11.895  1.920   -33.822 1.00 134.99 ? 66  CYS B C   1 
ATOM   1203  O O   . CYS B  2 66  ? 12.796  2.558   -34.374 1.00 137.29 ? 66  CYS B O   1 
ATOM   1204  C CB  . CYS B  2 66  ? 11.322  -0.325  -32.740 1.00 121.88 ? 66  CYS B CB  1 
ATOM   1205  S SG  . CYS B  2 66  ? 9.679   -0.051  -32.018 1.00 124.49 ? 66  CYS B SG  1 
ATOM   1206  N N   . ALA B  2 67  ? 10.602  2.090   -34.105 1.00 136.15 ? 67  ALA B N   1 
ATOM   1207  C CA  . ALA B  2 67  ? 10.060  3.038   -35.067 1.00 142.95 ? 67  ALA B CA  1 
ATOM   1208  C C   . ALA B  2 67  ? 8.763   3.535   -34.455 1.00 149.14 ? 67  ALA B C   1 
ATOM   1209  O O   . ALA B  2 67  ? 8.006   2.732   -33.895 1.00 146.14 ? 67  ALA B O   1 
ATOM   1210  C CB  . ALA B  2 67  ? 9.796   2.346   -36.394 1.00 149.08 ? 67  ALA B CB  1 
ATOM   1211  N N   . HIS B  2 68  ? 8.536   4.868   -34.494 1.00 150.30 ? 68  HIS B N   1 
ATOM   1212  C CA  . HIS B  2 68  ? 7.364   5.561   -33.919 1.00 151.74 ? 68  HIS B CA  1 
ATOM   1213  C C   . HIS B  2 68  ? 7.326   5.495   -32.375 1.00 149.93 ? 68  HIS B C   1 
ATOM   1214  O O   . HIS B  2 68  ? 6.561   6.235   -31.753 1.00 151.53 ? 68  HIS B O   1 
ATOM   1215  C CB  . HIS B  2 68  ? 6.013   5.097   -34.531 1.00 156.92 ? 68  HIS B CB  1 
ATOM   1216  C CG  . HIS B  2 68  ? 6.076   4.670   -35.968 1.00 165.54 ? 68  HIS B CG  1 
ATOM   1217  N ND1 . HIS B  2 68  ? 6.289   5.583   -36.989 1.00 173.25 ? 68  HIS B ND1 1 
ATOM   1218  C CD2 . HIS B  2 68  ? 5.941   3.435   -36.506 1.00 167.49 ? 68  HIS B CD2 1 
ATOM   1219  C CE1 . HIS B  2 68  ? 6.283   4.877   -38.108 1.00 176.23 ? 68  HIS B CE1 1 
ATOM   1220  N NE2 . HIS B  2 68  ? 6.075   3.580   -37.868 1.00 173.47 ? 68  HIS B NE2 1 
ATOM   1221  N N   . HIS B  2 69  ? 8.144   4.610   -31.769 1.00 139.49 ? 69  HIS B N   1 
ATOM   1222  C CA  . HIS B  2 69  ? 8.256   4.424   -30.324 1.00 132.83 ? 69  HIS B CA  1 
ATOM   1223  C C   . HIS B  2 69  ? 9.718   4.588   -29.908 1.00 130.51 ? 69  HIS B C   1 
ATOM   1224  O O   . HIS B  2 69  ? 10.584  3.828   -30.355 1.00 128.91 ? 69  HIS B O   1 
ATOM   1225  C CB  . HIS B  2 69  ? 7.695   3.060   -29.909 1.00 130.67 ? 69  HIS B CB  1 
ATOM   1226  C CG  . HIS B  2 69  ? 6.221   2.930   -30.133 1.00 137.40 ? 69  HIS B CG  1 
ATOM   1227  N ND1 . HIS B  2 69  ? 5.697   2.750   -31.402 1.00 144.38 ? 69  HIS B ND1 1 
ATOM   1228  C CD2 . HIS B  2 69  ? 5.204   2.972   -29.242 1.00 138.39 ? 69  HIS B CD2 1 
ATOM   1229  C CE1 . HIS B  2 69  ? 4.386   2.673   -31.240 1.00 145.95 ? 69  HIS B CE1 1 
ATOM   1230  N NE2 . HIS B  2 69  ? 4.042   2.790   -29.956 1.00 142.71 ? 69  HIS B NE2 1 
ATOM   1231  N N   . ALA B  2 70  ? 9.990   5.621   -29.095 1.00 124.03 ? 70  ALA B N   1 
ATOM   1232  C CA  . ALA B  2 70  ? 11.331  5.982   -28.633 1.00 120.68 ? 70  ALA B CA  1 
ATOM   1233  C C   . ALA B  2 70  ? 11.857  5.072   -27.534 1.00 116.94 ? 70  ALA B C   1 
ATOM   1234  O O   . ALA B  2 70  ? 11.073  4.391   -26.864 1.00 113.53 ? 70  ALA B O   1 
ATOM   1235  C CB  . ALA B  2 70  ? 11.344  7.427   -28.164 1.00 123.07 ? 70  ALA B CB  1 
ATOM   1236  N N   . ASP B  2 71  ? 13.193  5.067   -27.346 1.00 110.91 ? 71  ASP B N   1 
ATOM   1237  C CA  . ASP B  2 71  ? 13.833  4.269   -26.309 1.00 105.58 ? 71  ASP B CA  1 
ATOM   1238  C C   . ASP B  2 71  ? 13.415  4.755   -24.936 1.00 102.97 ? 71  ASP B C   1 
ATOM   1239  O O   . ASP B  2 71  ? 13.336  5.959   -24.695 1.00 104.37 ? 71  ASP B O   1 
ATOM   1240  C CB  . ASP B  2 71  ? 15.363  4.170   -26.498 1.00 108.35 ? 71  ASP B CB  1 
ATOM   1241  C CG  . ASP B  2 71  ? 16.222  5.393   -26.218 1.00 129.05 ? 71  ASP B CG  1 
ATOM   1242  O OD1 . ASP B  2 71  ? 15.683  6.528   -26.239 1.00 133.32 ? 71  ASP B OD1 1 
ATOM   1243  O OD2 . ASP B  2 71  ? 17.451  5.224   -26.055 1.00 137.72 ? 71  ASP B OD2 1 
ATOM   1244  N N   . SER B  2 72  ? 13.045  3.814   -24.082 1.00 92.91  ? 72  SER B N   1 
ATOM   1245  C CA  . SER B  2 72  ? 12.533  4.074   -22.747 1.00 89.26  ? 72  SER B CA  1 
ATOM   1246  C C   . SER B  2 72  ? 13.522  3.652   -21.658 1.00 87.37  ? 72  SER B C   1 
ATOM   1247  O O   . SER B  2 72  ? 14.643  3.238   -21.960 1.00 86.71  ? 72  SER B O   1 
ATOM   1248  C CB  . SER B  2 72  ? 11.211  3.331   -22.572 1.00 91.84  ? 72  SER B CB  1 
ATOM   1249  O OG  . SER B  2 72  ? 11.347  1.941   -22.833 1.00 96.33  ? 72  SER B OG  1 
ATOM   1250  N N   . LEU B  2 73  ? 13.102  3.775   -20.390 1.00 80.10  ? 73  LEU B N   1 
ATOM   1251  C CA  . LEU B  2 73  ? 13.850  3.342   -19.215 1.00 76.24  ? 73  LEU B CA  1 
ATOM   1252  C C   . LEU B  2 73  ? 13.010  2.272   -18.516 1.00 76.09  ? 73  LEU B C   1 
ATOM   1253  O O   . LEU B  2 73  ? 11.783  2.382   -18.500 1.00 74.53  ? 73  LEU B O   1 
ATOM   1254  C CB  . LEU B  2 73  ? 14.061  4.506   -18.217 1.00 77.19  ? 73  LEU B CB  1 
ATOM   1255  C CG  . LEU B  2 73  ? 15.178  5.545   -18.399 1.00 84.77  ? 73  LEU B CG  1 
ATOM   1256  C CD1 . LEU B  2 73  ? 16.553  4.918   -18.543 1.00 84.31  ? 73  LEU B CD1 1 
ATOM   1257  C CD2 . LEU B  2 73  ? 14.854  6.560   -19.472 1.00 92.19  ? 73  LEU B CD2 1 
ATOM   1258  N N   . TYR B  2 74  ? 13.671  1.265   -17.918 1.00 71.44  ? 74  TYR B N   1 
ATOM   1259  C CA  . TYR B  2 74  ? 13.038  0.213   -17.121 1.00 69.19  ? 74  TYR B CA  1 
ATOM   1260  C C   . TYR B  2 74  ? 13.837  -0.022  -15.848 1.00 70.40  ? 74  TYR B C   1 
ATOM   1261  O O   . TYR B  2 74  ? 15.064  -0.122  -15.912 1.00 70.29  ? 74  TYR B O   1 
ATOM   1262  C CB  . TYR B  2 74  ? 12.862  -1.101  -17.907 1.00 70.75  ? 74  TYR B CB  1 
ATOM   1263  C CG  . TYR B  2 74  ? 12.146  -2.193  -17.131 1.00 71.66  ? 74  TYR B CG  1 
ATOM   1264  C CD1 . TYR B  2 74  ? 10.773  -2.129  -16.898 1.00 74.27  ? 74  TYR B CD1 1 
ATOM   1265  C CD2 . TYR B  2 74  ? 12.843  -3.282  -16.617 1.00 70.76  ? 74  TYR B CD2 1 
ATOM   1266  C CE1 . TYR B  2 74  ? 10.110  -3.127  -16.175 1.00 73.18  ? 74  TYR B CE1 1 
ATOM   1267  C CE2 . TYR B  2 74  ? 12.188  -4.295  -15.913 1.00 69.62  ? 74  TYR B CE2 1 
ATOM   1268  C CZ  . TYR B  2 74  ? 10.822  -4.211  -15.691 1.00 78.13  ? 74  TYR B CZ  1 
ATOM   1269  O OH  . TYR B  2 74  ? 10.179  -5.206  -14.998 1.00 79.75  ? 74  TYR B OH  1 
ATOM   1270  N N   . THR B  2 75  ? 13.143  -0.113  -14.696 1.00 64.81  ? 75  THR B N   1 
ATOM   1271  C CA  . THR B  2 75  ? 13.786  -0.348  -13.404 1.00 63.31  ? 75  THR B CA  1 
ATOM   1272  C C   . THR B  2 75  ? 13.455  -1.733  -12.924 1.00 64.53  ? 75  THR B C   1 
ATOM   1273  O O   . THR B  2 75  ? 12.279  -2.093  -12.863 1.00 64.87  ? 75  THR B O   1 
ATOM   1274  C CB  . THR B  2 75  ? 13.438  0.749   -12.386 1.00 75.28  ? 75  THR B CB  1 
ATOM   1275  O OG1 . THR B  2 75  ? 13.680  2.032   -12.972 1.00 85.87  ? 75  THR B OG1 1 
ATOM   1276  C CG2 . THR B  2 75  ? 14.255  0.637   -11.108 1.00 70.51  ? 75  THR B CG2 1 
ATOM   1277  N N   . TYR B  2 76  ? 14.482  -2.518  -12.586 1.00 59.60  ? 76  TYR B N   1 
ATOM   1278  C CA  . TYR B  2 76  ? 14.279  -3.889  -12.119 1.00 57.38  ? 76  TYR B CA  1 
ATOM   1279  C C   . TYR B  2 76  ? 15.031  -4.173  -10.818 1.00 59.94  ? 76  TYR B C   1 
ATOM   1280  O O   . TYR B  2 76  ? 16.093  -3.582  -10.580 1.00 58.81  ? 76  TYR B O   1 
ATOM   1281  C CB  . TYR B  2 76  ? 14.634  -4.923  -13.212 1.00 58.49  ? 76  TYR B CB  1 
ATOM   1282  C CG  . TYR B  2 76  ? 16.096  -4.922  -13.600 1.00 62.10  ? 76  TYR B CG  1 
ATOM   1283  C CD1 . TYR B  2 76  ? 16.585  -4.032  -14.551 1.00 66.38  ? 76  TYR B CD1 1 
ATOM   1284  C CD2 . TYR B  2 76  ? 16.996  -5.805  -13.007 1.00 62.64  ? 76  TYR B CD2 1 
ATOM   1285  C CE1 . TYR B  2 76  ? 17.938  -4.007  -14.888 1.00 69.69  ? 76  TYR B CE1 1 
ATOM   1286  C CE2 . TYR B  2 76  ? 18.348  -5.797  -13.346 1.00 65.80  ? 76  TYR B CE2 1 
ATOM   1287  C CZ  . TYR B  2 76  ? 18.814  -4.898  -14.290 1.00 75.98  ? 76  TYR B CZ  1 
ATOM   1288  O OH  . TYR B  2 76  ? 20.149  -4.875  -14.612 1.00 80.06  ? 76  TYR B OH  1 
ATOM   1289  N N   . PRO B  2 77  ? 14.512  -5.106  -9.984  1.00 55.26  ? 77  PRO B N   1 
ATOM   1290  C CA  . PRO B  2 77  ? 15.201  -5.418  -8.727  1.00 55.21  ? 77  PRO B CA  1 
ATOM   1291  C C   . PRO B  2 77  ? 16.276  -6.477  -8.901  1.00 59.64  ? 77  PRO B C   1 
ATOM   1292  O O   . PRO B  2 77  ? 16.137  -7.380  -9.733  1.00 59.59  ? 77  PRO B O   1 
ATOM   1293  C CB  . PRO B  2 77  ? 14.073  -5.891  -7.815  1.00 54.91  ? 77  PRO B CB  1 
ATOM   1294  C CG  . PRO B  2 77  ? 13.038  -6.435  -8.735  1.00 57.77  ? 77  PRO B CG  1 
ATOM   1295  C CD  . PRO B  2 77  ? 13.259  -5.877  -10.113 1.00 54.74  ? 77  PRO B CD  1 
ATOM   1296  N N   . VAL B  2 78  ? 17.348  -6.357  -8.113  1.00 56.66  ? 78  VAL B N   1 
ATOM   1297  C CA  . VAL B  2 78  ? 18.499  -7.254  -8.122  1.00 57.46  ? 78  VAL B CA  1 
ATOM   1298  C C   . VAL B  2 78  ? 18.728  -7.781  -6.715  1.00 63.41  ? 78  VAL B C   1 
ATOM   1299  O O   . VAL B  2 78  ? 18.766  -6.999  -5.768  1.00 64.02  ? 78  VAL B O   1 
ATOM   1300  C CB  . VAL B  2 78  ? 19.784  -6.573  -8.667  1.00 63.24  ? 78  VAL B CB  1 
ATOM   1301  C CG1 . VAL B  2 78  ? 20.917  -7.584  -8.805  1.00 64.51  ? 78  VAL B CG1 1 
ATOM   1302  C CG2 . VAL B  2 78  ? 19.529  -5.883  -9.998  1.00 63.28  ? 78  VAL B CG2 1 
ATOM   1303  N N   . ALA B  2 79  ? 18.921  -9.104  -6.588  1.00 61.06  ? 79  ALA B N   1 
ATOM   1304  C CA  . ALA B  2 79  ? 19.223  -9.757  -5.311  1.00 61.27  ? 79  ALA B CA  1 
ATOM   1305  C C   . ALA B  2 79  ? 20.635  -9.353  -4.901  1.00 67.41  ? 79  ALA B C   1 
ATOM   1306  O O   . ALA B  2 79  ? 21.527  -9.222  -5.744  1.00 68.28  ? 79  ALA B O   1 
ATOM   1307  C CB  . ALA B  2 79  ? 19.114  -11.273 -5.442  1.00 61.01  ? 79  ALA B CB  1 
ATOM   1308  N N   . THR B  2 80  ? 20.802  -9.104  -3.614  1.00 65.05  ? 80  THR B N   1 
ATOM   1309  C CA  . THR B  2 80  ? 22.025  -8.612  -2.997  1.00 68.77  ? 80  THR B CA  1 
ATOM   1310  C C   . THR B  2 80  ? 22.523  -9.601  -1.943  1.00 75.02  ? 80  THR B C   1 
ATOM   1311  O O   . THR B  2 80  ? 23.719  -9.685  -1.664  1.00 78.51  ? 80  THR B O   1 
ATOM   1312  C CB  . THR B  2 80  ? 21.701  -7.188  -2.497  1.00 73.88  ? 80  THR B CB  1 
ATOM   1313  O OG1 . THR B  2 80  ? 22.301  -6.234  -3.371  1.00 72.42  ? 80  THR B OG1 1 
ATOM   1314  C CG2 . THR B  2 80  ? 22.038  -6.932  -1.025  1.00 73.22  ? 80  THR B CG2 1 
ATOM   1315  N N   . GLN B  2 81  ? 21.584  -10.355 -1.387  1.00 70.41  ? 81  GLN B N   1 
ATOM   1316  C CA  . GLN B  2 81  ? 21.755  -11.342 -0.335  1.00 72.11  ? 81  GLN B CA  1 
ATOM   1317  C C   . GLN B  2 81  ? 20.589  -12.317 -0.475  1.00 71.45  ? 81  GLN B C   1 
ATOM   1318  O O   . GLN B  2 81  ? 19.456  -11.882 -0.673  1.00 67.13  ? 81  GLN B O   1 
ATOM   1319  C CB  . GLN B  2 81  ? 21.675  -10.609 1.021   1.00 75.80  ? 81  GLN B CB  1 
ATOM   1320  C CG  . GLN B  2 81  ? 22.352  -11.298 2.207   1.00 99.44  ? 81  GLN B CG  1 
ATOM   1321  C CD  . GLN B  2 81  ? 22.442  -10.383 3.418   1.00 120.26 ? 81  GLN B CD  1 
ATOM   1322  O OE1 . GLN B  2 81  ? 22.578  -9.155  3.309   1.00 114.66 ? 81  GLN B OE1 1 
ATOM   1323  N NE2 . GLN B  2 81  ? 22.406  -10.969 4.607   1.00 116.38 ? 81  GLN B NE2 1 
ATOM   1324  N N   . CYS B  2 82  ? 20.868  -13.622 -0.446  1.00 69.75  ? 82  CYS B N   1 
ATOM   1325  C CA  . CYS B  2 82  ? 19.834  -14.663 -0.534  1.00 66.78  ? 82  CYS B CA  1 
ATOM   1326  C C   . CYS B  2 82  ? 19.767  -15.386 0.791   1.00 68.70  ? 82  CYS B C   1 
ATOM   1327  O O   . CYS B  2 82  ? 20.799  -15.593 1.439   1.00 72.40  ? 82  CYS B O   1 
ATOM   1328  C CB  . CYS B  2 82  ? 20.139  -15.655 -1.653  1.00 68.38  ? 82  CYS B CB  1 
ATOM   1329  S SG  . CYS B  2 82  ? 20.100  -14.956 -3.317  1.00 72.03  ? 82  CYS B SG  1 
ATOM   1330  N N   . HIS B  2 83  ? 18.583  -15.863 1.151   1.00 59.77  ? 83  HIS B N   1 
ATOM   1331  C CA  . HIS B  2 83  ? 18.427  -16.676 2.348   1.00 59.54  ? 83  HIS B CA  1 
ATOM   1332  C C   . HIS B  2 83  ? 17.245  -17.639 2.210   1.00 61.28  ? 83  HIS B C   1 
ATOM   1333  O O   . HIS B  2 83  ? 16.371  -17.412 1.368   1.00 57.15  ? 83  HIS B O   1 
ATOM   1334  C CB  . HIS B  2 83  ? 18.324  -15.790 3.615   1.00 60.58  ? 83  HIS B CB  1 
ATOM   1335  C CG  . HIS B  2 83  ? 16.995  -15.134 3.869   1.00 60.16  ? 83  HIS B CG  1 
ATOM   1336  N ND1 . HIS B  2 83  ? 16.086  -14.886 2.847   1.00 58.37  ? 83  HIS B ND1 1 
ATOM   1337  C CD2 . HIS B  2 83  ? 16.483  -14.664 5.026   1.00 61.39  ? 83  HIS B CD2 1 
ATOM   1338  C CE1 . HIS B  2 83  ? 15.053  -14.296 3.419   1.00 55.82  ? 83  HIS B CE1 1 
ATOM   1339  N NE2 . HIS B  2 83  ? 15.249  -14.137 4.726   1.00 58.18  ? 83  HIS B NE2 1 
ATOM   1340  N N   . CYS B  2 84  ? 17.226  -18.712 3.030   1.00 60.40  ? 84  CYS B N   1 
ATOM   1341  C CA  . CYS B  2 84  ? 16.092  -19.629 3.119   1.00 58.09  ? 84  CYS B CA  1 
ATOM   1342  C C   . CYS B  2 84  ? 15.238  -19.009 4.224   1.00 59.34  ? 84  CYS B C   1 
ATOM   1343  O O   . CYS B  2 84  ? 15.616  -19.006 5.399   1.00 60.00  ? 84  CYS B O   1 
ATOM   1344  C CB  . CYS B  2 84  ? 16.522  -21.052 3.468   1.00 61.16  ? 84  CYS B CB  1 
ATOM   1345  S SG  . CYS B  2 84  ? 17.091  -22.043 2.061   1.00 66.41  ? 84  CYS B SG  1 
ATOM   1346  N N   . GLY B  2 85  ? 14.166  -18.366 3.817   1.00 53.72  ? 85  GLY B N   1 
ATOM   1347  C CA  . GLY B  2 85  ? 13.297  -17.682 4.756   1.00 53.68  ? 85  GLY B CA  1 
ATOM   1348  C C   . GLY B  2 85  ? 11.867  -17.624 4.288   1.00 56.34  ? 85  GLY B C   1 
ATOM   1349  O O   . GLY B  2 85  ? 11.464  -18.389 3.402   1.00 54.58  ? 85  GLY B O   1 
ATOM   1350  N N   . LYS B  2 86  ? 11.079  -16.728 4.899   1.00 52.89  ? 86  LYS B N   1 
ATOM   1351  C CA  . LYS B  2 86  ? 9.697   -16.620 4.480   1.00 50.55  ? 86  LYS B CA  1 
ATOM   1352  C C   . LYS B  2 86  ? 9.651   -15.799 3.229   1.00 52.49  ? 86  LYS B C   1 
ATOM   1353  O O   . LYS B  2 86  ? 10.507  -14.938 3.027   1.00 51.95  ? 86  LYS B O   1 
ATOM   1354  C CB  . LYS B  2 86  ? 8.770   -16.059 5.580   1.00 54.19  ? 86  LYS B CB  1 
ATOM   1355  C CG  . LYS B  2 86  ? 7.984   -17.177 6.298   1.00 77.95  ? 86  LYS B CG  1 
ATOM   1356  C CD  . LYS B  2 86  ? 6.763   -16.673 7.118   1.00 87.87  ? 86  LYS B CD  1 
ATOM   1357  C CE  . LYS B  2 86  ? 5.948   -17.819 7.701   1.00 86.81  ? 86  LYS B CE  1 
ATOM   1358  N NZ  . LYS B  2 86  ? 4.651   -17.368 8.276   1.00 84.43  ? 86  LYS B NZ  1 
ATOM   1359  N N   . CYS B  2 87  ? 8.701   -16.131 2.351   1.00 47.90  ? 87  CYS B N   1 
ATOM   1360  C CA  . CYS B  2 87  ? 8.446   -15.426 1.114   1.00 46.83  ? 87  CYS B CA  1 
ATOM   1361  C C   . CYS B  2 87  ? 7.680   -14.155 1.482   1.00 48.71  ? 87  CYS B C   1 
ATOM   1362  O O   . CYS B  2 87  ? 6.598   -14.261 2.074   1.00 47.40  ? 87  CYS B O   1 
ATOM   1363  C CB  . CYS B  2 87  ? 7.643   -16.306 0.163   1.00 46.43  ? 87  CYS B CB  1 
ATOM   1364  S SG  . CYS B  2 87  ? 7.306   -15.531 -1.437  1.00 50.57  ? 87  CYS B SG  1 
ATOM   1365  N N   . ASP B  2 88  ? 8.252   -12.958 1.180   1.00 44.70  ? 88  ASP B N   1 
ATOM   1366  C CA  . ASP B  2 88  ? 7.589   -11.691 1.495   1.00 45.44  ? 88  ASP B CA  1 
ATOM   1367  C C   . ASP B  2 88  ? 6.435   -11.385 0.527   1.00 49.07  ? 88  ASP B C   1 
ATOM   1368  O O   . ASP B  2 88  ? 6.656   -10.723 -0.488  1.00 49.07  ? 88  ASP B O   1 
ATOM   1369  C CB  . ASP B  2 88  ? 8.589   -10.527 1.562   1.00 49.27  ? 88  ASP B CB  1 
ATOM   1370  C CG  . ASP B  2 88  ? 7.978   -9.178  1.917   1.00 65.02  ? 88  ASP B CG  1 
ATOM   1371  O OD1 . ASP B  2 88  ? 7.026   -9.149  2.747   1.00 65.75  ? 88  ASP B OD1 1 
ATOM   1372  O OD2 . ASP B  2 88  ? 8.460   -8.149  1.382   1.00 74.04  ? 88  ASP B OD2 1 
ATOM   1373  N N   . SER B  2 89  ? 5.196   -11.834 0.869   1.00 44.99  ? 89  SER B N   1 
ATOM   1374  C CA  . SER B  2 89  ? 3.971   -11.638 0.063   1.00 45.20  ? 89  SER B CA  1 
ATOM   1375  C C   . SER B  2 89  ? 3.676   -10.169 -0.264  1.00 49.55  ? 89  SER B C   1 
ATOM   1376  O O   . SER B  2 89  ? 2.951   -9.901  -1.220  1.00 49.35  ? 89  SER B O   1 
ATOM   1377  C CB  . SER B  2 89  ? 2.749   -12.316 0.705   1.00 50.45  ? 89  SER B CB  1 
ATOM   1378  O OG  . SER B  2 89  ? 2.362   -11.843 1.988   1.00 58.49  ? 89  SER B OG  1 
ATOM   1379  N N   . ASP B  2 90  ? 4.255   -9.229  0.527   1.00 46.54  ? 90  ASP B N   1 
ATOM   1380  C CA  . ASP B  2 90  ? 4.147   -7.779  0.375   1.00 47.56  ? 90  ASP B CA  1 
ATOM   1381  C C   . ASP B  2 90  ? 4.799   -7.289  -0.915  1.00 48.18  ? 90  ASP B C   1 
ATOM   1382  O O   . ASP B  2 90  ? 4.318   -6.318  -1.497  1.00 48.61  ? 90  ASP B O   1 
ATOM   1383  C CB  . ASP B  2 90  ? 4.857   -7.079  1.545   1.00 51.66  ? 90  ASP B CB  1 
ATOM   1384  C CG  . ASP B  2 90  ? 4.111   -6.987  2.861   1.00 72.26  ? 90  ASP B CG  1 
ATOM   1385  O OD1 . ASP B  2 90  ? 3.152   -7.783  3.071   1.00 73.75  ? 90  ASP B OD1 1 
ATOM   1386  O OD2 . ASP B  2 90  ? 4.509   -6.149  3.706   1.00 81.55  ? 90  ASP B OD2 1 
ATOM   1387  N N   . SER B  2 91  ? 5.914   -7.947  -1.335  1.00 41.72  ? 91  SER B N   1 
ATOM   1388  C CA  . SER B  2 91  ? 6.777   -7.569  -2.461  1.00 40.76  ? 91  SER B CA  1 
ATOM   1389  C C   . SER B  2 91  ? 6.982   -8.634  -3.523  1.00 43.45  ? 91  SER B C   1 
ATOM   1390  O O   . SER B  2 91  ? 7.326   -8.303  -4.660  1.00 42.04  ? 91  SER B O   1 
ATOM   1391  C CB  . SER B  2 91  ? 8.154   -7.206  -1.921  1.00 43.58  ? 91  SER B CB  1 
ATOM   1392  O OG  . SER B  2 91  ? 8.877   -8.385  -1.609  1.00 48.11  ? 91  SER B OG  1 
ATOM   1393  N N   . THR B  2 92  ? 6.893   -9.901  -3.117  1.00 41.25  ? 92  THR B N   1 
ATOM   1394  C CA  . THR B  2 92  ? 7.128   -11.077 -3.949  1.00 41.33  ? 92  THR B CA  1 
ATOM   1395  C C   . THR B  2 92  ? 5.821   -11.772 -4.330  1.00 47.94  ? 92  THR B C   1 
ATOM   1396  O O   . THR B  2 92  ? 4.823   -11.610 -3.622  1.00 47.85  ? 92  THR B O   1 
ATOM   1397  C CB  . THR B  2 92  ? 7.981   -12.074 -3.177  1.00 49.44  ? 92  THR B CB  1 
ATOM   1398  O OG1 . THR B  2 92  ? 8.828   -11.394 -2.244  1.00 52.12  ? 92  THR B OG1 1 
ATOM   1399  C CG2 . THR B  2 92  ? 8.777   -12.962 -4.079  1.00 49.64  ? 92  THR B CG2 1 
ATOM   1400  N N   . ASP B  2 93  ? 5.831   -12.548 -5.447  1.00 46.45  ? 93  ASP B N   1 
ATOM   1401  C CA  . ASP B  2 93  ? 4.689   -13.362 -5.864  1.00 47.45  ? 93  ASP B CA  1 
ATOM   1402  C C   . ASP B  2 93  ? 5.013   -14.766 -5.402  1.00 52.15  ? 93  ASP B C   1 
ATOM   1403  O O   . ASP B  2 93  ? 5.837   -15.445 -6.019  1.00 52.88  ? 93  ASP B O   1 
ATOM   1404  C CB  . ASP B  2 93  ? 4.446   -13.323 -7.384  1.00 50.66  ? 93  ASP B CB  1 
ATOM   1405  C CG  . ASP B  2 93  ? 3.257   -14.174 -7.843  1.00 54.07  ? 93  ASP B CG  1 
ATOM   1406  O OD1 . ASP B  2 93  ? 2.150   -14.020 -7.265  1.00 50.99  ? 93  ASP B OD1 1 
ATOM   1407  O OD2 . ASP B  2 93  ? 3.413   -14.923 -8.832  1.00 61.23  ? 93  ASP B OD2 1 
ATOM   1408  N N   . CYS B  2 94  ? 4.444   -15.161 -4.258  1.00 48.33  ? 94  CYS B N   1 
ATOM   1409  C CA  . CYS B  2 94  ? 4.727   -16.453 -3.642  1.00 47.08  ? 94  CYS B CA  1 
ATOM   1410  C C   . CYS B  2 94  ? 3.871   -17.503 -4.313  1.00 52.94  ? 94  CYS B C   1 
ATOM   1411  O O   . CYS B  2 94  ? 2.649   -17.552 -4.113  1.00 54.60  ? 94  CYS B O   1 
ATOM   1412  C CB  . CYS B  2 94  ? 4.526   -16.390 -2.128  1.00 46.57  ? 94  CYS B CB  1 
ATOM   1413  S SG  . CYS B  2 94  ? 5.367   -14.986 -1.333  1.00 50.64  ? 94  CYS B SG  1 
ATOM   1414  N N   . THR B  2 95  ? 4.510   -18.274 -5.218  1.00 49.47  ? 95  THR B N   1 
ATOM   1415  C CA  . THR B  2 95  ? 3.842   -19.291 -6.041  1.00 49.57  ? 95  THR B CA  1 
ATOM   1416  C C   . THR B  2 95  ? 4.716   -20.540 -6.292  1.00 54.18  ? 95  THR B C   1 
ATOM   1417  O O   . THR B  2 95  ? 5.891   -20.573 -5.916  1.00 54.15  ? 95  THR B O   1 
ATOM   1418  C CB  . THR B  2 95  ? 3.321   -18.649 -7.367  1.00 49.19  ? 95  THR B CB  1 
ATOM   1419  O OG1 . THR B  2 95  ? 2.498   -19.594 -8.053  1.00 55.77  ? 95  THR B OG1 1 
ATOM   1420  C CG2 . THR B  2 95  ? 4.446   -18.153 -8.295  1.00 39.86  ? 95  THR B CG2 1 
ATOM   1421  N N   . VAL B  2 96  ? 4.125   -21.544 -6.959  1.00 51.43  ? 96  VAL B N   1 
ATOM   1422  C CA  . VAL B  2 96  ? 4.766   -22.791 -7.370  1.00 51.73  ? 96  VAL B CA  1 
ATOM   1423  C C   . VAL B  2 96  ? 5.589   -22.534 -8.650  1.00 56.75  ? 96  VAL B C   1 
ATOM   1424  O O   . VAL B  2 96  ? 6.774   -22.868 -8.703  1.00 56.55  ? 96  VAL B O   1 
ATOM   1425  C CB  . VAL B  2 96  ? 3.721   -23.919 -7.565  1.00 55.86  ? 96  VAL B CB  1 
ATOM   1426  C CG1 . VAL B  2 96  ? 4.400   -25.227 -7.943  1.00 57.57  ? 96  VAL B CG1 1 
ATOM   1427  C CG2 . VAL B  2 96  ? 2.875   -24.105 -6.313  1.00 54.03  ? 96  VAL B CG2 1 
ATOM   1428  N N   . ARG B  2 97  ? 4.941   -21.974 -9.681  1.00 54.83  ? 97  ARG B N   1 
ATOM   1429  C CA  . ARG B  2 97  ? 5.567   -21.651 -10.957 1.00 56.57  ? 97  ARG B CA  1 
ATOM   1430  C C   . ARG B  2 97  ? 5.142   -20.278 -11.446 1.00 62.04  ? 97  ARG B C   1 
ATOM   1431  O O   . ARG B  2 97  ? 4.001   -19.852 -11.259 1.00 62.72  ? 97  ARG B O   1 
ATOM   1432  C CB  . ARG B  2 97  ? 5.242   -22.705 -12.027 1.00 58.63  ? 97  ARG B CB  1 
ATOM   1433  C CG  . ARG B  2 97  ? 5.965   -24.033 -11.810 1.00 70.65  ? 97  ARG B CG  1 
ATOM   1434  C CD  . ARG B  2 97  ? 5.290   -25.223 -12.477 1.00 77.94  ? 97  ARG B CD  1 
ATOM   1435  N NE  . ARG B  2 97  ? 3.924   -25.452 -11.996 1.00 80.75  ? 97  ARG B NE  1 
ATOM   1436  C CZ  . ARG B  2 97  ? 3.564   -26.449 -11.195 1.00 92.91  ? 97  ARG B CZ  1 
ATOM   1437  N NH1 . ARG B  2 97  ? 4.461   -27.337 -10.785 1.00 88.87  ? 97  ARG B NH1 1 
ATOM   1438  N NH2 . ARG B  2 97  ? 2.298   -26.586 -10.823 1.00 70.42  ? 97  ARG B NH2 1 
ATOM   1439  N N   . GLY B  2 98  ? 6.089   -19.595 -12.051 1.00 58.13  ? 98  GLY B N   1 
ATOM   1440  C CA  . GLY B  2 98  ? 5.884   -18.319 -12.704 1.00 57.96  ? 98  GLY B CA  1 
ATOM   1441  C C   . GLY B  2 98  ? 6.128   -18.560 -14.178 1.00 64.21  ? 98  GLY B C   1 
ATOM   1442  O O   . GLY B  2 98  ? 6.315   -19.715 -14.585 1.00 65.90  ? 98  GLY B O   1 
ATOM   1443  N N   . LEU B  2 99  ? 6.153   -17.486 -14.986 1.00 60.55  ? 99  LEU B N   1 
ATOM   1444  C CA  . LEU B  2 99  ? 6.377   -17.615 -16.429 1.00 62.76  ? 99  LEU B CA  1 
ATOM   1445  C C   . LEU B  2 99  ? 7.837   -17.856 -16.795 1.00 66.26  ? 99  LEU B C   1 
ATOM   1446  O O   . LEU B  2 99  ? 8.113   -18.239 -17.936 1.00 68.61  ? 99  LEU B O   1 
ATOM   1447  C CB  . LEU B  2 99  ? 5.802   -16.419 -17.221 1.00 63.99  ? 99  LEU B CB  1 
ATOM   1448  C CG  . LEU B  2 99  ? 4.330   -16.092 -17.014 1.00 68.27  ? 99  LEU B CG  1 
ATOM   1449  C CD1 . LEU B  2 99  ? 3.937   -14.867 -17.782 1.00 70.20  ? 99  LEU B CD1 1 
ATOM   1450  C CD2 . LEU B  2 99  ? 3.434   -17.262 -17.357 1.00 72.15  ? 99  LEU B CD2 1 
ATOM   1451  N N   . GLY B  2 100 ? 8.744   -17.632 -15.837 1.00 60.05  ? 100 GLY B N   1 
ATOM   1452  C CA  . GLY B  2 100 ? 10.183  -17.789 -16.032 1.00 60.80  ? 100 GLY B CA  1 
ATOM   1453  C C   . GLY B  2 100 ? 10.902  -16.457 -16.113 1.00 63.90  ? 100 GLY B C   1 
ATOM   1454  O O   . GLY B  2 100 ? 10.361  -15.510 -16.686 1.00 64.21  ? 100 GLY B O   1 
ATOM   1455  N N   . PRO B  2 101 ? 12.121  -16.346 -15.534 1.00 59.74  ? 101 PRO B N   1 
ATOM   1456  C CA  . PRO B  2 101 ? 12.851  -15.061 -15.552 1.00 59.62  ? 101 PRO B CA  1 
ATOM   1457  C C   . PRO B  2 101 ? 13.088  -14.456 -16.929 1.00 67.51  ? 101 PRO B C   1 
ATOM   1458  O O   . PRO B  2 101 ? 13.078  -13.231 -17.085 1.00 66.74  ? 101 PRO B O   1 
ATOM   1459  C CB  . PRO B  2 101 ? 14.186  -15.407 -14.878 1.00 61.42  ? 101 PRO B CB  1 
ATOM   1460  C CG  . PRO B  2 101 ? 14.295  -16.890 -14.956 1.00 66.82  ? 101 PRO B CG  1 
ATOM   1461  C CD  . PRO B  2 101 ? 12.893  -17.375 -14.815 1.00 61.09  ? 101 PRO B CD  1 
ATOM   1462  N N   . SER B  2 102 ? 13.317  -15.332 -17.920 1.00 68.11  ? 102 SER B N   1 
ATOM   1463  C CA  . SER B  2 102 ? 13.573  -14.962 -19.302 1.00 70.91  ? 102 SER B CA  1 
ATOM   1464  C C   . SER B  2 102 ? 12.315  -15.188 -20.140 1.00 74.89  ? 102 SER B C   1 
ATOM   1465  O O   . SER B  2 102 ? 12.389  -15.704 -21.252 1.00 78.49  ? 102 SER B O   1 
ATOM   1466  C CB  . SER B  2 102 ? 14.775  -15.730 -19.857 1.00 78.33  ? 102 SER B CB  1 
ATOM   1467  O OG  . SER B  2 102 ? 15.485  -16.483 -18.883 1.00 87.56  ? 102 SER B OG  1 
ATOM   1468  N N   . TYR B  2 103 ? 11.152  -14.812 -19.615 1.00 68.53  ? 103 TYR B N   1 
ATOM   1469  C CA  . TYR B  2 103 ? 9.964   -14.982 -20.417 1.00 70.21  ? 103 TYR B CA  1 
ATOM   1470  C C   . TYR B  2 103 ? 9.726   -13.797 -21.319 1.00 78.10  ? 103 TYR B C   1 
ATOM   1471  O O   . TYR B  2 103 ? 9.650   -12.657 -20.857 1.00 76.80  ? 103 TYR B O   1 
ATOM   1472  C CB  . TYR B  2 103 ? 8.712   -15.306 -19.607 1.00 69.11  ? 103 TYR B CB  1 
ATOM   1473  C CG  . TYR B  2 103 ? 7.537   -15.555 -20.529 1.00 74.06  ? 103 TYR B CG  1 
ATOM   1474  C CD1 . TYR B  2 103 ? 7.329   -16.807 -21.102 1.00 78.21  ? 103 TYR B CD1 1 
ATOM   1475  C CD2 . TYR B  2 103 ? 6.709   -14.509 -20.933 1.00 76.11  ? 103 TYR B CD2 1 
ATOM   1476  C CE1 . TYR B  2 103 ? 6.295   -17.024 -22.011 1.00 82.23  ? 103 TYR B CE1 1 
ATOM   1477  C CE2 . TYR B  2 103 ? 5.675   -14.713 -21.844 1.00 80.53  ? 103 TYR B CE2 1 
ATOM   1478  C CZ  . TYR B  2 103 ? 5.462   -15.976 -22.369 1.00 89.25  ? 103 TYR B CZ  1 
ATOM   1479  O OH  . TYR B  2 103 ? 4.441   -16.173 -23.263 1.00 91.91  ? 103 TYR B OH  1 
ATOM   1480  N N   . CYS B  2 104 ? 9.533   -14.086 -22.605 1.00 79.54  ? 104 CYS B N   1 
ATOM   1481  C CA  . CYS B  2 104 ? 9.217   -13.094 -23.621 1.00 82.31  ? 104 CYS B CA  1 
ATOM   1482  C C   . CYS B  2 104 ? 7.948   -13.480 -24.360 1.00 89.23  ? 104 CYS B C   1 
ATOM   1483  O O   . CYS B  2 104 ? 7.739   -14.659 -24.657 1.00 90.42  ? 104 CYS B O   1 
ATOM   1484  C CB  . CYS B  2 104 ? 10.380  -12.909 -24.586 1.00 85.46  ? 104 CYS B CB  1 
ATOM   1485  S SG  . CYS B  2 104 ? 10.148  -11.543 -25.744 1.00 92.90  ? 104 CYS B SG  1 
ATOM   1486  N N   . SER B  2 105 ? 7.124   -12.483 -24.691 1.00 87.52  ? 105 SER B N   1 
ATOM   1487  C CA  . SER B  2 105 ? 5.878   -12.691 -25.419 1.00 91.78  ? 105 SER B CA  1 
ATOM   1488  C C   . SER B  2 105 ? 6.106   -12.723 -26.928 1.00 105.46 ? 105 SER B C   1 
ATOM   1489  O O   . SER B  2 105 ? 5.141   -12.916 -27.675 1.00 109.67 ? 105 SER B O   1 
ATOM   1490  C CB  . SER B  2 105 ? 4.880   -11.589 -25.085 1.00 93.96  ? 105 SER B CB  1 
ATOM   1491  O OG  . SER B  2 105 ? 4.712   -11.444 -23.687 1.00 96.86  ? 105 SER B OG  1 
ATOM   1492  N N   . PHE B  2 106 ? 7.372   -12.528 -27.384 1.00 105.11 ? 106 PHE B N   1 
ATOM   1493  C CA  . PHE B  2 106 ? 7.722   -12.461 -28.806 1.00 111.56 ? 106 PHE B CA  1 
ATOM   1494  C C   . PHE B  2 106 ? 8.885   -13.380 -29.238 1.00 122.30 ? 106 PHE B C   1 
ATOM   1495  O O   . PHE B  2 106 ? 9.182   -13.469 -30.435 1.00 126.79 ? 106 PHE B O   1 
ATOM   1496  C CB  . PHE B  2 106 ? 8.005   -10.998 -29.205 1.00 113.72 ? 106 PHE B CB  1 
ATOM   1497  C CG  . PHE B  2 106 ? 7.044   -9.990  -28.616 1.00 113.07 ? 106 PHE B CG  1 
ATOM   1498  C CD1 . PHE B  2 106 ? 5.758   -9.849  -29.124 1.00 119.50 ? 106 PHE B CD1 1 
ATOM   1499  C CD2 . PHE B  2 106 ? 7.411   -9.211  -27.528 1.00 110.19 ? 106 PHE B CD2 1 
ATOM   1500  C CE1 . PHE B  2 106 ? 4.863   -8.934  -28.563 1.00 119.32 ? 106 PHE B CE1 1 
ATOM   1501  C CE2 . PHE B  2 106 ? 6.523   -8.280  -26.982 1.00 112.01 ? 106 PHE B CE2 1 
ATOM   1502  C CZ  . PHE B  2 106 ? 5.254   -8.150  -27.501 1.00 113.68 ? 106 PHE B CZ  1 
ATOM   1503  N N   . GLY B  2 107 ? 9.517   -14.057 -28.279 1.00 119.38 ? 107 GLY B N   1 
ATOM   1504  C CA  . GLY B  2 107 ? 10.626  -14.960 -28.571 1.00 122.88 ? 107 GLY B CA  1 
ATOM   1505  C C   . GLY B  2 107 ? 11.305  -15.620 -27.382 1.00 127.30 ? 107 GLY B C   1 
ATOM   1506  O O   . GLY B  2 107 ? 10.744  -15.684 -26.279 1.00 123.07 ? 107 GLY B O   1 
ATOM   1507  N N   . GLU B  2 108 ? 12.532  -16.142 -27.634 1.00 128.15 ? 108 GLU B N   1 
ATOM   1508  C CA  . GLU B  2 108 ? 13.406  -16.848 -26.683 1.00 126.27 ? 108 GLU B CA  1 
ATOM   1509  C C   . GLU B  2 108 ? 14.910  -16.586 -26.980 1.00 132.55 ? 108 GLU B C   1 
ATOM   1510  O O   . GLU B  2 108 ? 15.244  -15.761 -27.842 1.00 134.25 ? 108 GLU B O   1 
ATOM   1511  C CB  . GLU B  2 108 ? 13.104  -18.365 -26.717 1.00 129.71 ? 108 GLU B CB  1 
ATOM   1512  C CG  . GLU B  2 108 ? 11.984  -18.793 -25.780 1.00 136.72 ? 108 GLU B CG  1 
ATOM   1513  C CD  . GLU B  2 108 ? 10.750  -19.423 -26.404 1.00 155.11 ? 108 GLU B CD  1 
ATOM   1514  O OE1 . GLU B  2 108 ? 10.071  -20.195 -25.690 1.00 151.99 ? 108 GLU B OE1 1 
ATOM   1515  O OE2 . GLU B  2 108 ? 10.443  -19.133 -27.584 1.00 146.23 ? 108 GLU B OE2 1 
ATOM   1516  N N   . MET B  2 109 ? 15.805  -17.289 -26.252 1.00 128.48 ? 109 MET B N   1 
ATOM   1517  C CA  . MET B  2 109 ? 17.258  -17.204 -26.410 1.00 150.94 ? 109 MET B CA  1 
ATOM   1518  C C   . MET B  2 109 ? 17.719  -18.211 -27.470 1.00 195.91 ? 109 MET B C   1 
ATOM   1519  O O   . MET B  2 109 ? 18.917  -18.373 -27.706 1.00 160.92 ? 109 MET B O   1 
ATOM   1520  C CB  . MET B  2 109 ? 17.954  -17.489 -25.073 1.00 149.81 ? 109 MET B CB  1 
ATOM   1521  C CG  . MET B  2 109 ? 18.196  -16.261 -24.238 1.00 149.30 ? 109 MET B CG  1 
ATOM   1522  S SD  . MET B  2 109 ? 19.141  -16.648 -22.744 1.00 150.66 ? 109 MET B SD  1 
ATOM   1523  C CE  . MET B  2 109 ? 20.796  -16.733 -23.415 1.00 152.51 ? 109 MET B CE  1 
ATOM   1524  N N   . CYS C  3 3   ? 4.149   -37.873 -23.969 1.00 141.91 ? 18  CYS X N   1 
ATOM   1525  C CA  . CYS C  3 3   ? 2.739   -37.517 -24.105 1.00 140.66 ? 18  CYS X CA  1 
ATOM   1526  C C   . CYS C  3 3   ? 2.528   -36.262 -24.945 1.00 144.78 ? 18  CYS X C   1 
ATOM   1527  O O   . CYS C  3 3   ? 3.327   -35.327 -24.876 1.00 141.85 ? 18  CYS X O   1 
ATOM   1528  C CB  . CYS C  3 3   ? 2.070   -37.394 -22.741 1.00 135.03 ? 18  CYS X CB  1 
ATOM   1529  S SG  . CYS C  3 3   ? 0.349   -36.827 -22.811 1.00 137.75 ? 18  CYS X SG  1 
ATOM   1530  N N   . HIS C  3 4   ? 1.417   -36.235 -25.708 1.00 144.63 ? 19  HIS X N   1 
ATOM   1531  C CA  . HIS C  3 4   ? 1.051   -35.133 -26.599 1.00 146.12 ? 19  HIS X CA  1 
ATOM   1532  C C   . HIS C  3 4   ? -0.468  -34.934 -26.742 1.00 149.05 ? 19  HIS X C   1 
ATOM   1533  O O   . HIS C  3 4   ? -1.204  -35.888 -27.023 1.00 152.19 ? 19  HIS X O   1 
ATOM   1534  C CB  . HIS C  3 4   ? 1.712   -35.336 -27.982 1.00 153.90 ? 19  HIS X CB  1 
ATOM   1535  C CG  . HIS C  3 4   ? 1.204   -34.428 -29.062 1.00 160.62 ? 19  HIS X CG  1 
ATOM   1536  N ND1 . HIS C  3 4   ? 1.571   -33.092 -29.117 1.00 160.16 ? 19  HIS X ND1 1 
ATOM   1537  C CD2 . HIS C  3 4   ? 0.384   -34.699 -30.104 1.00 166.94 ? 19  HIS X CD2 1 
ATOM   1538  C CE1 . HIS C  3 4   ? 0.959   -32.597 -30.181 1.00 163.66 ? 19  HIS X CE1 1 
ATOM   1539  N NE2 . HIS C  3 4   ? 0.236   -33.526 -30.808 1.00 167.03 ? 19  HIS X NE2 1 
ATOM   1540  N N   . HIS C  3 5   ? -0.911  -33.668 -26.584 1.00 141.02 ? 20  HIS X N   1 
ATOM   1541  C CA  . HIS C  3 5   ? -2.298  -33.223 -26.760 1.00 140.18 ? 20  HIS X CA  1 
ATOM   1542  C C   . HIS C  3 5   ? -2.346  -32.119 -27.830 1.00 145.92 ? 20  HIS X C   1 
ATOM   1543  O O   . HIS C  3 5   ? -1.354  -31.408 -28.033 1.00 144.57 ? 20  HIS X O   1 
ATOM   1544  C CB  . HIS C  3 5   ? -2.922  -32.740 -25.435 1.00 134.02 ? 20  HIS X CB  1 
ATOM   1545  C CG  . HIS C  3 5   ? -4.323  -32.227 -25.587 1.00 137.66 ? 20  HIS X CG  1 
ATOM   1546  N ND1 . HIS C  3 5   ? -4.580  -30.887 -25.814 1.00 138.28 ? 20  HIS X ND1 1 
ATOM   1547  C CD2 . HIS C  3 5   ? -5.494  -32.904 -25.609 1.00 141.36 ? 20  HIS X CD2 1 
ATOM   1548  C CE1 . HIS C  3 5   ? -5.894  -30.787 -25.928 1.00 139.18 ? 20  HIS X CE1 1 
ATOM   1549  N NE2 . HIS C  3 5   ? -6.486  -31.975 -25.811 1.00 141.34 ? 20  HIS X NE2 1 
ATOM   1550  N N   . ARG C  3 6   ? -3.509  -31.993 -28.510 1.00 145.50 ? 21  ARG X N   1 
ATOM   1551  C CA  . ARG C  3 6   ? -3.795  -31.024 -29.570 1.00 148.16 ? 21  ARG X CA  1 
ATOM   1552  C C   . ARG C  3 6   ? -3.173  -29.643 -29.297 1.00 147.20 ? 21  ARG X C   1 
ATOM   1553  O O   . ARG C  3 6   ? -2.339  -29.194 -30.084 1.00 149.30 ? 21  ARG X O   1 
ATOM   1554  C CB  . ARG C  3 6   ? -5.317  -30.936 -29.818 1.00 149.73 ? 21  ARG X CB  1 
ATOM   1555  C CG  . ARG C  3 6   ? -5.712  -30.101 -31.033 1.00 158.40 ? 21  ARG X CG  1 
ATOM   1556  C CD  . ARG C  3 6   ? -7.189  -29.766 -31.029 1.00 162.20 ? 21  ARG X CD  1 
ATOM   1557  N NE  . ARG C  3 6   ? -7.526  -28.757 -30.024 1.00 165.29 ? 21  ARG X NE  1 
ATOM   1558  C CZ  . ARG C  3 6   ? -8.740  -28.586 -29.512 1.00 173.09 ? 21  ARG X CZ  1 
ATOM   1559  N NH1 . ARG C  3 6   ? -9.747  -29.360 -29.895 1.00 166.00 ? 21  ARG X NH1 1 
ATOM   1560  N NH2 . ARG C  3 6   ? -8.954  -27.646 -28.601 1.00 155.12 ? 21  ARG X NH2 1 
ATOM   1561  N N   . ILE C  3 7   ? -3.517  -29.012 -28.163 1.00 137.19 ? 22  ILE X N   1 
ATOM   1562  C CA  . ILE C  3 7   ? -2.978  -27.688 -27.835 1.00 133.69 ? 22  ILE X CA  1 
ATOM   1563  C C   . ILE C  3 7   ? -2.227  -27.648 -26.487 1.00 130.22 ? 22  ILE X C   1 
ATOM   1564  O O   . ILE C  3 7   ? -1.218  -26.944 -26.389 1.00 128.16 ? 22  ILE X O   1 
ATOM   1565  C CB  . ILE C  3 7   ? -4.046  -26.562 -27.941 1.00 137.22 ? 22  ILE X CB  1 
ATOM   1566  C CG1 . ILE C  3 7   ? -5.401  -26.965 -27.296 1.00 137.26 ? 22  ILE X CG1 1 
ATOM   1567  C CG2 . ILE C  3 7   ? -4.216  -26.128 -29.406 1.00 144.66 ? 22  ILE X CG2 1 
ATOM   1568  C CD1 . ILE C  3 7   ? -6.408  -25.781 -27.065 1.00 145.46 ? 22  ILE X CD1 1 
ATOM   1569  N N   . CYS C  3 8   ? -2.700  -28.394 -25.468 1.00 122.86 ? 23  CYS X N   1 
ATOM   1570  C CA  . CYS C  3 8   ? -2.065  -28.419 -24.146 1.00 116.45 ? 23  CYS X CA  1 
ATOM   1571  C C   . CYS C  3 8   ? -0.805  -29.262 -24.117 1.00 122.55 ? 23  CYS X C   1 
ATOM   1572  O O   . CYS C  3 8   ? -0.741  -30.312 -24.758 1.00 126.09 ? 23  CYS X O   1 
ATOM   1573  C CB  . CYS C  3 8   ? -3.047  -28.853 -23.064 1.00 112.90 ? 23  CYS X CB  1 
ATOM   1574  S SG  . CYS C  3 8   ? -4.580  -27.894 -23.036 1.00 116.38 ? 23  CYS X SG  1 
ATOM   1575  N N   . HIS C  3 9   ? 0.201   -28.796 -23.364 1.00 116.59 ? 24  HIS X N   1 
ATOM   1576  C CA  . HIS C  3 9   ? 1.463   -29.504 -23.177 1.00 116.97 ? 24  HIS X CA  1 
ATOM   1577  C C   . HIS C  3 9   ? 1.216   -30.597 -22.143 1.00 119.35 ? 24  HIS X C   1 
ATOM   1578  O O   . HIS C  3 9   ? 0.460   -30.378 -21.189 1.00 114.47 ? 24  HIS X O   1 
ATOM   1579  C CB  . HIS C  3 9   ? 2.585   -28.534 -22.777 1.00 115.00 ? 24  HIS X CB  1 
ATOM   1580  C CG  . HIS C  3 9   ? 2.795   -27.424 -23.771 1.00 121.23 ? 24  HIS X CG  1 
ATOM   1581  N ND1 . HIS C  3 9   ? 2.800   -26.091 -23.381 1.00 120.00 ? 24  HIS X ND1 1 
ATOM   1582  C CD2 . HIS C  3 9   ? 2.974   -27.483 -25.115 1.00 128.73 ? 24  HIS X CD2 1 
ATOM   1583  C CE1 . HIS C  3 9   ? 2.991   -25.393 -24.489 1.00 123.16 ? 24  HIS X CE1 1 
ATOM   1584  N NE2 . HIS C  3 9   ? 3.098   -26.186 -25.559 1.00 128.81 ? 24  HIS X NE2 1 
ATOM   1585  N N   . CYS C  3 10  ? 1.769   -31.798 -22.377 1.00 119.82 ? 25  CYS X N   1 
ATOM   1586  C CA  . CYS C  3 10  ? 1.500   -32.942 -21.517 1.00 118.96 ? 25  CYS X CA  1 
ATOM   1587  C C   . CYS C  3 10  ? 2.732   -33.740 -21.110 1.00 120.39 ? 25  CYS X C   1 
ATOM   1588  O O   . CYS C  3 10  ? 3.594   -34.015 -21.946 1.00 123.77 ? 25  CYS X O   1 
ATOM   1589  C CB  . CYS C  3 10  ? 0.455   -33.840 -22.171 1.00 124.49 ? 25  CYS X CB  1 
ATOM   1590  S SG  . CYS C  3 10  ? 0.222   -35.428 -21.337 1.00 129.03 ? 25  CYS X SG  1 
ATOM   1591  N N   . SER C  3 11  ? 2.765   -34.172 -19.827 1.00 111.44 ? 26  SER X N   1 
ATOM   1592  C CA  . SER C  3 11  ? 3.810   -35.018 -19.235 1.00 110.52 ? 26  SER X CA  1 
ATOM   1593  C C   . SER C  3 11  ? 3.318   -35.720 -17.969 1.00 109.68 ? 26  SER X C   1 
ATOM   1594  O O   . SER C  3 11  ? 3.093   -35.062 -16.953 1.00 104.20 ? 26  SER X O   1 
ATOM   1595  C CB  . SER C  3 11  ? 5.087   -34.229 -18.945 1.00 111.91 ? 26  SER X CB  1 
ATOM   1596  O OG  . SER C  3 11  ? 6.108   -35.068 -18.424 1.00 119.30 ? 26  SER X OG  1 
ATOM   1597  N N   . ASN C  3 12  ? 3.174   -37.067 -18.043 1.00 108.49 ? 27  ASN X N   1 
ATOM   1598  C CA  . ASN C  3 12  ? 2.750   -37.984 -16.971 1.00 106.14 ? 27  ASN X CA  1 
ATOM   1599  C C   . ASN C  3 12  ? 1.376   -37.609 -16.374 1.00 105.10 ? 27  ASN X C   1 
ATOM   1600  O O   . ASN C  3 12  ? 1.270   -37.302 -15.177 1.00 100.92 ? 27  ASN X O   1 
ATOM   1601  C CB  . ASN C  3 12  ? 3.844   -38.119 -15.888 1.00 104.61 ? 27  ASN X CB  1 
ATOM   1602  C CG  . ASN C  3 12  ? 5.207   -38.497 -16.418 1.00 134.60 ? 27  ASN X CG  1 
ATOM   1603  O OD1 . ASN C  3 12  ? 5.393   -39.539 -17.066 1.00 134.47 ? 27  ASN X OD1 1 
ATOM   1604  N ND2 . ASN C  3 12  ? 6.197   -37.660 -16.134 1.00 125.19 ? 27  ASN X ND2 1 
ATOM   1605  N N   . ARG C  3 13  ? 0.329   -37.611 -17.237 1.00 101.81 ? 28  ARG X N   1 
ATOM   1606  C CA  . ARG C  3 13  ? -1.065  -37.252 -16.915 1.00 98.79  ? 28  ARG X CA  1 
ATOM   1607  C C   . ARG C  3 13  ? -1.195  -35.812 -16.316 1.00 95.98  ? 28  ARG X C   1 
ATOM   1608  O O   . ARG C  3 13  ? -2.165  -35.515 -15.615 1.00 92.66  ? 28  ARG X O   1 
ATOM   1609  C CB  . ARG C  3 13  ? -1.755  -38.323 -16.033 1.00 97.75  ? 28  ARG X CB  1 
ATOM   1610  C CG  . ARG C  3 13  ? -1.721  -39.747 -16.605 1.00 110.79 ? 28  ARG X CG  1 
ATOM   1611  C CD  . ARG C  3 13  ? -2.781  -40.657 -16.002 1.00 115.85 ? 28  ARG X CD  1 
ATOM   1612  N NE  . ARG C  3 13  ? -2.522  -40.993 -14.600 1.00 117.15 ? 28  ARG X NE  1 
ATOM   1613  C CZ  . ARG C  3 13  ? -3.443  -41.439 -13.749 1.00 128.63 ? 28  ARG X CZ  1 
ATOM   1614  N NH1 . ARG C  3 13  ? -4.701  -41.593 -14.142 1.00 118.87 ? 28  ARG X NH1 1 
ATOM   1615  N NH2 . ARG C  3 13  ? -3.118  -41.716 -12.494 1.00 111.38 ? 28  ARG X NH2 1 
ATOM   1616  N N   . VAL C  3 14  ? -0.217  -34.924 -16.620 1.00 90.54  ? 29  VAL X N   1 
ATOM   1617  C CA  . VAL C  3 14  ? -0.192  -33.519 -16.183 1.00 86.03  ? 29  VAL X CA  1 
ATOM   1618  C C   . VAL C  3 14  ? -0.331  -32.654 -17.430 1.00 92.90  ? 29  VAL X C   1 
ATOM   1619  O O   . VAL C  3 14  ? 0.472   -32.775 -18.362 1.00 95.60  ? 29  VAL X O   1 
ATOM   1620  C CB  . VAL C  3 14  ? 1.047   -33.143 -15.333 1.00 85.88  ? 29  VAL X CB  1 
ATOM   1621  C CG1 . VAL C  3 14  ? 1.012   -31.677 -14.941 1.00 81.95  ? 29  VAL X CG1 1 
ATOM   1622  C CG2 . VAL C  3 14  ? 1.156   -34.020 -14.093 1.00 83.62  ? 29  VAL X CG2 1 
ATOM   1623  N N   . PHE C  3 15  ? -1.370  -31.807 -17.455 1.00 88.57  ? 30  PHE X N   1 
ATOM   1624  C CA  . PHE C  3 15  ? -1.685  -30.994 -18.619 1.00 91.23  ? 30  PHE X CA  1 
ATOM   1625  C C   . PHE C  3 15  ? -1.581  -29.517 -18.353 1.00 92.54  ? 30  PHE X C   1 
ATOM   1626  O O   . PHE C  3 15  ? -2.322  -28.984 -17.535 1.00 89.60  ? 30  PHE X O   1 
ATOM   1627  C CB  . PHE C  3 15  ? -3.073  -31.365 -19.163 1.00 96.27  ? 30  PHE X CB  1 
ATOM   1628  C CG  . PHE C  3 15  ? -3.165  -32.803 -19.610 1.00 102.10 ? 30  PHE X CG  1 
ATOM   1629  C CD1 . PHE C  3 15  ? -3.379  -33.825 -18.688 1.00 104.19 ? 30  PHE X CD1 1 
ATOM   1630  C CD2 . PHE C  3 15  ? -3.027  -33.140 -20.950 1.00 109.85 ? 30  PHE X CD2 1 
ATOM   1631  C CE1 . PHE C  3 15  ? -3.431  -35.158 -19.095 1.00 109.21 ? 30  PHE X CE1 1 
ATOM   1632  C CE2 . PHE C  3 15  ? -3.108  -34.472 -21.361 1.00 117.08 ? 30  PHE X CE2 1 
ATOM   1633  C CZ  . PHE C  3 15  ? -3.291  -35.474 -20.428 1.00 113.92 ? 30  PHE X CZ  1 
ATOM   1634  N N   . LEU C  3 16  ? -0.647  -28.855 -19.042 1.00 89.96  ? 31  LEU X N   1 
ATOM   1635  C CA  . LEU C  3 16  ? -0.427  -27.421 -18.935 1.00 87.30  ? 31  LEU X CA  1 
ATOM   1636  C C   . LEU C  3 16  ? -0.920  -26.802 -20.232 1.00 97.36  ? 31  LEU X C   1 
ATOM   1637  O O   . LEU C  3 16  ? -0.359  -27.069 -21.296 1.00 100.80 ? 31  LEU X O   1 
ATOM   1638  C CB  . LEU C  3 16  ? 1.075   -27.131 -18.678 1.00 85.17  ? 31  LEU X CB  1 
ATOM   1639  C CG  . LEU C  3 16  ? 1.649   -25.688 -18.713 1.00 87.17  ? 31  LEU X CG  1 
ATOM   1640  C CD1 . LEU C  3 16  ? 2.298   -25.384 -20.029 1.00 91.40  ? 31  LEU X CD1 1 
ATOM   1641  C CD2 . LEU C  3 16  ? 0.654   -24.621 -18.292 1.00 85.91  ? 31  LEU X CD2 1 
ATOM   1642  N N   . CYS C  3 17  ? -1.997  -26.007 -20.142 1.00 95.16  ? 32  CYS X N   1 
ATOM   1643  C CA  . CYS C  3 17  ? -2.575  -25.303 -21.286 1.00 99.68  ? 32  CYS X CA  1 
ATOM   1644  C C   . CYS C  3 17  ? -2.116  -23.846 -21.184 1.00 100.31 ? 32  CYS X C   1 
ATOM   1645  O O   . CYS C  3 17  ? -2.666  -23.069 -20.398 1.00 97.28  ? 32  CYS X O   1 
ATOM   1646  C CB  . CYS C  3 17  ? -4.096  -25.429 -21.300 1.00 102.19 ? 32  CYS X CB  1 
ATOM   1647  S SG  . CYS C  3 17  ? -4.699  -27.134 -21.160 1.00 108.39 ? 32  CYS X SG  1 
ATOM   1648  N N   . GLN C  3 18  ? -1.040  -23.509 -21.910 1.00 96.33  ? 33  GLN X N   1 
ATOM   1649  C CA  . GLN C  3 18  ? -0.460  -22.178 -21.864 1.00 93.76  ? 33  GLN X CA  1 
ATOM   1650  C C   . GLN C  3 18  ? -0.609  -21.419 -23.159 1.00 101.89 ? 33  GLN X C   1 
ATOM   1651  O O   . GLN C  3 18  ? -0.923  -22.001 -24.197 1.00 106.76 ? 33  GLN X O   1 
ATOM   1652  C CB  . GLN C  3 18  ? 1.018   -22.240 -21.445 1.00 92.75  ? 33  GLN X CB  1 
ATOM   1653  C CG  . GLN C  3 18  ? 1.408   -21.109 -20.493 1.00 100.11 ? 33  GLN X CG  1 
ATOM   1654  C CD  . GLN C  3 18  ? 2.850   -21.104 -20.074 1.00 114.39 ? 33  GLN X CD  1 
ATOM   1655  O OE1 . GLN C  3 18  ? 3.767   -21.204 -20.897 1.00 117.23 ? 33  GLN X OE1 1 
ATOM   1656  N NE2 . GLN C  3 18  ? 3.082   -20.899 -18.786 1.00 95.98  ? 33  GLN X NE2 1 
ATOM   1657  N N   . GLU C  3 19  ? -0.385  -20.099 -23.079 1.00 96.54  ? 34  GLU X N   1 
ATOM   1658  C CA  . GLU C  3 19  ? -0.348  -19.113 -24.159 1.00 99.74  ? 34  GLU X CA  1 
ATOM   1659  C C   . GLU C  3 19  ? -1.704  -18.734 -24.741 1.00 104.28 ? 34  GLU X C   1 
ATOM   1660  O O   . GLU C  3 19  ? -2.692  -19.459 -24.609 1.00 103.75 ? 34  GLU X O   1 
ATOM   1661  C CB  . GLU C  3 19  ? 0.625   -19.523 -25.287 1.00 105.47 ? 34  GLU X CB  1 
ATOM   1662  C CG  . GLU C  3 19  ? 2.071   -19.680 -24.835 1.00 111.33 ? 34  GLU X CG  1 
ATOM   1663  C CD  . GLU C  3 19  ? 2.690   -18.491 -24.127 1.00 122.21 ? 34  GLU X CD  1 
ATOM   1664  O OE1 . GLU C  3 19  ? 2.396   -17.336 -24.518 1.00 114.63 ? 34  GLU X OE1 1 
ATOM   1665  O OE2 . GLU C  3 19  ? 3.490   -18.719 -23.190 1.00 107.28 ? 34  GLU X OE2 1 
ATOM   1666  N N   . SER C  3 20  ? -1.708  -17.553 -25.385 1.00 102.03 ? 35  SER X N   1 
ATOM   1667  C CA  . SER C  3 20  ? -2.813  -16.866 -26.052 1.00 104.65 ? 35  SER X CA  1 
ATOM   1668  C C   . SER C  3 20  ? -3.661  -17.750 -26.967 1.00 111.89 ? 35  SER X C   1 
ATOM   1669  O O   . SER C  3 20  ? -4.863  -17.501 -27.088 1.00 113.70 ? 35  SER X O   1 
ATOM   1670  C CB  . SER C  3 20  ? -2.289  -15.657 -26.817 1.00 110.09 ? 35  SER X CB  1 
ATOM   1671  O OG  . SER C  3 20  ? -1.281  -14.997 -26.070 1.00 111.76 ? 35  SER X OG  1 
ATOM   1672  N N   . LYS C  3 21  ? -3.050  -18.791 -27.586 1.00 109.09 ? 36  LYS X N   1 
ATOM   1673  C CA  . LYS C  3 21  ? -3.745  -19.752 -28.455 1.00 113.02 ? 36  LYS X CA  1 
ATOM   1674  C C   . LYS C  3 21  ? -4.895  -20.479 -27.719 1.00 114.38 ? 36  LYS X C   1 
ATOM   1675  O O   . LYS C  3 21  ? -5.854  -20.913 -28.365 1.00 118.15 ? 36  LYS X O   1 
ATOM   1676  C CB  . LYS C  3 21  ? -2.760  -20.750 -29.105 1.00 117.27 ? 36  LYS X CB  1 
ATOM   1677  C CG  . LYS C  3 21  ? -2.047  -21.692 -28.132 1.00 123.02 ? 36  LYS X CG  1 
ATOM   1678  C CD  . LYS C  3 21  ? -1.317  -22.818 -28.852 1.00 134.78 ? 36  LYS X CD  1 
ATOM   1679  C CE  . LYS C  3 21  ? -0.706  -23.802 -27.882 1.00 140.96 ? 36  LYS X CE  1 
ATOM   1680  N NZ  . LYS C  3 21  ? 0.032   -24.890 -28.579 1.00 153.90 ? 36  LYS X NZ  1 
ATOM   1681  N N   . VAL C  3 22  ? -4.802  -20.574 -26.366 1.00 104.21 ? 37  VAL X N   1 
ATOM   1682  C CA  . VAL C  3 22  ? -5.814  -21.193 -25.507 1.00 101.56 ? 37  VAL X CA  1 
ATOM   1683  C C   . VAL C  3 22  ? -6.922  -20.178 -25.203 1.00 106.93 ? 37  VAL X C   1 
ATOM   1684  O O   . VAL C  3 22  ? -6.712  -19.254 -24.415 1.00 102.83 ? 37  VAL X O   1 
ATOM   1685  C CB  . VAL C  3 22  ? -5.217  -21.811 -24.219 1.00 98.73  ? 37  VAL X CB  1 
ATOM   1686  C CG1 . VAL C  3 22  ? -6.290  -22.537 -23.416 1.00 96.63  ? 37  VAL X CG1 1 
ATOM   1687  C CG2 . VAL C  3 22  ? -4.064  -22.752 -24.539 1.00 99.02  ? 37  VAL X CG2 1 
ATOM   1688  N N   . THR C  3 23  ? -8.094  -20.353 -25.845 1.00 109.20 ? 38  THR X N   1 
ATOM   1689  C CA  . THR C  3 23  ? -9.266  -19.482 -25.695 1.00 110.48 ? 38  THR X CA  1 
ATOM   1690  C C   . THR C  3 23  ? -10.426 -20.199 -24.987 1.00 113.40 ? 38  THR X C   1 
ATOM   1691  O O   . THR C  3 23  ? -11.209 -19.541 -24.299 1.00 111.72 ? 38  THR X O   1 
ATOM   1692  C CB  . THR C  3 23  ? -9.677  -18.837 -27.036 1.00 125.51 ? 38  THR X CB  1 
ATOM   1693  O OG1 . THR C  3 23  ? -9.458  -19.746 -28.121 1.00 127.87 ? 38  THR X OG1 1 
ATOM   1694  C CG2 . THR C  3 23  ? -8.940  -17.534 -27.296 1.00 124.45 ? 38  THR X CG2 1 
ATOM   1695  N N   . GLU C  3 24  ? -10.535 -21.529 -25.148 1.00 110.60 ? 39  GLU X N   1 
ATOM   1696  C CA  . GLU C  3 24  ? -11.555 -22.326 -24.466 1.00 109.69 ? 39  GLU X CA  1 
ATOM   1697  C C   . GLU C  3 24  ? -10.935 -23.595 -23.879 1.00 111.26 ? 39  GLU X C   1 
ATOM   1698  O O   . GLU C  3 24  ? -9.921  -24.069 -24.404 1.00 111.10 ? 39  GLU X O   1 
ATOM   1699  C CB  . GLU C  3 24  ? -12.765 -22.622 -25.374 1.00 117.40 ? 39  GLU X CB  1 
ATOM   1700  C CG  . GLU C  3 24  ? -12.525 -23.638 -26.483 1.00 129.12 ? 39  GLU X CG  1 
ATOM   1701  C CD  . GLU C  3 24  ? -12.966 -23.242 -27.880 1.00 144.97 ? 39  GLU X CD  1 
ATOM   1702  O OE1 . GLU C  3 24  ? -12.921 -24.119 -28.772 1.00 137.10 ? 39  GLU X OE1 1 
ATOM   1703  O OE2 . GLU C  3 24  ? -13.328 -22.062 -28.097 1.00 134.84 ? 39  GLU X OE2 1 
ATOM   1704  N N   . ILE C  3 25  ? -11.524 -24.128 -22.786 1.00 105.60 ? 40  ILE X N   1 
ATOM   1705  C CA  . ILE C  3 25  ? -11.040 -25.359 -22.152 1.00 103.48 ? 40  ILE X CA  1 
ATOM   1706  C C   . ILE C  3 25  ? -11.294 -26.524 -23.119 1.00 116.17 ? 40  ILE X C   1 
ATOM   1707  O O   . ILE C  3 25  ? -12.444 -26.731 -23.527 1.00 120.59 ? 40  ILE X O   1 
ATOM   1708  C CB  . ILE C  3 25  ? -11.632 -25.588 -20.744 1.00 102.25 ? 40  ILE X CB  1 
ATOM   1709  C CG1 . ILE C  3 25  ? -11.276 -24.416 -19.811 1.00 98.17  ? 40  ILE X CG1 1 
ATOM   1710  C CG2 . ILE C  3 25  ? -11.143 -26.915 -20.154 1.00 100.13 ? 40  ILE X CG2 1 
ATOM   1711  C CD1 . ILE C  3 25  ? -12.301 -24.147 -18.750 1.00 104.77 ? 40  ILE X CD1 1 
ATOM   1712  N N   . PRO C  3 26  ? -10.228 -27.241 -23.556 1.00 114.81 ? 41  PRO X N   1 
ATOM   1713  C CA  . PRO C  3 26  ? -10.412 -28.294 -24.576 1.00 120.27 ? 41  PRO X CA  1 
ATOM   1714  C C   . PRO C  3 26  ? -11.384 -29.414 -24.218 1.00 124.54 ? 41  PRO X C   1 
ATOM   1715  O O   . PRO C  3 26  ? -11.386 -29.904 -23.089 1.00 120.46 ? 41  PRO X O   1 
ATOM   1716  C CB  . PRO C  3 26  ? -8.992  -28.826 -24.808 1.00 121.42 ? 41  PRO X CB  1 
ATOM   1717  C CG  . PRO C  3 26  ? -8.096  -27.740 -24.352 1.00 121.71 ? 41  PRO X CG  1 
ATOM   1718  C CD  . PRO C  3 26  ? -8.800  -27.074 -23.212 1.00 112.89 ? 41  PRO X CD  1 
ATOM   1719  N N   . SER C  3 27  ? -12.221 -29.805 -25.190 1.00 126.49 ? 42  SER X N   1 
ATOM   1720  C CA  . SER C  3 27  ? -13.180 -30.892 -25.007 1.00 128.90 ? 42  SER X CA  1 
ATOM   1721  C C   . SER C  3 27  ? -12.439 -32.234 -24.957 1.00 133.57 ? 42  SER X C   1 
ATOM   1722  O O   . SER C  3 27  ? -12.805 -33.112 -24.173 1.00 132.53 ? 42  SER X O   1 
ATOM   1723  C CB  . SER C  3 27  ? -14.217 -30.890 -26.127 1.00 138.69 ? 42  SER X CB  1 
ATOM   1724  O OG  . SER C  3 27  ? -13.614 -31.039 -27.401 1.00 151.85 ? 42  SER X OG  1 
ATOM   1725  N N   . ASP C  3 28  ? -11.355 -32.348 -25.752 1.00 131.44 ? 43  ASP X N   1 
ATOM   1726  C CA  . ASP C  3 28  ? -10.513 -33.538 -25.885 1.00 132.16 ? 43  ASP X CA  1 
ATOM   1727  C C   . ASP C  3 28  ? -9.440  -33.693 -24.776 1.00 129.09 ? 43  ASP X C   1 
ATOM   1728  O O   . ASP C  3 28  ? -8.381  -34.272 -25.032 1.00 130.01 ? 43  ASP X O   1 
ATOM   1729  C CB  . ASP C  3 28  ? -9.879  -33.603 -27.299 1.00 139.59 ? 43  ASP X CB  1 
ATOM   1730  C CG  . ASP C  3 28  ? -9.158  -32.347 -27.762 1.00 149.40 ? 43  ASP X CG  1 
ATOM   1731  O OD1 . ASP C  3 28  ? -9.809  -31.281 -27.833 1.00 149.83 ? 43  ASP X OD1 1 
ATOM   1732  O OD2 . ASP C  3 28  ? -7.968  -32.449 -28.139 1.00 155.37 ? 43  ASP X OD2 1 
ATOM   1733  N N   . LEU C  3 29  ? -9.723  -33.229 -23.542 1.00 118.26 ? 44  LEU X N   1 
ATOM   1734  C CA  . LEU C  3 29  ? -8.782  -33.408 -22.436 1.00 111.77 ? 44  LEU X CA  1 
ATOM   1735  C C   . LEU C  3 29  ? -8.987  -34.813 -21.824 1.00 115.99 ? 44  LEU X C   1 
ATOM   1736  O O   . LEU C  3 29  ? -10.133 -35.164 -21.513 1.00 116.89 ? 44  LEU X O   1 
ATOM   1737  C CB  . LEU C  3 29  ? -8.920  -32.300 -21.376 1.00 105.96 ? 44  LEU X CB  1 
ATOM   1738  C CG  . LEU C  3 29  ? -8.277  -30.943 -21.710 1.00 108.81 ? 44  LEU X CG  1 
ATOM   1739  C CD1 . LEU C  3 29  ? -8.847  -29.856 -20.849 1.00 105.10 ? 44  LEU X CD1 1 
ATOM   1740  C CD2 . LEU C  3 29  ? -6.754  -30.968 -21.545 1.00 108.16 ? 44  LEU X CD2 1 
ATOM   1741  N N   . PRO C  3 30  ? -7.913  -35.645 -21.700 1.00 111.51 ? 45  PRO X N   1 
ATOM   1742  C CA  . PRO C  3 30  ? -8.081  -37.023 -21.166 1.00 112.02 ? 45  PRO X CA  1 
ATOM   1743  C C   . PRO C  3 30  ? -8.660  -37.077 -19.754 1.00 111.73 ? 45  PRO X C   1 
ATOM   1744  O O   . PRO C  3 30  ? -8.214  -36.313 -18.907 1.00 106.27 ? 45  PRO X O   1 
ATOM   1745  C CB  . PRO C  3 30  ? -6.659  -37.598 -21.214 1.00 113.44 ? 45  PRO X CB  1 
ATOM   1746  C CG  . PRO C  3 30  ? -5.936  -36.755 -22.214 1.00 119.19 ? 45  PRO X CG  1 
ATOM   1747  C CD  . PRO C  3 30  ? -6.508  -35.384 -22.068 1.00 111.92 ? 45  PRO X CD  1 
ATOM   1748  N N   . ARG C  3 31  ? -9.648  -37.962 -19.494 1.00 111.22 ? 46  ARG X N   1 
ATOM   1749  C CA  . ARG C  3 31  ? -10.312 -38.031 -18.178 1.00 108.34 ? 46  ARG X CA  1 
ATOM   1750  C C   . ARG C  3 31  ? -9.401  -38.556 -17.057 1.00 111.67 ? 46  ARG X C   1 
ATOM   1751  O O   . ARG C  3 31  ? -9.591  -38.179 -15.889 1.00 108.37 ? 46  ARG X O   1 
ATOM   1752  C CB  . ARG C  3 31  ? -11.652 -38.793 -18.209 1.00 110.90 ? 46  ARG X CB  1 
ATOM   1753  C CG  . ARG C  3 31  ? -12.524 -38.616 -19.471 1.00 125.43 ? 46  ARG X CG  1 
ATOM   1754  C CD  . ARG C  3 31  ? -12.807 -37.186 -19.922 1.00 131.20 ? 46  ARG X CD  1 
ATOM   1755  N NE  . ARG C  3 31  ? -13.692 -36.458 -19.014 1.00 136.07 ? 46  ARG X NE  1 
ATOM   1756  C CZ  . ARG C  3 31  ? -14.047 -35.187 -19.181 1.00 152.76 ? 46  ARG X CZ  1 
ATOM   1757  N NH1 . ARG C  3 31  ? -13.595 -34.495 -20.222 1.00 142.62 ? 46  ARG X NH1 1 
ATOM   1758  N NH2 . ARG C  3 31  ? -14.853 -34.598 -18.310 1.00 138.57 ? 46  ARG X NH2 1 
ATOM   1759  N N   . ASN C  3 32  ? -8.370  -39.351 -17.421 1.00 110.33 ? 47  ASN X N   1 
ATOM   1760  C CA  . ASN C  3 32  ? -7.377  -39.890 -16.485 1.00 107.60 ? 47  ASN X CA  1 
ATOM   1761  C C   . ASN C  3 32  ? -6.443  -38.806 -15.860 1.00 107.27 ? 47  ASN X C   1 
ATOM   1762  O O   . ASN C  3 32  ? -5.741  -39.103 -14.888 1.00 105.00 ? 47  ASN X O   1 
ATOM   1763  C CB  . ASN C  3 32  ? -6.563  -41.022 -17.145 1.00 110.46 ? 47  ASN X CB  1 
ATOM   1764  C CG  . ASN C  3 32  ? -5.575  -40.621 -18.233 1.00 136.11 ? 47  ASN X CG  1 
ATOM   1765  O OD1 . ASN C  3 32  ? -5.432  -39.450 -18.625 1.00 129.08 ? 47  ASN X OD1 1 
ATOM   1766  N ND2 . ASN C  3 32  ? -4.837  -41.604 -18.732 1.00 131.25 ? 47  ASN X ND2 1 
ATOM   1767  N N   . ALA C  3 33  ? -6.434  -37.568 -16.426 1.00 101.88 ? 48  ALA X N   1 
ATOM   1768  C CA  . ALA C  3 33  ? -5.601  -36.433 -15.994 1.00 96.93  ? 48  ALA X CA  1 
ATOM   1769  C C   . ALA C  3 33  ? -5.507  -36.297 -14.482 1.00 95.75  ? 48  ALA X C   1 
ATOM   1770  O O   . ALA C  3 33  ? -6.523  -36.374 -13.794 1.00 95.13  ? 48  ALA X O   1 
ATOM   1771  C CB  . ALA C  3 33  ? -6.113  -35.137 -16.601 1.00 97.33  ? 48  ALA X CB  1 
ATOM   1772  N N   . ILE C  3 34  ? -4.277  -36.130 -13.977 1.00 88.65  ? 49  ILE X N   1 
ATOM   1773  C CA  . ILE C  3 34  ? -3.927  -36.002 -12.560 1.00 83.54  ? 49  ILE X CA  1 
ATOM   1774  C C   . ILE C  3 34  ? -3.857  -34.530 -12.157 1.00 82.00  ? 49  ILE X C   1 
ATOM   1775  O O   . ILE C  3 34  ? -4.348  -34.147 -11.086 1.00 77.99  ? 49  ILE X O   1 
ATOM   1776  C CB  . ILE C  3 34  ? -2.610  -36.810 -12.300 1.00 86.97  ? 49  ILE X CB  1 
ATOM   1777  C CG1 . ILE C  3 34  ? -2.881  -38.333 -12.244 1.00 91.29  ? 49  ILE X CG1 1 
ATOM   1778  C CG2 . ILE C  3 34  ? -1.812  -36.350 -11.085 1.00 83.23  ? 49  ILE X CG2 1 
ATOM   1779  C CD1 . ILE C  3 34  ? -4.000  -38.871 -11.179 1.00 101.97 ? 49  ILE X CD1 1 
ATOM   1780  N N   . GLU C  3 35  ? -3.266  -33.709 -13.041 1.00 78.27  ? 50  GLU X N   1 
ATOM   1781  C CA  . GLU C  3 35  ? -3.077  -32.271 -12.865 1.00 74.18  ? 50  GLU X CA  1 
ATOM   1782  C C   . GLU C  3 35  ? -3.472  -31.546 -14.148 1.00 78.69  ? 50  GLU X C   1 
ATOM   1783  O O   . GLU C  3 35  ? -3.144  -31.988 -15.256 1.00 81.39  ? 50  GLU X O   1 
ATOM   1784  C CB  . GLU C  3 35  ? -1.613  -31.965 -12.486 1.00 73.17  ? 50  GLU X CB  1 
ATOM   1785  C CG  . GLU C  3 35  ? -1.423  -30.714 -11.645 1.00 80.40  ? 50  GLU X CG  1 
ATOM   1786  C CD  . GLU C  3 35  ? -0.026  -30.430 -11.115 1.00 103.66 ? 50  GLU X CD  1 
ATOM   1787  O OE1 . GLU C  3 35  ? 0.815   -31.359 -11.096 1.00 106.12 ? 50  GLU X OE1 1 
ATOM   1788  O OE2 . GLU C  3 35  ? 0.221   -29.275 -10.696 1.00 93.02  ? 50  GLU X OE2 1 
ATOM   1789  N N   . LEU C  3 36  ? -4.205  -30.444 -13.984 1.00 72.67  ? 51  LEU X N   1 
ATOM   1790  C CA  . LEU C  3 36  ? -4.649  -29.592 -15.076 1.00 73.75  ? 51  LEU X CA  1 
ATOM   1791  C C   . LEU C  3 36  ? -4.310  -28.147 -14.731 1.00 74.66  ? 51  LEU X C   1 
ATOM   1792  O O   . LEU C  3 36  ? -4.706  -27.662 -13.671 1.00 72.42  ? 51  LEU X O   1 
ATOM   1793  C CB  . LEU C  3 36  ? -6.148  -29.782 -15.346 1.00 75.69  ? 51  LEU X CB  1 
ATOM   1794  C CG  . LEU C  3 36  ? -6.484  -30.800 -16.428 1.00 84.30  ? 51  LEU X CG  1 
ATOM   1795  C CD1 . LEU C  3 36  ? -7.704  -31.584 -16.073 1.00 85.37  ? 51  LEU X CD1 1 
ATOM   1796  C CD2 . LEU C  3 36  ? -6.716  -30.123 -17.749 1.00 90.21  ? 51  LEU X CD2 1 
ATOM   1797  N N   . ARG C  3 37  ? -3.527  -27.489 -15.599 1.00 70.90  ? 52  ARG X N   1 
ATOM   1798  C CA  . ARG C  3 37  ? -3.070  -26.113 -15.446 1.00 68.38  ? 52  ARG X CA  1 
ATOM   1799  C C   . ARG C  3 37  ? -3.526  -25.279 -16.622 1.00 76.70  ? 52  ARG X C   1 
ATOM   1800  O O   . ARG C  3 37  ? -3.438  -25.715 -17.771 1.00 79.76  ? 52  ARG X O   1 
ATOM   1801  C CB  . ARG C  3 37  ? -1.535  -26.042 -15.373 1.00 66.85  ? 52  ARG X CB  1 
ATOM   1802  C CG  . ARG C  3 37  ? -0.883  -26.904 -14.308 1.00 72.15  ? 52  ARG X CG  1 
ATOM   1803  C CD  . ARG C  3 37  ? 0.615   -26.802 -14.432 1.00 80.00  ? 52  ARG X CD  1 
ATOM   1804  N NE  . ARG C  3 37  ? 1.313   -27.877 -13.728 1.00 93.65  ? 52  ARG X NE  1 
ATOM   1805  C CZ  . ARG C  3 37  ? 2.624   -28.093 -13.801 1.00 114.83 ? 52  ARG X CZ  1 
ATOM   1806  N NH1 . ARG C  3 37  ? 3.399   -27.295 -14.531 1.00 105.21 ? 52  ARG X NH1 1 
ATOM   1807  N NH2 . ARG C  3 37  ? 3.176   -29.092 -13.123 1.00 102.32 ? 52  ARG X NH2 1 
ATOM   1808  N N   . PHE C  3 38  ? -3.958  -24.049 -16.326 1.00 73.46  ? 53  PHE X N   1 
ATOM   1809  C CA  . PHE C  3 38  ? -4.411  -23.033 -17.272 1.00 76.16  ? 53  PHE X CA  1 
ATOM   1810  C C   . PHE C  3 38  ? -3.706  -21.732 -16.916 1.00 79.39  ? 53  PHE X C   1 
ATOM   1811  O O   . PHE C  3 38  ? -4.118  -21.032 -15.988 1.00 76.75  ? 53  PHE X O   1 
ATOM   1812  C CB  . PHE C  3 38  ? -5.940  -22.902 -17.222 1.00 79.26  ? 53  PHE X CB  1 
ATOM   1813  C CG  . PHE C  3 38  ? -6.635  -24.157 -17.690 1.00 83.70  ? 53  PHE X CG  1 
ATOM   1814  C CD1 . PHE C  3 38  ? -6.861  -24.383 -19.042 1.00 91.29  ? 53  PHE X CD1 1 
ATOM   1815  C CD2 . PHE C  3 38  ? -7.024  -25.133 -16.783 1.00 83.98  ? 53  PHE X CD2 1 
ATOM   1816  C CE1 . PHE C  3 38  ? -7.487  -25.550 -19.476 1.00 95.04  ? 53  PHE X CE1 1 
ATOM   1817  C CE2 . PHE C  3 38  ? -7.638  -26.305 -17.221 1.00 89.77  ? 53  PHE X CE2 1 
ATOM   1818  C CZ  . PHE C  3 38  ? -7.862  -26.506 -18.565 1.00 92.57  ? 53  PHE X CZ  1 
ATOM   1819  N N   . VAL C  3 39  ? -2.573  -21.473 -17.607 1.00 77.88  ? 54  VAL X N   1 
ATOM   1820  C CA  . VAL C  3 39  ? -1.667  -20.326 -17.426 1.00 75.86  ? 54  VAL X CA  1 
ATOM   1821  C C   . VAL C  3 39  ? -1.571  -19.520 -18.729 1.00 82.69  ? 54  VAL X C   1 
ATOM   1822  O O   . VAL C  3 39  ? -1.535  -20.119 -19.799 1.00 86.95  ? 54  VAL X O   1 
ATOM   1823  C CB  . VAL C  3 39  ? -0.265  -20.828 -16.995 1.00 78.54  ? 54  VAL X CB  1 
ATOM   1824  C CG1 . VAL C  3 39  ? 0.610   -19.679 -16.494 1.00 76.65  ? 54  VAL X CG1 1 
ATOM   1825  C CG2 . VAL C  3 39  ? -0.365  -21.927 -15.937 1.00 75.68  ? 54  VAL X CG2 1 
ATOM   1826  N N   . LEU C  3 40  ? -1.525  -18.175 -18.644 1.00 77.29  ? 55  LEU X N   1 
ATOM   1827  C CA  . LEU C  3 40  ? -1.412  -17.244 -19.789 1.00 80.44  ? 55  LEU X CA  1 
ATOM   1828  C C   . LEU C  3 40  ? -2.444  -17.428 -20.905 1.00 87.59  ? 55  LEU X C   1 
ATOM   1829  O O   . LEU C  3 40  ? -2.157  -17.135 -22.069 1.00 91.83  ? 55  LEU X O   1 
ATOM   1830  C CB  . LEU C  3 40  ? -0.001  -17.270 -20.400 1.00 81.93  ? 55  LEU X CB  1 
ATOM   1831  C CG  . LEU C  3 40  ? 1.046   -16.328 -19.832 1.00 84.43  ? 55  LEU X CG  1 
ATOM   1832  C CD1 . LEU C  3 40  ? 2.171   -16.154 -20.816 1.00 87.83  ? 55  LEU X CD1 1 
ATOM   1833  C CD2 . LEU C  3 40  ? 0.471   -14.963 -19.478 1.00 86.25  ? 55  LEU X CD2 1 
ATOM   1834  N N   . THR C  3 41  ? -3.639  -17.889 -20.566 1.00 82.51  ? 56  THR X N   1 
ATOM   1835  C CA  . THR C  3 41  ? -4.649  -18.136 -21.587 1.00 86.06  ? 56  THR X CA  1 
ATOM   1836  C C   . THR C  3 41  ? -5.521  -16.931 -21.815 1.00 90.01  ? 56  THR X C   1 
ATOM   1837  O O   . THR C  3 41  ? -5.671  -16.069 -20.943 1.00 86.14  ? 56  THR X O   1 
ATOM   1838  C CB  . THR C  3 41  ? -5.510  -19.368 -21.255 1.00 88.48  ? 56  THR X CB  1 
ATOM   1839  O OG1 . THR C  3 41  ? -6.543  -18.971 -20.367 1.00 85.34  ? 56  THR X OG1 1 
ATOM   1840  C CG2 . THR C  3 41  ? -4.718  -20.508 -20.649 1.00 82.44  ? 56  THR X CG2 1 
ATOM   1841  N N   . LYS C  3 42  ? -6.145  -16.916 -22.980 1.00 91.42  ? 57  LYS X N   1 
ATOM   1842  C CA  . LYS C  3 42  ? -7.100  -15.893 -23.346 1.00 93.93  ? 57  LYS X CA  1 
ATOM   1843  C C   . LYS C  3 42  ? -8.524  -16.461 -23.161 1.00 98.05  ? 57  LYS X C   1 
ATOM   1844  O O   . LYS C  3 42  ? -9.375  -16.407 -24.064 1.00 102.97 ? 57  LYS X O   1 
ATOM   1845  C CB  . LYS C  3 42  ? -6.806  -15.302 -24.739 1.00 101.30 ? 57  LYS X CB  1 
ATOM   1846  C CG  . LYS C  3 42  ? -5.490  -14.513 -24.792 1.00 108.66 ? 57  LYS X CG  1 
ATOM   1847  C CD  . LYS C  3 42  ? -5.547  -13.175 -24.039 1.00 115.80 ? 57  LYS X CD  1 
ATOM   1848  C CE  . LYS C  3 42  ? -4.179  -12.561 -23.847 1.00 122.01 ? 57  LYS X CE  1 
ATOM   1849  N NZ  . LYS C  3 42  ? -4.260  -11.119 -23.488 1.00 126.45 ? 57  LYS X NZ  1 
ATOM   1850  N N   . LEU C  3 43  ? -8.752  -17.028 -21.954 1.00 87.96  ? 58  LEU X N   1 
ATOM   1851  C CA  . LEU C  3 43  ? -10.028 -17.580 -21.529 1.00 87.76  ? 58  LEU X CA  1 
ATOM   1852  C C   . LEU C  3 43  ? -10.838 -16.424 -21.030 1.00 91.09  ? 58  LEU X C   1 
ATOM   1853  O O   . LEU C  3 43  ? -10.363 -15.665 -20.190 1.00 86.16  ? 58  LEU X O   1 
ATOM   1854  C CB  . LEU C  3 43  ? -9.853  -18.575 -20.366 1.00 82.96  ? 58  LEU X CB  1 
ATOM   1855  C CG  . LEU C  3 43  ? -9.642  -20.044 -20.688 1.00 88.01  ? 58  LEU X CG  1 
ATOM   1856  C CD1 . LEU C  3 43  ? -9.138  -20.779 -19.462 1.00 82.83  ? 58  LEU X CD1 1 
ATOM   1857  C CD2 . LEU C  3 43  ? -10.919 -20.693 -21.165 1.00 94.35  ? 58  LEU X CD2 1 
ATOM   1858  N N   . ARG C  3 44  ? -12.051 -16.276 -21.539 1.00 93.37  ? 59  ARG X N   1 
ATOM   1859  C CA  . ARG C  3 44  ? -12.917 -15.205 -21.091 1.00 94.48  ? 59  ARG X CA  1 
ATOM   1860  C C   . ARG C  3 44  ? -13.815 -15.681 -19.966 1.00 98.49  ? 59  ARG X C   1 
ATOM   1861  O O   . ARG C  3 44  ? -14.120 -14.900 -19.067 1.00 96.27  ? 59  ARG X O   1 
ATOM   1862  C CB  . ARG C  3 44  ? -13.699 -14.598 -22.259 1.00 100.68 ? 59  ARG X CB  1 
ATOM   1863  C CG  . ARG C  3 44  ? -12.881 -13.542 -23.004 1.00 112.08 ? 59  ARG X CG  1 
ATOM   1864  C CD  . ARG C  3 44  ? -13.578 -12.963 -24.229 1.00 131.39 ? 59  ARG X CD  1 
ATOM   1865  N NE  . ARG C  3 44  ? -14.848 -12.289 -23.929 1.00 143.64 ? 59  ARG X NE  1 
ATOM   1866  C CZ  . ARG C  3 44  ? -14.961 -11.050 -23.455 1.00 157.86 ? 59  ARG X CZ  1 
ATOM   1867  N NH1 . ARG C  3 44  ? -13.876 -10.332 -23.182 1.00 141.95 ? 59  ARG X NH1 1 
ATOM   1868  N NH2 . ARG C  3 44  ? -16.159 -10.529 -23.227 1.00 148.18 ? 59  ARG X NH2 1 
ATOM   1869  N N   . VAL C  3 45  ? -14.216 -16.971 -20.003 1.00 97.36  ? 60  VAL X N   1 
ATOM   1870  C CA  . VAL C  3 45  ? -15.102 -17.627 -19.033 1.00 96.99  ? 60  VAL X CA  1 
ATOM   1871  C C   . VAL C  3 45  ? -14.698 -19.106 -18.936 1.00 101.61 ? 60  VAL X C   1 
ATOM   1872  O O   . VAL C  3 45  ? -14.444 -19.733 -19.972 1.00 104.22 ? 60  VAL X O   1 
ATOM   1873  C CB  . VAL C  3 45  ? -16.606 -17.548 -19.476 1.00 107.05 ? 60  VAL X CB  1 
ATOM   1874  C CG1 . VAL C  3 45  ? -17.524 -18.258 -18.487 1.00 106.18 ? 60  VAL X CG1 1 
ATOM   1875  C CG2 . VAL C  3 45  ? -17.087 -16.119 -19.711 1.00 109.56 ? 60  VAL X CG2 1 
ATOM   1876  N N   . ILE C  3 46  ? -14.721 -19.681 -17.712 1.00 95.51  ? 61  ILE X N   1 
ATOM   1877  C CA  . ILE C  3 46  ? -14.496 -21.113 -17.513 1.00 94.78  ? 61  ILE X CA  1 
ATOM   1878  C C   . ILE C  3 46  ? -15.885 -21.768 -17.423 1.00 101.57 ? 61  ILE X C   1 
ATOM   1879  O O   . ILE C  3 46  ? -16.581 -21.643 -16.416 1.00 98.85  ? 61  ILE X O   1 
ATOM   1880  C CB  . ILE C  3 46  ? -13.484 -21.492 -16.399 1.00 92.91  ? 61  ILE X CB  1 
ATOM   1881  C CG1 . ILE C  3 46  ? -13.918 -20.997 -15.012 1.00 91.13  ? 61  ILE X CG1 1 
ATOM   1882  C CG2 . ILE C  3 46  ? -12.063 -20.987 -16.756 1.00 92.22  ? 61  ILE X CG2 1 
ATOM   1883  C CD1 . ILE C  3 46  ? -13.185 -21.693 -13.860 1.00 101.32 ? 61  ILE X CD1 1 
ATOM   1884  N N   . GLN C  3 47  ? -16.308 -22.351 -18.569 1.00 104.04 ? 62  GLN X N   1 
ATOM   1885  C CA  . GLN C  3 47  ? -17.594 -22.979 -18.937 1.00 108.90 ? 62  GLN X CA  1 
ATOM   1886  C C   . GLN C  3 47  ? -18.260 -23.816 -17.851 1.00 109.86 ? 62  GLN X C   1 
ATOM   1887  O O   . GLN C  3 47  ? -17.567 -24.479 -17.080 1.00 105.06 ? 62  GLN X O   1 
ATOM   1888  C CB  . GLN C  3 47  ? -17.443 -23.829 -20.219 1.00 115.08 ? 62  GLN X CB  1 
ATOM   1889  C CG  . GLN C  3 47  ? -16.866 -23.089 -21.444 1.00 143.87 ? 62  GLN X CG  1 
ATOM   1890  C CD  . GLN C  3 47  ? -15.342 -23.035 -21.471 1.00 168.79 ? 62  GLN X CD  1 
ATOM   1891  O OE1 . GLN C  3 47  ? -14.646 -24.037 -21.250 1.00 166.20 ? 62  GLN X OE1 1 
ATOM   1892  N NE2 . GLN C  3 47  ? -14.785 -21.863 -21.765 1.00 159.88 ? 62  GLN X NE2 1 
ATOM   1893  N N   . LYS C  3 48  ? -19.614 -23.798 -17.816 1.00 109.47 ? 63  LYS X N   1 
ATOM   1894  C CA  . LYS C  3 48  ? -20.440 -24.546 -16.855 1.00 108.89 ? 63  LYS X CA  1 
ATOM   1895  C C   . LYS C  3 48  ? -20.099 -26.052 -16.882 1.00 112.49 ? 63  LYS X C   1 
ATOM   1896  O O   . LYS C  3 48  ? -20.166 -26.680 -17.941 1.00 116.21 ? 63  LYS X O   1 
ATOM   1897  C CB  . LYS C  3 48  ? -21.949 -24.278 -17.096 1.00 116.77 ? 63  LYS X CB  1 
ATOM   1898  C CG  . LYS C  3 48  ? -22.874 -24.936 -16.072 1.00 126.93 ? 63  LYS X CG  1 
ATOM   1899  C CD  . LYS C  3 48  ? -24.176 -24.185 -15.835 1.00 136.49 ? 63  LYS X CD  1 
ATOM   1900  C CE  . LYS C  3 48  ? -25.042 -24.945 -14.852 1.00 141.37 ? 63  LYS X CE  1 
ATOM   1901  N NZ  . LYS C  3 48  ? -26.279 -24.204 -14.495 1.00 150.59 ? 63  LYS X NZ  1 
ATOM   1902  N N   . GLY C  3 49  ? -19.683 -26.579 -15.727 1.00 104.53 ? 64  GLY X N   1 
ATOM   1903  C CA  . GLY C  3 49  ? -19.277 -27.972 -15.553 1.00 103.79 ? 64  GLY X CA  1 
ATOM   1904  C C   . GLY C  3 49  ? -18.159 -28.375 -16.490 1.00 108.60 ? 64  GLY X C   1 
ATOM   1905  O O   . GLY C  3 49  ? -18.328 -29.304 -17.286 1.00 112.64 ? 64  GLY X O   1 
ATOM   1906  N N   . ALA C  3 50  ? -17.030 -27.639 -16.431 1.00 101.00 ? 65  ALA X N   1 
ATOM   1907  C CA  . ALA C  3 50  ? -15.873 -27.823 -17.305 1.00 100.55 ? 65  ALA X CA  1 
ATOM   1908  C C   . ALA C  3 50  ? -14.959 -28.946 -16.877 1.00 101.70 ? 65  ALA X C   1 
ATOM   1909  O O   . ALA C  3 50  ? -14.456 -29.672 -17.732 1.00 103.01 ? 65  ALA X O   1 
ATOM   1910  C CB  . ALA C  3 50  ? -15.082 -26.528 -17.404 1.00 98.71  ? 65  ALA X CB  1 
ATOM   1911  N N   . PHE C  3 51  ? -14.698 -29.060 -15.569 1.00 95.03  ? 66  PHE X N   1 
ATOM   1912  C CA  . PHE C  3 51  ? -13.795 -30.075 -15.030 1.00 92.91  ? 66  PHE X CA  1 
ATOM   1913  C C   . PHE C  3 51  ? -14.583 -31.176 -14.339 1.00 99.65  ? 66  PHE X C   1 
ATOM   1914  O O   . PHE C  3 51  ? -14.155 -31.685 -13.305 1.00 97.53  ? 66  PHE X O   1 
ATOM   1915  C CB  . PHE C  3 51  ? -12.766 -29.449 -14.056 1.00 89.10  ? 66  PHE X CB  1 
ATOM   1916  C CG  . PHE C  3 51  ? -12.248 -28.067 -14.377 1.00 88.67  ? 66  PHE X CG  1 
ATOM   1917  C CD1 . PHE C  3 51  ? -11.431 -27.852 -15.480 1.00 93.35  ? 66  PHE X CD1 1 
ATOM   1918  C CD2 . PHE C  3 51  ? -12.542 -26.991 -13.552 1.00 88.15  ? 66  PHE X CD2 1 
ATOM   1919  C CE1 . PHE C  3 51  ? -10.949 -26.573 -15.774 1.00 93.81  ? 66  PHE X CE1 1 
ATOM   1920  C CE2 . PHE C  3 51  ? -12.047 -25.715 -13.835 1.00 90.37  ? 66  PHE X CE2 1 
ATOM   1921  C CZ  . PHE C  3 51  ? -11.253 -25.512 -14.945 1.00 90.26  ? 66  PHE X CZ  1 
ATOM   1922  N N   . SER C  3 52  ? -15.726 -31.550 -14.900 1.00 100.67 ? 67  SER X N   1 
ATOM   1923  C CA  . SER C  3 52  ? -16.531 -32.588 -14.287 1.00 102.65 ? 67  SER X CA  1 
ATOM   1924  C C   . SER C  3 52  ? -16.343 -33.886 -15.044 1.00 110.07 ? 67  SER X C   1 
ATOM   1925  O O   . SER C  3 52  ? -16.565 -33.932 -16.255 1.00 114.06 ? 67  SER X O   1 
ATOM   1926  C CB  . SER C  3 52  ? -17.996 -32.167 -14.243 1.00 111.17 ? 67  SER X CB  1 
ATOM   1927  O OG  . SER C  3 52  ? -18.128 -30.881 -13.657 1.00 120.17 ? 67  SER X OG  1 
ATOM   1928  N N   . GLY C  3 53  ? -15.899 -34.913 -14.328 1.00 104.79 ? 68  GLY X N   1 
ATOM   1929  C CA  . GLY C  3 53  ? -15.647 -36.230 -14.899 1.00 107.88 ? 68  GLY X CA  1 
ATOM   1930  C C   . GLY C  3 53  ? -14.261 -36.776 -14.622 1.00 109.75 ? 68  GLY X C   1 
ATOM   1931  O O   . GLY C  3 53  ? -14.071 -37.997 -14.628 1.00 111.11 ? 68  GLY X O   1 
ATOM   1932  N N   . PHE C  3 54  ? -13.277 -35.879 -14.375 1.00 102.64 ? 69  PHE X N   1 
ATOM   1933  C CA  . PHE C  3 54  ? -11.889 -36.258 -14.095 1.00 99.92  ? 69  PHE X CA  1 
ATOM   1934  C C   . PHE C  3 54  ? -11.775 -36.823 -12.671 1.00 101.14 ? 69  PHE X C   1 
ATOM   1935  O O   . PHE C  3 54  ? -11.318 -36.147 -11.741 1.00 96.23  ? 69  PHE X O   1 
ATOM   1936  C CB  . PHE C  3 54  ? -10.933 -35.078 -14.324 1.00 98.71  ? 69  PHE X CB  1 
ATOM   1937  C CG  . PHE C  3 54  ? -11.023 -34.381 -15.661 1.00 103.24 ? 69  PHE X CG  1 
ATOM   1938  C CD1 . PHE C  3 54  ? -11.928 -33.344 -15.864 1.00 107.06 ? 69  PHE X CD1 1 
ATOM   1939  C CD2 . PHE C  3 54  ? -10.152 -34.704 -16.690 1.00 107.48 ? 69  PHE X CD2 1 
ATOM   1940  C CE1 . PHE C  3 54  ? -12.001 -32.689 -17.095 1.00 110.84 ? 69  PHE X CE1 1 
ATOM   1941  C CE2 . PHE C  3 54  ? -10.226 -34.048 -17.921 1.00 113.24 ? 69  PHE X CE2 1 
ATOM   1942  C CZ  . PHE C  3 54  ? -11.149 -33.044 -18.115 1.00 112.02 ? 69  PHE X CZ  1 
ATOM   1943  N N   . GLY C  3 55  ? -12.220 -38.069 -12.526 1.00 100.89 ? 70  GLY X N   1 
ATOM   1944  C CA  . GLY C  3 55  ? -12.234 -38.798 -11.263 1.00 99.39  ? 70  GLY X CA  1 
ATOM   1945  C C   . GLY C  3 55  ? -10.866 -39.076 -10.669 1.00 101.16 ? 70  GLY X C   1 
ATOM   1946  O O   . GLY C  3 55  ? -10.778 -39.540 -9.527  1.00 99.82  ? 70  GLY X O   1 
ATOM   1947  N N   . ASP C  3 56  ? -9.789  -38.799 -11.440 1.00 96.45  ? 71  ASP X N   1 
ATOM   1948  C CA  . ASP C  3 56  ? -8.411  -39.013 -11.010 1.00 93.59  ? 71  ASP X CA  1 
ATOM   1949  C C   . ASP C  3 56  ? -7.756  -37.711 -10.581 1.00 92.28  ? 71  ASP X C   1 
ATOM   1950  O O   . ASP C  3 56  ? -6.850  -37.732 -9.741  1.00 89.96  ? 71  ASP X O   1 
ATOM   1951  C CB  . ASP C  3 56  ? -7.590  -39.683 -12.128 1.00 98.80  ? 71  ASP X CB  1 
ATOM   1952  C CG  . ASP C  3 56  ? -7.738  -41.196 -12.203 1.00 114.86 ? 71  ASP X CG  1 
ATOM   1953  O OD1 . ASP C  3 56  ? -7.516  -41.868 -11.166 1.00 115.57 ? 71  ASP X OD1 1 
ATOM   1954  O OD2 . ASP C  3 56  ? -8.036  -41.713 -13.309 1.00 122.67 ? 71  ASP X OD2 1 
ATOM   1955  N N   . LEU C  3 57  ? -8.222  -36.580 -11.169 1.00 86.15  ? 72  LEU X N   1 
ATOM   1956  C CA  . LEU C  3 57  ? -7.720  -35.220 -10.993 1.00 80.55  ? 72  LEU X CA  1 
ATOM   1957  C C   . LEU C  3 57  ? -7.658  -34.793 -9.546  1.00 79.39  ? 72  LEU X C   1 
ATOM   1958  O O   . LEU C  3 57  ? -8.669  -34.815 -8.850  1.00 78.16  ? 72  LEU X O   1 
ATOM   1959  C CB  . LEU C  3 57  ? -8.546  -34.250 -11.851 1.00 81.40  ? 72  LEU X CB  1 
ATOM   1960  C CG  . LEU C  3 57  ? -8.179  -32.761 -11.903 1.00 82.99  ? 72  LEU X CG  1 
ATOM   1961  C CD1 . LEU C  3 57  ? -6.826  -32.529 -12.546 1.00 83.03  ? 72  LEU X CD1 1 
ATOM   1962  C CD2 . LEU C  3 57  ? -9.194  -32.009 -12.707 1.00 86.50  ? 72  LEU X CD2 1 
ATOM   1963  N N   . GLU C  3 58  ? -6.448  -34.411 -9.106  1.00 73.48  ? 73  GLU X N   1 
ATOM   1964  C CA  . GLU C  3 58  ? -6.145  -33.996 -7.735  1.00 68.78  ? 73  GLU X CA  1 
ATOM   1965  C C   . GLU C  3 58  ? -5.708  -32.516 -7.587  1.00 65.71  ? 73  GLU X C   1 
ATOM   1966  O O   . GLU C  3 58  ? -5.896  -31.961 -6.502  1.00 61.98  ? 73  GLU X O   1 
ATOM   1967  C CB  . GLU C  3 58  ? -5.129  -34.947 -7.064  1.00 69.81  ? 73  GLU X CB  1 
ATOM   1968  C CG  . GLU C  3 58  ? -4.222  -35.736 -7.994  1.00 80.41  ? 73  GLU X CG  1 
ATOM   1969  C CD  . GLU C  3 58  ? -3.221  -36.589 -7.247  1.00 96.32  ? 73  GLU X CD  1 
ATOM   1970  O OE1 . GLU C  3 58  ? -2.170  -36.048 -6.833  1.00 87.22  ? 73  GLU X OE1 1 
ATOM   1971  O OE2 . GLU C  3 58  ? -3.500  -37.793 -7.047  1.00 95.13  ? 73  GLU X OE2 1 
ATOM   1972  N N   . LYS C  3 59  ? -5.189  -31.869 -8.661  1.00 61.39  ? 74  LYS X N   1 
ATOM   1973  C CA  . LYS C  3 59  ? -4.754  -30.451 -8.630  1.00 58.23  ? 74  LYS X CA  1 
ATOM   1974  C C   . LYS C  3 59  ? -5.226  -29.641 -9.856  1.00 64.88  ? 74  LYS X C   1 
ATOM   1975  O O   . LYS C  3 59  ? -5.108  -30.114 -10.988 1.00 68.01  ? 74  LYS X O   1 
ATOM   1976  C CB  . LYS C  3 59  ? -3.215  -30.334 -8.546  1.00 58.43  ? 74  LYS X CB  1 
ATOM   1977  C CG  . LYS C  3 59  ? -2.550  -30.755 -7.241  1.00 64.03  ? 74  LYS X CG  1 
ATOM   1978  C CD  . LYS C  3 59  ? -1.043  -30.450 -7.241  1.00 66.45  ? 74  LYS X CD  1 
ATOM   1979  C CE  . LYS C  3 59  ? -0.268  -31.212 -6.172  1.00 77.53  ? 74  LYS X CE  1 
ATOM   1980  N NZ  . LYS C  3 59  ? -0.267  -30.549 -4.826  1.00 80.02  ? 74  LYS X NZ  1 
ATOM   1981  N N   . ILE C  3 60  ? -5.700  -28.404 -9.635  1.00 60.31  ? 75  ILE X N   1 
ATOM   1982  C CA  . ILE C  3 60  ? -6.124  -27.482 -10.706 1.00 62.26  ? 75  ILE X CA  1 
ATOM   1983  C C   . ILE C  3 60  ? -5.450  -26.156 -10.485 1.00 65.19  ? 75  ILE X C   1 
ATOM   1984  O O   . ILE C  3 60  ? -5.399  -25.709 -9.346  1.00 63.15  ? 75  ILE X O   1 
ATOM   1985  C CB  . ILE C  3 60  ? -7.662  -27.316 -10.788 1.00 66.85  ? 75  ILE X CB  1 
ATOM   1986  C CG1 . ILE C  3 60  ? -8.314  -28.542 -11.455 1.00 70.05  ? 75  ILE X CG1 1 
ATOM   1987  C CG2 . ILE C  3 60  ? -8.065  -25.991 -11.494 1.00 67.91  ? 75  ILE X CG2 1 
ATOM   1988  C CD1 . ILE C  3 60  ? -9.825  -28.632 -11.275 1.00 73.20  ? 75  ILE X CD1 1 
ATOM   1989  N N   . GLU C  3 61  ? -4.943  -25.523 -11.560 1.00 63.57  ? 76  GLU X N   1 
ATOM   1990  C CA  . GLU C  3 61  ? -4.247  -24.227 -11.508 1.00 61.46  ? 76  GLU X CA  1 
ATOM   1991  C C   . GLU C  3 61  ? -4.813  -23.282 -12.579 1.00 68.34  ? 76  GLU X C   1 
ATOM   1992  O O   . GLU C  3 61  ? -4.792  -23.609 -13.768 1.00 72.07  ? 76  GLU X O   1 
ATOM   1993  C CB  . GLU C  3 61  ? -2.725  -24.428 -11.711 1.00 61.95  ? 76  GLU X CB  1 
ATOM   1994  C CG  . GLU C  3 61  ? -1.866  -23.218 -11.375 1.00 71.30  ? 76  GLU X CG  1 
ATOM   1995  C CD  . GLU C  3 61  ? -0.395  -23.325 -11.742 1.00 96.82  ? 76  GLU X CD  1 
ATOM   1996  O OE1 . GLU C  3 61  ? 0.345   -24.049 -11.040 1.00 94.83  ? 76  GLU X OE1 1 
ATOM   1997  O OE2 . GLU C  3 61  ? 0.031   -22.645 -12.705 1.00 91.03  ? 76  GLU X OE2 1 
ATOM   1998  N N   . ILE C  3 62  ? -5.356  -22.133 -12.151 1.00 62.34  ? 77  ILE X N   1 
ATOM   1999  C CA  . ILE C  3 62  ? -5.867  -21.093 -13.044 1.00 63.67  ? 77  ILE X CA  1 
ATOM   2000  C C   . ILE C  3 62  ? -5.077  -19.792 -12.738 1.00 66.18  ? 77  ILE X C   1 
ATOM   2001  O O   . ILE C  3 62  ? -5.496  -18.960 -11.930 1.00 63.76  ? 77  ILE X O   1 
ATOM   2002  C CB  . ILE C  3 62  ? -7.417  -20.944 -13.012 1.00 67.38  ? 77  ILE X CB  1 
ATOM   2003  C CG1 . ILE C  3 62  ? -8.110  -22.278 -13.290 1.00 68.54  ? 77  ILE X CG1 1 
ATOM   2004  C CG2 . ILE C  3 62  ? -7.884  -19.884 -14.025 1.00 71.25  ? 77  ILE X CG2 1 
ATOM   2005  C CD1 . ILE C  3 62  ? -9.497  -22.384 -12.706 1.00 73.13  ? 77  ILE X CD1 1 
ATOM   2006  N N   . SER C  3 63  ? -3.901  -19.665 -13.350 1.00 63.93  ? 78  SER X N   1 
ATOM   2007  C CA  . SER C  3 63  ? -3.036  -18.519 -13.113 1.00 62.69  ? 78  SER X CA  1 
ATOM   2008  C C   . SER C  3 63  ? -2.772  -17.658 -14.349 1.00 68.58  ? 78  SER X C   1 
ATOM   2009  O O   . SER C  3 63  ? -2.899  -18.117 -15.487 1.00 71.04  ? 78  SER X O   1 
ATOM   2010  C CB  . SER C  3 63  ? -1.725  -18.950 -12.452 1.00 64.54  ? 78  SER X CB  1 
ATOM   2011  O OG  . SER C  3 63  ? -1.001  -19.903 -13.213 1.00 75.63  ? 78  SER X OG  1 
ATOM   2012  N N   . GLN C  3 64  ? -2.423  -16.387 -14.088 1.00 63.68  ? 79  GLN X N   1 
ATOM   2013  C CA  . GLN C  3 64  ? -2.077  -15.331 -15.041 1.00 65.86  ? 79  GLN X CA  1 
ATOM   2014  C C   . GLN C  3 64  ? -2.999  -15.259 -16.277 1.00 73.61  ? 79  GLN X C   1 
ATOM   2015  O O   . GLN C  3 64  ? -2.527  -15.329 -17.407 1.00 75.75  ? 79  GLN X O   1 
ATOM   2016  C CB  . GLN C  3 64  ? -0.597  -15.419 -15.425 1.00 67.18  ? 79  GLN X CB  1 
ATOM   2017  C CG  . GLN C  3 64  ? 0.295   -14.774 -14.362 1.00 77.61  ? 79  GLN X CG  1 
ATOM   2018  C CD  . GLN C  3 64  ? 1.547   -15.555 -14.073 1.00 90.08  ? 79  GLN X CD  1 
ATOM   2019  O OE1 . GLN C  3 64  ? 2.601   -15.292 -14.651 1.00 81.01  ? 79  GLN X OE1 1 
ATOM   2020  N NE2 . GLN C  3 64  ? 1.469   -16.501 -13.135 1.00 83.59  ? 79  GLN X NE2 1 
ATOM   2021  N N   . ASN C  3 65  ? -4.314  -15.084 -16.043 1.00 71.63  ? 80  ASN X N   1 
ATOM   2022  C CA  . ASN C  3 65  ? -5.320  -14.950 -17.104 1.00 76.69  ? 80  ASN X CA  1 
ATOM   2023  C C   . ASN C  3 65  ? -5.971  -13.557 -17.009 1.00 82.86  ? 80  ASN X C   1 
ATOM   2024  O O   . ASN C  3 65  ? -6.819  -13.297 -16.140 1.00 81.45  ? 80  ASN X O   1 
ATOM   2025  C CB  . ASN C  3 65  ? -6.351  -16.084 -17.053 1.00 78.61  ? 80  ASN X CB  1 
ATOM   2026  C CG  . ASN C  3 65  ? -5.738  -17.459 -17.048 1.00 96.35  ? 80  ASN X CG  1 
ATOM   2027  O OD1 . ASN C  3 65  ? -5.297  -17.973 -18.081 1.00 89.72  ? 80  ASN X OD1 1 
ATOM   2028  N ND2 . ASN C  3 65  ? -5.682  -18.075 -15.874 1.00 84.64  ? 80  ASN X ND2 1 
ATOM   2029  N N   . ASP C  3 66  ? -5.524  -12.651 -17.886 1.00 81.94  ? 81  ASP X N   1 
ATOM   2030  C CA  . ASP C  3 66  ? -5.951  -11.261 -17.878 1.00 83.51  ? 81  ASP X CA  1 
ATOM   2031  C C   . ASP C  3 66  ? -7.324  -10.996 -18.512 1.00 91.59  ? 81  ASP X C   1 
ATOM   2032  O O   . ASP C  3 66  ? -7.879  -9.914  -18.305 1.00 91.74  ? 81  ASP X O   1 
ATOM   2033  C CB  . ASP C  3 66  ? -4.873  -10.353 -18.493 1.00 87.26  ? 81  ASP X CB  1 
ATOM   2034  C CG  . ASP C  3 66  ? -4.297  -10.830 -19.810 1.00 104.65 ? 81  ASP X CG  1 
ATOM   2035  O OD1 . ASP C  3 66  ? -5.063  -10.915 -20.800 1.00 111.03 ? 81  ASP X OD1 1 
ATOM   2036  O OD2 . ASP C  3 66  ? -3.071  -11.061 -19.869 1.00 107.95 ? 81  ASP X OD2 1 
ATOM   2037  N N   . VAL C  3 67  ? -7.894  -11.966 -19.245 1.00 91.53  ? 82  VAL X N   1 
ATOM   2038  C CA  . VAL C  3 67  ? -9.209  -11.731 -19.852 1.00 95.73  ? 82  VAL X CA  1 
ATOM   2039  C C   . VAL C  3 67  ? -10.311 -12.613 -19.222 1.00 99.92  ? 82  VAL X C   1 
ATOM   2040  O O   . VAL C  3 67  ? -11.453 -12.554 -19.686 1.00 103.73 ? 82  VAL X O   1 
ATOM   2041  C CB  . VAL C  3 67  ? -9.219  -11.785 -21.400 1.00 104.46 ? 82  VAL X CB  1 
ATOM   2042  C CG1 . VAL C  3 67  ? -8.277  -10.740 -21.991 1.00 105.58 ? 82  VAL X CG1 1 
ATOM   2043  C CG2 . VAL C  3 67  ? -8.886  -13.173 -21.916 1.00 104.37 ? 82  VAL X CG2 1 
ATOM   2044  N N   . LEU C  3 68  ? -9.995  -13.376 -18.140 1.00 91.81  ? 83  LEU X N   1 
ATOM   2045  C CA  . LEU C  3 68  ? -11.007 -14.178 -17.450 1.00 91.05  ? 83  LEU X CA  1 
ATOM   2046  C C   . LEU C  3 68  ? -11.892 -13.283 -16.592 1.00 94.65  ? 83  LEU X C   1 
ATOM   2047  O O   . LEU C  3 68  ? -11.379 -12.512 -15.788 1.00 91.33  ? 83  LEU X O   1 
ATOM   2048  C CB  . LEU C  3 68  ? -10.384 -15.306 -16.616 1.00 86.76  ? 83  LEU X CB  1 
ATOM   2049  C CG  . LEU C  3 68  ? -11.363 -16.136 -15.769 1.00 90.65  ? 83  LEU X CG  1 
ATOM   2050  C CD1 . LEU C  3 68  ? -12.131 -17.149 -16.615 1.00 94.50  ? 83  LEU X CD1 1 
ATOM   2051  C CD2 . LEU C  3 68  ? -10.645 -16.814 -14.630 1.00 89.02  ? 83  LEU X CD2 1 
ATOM   2052  N N   . GLU C  3 69  ? -13.215 -13.402 -16.762 1.00 95.30  ? 84  GLU X N   1 
ATOM   2053  C CA  . GLU C  3 69  ? -14.208 -12.582 -16.076 1.00 96.50  ? 84  GLU X CA  1 
ATOM   2054  C C   . GLU C  3 69  ? -15.104 -13.337 -15.090 1.00 101.04 ? 84  GLU X C   1 
ATOM   2055  O O   . GLU C  3 69  ? -15.359 -12.809 -14.004 1.00 99.58  ? 84  GLU X O   1 
ATOM   2056  C CB  . GLU C  3 69  ? -15.060 -11.819 -17.100 1.00 103.80 ? 84  GLU X CB  1 
ATOM   2057  C CG  . GLU C  3 69  ? -14.275 -10.741 -17.839 1.00 113.34 ? 84  GLU X CG  1 
ATOM   2058  C CD  . GLU C  3 69  ? -14.885 -10.213 -19.125 1.00 122.76 ? 84  GLU X CD  1 
ATOM   2059  O OE1 . GLU C  3 69  ? -16.097 -9.896  -19.122 1.00 88.81  ? 84  GLU X OE1 1 
ATOM   2060  O OE2 . GLU C  3 69  ? -14.135 -10.061 -20.119 1.00 115.43 ? 84  GLU X OE2 1 
ATOM   2061  N N   . VAL C  3 70  ? -15.614 -14.535 -15.453 1.00 99.38  ? 85  VAL X N   1 
ATOM   2062  C CA  . VAL C  3 70  ? -16.512 -15.280 -14.552 1.00 98.69  ? 85  VAL X CA  1 
ATOM   2063  C C   . VAL C  3 70  ? -16.228 -16.764 -14.461 1.00 100.78 ? 85  VAL X C   1 
ATOM   2064  O O   . VAL C  3 70  ? -15.870 -17.412 -15.450 1.00 102.58 ? 85  VAL X O   1 
ATOM   2065  C CB  . VAL C  3 70  ? -18.034 -15.077 -14.819 1.00 107.66 ? 85  VAL X CB  1 
ATOM   2066  C CG1 . VAL C  3 70  ? -18.483 -13.645 -14.547 1.00 109.47 ? 85  VAL X CG1 1 
ATOM   2067  C CG2 . VAL C  3 70  ? -18.434 -15.525 -16.217 1.00 112.35 ? 85  VAL X CG2 1 
ATOM   2068  N N   . ILE C  3 71  ? -16.496 -17.305 -13.268 1.00 93.24  ? 86  ILE X N   1 
ATOM   2069  C CA  . ILE C  3 71  ? -16.420 -18.721 -12.954 1.00 90.56  ? 86  ILE X CA  1 
ATOM   2070  C C   . ILE C  3 71  ? -17.883 -19.163 -12.796 1.00 98.53  ? 86  ILE X C   1 
ATOM   2071  O O   . ILE C  3 71  ? -18.561 -18.767 -11.842 1.00 97.82  ? 86  ILE X O   1 
ATOM   2072  C CB  . ILE C  3 71  ? -15.515 -18.966 -11.721 1.00 87.17  ? 86  ILE X CB  1 
ATOM   2073  C CG1 . ILE C  3 71  ? -14.038 -18.626 -12.090 1.00 83.97  ? 86  ILE X CG1 1 
ATOM   2074  C CG2 . ILE C  3 71  ? -15.669 -20.403 -11.194 1.00 85.90  ? 86  ILE X CG2 1 
ATOM   2075  C CD1 . ILE C  3 71  ? -13.038 -18.647 -10.998 1.00 80.54  ? 86  ILE X CD1 1 
ATOM   2076  N N   . GLU C  3 72  ? -18.382 -19.904 -13.804 1.00 99.21  ? 87  GLU X N   1 
ATOM   2077  C CA  . GLU C  3 72  ? -19.760 -20.396 -13.910 1.00 103.60 ? 87  GLU X CA  1 
ATOM   2078  C C   . GLU C  3 72  ? -20.173 -21.360 -12.777 1.00 107.23 ? 87  GLU X C   1 
ATOM   2079  O O   . GLU C  3 72  ? -19.342 -21.796 -11.976 1.00 101.51 ? 87  GLU X O   1 
ATOM   2080  C CB  . GLU C  3 72  ? -19.959 -21.092 -15.270 1.00 109.22 ? 87  GLU X CB  1 
ATOM   2081  C CG  . GLU C  3 72  ? -20.069 -20.168 -16.463 1.00 121.79 ? 87  GLU X CG  1 
ATOM   2082  C CD  . GLU C  3 72  ? -21.479 -19.928 -16.962 1.00 156.15 ? 87  GLU X CD  1 
ATOM   2083  O OE1 . GLU C  3 72  ? -22.190 -20.913 -17.275 1.00 159.80 ? 87  GLU X OE1 1 
ATOM   2084  O OE2 . GLU C  3 72  ? -21.856 -18.741 -17.088 1.00 154.02 ? 87  GLU X OE2 1 
ATOM   2085  N N   . ALA C  3 73  ? -21.471 -21.707 -12.740 1.00 109.43 ? 88  ALA X N   1 
ATOM   2086  C CA  . ALA C  3 73  ? -22.045 -22.663 -11.796 1.00 109.32 ? 88  ALA X CA  1 
ATOM   2087  C C   . ALA C  3 73  ? -21.578 -24.069 -12.183 1.00 114.19 ? 88  ALA X C   1 
ATOM   2088  O O   . ALA C  3 73  ? -21.223 -24.295 -13.343 1.00 116.27 ? 88  ALA X O   1 
ATOM   2089  C CB  . ALA C  3 73  ? -23.562 -22.597 -11.868 1.00 115.54 ? 88  ALA X CB  1 
ATOM   2090  N N   . ASP C  3 74  ? -21.567 -25.004 -11.209 1.00 108.68 ? 89  ASP X N   1 
ATOM   2091  C CA  . ASP C  3 74  ? -21.215 -26.423 -11.357 1.00 108.03 ? 89  ASP X CA  1 
ATOM   2092  C C   . ASP C  3 74  ? -19.827 -26.710 -11.955 1.00 107.61 ? 89  ASP X C   1 
ATOM   2093  O O   . ASP C  3 74  ? -19.577 -27.848 -12.347 1.00 108.13 ? 89  ASP X O   1 
ATOM   2094  C CB  . ASP C  3 74  ? -22.298 -27.158 -12.167 1.00 116.32 ? 89  ASP X CB  1 
ATOM   2095  C CG  . ASP C  3 74  ? -23.308 -27.890 -11.316 1.00 136.49 ? 89  ASP X CG  1 
ATOM   2096  O OD1 . ASP C  3 74  ? -22.891 -28.766 -10.522 1.00 136.10 ? 89  ASP X OD1 1 
ATOM   2097  O OD2 . ASP C  3 74  ? -24.526 -27.635 -11.488 1.00 148.92 ? 89  ASP X OD2 1 
ATOM   2098  N N   . VAL C  3 75  ? -18.921 -25.710 -11.993 1.00 100.22 ? 90  VAL X N   1 
ATOM   2099  C CA  . VAL C  3 75  ? -17.563 -25.854 -12.546 1.00 97.41  ? 90  VAL X CA  1 
ATOM   2100  C C   . VAL C  3 75  ? -16.700 -26.852 -11.743 1.00 95.52  ? 90  VAL X C   1 
ATOM   2101  O O   . VAL C  3 75  ? -16.160 -27.795 -12.335 1.00 96.51  ? 90  VAL X O   1 
ATOM   2102  C CB  . VAL C  3 75  ? -16.868 -24.482 -12.727 1.00 99.58  ? 90  VAL X CB  1 
ATOM   2103  C CG1 . VAL C  3 75  ? -15.374 -24.636 -12.988 1.00 96.30  ? 90  VAL X CG1 1 
ATOM   2104  C CG2 . VAL C  3 75  ? -17.524 -23.694 -13.850 1.00 104.03 ? 90  VAL X CG2 1 
ATOM   2105  N N   . PHE C  3 76  ? -16.585 -26.653 -10.411 1.00 85.57  ? 91  PHE X N   1 
ATOM   2106  C CA  . PHE C  3 76  ? -15.805 -27.530 -9.534  1.00 80.48  ? 91  PHE X CA  1 
ATOM   2107  C C   . PHE C  3 76  ? -16.665 -28.668 -8.943  1.00 85.47  ? 91  PHE X C   1 
ATOM   2108  O O   . PHE C  3 76  ? -16.712 -28.857 -7.723  1.00 82.71  ? 91  PHE X O   1 
ATOM   2109  C CB  . PHE C  3 76  ? -15.056 -26.711 -8.460  1.00 76.58  ? 91  PHE X CB  1 
ATOM   2110  C CG  . PHE C  3 76  ? -14.112 -25.698 -9.060  1.00 75.19  ? 91  PHE X CG  1 
ATOM   2111  C CD1 . PHE C  3 76  ? -12.889 -26.089 -9.586  1.00 76.16  ? 91  PHE X CD1 1 
ATOM   2112  C CD2 . PHE C  3 76  ? -14.470 -24.360 -9.148  1.00 76.31  ? 91  PHE X CD2 1 
ATOM   2113  C CE1 . PHE C  3 76  ? -12.042 -25.159 -10.192 1.00 75.84  ? 91  PHE X CE1 1 
ATOM   2114  C CE2 . PHE C  3 76  ? -13.618 -23.430 -9.739  1.00 77.24  ? 91  PHE X CE2 1 
ATOM   2115  C CZ  . PHE C  3 76  ? -12.410 -23.835 -10.257 1.00 74.27  ? 91  PHE X CZ  1 
ATOM   2116  N N   . SER C  3 77  ? -17.337 -29.427 -9.835  1.00 85.98  ? 92  SER X N   1 
ATOM   2117  C CA  . SER C  3 77  ? -18.196 -30.566 -9.489  1.00 88.78  ? 92  SER X CA  1 
ATOM   2118  C C   . SER C  3 77  ? -17.604 -31.913 -9.942  1.00 92.78  ? 92  SER X C   1 
ATOM   2119  O O   . SER C  3 77  ? -16.713 -31.936 -10.797 1.00 92.21  ? 92  SER X O   1 
ATOM   2120  C CB  . SER C  3 77  ? -19.606 -30.376 -10.054 1.00 98.63  ? 92  SER X CB  1 
ATOM   2121  O OG  . SER C  3 77  ? -19.763 -30.756 -11.414 1.00 113.06 ? 92  SER X OG  1 
ATOM   2122  N N   . ASN C  3 78  ? -18.113 -33.027 -9.368  1.00 90.20  ? 93  ASN X N   1 
ATOM   2123  C CA  . ASN C  3 78  ? -17.721 -34.408 -9.679  1.00 92.16  ? 93  ASN X CA  1 
ATOM   2124  C C   . ASN C  3 78  ? -16.197 -34.573 -9.786  1.00 93.81  ? 93  ASN X C   1 
ATOM   2125  O O   . ASN C  3 78  ? -15.671 -34.794 -10.886 1.00 95.23  ? 93  ASN X O   1 
ATOM   2126  C CB  . ASN C  3 78  ? -18.447 -34.924 -10.948 1.00 99.70  ? 93  ASN X CB  1 
ATOM   2127  C CG  . ASN C  3 78  ? -19.962 -34.861 -10.893 1.00 126.33 ? 93  ASN X CG  1 
ATOM   2128  O OD1 . ASN C  3 78  ? -20.613 -35.549 -10.100 1.00 122.67 ? 93  ASN X OD1 1 
ATOM   2129  N ND2 . ASN C  3 78  ? -20.564 -34.058 -11.766 1.00 118.29 ? 93  ASN X ND2 1 
ATOM   2130  N N   . LEU C  3 79  ? -15.488 -34.389 -8.645  1.00 86.34  ? 94  LEU X N   1 
ATOM   2131  C CA  . LEU C  3 79  ? -14.024 -34.491 -8.541  1.00 82.81  ? 94  LEU X CA  1 
ATOM   2132  C C   . LEU C  3 79  ? -13.633 -35.142 -7.208  1.00 82.92  ? 94  LEU X C   1 
ATOM   2133  O O   . LEU C  3 79  ? -13.149 -34.458 -6.308  1.00 78.29  ? 94  LEU X O   1 
ATOM   2134  C CB  . LEU C  3 79  ? -13.387 -33.099 -8.687  1.00 80.09  ? 94  LEU X CB  1 
ATOM   2135  C CG  . LEU C  3 79  ? -13.334 -32.529 -10.093 1.00 87.53  ? 94  LEU X CG  1 
ATOM   2136  C CD1 . LEU C  3 79  ? -13.312 -31.017 -10.076 1.00 86.14  ? 94  LEU X CD1 1 
ATOM   2137  C CD2 . LEU C  3 79  ? -12.161 -33.071 -10.849 1.00 90.88  ? 94  LEU X CD2 1 
ATOM   2138  N N   . PRO C  3 80  ? -13.848 -36.468 -7.045  1.00 82.73  ? 95  PRO X N   1 
ATOM   2139  C CA  . PRO C  3 80  ? -13.561 -37.102 -5.748  1.00 80.88  ? 95  PRO X CA  1 
ATOM   2140  C C   . PRO C  3 80  ? -12.105 -37.092 -5.301  1.00 81.98  ? 95  PRO X C   1 
ATOM   2141  O O   . PRO C  3 80  ? -11.859 -37.238 -4.101  1.00 79.46  ? 95  PRO X O   1 
ATOM   2142  C CB  . PRO C  3 80  ? -14.090 -38.534 -5.928  1.00 86.27  ? 95  PRO X CB  1 
ATOM   2143  C CG  . PRO C  3 80  ? -14.054 -38.768 -7.386  1.00 93.44  ? 95  PRO X CG  1 
ATOM   2144  C CD  . PRO C  3 80  ? -14.442 -37.449 -7.981  1.00 88.68  ? 95  PRO X CD  1 
ATOM   2145  N N   . LYS C  3 81  ? -11.152 -36.896 -6.234  1.00 79.04  ? 96  LYS X N   1 
ATOM   2146  C CA  . LYS C  3 81  ? -9.728  -36.913 -5.891  1.00 76.95  ? 96  LYS X CA  1 
ATOM   2147  C C   . LYS C  3 81  ? -9.053  -35.501 -5.742  1.00 77.82  ? 96  LYS X C   1 
ATOM   2148  O O   . LYS C  3 81  ? -7.893  -35.432 -5.304  1.00 74.84  ? 96  LYS X O   1 
ATOM   2149  C CB  . LYS C  3 81  ? -8.957  -37.798 -6.889  1.00 81.75  ? 96  LYS X CB  1 
ATOM   2150  C CG  . LYS C  3 81  ? -9.065  -39.286 -6.583  1.00 95.09  ? 96  LYS X CG  1 
ATOM   2151  C CD  . LYS C  3 81  ? -8.052  -40.101 -7.384  1.00 108.20 ? 96  LYS X CD  1 
ATOM   2152  C CE  . LYS C  3 81  ? -8.162  -41.596 -7.161  1.00 118.61 ? 96  LYS X CE  1 
ATOM   2153  N NZ  . LYS C  3 81  ? -7.705  -42.006 -5.803  1.00 122.48 ? 96  LYS X NZ  1 
ATOM   2154  N N   . LEU C  3 82  ? -9.784  -34.397 -6.048  1.00 74.51  ? 97  LEU X N   1 
ATOM   2155  C CA  . LEU C  3 82  ? -9.251  -33.016 -5.993  1.00 71.49  ? 97  LEU X CA  1 
ATOM   2156  C C   . LEU C  3 82  ? -9.013  -32.493 -4.567  1.00 73.45  ? 97  LEU X C   1 
ATOM   2157  O O   . LEU C  3 82  ? -9.953  -32.399 -3.776  1.00 74.13  ? 97  LEU X O   1 
ATOM   2158  C CB  . LEU C  3 82  ? -10.148 -32.053 -6.800  1.00 72.01  ? 97  LEU X CB  1 
ATOM   2159  C CG  . LEU C  3 82  ? -9.677  -30.625 -7.045  1.00 72.33  ? 97  LEU X CG  1 
ATOM   2160  C CD1 . LEU C  3 82  ? -8.600  -30.570 -8.103  1.00 72.53  ? 97  LEU X CD1 1 
ATOM   2161  C CD2 . LEU C  3 82  ? -10.829 -29.783 -7.504  1.00 73.81  ? 97  LEU X CD2 1 
ATOM   2162  N N   . HIS C  3 83  ? -7.749  -32.159 -4.256  1.00 67.17  ? 98  HIS X N   1 
ATOM   2163  C CA  . HIS C  3 83  ? -7.349  -31.635 -2.946  1.00 64.18  ? 98  HIS X CA  1 
ATOM   2164  C C   . HIS C  3 83  ? -6.851  -30.192 -3.043  1.00 63.88  ? 98  HIS X C   1 
ATOM   2165  O O   . HIS C  3 83  ? -6.705  -29.521 -2.016  1.00 61.23  ? 98  HIS X O   1 
ATOM   2166  C CB  . HIS C  3 83  ? -6.259  -32.528 -2.314  1.00 64.74  ? 98  HIS X CB  1 
ATOM   2167  C CG  . HIS C  3 83  ? -4.971  -32.504 -3.067  1.00 68.49  ? 98  HIS X CG  1 
ATOM   2168  N ND1 . HIS C  3 83  ? -4.753  -33.340 -4.141  1.00 73.34  ? 98  HIS X ND1 1 
ATOM   2169  C CD2 . HIS C  3 83  ? -3.896  -31.693 -2.918  1.00 68.56  ? 98  HIS X CD2 1 
ATOM   2170  C CE1 . HIS C  3 83  ? -3.544  -33.037 -4.592  1.00 72.20  ? 98  HIS X CE1 1 
ATOM   2171  N NE2 . HIS C  3 83  ? -3.000  -32.036 -3.900  1.00 69.57  ? 98  HIS X NE2 1 
ATOM   2172  N N   . GLU C  3 84  ? -6.539  -29.741 -4.271  1.00 59.50  ? 99  GLU X N   1 
ATOM   2173  C CA  . GLU C  3 84  ? -5.958  -28.435 -4.470  1.00 57.61  ? 99  GLU X CA  1 
ATOM   2174  C C   . GLU C  3 84  ? -6.460  -27.699 -5.705  1.00 64.39  ? 99  GLU X C   1 
ATOM   2175  O O   . GLU C  3 84  ? -6.418  -28.243 -6.810  1.00 67.79  ? 99  GLU X O   1 
ATOM   2176  C CB  . GLU C  3 84  ? -4.438  -28.598 -4.532  1.00 57.87  ? 99  GLU X CB  1 
ATOM   2177  C CG  . GLU C  3 84  ? -3.666  -27.308 -4.407  1.00 67.78  ? 99  GLU X CG  1 
ATOM   2178  C CD  . GLU C  3 84  ? -2.249  -27.417 -4.918  1.00 86.49  ? 99  GLU X CD  1 
ATOM   2179  O OE1 . GLU C  3 84  ? -1.419  -28.055 -4.230  1.00 78.53  ? 99  GLU X OE1 1 
ATOM   2180  O OE2 . GLU C  3 84  ? -1.975  -26.879 -6.016  1.00 79.91  ? 99  GLU X OE2 1 
ATOM   2181  N N   . ILE C  3 85  ? -6.900  -26.438 -5.508  1.00 58.78  ? 100 ILE X N   1 
ATOM   2182  C CA  . ILE C  3 85  ? -7.334  -25.503 -6.555  1.00 59.67  ? 100 ILE X CA  1 
ATOM   2183  C C   . ILE C  3 85  ? -6.555  -24.227 -6.290  1.00 62.33  ? 100 ILE X C   1 
ATOM   2184  O O   . ILE C  3 85  ? -6.477  -23.794 -5.140  1.00 60.66  ? 100 ILE X O   1 
ATOM   2185  C CB  . ILE C  3 85  ? -8.863  -25.191 -6.603  1.00 64.11  ? 100 ILE X CB  1 
ATOM   2186  C CG1 . ILE C  3 85  ? -9.736  -26.446 -6.426  1.00 66.39  ? 100 ILE X CG1 1 
ATOM   2187  C CG2 . ILE C  3 85  ? -9.218  -24.429 -7.886  1.00 65.82  ? 100 ILE X CG2 1 
ATOM   2188  C CD1 . ILE C  3 85  ? -11.262 -26.193 -6.196  1.00 74.82  ? 100 ILE X CD1 1 
ATOM   2189  N N   . ARG C  3 86  ? -5.976  -23.628 -7.343  1.00 59.12  ? 101 ARG X N   1 
ATOM   2190  C CA  . ARG C  3 86  ? -5.212  -22.391 -7.241  1.00 56.20  ? 101 ARG X CA  1 
ATOM   2191  C C   . ARG C  3 86  ? -5.649  -21.401 -8.292  1.00 60.62  ? 101 ARG X C   1 
ATOM   2192  O O   . ARG C  3 86  ? -5.332  -21.570 -9.464  1.00 63.09  ? 101 ARG X O   1 
ATOM   2193  C CB  . ARG C  3 86  ? -3.704  -22.656 -7.302  1.00 54.28  ? 101 ARG X CB  1 
ATOM   2194  C CG  . ARG C  3 86  ? -3.142  -23.124 -5.967  1.00 59.34  ? 101 ARG X CG  1 
ATOM   2195  C CD  . ARG C  3 86  ? -1.638  -23.102 -5.945  1.00 61.29  ? 101 ARG X CD  1 
ATOM   2196  N NE  . ARG C  3 86  ? -1.083  -24.202 -6.726  1.00 70.32  ? 101 ARG X NE  1 
ATOM   2197  C CZ  . ARG C  3 86  ? -0.362  -24.043 -7.829  1.00 85.42  ? 101 ARG X CZ  1 
ATOM   2198  N NH1 . ARG C  3 86  ? -0.087  -22.824 -8.281  1.00 76.97  ? 101 ARG X NH1 1 
ATOM   2199  N NH2 . ARG C  3 86  ? 0.120   -25.099 -8.471  1.00 67.26  ? 101 ARG X NH2 1 
ATOM   2200  N N   . ILE C  3 87  ? -6.442  -20.407 -7.870  1.00 55.30  ? 102 ILE X N   1 
ATOM   2201  C CA  . ILE C  3 87  ? -6.941  -19.303 -8.695  1.00 56.03  ? 102 ILE X CA  1 
ATOM   2202  C C   . ILE C  3 87  ? -6.044  -18.100 -8.334  1.00 58.10  ? 102 ILE X C   1 
ATOM   2203  O O   . ILE C  3 87  ? -6.224  -17.439 -7.304  1.00 55.62  ? 102 ILE X O   1 
ATOM   2204  C CB  . ILE C  3 87  ? -8.486  -19.074 -8.533  1.00 59.74  ? 102 ILE X CB  1 
ATOM   2205  C CG1 . ILE C  3 87  ? -9.287  -20.276 -9.089  1.00 60.52  ? 102 ILE X CG1 1 
ATOM   2206  C CG2 . ILE C  3 87  ? -8.945  -17.753 -9.187  1.00 62.03  ? 102 ILE X CG2 1 
ATOM   2207  C CD1 . ILE C  3 87  ? -10.651 -20.387 -8.569  1.00 57.79  ? 102 ILE X CD1 1 
ATOM   2208  N N   . GLU C  3 88  ? -5.003  -17.915 -9.156  1.00 55.09  ? 103 GLU X N   1 
ATOM   2209  C CA  . GLU C  3 88  ? -3.950  -16.920 -9.004  1.00 52.74  ? 103 GLU X CA  1 
ATOM   2210  C C   . GLU C  3 88  ? -3.923  -15.918 -10.152 1.00 58.97  ? 103 GLU X C   1 
ATOM   2211  O O   . GLU C  3 88  ? -4.171  -16.282 -11.303 1.00 61.88  ? 103 GLU X O   1 
ATOM   2212  C CB  . GLU C  3 88  ? -2.593  -17.637 -8.992  1.00 52.77  ? 103 GLU X CB  1 
ATOM   2213  C CG  . GLU C  3 88  ? -2.254  -18.406 -7.728  1.00 61.52  ? 103 GLU X CG  1 
ATOM   2214  C CD  . GLU C  3 88  ? -0.906  -19.105 -7.759  1.00 85.72  ? 103 GLU X CD  1 
ATOM   2215  O OE1 . GLU C  3 88  ? 0.042   -18.536 -8.344  1.00 73.25  ? 103 GLU X OE1 1 
ATOM   2216  O OE2 . GLU C  3 88  ? -0.791  -20.214 -7.186  1.00 85.95  ? 103 GLU X OE2 1 
ATOM   2217  N N   . LYS C  3 89  ? -3.561  -14.662 -9.837  1.00 54.32  ? 104 LYS X N   1 
ATOM   2218  C CA  . LYS C  3 89  ? -3.353  -13.561 -10.780 1.00 55.55  ? 104 LYS X CA  1 
ATOM   2219  C C   . LYS C  3 89  ? -4.388  -13.509 -11.916 1.00 64.28  ? 104 LYS X C   1 
ATOM   2220  O O   . LYS C  3 89  ? -4.088  -13.853 -13.055 1.00 65.89  ? 104 LYS X O   1 
ATOM   2221  C CB  . LYS C  3 89  ? -1.912  -13.612 -11.322 1.00 56.15  ? 104 LYS X CB  1 
ATOM   2222  C CG  . LYS C  3 89  ? -0.871  -13.488 -10.229 1.00 52.64  ? 104 LYS X CG  1 
ATOM   2223  C CD  . LYS C  3 89  ? 0.365   -14.345 -10.500 1.00 65.47  ? 104 LYS X CD  1 
ATOM   2224  C CE  . LYS C  3 89  ? 0.336   -15.731 -9.892  1.00 76.41  ? 104 LYS X CE  1 
ATOM   2225  N NZ  . LYS C  3 89  ? 0.174   -15.710 -8.402  1.00 83.19  ? 104 LYS X NZ  1 
ATOM   2226  N N   . ALA C  3 90  ? -5.622  -13.123 -11.582 1.00 63.62  ? 105 ALA X N   1 
ATOM   2227  C CA  . ALA C  3 90  ? -6.724  -13.007 -12.539 1.00 67.96  ? 105 ALA X CA  1 
ATOM   2228  C C   . ALA C  3 90  ? -7.378  -11.632 -12.353 1.00 73.73  ? 105 ALA X C   1 
ATOM   2229  O O   . ALA C  3 90  ? -8.505  -11.533 -11.849 1.00 73.36  ? 105 ALA X O   1 
ATOM   2230  C CB  . ALA C  3 90  ? -7.722  -14.132 -12.315 1.00 69.24  ? 105 ALA X CB  1 
ATOM   2231  N N   . ASN C  3 91  ? -6.633  -10.565 -12.758 1.00 72.02  ? 106 ASN X N   1 
ATOM   2232  C CA  . ASN C  3 91  ? -6.985  -9.145  -12.609 1.00 73.86  ? 106 ASN X CA  1 
ATOM   2233  C C   . ASN C  3 91  ? -8.405  -8.735  -13.096 1.00 82.66  ? 106 ASN X C   1 
ATOM   2234  O O   . ASN C  3 91  ? -8.902  -7.702  -12.647 1.00 82.54  ? 106 ASN X O   1 
ATOM   2235  C CB  . ASN C  3 91  ? -5.928  -8.240  -13.262 1.00 76.40  ? 106 ASN X CB  1 
ATOM   2236  C CG  . ASN C  3 91  ? -5.931  -8.223  -14.775 1.00 99.51  ? 106 ASN X CG  1 
ATOM   2237  O OD1 . ASN C  3 91  ? -5.962  -9.270  -15.422 1.00 89.54  ? 106 ASN X OD1 1 
ATOM   2238  N ND2 . ASN C  3 91  ? -5.862  -7.027  -15.371 1.00 93.70  ? 106 ASN X ND2 1 
ATOM   2239  N N   . ASN C  3 92  ? -9.056  -9.518  -13.983 1.00 83.14  ? 107 ASN X N   1 
ATOM   2240  C CA  . ASN C  3 92  ? -10.378 -9.140  -14.480 1.00 87.46  ? 107 ASN X CA  1 
ATOM   2241  C C   . ASN C  3 92  ? -11.477 -10.094 -14.028 1.00 93.14  ? 107 ASN X C   1 
ATOM   2242  O O   . ASN C  3 92  ? -12.630 -9.951  -14.450 1.00 97.29  ? 107 ASN X O   1 
ATOM   2243  C CB  . ASN C  3 92  ? -10.365 -8.932  -15.999 1.00 90.15  ? 107 ASN X CB  1 
ATOM   2244  C CG  . ASN C  3 92  ? -9.867  -7.552  -16.390 1.00 113.39 ? 107 ASN X CG  1 
ATOM   2245  O OD1 . ASN C  3 92  ? -10.358 -6.522  -15.909 1.00 108.26 ? 107 ASN X OD1 1 
ATOM   2246  N ND2 . ASN C  3 92  ? -8.869  -7.494  -17.263 1.00 105.37 ? 107 ASN X ND2 1 
ATOM   2247  N N   . LEU C  3 93  ? -11.137 -11.038 -13.139 1.00 86.10  ? 108 LEU X N   1 
ATOM   2248  C CA  . LEU C  3 93  ? -12.108 -11.981 -12.591 1.00 86.20  ? 108 LEU X CA  1 
ATOM   2249  C C   . LEU C  3 93  ? -12.864 -11.286 -11.450 1.00 89.80  ? 108 LEU X C   1 
ATOM   2250  O O   . LEU C  3 93  ? -12.323 -11.125 -10.360 1.00 85.80  ? 108 LEU X O   1 
ATOM   2251  C CB  . LEU C  3 93  ? -11.380 -13.255 -12.129 1.00 82.76  ? 108 LEU X CB  1 
ATOM   2252  C CG  . LEU C  3 93  ? -12.199 -14.373 -11.499 1.00 87.13  ? 108 LEU X CG  1 
ATOM   2253  C CD1 . LEU C  3 93  ? -13.218 -14.950 -12.476 1.00 92.21  ? 108 LEU X CD1 1 
ATOM   2254  C CD2 . LEU C  3 93  ? -11.293 -15.450 -11.023 1.00 84.86  ? 108 LEU X CD2 1 
ATOM   2255  N N   . LEU C  3 94  ? -14.096 -10.834 -11.729 1.00 90.51  ? 109 LEU X N   1 
ATOM   2256  C CA  . LEU C  3 94  ? -14.922 -10.060 -10.798 1.00 90.91  ? 109 LEU X CA  1 
ATOM   2257  C C   . LEU C  3 94  ? -15.996 -10.856 -10.078 1.00 97.53  ? 109 LEU X C   1 
ATOM   2258  O O   . LEU C  3 94  ? -16.374 -10.495 -8.957  1.00 96.95  ? 109 LEU X O   1 
ATOM   2259  C CB  . LEU C  3 94  ? -15.582 -8.896  -11.551 1.00 95.34  ? 109 LEU X CB  1 
ATOM   2260  C CG  . LEU C  3 94  ? -14.641 -7.985  -12.341 1.00 100.09 ? 109 LEU X CG  1 
ATOM   2261  C CD1 . LEU C  3 94  ? -15.313 -7.434  -13.593 1.00 105.25 ? 109 LEU X CD1 1 
ATOM   2262  C CD2 . LEU C  3 94  ? -14.069 -6.884  -11.463 1.00 100.73 ? 109 LEU X CD2 1 
ATOM   2263  N N   . TYR C  3 95  ? -16.504 -11.919 -10.724 1.00 96.15  ? 110 TYR X N   1 
ATOM   2264  C CA  . TYR C  3 95  ? -17.605 -12.717 -10.203 1.00 97.31  ? 110 TYR X CA  1 
ATOM   2265  C C   . TYR C  3 95  ? -17.344 -14.224 -10.191 1.00 94.74  ? 110 TYR X C   1 
ATOM   2266  O O   . TYR C  3 95  ? -16.766 -14.779 -11.131 1.00 93.93  ? 110 TYR X O   1 
ATOM   2267  C CB  . TYR C  3 95  ? -18.862 -12.376 -11.039 1.00 106.27 ? 110 TYR X CB  1 
ATOM   2268  C CG  . TYR C  3 95  ? -20.135 -13.167 -10.777 1.00 113.46 ? 110 TYR X CG  1 
ATOM   2269  C CD1 . TYR C  3 95  ? -20.405 -14.345 -11.476 1.00 117.48 ? 110 TYR X CD1 1 
ATOM   2270  C CD2 . TYR C  3 95  ? -21.148 -12.647 -9.973  1.00 116.81 ? 110 TYR X CD2 1 
ATOM   2271  C CE1 . TYR C  3 95  ? -21.618 -15.023 -11.320 1.00 121.13 ? 110 TYR X CE1 1 
ATOM   2272  C CE2 . TYR C  3 95  ? -22.365 -13.317 -9.809  1.00 121.01 ? 110 TYR X CE2 1 
ATOM   2273  C CZ  . TYR C  3 95  ? -22.589 -14.509 -10.478 1.00 129.51 ? 110 TYR X CZ  1 
ATOM   2274  O OH  . TYR C  3 95  ? -23.775 -15.172 -10.307 1.00 135.98 ? 110 TYR X OH  1 
ATOM   2275  N N   . ILE C  3 96  ? -17.814 -14.877 -9.120  1.00 87.17  ? 111 ILE X N   1 
ATOM   2276  C CA  . ILE C  3 96  ? -17.832 -16.329 -8.966  1.00 84.90  ? 111 ILE X CA  1 
ATOM   2277  C C   . ILE C  3 96  ? -19.281 -16.746 -8.623  1.00 93.08  ? 111 ILE X C   1 
ATOM   2278  O O   . ILE C  3 96  ? -19.832 -16.294 -7.610  1.00 93.22  ? 111 ILE X O   1 
ATOM   2279  C CB  . ILE C  3 96  ? -16.774 -16.909 -7.996  1.00 81.50  ? 111 ILE X CB  1 
ATOM   2280  C CG1 . ILE C  3 96  ? -15.351 -16.749 -8.585  1.00 78.26  ? 111 ILE X CG1 1 
ATOM   2281  C CG2 . ILE C  3 96  ? -17.092 -18.399 -7.675  1.00 80.46  ? 111 ILE X CG2 1 
ATOM   2282  C CD1 . ILE C  3 96  ? -14.164 -16.979 -7.585  1.00 73.44  ? 111 ILE X CD1 1 
ATOM   2283  N N   . ASN C  3 97  ? -19.897 -17.576 -9.493  1.00 92.09  ? 112 ASN X N   1 
ATOM   2284  C CA  . ASN C  3 97  ? -21.255 -18.057 -9.298  1.00 95.88  ? 112 ASN X CA  1 
ATOM   2285  C C   . ASN C  3 97  ? -21.338 -18.774 -7.961  1.00 98.79  ? 112 ASN X C   1 
ATOM   2286  O O   . ASN C  3 97  ? -20.486 -19.613 -7.682  1.00 94.07  ? 112 ASN X O   1 
ATOM   2287  C CB  . ASN C  3 97  ? -21.671 -18.995 -10.428 1.00 98.88  ? 112 ASN X CB  1 
ATOM   2288  C CG  . ASN C  3 97  ? -23.165 -19.159 -10.561 1.00 121.51 ? 112 ASN X CG  1 
ATOM   2289  O OD1 . ASN C  3 97  ? -23.857 -19.630 -9.655  1.00 117.88 ? 112 ASN X OD1 1 
ATOM   2290  N ND2 . ASN C  3 97  ? -23.698 -18.805 -11.715 1.00 116.98 ? 112 ASN X ND2 1 
ATOM   2291  N N   . PRO C  3 98  ? -22.337 -18.459 -7.106  1.00 100.04 ? 113 PRO X N   1 
ATOM   2292  C CA  . PRO C  3 98  ? -22.439 -19.155 -5.806  1.00 98.55  ? 113 PRO X CA  1 
ATOM   2293  C C   . PRO C  3 98  ? -22.684 -20.669 -5.912  1.00 105.28 ? 113 PRO X C   1 
ATOM   2294  O O   . PRO C  3 98  ? -22.853 -21.348 -4.900  1.00 105.38 ? 113 PRO X O   1 
ATOM   2295  C CB  . PRO C  3 98  ? -23.593 -18.430 -5.095  1.00 103.43 ? 113 PRO X CB  1 
ATOM   2296  C CG  . PRO C  3 98  ? -23.832 -17.174 -5.880  1.00 110.35 ? 113 PRO X CG  1 
ATOM   2297  C CD  . PRO C  3 98  ? -23.432 -17.484 -7.280  1.00 106.55 ? 113 PRO X CD  1 
ATOM   2298  N N   . GLU C  3 99  ? -22.686 -21.191 -7.145  1.00 103.34 ? 114 GLU X N   1 
ATOM   2299  C CA  . GLU C  3 99  ? -22.859 -22.596 -7.468  1.00 104.03 ? 114 GLU X CA  1 
ATOM   2300  C C   . GLU C  3 99  ? -21.576 -23.189 -8.101  1.00 104.79 ? 114 GLU X C   1 
ATOM   2301  O O   . GLU C  3 99  ? -21.592 -24.343 -8.527  1.00 105.20 ? 114 GLU X O   1 
ATOM   2302  C CB  . GLU C  3 99  ? -24.068 -22.762 -8.398  1.00 111.54 ? 114 GLU X CB  1 
ATOM   2303  C CG  . GLU C  3 99  ? -25.406 -22.426 -7.756  1.00 126.14 ? 114 GLU X CG  1 
ATOM   2304  C CD  . GLU C  3 99  ? -25.912 -23.390 -6.697  1.00 142.33 ? 114 GLU X CD  1 
ATOM   2305  O OE1 . GLU C  3 99  ? -25.524 -24.581 -6.728  1.00 122.28 ? 114 GLU X OE1 1 
ATOM   2306  O OE2 . GLU C  3 99  ? -26.723 -22.955 -5.848  1.00 139.31 ? 114 GLU X OE2 1 
ATOM   2307  N N   . ALA C  3 100 ? -20.459 -22.415 -8.124  1.00 97.83  ? 115 ALA X N   1 
ATOM   2308  C CA  . ALA C  3 100 ? -19.181 -22.836 -8.720  1.00 94.34  ? 115 ALA X CA  1 
ATOM   2309  C C   . ALA C  3 100 ? -18.484 -23.925 -7.951  1.00 92.55  ? 115 ALA X C   1 
ATOM   2310  O O   . ALA C  3 100 ? -17.918 -24.837 -8.560  1.00 91.62  ? 115 ALA X O   1 
ATOM   2311  C CB  . ALA C  3 100 ? -18.254 -21.654 -8.868  1.00 92.67  ? 115 ALA X CB  1 
ATOM   2312  N N   . PHE C  3 101 ? -18.481 -23.812 -6.619  1.00 85.37  ? 116 PHE X N   1 
ATOM   2313  C CA  . PHE C  3 101 ? -17.838 -24.806 -5.779  1.00 81.49  ? 116 PHE X CA  1 
ATOM   2314  C C   . PHE C  3 101 ? -18.856 -25.790 -5.252  1.00 85.00  ? 116 PHE X C   1 
ATOM   2315  O O   . PHE C  3 101 ? -19.646 -25.473 -4.354  1.00 84.51  ? 116 PHE X O   1 
ATOM   2316  C CB  . PHE C  3 101 ? -17.027 -24.155 -4.657  1.00 79.19  ? 116 PHE X CB  1 
ATOM   2317  C CG  . PHE C  3 101 ? -15.839 -23.358 -5.126  1.00 78.02  ? 116 PHE X CG  1 
ATOM   2318  C CD1 . PHE C  3 101 ? -14.665 -23.992 -5.510  1.00 79.46  ? 116 PHE X CD1 1 
ATOM   2319  C CD2 . PHE C  3 101 ? -15.882 -21.971 -5.157  1.00 79.85  ? 116 PHE X CD2 1 
ATOM   2320  C CE1 . PHE C  3 101 ? -13.553 -23.247 -5.921  1.00 78.50  ? 116 PHE X CE1 1 
ATOM   2321  C CE2 . PHE C  3 101 ? -14.772 -21.230 -5.562  1.00 80.41  ? 116 PHE X CE2 1 
ATOM   2322  C CZ  . PHE C  3 101 ? -13.613 -21.873 -5.940  1.00 76.80  ? 116 PHE X CZ  1 
ATOM   2323  N N   . GLN C  3 102 ? -18.852 -26.982 -5.859  1.00 82.10  ? 117 GLN X N   1 
ATOM   2324  C CA  . GLN C  3 102 ? -19.738 -28.087 -5.518  1.00 83.89  ? 117 GLN X CA  1 
ATOM   2325  C C   . GLN C  3 102 ? -19.062 -29.028 -4.516  1.00 83.91  ? 117 GLN X C   1 
ATOM   2326  O O   . GLN C  3 102 ? -18.026 -28.685 -3.962  1.00 79.06  ? 117 GLN X O   1 
ATOM   2327  C CB  . GLN C  3 102 ? -20.182 -28.832 -6.794  1.00 89.15  ? 117 GLN X CB  1 
ATOM   2328  C CG  . GLN C  3 102 ? -21.156 -28.051 -7.684  1.00 99.80  ? 117 GLN X CG  1 
ATOM   2329  C CD  . GLN C  3 102 ? -22.490 -27.794 -7.025  1.00 114.43 ? 117 GLN X CD  1 
ATOM   2330  O OE1 . GLN C  3 102 ? -23.039 -28.649 -6.316  1.00 116.44 ? 117 GLN X OE1 1 
ATOM   2331  N NE2 . GLN C  3 102 ? -23.042 -26.606 -7.244  1.00 95.13  ? 117 GLN X NE2 1 
ATOM   2332  N N   . ASN C  3 103 ? -19.652 -30.201 -4.281  1.00 83.29  ? 118 ASN X N   1 
ATOM   2333  C CA  . ASN C  3 103 ? -19.159 -31.208 -3.351  1.00 81.34  ? 118 ASN X CA  1 
ATOM   2334  C C   . ASN C  3 103 ? -17.766 -31.713 -3.716  1.00 81.83  ? 118 ASN X C   1 
ATOM   2335  O O   . ASN C  3 103 ? -17.601 -32.507 -4.654  1.00 82.96  ? 118 ASN X O   1 
ATOM   2336  C CB  . ASN C  3 103 ? -20.185 -32.355 -3.204  1.00 85.89  ? 118 ASN X CB  1 
ATOM   2337  C CG  . ASN C  3 103 ? -19.745 -33.509 -2.326  1.00 97.24  ? 118 ASN X CG  1 
ATOM   2338  O OD1 . ASN C  3 103 ? -19.024 -33.335 -1.324  1.00 90.33  ? 118 ASN X OD1 1 
ATOM   2339  N ND2 . ASN C  3 103 ? -20.175 -34.721 -2.695  1.00 79.75  ? 118 ASN X ND2 1 
ATOM   2340  N N   . LEU C  3 104 ? -16.765 -31.225 -2.959  1.00 74.16  ? 119 LEU X N   1 
ATOM   2341  C CA  . LEU C  3 104 ? -15.357 -31.592 -3.101  1.00 71.35  ? 119 LEU X CA  1 
ATOM   2342  C C   . LEU C  3 104 ? -14.896 -32.245 -1.792  1.00 75.01  ? 119 LEU X C   1 
ATOM   2343  O O   . LEU C  3 104 ? -14.384 -31.561 -0.910  1.00 72.74  ? 119 LEU X O   1 
ATOM   2344  C CB  . LEU C  3 104 ? -14.508 -30.375 -3.489  1.00 68.49  ? 119 LEU X CB  1 
ATOM   2345  C CG  . LEU C  3 104 ? -14.883 -29.706 -4.817  1.00 75.26  ? 119 LEU X CG  1 
ATOM   2346  C CD1 . LEU C  3 104 ? -14.380 -28.278 -4.870  1.00 73.14  ? 119 LEU X CD1 1 
ATOM   2347  C CD2 . LEU C  3 104 ? -14.403 -30.519 -6.018  1.00 78.84  ? 119 LEU X CD2 1 
ATOM   2348  N N   . PRO C  3 105 ? -15.169 -33.563 -1.614  1.00 74.29  ? 120 PRO X N   1 
ATOM   2349  C CA  . PRO C  3 105 ? -14.848 -34.232 -0.333  1.00 73.12  ? 120 PRO X CA  1 
ATOM   2350  C C   . PRO C  3 105 ? -13.376 -34.353 0.063   1.00 73.56  ? 120 PRO X C   1 
ATOM   2351  O O   . PRO C  3 105 ? -13.092 -34.697 1.220   1.00 71.85  ? 120 PRO X O   1 
ATOM   2352  C CB  . PRO C  3 105 ? -15.458 -35.626 -0.516  1.00 78.09  ? 120 PRO X CB  1 
ATOM   2353  C CG  . PRO C  3 105 ? -15.453 -35.839 -1.988  1.00 83.86  ? 120 PRO X CG  1 
ATOM   2354  C CD  . PRO C  3 105 ? -15.843 -34.505 -2.535  1.00 78.89  ? 120 PRO X CD  1 
ATOM   2355  N N   . ASN C  3 106 ? -12.447 -34.142 -0.876  1.00 68.47  ? 121 ASN X N   1 
ATOM   2356  C CA  . ASN C  3 106 ? -11.061 -34.312 -0.495  1.00 66.10  ? 121 ASN X CA  1 
ATOM   2357  C C   . ASN C  3 106 ? -10.254 -33.052 -0.662  1.00 65.74  ? 121 ASN X C   1 
ATOM   2358  O O   . ASN C  3 106 ? -9.027  -33.113 -0.643  1.00 63.25  ? 121 ASN X O   1 
ATOM   2359  C CB  . ASN C  3 106 ? -10.423 -35.508 -1.194  1.00 73.08  ? 121 ASN X CB  1 
ATOM   2360  C CG  . ASN C  3 106 ? -9.478  -36.262 -0.280  1.00 102.71 ? 121 ASN X CG  1 
ATOM   2361  O OD1 . ASN C  3 106 ? -8.321  -35.861 -0.054  1.00 92.04  ? 121 ASN X OD1 1 
ATOM   2362  N ND2 . ASN C  3 106 ? -9.972  -37.348 0.306   1.00 97.02  ? 121 ASN X ND2 1 
ATOM   2363  N N   . LEU C  3 107 ? -10.945 -31.895 -0.750  1.00 61.53  ? 122 LEU X N   1 
ATOM   2364  C CA  . LEU C  3 107 ? -10.328 -30.580 -0.875  1.00 57.88  ? 122 LEU X CA  1 
ATOM   2365  C C   . LEU C  3 107 ? -9.541  -30.270 0.413   1.00 62.15  ? 122 LEU X C   1 
ATOM   2366  O O   . LEU C  3 107 ? -10.029 -30.520 1.518   1.00 62.10  ? 122 LEU X O   1 
ATOM   2367  C CB  . LEU C  3 107 ? -11.392 -29.503 -1.174  1.00 57.63  ? 122 LEU X CB  1 
ATOM   2368  C CG  . LEU C  3 107 ? -10.856 -28.082 -1.474  1.00 59.22  ? 122 LEU X CG  1 
ATOM   2369  C CD1 . LEU C  3 107 ? -10.505 -27.916 -2.929  1.00 60.09  ? 122 LEU X CD1 1 
ATOM   2370  C CD2 . LEU C  3 107 ? -11.853 -27.007 -1.074  1.00 59.57  ? 122 LEU X CD2 1 
ATOM   2371  N N   . GLN C  3 108 ? -8.309  -29.780 0.259   1.00 58.73  ? 123 GLN X N   1 
ATOM   2372  C CA  . GLN C  3 108 ? -7.433  -29.446 1.383   1.00 57.36  ? 123 GLN X CA  1 
ATOM   2373  C C   . GLN C  3 108 ? -6.952  -28.011 1.322   1.00 60.07  ? 123 GLN X C   1 
ATOM   2374  O O   . GLN C  3 108 ? -6.540  -27.456 2.349   1.00 58.76  ? 123 GLN X O   1 
ATOM   2375  C CB  . GLN C  3 108 ? -6.192  -30.345 1.361   1.00 58.85  ? 123 GLN X CB  1 
ATOM   2376  C CG  . GLN C  3 108 ? -6.369  -31.720 1.999   1.00 69.98  ? 123 GLN X CG  1 
ATOM   2377  C CD  . GLN C  3 108 ? -5.183  -32.596 1.679   1.00 76.72  ? 123 GLN X CD  1 
ATOM   2378  O OE1 . GLN C  3 108 ? -4.015  -32.200 1.842   1.00 76.75  ? 123 GLN X OE1 1 
ATOM   2379  N NE2 . GLN C  3 108 ? -5.451  -33.788 1.178   1.00 50.72  ? 123 GLN X NE2 1 
ATOM   2380  N N   . TYR C  3 109 ? -6.922  -27.438 0.105   1.00 56.50  ? 124 TYR X N   1 
ATOM   2381  C CA  . TYR C  3 109 ? -6.384  -26.110 -0.126  1.00 54.29  ? 124 TYR X CA  1 
ATOM   2382  C C   . TYR C  3 109 ? -7.110  -25.411 -1.261  1.00 57.31  ? 124 TYR X C   1 
ATOM   2383  O O   . TYR C  3 109 ? -7.178  -25.944 -2.373  1.00 57.55  ? 124 TYR X O   1 
ATOM   2384  C CB  . TYR C  3 109 ? -4.878  -26.261 -0.436  1.00 55.19  ? 124 TYR X CB  1 
ATOM   2385  C CG  . TYR C  3 109 ? -4.071  -24.993 -0.651  1.00 57.46  ? 124 TYR X CG  1 
ATOM   2386  C CD1 . TYR C  3 109 ? -3.879  -24.078 0.385   1.00 57.97  ? 124 TYR X CD1 1 
ATOM   2387  C CD2 . TYR C  3 109 ? -3.383  -24.777 -1.844  1.00 59.30  ? 124 TYR X CD2 1 
ATOM   2388  C CE1 . TYR C  3 109 ? -3.093  -22.940 0.212   1.00 58.25  ? 124 TYR X CE1 1 
ATOM   2389  C CE2 . TYR C  3 109 ? -2.572  -23.653 -2.024  1.00 59.83  ? 124 TYR X CE2 1 
ATOM   2390  C CZ  . TYR C  3 109 ? -2.435  -22.728 -0.997  1.00 67.12  ? 124 TYR X CZ  1 
ATOM   2391  O OH  . TYR C  3 109 ? -1.626  -21.616 -1.178  1.00 62.62  ? 124 TYR X OH  1 
ATOM   2392  N N   . LEU C  3 110 ? -7.673  -24.226 -0.969  1.00 53.32  ? 125 LEU X N   1 
ATOM   2393  C CA  . LEU C  3 110 ? -8.302  -23.364 -1.962  1.00 55.23  ? 125 LEU X CA  1 
ATOM   2394  C C   . LEU C  3 110 ? -7.607  -22.001 -1.924  1.00 60.51  ? 125 LEU X C   1 
ATOM   2395  O O   . LEU C  3 110 ? -7.718  -21.251 -0.947  1.00 60.94  ? 125 LEU X O   1 
ATOM   2396  C CB  . LEU C  3 110 ? -9.834  -23.239 -1.815  1.00 57.37  ? 125 LEU X CB  1 
ATOM   2397  C CG  . LEU C  3 110 ? -10.570 -22.261 -2.783  1.00 64.04  ? 125 LEU X CG  1 
ATOM   2398  C CD1 . LEU C  3 110 ? -10.275 -22.564 -4.257  1.00 66.11  ? 125 LEU X CD1 1 
ATOM   2399  C CD2 . LEU C  3 110 ? -12.073 -22.290 -2.563  1.00 67.26  ? 125 LEU X CD2 1 
ATOM   2400  N N   . LEU C  3 111 ? -6.848  -21.708 -2.976  1.00 56.23  ? 126 LEU X N   1 
ATOM   2401  C CA  . LEU C  3 111 ? -6.139  -20.452 -3.073  1.00 54.05  ? 126 LEU X CA  1 
ATOM   2402  C C   . LEU C  3 111 ? -6.821  -19.528 -4.067  1.00 59.34  ? 126 LEU X C   1 
ATOM   2403  O O   . LEU C  3 111 ? -7.113  -19.930 -5.193  1.00 61.82  ? 126 LEU X O   1 
ATOM   2404  C CB  . LEU C  3 111 ? -4.676  -20.685 -3.450  1.00 52.79  ? 126 LEU X CB  1 
ATOM   2405  C CG  . LEU C  3 111 ? -3.823  -19.433 -3.560  1.00 56.76  ? 126 LEU X CG  1 
ATOM   2406  C CD1 . LEU C  3 111 ? -3.589  -18.811 -2.204  1.00 55.57  ? 126 LEU X CD1 1 
ATOM   2407  C CD2 . LEU C  3 111 ? -2.515  -19.721 -4.259  1.00 58.13  ? 126 LEU X CD2 1 
ATOM   2408  N N   . ILE C  3 112 ? -7.132  -18.311 -3.620  1.00 53.97  ? 127 ILE X N   1 
ATOM   2409  C CA  . ILE C  3 112 ? -7.710  -17.260 -4.443  1.00 54.83  ? 127 ILE X CA  1 
ATOM   2410  C C   . ILE C  3 112 ? -6.873  -16.047 -4.137  1.00 57.86  ? 127 ILE X C   1 
ATOM   2411  O O   . ILE C  3 112 ? -7.067  -15.373 -3.121  1.00 55.49  ? 127 ILE X O   1 
ATOM   2412  C CB  . ILE C  3 112 ? -9.246  -17.035 -4.345  1.00 59.42  ? 127 ILE X CB  1 
ATOM   2413  C CG1 . ILE C  3 112 ? -10.027 -18.311 -4.764  1.00 60.66  ? 127 ILE X CG1 1 
ATOM   2414  C CG2 . ILE C  3 112 ? -9.643  -15.854 -5.255  1.00 62.82  ? 127 ILE X CG2 1 
ATOM   2415  C CD1 . ILE C  3 112 ? -11.556 -18.318 -4.492  1.00 59.86  ? 127 ILE X CD1 1 
ATOM   2416  N N   . SER C  3 113 ? -5.868  -15.843 -4.983  1.00 56.05  ? 128 SER X N   1 
ATOM   2417  C CA  . SER C  3 113 ? -4.904  -14.773 -4.829  1.00 55.29  ? 128 SER X CA  1 
ATOM   2418  C C   . SER C  3 113 ? -4.848  -13.857 -6.015  1.00 61.56  ? 128 SER X C   1 
ATOM   2419  O O   . SER C  3 113 ? -4.880  -14.307 -7.164  1.00 62.77  ? 128 SER X O   1 
ATOM   2420  C CB  . SER C  3 113 ? -3.514  -15.338 -4.524  1.00 57.13  ? 128 SER X CB  1 
ATOM   2421  O OG  . SER C  3 113 ? -2.572  -15.106 -5.562  1.00 68.19  ? 128 SER X OG  1 
ATOM   2422  N N   . ASN C  3 114 ? -4.696  -12.563 -5.714  1.00 58.58  ? 129 ASN X N   1 
ATOM   2423  C CA  . ASN C  3 114 ? -4.520  -11.471 -6.664  1.00 59.86  ? 129 ASN X CA  1 
ATOM   2424  C C   . ASN C  3 114 ? -5.554  -11.463 -7.793  1.00 66.56  ? 129 ASN X C   1 
ATOM   2425  O O   . ASN C  3 114 ? -5.174  -11.396 -8.965  1.00 69.24  ? 129 ASN X O   1 
ATOM   2426  C CB  . ASN C  3 114 ? -3.084  -11.470 -7.207  1.00 56.49  ? 129 ASN X CB  1 
ATOM   2427  C CG  . ASN C  3 114 ? -2.465  -10.106 -7.321  1.00 69.18  ? 129 ASN X CG  1 
ATOM   2428  O OD1 . ASN C  3 114 ? -3.099  -9.115  -7.728  1.00 68.25  ? 129 ASN X OD1 1 
ATOM   2429  N ND2 . ASN C  3 114 ? -1.184  -10.044 -7.019  1.00 52.66  ? 129 ASN X ND2 1 
ATOM   2430  N N   . THR C  3 115 ? -6.860  -11.534 -7.432  1.00 62.23  ? 130 THR X N   1 
ATOM   2431  C CA  . THR C  3 115 ? -7.994  -11.477 -8.375  1.00 64.84  ? 130 THR X CA  1 
ATOM   2432  C C   . THR C  3 115 ? -8.830  -10.188 -8.149  1.00 68.12  ? 130 THR X C   1 
ATOM   2433  O O   . THR C  3 115 ? -8.572  -9.427  -7.214  1.00 66.11  ? 130 THR X O   1 
ATOM   2434  C CB  . THR C  3 115 ? -8.858  -12.755 -8.306  1.00 77.39  ? 130 THR X CB  1 
ATOM   2435  O OG1 . THR C  3 115 ? -9.736  -12.680 -7.186  1.00 76.37  ? 130 THR X OG1 1 
ATOM   2436  C CG2 . THR C  3 115 ? -8.032  -14.045 -8.259  1.00 75.79  ? 130 THR X CG2 1 
ATOM   2437  N N   . GLY C  3 116 ? -9.817  -9.954  -8.995  1.00 67.02  ? 131 GLY X N   1 
ATOM   2438  C CA  . GLY C  3 116 ? -10.653 -8.773  -8.850  1.00 69.32  ? 131 GLY X CA  1 
ATOM   2439  C C   . GLY C  3 116 ? -12.005 -9.035  -8.231  1.00 74.77  ? 131 GLY X C   1 
ATOM   2440  O O   . GLY C  3 116 ? -12.847 -8.131  -8.230  1.00 77.41  ? 131 GLY X O   1 
ATOM   2441  N N   . ILE C  3 117 ? -12.216 -10.273 -7.693  1.00 69.47  ? 132 ILE X N   1 
ATOM   2442  C CA  . ILE C  3 117 ? -13.491 -10.736 -7.131  1.00 71.14  ? 132 ILE X CA  1 
ATOM   2443  C C   . ILE C  3 117 ? -14.017 -9.790  -6.044  1.00 74.56  ? 132 ILE X C   1 
ATOM   2444  O O   . ILE C  3 117 ? -13.304 -9.461  -5.094  1.00 70.54  ? 132 ILE X O   1 
ATOM   2445  C CB  . ILE C  3 117 ? -13.535 -12.238 -6.683  1.00 72.72  ? 132 ILE X CB  1 
ATOM   2446  C CG1 . ILE C  3 117 ? -12.519 -12.576 -5.575  1.00 68.91  ? 132 ILE X CG1 1 
ATOM   2447  C CG2 . ILE C  3 117 ? -13.397 -13.208 -7.880  1.00 74.38  ? 132 ILE X CG2 1 
ATOM   2448  C CD1 . ILE C  3 117 ? -12.793 -13.968 -4.909  1.00 75.90  ? 132 ILE X CD1 1 
ATOM   2449  N N   . LYS C  3 118 ? -15.268 -9.325  -6.251  1.00 75.54  ? 133 LYS X N   1 
ATOM   2450  C CA  . LYS C  3 118 ? -16.010 -8.377  -5.409  1.00 77.67  ? 133 LYS X CA  1 
ATOM   2451  C C   . LYS C  3 118 ? -16.541 -8.993  -4.099  1.00 82.80  ? 133 LYS X C   1 
ATOM   2452  O O   . LYS C  3 118 ? -16.912 -8.257  -3.168  1.00 82.76  ? 133 LYS X O   1 
ATOM   2453  C CB  . LYS C  3 118 ? -17.180 -7.759  -6.212  1.00 84.62  ? 133 LYS X CB  1 
ATOM   2454  C CG  . LYS C  3 118 ? -16.774 -6.728  -7.256  1.00 94.17  ? 133 LYS X CG  1 
ATOM   2455  C CD  . LYS C  3 118 ? -16.551 -5.348  -6.630  1.00 105.65 ? 133 LYS X CD  1 
ATOM   2456  C CE  . LYS C  3 118 ? -15.970 -4.332  -7.592  1.00 119.70 ? 133 LYS X CE  1 
ATOM   2457  N NZ  . LYS C  3 118 ? -17.000 -3.777  -8.512  1.00 132.01 ? 133 LYS X NZ  1 
ATOM   2458  N N   . HIS C  3 119 ? -16.625 -10.338 -4.053  1.00 79.47  ? 134 HIS X N   1 
ATOM   2459  C CA  . HIS C  3 119 ? -17.140 -11.093 -2.913  1.00 79.03  ? 134 HIS X CA  1 
ATOM   2460  C C   . HIS C  3 119 ? -16.335 -12.371 -2.677  1.00 77.55  ? 134 HIS X C   1 
ATOM   2461  O O   . HIS C  3 119 ? -15.649 -12.850 -3.582  1.00 75.87  ? 134 HIS X O   1 
ATOM   2462  C CB  . HIS C  3 119 ? -18.620 -11.446 -3.146  1.00 85.03  ? 134 HIS X CB  1 
ATOM   2463  C CG  . HIS C  3 119 ? -19.561 -10.269 -3.147  1.00 93.43  ? 134 HIS X CG  1 
ATOM   2464  N ND1 . HIS C  3 119 ? -19.638 -9.400  -4.228  1.00 98.24  ? 134 HIS X ND1 1 
ATOM   2465  C CD2 . HIS C  3 119 ? -20.488 -9.901  -2.229  1.00 98.02  ? 134 HIS X CD2 1 
ATOM   2466  C CE1 . HIS C  3 119 ? -20.577 -8.518  -3.919  1.00 101.90 ? 134 HIS X CE1 1 
ATOM   2467  N NE2 . HIS C  3 119 ? -21.119 -8.778  -2.725  1.00 102.24 ? 134 HIS X NE2 1 
ATOM   2468  N N   . LEU C  3 120 ? -16.438 -12.932 -1.464  1.00 71.27  ? 135 LEU X N   1 
ATOM   2469  C CA  . LEU C  3 120 ? -15.774 -14.179 -1.088  1.00 67.59  ? 135 LEU X CA  1 
ATOM   2470  C C   . LEU C  3 120 ? -16.398 -15.381 -1.846  1.00 73.72  ? 135 LEU X C   1 
ATOM   2471  O O   . LEU C  3 120 ? -17.530 -15.254 -2.310  1.00 78.46  ? 135 LEU X O   1 
ATOM   2472  C CB  . LEU C  3 120 ? -15.951 -14.399 0.417   1.00 66.70  ? 135 LEU X CB  1 
ATOM   2473  C CG  . LEU C  3 120 ? -15.096 -13.584 1.371   1.00 69.16  ? 135 LEU X CG  1 
ATOM   2474  C CD1 . LEU C  3 120 ? -15.627 -13.733 2.786   1.00 70.28  ? 135 LEU X CD1 1 
ATOM   2475  C CD2 . LEU C  3 120 ? -13.640 -14.035 1.337   1.00 66.44  ? 135 LEU X CD2 1 
ATOM   2476  N N   . PRO C  3 121 ? -15.741 -16.562 -1.970  1.00 67.49  ? 136 PRO X N   1 
ATOM   2477  C CA  . PRO C  3 121 ? -16.391 -17.667 -2.698  1.00 69.35  ? 136 PRO X CA  1 
ATOM   2478  C C   . PRO C  3 121 ? -17.490 -18.341 -1.888  1.00 76.94  ? 136 PRO X C   1 
ATOM   2479  O O   . PRO C  3 121 ? -17.414 -18.343 -0.663  1.00 75.28  ? 136 PRO X O   1 
ATOM   2480  C CB  . PRO C  3 121 ? -15.241 -18.628 -2.985  1.00 67.82  ? 136 PRO X CB  1 
ATOM   2481  C CG  . PRO C  3 121 ? -14.261 -18.378 -1.899  1.00 68.84  ? 136 PRO X CG  1 
ATOM   2482  C CD  . PRO C  3 121 ? -14.388 -16.942 -1.502  1.00 64.74  ? 136 PRO X CD  1 
ATOM   2483  N N   . ASP C  3 122 ? -18.506 -18.909 -2.558  1.00 78.08  ? 137 ASP X N   1 
ATOM   2484  C CA  . ASP C  3 122 ? -19.567 -19.608 -1.834  1.00 80.97  ? 137 ASP X CA  1 
ATOM   2485  C C   . ASP C  3 122 ? -19.101 -21.020 -1.593  1.00 83.76  ? 137 ASP X C   1 
ATOM   2486  O O   . ASP C  3 122 ? -18.996 -21.805 -2.541  1.00 85.19  ? 137 ASP X O   1 
ATOM   2487  C CB  . ASP C  3 122 ? -20.890 -19.598 -2.598  1.00 88.41  ? 137 ASP X CB  1 
ATOM   2488  C CG  . ASP C  3 122 ? -21.949 -20.394 -1.887  1.00 107.39 ? 137 ASP X CG  1 
ATOM   2489  O OD1 . ASP C  3 122 ? -21.954 -21.641 -2.037  1.00 108.72 ? 137 ASP X OD1 1 
ATOM   2490  O OD2 . ASP C  3 122 ? -22.737 -19.785 -1.123  1.00 118.55 ? 137 ASP X OD2 1 
ATOM   2491  N N   . VAL C  3 123 ? -18.860 -21.356 -0.324  1.00 77.41  ? 138 VAL X N   1 
ATOM   2492  C CA  . VAL C  3 123 ? -18.294 -22.648 0.056   1.00 74.76  ? 138 VAL X CA  1 
ATOM   2493  C C   . VAL C  3 123 ? -19.260 -23.629 0.747   1.00 80.68  ? 138 VAL X C   1 
ATOM   2494  O O   . VAL C  3 123 ? -18.840 -24.756 1.026   1.00 80.06  ? 138 VAL X O   1 
ATOM   2495  C CB  . VAL C  3 123 ? -17.021 -22.444 0.928   1.00 73.88  ? 138 VAL X CB  1 
ATOM   2496  C CG1 . VAL C  3 123 ? -15.925 -21.716 0.156   1.00 71.35  ? 138 VAL X CG1 1 
ATOM   2497  C CG2 . VAL C  3 123 ? -17.343 -21.724 2.239   1.00 73.45  ? 138 VAL X CG2 1 
ATOM   2498  N N   . HIS C  3 124 ? -20.509 -23.229 1.043   1.00 79.55  ? 139 HIS X N   1 
ATOM   2499  C CA  . HIS C  3 124 ? -21.444 -24.077 1.790   1.00 81.85  ? 139 HIS X CA  1 
ATOM   2500  C C   . HIS C  3 124 ? -21.719 -25.459 1.168   1.00 85.47  ? 139 HIS X C   1 
ATOM   2501  O O   . HIS C  3 124 ? -22.175 -26.355 1.881   1.00 85.72  ? 139 HIS X O   1 
ATOM   2502  C CB  . HIS C  3 124 ? -22.760 -23.343 2.094   1.00 87.30  ? 139 HIS X CB  1 
ATOM   2503  C CG  . HIS C  3 124 ? -23.738 -23.243 0.957   1.00 95.31  ? 139 HIS X CG  1 
ATOM   2504  N ND1 . HIS C  3 124 ? -23.720 -22.171 0.078   1.00 97.91  ? 139 HIS X ND1 1 
ATOM   2505  C CD2 . HIS C  3 124 ? -24.790 -24.037 0.652   1.00 101.12 ? 139 HIS X CD2 1 
ATOM   2506  C CE1 . HIS C  3 124 ? -24.721 -22.377 -0.760  1.00 101.70 ? 139 HIS X CE1 1 
ATOM   2507  N NE2 . HIS C  3 124 ? -25.399 -23.482 -0.448  1.00 104.22 ? 139 HIS X NE2 1 
ATOM   2508  N N   . LYS C  3 125 ? -21.387 -25.645 -0.122  1.00 81.39  ? 140 LYS X N   1 
ATOM   2509  C CA  . LYS C  3 125 ? -21.614 -26.898 -0.845  1.00 82.71  ? 140 LYS X CA  1 
ATOM   2510  C C   . LYS C  3 125 ? -20.351 -27.784 -1.015  1.00 82.66  ? 140 LYS X C   1 
ATOM   2511  O O   . LYS C  3 125 ? -20.454 -28.865 -1.588  1.00 83.30  ? 140 LYS X O   1 
ATOM   2512  C CB  . LYS C  3 125 ? -22.283 -26.604 -2.209  1.00 88.17  ? 140 LYS X CB  1 
ATOM   2513  C CG  . LYS C  3 125 ? -23.787 -26.287 -2.128  1.00 93.23  ? 140 LYS X CG  1 
ATOM   2514  C CD  . LYS C  3 125 ? -24.342 -25.808 -3.476  1.00 100.96 ? 140 LYS X CD  1 
ATOM   2515  C CE  . LYS C  3 125 ? -25.805 -26.149 -3.688  1.00 115.43 ? 140 LYS X CE  1 
ATOM   2516  N NZ  . LYS C  3 125 ? -26.736 -25.230 -2.970  1.00 121.26 ? 140 LYS X NZ  1 
ATOM   2517  N N   . ILE C  3 126 ? -19.180 -27.345 -0.511  1.00 75.65  ? 141 ILE X N   1 
ATOM   2518  C CA  . ILE C  3 126 ? -17.920 -28.095 -0.621  1.00 72.71  ? 141 ILE X CA  1 
ATOM   2519  C C   . ILE C  3 126 ? -17.968 -29.385 0.221   1.00 78.12  ? 141 ILE X C   1 
ATOM   2520  O O   . ILE C  3 126 ? -17.689 -30.469 -0.303  1.00 78.50  ? 141 ILE X O   1 
ATOM   2521  C CB  . ILE C  3 126 ? -16.676 -27.198 -0.333  1.00 71.41  ? 141 ILE X CB  1 
ATOM   2522  C CG1 . ILE C  3 126 ? -16.467 -26.214 -1.510  1.00 72.16  ? 141 ILE X CG1 1 
ATOM   2523  C CG2 . ILE C  3 126 ? -15.408 -28.047 -0.095  1.00 68.59  ? 141 ILE X CG2 1 
ATOM   2524  C CD1 . ILE C  3 126 ? -15.351 -25.109 -1.364  1.00 77.95  ? 141 ILE X CD1 1 
ATOM   2525  N N   . HIS C  3 127 ? -18.340 -29.251 1.512   1.00 75.02  ? 142 HIS X N   1 
ATOM   2526  C CA  . HIS C  3 127 ? -18.477 -30.326 2.494   1.00 75.82  ? 142 HIS X CA  1 
ATOM   2527  C C   . HIS C  3 127 ? -17.310 -31.295 2.511   1.00 74.41  ? 142 HIS X C   1 
ATOM   2528  O O   . HIS C  3 127 ? -17.520 -32.507 2.467   1.00 76.11  ? 142 HIS X O   1 
ATOM   2529  C CB  . HIS C  3 127 ? -19.805 -31.060 2.292   1.00 82.22  ? 142 HIS X CB  1 
ATOM   2530  C CG  . HIS C  3 127 ? -20.997 -30.215 2.577   1.00 88.93  ? 142 HIS X CG  1 
ATOM   2531  N ND1 . HIS C  3 127 ? -21.322 -29.843 3.868   1.00 91.33  ? 142 HIS X ND1 1 
ATOM   2532  C CD2 . HIS C  3 127 ? -21.916 -29.709 1.727   1.00 94.04  ? 142 HIS X CD2 1 
ATOM   2533  C CE1 . HIS C  3 127 ? -22.429 -29.126 3.764   1.00 93.87  ? 142 HIS X CE1 1 
ATOM   2534  N NE2 . HIS C  3 127 ? -22.819 -29.013 2.494   1.00 95.91  ? 142 HIS X NE2 1 
ATOM   2535  N N   . SER C  3 128 ? -16.080 -30.768 2.572   1.00 65.69  ? 143 SER X N   1 
ATOM   2536  C CA  . SER C  3 128 ? -14.877 -31.602 2.575   1.00 63.35  ? 143 SER X CA  1 
ATOM   2537  C C   . SER C  3 128 ? -14.745 -32.460 3.821   1.00 69.84  ? 143 SER X C   1 
ATOM   2538  O O   . SER C  3 128 ? -15.217 -32.073 4.896   1.00 71.48  ? 143 SER X O   1 
ATOM   2539  C CB  . SER C  3 128 ? -13.623 -30.760 2.413   1.00 60.11  ? 143 SER X CB  1 
ATOM   2540  O OG  . SER C  3 128 ? -12.502 -31.608 2.238   1.00 62.53  ? 143 SER X OG  1 
ATOM   2541  N N   . LEU C  3 129 ? -14.102 -33.631 3.664   1.00 65.59  ? 144 LEU X N   1 
ATOM   2542  C CA  . LEU C  3 129 ? -13.823 -34.565 4.755   1.00 65.18  ? 144 LEU X CA  1 
ATOM   2543  C C   . LEU C  3 129 ? -12.437 -34.264 5.371   1.00 63.70  ? 144 LEU X C   1 
ATOM   2544  O O   . LEU C  3 129 ? -12.071 -34.858 6.391   1.00 63.15  ? 144 LEU X O   1 
ATOM   2545  C CB  . LEU C  3 129 ? -13.853 -36.019 4.234   1.00 67.60  ? 144 LEU X CB  1 
ATOM   2546  C CG  . LEU C  3 129 ? -15.120 -36.518 3.524   1.00 74.78  ? 144 LEU X CG  1 
ATOM   2547  C CD1 . LEU C  3 129 ? -14.901 -37.908 2.933   1.00 76.36  ? 144 LEU X CD1 1 
ATOM   2548  C CD2 . LEU C  3 129 ? -16.322 -36.513 4.454   1.00 79.02  ? 144 LEU X CD2 1 
ATOM   2549  N N   . GLN C  3 130 ? -11.691 -33.323 4.751   1.00 56.11  ? 145 GLN X N   1 
ATOM   2550  C CA  . GLN C  3 130 ? -10.323 -32.954 5.096   1.00 52.73  ? 145 GLN X CA  1 
ATOM   2551  C C   . GLN C  3 130 ? -10.214 -31.632 5.819   1.00 54.94  ? 145 GLN X C   1 
ATOM   2552  O O   . GLN C  3 130 ? -11.109 -30.802 5.677   1.00 56.66  ? 145 GLN X O   1 
ATOM   2553  C CB  . GLN C  3 130 ? -9.480  -32.862 3.807   1.00 52.82  ? 145 GLN X CB  1 
ATOM   2554  C CG  . GLN C  3 130 ? -9.369  -34.146 2.976   1.00 73.27  ? 145 GLN X CG  1 
ATOM   2555  C CD  . GLN C  3 130 ? -8.890  -35.342 3.762   1.00 95.35  ? 145 GLN X CD  1 
ATOM   2556  O OE1 . GLN C  3 130 ? -7.745  -35.409 4.228   1.00 89.68  ? 145 GLN X OE1 1 
ATOM   2557  N NE2 . GLN C  3 130 ? -9.775  -36.308 3.935   1.00 93.20  ? 145 GLN X NE2 1 
ATOM   2558  N N   . LYS C  3 131 ? -9.091  -31.403 6.555   1.00 47.51  ? 146 LYS X N   1 
ATOM   2559  C CA  . LYS C  3 131 ? -8.811  -30.097 7.163   1.00 44.44  ? 146 LYS X CA  1 
ATOM   2560  C C   . LYS C  3 131 ? -8.531  -29.191 5.969   1.00 48.72  ? 146 LYS X C   1 
ATOM   2561  O O   . LYS C  3 131 ? -7.772  -29.598 5.078   1.00 48.86  ? 146 LYS X O   1 
ATOM   2562  C CB  . LYS C  3 131 ? -7.608  -30.119 8.134   1.00 42.93  ? 146 LYS X CB  1 
ATOM   2563  C CG  . LYS C  3 131 ? -7.978  -30.667 9.510   1.00 48.12  ? 146 LYS X CG  1 
ATOM   2564  C CD  . LYS C  3 131 ? -6.875  -30.549 10.553  1.00 55.13  ? 146 LYS X CD  1 
ATOM   2565  C CE  . LYS C  3 131 ? -7.232  -31.269 11.839  1.00 66.90  ? 146 LYS X CE  1 
ATOM   2566  N NZ  . LYS C  3 131 ? -7.099  -30.383 13.033  1.00 80.47  ? 146 LYS X NZ  1 
ATOM   2567  N N   . VAL C  3 132 ? -9.220  -28.025 5.895   1.00 44.21  ? 147 VAL X N   1 
ATOM   2568  C CA  . VAL C  3 132 ? -9.098  -27.120 4.757   1.00 42.59  ? 147 VAL X CA  1 
ATOM   2569  C C   . VAL C  3 132 ? -8.384  -25.820 5.089   1.00 46.95  ? 147 VAL X C   1 
ATOM   2570  O O   . VAL C  3 132 ? -8.607  -25.216 6.142   1.00 47.25  ? 147 VAL X O   1 
ATOM   2571  C CB  . VAL C  3 132 ? -10.475 -26.852 4.096   1.00 47.44  ? 147 VAL X CB  1 
ATOM   2572  C CG1 . VAL C  3 132 ? -10.348 -25.915 2.893   1.00 46.76  ? 147 VAL X CG1 1 
ATOM   2573  C CG2 . VAL C  3 132 ? -11.153 -28.152 3.689   1.00 48.99  ? 147 VAL X CG2 1 
ATOM   2574  N N   . LEU C  3 133 ? -7.531  -25.380 4.154   1.00 43.17  ? 148 LEU X N   1 
ATOM   2575  C CA  . LEU C  3 133 ? -6.848  -24.095 4.218   1.00 40.25  ? 148 LEU X CA  1 
ATOM   2576  C C   . LEU C  3 133 ? -7.425  -23.236 3.098   1.00 47.25  ? 148 LEU X C   1 
ATOM   2577  O O   . LEU C  3 133 ? -7.136  -23.437 1.912   1.00 48.17  ? 148 LEU X O   1 
ATOM   2578  C CB  . LEU C  3 133 ? -5.303  -24.210 4.166   1.00 37.28  ? 148 LEU X CB  1 
ATOM   2579  C CG  . LEU C  3 133 ? -4.440  -22.957 3.845   1.00 38.60  ? 148 LEU X CG  1 
ATOM   2580  C CD1 . LEU C  3 133 ? -4.707  -21.789 4.773   1.00 36.77  ? 148 LEU X CD1 1 
ATOM   2581  C CD2 . LEU C  3 133 ? -2.989  -23.305 3.899   1.00 40.10  ? 148 LEU X CD2 1 
ATOM   2582  N N   . LEU C  3 134 ? -8.319  -22.339 3.493   1.00 44.36  ? 149 LEU X N   1 
ATOM   2583  C CA  . LEU C  3 134 ? -8.912  -21.382 2.593   1.00 45.10  ? 149 LEU X CA  1 
ATOM   2584  C C   . LEU C  3 134 ? -7.982  -20.187 2.701   1.00 48.41  ? 149 LEU X C   1 
ATOM   2585  O O   . LEU C  3 134 ? -7.853  -19.590 3.779   1.00 46.94  ? 149 LEU X O   1 
ATOM   2586  C CB  . LEU C  3 134 ? -10.360 -21.046 3.010   1.00 47.33  ? 149 LEU X CB  1 
ATOM   2587  C CG  . LEU C  3 134 ? -11.202 -20.255 2.001   1.00 54.46  ? 149 LEU X CG  1 
ATOM   2588  C CD1 . LEU C  3 134 ? -11.161 -20.869 0.629   1.00 55.40  ? 149 LEU X CD1 1 
ATOM   2589  C CD2 . LEU C  3 134 ? -12.643 -20.138 2.441   1.00 60.41  ? 149 LEU X CD2 1 
ATOM   2590  N N   . ASP C  3 135 ? -7.240  -19.921 1.614   1.00 45.88  ? 150 ASP X N   1 
ATOM   2591  C CA  . ASP C  3 135 ? -6.255  -18.848 1.558   1.00 44.87  ? 150 ASP X CA  1 
ATOM   2592  C C   . ASP C  3 135 ? -6.671  -17.871 0.480   1.00 50.59  ? 150 ASP X C   1 
ATOM   2593  O O   . ASP C  3 135 ? -6.562  -18.168 -0.706  1.00 51.63  ? 150 ASP X O   1 
ATOM   2594  C CB  . ASP C  3 135 ? -4.852  -19.450 1.321   1.00 45.38  ? 150 ASP X CB  1 
ATOM   2595  C CG  . ASP C  3 135 ? -3.687  -18.483 1.323   1.00 54.96  ? 150 ASP X CG  1 
ATOM   2596  O OD1 . ASP C  3 135 ? -3.892  -17.306 1.676   1.00 57.95  ? 150 ASP X OD1 1 
ATOM   2597  O OD2 . ASP C  3 135 ? -2.560  -18.913 0.980   1.00 58.38  ? 150 ASP X OD2 1 
ATOM   2598  N N   . ILE C  3 136 ? -7.205  -16.725 0.912   1.00 48.33  ? 151 ILE X N   1 
ATOM   2599  C CA  . ILE C  3 136 ? -7.750  -15.640 0.079   1.00 50.51  ? 151 ILE X CA  1 
ATOM   2600  C C   . ILE C  3 136 ? -6.966  -14.371 0.409   1.00 56.07  ? 151 ILE X C   1 
ATOM   2601  O O   . ILE C  3 136 ? -7.075  -13.843 1.519   1.00 57.21  ? 151 ILE X O   1 
ATOM   2602  C CB  . ILE C  3 136 ? -9.294  -15.510 0.329   1.00 55.65  ? 151 ILE X CB  1 
ATOM   2603  C CG1 . ILE C  3 136 ? -10.042 -16.811 -0.085  1.00 56.48  ? 151 ILE X CG1 1 
ATOM   2604  C CG2 . ILE C  3 136 ? -9.899  -14.257 -0.326  1.00 58.10  ? 151 ILE X CG2 1 
ATOM   2605  C CD1 . ILE C  3 136 ? -11.274 -17.071 0.659   1.00 64.14  ? 151 ILE X CD1 1 
ATOM   2606  N N   . GLN C  3 137 ? -6.120  -13.923 -0.533  1.00 51.85  ? 152 GLN X N   1 
ATOM   2607  C CA  . GLN C  3 137 ? -5.212  -12.786 -0.340  1.00 49.64  ? 152 GLN X CA  1 
ATOM   2608  C C   . GLN C  3 137 ? -5.081  -11.945 -1.591  1.00 53.74  ? 152 GLN X C   1 
ATOM   2609  O O   . GLN C  3 137 ? -5.220  -12.462 -2.703  1.00 54.04  ? 152 GLN X O   1 
ATOM   2610  C CB  . GLN C  3 137 ? -3.816  -13.295 0.026   1.00 48.40  ? 152 GLN X CB  1 
ATOM   2611  C CG  . GLN C  3 137 ? -3.688  -13.967 1.385   1.00 59.37  ? 152 GLN X CG  1 
ATOM   2612  C CD  . GLN C  3 137 ? -2.247  -14.319 1.685   1.00 77.24  ? 152 GLN X CD  1 
ATOM   2613  O OE1 . GLN C  3 137 ? -1.295  -13.594 1.305   1.00 75.12  ? 152 GLN X OE1 1 
ATOM   2614  N NE2 . GLN C  3 137 ? -2.057  -15.421 2.410   1.00 56.50  ? 152 GLN X NE2 1 
ATOM   2615  N N   . ASP C  3 138 ? -4.778  -10.644 -1.399  1.00 49.66  ? 153 ASP X N   1 
ATOM   2616  C CA  . ASP C  3 138 ? -4.561  -9.645  -2.445  1.00 50.55  ? 153 ASP X CA  1 
ATOM   2617  C C   . ASP C  3 138 ? -5.783  -9.464  -3.358  1.00 57.71  ? 153 ASP X C   1 
ATOM   2618  O O   . ASP C  3 138 ? -5.637  -9.209  -4.557  1.00 59.28  ? 153 ASP X O   1 
ATOM   2619  C CB  . ASP C  3 138 ? -3.263  -9.929  -3.221  1.00 51.17  ? 153 ASP X CB  1 
ATOM   2620  C CG  . ASP C  3 138 ? -2.029  -9.628  -2.389  1.00 61.86  ? 153 ASP X CG  1 
ATOM   2621  O OD1 . ASP C  3 138 ? -1.863  -8.448  -1.976  1.00 64.42  ? 153 ASP X OD1 1 
ATOM   2622  O OD2 . ASP C  3 138 ? -1.227  -10.577 -2.134  1.00 62.52  ? 153 ASP X OD2 1 
ATOM   2623  N N   . ASN C  3 139 ? -6.992  -9.517  -2.758  1.00 55.52  ? 154 ASN X N   1 
ATOM   2624  C CA  . ASN C  3 139 ? -8.270  -9.340  -3.463  1.00 58.75  ? 154 ASN X CA  1 
ATOM   2625  C C   . ASN C  3 139 ? -8.966  -8.065  -2.952  1.00 66.45  ? 154 ASN X C   1 
ATOM   2626  O O   . ASN C  3 139 ? -10.017 -8.129  -2.304  1.00 67.90  ? 154 ASN X O   1 
ATOM   2627  C CB  . ASN C  3 139 ? -9.169  -10.574 -3.312  1.00 56.40  ? 154 ASN X CB  1 
ATOM   2628  C CG  . ASN C  3 139 ? -8.519  -11.865 -3.695  1.00 69.80  ? 154 ASN X CG  1 
ATOM   2629  O OD1 . ASN C  3 139 ? -8.385  -12.197 -4.879  1.00 59.43  ? 154 ASN X OD1 1 
ATOM   2630  N ND2 . ASN C  3 139 ? -8.093  -12.616 -2.691  1.00 63.72  ? 154 ASN X ND2 1 
ATOM   2631  N N   . ILE C  3 140 ? -8.376  -6.903  -3.282  1.00 63.69  ? 155 ILE X N   1 
ATOM   2632  C CA  . ILE C  3 140 ? -8.794  -5.562  -2.842  1.00 64.94  ? 155 ILE X CA  1 
ATOM   2633  C C   . ILE C  3 140 ? -10.277 -5.245  -3.073  1.00 72.00  ? 155 ILE X C   1 
ATOM   2634  O O   . ILE C  3 140 ? -10.784 -4.326  -2.431  1.00 74.57  ? 155 ILE X O   1 
ATOM   2635  C CB  . ILE C  3 140 ? -7.884  -4.440  -3.412  1.00 68.14  ? 155 ILE X CB  1 
ATOM   2636  C CG1 . ILE C  3 140 ? -7.673  -4.596  -4.935  1.00 69.72  ? 155 ILE X CG1 1 
ATOM   2637  C CG2 . ILE C  3 140 ? -6.550  -4.429  -2.650  1.00 64.94  ? 155 ILE X CG2 1 
ATOM   2638  C CD1 . ILE C  3 140 ? -7.275  -3.336  -5.677  1.00 78.94  ? 155 ILE X CD1 1 
ATOM   2639  N N   . ASN C  3 141 ? -10.978 -6.000  -3.928  1.00 68.76  ? 156 ASN X N   1 
ATOM   2640  C CA  . ASN C  3 141 ? -12.400 -5.746  -4.143  1.00 72.40  ? 156 ASN X CA  1 
ATOM   2641  C C   . ASN C  3 141 ? -13.308 -6.518  -3.160  1.00 76.60  ? 156 ASN X C   1 
ATOM   2642  O O   . ASN C  3 141 ? -14.525 -6.313  -3.182  1.00 80.03  ? 156 ASN X O   1 
ATOM   2643  C CB  . ASN C  3 141 ? -12.798 -5.959  -5.598  1.00 74.70  ? 156 ASN X CB  1 
ATOM   2644  C CG  . ASN C  3 141 ? -12.195 -4.921  -6.503  1.00 94.38  ? 156 ASN X CG  1 
ATOM   2645  O OD1 . ASN C  3 141 ? -12.049 -3.749  -6.138  1.00 84.97  ? 156 ASN X OD1 1 
ATOM   2646  N ND2 . ASN C  3 141 ? -11.819 -5.332  -7.702  1.00 89.06  ? 156 ASN X ND2 1 
ATOM   2647  N N   . ILE C  3 142 ? -12.722 -7.363  -2.275  1.00 69.19  ? 157 ILE X N   1 
ATOM   2648  C CA  . ILE C  3 142 ? -13.467 -8.055  -1.218  1.00 68.67  ? 157 ILE X CA  1 
ATOM   2649  C C   . ILE C  3 142 ? -13.485 -7.080  -0.029  1.00 76.37  ? 157 ILE X C   1 
ATOM   2650  O O   . ILE C  3 142 ? -12.432 -6.806  0.543   1.00 72.75  ? 157 ILE X O   1 
ATOM   2651  C CB  . ILE C  3 142 ? -12.870 -9.440  -0.841  1.00 67.25  ? 157 ILE X CB  1 
ATOM   2652  C CG1 . ILE C  3 142 ? -13.053 -10.447 -1.979  1.00 68.11  ? 157 ILE X CG1 1 
ATOM   2653  C CG2 . ILE C  3 142 ? -13.483 -9.969  0.459   1.00 66.50  ? 157 ILE X CG2 1 
ATOM   2654  C CD1 . ILE C  3 142 ? -12.312 -11.786 -1.800  1.00 72.59  ? 157 ILE X CD1 1 
ATOM   2655  N N   . HIS C  3 143 ? -14.674 -6.543  0.313   1.00 79.97  ? 158 HIS X N   1 
ATOM   2656  C CA  . HIS C  3 143 ? -14.859 -5.569  1.397   1.00 82.00  ? 158 HIS X CA  1 
ATOM   2657  C C   . HIS C  3 143 ? -15.699 -6.099  2.578   1.00 85.95  ? 158 HIS X C   1 
ATOM   2658  O O   . HIS C  3 143 ? -15.725 -5.449  3.632   1.00 85.46  ? 158 HIS X O   1 
ATOM   2659  C CB  . HIS C  3 143 ? -15.491 -4.255  0.871   1.00 87.78  ? 158 HIS X CB  1 
ATOM   2660  C CG  . HIS C  3 143 ? -14.859 -3.665  -0.359  1.00 92.10  ? 158 HIS X CG  1 
ATOM   2661  N ND1 . HIS C  3 143 ? -13.536 -3.227  -0.364  1.00 91.67  ? 158 HIS X ND1 1 
ATOM   2662  C CD2 . HIS C  3 143 ? -15.409 -3.398  -1.568  1.00 97.17  ? 158 HIS X CD2 1 
ATOM   2663  C CE1 . HIS C  3 143 ? -13.324 -2.741  -1.579  1.00 92.51  ? 158 HIS X CE1 1 
ATOM   2664  N NE2 . HIS C  3 143 ? -14.420 -2.818  -2.338  1.00 96.31  ? 158 HIS X NE2 1 
ATOM   2665  N N   . THR C  3 144 ? -16.400 -7.249  2.416   1.00 83.05  ? 159 THR X N   1 
ATOM   2666  C CA  . THR C  3 144 ? -17.270 -7.719  3.503   1.00 84.45  ? 159 THR X CA  1 
ATOM   2667  C C   . THR C  3 144 ? -17.432 -9.256  3.655   1.00 84.63  ? 159 THR X C   1 
ATOM   2668  O O   . THR C  3 144 ? -17.728 -9.980  2.699   1.00 83.58  ? 159 THR X O   1 
ATOM   2669  C CB  . THR C  3 144 ? -18.662 -7.039  3.409   1.00 100.38 ? 159 THR X CB  1 
ATOM   2670  O OG1 . THR C  3 144 ? -19.607 -7.725  4.236   1.00 100.39 ? 159 THR X OG1 1 
ATOM   2671  C CG2 . THR C  3 144 ? -19.186 -6.923  1.973   1.00 103.25 ? 159 THR X CG2 1 
ATOM   2672  N N   . ILE C  3 145 ? -17.315 -9.708  4.918   1.00 79.82  ? 160 ILE X N   1 
ATOM   2673  C CA  . ILE C  3 145 ? -17.508 -11.094 5.330   1.00 78.95  ? 160 ILE X CA  1 
ATOM   2674  C C   . ILE C  3 145 ? -18.883 -11.145 5.948   1.00 86.50  ? 160 ILE X C   1 
ATOM   2675  O O   . ILE C  3 145 ? -19.075 -10.664 7.068   1.00 87.16  ? 160 ILE X O   1 
ATOM   2676  C CB  . ILE C  3 145 ? -16.434 -11.617 6.319   1.00 79.23  ? 160 ILE X CB  1 
ATOM   2677  C CG1 . ILE C  3 145 ? -15.001 -11.351 5.816   1.00 76.24  ? 160 ILE X CG1 1 
ATOM   2678  C CG2 . ILE C  3 145 ? -16.660 -13.116 6.605   1.00 80.62  ? 160 ILE X CG2 1 
ATOM   2679  C CD1 . ILE C  3 145 ? -13.965 -11.484 6.868   1.00 83.65  ? 160 ILE X CD1 1 
ATOM   2680  N N   . GLU C  3 146 ? -19.839 -11.717 5.205   1.00 85.39  ? 161 GLU X N   1 
ATOM   2681  C CA  . GLU C  3 146 ? -21.249 -11.830 5.576   1.00 89.47  ? 161 GLU X CA  1 
ATOM   2682  C C   . GLU C  3 146 ? -21.517 -13.017 6.499   1.00 91.98  ? 161 GLU X C   1 
ATOM   2683  O O   . GLU C  3 146 ? -20.673 -13.900 6.593   1.00 87.07  ? 161 GLU X O   1 
ATOM   2684  C CB  . GLU C  3 146 ? -22.119 -11.918 4.305   1.00 94.23  ? 161 GLU X CB  1 
ATOM   2685  C CG  . GLU C  3 146 ? -21.775 -10.885 3.235   1.00 105.70 ? 161 GLU X CG  1 
ATOM   2686  C CD  . GLU C  3 146 ? -22.868 -10.540 2.242   1.00 133.43 ? 161 GLU X CD  1 
ATOM   2687  O OE1 . GLU C  3 146 ? -23.573 -11.460 1.767   1.00 131.41 ? 161 GLU X OE1 1 
ATOM   2688  O OE2 . GLU C  3 146 ? -22.996 -9.339  1.914   1.00 131.60 ? 161 GLU X OE2 1 
ATOM   2689  N N   . ARG C  3 147 ? -22.696 -13.043 7.172   1.00 93.58  ? 162 ARG X N   1 
ATOM   2690  C CA  . ARG C  3 147 ? -23.102 -14.133 8.073   1.00 94.16  ? 162 ARG X CA  1 
ATOM   2691  C C   . ARG C  3 147 ? -23.053 -15.512 7.377   1.00 95.59  ? 162 ARG X C   1 
ATOM   2692  O O   . ARG C  3 147 ? -23.492 -15.636 6.232   1.00 97.27  ? 162 ARG X O   1 
ATOM   2693  C CB  . ARG C  3 147 ? -24.512 -13.875 8.640   1.00 100.42 ? 162 ARG X CB  1 
ATOM   2694  C CG  . ARG C  3 147 ? -24.963 -14.871 9.722   1.00 111.41 ? 162 ARG X CG  1 
ATOM   2695  C CD  . ARG C  3 147 ? -26.421 -14.694 10.109  1.00 126.89 ? 162 ARG X CD  1 
ATOM   2696  N NE  . ARG C  3 147 ? -27.314 -15.507 9.281   1.00 140.07 ? 162 ARG X NE  1 
ATOM   2697  C CZ  . ARG C  3 147 ? -28.633 -15.595 9.451   1.00 160.38 ? 162 ARG X CZ  1 
ATOM   2698  N NH1 . ARG C  3 147 ? -29.232 -14.917 10.425  1.00 150.38 ? 162 ARG X NH1 1 
ATOM   2699  N NH2 . ARG C  3 147 ? -29.361 -16.363 8.654   1.00 149.33 ? 162 ARG X NH2 1 
ATOM   2700  N N   . ASN C  3 148 ? -22.513 -16.528 8.081   1.00 87.98  ? 163 ASN X N   1 
ATOM   2701  C CA  . ASN C  3 148 ? -22.397 -17.927 7.646   1.00 86.43  ? 163 ASN X CA  1 
ATOM   2702  C C   . ASN C  3 148 ? -21.540 -18.115 6.367   1.00 88.08  ? 163 ASN X C   1 
ATOM   2703  O O   . ASN C  3 148 ? -21.792 -19.016 5.560   1.00 88.73  ? 163 ASN X O   1 
ATOM   2704  C CB  . ASN C  3 148 ? -23.786 -18.580 7.507   1.00 87.84  ? 163 ASN X CB  1 
ATOM   2705  C CG  . ASN C  3 148 ? -24.608 -18.576 8.774   1.00 102.00 ? 163 ASN X CG  1 
ATOM   2706  O OD1 . ASN C  3 148 ? -24.109 -18.841 9.868   1.00 87.52  ? 163 ASN X OD1 1 
ATOM   2707  N ND2 . ASN C  3 148 ? -25.902 -18.302 8.648   1.00 95.73  ? 163 ASN X ND2 1 
ATOM   2708  N N   . SER C  3 149 ? -20.492 -17.296 6.229   1.00 81.35  ? 164 SER X N   1 
ATOM   2709  C CA  . SER C  3 149 ? -19.577 -17.315 5.086   1.00 78.34  ? 164 SER X CA  1 
ATOM   2710  C C   . SER C  3 149 ? -18.792 -18.621 4.897   1.00 79.16  ? 164 SER X C   1 
ATOM   2711  O O   . SER C  3 149 ? -18.411 -18.924 3.762   1.00 78.40  ? 164 SER X O   1 
ATOM   2712  C CB  . SER C  3 149 ? -18.595 -16.149 5.173   1.00 78.94  ? 164 SER X CB  1 
ATOM   2713  O OG  . SER C  3 149 ? -19.125 -14.960 4.612   1.00 91.09  ? 164 SER X OG  1 
ATOM   2714  N N   . PHE C  3 150 ? -18.532 -19.380 5.988   1.00 72.67  ? 165 PHE X N   1 
ATOM   2715  C CA  . PHE C  3 150 ? -17.672 -20.565 5.903   1.00 68.64  ? 165 PHE X CA  1 
ATOM   2716  C C   . PHE C  3 150 ? -18.331 -21.877 6.404   1.00 75.90  ? 165 PHE X C   1 
ATOM   2717  O O   . PHE C  3 150 ? -17.674 -22.933 6.456   1.00 73.92  ? 165 PHE X O   1 
ATOM   2718  C CB  . PHE C  3 150 ? -16.324 -20.283 6.611   1.00 65.49  ? 165 PHE X CB  1 
ATOM   2719  C CG  . PHE C  3 150 ? -15.670 -19.003 6.135   1.00 63.99  ? 165 PHE X CG  1 
ATOM   2720  C CD1 . PHE C  3 150 ? -14.974 -18.963 4.935   1.00 64.30  ? 165 PHE X CD1 1 
ATOM   2721  C CD2 . PHE C  3 150 ? -15.804 -17.823 6.857   1.00 65.41  ? 165 PHE X CD2 1 
ATOM   2722  C CE1 . PHE C  3 150 ? -14.408 -17.767 4.475   1.00 63.69  ? 165 PHE X CE1 1 
ATOM   2723  C CE2 . PHE C  3 150 ? -15.240 -16.632 6.395   1.00 66.65  ? 165 PHE X CE2 1 
ATOM   2724  C CZ  . PHE C  3 150 ? -14.546 -16.612 5.207   1.00 62.82  ? 165 PHE X CZ  1 
ATOM   2725  N N   . VAL C  3 151 ? -19.639 -21.823 6.705   1.00 76.15  ? 166 VAL X N   1 
ATOM   2726  C CA  . VAL C  3 151 ? -20.389 -23.008 7.128   1.00 78.02  ? 166 VAL X CA  1 
ATOM   2727  C C   . VAL C  3 151 ? -20.501 -23.973 5.930   1.00 81.44  ? 166 VAL X C   1 
ATOM   2728  O O   . VAL C  3 151 ? -20.600 -23.520 4.784   1.00 81.35  ? 166 VAL X O   1 
ATOM   2729  C CB  . VAL C  3 151 ? -21.755 -22.640 7.795   1.00 86.00  ? 166 VAL X CB  1 
ATOM   2730  C CG1 . VAL C  3 151 ? -22.733 -22.018 6.808   1.00 88.82  ? 166 VAL X CG1 1 
ATOM   2731  C CG2 . VAL C  3 151 ? -22.380 -23.823 8.533   1.00 88.02  ? 166 VAL X CG2 1 
ATOM   2732  N N   . GLY C  3 152 ? -20.372 -25.269 6.204   1.00 76.89  ? 167 GLY X N   1 
ATOM   2733  C CA  . GLY C  3 152 ? -20.441 -26.298 5.178   1.00 77.26  ? 167 GLY X CA  1 
ATOM   2734  C C   . GLY C  3 152 ? -19.192 -26.481 4.334   1.00 77.79  ? 167 GLY X C   1 
ATOM   2735  O O   . GLY C  3 152 ? -19.191 -27.341 3.449   1.00 78.87  ? 167 GLY X O   1 
ATOM   2736  N N   . LEU C  3 153 ? -18.121 -25.684 4.580   1.00 69.55  ? 168 LEU X N   1 
ATOM   2737  C CA  . LEU C  3 153 ? -16.847 -25.816 3.864   1.00 65.40  ? 168 LEU X CA  1 
ATOM   2738  C C   . LEU C  3 153 ? -16.215 -27.147 4.241   1.00 68.20  ? 168 LEU X C   1 
ATOM   2739  O O   . LEU C  3 153 ? -15.727 -27.866 3.363   1.00 67.73  ? 168 LEU X O   1 
ATOM   2740  C CB  . LEU C  3 153 ? -15.870 -24.665 4.215   1.00 61.94  ? 168 LEU X CB  1 
ATOM   2741  C CG  . LEU C  3 153 ? -14.400 -24.816 3.751   1.00 63.10  ? 168 LEU X CG  1 
ATOM   2742  C CD1 . LEU C  3 153 ? -14.279 -24.826 2.242   1.00 63.90  ? 168 LEU X CD1 1 
ATOM   2743  C CD2 . LEU C  3 153 ? -13.559 -23.698 4.250   1.00 62.77  ? 168 LEU X CD2 1 
ATOM   2744  N N   . SER C  3 154 ? -16.209 -27.464 5.553   1.00 64.02  ? 169 SER X N   1 
ATOM   2745  C CA  . SER C  3 154 ? -15.597 -28.696 6.039   1.00 63.07  ? 169 SER X CA  1 
ATOM   2746  C C   . SER C  3 154 ? -16.261 -29.280 7.282   1.00 70.60  ? 169 SER X C   1 
ATOM   2747  O O   . SER C  3 154 ? -16.806 -28.551 8.116   1.00 71.67  ? 169 SER X O   1 
ATOM   2748  C CB  . SER C  3 154 ? -14.111 -28.479 6.306   1.00 59.85  ? 169 SER X CB  1 
ATOM   2749  O OG  . SER C  3 154 ? -13.464 -29.726 6.455   1.00 60.22  ? 169 SER X OG  1 
ATOM   2750  N N   . PHE C  3 155 ? -16.182 -30.609 7.410   1.00 67.82  ? 170 PHE X N   1 
ATOM   2751  C CA  . PHE C  3 155 ? -16.660 -31.303 8.591   1.00 69.39  ? 170 PHE X CA  1 
ATOM   2752  C C   . PHE C  3 155 ? -15.517 -31.305 9.615   1.00 69.33  ? 170 PHE X C   1 
ATOM   2753  O O   . PHE C  3 155 ? -15.737 -31.583 10.798  1.00 69.65  ? 170 PHE X O   1 
ATOM   2754  C CB  . PHE C  3 155 ? -17.057 -32.722 8.237   1.00 73.81  ? 170 PHE X CB  1 
ATOM   2755  C CG  . PHE C  3 155 ? -18.265 -32.854 7.349   1.00 78.79  ? 170 PHE X CG  1 
ATOM   2756  C CD1 . PHE C  3 155 ? -19.546 -32.847 7.885   1.00 85.25  ? 170 PHE X CD1 1 
ATOM   2757  C CD2 . PHE C  3 155 ? -18.123 -33.073 5.985   1.00 81.64  ? 170 PHE X CD2 1 
ATOM   2758  C CE1 . PHE C  3 155 ? -20.665 -33.071 7.074   1.00 89.67  ? 170 PHE X CE1 1 
ATOM   2759  C CE2 . PHE C  3 155 ? -19.242 -33.288 5.172   1.00 87.70  ? 170 PHE X CE2 1 
ATOM   2760  C CZ  . PHE C  3 155 ? -20.506 -33.284 5.722   1.00 89.10  ? 170 PHE X CZ  1 
ATOM   2761  N N   . GLU C  3 156 ? -14.297 -30.971 9.133   1.00 62.07  ? 171 GLU X N   1 
ATOM   2762  C CA  . GLU C  3 156 ? -13.042 -30.887 9.886   1.00 59.58  ? 171 GLU X CA  1 
ATOM   2763  C C   . GLU C  3 156 ? -12.750 -29.449 10.248  1.00 63.34  ? 171 GLU X C   1 
ATOM   2764  O O   . GLU C  3 156 ? -13.449 -28.549 9.774   1.00 64.52  ? 171 GLU X O   1 
ATOM   2765  C CB  . GLU C  3 156 ? -11.867 -31.427 9.035   1.00 58.63  ? 171 GLU X CB  1 
ATOM   2766  C CG  . GLU C  3 156 ? -11.303 -32.766 9.473   1.00 65.38  ? 171 GLU X CG  1 
ATOM   2767  C CD  . GLU C  3 156 ? -10.871 -32.893 10.923  1.00 85.59  ? 171 GLU X CD  1 
ATOM   2768  O OE1 . GLU C  3 156 ? -10.412 -31.887 11.516  1.00 73.98  ? 171 GLU X OE1 1 
ATOM   2769  O OE2 . GLU C  3 156 ? -11.014 -34.011 11.471  1.00 80.79  ? 171 GLU X OE2 1 
ATOM   2770  N N   . SER C  3 157 ? -11.678 -29.217 11.043  1.00 58.11  ? 172 SER X N   1 
ATOM   2771  C CA  . SER C  3 157 ? -11.248 -27.861 11.410  1.00 55.37  ? 172 SER X CA  1 
ATOM   2772  C C   . SER C  3 157 ? -10.703 -27.147 10.201  1.00 57.19  ? 172 SER X C   1 
ATOM   2773  O O   . SER C  3 157 ? -10.314 -27.788 9.216   1.00 55.20  ? 172 SER X O   1 
ATOM   2774  C CB  . SER C  3 157 ? -10.246 -27.871 12.556  1.00 57.02  ? 172 SER X CB  1 
ATOM   2775  O OG  . SER C  3 157 ? -8.990  -28.408 12.183  1.00 58.22  ? 172 SER X OG  1 
ATOM   2776  N N   . VAL C  3 158 ? -10.695 -25.810 10.260  1.00 53.79  ? 173 VAL X N   1 
ATOM   2777  C CA  . VAL C  3 158 ? -10.369 -24.996 9.103   1.00 50.98  ? 173 VAL X CA  1 
ATOM   2778  C C   . VAL C  3 158 ? -9.385  -23.837 9.414   1.00 51.93  ? 173 VAL X C   1 
ATOM   2779  O O   . VAL C  3 158 ? -9.388  -23.324 10.530  1.00 53.38  ? 173 VAL X O   1 
ATOM   2780  C CB  . VAL C  3 158 ? -11.771 -24.565 8.544   1.00 55.73  ? 173 VAL X CB  1 
ATOM   2781  C CG1 . VAL C  3 158 ? -12.185 -23.138 8.872   1.00 55.48  ? 173 VAL X CG1 1 
ATOM   2782  C CG2 . VAL C  3 158 ? -11.943 -24.906 7.077   1.00 55.49  ? 173 VAL X CG2 1 
ATOM   2783  N N   . ILE C  3 159 ? -8.498  -23.491 8.447   1.00 44.75  ? 174 ILE X N   1 
ATOM   2784  C CA  . ILE C  3 159 ? -7.577  -22.349 8.561   1.00 42.54  ? 174 ILE X CA  1 
ATOM   2785  C C   . ILE C  3 159 ? -8.104  -21.310 7.578   1.00 47.75  ? 174 ILE X C   1 
ATOM   2786  O O   . ILE C  3 159 ? -8.322  -21.641 6.411   1.00 48.55  ? 174 ILE X O   1 
ATOM   2787  C CB  . ILE C  3 159 ? -6.065  -22.639 8.306   1.00 43.26  ? 174 ILE X CB  1 
ATOM   2788  C CG1 . ILE C  3 159 ? -5.473  -23.568 9.353   1.00 42.81  ? 174 ILE X CG1 1 
ATOM   2789  C CG2 . ILE C  3 159 ? -5.252  -21.320 8.283   1.00 43.61  ? 174 ILE X CG2 1 
ATOM   2790  C CD1 . ILE C  3 159 ? -4.031  -23.963 9.056   1.00 40.96  ? 174 ILE X CD1 1 
ATOM   2791  N N   . LEU C  3 160 ? -8.294  -20.064 8.039   1.00 44.02  ? 175 LEU X N   1 
ATOM   2792  C CA  . LEU C  3 160 ? -8.848  -19.001 7.218   1.00 44.45  ? 175 LEU X CA  1 
ATOM   2793  C C   . LEU C  3 160 ? -7.944  -17.797 7.091   1.00 48.79  ? 175 LEU X C   1 
ATOM   2794  O O   . LEU C  3 160 ? -7.871  -16.956 7.988   1.00 48.50  ? 175 LEU X O   1 
ATOM   2795  C CB  . LEU C  3 160 ? -10.258 -18.587 7.707   1.00 46.76  ? 175 LEU X CB  1 
ATOM   2796  C CG  . LEU C  3 160 ? -11.337 -19.681 7.795   1.00 51.66  ? 175 LEU X CG  1 
ATOM   2797  C CD1 . LEU C  3 160 ? -12.570 -19.168 8.498   1.00 53.09  ? 175 LEU X CD1 1 
ATOM   2798  C CD2 . LEU C  3 160 ? -11.672 -20.246 6.418   1.00 53.94  ? 175 LEU X CD2 1 
ATOM   2799  N N   . TRP C  3 161 ? -7.263  -17.712 5.949   1.00 46.06  ? 176 TRP X N   1 
ATOM   2800  C CA  . TRP C  3 161 ? -6.378  -16.607 5.644   1.00 45.26  ? 176 TRP X CA  1 
ATOM   2801  C C   . TRP C  3 161 ? -7.135  -15.682 4.744   1.00 51.30  ? 176 TRP X C   1 
ATOM   2802  O O   . TRP C  3 161 ? -7.379  -16.036 3.593   1.00 52.22  ? 176 TRP X O   1 
ATOM   2803  C CB  . TRP C  3 161 ? -5.084  -17.106 5.007   1.00 42.32  ? 176 TRP X CB  1 
ATOM   2804  C CG  . TRP C  3 161 ? -4.213  -17.854 5.963   1.00 42.53  ? 176 TRP X CG  1 
ATOM   2805  C CD1 . TRP C  3 161 ? -4.319  -17.883 7.322   1.00 45.81  ? 176 TRP X CD1 1 
ATOM   2806  C CD2 . TRP C  3 161 ? -3.091  -18.676 5.629   1.00 41.71  ? 176 TRP X CD2 1 
ATOM   2807  N NE1 . TRP C  3 161 ? -3.330  -18.671 7.857   1.00 44.88  ? 176 TRP X NE1 1 
ATOM   2808  C CE2 . TRP C  3 161 ? -2.569  -19.185 6.839   1.00 45.53  ? 176 TRP X CE2 1 
ATOM   2809  C CE3 . TRP C  3 161 ? -2.470  -19.040 4.417   1.00 42.26  ? 176 TRP X CE3 1 
ATOM   2810  C CZ2 . TRP C  3 161 ? -1.458  -20.036 6.872   1.00 43.72  ? 176 TRP X CZ2 1 
ATOM   2811  C CZ3 . TRP C  3 161 ? -1.369  -19.877 4.453   1.00 42.34  ? 176 TRP X CZ3 1 
ATOM   2812  C CH2 . TRP C  3 161 ? -0.875  -20.366 5.666   1.00 42.75  ? 176 TRP X CH2 1 
ATOM   2813  N N   . LEU C  3 162 ? -7.603  -14.544 5.317   1.00 47.60  ? 177 LEU X N   1 
ATOM   2814  C CA  . LEU C  3 162 ? -8.402  -13.500 4.670   1.00 48.07  ? 177 LEU X CA  1 
ATOM   2815  C C   . LEU C  3 162 ? -7.637  -12.205 4.767   1.00 54.75  ? 177 LEU X C   1 
ATOM   2816  O O   . LEU C  3 162 ? -8.208  -11.119 4.737   1.00 57.39  ? 177 LEU X O   1 
ATOM   2817  C CB  . LEU C  3 162 ? -9.782  -13.379 5.348   1.00 49.64  ? 177 LEU X CB  1 
ATOM   2818  C CG  . LEU C  3 162 ? -10.529 -14.700 5.577   1.00 53.65  ? 177 LEU X CG  1 
ATOM   2819  C CD1 . LEU C  3 162 ? -11.621 -14.546 6.580   1.00 55.13  ? 177 LEU X CD1 1 
ATOM   2820  C CD2 . LEU C  3 162 ? -11.052 -15.272 4.293   1.00 56.64  ? 177 LEU X CD2 1 
ATOM   2821  N N   . ASN C  3 163 ? -6.317  -12.315 4.856   1.00 51.19  ? 178 ASN X N   1 
ATOM   2822  C CA  . ASN C  3 163 ? -5.452  -11.144 4.956   1.00 50.51  ? 178 ASN X CA  1 
ATOM   2823  C C   . ASN C  3 163 ? -5.234  -10.472 3.602   1.00 54.34  ? 178 ASN X C   1 
ATOM   2824  O O   . ASN C  3 163 ? -5.541  -11.053 2.551   1.00 54.43  ? 178 ASN X O   1 
ATOM   2825  C CB  . ASN C  3 163 ? -4.122  -11.508 5.629   1.00 46.79  ? 178 ASN X CB  1 
ATOM   2826  C CG  . ASN C  3 163 ? -3.348  -12.546 4.887   1.00 71.41  ? 178 ASN X CG  1 
ATOM   2827  O OD1 . ASN C  3 163 ? -3.753  -13.715 4.796   1.00 69.92  ? 178 ASN X OD1 1 
ATOM   2828  N ND2 . ASN C  3 163 ? -2.229  -12.128 4.320   1.00 63.31  ? 178 ASN X ND2 1 
ATOM   2829  N N   . LYS C  3 164 ? -4.738  -9.218  3.647   1.00 50.17  ? 179 LYS X N   1 
ATOM   2830  C CA  . LYS C  3 164 ? -4.377  -8.382  2.505   1.00 49.56  ? 179 LYS X CA  1 
ATOM   2831  C C   . LYS C  3 164 ? -5.498  -8.182  1.475   1.00 56.96  ? 179 LYS X C   1 
ATOM   2832  O O   . LYS C  3 164 ? -5.193  -7.986  0.305   1.00 59.48  ? 179 LYS X O   1 
ATOM   2833  C CB  . LYS C  3 164 ? -3.098  -8.921  1.823   1.00 49.04  ? 179 LYS X CB  1 
ATOM   2834  C CG  . LYS C  3 164 ? -1.887  -9.060  2.743   1.00 49.92  ? 179 LYS X CG  1 
ATOM   2835  C CD  . LYS C  3 164 ? -0.708  -9.628  2.023   1.00 54.93  ? 179 LYS X CD  1 
ATOM   2836  C CE  . LYS C  3 164 ? 0.315   -8.577  1.696   1.00 62.22  ? 179 LYS X CE  1 
ATOM   2837  N NZ  . LYS C  3 164 ? 0.864   -8.784  0.337   1.00 71.06  ? 179 LYS X NZ  1 
ATOM   2838  N N   . ASN C  3 165 ? -6.776  -8.208  1.880   1.00 54.03  ? 180 ASN X N   1 
ATOM   2839  C CA  . ASN C  3 165 ? -7.870  -7.965  0.930   1.00 56.31  ? 180 ASN X CA  1 
ATOM   2840  C C   . ASN C  3 165 ? -8.331  -6.487  1.068   1.00 63.85  ? 180 ASN X C   1 
ATOM   2841  O O   . ASN C  3 165 ? -7.460  -5.607  1.162   1.00 64.57  ? 180 ASN X O   1 
ATOM   2842  C CB  . ASN C  3 165 ? -8.996  -9.002  1.088   1.00 54.44  ? 180 ASN X CB  1 
ATOM   2843  C CG  . ASN C  3 165 ? -8.552  -10.417 0.809   1.00 63.85  ? 180 ASN X CG  1 
ATOM   2844  O OD1 . ASN C  3 165 ? -8.020  -10.734 -0.250  1.00 62.93  ? 180 ASN X OD1 1 
ATOM   2845  N ND2 . ASN C  3 165 ? -8.760  -11.308 1.750   1.00 50.38  ? 180 ASN X ND2 1 
ATOM   2846  N N   . GLY C  3 166 ? -9.643  -6.218  1.093   1.00 61.06  ? 181 GLY X N   1 
ATOM   2847  C CA  . GLY C  3 166 ? -10.147 -4.855  1.266   1.00 63.61  ? 181 GLY X CA  1 
ATOM   2848  C C   . GLY C  3 166 ? -11.285 -4.772  2.267   1.00 68.40  ? 181 GLY X C   1 
ATOM   2849  O O   . GLY C  3 166 ? -12.089 -3.826  2.238   1.00 70.61  ? 181 GLY X O   1 
ATOM   2850  N N   . ILE C  3 167 ? -11.357 -5.801  3.145   1.00 61.71  ? 182 ILE X N   1 
ATOM   2851  C CA  . ILE C  3 167 ? -12.360 -6.003  4.190   1.00 62.85  ? 182 ILE X CA  1 
ATOM   2852  C C   . ILE C  3 167 ? -12.453 -4.803  5.145   1.00 69.35  ? 182 ILE X C   1 
ATOM   2853  O O   . ILE C  3 167 ? -11.430 -4.333  5.639   1.00 68.61  ? 182 ILE X O   1 
ATOM   2854  C CB  . ILE C  3 167 ? -12.094 -7.358  4.902   1.00 62.93  ? 182 ILE X CB  1 
ATOM   2855  C CG1 . ILE C  3 167 ? -12.337 -8.514  3.919   1.00 62.71  ? 182 ILE X CG1 1 
ATOM   2856  C CG2 . ILE C  3 167 ? -12.935 -7.560  6.173   1.00 65.06  ? 182 ILE X CG2 1 
ATOM   2857  C CD1 . ILE C  3 167 ? -11.367 -9.652  4.024   1.00 68.28  ? 182 ILE X CD1 1 
ATOM   2858  N N   . GLN C  3 168 ? -13.686 -4.287  5.351   1.00 68.72  ? 183 GLN X N   1 
ATOM   2859  C CA  . GLN C  3 168 ? -13.996 -3.161  6.246   1.00 70.52  ? 183 GLN X CA  1 
ATOM   2860  C C   . GLN C  3 168 ? -15.223 -3.432  7.096   1.00 77.31  ? 183 GLN X C   1 
ATOM   2861  O O   . GLN C  3 168 ? -15.489 -2.664  8.029   1.00 79.37  ? 183 GLN X O   1 
ATOM   2862  C CB  . GLN C  3 168 ? -14.122 -1.817  5.505   1.00 74.11  ? 183 GLN X CB  1 
ATOM   2863  C CG  . GLN C  3 168 ? -14.738 -1.872  4.114   1.00 82.76  ? 183 GLN X CG  1 
ATOM   2864  C CD  . GLN C  3 168 ? -14.284 -0.698  3.269   1.00 98.52  ? 183 GLN X CD  1 
ATOM   2865  O OE1 . GLN C  3 168 ? -13.100 -0.557  2.905   1.00 88.39  ? 183 GLN X OE1 1 
ATOM   2866  N NE2 . GLN C  3 168 ? -15.224 0.162   2.918   1.00 91.47  ? 183 GLN X NE2 1 
ATOM   2867  N N   . GLU C  3 169 ? -15.944 -4.549  6.795   1.00 73.11  ? 184 GLU X N   1 
ATOM   2868  C CA  . GLU C  3 169 ? -17.166 -4.999  7.473   1.00 75.23  ? 184 GLU X CA  1 
ATOM   2869  C C   . GLU C  3 169 ? -17.140 -6.501  7.731   1.00 76.09  ? 184 GLU X C   1 
ATOM   2870  O O   . GLU C  3 169 ? -16.859 -7.280  6.817   1.00 74.13  ? 184 GLU X O   1 
ATOM   2871  C CB  . GLU C  3 169 ? -18.388 -4.710  6.592   1.00 80.81  ? 184 GLU X CB  1 
ATOM   2872  C CG  . GLU C  3 169 ? -18.798 -3.250  6.505   1.00 97.72  ? 184 GLU X CG  1 
ATOM   2873  C CD  . GLU C  3 169 ? -19.556 -2.695  7.695   1.00 122.68 ? 184 GLU X CD  1 
ATOM   2874  O OE1 . GLU C  3 169 ? -19.327 -1.511  8.036   1.00 121.84 ? 184 GLU X OE1 1 
ATOM   2875  O OE2 . GLU C  3 169 ? -20.388 -3.433  8.275   1.00 113.13 ? 184 GLU X OE2 1 
ATOM   2876  N N   . ILE C  3 170 ? -17.452 -6.914  8.965   1.00 71.90  ? 185 ILE X N   1 
ATOM   2877  C CA  . ILE C  3 170 ? -17.547 -8.332  9.332   1.00 69.25  ? 185 ILE X CA  1 
ATOM   2878  C C   . ILE C  3 170 ? -18.851 -8.512  10.091  1.00 80.03  ? 185 ILE X C   1 
ATOM   2879  O O   . ILE C  3 170 ? -18.988 -8.010  11.200  1.00 81.58  ? 185 ILE X O   1 
ATOM   2880  C CB  . ILE C  3 170 ? -16.318 -8.907  10.094  1.00 66.94  ? 185 ILE X CB  1 
ATOM   2881  C CG1 . ILE C  3 170 ? -15.045 -8.819  9.246   1.00 61.42  ? 185 ILE X CG1 1 
ATOM   2882  C CG2 . ILE C  3 170 ? -16.585 -10.369 10.521  1.00 67.57  ? 185 ILE X CG2 1 
ATOM   2883  C CD1 . ILE C  3 170 ? -13.846 -9.029  9.990   1.00 56.97  ? 185 ILE X CD1 1 
ATOM   2884  N N   . HIS C  3 171 ? -19.810 -9.209  9.480   1.00 80.63  ? 186 HIS X N   1 
ATOM   2885  C CA  . HIS C  3 171 ? -21.133 -9.437  10.051  1.00 86.19  ? 186 HIS X CA  1 
ATOM   2886  C C   . HIS C  3 171 ? -21.138 -10.398 11.247  1.00 90.75  ? 186 HIS X C   1 
ATOM   2887  O O   . HIS C  3 171 ? -20.226 -11.207 11.402  1.00 86.04  ? 186 HIS X O   1 
ATOM   2888  C CB  . HIS C  3 171 ? -22.104 -9.922  8.955   1.00 89.82  ? 186 HIS X CB  1 
ATOM   2889  C CG  . HIS C  3 171 ? -22.426 -8.907  7.888   1.00 95.46  ? 186 HIS X CG  1 
ATOM   2890  N ND1 . HIS C  3 171 ? -23.533 -9.057  7.072   1.00 100.98 ? 186 HIS X ND1 1 
ATOM   2891  C CD2 . HIS C  3 171 ? -21.770 -7.779  7.522   1.00 96.28  ? 186 HIS X CD2 1 
ATOM   2892  C CE1 . HIS C  3 171 ? -23.517 -8.021  6.249   1.00 101.70 ? 186 HIS X CE1 1 
ATOM   2893  N NE2 . HIS C  3 171 ? -22.481 -7.223  6.486   1.00 99.36  ? 186 HIS X NE2 1 
ATOM   2894  N N   . ASN C  3 172 ? -22.173 -10.303 12.098  1.00 93.55  ? 187 ASN X N   1 
ATOM   2895  C CA  . ASN C  3 172 ? -22.317 -11.199 13.242  1.00 94.36  ? 187 ASN X CA  1 
ATOM   2896  C C   . ASN C  3 172 ? -22.608 -12.602 12.740  1.00 98.77  ? 187 ASN X C   1 
ATOM   2897  O O   . ASN C  3 172 ? -23.335 -12.763 11.756  1.00 100.35 ? 187 ASN X O   1 
ATOM   2898  C CB  . ASN C  3 172 ? -23.391 -10.715 14.203  1.00 98.90  ? 187 ASN X CB  1 
ATOM   2899  C CG  . ASN C  3 172 ? -22.936 -9.530  15.001  1.00 120.17 ? 187 ASN X CG  1 
ATOM   2900  O OD1 . ASN C  3 172 ? -22.074 -9.633  15.876  1.00 102.01 ? 187 ASN X OD1 1 
ATOM   2901  N ND2 . ASN C  3 172 ? -23.471 -8.365  14.678  1.00 122.56 ? 187 ASN X ND2 1 
ATOM   2902  N N   . SER C  3 173 ? -21.963 -13.602 13.368  1.00 92.88  ? 188 SER X N   1 
ATOM   2903  C CA  . SER C  3 173 ? -22.043 -15.030 13.039  1.00 90.93  ? 188 SER X CA  1 
ATOM   2904  C C   . SER C  3 173 ? -21.400 -15.367 11.675  1.00 91.52  ? 188 SER X C   1 
ATOM   2905  O O   . SER C  3 173 ? -21.628 -16.457 11.146  1.00 90.88  ? 188 SER X O   1 
ATOM   2906  C CB  . SER C  3 173 ? -23.475 -15.557 13.157  1.00 95.75  ? 188 SER X CB  1 
ATOM   2907  O OG  . SER C  3 173 ? -23.833 -15.667 14.522  1.00 99.48  ? 188 SER X OG  1 
ATOM   2908  N N   . ALA C  3 174 ? -20.546 -14.464 11.142  1.00 85.47  ? 189 ALA X N   1 
ATOM   2909  C CA  . ALA C  3 174 ? -19.829 -14.687 9.875   1.00 83.02  ? 189 ALA X CA  1 
ATOM   2910  C C   . ALA C  3 174 ? -19.082 -16.027 9.876   1.00 83.19  ? 189 ALA X C   1 
ATOM   2911  O O   . ALA C  3 174 ? -18.888 -16.633 8.820   1.00 81.05  ? 189 ALA X O   1 
ATOM   2912  C CB  . ALA C  3 174 ? -18.836 -13.559 9.621   1.00 81.85  ? 189 ALA X CB  1 
ATOM   2913  N N   . PHE C  3 175 ? -18.701 -16.487 11.079  1.00 78.75  ? 190 PHE X N   1 
ATOM   2914  C CA  . PHE C  3 175 ? -17.968 -17.723 11.309  1.00 75.52  ? 190 PHE X CA  1 
ATOM   2915  C C   . PHE C  3 175 ? -18.800 -18.810 11.983  1.00 82.44  ? 190 PHE X C   1 
ATOM   2916  O O   . PHE C  3 175 ? -18.231 -19.752 12.525  1.00 80.97  ? 190 PHE X O   1 
ATOM   2917  C CB  . PHE C  3 175 ? -16.677 -17.425 12.099  1.00 73.92  ? 190 PHE X CB  1 
ATOM   2918  C CG  . PHE C  3 175 ? -15.821 -16.349 11.474  1.00 72.41  ? 190 PHE X CG  1 
ATOM   2919  C CD1 . PHE C  3 175 ? -15.102 -16.598 10.309  1.00 71.41  ? 190 PHE X CD1 1 
ATOM   2920  C CD2 . PHE C  3 175 ? -15.743 -15.086 12.042  1.00 75.25  ? 190 PHE X CD2 1 
ATOM   2921  C CE1 . PHE C  3 175 ? -14.341 -15.597 9.714   1.00 70.35  ? 190 PHE X CE1 1 
ATOM   2922  C CE2 . PHE C  3 175 ? -14.955 -14.088 11.454  1.00 76.13  ? 190 PHE X CE2 1 
ATOM   2923  C CZ  . PHE C  3 175 ? -14.271 -14.348 10.289  1.00 70.96  ? 190 PHE X CZ  1 
ATOM   2924  N N   . ASN C  3 176 ? -20.133 -18.712 11.928  1.00 83.45  ? 191 ASN X N   1 
ATOM   2925  C CA  . ASN C  3 176 ? -21.007 -19.731 12.534  1.00 86.66  ? 191 ASN X CA  1 
ATOM   2926  C C   . ASN C  3 176 ? -20.900 -21.072 11.796  1.00 89.04  ? 191 ASN X C   1 
ATOM   2927  O O   . ASN C  3 176 ? -20.669 -21.079 10.590  1.00 88.24  ? 191 ASN X O   1 
ATOM   2928  C CB  . ASN C  3 176 ? -22.466 -19.229 12.626  1.00 92.70  ? 191 ASN X CB  1 
ATOM   2929  C CG  . ASN C  3 176 ? -23.506 -20.251 13.010  1.00 107.04 ? 191 ASN X CG  1 
ATOM   2930  O OD1 . ASN C  3 176 ? -23.403 -20.920 14.047  1.00 93.46  ? 191 ASN X OD1 1 
ATOM   2931  N ND2 . ASN C  3 176 ? -24.523 -20.357 12.153  1.00 106.84 ? 191 ASN X ND2 1 
ATOM   2932  N N   . GLY C  3 177 ? -21.019 -22.169 12.540  1.00 85.23  ? 192 GLY X N   1 
ATOM   2933  C CA  . GLY C  3 177 ? -20.932 -23.539 12.042  1.00 84.25  ? 192 GLY X CA  1 
ATOM   2934  C C   . GLY C  3 177 ? -19.586 -23.884 11.438  1.00 82.71  ? 192 GLY X C   1 
ATOM   2935  O O   . GLY C  3 177 ? -19.521 -24.575 10.417  1.00 80.83  ? 192 GLY X O   1 
ATOM   2936  N N   . THR C  3 178 ? -18.506 -23.391 12.073  1.00 76.71  ? 193 THR X N   1 
ATOM   2937  C CA  . THR C  3 178 ? -17.119 -23.551 11.637  1.00 72.60  ? 193 THR X CA  1 
ATOM   2938  C C   . THR C  3 178 ? -16.205 -23.942 12.808  1.00 76.56  ? 193 THR X C   1 
ATOM   2939  O O   . THR C  3 178 ? -16.374 -23.420 13.913  1.00 79.14  ? 193 THR X O   1 
ATOM   2940  C CB  . THR C  3 178 ? -16.685 -22.242 10.929  1.00 74.76  ? 193 THR X CB  1 
ATOM   2941  O OG1 . THR C  3 178 ? -17.023 -22.324 9.548   1.00 76.59  ? 193 THR X OG1 1 
ATOM   2942  C CG2 . THR C  3 178 ? -15.208 -21.921 11.071  1.00 67.41  ? 193 THR X CG2 1 
ATOM   2943  N N   . GLN C  3 179 ? -15.230 -24.837 12.563  1.00 69.45  ? 194 GLN X N   1 
ATOM   2944  C CA  . GLN C  3 179 ? -14.241 -25.182 13.577  1.00 68.20  ? 194 GLN X CA  1 
ATOM   2945  C C   . GLN C  3 179 ? -13.001 -24.354 13.223  1.00 69.10  ? 194 GLN X C   1 
ATOM   2946  O O   . GLN C  3 179 ? -12.192 -24.793 12.404  1.00 68.16  ? 194 GLN X O   1 
ATOM   2947  C CB  . GLN C  3 179 ? -13.913 -26.677 13.539  1.00 69.57  ? 194 GLN X CB  1 
ATOM   2948  C CG  . GLN C  3 179 ? -14.777 -27.573 14.399  1.00 75.82  ? 194 GLN X CG  1 
ATOM   2949  C CD  . GLN C  3 179 ? -14.337 -28.997 14.191  1.00 98.02  ? 194 GLN X CD  1 
ATOM   2950  O OE1 . GLN C  3 179 ? -13.319 -29.448 14.736  1.00 95.08  ? 194 GLN X OE1 1 
ATOM   2951  N NE2 . GLN C  3 179 ? -15.031 -29.707 13.310  1.00 92.20  ? 194 GLN X NE2 1 
ATOM   2952  N N   . LEU C  3 180 ? -12.879 -23.133 13.780  1.00 64.14  ? 195 LEU X N   1 
ATOM   2953  C CA  . LEU C  3 180 ? -11.755 -22.241 13.449  1.00 60.70  ? 195 LEU X CA  1 
ATOM   2954  C C   . LEU C  3 180 ? -10.444 -22.593 14.117  1.00 62.39  ? 195 LEU X C   1 
ATOM   2955  O O   . LEU C  3 180 ? -10.316 -22.526 15.338  1.00 63.60  ? 195 LEU X O   1 
ATOM   2956  C CB  . LEU C  3 180 ? -12.087 -20.765 13.708  1.00 61.13  ? 195 LEU X CB  1 
ATOM   2957  C CG  . LEU C  3 180 ? -12.296 -19.937 12.472  1.00 64.64  ? 195 LEU X CG  1 
ATOM   2958  C CD1 . LEU C  3 180 ? -12.914 -18.623 12.820  1.00 66.02  ? 195 LEU X CD1 1 
ATOM   2959  C CD2 . LEU C  3 180 ? -11.000 -19.738 11.740  1.00 66.17  ? 195 LEU X CD2 1 
ATOM   2960  N N   . ASP C  3 181 ? -9.461  -22.953 13.315  1.00 56.24  ? 196 ASP X N   1 
ATOM   2961  C CA  . ASP C  3 181 ? -8.148  -23.268 13.848  1.00 54.98  ? 196 ASP X CA  1 
ATOM   2962  C C   . ASP C  3 181 ? -7.367  -21.988 13.928  1.00 57.13  ? 196 ASP X C   1 
ATOM   2963  O O   . ASP C  3 181 ? -6.907  -21.604 15.003  1.00 57.91  ? 196 ASP X O   1 
ATOM   2964  C CB  . ASP C  3 181 ? -7.415  -24.256 12.932  1.00 55.75  ? 196 ASP X CB  1 
ATOM   2965  C CG  . ASP C  3 181 ? -7.610  -25.719 13.243  1.00 73.06  ? 196 ASP X CG  1 
ATOM   2966  O OD1 . ASP C  3 181 ? -8.337  -26.038 14.232  1.00 75.18  ? 196 ASP X OD1 1 
ATOM   2967  O OD2 . ASP C  3 181 ? -7.034  -26.553 12.513  1.00 83.54  ? 196 ASP X OD2 1 
ATOM   2968  N N   . GLU C  3 182 ? -7.266  -21.304 12.781  1.00 51.39  ? 197 GLU X N   1 
ATOM   2969  C CA  . GLU C  3 182 ? -6.500  -20.089 12.598  1.00 49.49  ? 197 GLU X CA  1 
ATOM   2970  C C   . GLU C  3 182 ? -7.290  -19.117 11.732  1.00 52.51  ? 197 GLU X C   1 
ATOM   2971  O O   . GLU C  3 182 ? -7.871  -19.536 10.729  1.00 53.48  ? 197 GLU X O   1 
ATOM   2972  C CB  . GLU C  3 182 ? -5.192  -20.485 11.901  1.00 48.96  ? 197 GLU X CB  1 
ATOM   2973  C CG  . GLU C  3 182 ? -4.257  -19.345 11.566  1.00 58.83  ? 197 GLU X CG  1 
ATOM   2974  C CD  . GLU C  3 182 ? -2.909  -19.843 11.108  1.00 79.76  ? 197 GLU X CD  1 
ATOM   2975  O OE1 . GLU C  3 182 ? -2.508  -20.942 11.551  1.00 65.02  ? 197 GLU X OE1 1 
ATOM   2976  O OE2 . GLU C  3 182 ? -2.236  -19.119 10.340  1.00 82.23  ? 197 GLU X OE2 1 
ATOM   2977  N N   . LEU C  3 183 ? -7.298  -17.821 12.107  1.00 46.44  ? 198 LEU X N   1 
ATOM   2978  C CA  . LEU C  3 183 ? -7.985  -16.774 11.359  1.00 45.40  ? 198 LEU X CA  1 
ATOM   2979  C C   . LEU C  3 183 ? -7.064  -15.596 11.220  1.00 48.47  ? 198 LEU X C   1 
ATOM   2980  O O   . LEU C  3 183 ? -6.632  -15.041 12.226  1.00 49.83  ? 198 LEU X O   1 
ATOM   2981  C CB  . LEU C  3 183 ? -9.327  -16.373 12.015  1.00 47.61  ? 198 LEU X CB  1 
ATOM   2982  C CG  . LEU C  3 183 ? -10.063 -15.145 11.442  1.00 51.95  ? 198 LEU X CG  1 
ATOM   2983  C CD1 . LEU C  3 183 ? -10.675 -15.432 10.080  1.00 51.27  ? 198 LEU X CD1 1 
ATOM   2984  C CD2 . LEU C  3 183 ? -11.116 -14.680 12.378  1.00 55.58  ? 198 LEU X CD2 1 
ATOM   2985  N N   . ASN C  3 184 ? -6.744  -15.225 9.974   1.00 43.32  ? 199 ASN X N   1 
ATOM   2986  C CA  . ASN C  3 184 ? -5.854  -14.111 9.700   1.00 42.37  ? 199 ASN X CA  1 
ATOM   2987  C C   . ASN C  3 184 ? -6.600  -13.040 8.943   1.00 49.07  ? 199 ASN X C   1 
ATOM   2988  O O   . ASN C  3 184 ? -6.995  -13.229 7.788   1.00 49.79  ? 199 ASN X O   1 
ATOM   2989  C CB  . ASN C  3 184 ? -4.610  -14.571 8.953   1.00 40.31  ? 199 ASN X CB  1 
ATOM   2990  C CG  . ASN C  3 184 ? -3.600  -13.481 8.662   1.00 63.32  ? 199 ASN X CG  1 
ATOM   2991  O OD1 . ASN C  3 184 ? -3.786  -12.298 8.974   1.00 54.97  ? 199 ASN X OD1 1 
ATOM   2992  N ND2 . ASN C  3 184 ? -2.499  -13.864 8.043   1.00 52.09  ? 199 ASN X ND2 1 
ATOM   2993  N N   . LEU C  3 185 ? -6.792  -11.911 9.615   1.00 46.02  ? 200 LEU X N   1 
ATOM   2994  C CA  . LEU C  3 185 ? -7.492  -10.750 9.090   1.00 46.54  ? 200 LEU X CA  1 
ATOM   2995  C C   . LEU C  3 185 ? -6.544  -9.554  8.875   1.00 49.74  ? 200 LEU X C   1 
ATOM   2996  O O   . LEU C  3 185 ? -6.996  -8.473  8.496   1.00 50.73  ? 200 LEU X O   1 
ATOM   2997  C CB  . LEU C  3 185 ? -8.672  -10.388 10.014  1.00 48.69  ? 200 LEU X CB  1 
ATOM   2998  C CG  . LEU C  3 185 ? -9.886  -11.304 9.913   1.00 53.86  ? 200 LEU X CG  1 
ATOM   2999  C CD1 . LEU C  3 185 ? -10.850 -11.060 11.057  1.00 56.04  ? 200 LEU X CD1 1 
ATOM   3000  C CD2 . LEU C  3 185 ? -10.595 -11.148 8.563   1.00 56.34  ? 200 LEU X CD2 1 
ATOM   3001  N N   . SER C  3 186 ? -5.222  -9.772  9.043   1.00 43.78  ? 201 SER X N   1 
ATOM   3002  C CA  . SER C  3 186 ? -4.202  -8.734  8.886   1.00 42.22  ? 201 SER X CA  1 
ATOM   3003  C C   . SER C  3 186 ? -4.202  -8.049  7.527   1.00 46.85  ? 201 SER X C   1 
ATOM   3004  O O   . SER C  3 186 ? -4.771  -8.542  6.561   1.00 44.97  ? 201 SER X O   1 
ATOM   3005  C CB  . SER C  3 186 ? -2.809  -9.266  9.212   1.00 41.88  ? 201 SER X CB  1 
ATOM   3006  O OG  . SER C  3 186 ? -2.324  -10.137 8.203   1.00 49.05  ? 201 SER X OG  1 
ATOM   3007  N N   . ASP C  3 187 ? -3.606  -6.863  7.496   1.00 46.79  ? 202 ASP X N   1 
ATOM   3008  C CA  . ASP C  3 187 ? -3.389  -6.014  6.339   1.00 48.35  ? 202 ASP X CA  1 
ATOM   3009  C C   . ASP C  3 187 ? -4.649  -5.641  5.567   1.00 57.93  ? 202 ASP X C   1 
ATOM   3010  O O   . ASP C  3 187 ? -4.541  -5.237  4.407   1.00 61.34  ? 202 ASP X O   1 
ATOM   3011  C CB  . ASP C  3 187 ? -2.314  -6.597  5.424   1.00 48.33  ? 202 ASP X CB  1 
ATOM   3012  C CG  . ASP C  3 187 ? -0.961  -6.564  6.105   1.00 62.52  ? 202 ASP X CG  1 
ATOM   3013  O OD1 . ASP C  3 187 ? -0.384  -5.451  6.228   1.00 64.53  ? 202 ASP X OD1 1 
ATOM   3014  O OD2 . ASP C  3 187 ? -0.534  -7.623  6.625   1.00 70.73  ? 202 ASP X OD2 1 
ATOM   3015  N N   . ASN C  3 188 ? -5.822  -5.686  6.238   1.00 55.27  ? 203 ASN X N   1 
ATOM   3016  C CA  . ASN C  3 188 ? -7.123  -5.190  5.769   1.00 56.87  ? 203 ASN X CA  1 
ATOM   3017  C C   . ASN C  3 188 ? -7.182  -3.915  6.602   1.00 62.83  ? 203 ASN X C   1 
ATOM   3018  O O   . ASN C  3 188 ? -7.533  -3.954  7.781   1.00 63.03  ? 203 ASN X O   1 
ATOM   3019  C CB  . ASN C  3 188 ? -8.262  -6.163  6.119   1.00 53.10  ? 203 ASN X CB  1 
ATOM   3020  C CG  . ASN C  3 188 ? -8.385  -7.314  5.154   1.00 64.20  ? 203 ASN X CG  1 
ATOM   3021  O OD1 . ASN C  3 188 ? -8.954  -7.173  4.079   1.00 61.26  ? 203 ASN X OD1 1 
ATOM   3022  N ND2 . ASN C  3 188 ? -7.873  -8.489  5.517   1.00 48.23  ? 203 ASN X ND2 1 
ATOM   3023  N N   . ASN C  3 189 ? -6.665  -2.826  6.038   1.00 61.03  ? 204 ASN X N   1 
ATOM   3024  C CA  . ASN C  3 189 ? -6.460  -1.570  6.759   1.00 63.69  ? 204 ASN X CA  1 
ATOM   3025  C C   . ASN C  3 189 ? -7.727  -0.826  7.125   1.00 71.77  ? 204 ASN X C   1 
ATOM   3026  O O   . ASN C  3 189 ? -7.774  -0.236  8.205   1.00 73.43  ? 204 ASN X O   1 
ATOM   3027  C CB  . ASN C  3 189 ? -5.493  -0.664  6.003   1.00 66.27  ? 204 ASN X CB  1 
ATOM   3028  C CG  . ASN C  3 189 ? -4.279  -1.416  5.500   1.00 92.49  ? 204 ASN X CG  1 
ATOM   3029  O OD1 . ASN C  3 189 ? -4.121  -1.642  4.292   1.00 89.57  ? 204 ASN X OD1 1 
ATOM   3030  N ND2 . ASN C  3 189 ? -3.471  -1.944  6.423   1.00 81.32  ? 204 ASN X ND2 1 
ATOM   3031  N N   . ASN C  3 190 ? -8.761  -0.886  6.276   1.00 69.81  ? 205 ASN X N   1 
ATOM   3032  C CA  . ASN C  3 190 ? -10.028 -0.197  6.541   1.00 73.16  ? 205 ASN X CA  1 
ATOM   3033  C C   . ASN C  3 190 ? -10.879 -0.881  7.616   1.00 75.68  ? 205 ASN X C   1 
ATOM   3034  O O   . ASN C  3 190 ? -11.875 -0.288  8.048   1.00 79.56  ? 205 ASN X O   1 
ATOM   3035  C CB  . ASN C  3 190 ? -10.850 0.004   5.257   1.00 75.91  ? 205 ASN X CB  1 
ATOM   3036  C CG  . ASN C  3 190 ? -10.086 0.492   4.051   1.00 101.17 ? 205 ASN X CG  1 
ATOM   3037  O OD1 . ASN C  3 190 ? -9.339  1.492   4.096   1.00 89.30  ? 205 ASN X OD1 1 
ATOM   3038  N ND2 . ASN C  3 190 ? -10.308 -0.190  2.927   1.00 95.38  ? 205 ASN X ND2 1 
ATOM   3039  N N   . LEU C  3 191 ? -10.505 -2.111  8.044   1.00 65.91  ? 206 LEU X N   1 
ATOM   3040  C CA  . LEU C  3 191 ? -11.264 -2.863  9.045   1.00 65.95  ? 206 LEU X CA  1 
ATOM   3041  C C   . LEU C  3 191 ? -11.214 -2.172  10.403  1.00 72.64  ? 206 LEU X C   1 
ATOM   3042  O O   . LEU C  3 191 ? -10.157 -2.113  11.036  1.00 69.87  ? 206 LEU X O   1 
ATOM   3043  C CB  . LEU C  3 191 ? -10.790 -4.328  9.105   1.00 62.04  ? 206 LEU X CB  1 
ATOM   3044  C CG  . LEU C  3 191 ? -11.581 -5.321  9.958   1.00 65.43  ? 206 LEU X CG  1 
ATOM   3045  C CD1 . LEU C  3 191 ? -13.075 -5.326  9.596   1.00 68.26  ? 206 LEU X CD1 1 
ATOM   3046  C CD2 . LEU C  3 191 ? -10.969 -6.697  9.855   1.00 60.48  ? 206 LEU X CD2 1 
ATOM   3047  N N   . GLU C  3 192 ? -12.367 -1.613  10.813  1.00 74.66  ? 207 GLU X N   1 
ATOM   3048  C CA  . GLU C  3 192 ? -12.515 -0.803  12.022  1.00 78.55  ? 207 GLU X CA  1 
ATOM   3049  C C   . GLU C  3 192 ? -12.998 -1.542  13.267  1.00 85.29  ? 207 GLU X C   1 
ATOM   3050  O O   . GLU C  3 192 ? -12.644 -1.119  14.373  1.00 85.68  ? 207 GLU X O   1 
ATOM   3051  C CB  . GLU C  3 192 ? -13.438 0.406   11.757  1.00 84.79  ? 207 GLU X CB  1 
ATOM   3052  C CG  . GLU C  3 192 ? -12.862 1.470   10.836  1.00 90.89  ? 207 GLU X CG  1 
ATOM   3053  C CD  . GLU C  3 192 ? -12.029 2.551   11.495  1.00 103.25 ? 207 GLU X CD  1 
ATOM   3054  O OE1 . GLU C  3 192 ? -11.609 2.367   12.661  1.00 85.90  ? 207 GLU X OE1 1 
ATOM   3055  O OE2 . GLU C  3 192 ? -11.778 3.581   10.828  1.00 98.77  ? 207 GLU X OE2 1 
ATOM   3056  N N   . GLU C  3 193 ? -13.844 -2.589  13.123  1.00 83.52  ? 208 GLU X N   1 
ATOM   3057  C CA  . GLU C  3 193 ? -14.315 -3.289  14.325  1.00 84.77  ? 208 GLU X CA  1 
ATOM   3058  C C   . GLU C  3 193 ? -14.679 -4.768  14.155  1.00 84.01  ? 208 GLU X C   1 
ATOM   3059  O O   . GLU C  3 193 ? -15.139 -5.217  13.100  1.00 83.28  ? 208 GLU X O   1 
ATOM   3060  C CB  . GLU C  3 193 ? -15.492 -2.544  15.003  1.00 91.99  ? 208 GLU X CB  1 
ATOM   3061  C CG  . GLU C  3 193 ? -16.861 -2.692  14.364  1.00 107.22 ? 208 GLU X CG  1 
ATOM   3062  C CD  . GLU C  3 193 ? -17.988 -2.468  15.354  1.00 134.94 ? 208 GLU X CD  1 
ATOM   3063  O OE1 . GLU C  3 193 ? -18.590 -3.469  15.805  1.00 126.75 ? 208 GLU X OE1 1 
ATOM   3064  O OE2 . GLU C  3 193 ? -18.235 -1.295  15.717  1.00 135.35 ? 208 GLU X OE2 1 
ATOM   3065  N N   . LEU C  3 194 ? -14.501 -5.497  15.254  1.00 77.40  ? 209 LEU X N   1 
ATOM   3066  C CA  . LEU C  3 194 ? -14.879 -6.885  15.370  1.00 75.02  ? 209 LEU X CA  1 
ATOM   3067  C C   . LEU C  3 194 ? -16.154 -6.923  16.216  1.00 87.38  ? 209 LEU X C   1 
ATOM   3068  O O   . LEU C  3 194 ? -16.058 -6.778  17.441  1.00 89.51  ? 209 LEU X O   1 
ATOM   3069  C CB  . LEU C  3 194 ? -13.784 -7.704  16.053  1.00 70.57  ? 209 LEU X CB  1 
ATOM   3070  C CG  . LEU C  3 194 ? -12.656 -8.220  15.194  1.00 68.64  ? 209 LEU X CG  1 
ATOM   3071  C CD1 . LEU C  3 194 ? -12.040 -9.430  15.831  1.00 65.88  ? 209 LEU X CD1 1 
ATOM   3072  C CD2 . LEU C  3 194 ? -13.113 -8.558  13.782  1.00 67.96  ? 209 LEU X CD2 1 
ATOM   3073  N N   . PRO C  3 195 ? -17.357 -7.105  15.612  1.00 87.74  ? 210 PRO X N   1 
ATOM   3074  C CA  . PRO C  3 195 ? -18.587 -7.175  16.424  1.00 92.76  ? 210 PRO X CA  1 
ATOM   3075  C C   . PRO C  3 195 ? -18.503 -8.262  17.491  1.00 96.75  ? 210 PRO X C   1 
ATOM   3076  O O   . PRO C  3 195 ? -17.668 -9.161  17.370  1.00 92.11  ? 210 PRO X O   1 
ATOM   3077  C CB  . PRO C  3 195 ? -19.674 -7.474  15.390  1.00 96.20  ? 210 PRO X CB  1 
ATOM   3078  C CG  . PRO C  3 195 ? -19.125 -6.932  14.121  1.00 98.23  ? 210 PRO X CG  1 
ATOM   3079  C CD  . PRO C  3 195 ? -17.665 -7.274  14.180  1.00 88.53  ? 210 PRO X CD  1 
ATOM   3080  N N   . ASN C  3 196 ? -19.316 -8.154  18.556  1.00 98.35  ? 211 ASN X N   1 
ATOM   3081  C CA  . ASN C  3 196 ? -19.263 -9.113  19.658  1.00 99.15  ? 211 ASN X CA  1 
ATOM   3082  C C   . ASN C  3 196 ? -19.683 -10.532 19.269  1.00 101.09 ? 211 ASN X C   1 
ATOM   3083  O O   . ASN C  3 196 ? -19.064 -11.485 19.748  1.00 98.12  ? 211 ASN X O   1 
ATOM   3084  C CB  . ASN C  3 196 ? -20.033 -8.616  20.870  1.00 109.75 ? 211 ASN X CB  1 
ATOM   3085  C CG  . ASN C  3 196 ? -19.109 -8.040  21.911  1.00 144.58 ? 211 ASN X CG  1 
ATOM   3086  O OD1 . ASN C  3 196 ? -18.452 -8.769  22.664  1.00 140.70 ? 211 ASN X OD1 1 
ATOM   3087  N ND2 . ASN C  3 196 ? -18.980 -6.724  21.929  1.00 139.39 ? 211 ASN X ND2 1 
ATOM   3088  N N   . ASP C  3 197 ? -20.672 -10.680 18.368  1.00 99.42  ? 212 ASP X N   1 
ATOM   3089  C CA  . ASP C  3 197 ? -21.108 -12.008 17.940  1.00 99.30  ? 212 ASP X CA  1 
ATOM   3090  C C   . ASP C  3 197 ? -20.354 -12.502 16.691  1.00 99.66  ? 212 ASP X C   1 
ATOM   3091  O O   . ASP C  3 197 ? -20.887 -13.340 15.953  1.00 101.35 ? 212 ASP X O   1 
ATOM   3092  C CB  . ASP C  3 197 ? -22.644 -12.091 17.764  1.00 106.26 ? 212 ASP X CB  1 
ATOM   3093  C CG  . ASP C  3 197 ? -23.454 -11.664 18.979  1.00 124.29 ? 212 ASP X CG  1 
ATOM   3094  O OD1 . ASP C  3 197 ? -23.373 -12.354 20.019  1.00 125.46 ? 212 ASP X OD1 1 
ATOM   3095  O OD2 . ASP C  3 197 ? -24.193 -10.656 18.878  1.00 134.60 ? 212 ASP X OD2 1 
ATOM   3096  N N   . VAL C  3 198 ? -19.108 -12.021 16.473  1.00 89.85  ? 213 VAL X N   1 
ATOM   3097  C CA  . VAL C  3 198 ? -18.305 -12.432 15.329  1.00 84.75  ? 213 VAL X CA  1 
ATOM   3098  C C   . VAL C  3 198 ? -18.037 -13.946 15.421  1.00 88.32  ? 213 VAL X C   1 
ATOM   3099  O O   . VAL C  3 198 ? -18.339 -14.675 14.476  1.00 88.38  ? 213 VAL X O   1 
ATOM   3100  C CB  . VAL C  3 198 ? -17.030 -11.546 15.104  1.00 85.22  ? 213 VAL X CB  1 
ATOM   3101  C CG1 . VAL C  3 198 ? -16.008 -11.650 16.237  1.00 83.20  ? 213 VAL X CG1 1 
ATOM   3102  C CG2 . VAL C  3 198 ? -16.371 -11.824 13.761  1.00 81.25  ? 213 VAL X CG2 1 
ATOM   3103  N N   . PHE C  3 199 ? -17.602 -14.422 16.601  1.00 84.44  ? 214 PHE X N   1 
ATOM   3104  C CA  . PHE C  3 199 ? -17.288 -15.826 16.851  1.00 82.39  ? 214 PHE X CA  1 
ATOM   3105  C C   . PHE C  3 199 ? -18.489 -16.624 17.409  1.00 91.29  ? 214 PHE X C   1 
ATOM   3106  O O   . PHE C  3 199 ? -18.297 -17.591 18.158  1.00 90.73  ? 214 PHE X O   1 
ATOM   3107  C CB  . PHE C  3 199 ? -16.029 -15.943 17.749  1.00 81.74  ? 214 PHE X CB  1 
ATOM   3108  C CG  . PHE C  3 199 ? -14.791 -15.250 17.209  1.00 80.07  ? 214 PHE X CG  1 
ATOM   3109  C CD1 . PHE C  3 199 ? -14.279 -15.573 15.954  1.00 79.67  ? 214 PHE X CD1 1 
ATOM   3110  C CD2 . PHE C  3 199 ? -14.124 -14.290 17.963  1.00 82.71  ? 214 PHE X CD2 1 
ATOM   3111  C CE1 . PHE C  3 199 ? -13.147 -14.920 15.450  1.00 77.17  ? 214 PHE X CE1 1 
ATOM   3112  C CE2 . PHE C  3 199 ? -12.988 -13.645 17.461  1.00 81.94  ? 214 PHE X CE2 1 
ATOM   3113  C CZ  . PHE C  3 199 ? -12.503 -13.972 16.212  1.00 76.48  ? 214 PHE X CZ  1 
ATOM   3114  N N   . HIS C  3 200 ? -19.726 -16.241 17.031  1.00 92.42  ? 215 HIS X N   1 
ATOM   3115  C CA  . HIS C  3 200 ? -20.898 -16.968 17.523  1.00 96.94  ? 215 HIS X CA  1 
ATOM   3116  C C   . HIS C  3 200 ? -21.114 -18.283 16.786  1.00 100.41 ? 215 HIS X C   1 
ATOM   3117  O O   . HIS C  3 200 ? -21.255 -18.277 15.566  1.00 99.51  ? 215 HIS X O   1 
ATOM   3118  C CB  . HIS C  3 200 ? -22.175 -16.128 17.515  1.00 102.45 ? 215 HIS X CB  1 
ATOM   3119  C CG  . HIS C  3 200 ? -23.258 -16.795 18.296  1.00 110.60 ? 215 HIS X CG  1 
ATOM   3120  N ND1 . HIS C  3 200 ? -24.119 -17.696 17.702  1.00 114.11 ? 215 HIS X ND1 1 
ATOM   3121  C CD2 . HIS C  3 200 ? -23.506 -16.764 19.626  1.00 115.79 ? 215 HIS X CD2 1 
ATOM   3122  C CE1 . HIS C  3 200 ? -24.893 -18.146 18.675  1.00 117.96 ? 215 HIS X CE1 1 
ATOM   3123  N NE2 . HIS C  3 200 ? -24.564 -17.608 19.850  1.00 119.49 ? 215 HIS X NE2 1 
ATOM   3124  N N   . GLY C  3 201 ? -21.160 -19.382 17.535  1.00 97.29  ? 216 GLY X N   1 
ATOM   3125  C CA  . GLY C  3 201 ? -21.315 -20.717 16.972  1.00 96.77  ? 216 GLY X CA  1 
ATOM   3126  C C   . GLY C  3 201 ? -20.083 -21.157 16.195  1.00 97.44  ? 216 GLY X C   1 
ATOM   3127  O O   . GLY C  3 201 ? -20.194 -21.685 15.087  1.00 96.78  ? 216 GLY X O   1 
ATOM   3128  N N   . ALA C  3 202 ? -18.891 -20.921 16.752  1.00 90.70  ? 217 ALA X N   1 
ATOM   3129  C CA  . ALA C  3 202 ? -17.649 -21.302 16.099  1.00 86.06  ? 217 ALA X CA  1 
ATOM   3130  C C   . ALA C  3 202 ? -16.641 -21.704 17.128  1.00 88.70  ? 217 ALA X C   1 
ATOM   3131  O O   . ALA C  3 202 ? -16.469 -20.999 18.128  1.00 90.60  ? 217 ALA X O   1 
ATOM   3132  C CB  . ALA C  3 202 ? -17.100 -20.142 15.286  1.00 84.53  ? 217 ALA X CB  1 
ATOM   3133  N N   . SER C  3 203 ? -15.953 -22.821 16.882  1.00 82.07  ? 218 SER X N   1 
ATOM   3134  C CA  . SER C  3 203 ? -14.896 -23.272 17.770  1.00 81.00  ? 218 SER X CA  1 
ATOM   3135  C C   . SER C  3 203 ? -13.705 -22.351 17.529  1.00 83.19  ? 218 SER X C   1 
ATOM   3136  O O   . SER C  3 203 ? -13.495 -21.912 16.395  1.00 80.53  ? 218 SER X O   1 
ATOM   3137  C CB  . SER C  3 203 ? -14.505 -24.707 17.448  1.00 83.43  ? 218 SER X CB  1 
ATOM   3138  O OG  . SER C  3 203 ? -15.584 -25.593 17.686  1.00 96.27  ? 218 SER X OG  1 
ATOM   3139  N N   . GLY C  3 204 ? -12.987 -22.026 18.601  1.00 80.50  ? 219 GLY X N   1 
ATOM   3140  C CA  . GLY C  3 204 ? -11.792 -21.187 18.552  1.00 77.88  ? 219 GLY X CA  1 
ATOM   3141  C C   . GLY C  3 204 ? -12.006 -19.744 18.135  1.00 80.51  ? 219 GLY X C   1 
ATOM   3142  O O   . GLY C  3 204 ? -13.012 -19.146 18.520  1.00 83.96  ? 219 GLY X O   1 
ATOM   3143  N N   . PRO C  3 205 ? -11.083 -19.136 17.349  1.00 72.43  ? 220 PRO X N   1 
ATOM   3144  C CA  . PRO C  3 205 ? -9.845  -19.708 16.795  1.00 68.34  ? 220 PRO X CA  1 
ATOM   3145  C C   . PRO C  3 205 ? -8.730  -19.849 17.819  1.00 69.36  ? 220 PRO X C   1 
ATOM   3146  O O   . PRO C  3 205 ? -8.755  -19.198 18.861  1.00 70.72  ? 220 PRO X O   1 
ATOM   3147  C CB  . PRO C  3 205 ? -9.500  -18.737 15.661  1.00 67.95  ? 220 PRO X CB  1 
ATOM   3148  C CG  . PRO C  3 205 ? -9.984  -17.413 16.161  1.00 74.43  ? 220 PRO X CG  1 
ATOM   3149  C CD  . PRO C  3 205 ? -11.248 -17.726 16.935  1.00 73.85  ? 220 PRO X CD  1 
ATOM   3150  N N   . VAL C  3 206 ? -7.778  -20.732 17.530  1.00 62.29  ? 221 VAL X N   1 
ATOM   3151  C CA  . VAL C  3 206 ? -6.622  -20.980 18.393  1.00 61.35  ? 221 VAL X CA  1 
ATOM   3152  C C   . VAL C  3 206 ? -5.551  -19.916 18.093  1.00 61.83  ? 221 VAL X C   1 
ATOM   3153  O O   . VAL C  3 206 ? -4.859  -19.434 18.999  1.00 60.76  ? 221 VAL X O   1 
ATOM   3154  C CB  . VAL C  3 206 ? -6.126  -22.432 18.220  1.00 63.83  ? 221 VAL X CB  1 
ATOM   3155  C CG1 . VAL C  3 206 ? -4.928  -22.725 19.114  1.00 64.20  ? 221 VAL X CG1 1 
ATOM   3156  C CG2 . VAL C  3 206 ? -7.255  -23.403 18.519  1.00 65.54  ? 221 VAL X CG2 1 
ATOM   3157  N N   . ILE C  3 207 ? -5.461  -19.534 16.811  1.00 56.04  ? 222 ILE X N   1 
ATOM   3158  C CA  . ILE C  3 207 ? -4.561  -18.500 16.329  1.00 54.02  ? 222 ILE X CA  1 
ATOM   3159  C C   . ILE C  3 207 ? -5.405  -17.389 15.713  1.00 56.79  ? 222 ILE X C   1 
ATOM   3160  O O   . ILE C  3 207 ? -6.320  -17.685 14.940  1.00 57.28  ? 222 ILE X O   1 
ATOM   3161  C CB  . ILE C  3 207 ? -3.516  -19.073 15.327  1.00 54.66  ? 222 ILE X CB  1 
ATOM   3162  C CG1 . ILE C  3 207 ? -2.666  -20.183 15.988  1.00 55.76  ? 222 ILE X CG1 1 
ATOM   3163  C CG2 . ILE C  3 207 ? -2.635  -17.952 14.751  1.00 52.44  ? 222 ILE X CG2 1 
ATOM   3164  C CD1 . ILE C  3 207 ? -1.811  -20.963 15.068  1.00 63.80  ? 222 ILE X CD1 1 
ATOM   3165  N N   . LEU C  3 208 ? -5.107  -16.122 16.068  1.00 51.41  ? 223 LEU X N   1 
ATOM   3166  C CA  . LEU C  3 208 ? -5.772  -14.941 15.518  1.00 50.50  ? 223 LEU X CA  1 
ATOM   3167  C C   . LEU C  3 208 ? -4.758  -13.858 15.206  1.00 51.81  ? 223 LEU X C   1 
ATOM   3168  O O   . LEU C  3 208 ? -3.910  -13.524 16.045  1.00 50.65  ? 223 LEU X O   1 
ATOM   3169  C CB  . LEU C  3 208 ? -6.913  -14.406 16.417  1.00 53.05  ? 223 LEU X CB  1 
ATOM   3170  C CG  . LEU C  3 208 ? -7.652  -13.116 15.978  1.00 57.68  ? 223 LEU X CG  1 
ATOM   3171  C CD1 . LEU C  3 208 ? -8.472  -13.333 14.726  1.00 56.80  ? 223 LEU X CD1 1 
ATOM   3172  C CD2 . LEU C  3 208 ? -8.580  -12.640 17.054  1.00 62.11  ? 223 LEU X CD2 1 
ATOM   3173  N N   . ASP C  3 209 ? -4.850  -13.315 13.982  1.00 47.78  ? 224 ASP X N   1 
ATOM   3174  C CA  . ASP C  3 209 ? -3.964  -12.249 13.535  1.00 46.82  ? 224 ASP X CA  1 
ATOM   3175  C C   . ASP C  3 209 ? -4.784  -11.075 13.035  1.00 51.26  ? 224 ASP X C   1 
ATOM   3176  O O   . ASP C  3 209 ? -5.423  -11.177 11.984  1.00 51.40  ? 224 ASP X O   1 
ATOM   3177  C CB  . ASP C  3 209 ? -2.981  -12.741 12.465  1.00 46.18  ? 224 ASP X CB  1 
ATOM   3178  C CG  . ASP C  3 209 ? -1.818  -11.808 12.216  1.00 59.30  ? 224 ASP X CG  1 
ATOM   3179  O OD1 . ASP C  3 209 ? -1.841  -10.683 12.741  1.00 61.90  ? 224 ASP X OD1 1 
ATOM   3180  O OD2 . ASP C  3 209 ? -0.885  -12.201 11.481  1.00 64.90  ? 224 ASP X OD2 1 
ATOM   3181  N N   . ILE C  3 210 ? -4.785  -9.977  13.821  1.00 47.43  ? 225 ILE X N   1 
ATOM   3182  C CA  . ILE C  3 210 ? -5.456  -8.710  13.521  1.00 48.59  ? 225 ILE X CA  1 
ATOM   3183  C C   . ILE C  3 210 ? -4.375  -7.631  13.329  1.00 52.83  ? 225 ILE X C   1 
ATOM   3184  O O   . ILE C  3 210 ? -4.584  -6.478  13.680  1.00 55.85  ? 225 ILE X O   1 
ATOM   3185  C CB  . ILE C  3 210 ? -6.489  -8.317  14.617  1.00 54.93  ? 225 ILE X CB  1 
ATOM   3186  C CG1 . ILE C  3 210 ? -5.867  -8.351  16.040  1.00 56.51  ? 225 ILE X CG1 1 
ATOM   3187  C CG2 . ILE C  3 210 ? -7.768  -9.172  14.531  1.00 56.78  ? 225 ILE X CG2 1 
ATOM   3188  C CD1 . ILE C  3 210 ? -6.482  -7.331  17.054  1.00 65.54  ? 225 ILE X CD1 1 
ATOM   3189  N N   . SER C  3 211 ? -3.212  -8.002  12.790  1.00 45.96  ? 226 SER X N   1 
ATOM   3190  C CA  . SER C  3 211 ? -2.138  -7.049  12.619  1.00 45.60  ? 226 SER X CA  1 
ATOM   3191  C C   . SER C  3 211 ? -2.438  -6.073  11.518  1.00 51.11  ? 226 SER X C   1 
ATOM   3192  O O   . SER C  3 211 ? -3.085  -6.440  10.550  1.00 51.20  ? 226 SER X O   1 
ATOM   3193  C CB  . SER C  3 211 ? -0.818  -7.762  12.371  1.00 47.20  ? 226 SER X CB  1 
ATOM   3194  O OG  . SER C  3 211 ? -0.461  -8.517  13.518  1.00 54.05  ? 226 SER X OG  1 
ATOM   3195  N N   . ARG C  3 212 ? -1.990  -4.814  11.675  1.00 48.47  ? 227 ARG X N   1 
ATOM   3196  C CA  . ARG C  3 212 ? -2.196  -3.731  10.716  1.00 48.35  ? 227 ARG X CA  1 
ATOM   3197  C C   . ARG C  3 212 ? -3.686  -3.620  10.312  1.00 54.91  ? 227 ARG X C   1 
ATOM   3198  O O   . ARG C  3 212 ? -4.048  -3.804  9.143   1.00 55.02  ? 227 ARG X O   1 
ATOM   3199  C CB  . ARG C  3 212 ? -1.235  -3.848  9.524   1.00 43.99  ? 227 ARG X CB  1 
ATOM   3200  C CG  . ARG C  3 212 ? 0.225   -3.815  9.963   1.00 48.26  ? 227 ARG X CG  1 
ATOM   3201  C CD  . ARG C  3 212 ? 1.238   -4.350  8.950   1.00 45.08  ? 227 ARG X CD  1 
ATOM   3202  N NE  . ARG C  3 212 ? 1.039   -5.763  8.612   1.00 52.67  ? 227 ARG X NE  1 
ATOM   3203  C CZ  . ARG C  3 212 ? 1.441   -6.794  9.354   1.00 62.27  ? 227 ARG X CZ  1 
ATOM   3204  N NH1 . ARG C  3 212 ? 2.070   -6.588  10.505  1.00 49.71  ? 227 ARG X NH1 1 
ATOM   3205  N NH2 . ARG C  3 212 ? 1.195   -8.035  8.963   1.00 43.01  ? 227 ARG X NH2 1 
ATOM   3206  N N   . THR C  3 213 ? -4.551  -3.407  11.337  1.00 52.41  ? 228 THR X N   1 
ATOM   3207  C CA  . THR C  3 213 ? -5.993  -3.190  11.234  1.00 54.26  ? 228 THR X CA  1 
ATOM   3208  C C   . THR C  3 213 ? -6.401  -2.100  12.240  1.00 63.20  ? 228 THR X C   1 
ATOM   3209  O O   . THR C  3 213 ? -5.780  -1.967  13.302  1.00 63.63  ? 228 THR X O   1 
ATOM   3210  C CB  . THR C  3 213 ? -6.812  -4.473  11.474  1.00 57.26  ? 228 THR X CB  1 
ATOM   3211  O OG1 . THR C  3 213 ? -6.688  -4.888  12.835  1.00 60.41  ? 228 THR X OG1 1 
ATOM   3212  C CG2 . THR C  3 213 ? -6.489  -5.604  10.498  1.00 46.69  ? 228 THR X CG2 1 
ATOM   3213  N N   . ARG C  3 214 ? -7.470  -1.345  11.919  1.00 62.83  ? 229 ARG X N   1 
ATOM   3214  C CA  . ARG C  3 214 ? -7.988  -0.276  12.777  1.00 66.53  ? 229 ARG X CA  1 
ATOM   3215  C C   . ARG C  3 214 ? -8.924  -0.834  13.880  1.00 70.97  ? 229 ARG X C   1 
ATOM   3216  O O   . ARG C  3 214 ? -9.683  -0.076  14.488  1.00 73.02  ? 229 ARG X O   1 
ATOM   3217  C CB  . ARG C  3 214 ? -8.715  0.799   11.931  1.00 70.82  ? 229 ARG X CB  1 
ATOM   3218  C CG  . ARG C  3 214 ? -7.835  1.626   11.021  1.00 83.18  ? 229 ARG X CG  1 
ATOM   3219  C CD  . ARG C  3 214 ? -8.662  2.533   10.130  1.00 105.14 ? 229 ARG X CD  1 
ATOM   3220  N NE  . ARG C  3 214 ? -8.203  2.493   8.739   1.00 119.27 ? 229 ARG X NE  1 
ATOM   3221  C CZ  . ARG C  3 214 ? -8.894  2.953   7.699   1.00 136.28 ? 229 ARG X CZ  1 
ATOM   3222  N NH1 . ARG C  3 214 ? -10.098 3.486   7.875   1.00 127.95 ? 229 ARG X NH1 1 
ATOM   3223  N NH2 . ARG C  3 214 ? -8.395  2.864   6.472   1.00 119.41 ? 229 ARG X NH2 1 
ATOM   3224  N N   . ILE C  3 215 ? -8.863  -2.150  14.141  1.00 66.23  ? 230 ILE X N   1 
ATOM   3225  C CA  . ILE C  3 215 ? -9.698  -2.793  15.162  1.00 67.99  ? 230 ILE X CA  1 
ATOM   3226  C C   . ILE C  3 215 ? -9.392  -2.176  16.542  1.00 76.58  ? 230 ILE X C   1 
ATOM   3227  O O   . ILE C  3 215 ? -8.227  -2.076  16.957  1.00 74.08  ? 230 ILE X O   1 
ATOM   3228  C CB  . ILE C  3 215 ? -9.647  -4.347  15.108  1.00 67.18  ? 230 ILE X CB  1 
ATOM   3229  C CG1 . ILE C  3 215 ? -10.196 -4.839  13.752  1.00 65.60  ? 230 ILE X CG1 1 
ATOM   3230  C CG2 . ILE C  3 215 ? -10.439 -4.980  16.262  1.00 69.29  ? 230 ILE X CG2 1 
ATOM   3231  C CD1 . ILE C  3 215 ? -9.764  -6.240  13.320  1.00 64.48  ? 230 ILE X CD1 1 
ATOM   3232  N N   . HIS C  3 216 ? -10.472 -1.675  17.179  1.00 79.29  ? 231 HIS X N   1 
ATOM   3233  C CA  . HIS C  3 216 ? -10.491 -0.964  18.452  1.00 83.67  ? 231 HIS X CA  1 
ATOM   3234  C C   . HIS C  3 216 ? -10.532 -1.850  19.681  1.00 87.22  ? 231 HIS X C   1 
ATOM   3235  O O   . HIS C  3 216 ? -10.039 -1.430  20.732  1.00 88.84  ? 231 HIS X O   1 
ATOM   3236  C CB  . HIS C  3 216 ? -11.668 0.036   18.478  1.00 90.19  ? 231 HIS X CB  1 
ATOM   3237  C CG  . HIS C  3 216 ? -11.465 1.187   17.536  1.00 95.30  ? 231 HIS X CG  1 
ATOM   3238  N ND1 . HIS C  3 216 ? -10.818 2.353   17.938  1.00 99.62  ? 231 HIS X ND1 1 
ATOM   3239  C CD2 . HIS C  3 216 ? -11.771 1.292   16.221  1.00 96.36  ? 231 HIS X CD2 1 
ATOM   3240  C CE1 . HIS C  3 216 ? -10.768 3.123   16.864  1.00 99.07  ? 231 HIS X CE1 1 
ATOM   3241  N NE2 . HIS C  3 216 ? -11.309 2.520   15.802  1.00 97.44  ? 231 HIS X NE2 1 
ATOM   3242  N N   . SER C  3 217 ? -11.132 -3.054  19.571  1.00 81.75  ? 232 SER X N   1 
ATOM   3243  C CA  . SER C  3 217 ? -11.345 -3.952  20.707  1.00 82.83  ? 232 SER X CA  1 
ATOM   3244  C C   . SER C  3 217 ? -11.554 -5.410  20.270  1.00 84.66  ? 232 SER X C   1 
ATOM   3245  O O   . SER C  3 217 ? -11.957 -5.674  19.134  1.00 83.41  ? 232 SER X O   1 
ATOM   3246  C CB  . SER C  3 217 ? -12.573 -3.483  21.497  1.00 91.25  ? 232 SER X CB  1 
ATOM   3247  O OG  . SER C  3 217 ? -12.509 -3.767  22.885  1.00 101.21 ? 232 SER X OG  1 
ATOM   3248  N N   . LEU C  3 218 ? -11.302 -6.350  21.191  1.00 79.98  ? 233 LEU X N   1 
ATOM   3249  C CA  . LEU C  3 218 ? -11.521 -7.767  20.962  1.00 77.88  ? 233 LEU X CA  1 
ATOM   3250  C C   . LEU C  3 218 ? -12.907 -8.134  21.537  1.00 90.16  ? 233 LEU X C   1 
ATOM   3251  O O   . LEU C  3 218 ? -13.373 -7.449  22.458  1.00 95.22  ? 233 LEU X O   1 
ATOM   3252  C CB  . LEU C  3 218 ? -10.420 -8.582  21.656  1.00 75.46  ? 233 LEU X CB  1 
ATOM   3253  C CG  . LEU C  3 218 ? -9.011  -8.528  21.057  1.00 75.35  ? 233 LEU X CG  1 
ATOM   3254  C CD1 . LEU C  3 218 ? -8.047  -9.270  21.919  1.00 74.44  ? 233 LEU X CD1 1 
ATOM   3255  C CD2 . LEU C  3 218 ? -8.957  -9.144  19.672  1.00 73.19  ? 233 LEU X CD2 1 
ATOM   3256  N N   . PRO C  3 219 ? -13.607 -9.180  21.039  1.00 87.49  ? 234 PRO X N   1 
ATOM   3257  C CA  . PRO C  3 219 ? -14.924 -9.504  21.615  1.00 91.52  ? 234 PRO X CA  1 
ATOM   3258  C C   . PRO C  3 219 ? -14.822 -10.208 22.966  1.00 98.79  ? 234 PRO X C   1 
ATOM   3259  O O   . PRO C  3 219 ? -13.884 -10.970 23.196  1.00 95.18  ? 234 PRO X O   1 
ATOM   3260  C CB  . PRO C  3 219 ? -15.584 -10.388 20.548  1.00 91.68  ? 234 PRO X CB  1 
ATOM   3261  C CG  . PRO C  3 219 ? -14.610 -10.461 19.403  1.00 91.79  ? 234 PRO X CG  1 
ATOM   3262  C CD  . PRO C  3 219 ? -13.267 -10.108 19.947  1.00 85.54  ? 234 PRO X CD  1 
ATOM   3263  N N   . SER C  3 220 ? -15.802 -9.950  23.856  1.00 102.67 ? 235 SER X N   1 
ATOM   3264  C CA  . SER C  3 220 ? -15.898 -10.503 25.214  1.00 106.53 ? 235 SER X CA  1 
ATOM   3265  C C   . SER C  3 220 ? -15.868 -12.035 25.284  1.00 110.77 ? 235 SER X C   1 
ATOM   3266  O O   . SER C  3 220 ? -15.406 -12.575 26.287  1.00 112.28 ? 235 SER X O   1 
ATOM   3267  C CB  . SER C  3 220 ? -17.147 -9.984  25.914  1.00 117.00 ? 235 SER X CB  1 
ATOM   3268  O OG  . SER C  3 220 ? -18.330 -10.544 25.363  1.00 130.45 ? 235 SER X OG  1 
ATOM   3269  N N   . TYR C  3 221 ? -16.379 -12.725 24.246  1.00 105.64 ? 236 TYR X N   1 
ATOM   3270  C CA  . TYR C  3 221 ? -16.395 -14.187 24.189  1.00 104.56 ? 236 TYR X CA  1 
ATOM   3271  C C   . TYR C  3 221 ? -15.848 -14.687 22.845  1.00 100.89 ? 236 TYR X C   1 
ATOM   3272  O O   . TYR C  3 221 ? -15.750 -13.899 21.911  1.00 98.08  ? 236 TYR X O   1 
ATOM   3273  C CB  . TYR C  3 221 ? -17.809 -14.732 24.499  1.00 111.37 ? 236 TYR X CB  1 
ATOM   3274  C CG  . TYR C  3 221 ? -18.799 -14.627 23.356  1.00 115.08 ? 236 TYR X CG  1 
ATOM   3275  C CD1 . TYR C  3 221 ? -19.520 -13.456 23.136  1.00 120.18 ? 236 TYR X CD1 1 
ATOM   3276  C CD2 . TYR C  3 221 ? -19.033 -15.708 22.508  1.00 114.04 ? 236 TYR X CD2 1 
ATOM   3277  C CE1 . TYR C  3 221 ? -20.431 -13.354 22.084  1.00 122.00 ? 236 TYR X CE1 1 
ATOM   3278  C CE2 . TYR C  3 221 ? -19.933 -15.615 21.447  1.00 115.53 ? 236 TYR X CE2 1 
ATOM   3279  C CZ  . TYR C  3 221 ? -20.632 -14.436 21.241  1.00 126.29 ? 236 TYR X CZ  1 
ATOM   3280  O OH  . TYR C  3 221 ? -21.527 -14.347 20.204  1.00 128.35 ? 236 TYR X OH  1 
ATOM   3281  N N   . GLY C  3 222 ? -15.505 -15.975 22.769  1.00 94.65  ? 237 GLY X N   1 
ATOM   3282  C CA  . GLY C  3 222 ? -14.959 -16.601 21.564  1.00 89.95  ? 237 GLY X CA  1 
ATOM   3283  C C   . GLY C  3 222 ? -13.454 -16.795 21.606  1.00 90.08  ? 237 GLY X C   1 
ATOM   3284  O O   . GLY C  3 222 ? -12.898 -17.575 20.830  1.00 86.19  ? 237 GLY X O   1 
ATOM   3285  N N   . LEU C  3 223 ? -12.786 -16.082 22.521  1.00 87.88  ? 238 LEU X N   1 
ATOM   3286  C CA  . LEU C  3 223 ? -11.334 -16.103 22.686  1.00 85.26  ? 238 LEU X CA  1 
ATOM   3287  C C   . LEU C  3 223 ? -10.877 -17.047 23.795  1.00 90.91  ? 238 LEU X C   1 
ATOM   3288  O O   . LEU C  3 223 ? -9.686  -17.104 24.126  1.00 89.18  ? 238 LEU X O   1 
ATOM   3289  C CB  . LEU C  3 223 ? -10.810 -14.675 22.925  1.00 85.67  ? 238 LEU X CB  1 
ATOM   3290  C CG  . LEU C  3 223 ? -11.300 -13.579 21.968  1.00 89.86  ? 238 LEU X CG  1 
ATOM   3291  C CD1 . LEU C  3 223 ? -10.754 -12.226 22.378  1.00 91.12  ? 238 LEU X CD1 1 
ATOM   3292  C CD2 . LEU C  3 223 ? -10.937 -13.887 20.519  1.00 88.33  ? 238 LEU X CD2 1 
ATOM   3293  N N   . GLU C  3 224 ? -11.825 -17.821 24.338  1.00 90.95  ? 239 GLU X N   1 
ATOM   3294  C CA  . GLU C  3 224 ? -11.578 -18.809 25.392  1.00 93.08  ? 239 GLU X CA  1 
ATOM   3295  C C   . GLU C  3 224 ? -10.610 -19.927 24.936  1.00 90.92  ? 239 GLU X C   1 
ATOM   3296  O O   . GLU C  3 224 ? -10.029 -20.616 25.775  1.00 91.56  ? 239 GLU X O   1 
ATOM   3297  C CB  . GLU C  3 224 ? -12.907 -19.368 25.962  1.00 98.93  ? 239 GLU X CB  1 
ATOM   3298  C CG  . GLU C  3 224 ? -13.803 -20.118 24.976  1.00 113.54 ? 239 GLU X CG  1 
ATOM   3299  C CD  . GLU C  3 224 ? -14.633 -19.283 24.017  1.00 140.43 ? 239 GLU X CD  1 
ATOM   3300  O OE1 . GLU C  3 224 ? -15.145 -18.218 24.436  1.00 140.05 ? 239 GLU X OE1 1 
ATOM   3301  O OE2 . GLU C  3 224 ? -14.797 -19.714 22.852  1.00 132.92 ? 239 GLU X OE2 1 
ATOM   3302  N N   . ASN C  3 225 ? -10.410 -20.054 23.607  1.00 81.41  ? 240 ASN X N   1 
ATOM   3303  C CA  . ASN C  3 225 ? -9.524  -21.038 22.996  1.00 77.32  ? 240 ASN X CA  1 
ATOM   3304  C C   . ASN C  3 225 ? -8.290  -20.435 22.355  1.00 74.24  ? 240 ASN X C   1 
ATOM   3305  O O   . ASN C  3 225 ? -7.389  -21.171 21.949  1.00 71.08  ? 240 ASN X O   1 
ATOM   3306  C CB  . ASN C  3 225 ? -10.293 -21.873 21.992  1.00 77.92  ? 240 ASN X CB  1 
ATOM   3307  C CG  . ASN C  3 225 ? -11.284 -22.761 22.667  1.00 93.62  ? 240 ASN X CG  1 
ATOM   3308  O OD1 . ASN C  3 225 ? -10.914 -23.656 23.435  1.00 82.18  ? 240 ASN X OD1 1 
ATOM   3309  N ND2 . ASN C  3 225 ? -12.561 -22.465 22.468  1.00 88.80  ? 240 ASN X ND2 1 
ATOM   3310  N N   . LEU C  3 226 ? -8.242  -19.102 22.279  1.00 69.23  ? 241 LEU X N   1 
ATOM   3311  C CA  . LEU C  3 226 ? -7.134  -18.354 21.697  1.00 65.42  ? 241 LEU X CA  1 
ATOM   3312  C C   . LEU C  3 226 ? -5.817  -18.620 22.446  1.00 70.51  ? 241 LEU X C   1 
ATOM   3313  O O   . LEU C  3 226 ? -5.741  -18.361 23.644  1.00 73.86  ? 241 LEU X O   1 
ATOM   3314  C CB  . LEU C  3 226 ? -7.486  -16.848 21.662  1.00 65.14  ? 241 LEU X CB  1 
ATOM   3315  C CG  . LEU C  3 226 ? -6.516  -15.903 20.960  1.00 66.26  ? 241 LEU X CG  1 
ATOM   3316  C CD1 . LEU C  3 226 ? -6.379  -16.231 19.493  1.00 62.98  ? 241 LEU X CD1 1 
ATOM   3317  C CD2 . LEU C  3 226 ? -6.955  -14.489 21.121  1.00 68.57  ? 241 LEU X CD2 1 
ATOM   3318  N N   . LYS C  3 227 ? -4.810  -19.169 21.740  1.00 63.61  ? 242 LYS X N   1 
ATOM   3319  C CA  . LYS C  3 227 ? -3.478  -19.456 22.273  1.00 63.57  ? 242 LYS X CA  1 
ATOM   3320  C C   . LYS C  3 227 ? -2.448  -18.403 21.792  1.00 66.97  ? 242 LYS X C   1 
ATOM   3321  O O   . LYS C  3 227 ? -1.595  -17.963 22.574  1.00 68.35  ? 242 LYS X O   1 
ATOM   3322  C CB  . LYS C  3 227 ? -3.022  -20.856 21.846  1.00 64.46  ? 242 LYS X CB  1 
ATOM   3323  C CG  . LYS C  3 227 ? -3.353  -21.963 22.823  1.00 79.57  ? 242 LYS X CG  1 
ATOM   3324  C CD  . LYS C  3 227 ? -2.724  -23.270 22.376  1.00 88.12  ? 242 LYS X CD  1 
ATOM   3325  C CE  . LYS C  3 227 ? -2.988  -24.424 23.316  1.00 99.74  ? 242 LYS X CE  1 
ATOM   3326  N NZ  . LYS C  3 227 ? -2.565  -25.723 22.718  1.00 103.08 ? 242 LYS X NZ  1 
ATOM   3327  N N   . LYS C  3 228 ? -2.516  -18.026 20.498  1.00 60.50  ? 243 LYS X N   1 
ATOM   3328  C CA  . LYS C  3 228 ? -1.586  -17.073 19.874  1.00 57.83  ? 243 LYS X CA  1 
ATOM   3329  C C   . LYS C  3 228 ? -2.310  -15.850 19.283  1.00 60.57  ? 243 LYS X C   1 
ATOM   3330  O O   . LYS C  3 228 ? -3.186  -15.992 18.422  1.00 60.20  ? 243 LYS X O   1 
ATOM   3331  C CB  . LYS C  3 228 ? -0.721  -17.769 18.808  1.00 55.99  ? 243 LYS X CB  1 
ATOM   3332  C CG  . LYS C  3 228 ? 0.210   -18.833 19.358  1.00 53.50  ? 243 LYS X CG  1 
ATOM   3333  C CD  . LYS C  3 228 ? 0.713   -19.743 18.252  1.00 55.08  ? 243 LYS X CD  1 
ATOM   3334  C CE  . LYS C  3 228 ? 1.139   -21.098 18.765  1.00 54.70  ? 243 LYS X CE  1 
ATOM   3335  N NZ  . LYS C  3 228 ? 2.615   -21.262 18.788  1.00 55.82  ? 243 LYS X NZ  1 
ATOM   3336  N N   . LEU C  3 229 ? -1.968  -14.656 19.770  1.00 55.49  ? 244 LEU X N   1 
ATOM   3337  C CA  . LEU C  3 229 ? -2.585  -13.430 19.284  1.00 53.72  ? 244 LEU X CA  1 
ATOM   3338  C C   . LEU C  3 229 ? -1.527  -12.587 18.632  1.00 55.65  ? 244 LEU X C   1 
ATOM   3339  O O   . LEU C  3 229 ? -0.490  -12.303 19.241  1.00 56.60  ? 244 LEU X O   1 
ATOM   3340  C CB  . LEU C  3 229 ? -3.298  -12.648 20.410  1.00 56.25  ? 244 LEU X CB  1 
ATOM   3341  C CG  . LEU C  3 229 ? -3.853  -11.268 20.047  1.00 60.71  ? 244 LEU X CG  1 
ATOM   3342  C CD1 . LEU C  3 229 ? -4.958  -11.357 19.000  1.00 59.66  ? 244 LEU X CD1 1 
ATOM   3343  C CD2 . LEU C  3 229 ? -4.368  -10.565 21.265  1.00 66.55  ? 244 LEU X CD2 1 
ATOM   3344  N N   . ARG C  3 230 ? -1.760  -12.221 17.376  1.00 48.61  ? 245 ARG X N   1 
ATOM   3345  C CA  . ARG C  3 230 ? -0.796  -11.384 16.681  1.00 46.37  ? 245 ARG X CA  1 
ATOM   3346  C C   . ARG C  3 230 ? -1.519  -10.090 16.338  1.00 48.47  ? 245 ARG X C   1 
ATOM   3347  O O   . ARG C  3 230 ? -2.594  -10.116 15.724  1.00 47.60  ? 245 ARG X O   1 
ATOM   3348  C CB  . ARG C  3 230 ? -0.144  -12.121 15.496  1.00 43.62  ? 245 ARG X CB  1 
ATOM   3349  C CG  . ARG C  3 230 ? 0.410   -13.487 15.907  1.00 58.37  ? 245 ARG X CG  1 
ATOM   3350  C CD  . ARG C  3 230 ? 0.925   -14.288 14.734  1.00 74.90  ? 245 ARG X CD  1 
ATOM   3351  N NE  . ARG C  3 230 ? 0.884   -15.743 14.939  1.00 74.24  ? 245 ARG X NE  1 
ATOM   3352  C CZ  . ARG C  3 230 ? 1.786   -16.442 15.625  1.00 89.63  ? 245 ARG X CZ  1 
ATOM   3353  N NH1 . ARG C  3 230 ? 2.771   -15.823 16.267  1.00 82.48  ? 245 ARG X NH1 1 
ATOM   3354  N NH2 . ARG C  3 230 ? 1.688   -17.761 15.706  1.00 76.01  ? 245 ARG X NH2 1 
ATOM   3355  N N   . ALA C  3 231 ? -1.016  -8.988  16.898  1.00 44.33  ? 246 ALA X N   1 
ATOM   3356  C CA  . ALA C  3 231 ? -1.613  -7.678  16.761  1.00 45.83  ? 246 ALA X CA  1 
ATOM   3357  C C   . ALA C  3 231 ? -0.506  -6.656  16.621  1.00 53.55  ? 246 ALA X C   1 
ATOM   3358  O O   . ALA C  3 231 ? -0.339  -5.747  17.435  1.00 56.00  ? 246 ALA X O   1 
ATOM   3359  C CB  . ALA C  3 231 ? -2.499  -7.383  17.961  1.00 49.26  ? 246 ALA X CB  1 
ATOM   3360  N N   . ARG C  3 232 ? 0.280   -6.834  15.571  1.00 50.39  ? 247 ARG X N   1 
ATOM   3361  C CA  . ARG C  3 232 ? 1.394   -5.959  15.240  1.00 50.97  ? 247 ARG X CA  1 
ATOM   3362  C C   . ARG C  3 232 ? 0.782   -4.737  14.554  1.00 59.49  ? 247 ARG X C   1 
ATOM   3363  O O   . ARG C  3 232 ? -0.110  -4.902  13.724  1.00 59.66  ? 247 ARG X O   1 
ATOM   3364  C CB  . ARG C  3 232 ? 2.367   -6.680  14.299  1.00 45.31  ? 247 ARG X CB  1 
ATOM   3365  C CG  . ARG C  3 232 ? 2.932   -7.969  14.852  1.00 53.91  ? 247 ARG X CG  1 
ATOM   3366  C CD  . ARG C  3 232 ? 4.441   -7.926  15.010  1.00 77.51  ? 247 ARG X CD  1 
ATOM   3367  N NE  . ARG C  3 232 ? 4.839   -7.511  16.359  1.00 98.36  ? 247 ARG X NE  1 
ATOM   3368  C CZ  . ARG C  3 232 ? 5.858   -8.030  17.041  1.00 113.56 ? 247 ARG X CZ  1 
ATOM   3369  N NH1 . ARG C  3 232 ? 6.598   -9.000  16.512  1.00 95.42  ? 247 ARG X NH1 1 
ATOM   3370  N NH2 . ARG C  3 232 ? 6.142   -7.586  18.259  1.00 104.40 ? 247 ARG X NH2 1 
ATOM   3371  N N   . SER C  3 233 ? 1.208   -3.516  14.934  1.00 58.04  ? 248 SER X N   1 
ATOM   3372  C CA  . SER C  3 233 ? 0.707   -2.263  14.369  1.00 58.97  ? 248 SER X CA  1 
ATOM   3373  C C   . SER C  3 233 ? -0.821  -2.183  14.388  1.00 63.20  ? 248 SER X C   1 
ATOM   3374  O O   . SER C  3 233 ? -1.454  -1.787  13.413  1.00 63.57  ? 248 SER X O   1 
ATOM   3375  C CB  . SER C  3 233 ? 1.283   -2.022  12.976  1.00 62.16  ? 248 SER X CB  1 
ATOM   3376  O OG  . SER C  3 233 ? 2.682   -2.264  12.953  1.00 75.31  ? 248 SER X OG  1 
ATOM   3377  N N   . THR C  3 234 ? -1.405  -2.594  15.508  1.00 60.59  ? 249 THR X N   1 
ATOM   3378  C CA  . THR C  3 234 ? -2.848  -2.569  15.729  1.00 62.17  ? 249 THR X CA  1 
ATOM   3379  C C   . THR C  3 234 ? -3.079  -1.487  16.783  1.00 70.00  ? 249 THR X C   1 
ATOM   3380  O O   . THR C  3 234 ? -3.473  -1.760  17.924  1.00 71.56  ? 249 THR X O   1 
ATOM   3381  C CB  . THR C  3 234 ? -3.358  -3.969  16.069  1.00 66.53  ? 249 THR X CB  1 
ATOM   3382  O OG1 . THR C  3 234 ? -2.862  -4.881  15.088  1.00 61.59  ? 249 THR X OG1 1 
ATOM   3383  C CG2 . THR C  3 234 ? -4.871  -4.040  16.086  1.00 69.91  ? 249 THR X CG2 1 
ATOM   3384  N N   . TYR C  3 235 ? -2.759  -0.252  16.377  1.00 67.23  ? 250 TYR X N   1 
ATOM   3385  C CA  . TYR C  3 235 ? -2.757  0.954   17.192  1.00 70.72  ? 250 TYR X CA  1 
ATOM   3386  C C   . TYR C  3 235 ? -4.085  1.353   17.831  1.00 78.20  ? 250 TYR X C   1 
ATOM   3387  O O   . TYR C  3 235 ? -4.059  2.083   18.824  1.00 80.93  ? 250 TYR X O   1 
ATOM   3388  C CB  . TYR C  3 235 ? -2.216  2.128   16.381  1.00 72.68  ? 250 TYR X CB  1 
ATOM   3389  C CG  . TYR C  3 235 ? -0.793  1.940   15.904  1.00 72.90  ? 250 TYR X CG  1 
ATOM   3390  C CD1 . TYR C  3 235 ? 0.286   2.124   16.770  1.00 75.92  ? 250 TYR X CD1 1 
ATOM   3391  C CD2 . TYR C  3 235 ? -0.517  1.615   14.578  1.00 70.95  ? 250 TYR X CD2 1 
ATOM   3392  C CE1 . TYR C  3 235 ? 1.601   1.955   16.335  1.00 74.30  ? 250 TYR X CE1 1 
ATOM   3393  C CE2 . TYR C  3 235 ? 0.793   1.457   14.128  1.00 69.98  ? 250 TYR X CE2 1 
ATOM   3394  C CZ  . TYR C  3 235 ? 1.848   1.624   15.012  1.00 78.30  ? 250 TYR X CZ  1 
ATOM   3395  O OH  . TYR C  3 235 ? 3.137   1.477   14.570  1.00 78.96  ? 250 TYR X OH  1 
ATOM   3396  N N   . ASN C  3 236 ? -5.239  0.909   17.284  1.00 74.23  ? 251 ASN X N   1 
ATOM   3397  C CA  . ASN C  3 236 ? -6.526  1.305   17.864  1.00 76.95  ? 251 ASN X CA  1 
ATOM   3398  C C   . ASN C  3 236 ? -6.949  0.455   19.049  1.00 80.56  ? 251 ASN X C   1 
ATOM   3399  O O   . ASN C  3 236 ? -7.846  0.881   19.771  1.00 83.44  ? 251 ASN X O   1 
ATOM   3400  C CB  . ASN C  3 236 ? -7.634  1.385   16.812  1.00 75.79  ? 251 ASN X CB  1 
ATOM   3401  C CG  . ASN C  3 236 ? -7.539  2.595   15.906  1.00 90.41  ? 251 ASN X CG  1 
ATOM   3402  O OD1 . ASN C  3 236 ? -7.996  2.567   14.758  1.00 85.23  ? 251 ASN X OD1 1 
ATOM   3403  N ND2 . ASN C  3 236 ? -6.954  3.692   16.386  1.00 80.92  ? 251 ASN X ND2 1 
ATOM   3404  N N   . LEU C  3 237 ? -6.282  -0.704  19.285  1.00 74.45  ? 252 LEU X N   1 
ATOM   3405  C CA  . LEU C  3 237 ? -6.600  -1.591  20.394  1.00 75.70  ? 252 LEU X CA  1 
ATOM   3406  C C   . LEU C  3 237 ? -6.506  -0.874  21.742  1.00 87.02  ? 252 LEU X C   1 
ATOM   3407  O O   . LEU C  3 237 ? -7.547  -0.386  22.215  1.00 91.79  ? 252 LEU X O   1 
ATOM   3408  C CB  . LEU C  3 237 ? -5.808  -2.898  20.358  1.00 72.03  ? 252 LEU X CB  1 
ATOM   3409  C CG  . LEU C  3 237 ? -6.677  -4.165  20.570  1.00 76.22  ? 252 LEU X CG  1 
ATOM   3410  C CD1 . LEU C  3 237 ? -7.802  -4.247  19.558  1.00 76.07  ? 252 LEU X CD1 1 
ATOM   3411  C CD2 . LEU C  3 237 ? -5.859  -5.434  20.481  1.00 72.77  ? 252 LEU X CD2 1 
ATOM   3412  N N   . LYS C  3 238 ? -5.302  -0.764  22.349  1.00 84.04  ? 253 LYS X N   1 
ATOM   3413  C CA  . LYS C  3 238 ? -5.075  -0.041  23.630  1.00 88.59  ? 253 LYS X CA  1 
ATOM   3414  C C   . LYS C  3 238 ? -5.700  -0.720  24.877  1.00 96.89  ? 253 LYS X C   1 
ATOM   3415  O O   . LYS C  3 238 ? -5.150  -0.586  25.971  1.00 99.72  ? 253 LYS X O   1 
ATOM   3416  C CB  . LYS C  3 238 ? -5.502  1.448   23.555  1.00 93.43  ? 253 LYS X CB  1 
ATOM   3417  C CG  . LYS C  3 238 ? -4.564  2.307   22.720  1.00 99.20  ? 253 LYS X CG  1 
ATOM   3418  C CD  . LYS C  3 238 ? -5.309  3.314   21.854  1.00 111.05 ? 253 LYS X CD  1 
ATOM   3419  C CE  . LYS C  3 238 ? -4.367  4.374   21.318  1.00 126.38 ? 253 LYS X CE  1 
ATOM   3420  N NZ  . LYS C  3 238 ? -5.015  5.282   20.330  1.00 136.49 ? 253 LYS X NZ  1 
ATOM   3421  N N   . LYS C  3 239 ? -6.837  -1.413  24.719  1.00 93.10  ? 254 LYS X N   1 
ATOM   3422  C CA  . LYS C  3 239 ? -7.522  -2.137  25.782  1.00 94.89  ? 254 LYS X CA  1 
ATOM   3423  C C   . LYS C  3 239 ? -7.610  -3.581  25.349  1.00 95.98  ? 254 LYS X C   1 
ATOM   3424  O O   . LYS C  3 239 ? -8.087  -3.884  24.252  1.00 92.82  ? 254 LYS X O   1 
ATOM   3425  C CB  . LYS C  3 239 ? -8.917  -1.539  26.052  1.00 101.10 ? 254 LYS X CB  1 
ATOM   3426  C CG  . LYS C  3 239 ? -9.917  -2.492  26.705  1.00 111.51 ? 254 LYS X CG  1 
ATOM   3427  C CD  . LYS C  3 239 ? -10.572 -1.890  27.926  1.00 128.73 ? 254 LYS X CD  1 
ATOM   3428  C CE  . LYS C  3 239 ? -11.969 -2.422  28.147  1.00 141.16 ? 254 LYS X CE  1 
ATOM   3429  N NZ  . LYS C  3 239 ? -12.985 -1.646  27.386  1.00 150.25 ? 254 LYS X NZ  1 
ATOM   3430  N N   . LEU C  3 240 ? -7.130  -4.466  26.204  1.00 93.71  ? 255 LEU X N   1 
ATOM   3431  C CA  . LEU C  3 240 ? -7.160  -5.895  25.948  1.00 90.88  ? 255 LEU X CA  1 
ATOM   3432  C C   . LEU C  3 240 ? -7.967  -6.598  27.023  1.00 98.42  ? 255 LEU X C   1 
ATOM   3433  O O   . LEU C  3 240 ? -8.000  -6.113  28.155  1.00 102.04 ? 255 LEU X O   1 
ATOM   3434  C CB  . LEU C  3 240 ? -5.732  -6.453  25.952  1.00 88.37  ? 255 LEU X CB  1 
ATOM   3435  C CG  . LEU C  3 240 ? -4.944  -6.381  24.653  1.00 88.79  ? 255 LEU X CG  1 
ATOM   3436  C CD1 . LEU C  3 240 ? -3.515  -6.797  24.889  1.00 87.90  ? 255 LEU X CD1 1 
ATOM   3437  C CD2 . LEU C  3 240 ? -5.515  -7.313  23.618  1.00 88.19  ? 255 LEU X CD2 1 
ATOM   3438  N N   . PRO C  3 241 ? -8.574  -7.769  26.729  1.00 94.54  ? 256 PRO X N   1 
ATOM   3439  C CA  . PRO C  3 241 ? -9.293  -8.506  27.789  1.00 98.39  ? 256 PRO X CA  1 
ATOM   3440  C C   . PRO C  3 241 ? -8.346  -9.028  28.876  1.00 104.63 ? 256 PRO X C   1 
ATOM   3441  O O   . PRO C  3 241 ? -7.148  -9.190  28.631  1.00 101.14 ? 256 PRO X O   1 
ATOM   3442  C CB  . PRO C  3 241 ? -9.959  -9.667  27.036  1.00 97.54  ? 256 PRO X CB  1 
ATOM   3443  C CG  . PRO C  3 241 ? -9.856  -9.312  25.577  1.00 97.87  ? 256 PRO X CG  1 
ATOM   3444  C CD  . PRO C  3 241 ? -8.629  -8.492  25.444  1.00 91.64  ? 256 PRO X CD  1 
ATOM   3445  N N   . THR C  3 242 ? -8.878  -9.264  30.085  1.00 106.87 ? 257 THR X N   1 
ATOM   3446  C CA  . THR C  3 242 ? -8.094  -9.784  31.211  1.00 109.40 ? 257 THR X CA  1 
ATOM   3447  C C   . THR C  3 242 ? -7.694  -11.239 30.973  1.00 110.89 ? 257 THR X C   1 
ATOM   3448  O O   . THR C  3 242 ? -8.405  -11.950 30.256  1.00 108.27 ? 257 THR X O   1 
ATOM   3449  C CB  . THR C  3 242 ? -8.874  -9.669  32.518  1.00 125.93 ? 257 THR X CB  1 
ATOM   3450  O OG1 . THR C  3 242 ? -10.259 -9.423  32.250  1.00 127.42 ? 257 THR X OG1 1 
ATOM   3451  C CG2 . THR C  3 242 ? -8.297  -8.623  33.450  1.00 129.82 ? 257 THR X CG2 1 
ATOM   3452  N N   . LEU C  3 243 ? -6.579  -11.694 31.601  1.00 108.06 ? 258 LEU X N   1 
ATOM   3453  C CA  . LEU C  3 243 ? -6.095  -13.081 31.486  1.00 105.75 ? 258 LEU X CA  1 
ATOM   3454  C C   . LEU C  3 243 ? -7.103  -14.105 32.040  1.00 111.50 ? 258 LEU X C   1 
ATOM   3455  O O   . LEU C  3 243 ? -6.885  -15.315 31.916  1.00 109.83 ? 258 LEU X O   1 
ATOM   3456  C CB  . LEU C  3 243 ? -4.689  -13.268 32.100  1.00 106.60 ? 258 LEU X CB  1 
ATOM   3457  C CG  . LEU C  3 243 ? -3.535  -13.581 31.121  1.00 106.28 ? 258 LEU X CG  1 
ATOM   3458  C CD1 . LEU C  3 243 ? -2.185  -13.381 31.788  1.00 108.05 ? 258 LEU X CD1 1 
ATOM   3459  C CD2 . LEU C  3 243 ? -3.618  -15.006 30.590  1.00 105.33 ? 258 LEU X CD2 1 
ATOM   3460  N N   . GLU C  3 244 ? -8.221  -13.608 32.619  1.00 111.14 ? 259 GLU X N   1 
ATOM   3461  C CA  . GLU C  3 244 ? -9.340  -14.415 33.098  1.00 113.67 ? 259 GLU X CA  1 
ATOM   3462  C C   . GLU C  3 244 ? -10.167 -14.852 31.869  1.00 112.91 ? 259 GLU X C   1 
ATOM   3463  O O   . GLU C  3 244 ? -10.750 -15.933 31.879  1.00 112.95 ? 259 GLU X O   1 
ATOM   3464  C CB  . GLU C  3 244 ? -10.197 -13.642 34.130  1.00 121.19 ? 259 GLU X CB  1 
ATOM   3465  C CG  . GLU C  3 244 ? -10.883 -12.389 33.590  1.00 135.03 ? 259 GLU X CG  1 
ATOM   3466  C CD  . GLU C  3 244 ? -11.661 -11.503 34.548  1.00 165.77 ? 259 GLU X CD  1 
ATOM   3467  O OE1 . GLU C  3 244 ? -11.204 -11.297 35.697  1.00 167.14 ? 259 GLU X OE1 1 
ATOM   3468  O OE2 . GLU C  3 244 ? -12.701 -10.955 34.117  1.00 160.85 ? 259 GLU X OE2 1 
ATOM   3469  N N   . LYS C  3 245 ? -10.182 -14.010 30.808  1.00 105.66 ? 260 LYS X N   1 
ATOM   3470  C CA  . LYS C  3 245 ? -10.862 -14.247 29.531  1.00 102.02 ? 260 LYS X CA  1 
ATOM   3471  C C   . LYS C  3 245 ? -9.927  -14.897 28.500  1.00 100.80 ? 260 LYS X C   1 
ATOM   3472  O O   . LYS C  3 245 ? -10.395 -15.629 27.626  1.00 98.80  ? 260 LYS X O   1 
ATOM   3473  C CB  . LYS C  3 245 ? -11.407 -12.935 28.959  1.00 104.29 ? 260 LYS X CB  1 
ATOM   3474  C CG  . LYS C  3 245 ? -12.801 -12.597 29.445  1.00 122.35 ? 260 LYS X CG  1 
ATOM   3475  C CD  . LYS C  3 245 ? -13.199 -11.171 29.072  1.00 132.52 ? 260 LYS X CD  1 
ATOM   3476  C CE  . LYS C  3 245 ? -13.137 -10.226 30.251  1.00 146.58 ? 260 LYS X CE  1 
ATOM   3477  N NZ  . LYS C  3 245 ? -14.253 -10.453 31.214  1.00 158.25 ? 260 LYS X NZ  1 
ATOM   3478  N N   . LEU C  3 246 ? -8.618  -14.610 28.579  1.00 94.44  ? 261 LEU X N   1 
ATOM   3479  C CA  . LEU C  3 246 ? -7.651  -15.165 27.637  1.00 88.98  ? 261 LEU X CA  1 
ATOM   3480  C C   . LEU C  3 246 ? -6.868  -16.344 28.235  1.00 93.55  ? 261 LEU X C   1 
ATOM   3481  O O   . LEU C  3 246 ? -5.719  -16.571 27.874  1.00 91.22  ? 261 LEU X O   1 
ATOM   3482  C CB  . LEU C  3 246 ? -6.725  -14.057 27.104  1.00 86.50  ? 261 LEU X CB  1 
ATOM   3483  C CG  . LEU C  3 246 ? -7.392  -12.915 26.312  1.00 89.85  ? 261 LEU X CG  1 
ATOM   3484  C CD1 . LEU C  3 246 ? -6.535  -11.664 26.336  1.00 89.49  ? 261 LEU X CD1 1 
ATOM   3485  C CD2 . LEU C  3 246 ? -7.726  -13.331 24.875  1.00 87.38  ? 261 LEU X CD2 1 
ATOM   3486  N N   . VAL C  3 247 ? -7.522  -17.123 29.118  1.00 93.15  ? 262 VAL X N   1 
ATOM   3487  C CA  . VAL C  3 247 ? -6.989  -18.301 29.827  1.00 94.33  ? 262 VAL X CA  1 
ATOM   3488  C C   . VAL C  3 247 ? -6.059  -19.196 28.977  1.00 94.33  ? 262 VAL X C   1 
ATOM   3489  O O   . VAL C  3 247 ? -4.967  -19.553 29.433  1.00 94.66  ? 262 VAL X O   1 
ATOM   3490  C CB  . VAL C  3 247 ? -8.119  -19.140 30.473  1.00 101.48 ? 262 VAL X CB  1 
ATOM   3491  C CG1 . VAL C  3 247 ? -8.546  -18.535 31.803  1.00 106.69 ? 262 VAL X CG1 1 
ATOM   3492  C CG2 . VAL C  3 247 ? -9.318  -19.301 29.534  1.00 99.60  ? 262 VAL X CG2 1 
ATOM   3493  N N   . ALA C  3 248 ? -6.487  -19.528 27.747  1.00 86.76  ? 263 ALA X N   1 
ATOM   3494  C CA  . ALA C  3 248 ? -5.739  -20.378 26.827  1.00 82.69  ? 263 ALA X CA  1 
ATOM   3495  C C   . ALA C  3 248 ? -4.493  -19.713 26.234  1.00 83.80  ? 263 ALA X C   1 
ATOM   3496  O O   . ALA C  3 248 ? -3.573  -20.441 25.862  1.00 82.63  ? 263 ALA X O   1 
ATOM   3497  C CB  . ALA C  3 248 ? -6.651  -20.875 25.719  1.00 81.03  ? 263 ALA X CB  1 
ATOM   3498  N N   . LEU C  3 249 ? -4.461  -18.350 26.137  1.00 78.94  ? 264 LEU X N   1 
ATOM   3499  C CA  . LEU C  3 249 ? -3.348  -17.565 25.570  1.00 76.09  ? 264 LEU X CA  1 
ATOM   3500  C C   . LEU C  3 249 ? -2.006  -17.929 26.182  1.00 81.83  ? 264 LEU X C   1 
ATOM   3501  O O   . LEU C  3 249 ? -1.884  -17.986 27.407  1.00 85.00  ? 264 LEU X O   1 
ATOM   3502  C CB  . LEU C  3 249 ? -3.603  -16.044 25.651  1.00 76.50  ? 264 LEU X CB  1 
ATOM   3503  C CG  . LEU C  3 249 ? -2.858  -15.161 24.640  1.00 77.20  ? 264 LEU X CG  1 
ATOM   3504  C CD1 . LEU C  3 249 ? -3.795  -14.672 23.567  1.00 75.35  ? 264 LEU X CD1 1 
ATOM   3505  C CD2 . LEU C  3 249 ? -2.207  -13.975 25.325  1.00 79.31  ? 264 LEU X CD2 1 
ATOM   3506  N N   . MET C  3 250 ? -1.017  -18.208 25.318  1.00 76.77  ? 265 MET X N   1 
ATOM   3507  C CA  . MET C  3 250 ? 0.327   -18.634 25.711  1.00 78.48  ? 265 MET X CA  1 
ATOM   3508  C C   . MET C  3 250 ? 1.443   -17.875 25.005  1.00 76.29  ? 265 MET X C   1 
ATOM   3509  O O   . MET C  3 250 ? 2.596   -17.944 25.432  1.00 76.33  ? 265 MET X O   1 
ATOM   3510  C CB  . MET C  3 250 ? 0.498   -20.163 25.544  1.00 82.14  ? 265 MET X CB  1 
ATOM   3511  C CG  . MET C  3 250 ? -0.048  -20.731 24.228  1.00 84.60  ? 265 MET X CG  1 
ATOM   3512  S SD  . MET C  3 250 ? 1.114   -20.705 22.822  1.00 86.86  ? 265 MET X SD  1 
ATOM   3513  C CE  . MET C  3 250 ? 1.066   -22.493 22.327  1.00 82.74  ? 265 MET X CE  1 
ATOM   3514  N N   . GLU C  3 251 ? 1.098   -17.149 23.934  1.00 68.30  ? 266 GLU X N   1 
ATOM   3515  C CA  . GLU C  3 251 ? 2.029   -16.355 23.126  1.00 64.92  ? 266 GLU X CA  1 
ATOM   3516  C C   . GLU C  3 251 ? 1.258   -15.166 22.542  1.00 64.80  ? 266 GLU X C   1 
ATOM   3517  O O   . GLU C  3 251 ? 0.111   -15.329 22.120  1.00 63.03  ? 266 GLU X O   1 
ATOM   3518  C CB  . GLU C  3 251 ? 2.617   -17.242 22.019  1.00 63.60  ? 266 GLU X CB  1 
ATOM   3519  C CG  . GLU C  3 251 ? 3.729   -16.631 21.190  1.00 72.50  ? 266 GLU X CG  1 
ATOM   3520  C CD  . GLU C  3 251 ? 3.955   -17.375 19.886  1.00 91.72  ? 266 GLU X CD  1 
ATOM   3521  O OE1 . GLU C  3 251 ? 3.843   -16.737 18.812  1.00 77.16  ? 266 GLU X OE1 1 
ATOM   3522  O OE2 . GLU C  3 251 ? 4.190   -18.607 19.935  1.00 84.80  ? 266 GLU X OE2 1 
ATOM   3523  N N   . ALA C  3 252 ? 1.866   -13.965 22.564  1.00 60.71  ? 267 ALA X N   1 
ATOM   3524  C CA  . ALA C  3 252 ? 1.228   -12.742 22.059  1.00 59.10  ? 267 ALA X CA  1 
ATOM   3525  C C   . ALA C  3 252 ? 2.191   -11.677 21.509  1.00 58.92  ? 267 ALA X C   1 
ATOM   3526  O O   . ALA C  3 252 ? 2.905   -11.053 22.286  1.00 59.27  ? 267 ALA X O   1 
ATOM   3527  C CB  . ALA C  3 252 ? 0.337   -12.133 23.136  1.00 63.07  ? 267 ALA X CB  1 
ATOM   3528  N N   . SER C  3 253 ? 2.182   -11.449 20.180  1.00 52.72  ? 268 SER X N   1 
ATOM   3529  C CA  . SER C  3 253 ? 2.992   -10.394 19.559  1.00 52.86  ? 268 SER X CA  1 
ATOM   3530  C C   . SER C  3 253 ? 2.114   -9.160  19.222  1.00 57.26  ? 268 SER X C   1 
ATOM   3531  O O   . SER C  3 253 ? 1.423   -9.105  18.199  1.00 54.45  ? 268 SER X O   1 
ATOM   3532  C CB  . SER C  3 253 ? 3.819   -10.908 18.381  1.00 55.89  ? 268 SER X CB  1 
ATOM   3533  O OG  . SER C  3 253 ? 3.040   -11.400 17.305  1.00 70.50  ? 268 SER X OG  1 
ATOM   3534  N N   . LEU C  3 254 ? 2.137   -8.188  20.149  1.00 56.67  ? 269 LEU X N   1 
ATOM   3535  C CA  . LEU C  3 254 ? 1.333   -6.975  20.164  1.00 57.29  ? 269 LEU X CA  1 
ATOM   3536  C C   . LEU C  3 254 ? 2.053   -5.693  19.683  1.00 61.69  ? 269 LEU X C   1 
ATOM   3537  O O   . LEU C  3 254 ? 3.053   -5.785  18.954  1.00 59.45  ? 269 LEU X O   1 
ATOM   3538  C CB  . LEU C  3 254 ? 0.774   -6.802  21.583  1.00 60.36  ? 269 LEU X CB  1 
ATOM   3539  C CG  . LEU C  3 254 ? 0.118   -8.040  22.168  1.00 64.46  ? 269 LEU X CG  1 
ATOM   3540  C CD1 . LEU C  3 254 ? -0.080  -7.889  23.642  1.00 68.75  ? 269 LEU X CD1 1 
ATOM   3541  C CD2 . LEU C  3 254 ? -1.195  -8.364  21.465  1.00 64.30  ? 269 LEU X CD2 1 
ATOM   3542  N N   . THR C  3 255 ? 1.498   -4.501  20.059  1.00 60.46  ? 270 THR X N   1 
ATOM   3543  C CA  . THR C  3 255 ? 1.984   -3.166  19.678  1.00 61.57  ? 270 THR X CA  1 
ATOM   3544  C C   . THR C  3 255 ? 2.584   -2.401  20.882  1.00 70.70  ? 270 THR X C   1 
ATOM   3545  O O   . THR C  3 255 ? 3.729   -1.951  20.819  1.00 70.38  ? 270 THR X O   1 
ATOM   3546  C CB  . THR C  3 255 ? 0.835   -2.383  18.964  1.00 63.14  ? 270 THR X CB  1 
ATOM   3547  O OG1 . THR C  3 255 ? 0.509   -3.006  17.722  1.00 56.27  ? 270 THR X OG1 1 
ATOM   3548  C CG2 . THR C  3 255 ? 1.151   -0.905  18.732  1.00 61.22  ? 270 THR X CG2 1 
ATOM   3549  N N   . TYR C  3 256 ? 1.788   -2.243  21.957  1.00 71.43  ? 271 TYR X N   1 
ATOM   3550  C CA  . TYR C  3 256 ? 2.121   -1.507  23.175  1.00 75.30  ? 271 TYR X CA  1 
ATOM   3551  C C   . TYR C  3 256 ? 2.813   -2.359  24.241  1.00 82.10  ? 271 TYR X C   1 
ATOM   3552  O O   . TYR C  3 256 ? 2.234   -3.347  24.709  1.00 81.12  ? 271 TYR X O   1 
ATOM   3553  C CB  . TYR C  3 256 ? 0.866   -0.834  23.735  1.00 79.30  ? 271 TYR X CB  1 
ATOM   3554  C CG  . TYR C  3 256 ? 0.181   0.035   22.709  1.00 81.15  ? 271 TYR X CG  1 
ATOM   3555  C CD1 . TYR C  3 256 ? 0.696   1.281   22.368  1.00 84.90  ? 271 TYR X CD1 1 
ATOM   3556  C CD2 . TYR C  3 256 ? -0.970  -0.398  22.054  1.00 80.37  ? 271 TYR X CD2 1 
ATOM   3557  C CE1 . TYR C  3 256 ? 0.083   2.081   21.409  1.00 85.63  ? 271 TYR X CE1 1 
ATOM   3558  C CE2 . TYR C  3 256 ? -1.597  0.398   21.094  1.00 81.41  ? 271 TYR X CE2 1 
ATOM   3559  C CZ  . TYR C  3 256 ? -1.063  1.638   20.775  1.00 91.56  ? 271 TYR X CZ  1 
ATOM   3560  O OH  . TYR C  3 256 ? -1.645  2.456   19.843  1.00 93.71  ? 271 TYR X OH  1 
ATOM   3561  N N   . PRO C  3 257 ? 4.044   -1.971  24.664  1.00 82.21  ? 272 PRO X N   1 
ATOM   3562  C CA  . PRO C  3 257 ? 4.768   -2.756  25.686  1.00 84.07  ? 272 PRO X CA  1 
ATOM   3563  C C   . PRO C  3 257 ? 4.083   -2.833  27.048  1.00 91.59  ? 272 PRO X C   1 
ATOM   3564  O O   . PRO C  3 257 ? 4.398   -3.730  27.833  1.00 92.39  ? 272 PRO X O   1 
ATOM   3565  C CB  . PRO C  3 257 ? 6.123   -2.048  25.775  1.00 87.54  ? 272 PRO X CB  1 
ATOM   3566  C CG  . PRO C  3 257 ? 6.261   -1.338  24.466  1.00 89.63  ? 272 PRO X CG  1 
ATOM   3567  C CD  . PRO C  3 257 ? 4.873   -0.846  24.199  1.00 84.97  ? 272 PRO X CD  1 
ATOM   3568  N N   . SER C  3 258 ? 3.141   -1.903  27.314  1.00 89.99  ? 273 SER X N   1 
ATOM   3569  C CA  . SER C  3 258 ? 2.322   -1.841  28.525  1.00 93.80  ? 273 SER X CA  1 
ATOM   3570  C C   . SER C  3 258 ? 1.464   -3.118  28.649  1.00 96.60  ? 273 SER X C   1 
ATOM   3571  O O   . SER C  3 258 ? 1.269   -3.635  29.759  1.00 99.34  ? 273 SER X O   1 
ATOM   3572  C CB  . SER C  3 258 ? 1.437   -0.594  28.508  1.00 99.37  ? 273 SER X CB  1 
ATOM   3573  O OG  . SER C  3 258 ? 1.222   -0.074  27.203  1.00 103.93 ? 273 SER X OG  1 
ATOM   3574  N N   . HIS C  3 259 ? 0.994   -3.637  27.491  1.00 88.31  ? 274 HIS X N   1 
ATOM   3575  C CA  . HIS C  3 259 ? 0.189   -4.850  27.387  1.00 86.35  ? 274 HIS X CA  1 
ATOM   3576  C C   . HIS C  3 259 ? 0.987   -6.078  27.828  1.00 91.02  ? 274 HIS X C   1 
ATOM   3577  O O   . HIS C  3 259 ? 0.431   -6.962  28.480  1.00 91.24  ? 274 HIS X O   1 
ATOM   3578  C CB  . HIS C  3 259 ? -0.337  -5.021  25.953  1.00 82.38  ? 274 HIS X CB  1 
ATOM   3579  C CG  . HIS C  3 259 ? -1.353  -4.001  25.523  1.00 86.24  ? 274 HIS X CG  1 
ATOM   3580  N ND1 . HIS C  3 259 ? -1.777  -3.923  24.207  1.00 84.63  ? 274 HIS X ND1 1 
ATOM   3581  C CD2 . HIS C  3 259 ? -2.018  -3.069  26.245  1.00 91.48  ? 274 HIS X CD2 1 
ATOM   3582  C CE1 . HIS C  3 259 ? -2.675  -2.955  24.172  1.00 85.94  ? 274 HIS X CE1 1 
ATOM   3583  N NE2 . HIS C  3 259 ? -2.857  -2.417  25.375  1.00 90.55  ? 274 HIS X NE2 1 
ATOM   3584  N N   . CYS C  3 260 ? 2.297   -6.104  27.509  1.00 87.61  ? 275 CYS X N   1 
ATOM   3585  C CA  . CYS C  3 260 ? 3.213   -7.184  27.877  1.00 87.72  ? 275 CYS X CA  1 
ATOM   3586  C C   . CYS C  3 260 ? 3.458   -7.253  29.371  1.00 99.89  ? 275 CYS X C   1 
ATOM   3587  O O   . CYS C  3 260 ? 3.484   -8.355  29.924  1.00 100.58 ? 275 CYS X O   1 
ATOM   3588  C CB  . CYS C  3 260 ? 4.519   -7.088  27.100  1.00 85.08  ? 275 CYS X CB  1 
ATOM   3589  S SG  . CYS C  3 260 ? 4.358   -7.519  25.354  1.00 82.87  ? 275 CYS X SG  1 
ATOM   3590  N N   . CYS C  3 261 ? 3.627   -6.081  30.022  1.00 102.41 ? 276 CYS X N   1 
ATOM   3591  C CA  . CYS C  3 261 ? 3.849   -5.960  31.463  1.00 109.14 ? 276 CYS X CA  1 
ATOM   3592  C C   . CYS C  3 261 ? 2.687   -6.570  32.232  1.00 113.50 ? 276 CYS X C   1 
ATOM   3593  O O   . CYS C  3 261 ? 2.905   -7.254  33.232  1.00 116.18 ? 276 CYS X O   1 
ATOM   3594  C CB  . CYS C  3 261 ? 4.083   -4.506  31.857  1.00 114.50 ? 276 CYS X CB  1 
ATOM   3595  S SG  . CYS C  3 261 ? 5.524   -3.746  31.061  1.00 118.09 ? 276 CYS X SG  1 
ATOM   3596  N N   . ALA C  3 262 ? 1.462   -6.380  31.719  1.00 107.53 ? 277 ALA X N   1 
ATOM   3597  C CA  . ALA C  3 262 ? 0.244   -6.946  32.280  1.00 108.92 ? 277 ALA X CA  1 
ATOM   3598  C C   . ALA C  3 262 ? 0.234   -8.487  32.177  1.00 110.67 ? 277 ALA X C   1 
ATOM   3599  O O   . ALA C  3 262 ? -0.348  -9.148  33.035  1.00 112.42 ? 277 ALA X O   1 
ATOM   3600  C CB  . ALA C  3 262 ? -0.960  -6.361  31.569  1.00 108.28 ? 277 ALA X CB  1 
ATOM   3601  N N   . PHE C  3 263 ? 0.893   -9.053  31.147  1.00 103.84 ? 278 PHE X N   1 
ATOM   3602  C CA  . PHE C  3 263 ? 0.972   -10.505 30.953  1.00 102.47 ? 278 PHE X CA  1 
ATOM   3603  C C   . PHE C  3 263 ? 2.063   -11.177 31.806  1.00 111.86 ? 278 PHE X C   1 
ATOM   3604  O O   . PHE C  3 263 ? 1.971   -12.377 32.085  1.00 112.28 ? 278 PHE X O   1 
ATOM   3605  C CB  . PHE C  3 263 ? 1.111   -10.877 29.460  1.00 98.37  ? 278 PHE X CB  1 
ATOM   3606  C CG  . PHE C  3 263 ? -0.130  -10.651 28.619  1.00 97.07  ? 278 PHE X CG  1 
ATOM   3607  C CD1 . PHE C  3 263 ? -1.381  -11.073 29.062  1.00 101.58 ? 278 PHE X CD1 1 
ATOM   3608  C CD2 . PHE C  3 263 ? -0.042  -10.062 27.367  1.00 95.15  ? 278 PHE X CD2 1 
ATOM   3609  C CE1 . PHE C  3 263 ? -2.524  -10.867 28.284  1.00 100.54 ? 278 PHE X CE1 1 
ATOM   3610  C CE2 . PHE C  3 263 ? -1.184  -9.864  26.587  1.00 96.23  ? 278 PHE X CE2 1 
ATOM   3611  C CZ  . PHE C  3 263 ? -2.418  -10.264 27.053  1.00 96.04  ? 278 PHE X CZ  1 
ATOM   3612  N N   . ALA C  3 264 ? 3.074   -10.405 32.239  1.00 112.37 ? 279 ALA X N   1 
ATOM   3613  C CA  . ALA C  3 264 ? 4.161   -10.902 33.082  1.00 116.14 ? 279 ALA X CA  1 
ATOM   3614  C C   . ALA C  3 264 ? 3.702   -11.032 34.541  1.00 129.03 ? 279 ALA X C   1 
ATOM   3615  O O   . ALA C  3 264 ? 2.584   -10.624 34.874  1.00 130.35 ? 279 ALA X O   1 
ATOM   3616  C CB  . ALA C  3 264 ? 5.354   -9.963  32.988  1.00 117.41 ? 279 ALA X CB  1 
ATOM   3617  N N   . ASN C  3 265 ? 4.560   -11.629 35.404  1.00 131.38 ? 280 ASN X N   1 
ATOM   3618  C CA  . ASN C  3 265 ? 4.366   -11.827 36.850  1.00 138.28 ? 280 ASN X CA  1 
ATOM   3619  C C   . ASN C  3 265 ? 3.138   -12.692 37.233  1.00 145.59 ? 280 ASN X C   1 
ATOM   3620  O O   . ASN C  3 265 ? 2.989   -13.036 38.411  1.00 150.27 ? 280 ASN X O   1 
ATOM   3621  C CB  . ASN C  3 265 ? 4.339   -10.480 37.594  1.00 143.45 ? 280 ASN X CB  1 
ATOM   3622  N N   . TRP C  3 266 ? 2.283   -13.061 36.248  1.00 139.46 ? 281 TRP X N   1 
ATOM   3623  C CA  . TRP C  3 266 ? 1.088   -13.889 36.457  1.00 140.46 ? 281 TRP X CA  1 
ATOM   3624  C C   . TRP C  3 266 ? 0.998   -15.035 35.437  1.00 140.69 ? 281 TRP X C   1 
ATOM   3625  O O   . TRP C  3 266 ? 1.239   -14.814 34.243  1.00 135.71 ? 281 TRP X O   1 
ATOM   3626  C CB  . TRP C  3 266 ? -0.185  -13.030 36.421  1.00 139.76 ? 281 TRP X CB  1 
ATOM   3627  N N   . ARG C  3 267 ? 0.647   -16.256 35.921  1.00 138.99 ? 282 ARG X N   1 
ATOM   3628  C CA  . ARG C  3 267 ? 0.500   -17.475 35.113  1.00 164.05 ? 282 ARG X CA  1 
ATOM   3629  C C   . ARG C  3 267 ? -0.863  -18.154 35.315  1.00 192.89 ? 282 ARG X C   1 
ATOM   3630  O O   . ARG C  3 267 ? -1.314  -18.350 36.445  1.00 155.96 ? 282 ARG X O   1 
ATOM   3631  C CB  . ARG C  3 267 ? 1.648   -18.463 35.387  1.00 165.18 ? 282 ARG X CB  1 
ATOM   3632  N N   . ILE C  3 276 ? 3.506   -32.053 34.650  1.00 197.88 ? 291 ILE X N   1 
ATOM   3633  C CA  . ILE C  3 276 ? 2.232   -31.508 34.191  1.00 194.82 ? 291 ILE X CA  1 
ATOM   3634  C C   . ILE C  3 276 ? 1.554   -32.431 33.176  1.00 196.08 ? 291 ILE X C   1 
ATOM   3635  O O   . ILE C  3 276 ? 0.389   -32.790 33.362  1.00 196.34 ? 291 ILE X O   1 
ATOM   3636  C CB  . ILE C  3 276 ? 2.402   -30.069 33.648  1.00 194.12 ? 291 ILE X CB  1 
ATOM   3637  N N   . CYS C  3 277 ? 2.283   -32.814 32.109  1.00 189.90 ? 292 CYS X N   1 
ATOM   3638  C CA  . CYS C  3 277 ? 1.784   -33.690 31.048  1.00 187.13 ? 292 CYS X CA  1 
ATOM   3639  C C   . CYS C  3 277 ? 2.730   -34.858 30.778  1.00 190.81 ? 292 CYS X C   1 
ATOM   3640  O O   . CYS C  3 277 ? 3.946   -34.665 30.714  1.00 190.60 ? 292 CYS X O   1 
ATOM   3641  C CB  . CYS C  3 277 ? 1.484   -32.898 29.776  1.00 182.01 ? 292 CYS X CB  1 
ATOM   3642  S SG  . CYS C  3 277 ? 2.883   -31.930 29.148  1.00 183.21 ? 292 CYS X SG  1 
ATOM   3643  N N   . ASN C  3 278 ? 2.161   -36.071 30.629  1.00 187.43 ? 293 ASN X N   1 
ATOM   3644  C CA  . ASN C  3 278 ? 2.892   -37.313 30.368  1.00 188.74 ? 293 ASN X CA  1 
ATOM   3645  C C   . ASN C  3 278 ? 3.664   -37.258 29.053  1.00 187.53 ? 293 ASN X C   1 
ATOM   3646  O O   . ASN C  3 278 ? 3.228   -36.602 28.105  1.00 181.92 ? 293 ASN X O   1 
ATOM   3647  C CB  . ASN C  3 278 ? 1.946   -38.509 30.381  1.00 190.93 ? 293 ASN X CB  1 
ATOM   3648  N N   . LYS C  3 279 ? 4.832   -37.918 29.022  1.00 186.14 ? 294 LYS X N   1 
ATOM   3649  C CA  . LYS C  3 279 ? 5.722   -37.988 27.862  1.00 209.64 ? 294 LYS X CA  1 
ATOM   3650  C C   . LYS C  3 279 ? 6.519   -39.291 27.879  1.00 239.44 ? 294 LYS X C   1 
ATOM   3651  O O   . LYS C  3 279 ? 6.877   -39.789 28.946  1.00 207.44 ? 294 LYS X O   1 
ATOM   3652  C CB  . LYS C  3 279 ? 6.669   -36.797 27.849  1.00 208.68 ? 294 LYS X CB  1 
ATOM   3653  N N   . ASP C  3 319 ? 12.975  -28.857 16.893  1.00 134.88 ? 334 ASP X N   1 
ATOM   3654  C CA  . ASP C  3 319 ? 12.265  -28.068 17.897  1.00 134.09 ? 334 ASP X CA  1 
ATOM   3655  C C   . ASP C  3 319 ? 10.850  -28.601 18.097  1.00 136.06 ? 334 ASP X C   1 
ATOM   3656  O O   . ASP C  3 319 ? 10.147  -28.839 17.107  1.00 132.92 ? 334 ASP X O   1 
ATOM   3657  C CB  . ASP C  3 319 ? 12.223  -26.601 17.483  1.00 132.25 ? 334 ASP X CB  1 
HETATM 3658  N N   . TYS C  3 320 ? 10.442  -28.799 19.380  1.00 134.17 ? 335 TYS X N   1 
HETATM 3659  C CA  . TYS C  3 320 ? 9.113   -29.303 19.762  1.00 132.81 ? 335 TYS X CA  1 
HETATM 3660  C CB  . TYS C  3 320 ? 8.834   -30.812 19.569  1.00 132.18 ? 335 TYS X CB  1 
HETATM 3661  C CG  . TYS C  3 320 ? 7.916   -31.128 18.376  1.00 126.99 ? 335 TYS X CG  1 
HETATM 3662  C CD1 . TYS C  3 320 ? 7.150   -30.136 17.619  1.00 121.76 ? 335 TYS X CD1 1 
HETATM 3663  C CD2 . TYS C  3 320 ? 7.848   -32.504 18.009  1.00 127.10 ? 335 TYS X CD2 1 
HETATM 3664  C CE1 . TYS C  3 320 ? 6.349   -30.533 16.525  1.00 118.24 ? 335 TYS X CE1 1 
HETATM 3665  C CE2 . TYS C  3 320 ? 7.032   -32.909 16.951  1.00 123.40 ? 335 TYS X CE2 1 
HETATM 3666  C CZ  . TYS C  3 320 ? 6.294   -31.918 16.174  1.00 118.22 ? 335 TYS X CZ  1 
HETATM 3667  O OH  . TYS C  3 320 ? 5.492   -32.195 15.095  1.00 113.04 ? 335 TYS X OH  1 
HETATM 3668  S S   . TYS C  3 320 ? 5.916   -33.304 14.261  1.00 110.87 ? 335 TYS X S   1 
HETATM 3669  O O1  . TYS C  3 320 ? 4.882   -34.270 14.537  1.00 112.45 ? 335 TYS X O1  1 
HETATM 3670  O O2  . TYS C  3 320 ? 7.371   -33.473 14.169  1.00 111.54 ? 335 TYS X O2  1 
HETATM 3671  O O3  . TYS C  3 320 ? 5.607   -33.020 12.931  1.00 107.91 ? 335 TYS X O3  1 
HETATM 3672  C C   . TYS C  3 320 ? 8.639   -28.923 21.166  1.00 139.04 ? 335 TYS X C   1 
HETATM 3673  O O   . TYS C  3 320 ? 9.354   -29.155 22.145  1.00 141.81 ? 335 TYS X O   1 
ATOM   3674  N N   . ASP C  3 321 ? 7.403   -28.376 21.251  1.00 134.13 ? 336 ASP X N   1 
ATOM   3675  C CA  . ASP C  3 321 ? 6.744   -27.980 22.496  1.00 135.75 ? 336 ASP X CA  1 
ATOM   3676  C C   . ASP C  3 321 ? 6.131   -29.236 23.123  1.00 142.14 ? 336 ASP X C   1 
ATOM   3677  O O   . ASP C  3 321 ? 4.936   -29.496 22.948  1.00 140.49 ? 336 ASP X O   1 
ATOM   3678  C CB  . ASP C  3 321 ? 5.677   -26.903 22.222  1.00 134.76 ? 336 ASP X CB  1 
ATOM   3679  N N   . LEU C  3 322 ? 6.985   -30.031 23.821  1.00 142.49 ? 337 LEU X N   1 
ATOM   3680  C CA  . LEU C  3 322 ? 6.683   -31.322 24.457  1.00 145.41 ? 337 LEU X CA  1 
ATOM   3681  C C   . LEU C  3 322 ? 5.587   -31.266 25.541  1.00 151.20 ? 337 LEU X C   1 
ATOM   3682  O O   . LEU C  3 322 ? 5.882   -31.356 26.738  1.00 154.61 ? 337 LEU X O   1 
ATOM   3683  C CB  . LEU C  3 322 ? 7.967   -31.972 25.004  1.00 149.35 ? 337 LEU X CB  1 
ATOM   3684  N N   . CYS C  3 323 ? 4.313   -31.143 25.087  1.00 145.20 ? 338 CYS X N   1 
ATOM   3685  C CA  . CYS C  3 323 ? 3.066   -31.117 25.868  1.00 167.86 ? 338 CYS X CA  1 
ATOM   3686  C C   . CYS C  3 323 ? 1.848   -31.136 24.941  1.00 170.57 ? 338 CYS X C   1 
ATOM   3687  O O   . CYS C  3 323 ? 1.800   -31.912 23.986  1.00 119.98 ? 338 CYS X O   1 
ATOM   3688  C CB  . CYS C  3 323 ? 3.015   -29.934 26.835  1.00 169.26 ? 338 CYS X CB  1 
ATOM   3689  S SG  . CYS C  3 323 ? 2.057   -30.252 28.343  1.00 177.73 ? 338 CYS X SG  1 
ATOM   3690  N N   . VAL C  3 327 ? 6.242   -21.770 29.295  1.00 110.40 ? 342 VAL X N   1 
ATOM   3691  C CA  . VAL C  3 327 ? 5.328   -22.058 30.407  1.00 113.76 ? 342 VAL X CA  1 
ATOM   3692  C C   . VAL C  3 327 ? 4.364   -20.861 30.652  1.00 116.63 ? 342 VAL X C   1 
ATOM   3693  O O   . VAL C  3 327 ? 3.182   -21.076 30.951  1.00 116.69 ? 342 VAL X O   1 
ATOM   3694  C CB  . VAL C  3 327 ? 6.093   -22.534 31.682  1.00 123.14 ? 342 VAL X CB  1 
ATOM   3695  C CG1 . VAL C  3 327 ? 5.153   -22.759 32.868  1.00 126.84 ? 342 VAL X CG1 1 
ATOM   3696  C CG2 . VAL C  3 327 ? 6.891   -23.807 31.395  1.00 123.60 ? 342 VAL X CG2 1 
ATOM   3697  N N   . ASP C  3 328 ? 4.864   -19.616 30.487  1.00 111.68 ? 343 ASP X N   1 
ATOM   3698  C CA  . ASP C  3 328 ? 4.072   -18.387 30.629  1.00 110.66 ? 343 ASP X CA  1 
ATOM   3699  C C   . ASP C  3 328 ? 3.831   -17.718 29.246  1.00 107.70 ? 343 ASP X C   1 
ATOM   3700  O O   . ASP C  3 328 ? 4.202   -18.296 28.218  1.00 104.12 ? 343 ASP X O   1 
ATOM   3701  C CB  . ASP C  3 328 ? 4.723   -17.422 31.653  1.00 116.12 ? 343 ASP X CB  1 
ATOM   3702  C CG  . ASP C  3 328 ? 3.750   -16.493 32.368  1.00 125.25 ? 343 ASP X CG  1 
ATOM   3703  O OD1 . ASP C  3 328 ? 2.612   -16.921 32.642  1.00 125.74 ? 343 ASP X OD1 1 
ATOM   3704  O OD2 . ASP C  3 328 ? 4.135   -15.340 32.657  1.00 131.16 ? 343 ASP X OD2 1 
ATOM   3705  N N   . VAL C  3 329 ? 3.182   -16.529 29.223  1.00 102.42 ? 344 VAL X N   1 
ATOM   3706  C CA  . VAL C  3 329 ? 2.863   -15.777 28.002  1.00 97.38  ? 344 VAL X CA  1 
ATOM   3707  C C   . VAL C  3 329 ? 4.144   -15.235 27.372  1.00 98.41  ? 344 VAL X C   1 
ATOM   3708  O O   . VAL C  3 329 ? 4.863   -14.474 28.017  1.00 100.44 ? 344 VAL X O   1 
ATOM   3709  C CB  . VAL C  3 329 ? 1.819   -14.644 28.229  1.00 101.81 ? 344 VAL X CB  1 
ATOM   3710  C CG1 . VAL C  3 329 ? 1.321   -14.083 26.900  1.00 97.69  ? 344 VAL X CG1 1 
ATOM   3711  C CG2 . VAL C  3 329 ? 0.645   -15.114 29.081  1.00 104.03 ? 344 VAL X CG2 1 
ATOM   3712  N N   . THR C  3 330 ? 4.424   -15.637 26.120  1.00 90.84  ? 345 THR X N   1 
ATOM   3713  C CA  . THR C  3 330 ? 5.589   -15.204 25.333  1.00 88.70  ? 345 THR X CA  1 
ATOM   3714  C C   . THR C  3 330 ? 5.182   -13.899 24.650  1.00 90.20  ? 345 THR X C   1 
ATOM   3715  O O   . THR C  3 330 ? 4.673   -13.911 23.524  1.00 86.97  ? 345 THR X O   1 
ATOM   3716  C CB  . THR C  3 330 ? 6.000   -16.306 24.341  1.00 93.99  ? 345 THR X CB  1 
ATOM   3717  O OG1 . THR C  3 330 ? 6.034   -17.566 25.017  1.00 97.75  ? 345 THR X OG1 1 
ATOM   3718  C CG2 . THR C  3 330 ? 7.336   -16.028 23.675  1.00 90.59  ? 345 THR X CG2 1 
ATOM   3719  N N   . CYS C  3 331 ? 5.381   -12.776 25.354  1.00 88.46  ? 346 CYS X N   1 
ATOM   3720  C CA  . CYS C  3 331 ? 4.931   -11.470 24.899  1.00 87.09  ? 346 CYS X CA  1 
ATOM   3721  C C   . CYS C  3 331 ? 6.021   -10.546 24.361  1.00 87.47  ? 346 CYS X C   1 
ATOM   3722  O O   . CYS C  3 331 ? 7.117   -10.486 24.907  1.00 88.60  ? 346 CYS X O   1 
ATOM   3723  C CB  . CYS C  3 331 ? 4.134   -10.790 26.002  1.00 91.39  ? 346 CYS X CB  1 
ATOM   3724  S SG  . CYS C  3 331 ? 2.827   -9.705  25.386  1.00 94.59  ? 346 CYS X SG  1 
ATOM   3725  N N   . SER C  3 332 ? 5.677   -9.798  23.295  1.00 80.79  ? 347 SER X N   1 
ATOM   3726  C CA  . SER C  3 332 ? 6.520   -8.808  22.620  1.00 79.94  ? 347 SER X CA  1 
ATOM   3727  C C   . SER C  3 332 ? 5.644   -7.672  22.044  1.00 84.80  ? 347 SER X C   1 
ATOM   3728  O O   . SER C  3 332 ? 4.547   -7.968  21.575  1.00 81.10  ? 347 SER X O   1 
ATOM   3729  C CB  . SER C  3 332 ? 7.339   -9.457  21.512  1.00 79.76  ? 347 SER X CB  1 
ATOM   3730  O OG  . SER C  3 332 ? 6.633   -9.459  20.284  1.00 84.33  ? 347 SER X OG  1 
ATOM   3731  N N   . PRO C  3 333 ? 6.057   -6.373  22.069  1.00 86.65  ? 348 PRO X N   1 
ATOM   3732  C CA  . PRO C  3 333 ? 7.321   -5.793  22.569  1.00 89.91  ? 348 PRO X CA  1 
ATOM   3733  C C   . PRO C  3 333 ? 7.486   -5.857  24.086  1.00 101.37 ? 348 PRO X C   1 
ATOM   3734  O O   . PRO C  3 333 ? 6.594   -5.446  24.822  1.00 102.39 ? 348 PRO X O   1 
ATOM   3735  C CB  . PRO C  3 333 ? 7.256   -4.330  22.082  1.00 92.03  ? 348 PRO X CB  1 
ATOM   3736  C CG  . PRO C  3 333 ? 6.173   -4.283  21.053  1.00 93.43  ? 348 PRO X CG  1 
ATOM   3737  C CD  . PRO C  3 333 ? 5.196   -5.318  21.504  1.00 88.40  ? 348 PRO X CD  1 
ATOM   3738  N N   . LYS C  3 334 ? 8.665   -6.307  24.543  1.00 103.56 ? 349 LYS X N   1 
ATOM   3739  C CA  . LYS C  3 334 ? 9.013   -6.441  25.963  1.00 109.81 ? 349 LYS X CA  1 
ATOM   3740  C C   . LYS C  3 334 ? 10.209  -5.545  26.424  1.00 122.16 ? 349 LYS X C   1 
ATOM   3741  O O   . LYS C  3 334 ? 11.044  -6.035  27.192  1.00 124.54 ? 349 LYS X O   1 
ATOM   3742  C CB  . LYS C  3 334 ? 9.284   -7.929  26.273  1.00 112.63 ? 349 LYS X CB  1 
ATOM   3743  C CG  . LYS C  3 334 ? 10.248  -8.611  25.292  1.00 129.72 ? 349 LYS X CG  1 
ATOM   3744  C CD  . LYS C  3 334 ? 10.365  -10.093 25.571  1.00 144.31 ? 349 LYS X CD  1 
ATOM   3745  C CE  . LYS C  3 334 ? 11.349  -10.767 24.653  1.00 159.46 ? 349 LYS X CE  1 
ATOM   3746  N NZ  . LYS C  3 334 ? 11.564  -12.187 25.036  1.00 171.95 ? 349 LYS X NZ  1 
ATOM   3747  N N   . PRO C  3 335 ? 10.321  -4.242  26.032  1.00 123.24 ? 350 PRO X N   1 
ATOM   3748  C CA  . PRO C  3 335 ? 11.510  -3.463  26.426  1.00 127.95 ? 350 PRO X CA  1 
ATOM   3749  C C   . PRO C  3 335 ? 11.519  -2.903  27.839  1.00 139.91 ? 350 PRO X C   1 
ATOM   3750  O O   . PRO C  3 335 ? 10.483  -2.508  28.381  1.00 140.65 ? 350 PRO X O   1 
ATOM   3751  C CB  . PRO C  3 335 ? 11.565  -2.335  25.383  1.00 128.33 ? 350 PRO X CB  1 
ATOM   3752  C CG  . PRO C  3 335 ? 10.510  -2.691  24.342  1.00 127.77 ? 350 PRO X CG  1 
ATOM   3753  C CD  . PRO C  3 335 ? 9.489   -3.447  25.113  1.00 123.04 ? 350 PRO X CD  1 
ATOM   3754  N N   . ASP C  3 336 ? 12.736  -2.839  28.403  1.00 142.25 ? 351 ASP X N   1 
ATOM   3755  C CA  . ASP C  3 336 ? 13.050  -2.351  29.748  1.00 148.76 ? 351 ASP X CA  1 
ATOM   3756  C C   . ASP C  3 336 ? 13.603  -0.918  29.701  1.00 157.68 ? 351 ASP X C   1 
ATOM   3757  O O   . ASP C  3 336 ? 13.667  -0.257  30.742  1.00 162.50 ? 351 ASP X O   1 
ATOM   3758  C CB  . ASP C  3 336 ? 14.090  -3.280  30.426  1.00 153.08 ? 351 ASP X CB  1 
ATOM   3759  C CG  . ASP C  3 336 ? 13.760  -4.766  30.439  1.00 159.14 ? 351 ASP X CG  1 
ATOM   3760  O OD1 . ASP C  3 336 ? 13.574  -5.345  29.343  1.00 154.97 ? 351 ASP X OD1 1 
ATOM   3761  O OD2 . ASP C  3 336 ? 13.772  -5.366  31.535  1.00 166.85 ? 351 ASP X OD2 1 
ATOM   3762  N N   . ALA C  3 337 ? 14.012  -0.449  28.497  1.00 152.79 ? 352 ALA X N   1 
ATOM   3763  C CA  . ALA C  3 337 ? 14.615  0.872   28.251  1.00 155.43 ? 352 ALA X CA  1 
ATOM   3764  C C   . ALA C  3 337 ? 13.742  2.081   28.643  1.00 161.90 ? 352 ALA X C   1 
ATOM   3765  O O   . ALA C  3 337 ? 14.280  3.146   28.960  1.00 165.00 ? 352 ALA X O   1 
ATOM   3766  C CB  . ALA C  3 337 ? 15.042  0.983   26.795  1.00 152.45 ? 352 ALA X CB  1 
ATOM   3767  N N   . PHE C  3 338 ? 12.408  1.907   28.624  1.00 156.94 ? 353 PHE X N   1 
ATOM   3768  C CA  . PHE C  3 338 ? 11.427  2.950   28.940  1.00 158.81 ? 353 PHE X CA  1 
ATOM   3769  C C   . PHE C  3 338 ? 10.245  2.432   29.784  1.00 163.18 ? 353 PHE X C   1 
ATOM   3770  O O   . PHE C  3 338 ? 9.569   3.239   30.428  1.00 166.09 ? 353 PHE X O   1 
ATOM   3771  C CB  . PHE C  3 338 ? 10.927  3.626   27.646  1.00 157.27 ? 353 PHE X CB  1 
ATOM   3772  C CG  . PHE C  3 338 ? 10.535  2.658   26.554  1.00 153.22 ? 353 PHE X CG  1 
ATOM   3773  C CD1 . PHE C  3 338 ? 9.260   2.106   26.516  1.00 154.29 ? 353 PHE X CD1 1 
ATOM   3774  C CD2 . PHE C  3 338 ? 11.446  2.287   25.571  1.00 152.57 ? 353 PHE X CD2 1 
ATOM   3775  C CE1 . PHE C  3 338 ? 8.904   1.195   25.519  1.00 150.25 ? 353 PHE X CE1 1 
ATOM   3776  C CE2 . PHE C  3 338 ? 11.091  1.374   24.576  1.00 150.60 ? 353 PHE X CE2 1 
ATOM   3777  C CZ  . PHE C  3 338 ? 9.818   0.844   24.550  1.00 146.66 ? 353 PHE X CZ  1 
ATOM   3778  N N   . ASN C  3 339 ? 10.003  1.090   29.771  1.00 156.66 ? 354 ASN X N   1 
ATOM   3779  C CA  . ASN C  3 339 ? 8.929   0.380   30.490  1.00 156.74 ? 354 ASN X CA  1 
ATOM   3780  C C   . ASN C  3 339 ? 7.510   0.803   29.930  1.00 158.35 ? 354 ASN X C   1 
ATOM   3781  O O   . ASN C  3 339 ? 7.348   0.586   28.725  1.00 153.13 ? 354 ASN X O   1 
ATOM   3782  C CB  . ASN C  3 339 ? 9.097   0.498   32.013  1.00 161.71 ? 354 ASN X CB  1 
ATOM   3783  C CG  . ASN C  3 339 ? 10.293  -0.228  32.554  1.00 177.68 ? 354 ASN X CG  1 
ATOM   3784  O OD1 . ASN C  3 339 ? 11.393  0.326   32.650  1.00 173.71 ? 354 ASN X OD1 1 
ATOM   3785  N ND2 . ASN C  3 339 ? 10.094  -1.476  32.945  1.00 165.88 ? 354 ASN X ND2 1 
ATOM   3786  N N   . PRO C  3 340 ? 6.471   1.361   30.646  1.00 157.73 ? 355 PRO X N   1 
ATOM   3787  C CA  . PRO C  3 340 ? 6.351   1.758   32.065  1.00 163.04 ? 355 PRO X CA  1 
ATOM   3788  C C   . PRO C  3 340 ? 5.628   0.718   32.946  1.00 165.74 ? 355 PRO X C   1 
ATOM   3789  O O   . PRO C  3 340 ? 4.392   0.625   32.932  1.00 165.63 ? 355 PRO X O   1 
ATOM   3790  C CB  . PRO C  3 340 ? 5.604   3.102   31.968  1.00 167.12 ? 355 PRO X CB  1 
ATOM   3791  C CG  . PRO C  3 340 ? 4.784   3.007   30.658  1.00 166.71 ? 355 PRO X CG  1 
ATOM   3792  C CD  . PRO C  3 340 ? 5.232   1.737   29.938  1.00 157.17 ? 355 PRO X CD  1 
ATOM   3793  N N   . CYS C  3 341 ? 6.411   -0.075  33.710  1.00 160.99 ? 356 CYS X N   1 
ATOM   3794  C CA  . CYS C  3 341 ? 5.921   -1.130  34.604  1.00 134.20 ? 356 CYS X CA  1 
ATOM   3795  C C   . CYS C  3 341 ? 6.959   -1.490  35.660  1.00 148.34 ? 356 CYS X C   1 
ATOM   3796  O O   . CYS C  3 341 ? 7.080   -0.788  36.660  1.00 112.25 ? 356 CYS X O   1 
ATOM   3797  C CB  . CYS C  3 341 ? 5.468   -2.359  33.817  1.00 128.19 ? 356 CYS X CB  1 
ATOM   3798  S SG  . CYS C  3 341 ? 6.643   -2.911  32.547  1.00 125.83 ? 356 CYS X SG  1 
ATOM   3799  N N   . VAL D  1 4   ? -53.292 -5.709  -3.786  1.00 150.87 ? 4   VAL D N   1 
ATOM   3800  C CA  . VAL D  1 4   ? -53.590 -6.928  -3.024  1.00 155.96 ? 4   VAL D CA  1 
ATOM   3801  C C   . VAL D  1 4   ? -53.981 -6.560  -1.577  1.00 157.72 ? 4   VAL D C   1 
ATOM   3802  O O   . VAL D  1 4   ? -54.923 -7.147  -1.033  1.00 163.71 ? 4   VAL D O   1 
ATOM   3803  C CB  . VAL D  1 4   ? -52.427 -7.973  -3.096  1.00 159.82 ? 4   VAL D CB  1 
ATOM   3804  C CG1 . VAL D  1 4   ? -52.723 -9.221  -2.264  1.00 165.79 ? 4   VAL D CG1 1 
ATOM   3805  C CG2 . VAL D  1 4   ? -52.117 -8.363  -4.541  1.00 161.33 ? 4   VAL D CG2 1 
ATOM   3806  N N   . GLN D  1 5   ? -53.272 -5.572  -0.974  1.00 145.58 ? 5   GLN D N   1 
ATOM   3807  C CA  . GLN D  1 5   ? -53.499 -5.116  0.407   1.00 142.97 ? 5   GLN D CA  1 
ATOM   3808  C C   . GLN D  1 5   ? -54.499 -3.944  0.532   1.00 141.11 ? 5   GLN D C   1 
ATOM   3809  O O   . GLN D  1 5   ? -54.986 -3.683  1.640   1.00 141.38 ? 5   GLN D O   1 
ATOM   3810  C CB  . GLN D  1 5   ? -52.163 -4.781  1.105   1.00 138.80 ? 5   GLN D CB  1 
ATOM   3811  C CG  . GLN D  1 5   ? -51.325 -6.014  1.466   1.00 160.82 ? 5   GLN D CG  1 
ATOM   3812  C CD  . GLN D  1 5   ? -49.989 -5.667  2.081   1.00 180.41 ? 5   GLN D CD  1 
ATOM   3813  O OE1 . GLN D  1 5   ? -49.902 -5.026  3.137   1.00 173.82 ? 5   GLN D OE1 1 
ATOM   3814  N NE2 . GLN D  1 5   ? -48.913 -6.131  1.456   1.00 173.62 ? 5   GLN D NE2 1 
ATOM   3815  N N   . ASP D  1 6   ? -54.824 -3.274  -0.605  1.00 132.41 ? 6   ASP D N   1 
ATOM   3816  C CA  . ASP D  1 6   ? -55.738 -2.124  -0.710  1.00 129.04 ? 6   ASP D CA  1 
ATOM   3817  C C   . ASP D  1 6   ? -55.300 -0.981  0.209   1.00 120.55 ? 6   ASP D C   1 
ATOM   3818  O O   . ASP D  1 6   ? -55.970 -0.681  1.205   1.00 121.39 ? 6   ASP D O   1 
ATOM   3819  C CB  . ASP D  1 6   ? -57.222 -2.522  -0.494  1.00 137.96 ? 6   ASP D CB  1 
ATOM   3820  C CG  . ASP D  1 6   ? -58.241 -1.524  -1.030  1.00 147.51 ? 6   ASP D CG  1 
ATOM   3821  O OD1 . ASP D  1 6   ? -58.152 -0.319  -0.668  1.00 142.35 ? 6   ASP D OD1 1 
ATOM   3822  O OD2 . ASP D  1 6   ? -59.159 -1.952  -1.768  1.00 158.32 ? 6   ASP D OD2 1 
ATOM   3823  N N   . CYS D  1 7   ? -54.143 -0.377  -0.125  1.00 105.77 ? 7   CYS D N   1 
ATOM   3824  C CA  . CYS D  1 7   ? -53.531 0.736   0.593   1.00 97.26  ? 7   CYS D CA  1 
ATOM   3825  C C   . CYS D  1 7   ? -54.408 1.981   0.376   1.00 98.16  ? 7   CYS D C   1 
ATOM   3826  O O   . CYS D  1 7   ? -54.528 2.425   -0.770  1.00 97.34  ? 7   CYS D O   1 
ATOM   3827  C CB  . CYS D  1 7   ? -52.108 0.956   0.089   1.00 92.01  ? 7   CYS D CB  1 
ATOM   3828  S SG  . CYS D  1 7   ? -50.958 1.595   1.338   1.00 90.22  ? 7   CYS D SG  1 
ATOM   3829  N N   . PRO D  1 8   ? -55.069 2.530   1.435   1.00 93.78  ? 8   PRO D N   1 
ATOM   3830  C CA  . PRO D  1 8   ? -55.966 3.692   1.223   1.00 92.50  ? 8   PRO D CA  1 
ATOM   3831  C C   . PRO D  1 8   ? -55.241 4.943   0.750   1.00 88.81  ? 8   PRO D C   1 
ATOM   3832  O O   . PRO D  1 8   ? -54.229 5.300   1.336   1.00 83.92  ? 8   PRO D O   1 
ATOM   3833  C CB  . PRO D  1 8   ? -56.648 3.888   2.583   1.00 95.76  ? 8   PRO D CB  1 
ATOM   3834  C CG  . PRO D  1 8   ? -55.752 3.225   3.569   1.00 99.64  ? 8   PRO D CG  1 
ATOM   3835  C CD  . PRO D  1 8   ? -55.064 2.099   2.851   1.00 96.41  ? 8   PRO D CD  1 
ATOM   3836  N N   . GLU D  1 9   ? -55.761 5.591   -0.313  1.00 85.26  ? 9   GLU D N   1 
ATOM   3837  C CA  . GLU D  1 9   ? -55.198 6.782   -0.970  1.00 81.32  ? 9   GLU D CA  1 
ATOM   3838  C C   . GLU D  1 9   ? -54.989 7.992   -0.064  1.00 78.48  ? 9   GLU D C   1 
ATOM   3839  O O   . GLU D  1 9   ? -55.724 8.195   0.897   1.00 79.81  ? 9   GLU D O   1 
ATOM   3840  C CB  . GLU D  1 9   ? -56.054 7.183   -2.185  1.00 86.31  ? 9   GLU D CB  1 
ATOM   3841  C CG  . GLU D  1 9   ? -55.327 7.974   -3.267  1.00 98.89  ? 9   GLU D CG  1 
ATOM   3842  C CD  . GLU D  1 9   ? -56.202 8.376   -4.440  1.00 133.38 ? 9   GLU D CD  1 
ATOM   3843  O OE1 . GLU D  1 9   ? -57.093 9.237   -4.248  1.00 138.97 ? 9   GLU D OE1 1 
ATOM   3844  O OE2 . GLU D  1 9   ? -56.003 7.829   -5.550  1.00 128.76 ? 9   GLU D OE2 1 
ATOM   3845  N N   . CYS D  1 10  ? -53.984 8.794   -0.411  1.00 68.81  ? 10  CYS D N   1 
ATOM   3846  C CA  . CYS D  1 10  ? -53.606 10.042  0.235   1.00 65.07  ? 10  CYS D CA  1 
ATOM   3847  C C   . CYS D  1 10  ? -54.767 11.054  0.194   1.00 71.26  ? 10  CYS D C   1 
ATOM   3848  O O   . CYS D  1 10  ? -55.144 11.556  -0.871  1.00 71.09  ? 10  CYS D O   1 
ATOM   3849  C CB  . CYS D  1 10  ? -52.349 10.598  -0.424  1.00 61.65  ? 10  CYS D CB  1 
ATOM   3850  S SG  . CYS D  1 10  ? -51.866 12.234  0.160   1.00 62.68  ? 10  CYS D SG  1 
ATOM   3851  N N   . THR D  1 11  ? -55.347 11.314  1.367   1.00 70.09  ? 11  THR D N   1 
ATOM   3852  C CA  . THR D  1 11  ? -56.481 12.223  1.547   1.00 72.77  ? 11  THR D CA  1 
ATOM   3853  C C   . THR D  1 11  ? -56.437 12.863  2.934   1.00 75.87  ? 11  THR D C   1 
ATOM   3854  O O   . THR D  1 11  ? -55.655 12.439  3.783   1.00 73.83  ? 11  THR D O   1 
ATOM   3855  C CB  . THR D  1 11  ? -57.826 11.491  1.261   1.00 88.29  ? 11  THR D CB  1 
ATOM   3856  O OG1 . THR D  1 11  ? -58.909 12.424  1.304   1.00 89.41  ? 11  THR D OG1 1 
ATOM   3857  C CG2 . THR D  1 11  ? -58.099 10.333  2.225   1.00 90.63  ? 11  THR D CG2 1 
ATOM   3858  N N   . LEU D  1 12  ? -57.282 13.876  3.158   1.00 74.06  ? 12  LEU D N   1 
ATOM   3859  C CA  . LEU D  1 12  ? -57.387 14.553  4.446   1.00 73.63  ? 12  LEU D CA  1 
ATOM   3860  C C   . LEU D  1 12  ? -58.111 13.681  5.471   1.00 81.73  ? 12  LEU D C   1 
ATOM   3861  O O   . LEU D  1 12  ? -59.184 13.111  5.187   1.00 84.17  ? 12  LEU D O   1 
ATOM   3862  C CB  . LEU D  1 12  ? -58.123 15.900  4.312   1.00 74.52  ? 12  LEU D CB  1 
ATOM   3863  C CG  . LEU D  1 12  ? -57.286 17.160  4.147   1.00 75.57  ? 12  LEU D CG  1 
ATOM   3864  C CD1 . LEU D  1 12  ? -58.171 18.384  4.174   1.00 77.58  ? 12  LEU D CD1 1 
ATOM   3865  C CD2 . LEU D  1 12  ? -56.245 17.267  5.221   1.00 74.30  ? 12  LEU D CD2 1 
ATOM   3866  N N   . GLN D  1 13  ? -57.504 13.585  6.669   1.00 78.00  ? 13  GLN D N   1 
ATOM   3867  C CA  . GLN D  1 13  ? -58.038 12.842  7.815   1.00 80.64  ? 13  GLN D CA  1 
ATOM   3868  C C   . GLN D  1 13  ? -57.971 13.709  9.080   1.00 83.89  ? 13  GLN D C   1 
ATOM   3869  O O   . GLN D  1 13  ? -57.149 14.623  9.171   1.00 81.04  ? 13  GLN D O   1 
ATOM   3870  C CB  . GLN D  1 13  ? -57.299 11.504  8.014   1.00 81.58  ? 13  GLN D CB  1 
ATOM   3871  C CG  . GLN D  1 13  ? -57.466 10.503  6.858   1.00 95.41  ? 13  GLN D CG  1 
ATOM   3872  C CD  . GLN D  1 13  ? -58.365 9.325   7.162   1.00 111.59 ? 13  GLN D CD  1 
ATOM   3873  O OE1 . GLN D  1 13  ? -58.396 8.793   8.280   1.00 110.65 ? 13  GLN D OE1 1 
ATOM   3874  N NE2 . GLN D  1 13  ? -59.068 8.845   6.142   1.00 95.65  ? 13  GLN D NE2 1 
ATOM   3875  N N   . GLU D  1 14  ? -58.858 13.448  10.033  1.00 83.45  ? 14  GLU D N   1 
ATOM   3876  C CA  . GLU D  1 14  ? -58.906 14.184  11.288  1.00 84.30  ? 14  GLU D CA  1 
ATOM   3877  C C   . GLU D  1 14  ? -57.755 13.701  12.169  1.00 87.30  ? 14  GLU D C   1 
ATOM   3878  O O   . GLU D  1 14  ? -57.630 12.491  12.376  1.00 89.03  ? 14  GLU D O   1 
ATOM   3879  C CB  . GLU D  1 14  ? -60.264 13.929  11.963  1.00 90.67  ? 14  GLU D CB  1 
ATOM   3880  C CG  . GLU D  1 14  ? -60.484 14.683  13.260  1.00 101.81 ? 14  GLU D CG  1 
ATOM   3881  C CD  . GLU D  1 14  ? -61.812 14.352  13.902  1.00 117.27 ? 14  GLU D CD  1 
ATOM   3882  O OE1 . GLU D  1 14  ? -61.849 13.442  14.762  1.00 113.30 ? 14  GLU D OE1 1 
ATOM   3883  O OE2 . GLU D  1 14  ? -62.827 14.971  13.510  1.00 106.31 ? 14  GLU D OE2 1 
ATOM   3884  N N   . ASN D  1 15  ? -56.905 14.631  12.661  1.00 80.95  ? 15  ASN D N   1 
ATOM   3885  C CA  . ASN D  1 15  ? -55.768 14.313  13.538  1.00 79.78  ? 15  ASN D CA  1 
ATOM   3886  C C   . ASN D  1 15  ? -56.281 13.953  14.939  1.00 89.69  ? 15  ASN D C   1 
ATOM   3887  O O   . ASN D  1 15  ? -57.036 14.745  15.495  1.00 91.99  ? 15  ASN D O   1 
ATOM   3888  C CB  . ASN D  1 15  ? -54.849 15.514  13.655  1.00 76.01  ? 15  ASN D CB  1 
ATOM   3889  C CG  . ASN D  1 15  ? -53.458 15.188  14.132  1.00 101.45 ? 15  ASN D CG  1 
ATOM   3890  O OD1 . ASN D  1 15  ? -53.237 14.549  15.165  1.00 96.93  ? 15  ASN D OD1 1 
ATOM   3891  N ND2 . ASN D  1 15  ? -52.478 15.674  13.404  1.00 92.34  ? 15  ASN D ND2 1 
ATOM   3892  N N   . PRO D  1 16  ? -55.907 12.799  15.549  1.00 88.95  ? 16  PRO D N   1 
ATOM   3893  C CA  . PRO D  1 16  ? -56.427 12.486  16.905  1.00 94.05  ? 16  PRO D CA  1 
ATOM   3894  C C   . PRO D  1 16  ? -55.960 13.492  17.969  1.00 98.48  ? 16  PRO D C   1 
ATOM   3895  O O   . PRO D  1 16  ? -56.779 14.024  18.725  1.00 100.77 ? 16  PRO D O   1 
ATOM   3896  C CB  . PRO D  1 16  ? -55.931 11.060  17.166  1.00 97.55  ? 16  PRO D CB  1 
ATOM   3897  C CG  . PRO D  1 16  ? -54.757 10.889  16.258  1.00 97.22  ? 16  PRO D CG  1 
ATOM   3898  C CD  . PRO D  1 16  ? -55.025 11.726  15.043  1.00 88.81  ? 16  PRO D CD  1 
ATOM   3899  N N   . LEU D  1 17  ? -54.645 13.785  17.985  1.00 92.49  ? 17  LEU D N   1 
ATOM   3900  C CA  . LEU D  1 17  ? -54.037 14.786  18.857  1.00 93.00  ? 17  LEU D CA  1 
ATOM   3901  C C   . LEU D  1 17  ? -54.359 16.148  18.246  1.00 94.04  ? 17  LEU D C   1 
ATOM   3902  O O   . LEU D  1 17  ? -54.464 16.256  17.016  1.00 90.99  ? 17  LEU D O   1 
ATOM   3903  C CB  . LEU D  1 17  ? -52.512 14.611  18.867  1.00 90.78  ? 17  LEU D CB  1 
ATOM   3904  C CG  . LEU D  1 17  ? -51.817 14.582  20.221  1.00 99.40  ? 17  LEU D CG  1 
ATOM   3905  C CD1 . LEU D  1 17  ? -50.385 14.079  20.066  1.00 98.31  ? 17  LEU D CD1 1 
ATOM   3906  C CD2 . LEU D  1 17  ? -51.835 15.956  20.908  1.00 102.58 ? 17  LEU D CD2 1 
ATOM   3907  N N   . PHE D  1 18  ? -54.500 17.186  19.097  1.00 90.51  ? 18  PHE D N   1 
ATOM   3908  C CA  . PHE D  1 18  ? -54.786 18.582  18.723  1.00 87.56  ? 18  PHE D CA  1 
ATOM   3909  C C   . PHE D  1 18  ? -56.244 18.836  18.438  1.00 89.94  ? 18  PHE D C   1 
ATOM   3910  O O   . PHE D  1 18  ? -56.767 19.839  18.920  1.00 92.32  ? 18  PHE D O   1 
ATOM   3911  C CB  . PHE D  1 18  ? -53.910 19.105  17.560  1.00 84.00  ? 18  PHE D CB  1 
ATOM   3912  C CG  . PHE D  1 18  ? -52.423 18.990  17.783  1.00 83.28  ? 18  PHE D CG  1 
ATOM   3913  C CD1 . PHE D  1 18  ? -51.764 19.857  18.644  1.00 87.83  ? 18  PHE D CD1 1 
ATOM   3914  C CD2 . PHE D  1 18  ? -51.678 18.031  17.111  1.00 81.85  ? 18  PHE D CD2 1 
ATOM   3915  C CE1 . PHE D  1 18  ? -50.392 19.750  18.849  1.00 88.32  ? 18  PHE D CE1 1 
ATOM   3916  C CE2 . PHE D  1 18  ? -50.302 17.927  17.313  1.00 83.64  ? 18  PHE D CE2 1 
ATOM   3917  C CZ  . PHE D  1 18  ? -49.668 18.787  18.178  1.00 84.14  ? 18  PHE D CZ  1 
ATOM   3918  N N   . SER D  1 19  ? -56.899 17.957  17.648  1.00 83.07  ? 19  SER D N   1 
ATOM   3919  C CA  . SER D  1 19  ? -58.315 18.092  17.315  1.00 83.55  ? 19  SER D CA  1 
ATOM   3920  C C   . SER D  1 19  ? -59.179 18.191  18.560  1.00 93.44  ? 19  SER D C   1 
ATOM   3921  O O   . SER D  1 19  ? -58.911 17.548  19.580  1.00 95.71  ? 19  SER D O   1 
ATOM   3922  C CB  . SER D  1 19  ? -58.793 16.935  16.449  1.00 83.22  ? 19  SER D CB  1 
ATOM   3923  O OG  . SER D  1 19  ? -58.349 17.059  15.111  1.00 81.44  ? 19  SER D OG  1 
ATOM   3924  N N   . GLN D  1 20  ? -60.201 19.024  18.476  1.00 92.35  ? 20  GLN D N   1 
ATOM   3925  C CA  . GLN D  1 20  ? -61.150 19.227  19.557  1.00 97.64  ? 20  GLN D CA  1 
ATOM   3926  C C   . GLN D  1 20  ? -62.575 19.195  18.988  1.00 100.42 ? 20  GLN D C   1 
ATOM   3927  O O   . GLN D  1 20  ? -62.710 19.259  17.764  1.00 95.48  ? 20  GLN D O   1 
ATOM   3928  C CB  . GLN D  1 20  ? -60.829 20.546  20.284  1.00 100.91 ? 20  GLN D CB  1 
ATOM   3929  C CG  . GLN D  1 20  ? -59.762 20.404  21.377  1.00 119.28 ? 20  GLN D CG  1 
ATOM   3930  C CD  . GLN D  1 20  ? -60.242 19.567  22.543  1.00 146.92 ? 20  GLN D CD  1 
ATOM   3931  O OE1 . GLN D  1 20  ? -59.807 18.428  22.729  1.00 144.01 ? 20  GLN D OE1 1 
ATOM   3932  N NE2 . GLN D  1 20  ? -61.174 20.095  23.335  1.00 142.66 ? 20  GLN D NE2 1 
ATOM   3933  N N   . PRO D  1 21  ? -63.649 19.042  19.807  1.00 102.54 ? 21  PRO D N   1 
ATOM   3934  C CA  . PRO D  1 21  ? -65.010 19.015  19.224  1.00 104.19 ? 21  PRO D CA  1 
ATOM   3935  C C   . PRO D  1 21  ? -65.358 20.376  18.634  1.00 105.43 ? 21  PRO D C   1 
ATOM   3936  O O   . PRO D  1 21  ? -65.228 21.396  19.311  1.00 105.84 ? 21  PRO D O   1 
ATOM   3937  C CB  . PRO D  1 21  ? -65.915 18.642  20.407  1.00 112.50 ? 21  PRO D CB  1 
ATOM   3938  C CG  . PRO D  1 21  ? -64.990 18.212  21.507  1.00 118.37 ? 21  PRO D CG  1 
ATOM   3939  C CD  . PRO D  1 21  ? -63.703 18.929  21.278  1.00 109.16 ? 21  PRO D CD  1 
ATOM   3940  N N   . GLY D  1 22  ? -65.673 20.386  17.344  1.00 99.25  ? 22  GLY D N   1 
ATOM   3941  C CA  . GLY D  1 22  ? -65.957 21.618  16.619  1.00 98.14  ? 22  GLY D CA  1 
ATOM   3942  C C   . GLY D  1 22  ? -64.707 22.263  16.049  1.00 96.70  ? 22  GLY D C   1 
ATOM   3943  O O   . GLY D  1 22  ? -64.780 22.993  15.053  1.00 94.74  ? 22  GLY D O   1 
ATOM   3944  N N   . ALA D  1 23  ? -63.538 21.972  16.665  1.00 90.59  ? 23  ALA D N   1 
ATOM   3945  C CA  . ALA D  1 23  ? -62.238 22.475  16.229  1.00 85.73  ? 23  ALA D CA  1 
ATOM   3946  C C   . ALA D  1 23  ? -61.300 21.307  15.771  1.00 87.76  ? 23  ALA D C   1 
ATOM   3947  O O   . ALA D  1 23  ? -60.227 21.075  16.371  1.00 86.86  ? 23  ALA D O   1 
ATOM   3948  C CB  . ALA D  1 23  ? -61.600 23.319  17.329  1.00 87.31  ? 23  ALA D CB  1 
ATOM   3949  N N   . PRO D  1 24  ? -61.676 20.543  14.705  1.00 82.14  ? 24  PRO D N   1 
ATOM   3950  C CA  . PRO D  1 24  ? -60.770 19.477  14.253  1.00 78.15  ? 24  PRO D CA  1 
ATOM   3951  C C   . PRO D  1 24  ? -59.564 20.067  13.533  1.00 75.74  ? 24  PRO D C   1 
ATOM   3952  O O   . PRO D  1 24  ? -59.591 21.222  13.102  1.00 73.03  ? 24  PRO D O   1 
ATOM   3953  C CB  . PRO D  1 24  ? -61.641 18.647  13.304  1.00 80.53  ? 24  PRO D CB  1 
ATOM   3954  C CG  . PRO D  1 24  ? -62.635 19.619  12.756  1.00 86.54  ? 24  PRO D CG  1 
ATOM   3955  C CD  . PRO D  1 24  ? -62.870 20.643  13.828  1.00 84.59  ? 24  PRO D CD  1 
ATOM   3956  N N   . ILE D  1 25  ? -58.503 19.273  13.439  1.00 70.35  ? 25  ILE D N   1 
ATOM   3957  C CA  . ILE D  1 25  ? -57.281 19.615  12.731  1.00 66.15  ? 25  ILE D CA  1 
ATOM   3958  C C   . ILE D  1 25  ? -57.161 18.547  11.681  1.00 68.03  ? 25  ILE D C   1 
ATOM   3959  O O   . ILE D  1 25  ? -57.242 17.346  11.990  1.00 69.60  ? 25  ILE D O   1 
ATOM   3960  C CB  . ILE D  1 25  ? -56.054 19.731  13.667  1.00 68.77  ? 25  ILE D CB  1 
ATOM   3961  C CG1 . ILE D  1 25  ? -56.047 21.093  14.370  1.00 71.50  ? 25  ILE D CG1 1 
ATOM   3962  C CG2 . ILE D  1 25  ? -54.749 19.557  12.904  1.00 66.26  ? 25  ILE D CG2 1 
ATOM   3963  C CD1 . ILE D  1 25  ? -56.703 21.100  15.712  1.00 89.33  ? 25  ILE D CD1 1 
ATOM   3964  N N   . LEU D  1 26  ? -57.050 18.979  10.431  1.00 60.80  ? 26  LEU D N   1 
ATOM   3965  C CA  . LEU D  1 26  ? -56.986 18.045  9.321   1.00 58.17  ? 26  LEU D CA  1 
ATOM   3966  C C   . LEU D  1 26  ? -55.551 17.832  8.840   1.00 55.93  ? 26  LEU D C   1 
ATOM   3967  O O   . LEU D  1 26  ? -54.799 18.790  8.664   1.00 52.11  ? 26  LEU D O   1 
ATOM   3968  C CB  . LEU D  1 26  ? -57.954 18.473  8.210   1.00 59.13  ? 26  LEU D CB  1 
ATOM   3969  C CG  . LEU D  1 26  ? -59.316 18.956  8.676   1.00 67.05  ? 26  LEU D CG  1 
ATOM   3970  C CD1 . LEU D  1 26  ? -60.126 19.394  7.527   1.00 69.07  ? 26  LEU D CD1 1 
ATOM   3971  C CD2 . LEU D  1 26  ? -60.076 17.879  9.441   1.00 71.94  ? 26  LEU D CD2 1 
ATOM   3972  N N   . GLN D  1 27  ? -55.177 16.556  8.690   1.00 52.81  ? 27  GLN D N   1 
ATOM   3973  C CA  . GLN D  1 27  ? -53.837 16.067  8.338   1.00 50.37  ? 27  GLN D CA  1 
ATOM   3974  C C   . GLN D  1 27  ? -53.837 15.198  7.072   1.00 57.25  ? 27  GLN D C   1 
ATOM   3975  O O   . GLN D  1 27  ? -54.751 14.394  6.872   1.00 59.11  ? 27  GLN D O   1 
ATOM   3976  C CB  . GLN D  1 27  ? -53.282 15.274  9.529   1.00 51.26  ? 27  GLN D CB  1 
ATOM   3977  C CG  . GLN D  1 27  ? -51.872 14.785  9.357   1.00 56.38  ? 27  GLN D CG  1 
ATOM   3978  C CD  . GLN D  1 27  ? -51.295 14.215  10.623  1.00 74.89  ? 27  GLN D CD  1 
ATOM   3979  O OE1 . GLN D  1 27  ? -52.006 13.713  11.506  1.00 72.27  ? 27  GLN D OE1 1 
ATOM   3980  N NE2 . GLN D  1 27  ? -49.974 14.260  10.725  1.00 59.61  ? 27  GLN D NE2 1 
ATOM   3981  N N   . CYS D  1 28  ? -52.809 15.363  6.227   1.00 54.36  ? 28  CYS D N   1 
ATOM   3982  C CA  . CYS D  1 28  ? -52.665 14.591  4.994   1.00 55.50  ? 28  CYS D CA  1 
ATOM   3983  C C   . CYS D  1 28  ? -52.036 13.249  5.229   1.00 60.70  ? 28  CYS D C   1 
ATOM   3984  O O   . CYS D  1 28  ? -50.854 13.159  5.568   1.00 60.37  ? 28  CYS D O   1 
ATOM   3985  C CB  . CYS D  1 28  ? -51.922 15.380  3.926   1.00 54.83  ? 28  CYS D CB  1 
ATOM   3986  S SG  . CYS D  1 28  ? -52.898 16.722  3.227   1.00 61.28  ? 28  CYS D SG  1 
ATOM   3987  N N   . MET D  1 29  ? -52.814 12.197  5.044   1.00 58.43  ? 29  MET D N   1 
ATOM   3988  C CA  . MET D  1 29  ? -52.300 10.855  5.242   1.00 58.80  ? 29  MET D CA  1 
ATOM   3989  C C   . MET D  1 29  ? -52.887 9.849   4.258   1.00 66.49  ? 29  MET D C   1 
ATOM   3990  O O   . MET D  1 29  ? -53.988 10.050  3.729   1.00 68.91  ? 29  MET D O   1 
ATOM   3991  C CB  . MET D  1 29  ? -52.465 10.412  6.688   1.00 62.69  ? 29  MET D CB  1 
ATOM   3992  C CG  . MET D  1 29  ? -53.878 10.365  7.132   1.00 69.46  ? 29  MET D CG  1 
ATOM   3993  S SD  . MET D  1 29  ? -53.936 9.967   8.863   1.00 76.24  ? 29  MET D SD  1 
ATOM   3994  C CE  . MET D  1 29  ? -53.813 11.578  9.561   1.00 71.78  ? 29  MET D CE  1 
ATOM   3995  N N   . GLY D  1 30  ? -52.122 8.798   3.998   1.00 62.55  ? 30  GLY D N   1 
ATOM   3996  C CA  . GLY D  1 30  ? -52.519 7.773   3.057   1.00 65.19  ? 30  GLY D CA  1 
ATOM   3997  C C   . GLY D  1 30  ? -51.374 7.194   2.263   1.00 69.81  ? 30  GLY D C   1 
ATOM   3998  O O   . GLY D  1 30  ? -50.206 7.387   2.598   1.00 66.07  ? 30  GLY D O   1 
ATOM   3999  N N   . CYS D  1 31  ? -51.726 6.495   1.185   1.00 71.79  ? 31  CYS D N   1 
ATOM   4000  C CA  . CYS D  1 31  ? -50.819 5.754   0.331   1.00 72.47  ? 31  CYS D CA  1 
ATOM   4001  C C   . CYS D  1 31  ? -50.578 6.383   -1.007  1.00 72.30  ? 31  CYS D C   1 
ATOM   4002  O O   . CYS D  1 31  ? -51.513 6.855   -1.672  1.00 73.07  ? 31  CYS D O   1 
ATOM   4003  C CB  . CYS D  1 31  ? -51.295 4.317   0.181   1.00 78.84  ? 31  CYS D CB  1 
ATOM   4004  S SG  . CYS D  1 31  ? -51.604 3.474   1.752   1.00 86.46  ? 31  CYS D SG  1 
ATOM   4005  N N   . CYS D  1 32  ? -49.295 6.319   -1.419  1.00 64.69  ? 32  CYS D N   1 
ATOM   4006  C CA  . CYS D  1 32  ? -48.758 6.833   -2.672  1.00 62.54  ? 32  CYS D CA  1 
ATOM   4007  C C   . CYS D  1 32  ? -47.889 5.775   -3.394  1.00 65.75  ? 32  CYS D C   1 
ATOM   4008  O O   . CYS D  1 32  ? -47.378 4.849   -2.753  1.00 65.76  ? 32  CYS D O   1 
ATOM   4009  C CB  . CYS D  1 32  ? -47.993 8.119   -2.405  1.00 59.35  ? 32  CYS D CB  1 
ATOM   4010  S SG  . CYS D  1 32  ? -49.011 9.444   -1.702  1.00 63.29  ? 32  CYS D SG  1 
ATOM   4011  N N   . PHE D  1 33  ? -47.785 5.867   -4.734  1.00 61.47  ? 33  PHE D N   1 
ATOM   4012  C CA  . PHE D  1 33  ? -47.020 4.895   -5.511  1.00 60.99  ? 33  PHE D CA  1 
ATOM   4013  C C   . PHE D  1 33  ? -45.512 5.149   -5.501  1.00 61.11  ? 33  PHE D C   1 
ATOM   4014  O O   . PHE D  1 33  ? -45.039 6.274   -5.740  1.00 58.30  ? 33  PHE D O   1 
ATOM   4015  C CB  . PHE D  1 33  ? -47.541 4.762   -6.956  1.00 66.20  ? 33  PHE D CB  1 
ATOM   4016  C CG  . PHE D  1 33  ? -46.850 3.660   -7.737  1.00 69.75  ? 33  PHE D CG  1 
ATOM   4017  C CD1 . PHE D  1 33  ? -47.194 2.322   -7.543  1.00 75.23  ? 33  PHE D CD1 1 
ATOM   4018  C CD2 . PHE D  1 33  ? -45.828 3.954   -8.636  1.00 70.92  ? 33  PHE D CD2 1 
ATOM   4019  C CE1 . PHE D  1 33  ? -46.526 1.307   -8.229  1.00 77.49  ? 33  PHE D CE1 1 
ATOM   4020  C CE2 . PHE D  1 33  ? -45.160 2.934   -9.320  1.00 75.02  ? 33  PHE D CE2 1 
ATOM   4021  C CZ  . PHE D  1 33  ? -45.521 1.620   -9.119  1.00 75.68  ? 33  PHE D CZ  1 
ATOM   4022  N N   . SER D  1 34  ? -44.762 4.062   -5.262  1.00 56.74  ? 34  SER D N   1 
ATOM   4023  C CA  . SER D  1 34  ? -43.305 4.049   -5.269  1.00 53.71  ? 34  SER D CA  1 
ATOM   4024  C C   . SER D  1 34  ? -42.815 2.734   -5.855  1.00 59.42  ? 34  SER D C   1 
ATOM   4025  O O   . SER D  1 34  ? -43.497 1.712   -5.766  1.00 61.76  ? 34  SER D O   1 
ATOM   4026  C CB  . SER D  1 34  ? -42.729 4.289   -3.875  1.00 54.53  ? 34  SER D CB  1 
ATOM   4027  O OG  . SER D  1 34  ? -43.516 3.726   -2.834  1.00 67.76  ? 34  SER D OG  1 
ATOM   4028  N N   . ARG D  1 35  ? -41.651 2.771   -6.502  1.00 54.50  ? 35  ARG D N   1 
ATOM   4029  C CA  . ARG D  1 35  ? -41.050 1.583   -7.111  1.00 55.31  ? 35  ARG D CA  1 
ATOM   4030  C C   . ARG D  1 35  ? -39.513 1.656   -7.090  1.00 57.62  ? 35  ARG D C   1 
ATOM   4031  O O   . ARG D  1 35  ? -38.930 2.728   -6.818  1.00 55.43  ? 35  ARG D O   1 
ATOM   4032  C CB  . ARG D  1 35  ? -41.614 1.310   -8.528  1.00 53.71  ? 35  ARG D CB  1 
ATOM   4033  C CG  . ARG D  1 35  ? -41.381 2.420   -9.555  1.00 48.38  ? 35  ARG D CG  1 
ATOM   4034  C CD  . ARG D  1 35  ? -41.267 1.843   -10.947 1.00 42.36  ? 35  ARG D CD  1 
ATOM   4035  N NE  . ARG D  1 35  ? -41.190 2.887   -11.968 1.00 45.57  ? 35  ARG D NE  1 
ATOM   4036  C CZ  . ARG D  1 35  ? -41.214 2.668   -13.282 1.00 67.07  ? 35  ARG D CZ  1 
ATOM   4037  N NH1 . ARG D  1 35  ? -41.302 1.427   -13.757 1.00 61.82  ? 35  ARG D NH1 1 
ATOM   4038  N NH2 . ARG D  1 35  ? -41.155 3.686   -14.131 1.00 52.23  ? 35  ARG D NH2 1 
ATOM   4039  N N   . ALA D  1 36  ? -38.873 0.496   -7.322  1.00 54.12  ? 36  ALA D N   1 
ATOM   4040  C CA  . ALA D  1 36  ? -37.421 0.350   -7.384  1.00 52.19  ? 36  ALA D CA  1 
ATOM   4041  C C   . ALA D  1 36  ? -37.102 -0.512  -8.585  1.00 57.55  ? 36  ALA D C   1 
ATOM   4042  O O   . ALA D  1 36  ? -37.887 -1.403  -8.922  1.00 61.74  ? 36  ALA D O   1 
ATOM   4043  C CB  . ALA D  1 36  ? -36.893 -0.302  -6.114  1.00 52.04  ? 36  ALA D CB  1 
ATOM   4044  N N   . TYR D  1 37  ? -35.986 -0.213  -9.265  1.00 50.84  ? 37  TYR D N   1 
ATOM   4045  C CA  . TYR D  1 37  ? -35.512 -0.940  -10.450 1.00 52.41  ? 37  TYR D CA  1 
ATOM   4046  C C   . TYR D  1 37  ? -34.015 -0.673  -10.692 1.00 53.29  ? 37  TYR D C   1 
ATOM   4047  O O   . TYR D  1 37  ? -33.512 0.345   -10.227 1.00 50.60  ? 37  TYR D O   1 
ATOM   4048  C CB  . TYR D  1 37  ? -36.373 -0.609  -11.699 1.00 55.88  ? 37  TYR D CB  1 
ATOM   4049  C CG  . TYR D  1 37  ? -36.428 0.853   -12.093 1.00 55.32  ? 37  TYR D CG  1 
ATOM   4050  C CD1 . TYR D  1 37  ? -35.378 1.448   -12.788 1.00 57.79  ? 37  TYR D CD1 1 
ATOM   4051  C CD2 . TYR D  1 37  ? -37.553 1.628   -11.822 1.00 54.37  ? 37  TYR D CD2 1 
ATOM   4052  C CE1 . TYR D  1 37  ? -35.428 2.788   -13.170 1.00 57.97  ? 37  TYR D CE1 1 
ATOM   4053  C CE2 . TYR D  1 37  ? -37.617 2.969   -12.205 1.00 54.10  ? 37  TYR D CE2 1 
ATOM   4054  C CZ  . TYR D  1 37  ? -36.548 3.546   -12.876 1.00 60.11  ? 37  TYR D CZ  1 
ATOM   4055  O OH  . TYR D  1 37  ? -36.569 4.861   -13.266 1.00 55.62  ? 37  TYR D OH  1 
ATOM   4056  N N   . PRO D  1 38  ? -33.249 -1.544  -11.376 1.00 51.47  ? 38  PRO D N   1 
ATOM   4057  C CA  . PRO D  1 38  ? -31.840 -1.222  -11.594 1.00 50.14  ? 38  PRO D CA  1 
ATOM   4058  C C   . PRO D  1 38  ? -31.699 0.013   -12.479 1.00 55.32  ? 38  PRO D C   1 
ATOM   4059  O O   . PRO D  1 38  ? -32.428 0.181   -13.465 1.00 56.94  ? 38  PRO D O   1 
ATOM   4060  C CB  . PRO D  1 38  ? -31.280 -2.478  -12.275 1.00 54.93  ? 38  PRO D CB  1 
ATOM   4061  C CG  . PRO D  1 38  ? -32.275 -3.530  -12.068 1.00 61.55  ? 38  PRO D CG  1 
ATOM   4062  C CD  . PRO D  1 38  ? -33.593 -2.828  -12.013 1.00 57.03  ? 38  PRO D CD  1 
ATOM   4063  N N   . THR D  1 39  ? -30.780 0.896   -12.077 1.00 50.80  ? 39  THR D N   1 
ATOM   4064  C CA  . THR D  1 39  ? -30.426 2.136   -12.758 1.00 50.80  ? 39  THR D CA  1 
ATOM   4065  C C   . THR D  1 39  ? -30.051 1.846   -14.207 1.00 59.22  ? 39  THR D C   1 
ATOM   4066  O O   . THR D  1 39  ? -29.185 1.004   -14.451 1.00 59.16  ? 39  THR D O   1 
ATOM   4067  C CB  . THR D  1 39  ? -29.259 2.791   -12.033 1.00 49.81  ? 39  THR D CB  1 
ATOM   4068  O OG1 . THR D  1 39  ? -29.631 2.895   -10.673 1.00 51.24  ? 39  THR D OG1 1 
ATOM   4069  C CG2 . THR D  1 39  ? -28.943 4.168   -12.554 1.00 44.97  ? 39  THR D CG2 1 
ATOM   4070  N N   . PRO D  1 40  ? -30.703 2.520   -15.184 1.00 59.25  ? 40  PRO D N   1 
ATOM   4071  C CA  . PRO D  1 40  ? -30.322 2.297   -16.584 1.00 63.73  ? 40  PRO D CA  1 
ATOM   4072  C C   . PRO D  1 40  ? -28.898 2.800   -16.808 1.00 69.47  ? 40  PRO D C   1 
ATOM   4073  O O   . PRO D  1 40  ? -28.497 3.807   -16.215 1.00 66.62  ? 40  PRO D O   1 
ATOM   4074  C CB  . PRO D  1 40  ? -31.361 3.103   -17.382 1.00 67.35  ? 40  PRO D CB  1 
ATOM   4075  C CG  . PRO D  1 40  ? -32.409 3.514   -16.403 1.00 67.77  ? 40  PRO D CG  1 
ATOM   4076  C CD  . PRO D  1 40  ? -31.754 3.554   -15.070 1.00 59.19  ? 40  PRO D CD  1 
ATOM   4077  N N   . LEU D  1 41  ? -28.125 2.078   -17.633 1.00 70.67  ? 41  LEU D N   1 
ATOM   4078  C CA  . LEU D  1 41  ? -26.738 2.423   -17.947 1.00 72.33  ? 41  LEU D CA  1 
ATOM   4079  C C   . LEU D  1 41  ? -26.567 3.863   -18.403 1.00 76.29  ? 41  LEU D C   1 
ATOM   4080  O O   . LEU D  1 41  ? -25.527 4.458   -18.128 1.00 76.26  ? 41  LEU D O   1 
ATOM   4081  C CB  . LEU D  1 41  ? -26.156 1.454   -18.969 1.00 77.28  ? 41  LEU D CB  1 
ATOM   4082  C CG  . LEU D  1 41  ? -25.797 0.094   -18.400 1.00 82.26  ? 41  LEU D CG  1 
ATOM   4083  C CD1 . LEU D  1 41  ? -26.159 -1.024  -19.369 1.00 86.88  ? 41  LEU D CD1 1 
ATOM   4084  C CD2 . LEU D  1 41  ? -24.335 0.048   -17.982 1.00 85.51  ? 41  LEU D CD2 1 
ATOM   4085  N N   . ARG D  1 42  ? -27.603 4.431   -19.049 1.00 73.20  ? 42  ARG D N   1 
ATOM   4086  C CA  . ARG D  1 42  ? -27.613 5.811   -19.516 1.00 74.53  ? 42  ARG D CA  1 
ATOM   4087  C C   . ARG D  1 42  ? -27.564 6.793   -18.342 1.00 74.38  ? 42  ARG D C   1 
ATOM   4088  O O   . ARG D  1 42  ? -26.901 7.828   -18.450 1.00 75.48  ? 42  ARG D O   1 
ATOM   4089  C CB  . ARG D  1 42  ? -28.823 6.066   -20.438 1.00 77.01  ? 42  ARG D CB  1 
ATOM   4090  C CG  . ARG D  1 42  ? -28.986 7.507   -20.949 1.00 87.74  ? 42  ARG D CG  1 
ATOM   4091  C CD  . ARG D  1 42  ? -27.850 7.986   -21.840 1.00 100.32 ? 42  ARG D CD  1 
ATOM   4092  N NE  . ARG D  1 42  ? -28.129 9.313   -22.387 1.00 108.43 ? 42  ARG D NE  1 
ATOM   4093  C CZ  . ARG D  1 42  ? -27.533 10.433  -21.994 1.00 116.09 ? 42  ARG D CZ  1 
ATOM   4094  N NH1 . ARG D  1 42  ? -26.601 10.401  -21.047 1.00 95.37  ? 42  ARG D NH1 1 
ATOM   4095  N NH2 . ARG D  1 42  ? -27.865 11.595  -22.542 1.00 102.76 ? 42  ARG D NH2 1 
ATOM   4096  N N   . SER D  1 43  ? -28.243 6.457   -17.218 1.00 66.46  ? 43  SER D N   1 
ATOM   4097  C CA  . SER D  1 43  ? -28.269 7.291   -16.006 1.00 61.84  ? 43  SER D CA  1 
ATOM   4098  C C   . SER D  1 43  ? -26.921 7.245   -15.332 1.00 64.07  ? 43  SER D C   1 
ATOM   4099  O O   . SER D  1 43  ? -26.405 8.288   -14.953 1.00 63.33  ? 43  SER D O   1 
ATOM   4100  C CB  . SER D  1 43  ? -29.343 6.823   -15.039 1.00 60.09  ? 43  SER D CB  1 
ATOM   4101  O OG  . SER D  1 43  ? -30.638 6.965   -15.591 1.00 67.87  ? 43  SER D OG  1 
ATOM   4102  N N   . LYS D  1 44  ? -26.315 6.045   -15.248 1.00 60.33  ? 44  LYS D N   1 
ATOM   4103  C CA  . LYS D  1 44  ? -24.991 5.848   -14.652 1.00 59.49  ? 44  LYS D CA  1 
ATOM   4104  C C   . LYS D  1 44  ? -23.941 6.790   -15.241 1.00 67.03  ? 44  LYS D C   1 
ATOM   4105  O O   . LYS D  1 44  ? -23.040 7.220   -14.517 1.00 67.12  ? 44  LYS D O   1 
ATOM   4106  C CB  . LYS D  1 44  ? -24.538 4.383   -14.754 1.00 61.49  ? 44  LYS D CB  1 
ATOM   4107  C CG  . LYS D  1 44  ? -25.270 3.422   -13.819 1.00 60.40  ? 44  LYS D CG  1 
ATOM   4108  C CD  . LYS D  1 44  ? -24.549 2.083   -13.773 1.00 67.08  ? 44  LYS D CD  1 
ATOM   4109  C CE  . LYS D  1 44  ? -25.465 0.921   -13.518 1.00 68.63  ? 44  LYS D CE  1 
ATOM   4110  N NZ  . LYS D  1 44  ? -24.697 -0.337  -13.432 1.00 80.58  ? 44  LYS D NZ  1 
ATOM   4111  N N   . LYS D  1 45  ? -24.093 7.151   -16.535 1.00 66.35  ? 45  LYS D N   1 
ATOM   4112  C CA  . LYS D  1 45  ? -23.216 8.079   -17.245 1.00 69.87  ? 45  LYS D CA  1 
ATOM   4113  C C   . LYS D  1 45  ? -23.242 9.491   -16.612 1.00 74.82  ? 45  LYS D C   1 
ATOM   4114  O O   . LYS D  1 45  ? -22.297 10.256  -16.804 1.00 79.43  ? 45  LYS D O   1 
ATOM   4115  C CB  . LYS D  1 45  ? -23.611 8.165   -18.731 1.00 75.76  ? 45  LYS D CB  1 
ATOM   4116  C CG  . LYS D  1 45  ? -23.186 6.963   -19.583 1.00 89.42  ? 45  LYS D CG  1 
ATOM   4117  C CD  . LYS D  1 45  ? -22.720 7.356   -21.007 1.00 105.49 ? 45  LYS D CD  1 
ATOM   4118  C CE  . LYS D  1 45  ? -23.850 7.675   -21.973 1.00 119.25 ? 45  LYS D CE  1 
ATOM   4119  N NZ  . LYS D  1 45  ? -23.405 8.531   -23.109 1.00 128.10 ? 45  LYS D NZ  1 
ATOM   4120  N N   . THR D  1 46  ? -24.302 9.820   -15.845 1.00 66.35  ? 46  THR D N   1 
ATOM   4121  C CA  . THR D  1 46  ? -24.512 11.137  -15.224 1.00 64.97  ? 46  THR D CA  1 
ATOM   4122  C C   . THR D  1 46  ? -24.230 11.180  -13.709 1.00 63.64  ? 46  THR D C   1 
ATOM   4123  O O   . THR D  1 46  ? -24.525 12.187  -13.061 1.00 61.92  ? 46  THR D O   1 
ATOM   4124  C CB  . THR D  1 46  ? -25.949 11.631  -15.527 1.00 70.64  ? 46  THR D CB  1 
ATOM   4125  O OG1 . THR D  1 46  ? -26.869 10.945  -14.686 1.00 61.07  ? 46  THR D OG1 1 
ATOM   4126  C CG2 . THR D  1 46  ? -26.356 11.446  -16.992 1.00 75.10  ? 46  THR D CG2 1 
ATOM   4127  N N   . MET D  1 47  ? -23.681 10.100  -13.141 1.00 57.90  ? 47  MET D N   1 
ATOM   4128  C CA  . MET D  1 47  ? -23.453 10.030  -11.696 1.00 54.13  ? 47  MET D CA  1 
ATOM   4129  C C   . MET D  1 47  ? -21.995 9.898   -11.313 1.00 58.25  ? 47  MET D C   1 
ATOM   4130  O O   . MET D  1 47  ? -21.354 8.909   -11.675 1.00 59.84  ? 47  MET D O   1 
ATOM   4131  C CB  . MET D  1 47  ? -24.249 8.868   -11.069 1.00 52.75  ? 47  MET D CB  1 
ATOM   4132  C CG  . MET D  1 47  ? -25.606 8.624   -11.690 1.00 55.66  ? 47  MET D CG  1 
ATOM   4133  S SD  . MET D  1 47  ? -26.552 7.275   -10.938 1.00 56.72  ? 47  MET D SD  1 
ATOM   4134  C CE  . MET D  1 47  ? -25.385 6.003   -11.014 1.00 54.53  ? 47  MET D CE  1 
ATOM   4135  N N   . LEU D  1 48  ? -21.476 10.861  -10.541 1.00 53.75  ? 48  LEU D N   1 
ATOM   4136  C CA  . LEU D  1 48  ? -20.100 10.798  -10.035 1.00 54.90  ? 48  LEU D CA  1 
ATOM   4137  C C   . LEU D  1 48  ? -20.015 9.721   -8.965  1.00 55.52  ? 48  LEU D C   1 
ATOM   4138  O O   . LEU D  1 48  ? -19.032 8.997   -8.887  1.00 55.54  ? 48  LEU D O   1 
ATOM   4139  C CB  . LEU D  1 48  ? -19.664 12.152  -9.472  1.00 57.23  ? 48  LEU D CB  1 
ATOM   4140  C CG  . LEU D  1 48  ? -18.823 13.001  -10.415 1.00 66.22  ? 48  LEU D CG  1 
ATOM   4141  C CD1 . LEU D  1 48  ? -18.966 14.431  -10.086 1.00 68.19  ? 48  LEU D CD1 1 
ATOM   4142  C CD2 . LEU D  1 48  ? -17.367 12.585  -10.391 1.00 69.82  ? 48  LEU D CD2 1 
ATOM   4143  N N   . VAL D  1 49  ? -21.078 9.596   -8.167  1.00 50.08  ? 49  VAL D N   1 
ATOM   4144  C CA  . VAL D  1 49  ? -21.228 8.555   -7.171  1.00 47.70  ? 49  VAL D CA  1 
ATOM   4145  C C   . VAL D  1 49  ? -22.200 7.562   -7.795  1.00 52.52  ? 49  VAL D C   1 
ATOM   4146  O O   . VAL D  1 49  ? -23.373 7.869   -8.009  1.00 49.88  ? 49  VAL D O   1 
ATOM   4147  C CB  . VAL D  1 49  ? -21.691 9.074   -5.789  1.00 49.01  ? 49  VAL D CB  1 
ATOM   4148  C CG1 . VAL D  1 49  ? -21.870 7.921   -4.805  1.00 46.75  ? 49  VAL D CG1 1 
ATOM   4149  C CG2 . VAL D  1 49  ? -20.710 10.095  -5.237  1.00 51.31  ? 49  VAL D CG2 1 
ATOM   4150  N N   . GLN D  1 50  ? -21.688 6.386   -8.129  1.00 53.10  ? 50  GLN D N   1 
ATOM   4151  C CA  . GLN D  1 50  ? -22.480 5.334   -8.749  1.00 53.59  ? 50  GLN D CA  1 
ATOM   4152  C C   . GLN D  1 50  ? -23.523 4.733   -7.805  1.00 57.86  ? 50  GLN D C   1 
ATOM   4153  O O   . GLN D  1 50  ? -23.221 4.410   -6.649  1.00 57.83  ? 50  GLN D O   1 
ATOM   4154  C CB  . GLN D  1 50  ? -21.568 4.246   -9.319  1.00 57.40  ? 50  GLN D CB  1 
ATOM   4155  C CG  . GLN D  1 50  ? -20.720 4.704   -10.505 1.00 77.22  ? 50  GLN D CG  1 
ATOM   4156  C CD  . GLN D  1 50  ? -21.515 4.773   -11.787 1.00 91.50  ? 50  GLN D CD  1 
ATOM   4157  O OE1 . GLN D  1 50  ? -22.028 3.761   -12.287 1.00 86.13  ? 50  GLN D OE1 1 
ATOM   4158  N NE2 . GLN D  1 50  ? -21.621 5.973   -12.349 1.00 78.75  ? 50  GLN D NE2 1 
ATOM   4159  N N   . LYS D  1 51  ? -24.768 4.627   -8.305  1.00 53.74  ? 51  LYS D N   1 
ATOM   4160  C CA  . LYS D  1 51  ? -25.933 4.042   -7.625  1.00 50.49  ? 51  LYS D CA  1 
ATOM   4161  C C   . LYS D  1 51  ? -26.542 3.039   -8.611  1.00 54.54  ? 51  LYS D C   1 
ATOM   4162  O O   . LYS D  1 51  ? -27.151 3.454   -9.598  1.00 53.54  ? 51  LYS D O   1 
ATOM   4163  C CB  . LYS D  1 51  ? -26.969 5.123   -7.253  1.00 50.31  ? 51  LYS D CB  1 
ATOM   4164  C CG  . LYS D  1 51  ? -26.404 6.388   -6.600  1.00 56.09  ? 51  LYS D CG  1 
ATOM   4165  C CD  . LYS D  1 51  ? -26.221 6.276   -5.104  1.00 55.04  ? 51  LYS D CD  1 
ATOM   4166  C CE  . LYS D  1 51  ? -25.744 7.581   -4.543  1.00 58.72  ? 51  LYS D CE  1 
ATOM   4167  N NZ  . LYS D  1 51  ? -24.895 7.375   -3.349  1.00 79.00  ? 51  LYS D NZ  1 
ATOM   4168  N N   . ASN D  1 52  ? -26.300 1.721   -8.393  1.00 52.79  ? 52  ASN D N   1 
ATOM   4169  C CA  . ASN D  1 52  ? -26.812 0.646   -9.259  1.00 53.80  ? 52  ASN D CA  1 
ATOM   4170  C C   . ASN D  1 52  ? -28.335 0.460   -9.188  1.00 56.52  ? 52  ASN D C   1 
ATOM   4171  O O   . ASN D  1 52  ? -28.921 -0.067  -10.132 1.00 58.69  ? 52  ASN D O   1 
ATOM   4172  C CB  . ASN D  1 52  ? -26.099 -0.660  -8.994  1.00 53.85  ? 52  ASN D CB  1 
ATOM   4173  C CG  . ASN D  1 52  ? -24.713 -0.752  -9.570  1.00 69.55  ? 52  ASN D CG  1 
ATOM   4174  O OD1 . ASN D  1 52  ? -24.284 0.058   -10.411 1.00 53.88  ? 52  ASN D OD1 1 
ATOM   4175  N ND2 . ASN D  1 52  ? -23.989 -1.766  -9.122  1.00 68.17  ? 52  ASN D ND2 1 
ATOM   4176  N N   . VAL D  1 53  ? -28.972 0.909   -8.095  1.00 49.63  ? 53  VAL D N   1 
ATOM   4177  C CA  . VAL D  1 53  ? -30.424 0.847   -7.940  1.00 48.74  ? 53  VAL D CA  1 
ATOM   4178  C C   . VAL D  1 53  ? -31.022 2.278   -8.030  1.00 52.05  ? 53  VAL D C   1 
ATOM   4179  O O   . VAL D  1 53  ? -30.422 3.255   -7.576  1.00 48.62  ? 53  VAL D O   1 
ATOM   4180  C CB  . VAL D  1 53  ? -30.864 0.098   -6.648  1.00 50.74  ? 53  VAL D CB  1 
ATOM   4181  C CG1 . VAL D  1 53  ? -32.387 0.028   -6.525  1.00 49.91  ? 53  VAL D CG1 1 
ATOM   4182  C CG2 . VAL D  1 53  ? -30.249 -1.298  -6.576  1.00 52.20  ? 53  VAL D CG2 1 
ATOM   4183  N N   . THR D  1 54  ? -32.184 2.379   -8.668  1.00 50.81  ? 54  THR D N   1 
ATOM   4184  C CA  . THR D  1 54  ? -32.937 3.609   -8.805  1.00 49.74  ? 54  THR D CA  1 
ATOM   4185  C C   . THR D  1 54  ? -34.264 3.396   -8.094  1.00 53.54  ? 54  THR D C   1 
ATOM   4186  O O   . THR D  1 54  ? -34.941 2.393   -8.338  1.00 55.58  ? 54  THR D O   1 
ATOM   4187  C CB  . THR D  1 54  ? -33.057 4.006   -10.281 1.00 55.78  ? 54  THR D CB  1 
ATOM   4188  O OG1 . THR D  1 54  ? -31.798 4.537   -10.688 1.00 56.44  ? 54  THR D OG1 1 
ATOM   4189  C CG2 . THR D  1 54  ? -34.145 5.055   -10.531 1.00 50.83  ? 54  THR D CG2 1 
ATOM   4190  N N   . SER D  1 55  ? -34.607 4.322   -7.189  1.00 46.88  ? 55  SER D N   1 
ATOM   4191  C CA  . SER D  1 55  ? -35.855 4.302   -6.437  1.00 45.56  ? 55  SER D CA  1 
ATOM   4192  C C   . SER D  1 55  ? -36.651 5.537   -6.843  1.00 51.06  ? 55  SER D C   1 
ATOM   4193  O O   . SER D  1 55  ? -36.150 6.664   -6.707  1.00 51.43  ? 55  SER D O   1 
ATOM   4194  C CB  . SER D  1 55  ? -35.569 4.317   -4.934  1.00 45.08  ? 55  SER D CB  1 
ATOM   4195  O OG  . SER D  1 55  ? -36.710 4.636   -4.156  1.00 54.46  ? 55  SER D OG  1 
ATOM   4196  N N   . GLU D  1 56  ? -37.871 5.334   -7.370  1.00 47.29  ? 56  GLU D N   1 
ATOM   4197  C CA  . GLU D  1 56  ? -38.771 6.442   -7.744  1.00 45.97  ? 56  GLU D CA  1 
ATOM   4198  C C   . GLU D  1 56  ? -39.843 6.485   -6.656  1.00 48.14  ? 56  GLU D C   1 
ATOM   4199  O O   . GLU D  1 56  ? -40.536 5.480   -6.474  1.00 49.23  ? 56  GLU D O   1 
ATOM   4200  C CB  . GLU D  1 56  ? -39.451 6.173   -9.091  1.00 49.85  ? 56  GLU D CB  1 
ATOM   4201  C CG  . GLU D  1 56  ? -38.560 6.143   -10.311 1.00 54.11  ? 56  GLU D CG  1 
ATOM   4202  C CD  . GLU D  1 56  ? -39.340 5.946   -11.595 1.00 76.76  ? 56  GLU D CD  1 
ATOM   4203  O OE1 . GLU D  1 56  ? -40.513 5.512   -11.534 1.00 59.73  ? 56  GLU D OE1 1 
ATOM   4204  O OE2 . GLU D  1 56  ? -38.781 6.248   -12.670 1.00 85.23  ? 56  GLU D OE2 1 
ATOM   4205  N N   . SER D  1 57  ? -39.953 7.591   -5.899  1.00 42.87  ? 57  SER D N   1 
ATOM   4206  C CA  . SER D  1 57  ? -40.955 7.652   -4.833  1.00 43.27  ? 57  SER D CA  1 
ATOM   4207  C C   . SER D  1 57  ? -41.714 8.994   -4.670  1.00 51.11  ? 57  SER D C   1 
ATOM   4208  O O   . SER D  1 57  ? -41.210 10.104  -4.921  1.00 50.23  ? 57  SER D O   1 
ATOM   4209  C CB  . SER D  1 57  ? -40.370 7.237   -3.489  1.00 43.83  ? 57  SER D CB  1 
ATOM   4210  O OG  . SER D  1 57  ? -39.308 8.089   -3.109  1.00 51.65  ? 57  SER D OG  1 
ATOM   4211  N N   . THR D  1 58  ? -42.957 8.841   -4.198  1.00 49.69  ? 58  THR D N   1 
ATOM   4212  C CA  . THR D  1 58  ? -43.865 9.924   -3.925  1.00 49.33  ? 58  THR D CA  1 
ATOM   4213  C C   . THR D  1 58  ? -44.502 9.676   -2.535  1.00 52.28  ? 58  THR D C   1 
ATOM   4214  O O   . THR D  1 58  ? -44.656 8.531   -2.122  1.00 51.97  ? 58  THR D O   1 
ATOM   4215  C CB  . THR D  1 58  ? -44.766 10.121  -5.127  1.00 56.22  ? 58  THR D CB  1 
ATOM   4216  O OG1 . THR D  1 58  ? -45.007 11.507  -5.280  1.00 61.64  ? 58  THR D OG1 1 
ATOM   4217  C CG2 . THR D  1 58  ? -46.025 9.305   -5.092  1.00 51.21  ? 58  THR D CG2 1 
ATOM   4218  N N   . CYS D  1 59  ? -44.709 10.755  -1.772  1.00 49.79  ? 59  CYS D N   1 
ATOM   4219  C CA  . CYS D  1 59  ? -45.220 10.749  -0.400  1.00 50.81  ? 59  CYS D CA  1 
ATOM   4220  C C   . CYS D  1 59  ? -46.487 11.589  -0.240  1.00 56.30  ? 59  CYS D C   1 
ATOM   4221  O O   . CYS D  1 59  ? -46.653 12.592  -0.938  1.00 57.18  ? 59  CYS D O   1 
ATOM   4222  C CB  . CYS D  1 59  ? -44.139 11.219  0.564   1.00 50.45  ? 59  CYS D CB  1 
ATOM   4223  S SG  . CYS D  1 59  ? -42.703 10.112  0.695   1.00 54.33  ? 59  CYS D SG  1 
ATOM   4224  N N   . CYS D  1 60  ? -47.357 11.201  0.718   1.00 52.16  ? 60  CYS D N   1 
ATOM   4225  C CA  . CYS D  1 60  ? -48.589 11.923  1.022   1.00 51.94  ? 60  CYS D CA  1 
ATOM   4226  C C   . CYS D  1 60  ? -48.307 13.221  1.793   1.00 51.49  ? 60  CYS D C   1 
ATOM   4227  O O   . CYS D  1 60  ? -47.836 13.197  2.940   1.00 48.34  ? 60  CYS D O   1 
ATOM   4228  C CB  . CYS D  1 60  ? -49.587 11.038  1.754   1.00 54.25  ? 60  CYS D CB  1 
ATOM   4229  S SG  . CYS D  1 60  ? -51.177 11.845  2.028   1.00 60.75  ? 60  CYS D SG  1 
ATOM   4230  N N   . VAL D  1 61  ? -48.577 14.361  1.138   1.00 48.06  ? 61  VAL D N   1 
ATOM   4231  C CA  . VAL D  1 61  ? -48.303 15.706  1.678   1.00 46.22  ? 61  VAL D CA  1 
ATOM   4232  C C   . VAL D  1 61  ? -49.392 16.753  1.375   1.00 50.25  ? 61  VAL D C   1 
ATOM   4233  O O   . VAL D  1 61  ? -50.080 16.663  0.357   1.00 49.48  ? 61  VAL D O   1 
ATOM   4234  C CB  . VAL D  1 61  ? -46.922 16.226  1.224   1.00 47.33  ? 61  VAL D CB  1 
ATOM   4235  C CG1 . VAL D  1 61  ? -45.807 15.406  1.827   1.00 45.69  ? 61  VAL D CG1 1 
ATOM   4236  C CG2 . VAL D  1 61  ? -46.805 16.235  -0.291  1.00 47.81  ? 61  VAL D CG2 1 
ATOM   4237  N N   . ALA D  1 62  ? -49.470 17.785  2.237   1.00 47.35  ? 62  ALA D N   1 
ATOM   4238  C CA  . ALA D  1 62  ? -50.372 18.919  2.089   1.00 49.49  ? 62  ALA D CA  1 
ATOM   4239  C C   . ALA D  1 62  ? -50.036 19.740  0.858   1.00 55.88  ? 62  ALA D C   1 
ATOM   4240  O O   . ALA D  1 62  ? -48.895 20.197  0.697   1.00 54.71  ? 62  ALA D O   1 
ATOM   4241  C CB  . ALA D  1 62  ? -50.330 19.804  3.322   1.00 50.51  ? 62  ALA D CB  1 
ATOM   4242  N N   . LYS D  1 63  ? -51.037 19.905  -0.026  1.00 54.89  ? 63  LYS D N   1 
ATOM   4243  C CA  . LYS D  1 63  ? -50.898 20.720  -1.222  1.00 56.22  ? 63  LYS D CA  1 
ATOM   4244  C C   . LYS D  1 63  ? -51.063 22.166  -0.762  1.00 61.36  ? 63  LYS D C   1 
ATOM   4245  O O   . LYS D  1 63  ? -50.581 23.079  -1.424  1.00 62.71  ? 63  LYS D O   1 
ATOM   4246  C CB  . LYS D  1 63  ? -51.976 20.354  -2.248  1.00 61.26  ? 63  LYS D CB  1 
ATOM   4247  C CG  . LYS D  1 63  ? -51.721 20.921  -3.643  1.00 81.34  ? 63  LYS D CG  1 
ATOM   4248  C CD  . LYS D  1 63  ? -52.949 20.788  -4.549  1.00 96.80  ? 63  LYS D CD  1 
ATOM   4249  C CE  . LYS D  1 63  ? -52.672 21.165  -5.991  1.00 111.64 ? 63  LYS D CE  1 
ATOM   4250  N NZ  . LYS D  1 63  ? -51.838 20.151  -6.700  1.00 119.44 ? 63  LYS D NZ  1 
ATOM   4251  N N   . SER D  1 64  ? -51.725 22.359  0.402   1.00 57.83  ? 64  SER D N   1 
ATOM   4252  C CA  . SER D  1 64  ? -52.036 23.657  1.014   1.00 59.13  ? 64  SER D CA  1 
ATOM   4253  C C   . SER D  1 64  ? -52.455 23.489  2.475   1.00 64.71  ? 64  SER D C   1 
ATOM   4254  O O   . SER D  1 64  ? -52.983 22.438  2.840   1.00 64.42  ? 64  SER D O   1 
ATOM   4255  C CB  . SER D  1 64  ? -53.184 24.315  0.256   1.00 61.59  ? 64  SER D CB  1 
ATOM   4256  O OG  . SER D  1 64  ? -54.297 23.440  0.204   1.00 56.86  ? 64  SER D OG  1 
ATOM   4257  N N   . TYR D  1 65  ? -52.260 24.525  3.295   1.00 63.27  ? 65  TYR D N   1 
ATOM   4258  C CA  . TYR D  1 65  ? -52.681 24.488  4.694   1.00 64.92  ? 65  TYR D CA  1 
ATOM   4259  C C   . TYR D  1 65  ? -52.927 25.880  5.268   1.00 74.24  ? 65  TYR D C   1 
ATOM   4260  O O   . TYR D  1 65  ? -52.699 26.886  4.590   1.00 76.29  ? 65  TYR D O   1 
ATOM   4261  C CB  . TYR D  1 65  ? -51.679 23.715  5.572   1.00 64.52  ? 65  TYR D CB  1 
ATOM   4262  C CG  . TYR D  1 65  ? -50.293 24.326  5.626   1.00 67.67  ? 65  TYR D CG  1 
ATOM   4263  C CD1 . TYR D  1 65  ? -49.300 23.926  4.739   1.00 67.83  ? 65  TYR D CD1 1 
ATOM   4264  C CD2 . TYR D  1 65  ? -49.963 25.272  6.594   1.00 71.00  ? 65  TYR D CD2 1 
ATOM   4265  C CE1 . TYR D  1 65  ? -48.018 24.466  4.795   1.00 68.93  ? 65  TYR D CE1 1 
ATOM   4266  C CE2 . TYR D  1 65  ? -48.692 25.838  6.645   1.00 72.95  ? 65  TYR D CE2 1 
ATOM   4267  C CZ  . TYR D  1 65  ? -47.714 25.415  5.757   1.00 81.85  ? 65  TYR D CZ  1 
ATOM   4268  O OH  . TYR D  1 65  ? -46.442 25.944  5.813   1.00 87.03  ? 65  TYR D OH  1 
ATOM   4269  N N   . ASN D  1 66  ? -53.367 25.928  6.536   1.00 72.50  ? 66  ASN D N   1 
ATOM   4270  C CA  . ASN D  1 66  ? -53.575 27.159  7.288   1.00 75.77  ? 66  ASN D CA  1 
ATOM   4271  C C   . ASN D  1 66  ? -52.916 26.994  8.648   1.00 81.34  ? 66  ASN D C   1 
ATOM   4272  O O   . ASN D  1 66  ? -53.186 26.011  9.337   1.00 79.95  ? 66  ASN D O   1 
ATOM   4273  C CB  . ASN D  1 66  ? -55.070 27.481  7.452   1.00 77.62  ? 66  ASN D CB  1 
ATOM   4274  C CG  . ASN D  1 66  ? -55.846 27.770  6.183   1.00 86.18  ? 66  ASN D CG  1 
ATOM   4275  O OD1 . ASN D  1 66  ? -57.045 27.479  6.107   1.00 83.05  ? 66  ASN D OD1 1 
ATOM   4276  N ND2 . ASN D  1 66  ? -55.218 28.388  5.179   1.00 69.35  ? 66  ASN D ND2 1 
ATOM   4277  N N   . ARG D  1 67  ? -52.031 27.928  9.023   1.00 81.02  ? 67  ARG D N   1 
ATOM   4278  C CA  . ARG D  1 67  ? -51.339 27.890  10.309  1.00 82.24  ? 67  ARG D CA  1 
ATOM   4279  C C   . ARG D  1 67  ? -52.313 28.363  11.402  1.00 92.10  ? 67  ARG D C   1 
ATOM   4280  O O   . ARG D  1 67  ? -52.870 29.458  11.296  1.00 94.46  ? 67  ARG D O   1 
ATOM   4281  C CB  . ARG D  1 67  ? -50.092 28.774  10.256  1.00 82.54  ? 67  ARG D CB  1 
ATOM   4282  C CG  . ARG D  1 67  ? -48.819 28.047  10.601  1.00 91.00  ? 67  ARG D CG  1 
ATOM   4283  C CD  . ARG D  1 67  ? -47.618 28.770  10.025  1.00 108.56 ? 67  ARG D CD  1 
ATOM   4284  N NE  . ARG D  1 67  ? -47.390 28.426  8.618   1.00 119.80 ? 67  ARG D NE  1 
ATOM   4285  C CZ  . ARG D  1 67  ? -46.469 28.993  7.841   1.00 135.19 ? 67  ARG D CZ  1 
ATOM   4286  N NH1 . ARG D  1 67  ? -45.679 29.948  8.321   1.00 124.63 ? 67  ARG D NH1 1 
ATOM   4287  N NH2 . ARG D  1 67  ? -46.335 28.614  6.577   1.00 118.78 ? 67  ARG D NH2 1 
ATOM   4288  N N   . VAL D  1 68  ? -52.570 27.506  12.414  1.00 90.35  ? 68  VAL D N   1 
ATOM   4289  C CA  . VAL D  1 68  ? -53.495 27.785  13.530  1.00 93.76  ? 68  VAL D CA  1 
ATOM   4290  C C   . VAL D  1 68  ? -52.859 27.471  14.886  1.00 101.47 ? 68  VAL D C   1 
ATOM   4291  O O   . VAL D  1 68  ? -51.922 26.668  14.952  1.00 99.29  ? 68  VAL D O   1 
ATOM   4292  C CB  . VAL D  1 68  ? -54.858 27.067  13.375  1.00 97.02  ? 68  VAL D CB  1 
ATOM   4293  C CG1 . VAL D  1 68  ? -55.644 27.616  12.193  1.00 97.08  ? 68  VAL D CG1 1 
ATOM   4294  C CG2 . VAL D  1 68  ? -54.695 25.552  13.266  1.00 93.93  ? 68  VAL D CG2 1 
ATOM   4295  N N   . THR D  1 69  ? -53.379 28.082  15.967  1.00 103.11 ? 69  THR D N   1 
ATOM   4296  C CA  . THR D  1 69  ? -52.862 27.831  17.310  1.00 106.07 ? 69  THR D CA  1 
ATOM   4297  C C   . THR D  1 69  ? -53.961 27.210  18.164  1.00 112.93 ? 69  THR D C   1 
ATOM   4298  O O   . THR D  1 69  ? -54.972 27.848  18.449  1.00 115.32 ? 69  THR D O   1 
ATOM   4299  C CB  . THR D  1 69  ? -52.184 29.068  17.892  1.00 120.12 ? 69  THR D CB  1 
ATOM   4300  O OG1 . THR D  1 69  ? -51.226 29.537  16.939  1.00 120.04 ? 69  THR D OG1 1 
ATOM   4301  C CG2 . THR D  1 69  ? -51.475 28.777  19.208  1.00 122.08 ? 69  THR D CG2 1 
ATOM   4302  N N   . VAL D  1 70  ? -53.762 25.936  18.526  1.00 109.14 ? 70  VAL D N   1 
ATOM   4303  C CA  . VAL D  1 70  ? -54.703 25.100  19.277  1.00 111.14 ? 70  VAL D CA  1 
ATOM   4304  C C   . VAL D  1 70  ? -54.142 24.709  20.643  1.00 120.92 ? 70  VAL D C   1 
ATOM   4305  O O   . VAL D  1 70  ? -52.940 24.890  20.869  1.00 121.13 ? 70  VAL D O   1 
ATOM   4306  C CB  . VAL D  1 70  ? -55.076 23.846  18.442  1.00 110.93 ? 70  VAL D CB  1 
ATOM   4307  C CG1 . VAL D  1 70  ? -55.376 24.225  16.999  1.00 107.60 ? 70  VAL D CG1 1 
ATOM   4308  C CG2 . VAL D  1 70  ? -53.980 22.785  18.497  1.00 108.33 ? 70  VAL D CG2 1 
ATOM   4309  N N   . MET D  1 71  ? -55.000 24.128  21.533  1.00 121.94 ? 71  MET D N   1 
ATOM   4310  C CA  . MET D  1 71  ? -54.637 23.649  22.881  1.00 126.63 ? 71  MET D CA  1 
ATOM   4311  C C   . MET D  1 71  ? -53.766 24.692  23.594  1.00 132.71 ? 71  MET D C   1 
ATOM   4312  O O   . MET D  1 71  ? -52.627 24.414  24.007  1.00 131.68 ? 71  MET D O   1 
ATOM   4313  C CB  . MET D  1 71  ? -53.914 22.286  22.798  1.00 127.47 ? 71  MET D CB  1 
ATOM   4314  C CG  . MET D  1 71  ? -54.834 21.095  22.603  1.00 131.48 ? 71  MET D CG  1 
ATOM   4315  S SD  . MET D  1 71  ? -53.919 19.552  22.286  1.00 133.94 ? 71  MET D SD  1 
ATOM   4316  C CE  . MET D  1 71  ? -53.158 19.244  23.923  1.00 136.54 ? 71  MET D CE  1 
ATOM   4317  N N   . GLY D  1 72  ? -54.298 25.909  23.645  1.00 131.81 ? 72  GLY D N   1 
ATOM   4318  C CA  . GLY D  1 72  ? -53.607 27.057  24.209  1.00 135.01 ? 72  GLY D CA  1 
ATOM   4319  C C   . GLY D  1 72  ? -52.546 27.598  23.267  1.00 133.88 ? 72  GLY D C   1 
ATOM   4320  O O   . GLY D  1 72  ? -52.820 28.537  22.508  1.00 133.45 ? 72  GLY D O   1 
ATOM   4321  N N   . GLY D  1 73  ? -51.350 26.993  23.303  1.00 125.72 ? 73  GLY D N   1 
ATOM   4322  C CA  . GLY D  1 73  ? -50.221 27.449  22.501  1.00 121.69 ? 73  GLY D CA  1 
ATOM   4323  C C   . GLY D  1 73  ? -49.472 26.415  21.691  1.00 118.18 ? 73  GLY D C   1 
ATOM   4324  O O   . GLY D  1 73  ? -48.301 26.144  21.970  1.00 118.80 ? 73  GLY D O   1 
ATOM   4325  N N   . PHE D  1 74  ? -50.116 25.865  20.654  1.00 107.94 ? 74  PHE D N   1 
ATOM   4326  C CA  . PHE D  1 74  ? -49.482 24.903  19.752  1.00 101.86 ? 74  PHE D CA  1 
ATOM   4327  C C   . PHE D  1 74  ? -49.699 25.329  18.320  1.00 100.59 ? 74  PHE D C   1 
ATOM   4328  O O   . PHE D  1 74  ? -50.818 25.225  17.809  1.00 100.07 ? 74  PHE D O   1 
ATOM   4329  C CB  . PHE D  1 74  ? -49.992 23.474  19.971  1.00 102.27 ? 74  PHE D CB  1 
ATOM   4330  C CG  . PHE D  1 74  ? -49.334 22.736  21.105  1.00 106.44 ? 74  PHE D CG  1 
ATOM   4331  C CD1 . PHE D  1 74  ? -47.957 22.544  21.125  1.00 108.93 ? 74  PHE D CD1 1 
ATOM   4332  C CD2 . PHE D  1 74  ? -50.095 22.175  22.122  1.00 112.02 ? 74  PHE D CD2 1 
ATOM   4333  C CE1 . PHE D  1 74  ? -47.350 21.840  22.164  1.00 113.11 ? 74  PHE D CE1 1 
ATOM   4334  C CE2 . PHE D  1 74  ? -49.487 21.474  23.164  1.00 118.27 ? 74  PHE D CE2 1 
ATOM   4335  C CZ  . PHE D  1 74  ? -48.119 21.313  23.180  1.00 115.99 ? 74  PHE D CZ  1 
ATOM   4336  N N   . LYS D  1 75  ? -48.641 25.848  17.682  1.00 93.22  ? 75  LYS D N   1 
ATOM   4337  C CA  . LYS D  1 75  ? -48.701 26.308  16.300  1.00 88.74  ? 75  LYS D CA  1 
ATOM   4338  C C   . LYS D  1 75  ? -48.693 25.073  15.402  1.00 85.05  ? 75  LYS D C   1 
ATOM   4339  O O   . LYS D  1 75  ? -47.651 24.413  15.261  1.00 83.85  ? 75  LYS D O   1 
ATOM   4340  C CB  . LYS D  1 75  ? -47.536 27.274  15.984  1.00 92.53  ? 75  LYS D CB  1 
ATOM   4341  C CG  . LYS D  1 75  ? -47.712 28.696  16.530  1.00 110.78 ? 75  LYS D CG  1 
ATOM   4342  C CD  . LYS D  1 75  ? -46.488 29.581  16.242  1.00 122.12 ? 75  LYS D CD  1 
ATOM   4343  C CE  . LYS D  1 75  ? -46.712 31.038  16.592  1.00 135.43 ? 75  LYS D CE  1 
ATOM   4344  N NZ  . LYS D  1 75  ? -45.508 31.871  16.313  1.00 143.30 ? 75  LYS D NZ  1 
ATOM   4345  N N   . VAL D  1 76  ? -49.879 24.727  14.855  1.00 76.80  ? 76  VAL D N   1 
ATOM   4346  C CA  . VAL D  1 76  ? -50.096 23.560  13.983  1.00 71.75  ? 76  VAL D CA  1 
ATOM   4347  C C   . VAL D  1 76  ? -50.609 23.952  12.594  1.00 73.41  ? 76  VAL D C   1 
ATOM   4348  O O   . VAL D  1 76  ? -51.288 24.976  12.449  1.00 75.77  ? 76  VAL D O   1 
ATOM   4349  C CB  . VAL D  1 76  ? -51.039 22.508  14.623  1.00 75.33  ? 76  VAL D CB  1 
ATOM   4350  C CG1 . VAL D  1 76  ? -50.378 21.793  15.777  1.00 76.46  ? 76  VAL D CG1 1 
ATOM   4351  C CG2 . VAL D  1 76  ? -52.355 23.126  15.062  1.00 78.08  ? 76  VAL D CG2 1 
ATOM   4352  N N   . GLU D  1 77  ? -50.325 23.109  11.588  1.00 64.98  ? 77  GLU D N   1 
ATOM   4353  C CA  . GLU D  1 77  ? -50.824 23.276  10.221  1.00 62.96  ? 77  GLU D CA  1 
ATOM   4354  C C   . GLU D  1 77  ? -52.202 22.606  10.155  1.00 63.28  ? 77  GLU D C   1 
ATOM   4355  O O   . GLU D  1 77  ? -52.376 21.537  10.729  1.00 61.30  ? 77  GLU D O   1 
ATOM   4356  C CB  . GLU D  1 77  ? -49.902 22.580  9.202   1.00 61.83  ? 77  GLU D CB  1 
ATOM   4357  C CG  . GLU D  1 77  ? -48.465 23.058  9.182   1.00 73.75  ? 77  GLU D CG  1 
ATOM   4358  C CD  . GLU D  1 77  ? -47.557 22.388  8.166   1.00 103.48 ? 77  GLU D CD  1 
ATOM   4359  O OE1 . GLU D  1 77  ? -47.873 21.265  7.705   1.00 88.71  ? 77  GLU D OE1 1 
ATOM   4360  O OE2 . GLU D  1 77  ? -46.497 22.980  7.861   1.00 110.95 ? 77  GLU D OE2 1 
ATOM   4361  N N   . ASN D  1 78  ? -53.175 23.235  9.482   1.00 60.75  ? 78  ASN D N   1 
ATOM   4362  C CA  . ASN D  1 78  ? -54.537 22.703  9.285   1.00 60.97  ? 78  ASN D CA  1 
ATOM   4363  C C   . ASN D  1 78  ? -54.636 22.528  7.790   1.00 62.80  ? 78  ASN D C   1 
ATOM   4364  O O   . ASN D  1 78  ? -54.825 23.508  7.069   1.00 63.33  ? 78  ASN D O   1 
ATOM   4365  C CB  . ASN D  1 78  ? -55.623 23.656  9.826   1.00 62.35  ? 78  ASN D CB  1 
ATOM   4366  C CG  . ASN D  1 78  ? -56.967 23.007  10.086  1.00 84.27  ? 78  ASN D CG  1 
ATOM   4367  O OD1 . ASN D  1 78  ? -57.078 21.771  10.123  1.00 84.23  ? 78  ASN D OD1 1 
ATOM   4368  N ND2 . ASN D  1 78  ? -58.019 23.838  10.284  1.00 73.04  ? 78  ASN D ND2 1 
ATOM   4369  N N   . HIS D  1 79  ? -54.359 21.302  7.314   1.00 56.69  ? 79  HIS D N   1 
ATOM   4370  C CA  . HIS D  1 79  ? -54.287 21.004  5.887   1.00 54.77  ? 79  HIS D CA  1 
ATOM   4371  C C   . HIS D  1 79  ? -55.607 21.223  5.198   1.00 61.79  ? 79  HIS D C   1 
ATOM   4372  O O   . HIS D  1 79  ? -56.650 20.834  5.717   1.00 63.20  ? 79  HIS D O   1 
ATOM   4373  C CB  . HIS D  1 79  ? -53.700 19.610  5.611   1.00 52.88  ? 79  HIS D CB  1 
ATOM   4374  C CG  . HIS D  1 79  ? -52.338 19.381  6.207   1.00 53.88  ? 79  HIS D CG  1 
ATOM   4375  N ND1 . HIS D  1 79  ? -51.858 18.107  6.421   1.00 53.99  ? 79  HIS D ND1 1 
ATOM   4376  C CD2 . HIS D  1 79  ? -51.393 20.274  6.600   1.00 54.75  ? 79  HIS D CD2 1 
ATOM   4377  C CE1 . HIS D  1 79  ? -50.651 18.264  6.938   1.00 51.87  ? 79  HIS D CE1 1 
ATOM   4378  N NE2 . HIS D  1 79  ? -50.333 19.552  7.065   1.00 52.63  ? 79  HIS D NE2 1 
ATOM   4379  N N   . THR D  1 80  ? -55.559 21.947  4.077   1.00 59.50  ? 80  THR D N   1 
ATOM   4380  C CA  . THR D  1 80  ? -56.725 22.305  3.282   1.00 62.17  ? 80  THR D CA  1 
ATOM   4381  C C   . THR D  1 80  ? -56.828 21.361  2.066   1.00 66.71  ? 80  THR D C   1 
ATOM   4382  O O   . THR D  1 80  ? -57.939 21.060  1.618   1.00 70.94  ? 80  THR D O   1 
ATOM   4383  C CB  . THR D  1 80  ? -56.744 23.824  2.973   1.00 70.55  ? 80  THR D CB  1 
ATOM   4384  O OG1 . THR D  1 80  ? -55.462 24.257  2.528   1.00 70.56  ? 80  THR D OG1 1 
ATOM   4385  C CG2 . THR D  1 80  ? -57.108 24.657  4.189   1.00 67.67  ? 80  THR D CG2 1 
ATOM   4386  N N   . ALA D  1 81  ? -55.683 20.841  1.586   1.00 58.64  ? 81  ALA D N   1 
ATOM   4387  C CA  . ALA D  1 81  ? -55.602 19.886  0.482   1.00 58.25  ? 81  ALA D CA  1 
ATOM   4388  C C   . ALA D  1 81  ? -54.384 18.945  0.636   1.00 62.64  ? 81  ALA D C   1 
ATOM   4389  O O   . ALA D  1 81  ? -53.431 19.296  1.331   1.00 60.36  ? 81  ALA D O   1 
ATOM   4390  C CB  . ALA D  1 81  ? -55.528 20.625  -0.839  1.00 60.39  ? 81  ALA D CB  1 
ATOM   4391  N N   . CYS D  1 82  ? -54.429 17.758  -0.024  1.00 61.50  ? 82  CYS D N   1 
ATOM   4392  C CA  . CYS D  1 82  ? -53.392 16.711  -0.068  1.00 59.36  ? 82  CYS D CA  1 
ATOM   4393  C C   . CYS D  1 82  ? -53.059 16.377  -1.496  1.00 66.08  ? 82  CYS D C   1 
ATOM   4394  O O   . CYS D  1 82  ? -53.809 16.731  -2.400  1.00 69.65  ? 82  CYS D O   1 
ATOM   4395  C CB  . CYS D  1 82  ? -53.848 15.456  0.667   1.00 60.22  ? 82  CYS D CB  1 
ATOM   4396  S SG  . CYS D  1 82  ? -54.450 15.756  2.341   1.00 64.82  ? 82  CYS D SG  1 
ATOM   4397  N N   . HIS D  1 83  ? -51.963 15.633  -1.690  1.00 62.09  ? 83  HIS D N   1 
ATOM   4398  C CA  . HIS D  1 83  ? -51.452 15.120  -2.967  1.00 62.95  ? 83  HIS D CA  1 
ATOM   4399  C C   . HIS D  1 83  ? -50.174 14.364  -2.734  1.00 61.51  ? 83  HIS D C   1 
ATOM   4400  O O   . HIS D  1 83  ? -49.467 14.642  -1.768  1.00 57.69  ? 83  HIS D O   1 
ATOM   4401  C CB  . HIS D  1 83  ? -51.295 16.211  -4.069  1.00 66.24  ? 83  HIS D CB  1 
ATOM   4402  C CG  . HIS D  1 83  ? -50.123 17.140  -3.951  1.00 68.48  ? 83  HIS D CG  1 
ATOM   4403  N ND1 . HIS D  1 83  ? -49.638 17.559  -2.719  1.00 68.68  ? 83  HIS D ND1 1 
ATOM   4404  C CD2 . HIS D  1 83  ? -49.418 17.753  -4.927  1.00 71.50  ? 83  HIS D CD2 1 
ATOM   4405  C CE1 . HIS D  1 83  ? -48.631 18.375  -2.987  1.00 67.74  ? 83  HIS D CE1 1 
ATOM   4406  N NE2 . HIS D  1 83  ? -48.461 18.523  -4.302  1.00 69.86  ? 83  HIS D NE2 1 
ATOM   4407  N N   . CYS D  1 84  ? -49.910 13.374  -3.588  1.00 58.96  ? 84  CYS D N   1 
ATOM   4408  C CA  . CYS D  1 84  ? -48.707 12.559  -3.541  1.00 56.64  ? 84  CYS D CA  1 
ATOM   4409  C C   . CYS D  1 84  ? -47.662 13.365  -4.297  1.00 57.43  ? 84  CYS D C   1 
ATOM   4410  O O   . CYS D  1 84  ? -47.817 13.594  -5.503  1.00 58.40  ? 84  CYS D O   1 
ATOM   4411  C CB  . CYS D  1 84  ? -48.948 11.198  -4.192  1.00 59.93  ? 84  CYS D CB  1 
ATOM   4412  S SG  . CYS D  1 84  ? -50.094 10.115  -3.288  1.00 66.33  ? 84  CYS D SG  1 
ATOM   4413  N N   . SER D  1 85  ? -46.654 13.888  -3.567  1.00 50.74  ? 85  SER D N   1 
ATOM   4414  C CA  . SER D  1 85  ? -45.579 14.694  -4.138  1.00 49.88  ? 85  SER D CA  1 
ATOM   4415  C C   . SER D  1 85  ? -44.216 14.230  -3.620  1.00 51.21  ? 85  SER D C   1 
ATOM   4416  O O   . SER D  1 85  ? -44.133 13.160  -3.039  1.00 49.96  ? 85  SER D O   1 
ATOM   4417  C CB  . SER D  1 85  ? -45.819 16.179  -3.880  1.00 54.11  ? 85  SER D CB  1 
ATOM   4418  O OG  . SER D  1 85  ? -44.890 16.992  -4.581  1.00 63.45  ? 85  SER D OG  1 
ATOM   4419  N N   . THR D  1 86  ? -43.156 15.021  -3.846  1.00 47.26  ? 86  THR D N   1 
ATOM   4420  C CA  . THR D  1 86  ? -41.772 14.764  -3.465  1.00 45.20  ? 86  THR D CA  1 
ATOM   4421  C C   . THR D  1 86  ? -41.605 14.353  -2.004  1.00 47.75  ? 86  THR D C   1 
ATOM   4422  O O   . THR D  1 86  ? -42.133 15.006  -1.111  1.00 46.36  ? 86  THR D O   1 
ATOM   4423  C CB  . THR D  1 86  ? -40.948 16.002  -3.834  1.00 52.81  ? 86  THR D CB  1 
ATOM   4424  O OG1 . THR D  1 86  ? -41.103 16.235  -5.234  1.00 53.25  ? 86  THR D OG1 1 
ATOM   4425  C CG2 . THR D  1 86  ? -39.465 15.869  -3.496  1.00 51.54  ? 86  THR D CG2 1 
ATOM   4426  N N   . CYS D  1 87  ? -40.867 13.256  -1.784  1.00 46.21  ? 87  CYS D N   1 
ATOM   4427  C CA  . CYS D  1 87  ? -40.493 12.754  -0.464  1.00 46.57  ? 87  CYS D CA  1 
ATOM   4428  C C   . CYS D  1 87  ? -39.240 13.456  -0.060  1.00 50.34  ? 87  CYS D C   1 
ATOM   4429  O O   . CYS D  1 87  ? -38.247 13.412  -0.795  1.00 51.84  ? 87  CYS D O   1 
ATOM   4430  C CB  . CYS D  1 87  ? -40.260 11.255  -0.500  1.00 47.85  ? 87  CYS D CB  1 
ATOM   4431  S SG  . CYS D  1 87  ? -41.686 10.315  -1.047  1.00 53.85  ? 87  CYS D SG  1 
ATOM   4432  N N   . TYR D  1 88  ? -39.257 14.085  1.103   1.00 45.14  ? 88  TYR D N   1 
ATOM   4433  C CA  . TYR D  1 88  ? -38.071 14.773  1.579   1.00 44.40  ? 88  TYR D CA  1 
ATOM   4434  C C   . TYR D  1 88  ? -37.291 13.879  2.576   1.00 47.74  ? 88  TYR D C   1 
ATOM   4435  O O   . TYR D  1 88  ? -36.068 13.996  2.660   1.00 48.69  ? 88  TYR D O   1 
ATOM   4436  C CB  . TYR D  1 88  ? -38.454 16.112  2.257   1.00 45.33  ? 88  TYR D CB  1 
ATOM   4437  C CG  . TYR D  1 88  ? -39.050 17.233  1.418   1.00 46.75  ? 88  TYR D CG  1 
ATOM   4438  C CD1 . TYR D  1 88  ? -39.188 17.111  0.035   1.00 48.71  ? 88  TYR D CD1 1 
ATOM   4439  C CD2 . TYR D  1 88  ? -39.423 18.443  2.003   1.00 48.53  ? 88  TYR D CD2 1 
ATOM   4440  C CE1 . TYR D  1 88  ? -39.725 18.151  -0.734  1.00 50.84  ? 88  TYR D CE1 1 
ATOM   4441  C CE2 . TYR D  1 88  ? -39.954 19.489  1.246   1.00 49.97  ? 88  TYR D CE2 1 
ATOM   4442  C CZ  . TYR D  1 88  ? -40.119 19.335  -0.119  1.00 55.57  ? 88  TYR D CZ  1 
ATOM   4443  O OH  . TYR D  1 88  ? -40.672 20.370  -0.843  1.00 55.40  ? 88  TYR D OH  1 
ATOM   4444  N N   . TYR D  1 89  ? -38.000 12.979  3.296   1.00 42.77  ? 89  TYR D N   1 
ATOM   4445  C CA  . TYR D  1 89  ? -37.501 12.183  4.420   1.00 43.56  ? 89  TYR D CA  1 
ATOM   4446  C C   . TYR D  1 89  ? -37.489 10.658  4.233   1.00 49.98  ? 89  TYR D C   1 
ATOM   4447  O O   . TYR D  1 89  ? -37.343 9.920   5.218   1.00 52.05  ? 89  TYR D O   1 
ATOM   4448  C CB  . TYR D  1 89  ? -38.311 12.548  5.689   1.00 45.10  ? 89  TYR D CB  1 
ATOM   4449  C CG  . TYR D  1 89  ? -38.570 14.037  5.813   1.00 47.17  ? 89  TYR D CG  1 
ATOM   4450  C CD1 . TYR D  1 89  ? -37.546 14.915  6.159   1.00 50.07  ? 89  TYR D CD1 1 
ATOM   4451  C CD2 . TYR D  1 89  ? -39.820 14.578  5.511   1.00 47.35  ? 89  TYR D CD2 1 
ATOM   4452  C CE1 . TYR D  1 89  ? -37.755 16.292  6.212   1.00 51.42  ? 89  TYR D CE1 1 
ATOM   4453  C CE2 . TYR D  1 89  ? -40.043 15.956  5.565   1.00 49.13  ? 89  TYR D CE2 1 
ATOM   4454  C CZ  . TYR D  1 89  ? -39.004 16.809  5.917   1.00 59.77  ? 89  TYR D CZ  1 
ATOM   4455  O OH  . TYR D  1 89  ? -39.187 18.171  5.994   1.00 65.09  ? 89  TYR D OH  1 
ATOM   4456  N N   . HIS D  1 90  ? -37.579 10.183  2.988   1.00 45.02  ? 90  HIS D N   1 
ATOM   4457  C CA  . HIS D  1 90  ? -37.591 8.748   2.691   1.00 44.11  ? 90  HIS D CA  1 
ATOM   4458  C C   . HIS D  1 90  ? -36.228 8.080   2.830   1.00 47.33  ? 90  HIS D C   1 
ATOM   4459  O O   . HIS D  1 90  ? -36.178 6.927   3.238   1.00 48.89  ? 90  HIS D O   1 
ATOM   4460  C CB  . HIS D  1 90  ? -38.202 8.479   1.313   1.00 44.68  ? 90  HIS D CB  1 
ATOM   4461  C CG  . HIS D  1 90  ? -37.478 9.144   0.182   1.00 48.37  ? 90  HIS D CG  1 
ATOM   4462  N ND1 . HIS D  1 90  ? -37.117 10.492  0.230   1.00 50.22  ? 90  HIS D ND1 1 
ATOM   4463  C CD2 . HIS D  1 90  ? -37.086 8.630   -1.007  1.00 51.17  ? 90  HIS D CD2 1 
ATOM   4464  C CE1 . HIS D  1 90  ? -36.502 10.737  -0.912  1.00 50.34  ? 90  HIS D CE1 1 
ATOM   4465  N NE2 . HIS D  1 90  ? -36.472 9.651   -1.697  1.00 51.14  ? 90  HIS D NE2 1 
ATOM   4466  N N   . LYS D  1 91  ? -35.127 8.795   2.525   1.00 41.73  ? 91  LYS D N   1 
ATOM   4467  C CA  . LYS D  1 91  ? -33.770 8.238   2.569   1.00 40.54  ? 91  LYS D CA  1 
ATOM   4468  C C   . LYS D  1 91  ? -33.087 8.304   3.927   1.00 46.48  ? 91  LYS D C   1 
ATOM   4469  O O   . LYS D  1 91  ? -33.518 9.039   4.812   1.00 47.22  ? 91  LYS D O   1 
ATOM   4470  C CB  . LYS D  1 91  ? -32.865 8.856   1.491   1.00 40.24  ? 91  LYS D CB  1 
ATOM   4471  C CG  . LYS D  1 91  ? -33.058 10.331  1.234   1.00 34.05  ? 91  LYS D CG  1 
ATOM   4472  C CD  . LYS D  1 91  ? -32.263 10.730  0.014   1.00 42.53  ? 91  LYS D CD  1 
ATOM   4473  C CE  . LYS D  1 91  ? -32.817 11.936  -0.717  1.00 43.45  ? 91  LYS D CE  1 
ATOM   4474  N NZ  . LYS D  1 91  ? -32.044 13.164  -0.393  1.00 29.62  ? 91  LYS D NZ  1 
ATOM   4475  N N   . SER D  1 92  ? -32.023 7.502   4.084   1.00 45.04  ? 92  SER D N   1 
ATOM   4476  C CA  . SER D  1 92  ? -31.156 7.446   5.270   1.00 88.17  ? 92  SER D CA  1 
ATOM   4477  C C   . SER D  1 92  ? -30.284 8.715   5.328   1.00 122.14 ? 92  SER D C   1 
ATOM   4478  O O   . SER D  1 92  ? -29.722 9.056   6.370   1.00 84.62  ? 92  SER D O   1 
ATOM   4479  C CB  . SER D  1 92  ? -30.265 6.198   5.240   1.00 92.44  ? 92  SER D CB  1 
ATOM   4480  O OG  . SER D  1 92  ? -29.608 5.950   4.004   1.00 96.18  ? 92  SER D OG  1 
ATOM   4481  N N   . ASN E  2 1   ? -48.418 -0.202  2.953   1.00 85.93  ? 1   ASN E N   1 
ATOM   4482  C CA  . ASN E  2 1   ? -48.865 -1.590  3.048   1.00 90.89  ? 1   ASN E CA  1 
ATOM   4483  C C   . ASN E  2 1   ? -48.462 -2.437  1.805   1.00 94.90  ? 1   ASN E C   1 
ATOM   4484  O O   . ASN E  2 1   ? -47.446 -3.136  1.863   1.00 94.49  ? 1   ASN E O   1 
ATOM   4485  C CB  . ASN E  2 1   ? -50.392 -1.685  3.364   1.00 95.48  ? 1   ASN E CB  1 
ATOM   4486  C CG  . ASN E  2 1   ? -50.847 -1.020  4.665   1.00 113.87 ? 1   ASN E CG  1 
ATOM   4487  O OD1 . ASN E  2 1   ? -50.126 -0.962  5.672   1.00 107.57 ? 1   ASN E OD1 1 
ATOM   4488  N ND2 . ASN E  2 1   ? -52.080 -0.521  4.688   1.00 102.93 ? 1   ASN E ND2 1 
ATOM   4489  N N   . SER E  2 2   ? -49.235 -2.342  0.690   1.00 91.25  ? 2   SER E N   1 
ATOM   4490  C CA  . SER E  2 2   ? -49.074 -3.095  -0.571  1.00 90.91  ? 2   SER E CA  1 
ATOM   4491  C C   . SER E  2 2   ? -47.770 -2.830  -1.383  1.00 87.60  ? 2   SER E C   1 
ATOM   4492  O O   . SER E  2 2   ? -47.822 -2.322  -2.504  1.00 85.85  ? 2   SER E O   1 
ATOM   4493  C CB  . SER E  2 2   ? -50.293 -2.895  -1.474  1.00 97.71  ? 2   SER E CB  1 
ATOM   4494  O OG  . SER E  2 2   ? -50.374 -1.589  -2.025  1.00 103.25 ? 2   SER E OG  1 
ATOM   4495  N N   . CYS E  2 3   ? -46.619 -3.246  -0.848  1.00 79.77  ? 3   CYS E N   1 
ATOM   4496  C CA  . CYS E  2 3   ? -45.336 -3.158  -1.547  1.00 73.73  ? 3   CYS E CA  1 
ATOM   4497  C C   . CYS E  2 3   ? -44.864 -4.605  -1.775  1.00 78.78  ? 3   CYS E C   1 
ATOM   4498  O O   . CYS E  2 3   ? -44.698 -5.358  -0.801  1.00 79.58  ? 3   CYS E O   1 
ATOM   4499  C CB  . CYS E  2 3   ? -44.325 -2.349  -0.737  1.00 69.39  ? 3   CYS E CB  1 
ATOM   4500  S SG  . CYS E  2 3   ? -42.616 -2.449  -1.339  1.00 69.05  ? 3   CYS E SG  1 
ATOM   4501  N N   . GLU E  2 4   ? -44.720 -5.015  -3.057  1.00 75.18  ? 4   GLU E N   1 
ATOM   4502  C CA  . GLU E  2 4   ? -44.276 -6.377  -3.354  1.00 77.72  ? 4   GLU E CA  1 
ATOM   4503  C C   . GLU E  2 4   ? -43.440 -6.523  -4.633  1.00 77.61  ? 4   GLU E C   1 
ATOM   4504  O O   . GLU E  2 4   ? -43.296 -5.594  -5.436  1.00 72.67  ? 4   GLU E O   1 
ATOM   4505  C CB  . GLU E  2 4   ? -45.426 -7.429  -3.344  1.00 85.34  ? 4   GLU E CB  1 
ATOM   4506  C CG  . GLU E  2 4   ? -46.836 -6.918  -3.606  1.00 102.52 ? 4   GLU E CG  1 
ATOM   4507  C CD  . GLU E  2 4   ? -47.921 -7.554  -2.752  1.00 132.73 ? 4   GLU E CD  1 
ATOM   4508  O OE1 . GLU E  2 4   ? -49.024 -7.797  -3.293  1.00 135.56 ? 4   GLU E OE1 1 
ATOM   4509  O OE2 . GLU E  2 4   ? -47.678 -7.799  -1.547  1.00 125.98 ? 4   GLU E OE2 1 
ATOM   4510  N N   . LEU E  2 5   ? -42.860 -7.737  -4.764  1.00 76.00  ? 5   LEU E N   1 
ATOM   4511  C CA  . LEU E  2 5   ? -42.046 -8.192  -5.876  1.00 74.26  ? 5   LEU E CA  1 
ATOM   4512  C C   . LEU E  2 5   ? -42.935 -8.252  -7.093  1.00 79.50  ? 5   LEU E C   1 
ATOM   4513  O O   . LEU E  2 5   ? -43.997 -8.867  -7.051  1.00 83.07  ? 5   LEU E O   1 
ATOM   4514  C CB  . LEU E  2 5   ? -41.451 -9.589  -5.584  1.00 76.31  ? 5   LEU E CB  1 
ATOM   4515  C CG  . LEU E  2 5   ? -40.302 -9.671  -4.578  1.00 79.02  ? 5   LEU E CG  1 
ATOM   4516  C CD1 . LEU E  2 5   ? -40.256 -11.016 -3.943  1.00 83.17  ? 5   LEU E CD1 1 
ATOM   4517  C CD2 . LEU E  2 5   ? -38.959 -9.362  -5.227  1.00 77.98  ? 5   LEU E CD2 1 
ATOM   4518  N N   . THR E  2 6   ? -42.556 -7.525  -8.136  1.00 74.15  ? 6   THR E N   1 
ATOM   4519  C CA  . THR E  2 6   ? -43.275 -7.487  -9.406  1.00 76.21  ? 6   THR E CA  1 
ATOM   4520  C C   . THR E  2 6   ? -42.266 -7.796  -10.521 1.00 79.56  ? 6   THR E C   1 
ATOM   4521  O O   . THR E  2 6   ? -41.074 -7.480  -10.390 1.00 73.83  ? 6   THR E O   1 
ATOM   4522  C CB  . THR E  2 6   ? -44.071 -6.165  -9.612  1.00 81.35  ? 6   THR E CB  1 
ATOM   4523  O OG1 . THR E  2 6   ? -43.183 -5.099  -9.914  1.00 80.88  ? 6   THR E OG1 1 
ATOM   4524  C CG2 . THR E  2 6   ? -44.951 -5.781  -8.416  1.00 79.23  ? 6   THR E CG2 1 
ATOM   4525  N N   . ASN E  2 7   ? -42.740 -8.466  -11.586 1.00 81.82  ? 7   ASN E N   1 
ATOM   4526  C CA  . ASN E  2 7   ? -41.909 -8.825  -12.728 1.00 82.25  ? 7   ASN E CA  1 
ATOM   4527  C C   . ASN E  2 7   ? -41.745 -7.612  -13.599 1.00 83.82  ? 7   ASN E C   1 
ATOM   4528  O O   . ASN E  2 7   ? -42.728 -7.023  -14.052 1.00 85.40  ? 7   ASN E O   1 
ATOM   4529  C CB  . ASN E  2 7   ? -42.491 -10.003 -13.511 1.00 92.83  ? 7   ASN E CB  1 
ATOM   4530  C CG  . ASN E  2 7   ? -42.429 -11.282 -12.729 1.00 137.35 ? 7   ASN E CG  1 
ATOM   4531  O OD1 . ASN E  2 7   ? -41.339 -11.846 -12.530 1.00 128.51 ? 7   ASN E OD1 1 
ATOM   4532  N ND2 . ASN E  2 7   ? -43.620 -11.736 -12.274 1.00 144.39 ? 7   ASN E ND2 1 
ATOM   4533  N N   . ILE E  2 8   ? -40.501 -7.180  -13.749 1.00 76.48  ? 8   ILE E N   1 
ATOM   4534  C CA  . ILE E  2 8   ? -40.180 -6.020  -14.561 1.00 74.07  ? 8   ILE E CA  1 
ATOM   4535  C C   . ILE E  2 8   ? -39.332 -6.461  -15.742 1.00 77.32  ? 8   ILE E C   1 
ATOM   4536  O O   . ILE E  2 8   ? -38.923 -7.623  -15.808 1.00 77.15  ? 8   ILE E O   1 
ATOM   4537  C CB  . ILE E  2 8   ? -39.583 -4.831  -13.747 1.00 72.95  ? 8   ILE E CB  1 
ATOM   4538  C CG1 . ILE E  2 8   ? -38.179 -5.124  -13.227 1.00 70.99  ? 8   ILE E CG1 1 
ATOM   4539  C CG2 . ILE E  2 8   ? -40.516 -4.402  -12.617 1.00 73.71  ? 8   ILE E CG2 1 
ATOM   4540  C CD1 . ILE E  2 8   ? -37.312 -3.917  -13.194 1.00 79.18  ? 8   ILE E CD1 1 
ATOM   4541  N N   . THR E  2 9   ? -39.116 -5.548  -16.688 1.00 73.67  ? 9   THR E N   1 
ATOM   4542  C CA  . THR E  2 9   ? -38.347 -5.794  -17.893 1.00 74.54  ? 9   THR E CA  1 
ATOM   4543  C C   . THR E  2 9   ? -37.356 -4.661  -18.031 1.00 75.87  ? 9   THR E C   1 
ATOM   4544  O O   . THR E  2 9   ? -37.766 -3.519  -18.243 1.00 76.39  ? 9   THR E O   1 
ATOM   4545  C CB  . THR E  2 9   ? -39.292 -5.916  -19.092 1.00 86.82  ? 9   THR E CB  1 
ATOM   4546  O OG1 . THR E  2 9   ? -40.287 -6.913  -18.819 1.00 88.86  ? 9   THR E OG1 1 
ATOM   4547  C CG2 . THR E  2 9   ? -38.553 -6.229  -20.384 1.00 88.23  ? 9   THR E CG2 1 
ATOM   4548  N N   . ILE E  2 10  ? -36.057 -4.965  -17.889 1.00 69.33  ? 10  ILE E N   1 
ATOM   4549  C CA  . ILE E  2 10  ? -35.001 -3.958  -17.982 1.00 66.18  ? 10  ILE E CA  1 
ATOM   4550  C C   . ILE E  2 10  ? -34.336 -3.925  -19.336 1.00 69.08  ? 10  ILE E C   1 
ATOM   4551  O O   . ILE E  2 10  ? -34.459 -4.860  -20.122 1.00 69.27  ? 10  ILE E O   1 
ATOM   4552  C CB  . ILE E  2 10  ? -33.956 -4.059  -16.848 1.00 66.92  ? 10  ILE E CB  1 
ATOM   4553  C CG1 . ILE E  2 10  ? -33.351 -5.488  -16.727 1.00 68.23  ? 10  ILE E CG1 1 
ATOM   4554  C CG2 . ILE E  2 10  ? -34.543 -3.552  -15.532 1.00 66.17  ? 10  ILE E CG2 1 
ATOM   4555  C CD1 . ILE E  2 10  ? -31.913 -5.520  -16.250 1.00 72.69  ? 10  ILE E CD1 1 
ATOM   4556  N N   . ALA E  2 11  ? -33.625 -2.821  -19.589 1.00 65.91  ? 11  ALA E N   1 
ATOM   4557  C CA  . ALA E  2 11  ? -32.868 -2.568  -20.805 1.00 68.82  ? 11  ALA E CA  1 
ATOM   4558  C C   . ALA E  2 11  ? -31.357 -2.582  -20.526 1.00 73.50  ? 11  ALA E C   1 
ATOM   4559  O O   . ALA E  2 11  ? -30.833 -1.737  -19.787 1.00 72.13  ? 11  ALA E O   1 
ATOM   4560  C CB  . ALA E  2 11  ? -33.279 -1.234  -21.409 1.00 70.84  ? 11  ALA E CB  1 
ATOM   4561  N N   . ILE E  2 12  ? -30.664 -3.547  -21.103 1.00 71.21  ? 12  ILE E N   1 
ATOM   4562  C CA  . ILE E  2 12  ? -29.228 -3.597  -20.946 1.00 70.74  ? 12  ILE E CA  1 
ATOM   4563  C C   . ILE E  2 12  ? -28.645 -3.009  -22.231 1.00 79.44  ? 12  ILE E C   1 
ATOM   4564  O O   . ILE E  2 12  ? -28.680 -3.649  -23.284 1.00 82.72  ? 12  ILE E O   1 
ATOM   4565  C CB  . ILE E  2 12  ? -28.737 -5.013  -20.583 1.00 73.50  ? 12  ILE E CB  1 
ATOM   4566  C CG1 . ILE E  2 12  ? -29.318 -5.441  -19.222 1.00 71.08  ? 12  ILE E CG1 1 
ATOM   4567  C CG2 . ILE E  2 12  ? -27.213 -5.070  -20.570 1.00 74.41  ? 12  ILE E CG2 1 
ATOM   4568  C CD1 . ILE E  2 12  ? -29.667 -6.894  -19.128 1.00 80.33  ? 12  ILE E CD1 1 
ATOM   4569  N N   . GLU E  2 13  ? -28.184 -1.751  -22.136 1.00 75.84  ? 13  GLU E N   1 
ATOM   4570  C CA  . GLU E  2 13  ? -27.611 -0.939  -23.210 1.00 79.22  ? 13  GLU E CA  1 
ATOM   4571  C C   . GLU E  2 13  ? -26.139 -1.296  -23.529 1.00 87.01  ? 13  GLU E C   1 
ATOM   4572  O O   . GLU E  2 13  ? -25.273 -1.251  -22.645 1.00 85.06  ? 13  GLU E O   1 
ATOM   4573  C CB  . GLU E  2 13  ? -27.734 0.540   -22.803 1.00 79.65  ? 13  GLU E CB  1 
ATOM   4574  C CG  . GLU E  2 13  ? -27.488 1.560   -23.900 1.00 92.31  ? 13  GLU E CG  1 
ATOM   4575  C CD  . GLU E  2 13  ? -28.067 2.937   -23.621 1.00 106.00 ? 13  GLU E CD  1 
ATOM   4576  O OE1 . GLU E  2 13  ? -29.304 3.047   -23.453 1.00 96.34  ? 13  GLU E OE1 1 
ATOM   4577  O OE2 . GLU E  2 13  ? -27.284 3.914   -23.609 1.00 95.65  ? 13  GLU E OE2 1 
ATOM   4578  N N   . LYS E  2 14  ? -25.864 -1.644  -24.798 1.00 88.54  ? 14  LYS E N   1 
ATOM   4579  C CA  . LYS E  2 14  ? -24.514 -1.927  -25.283 1.00 91.34  ? 14  LYS E CA  1 
ATOM   4580  C C   . LYS E  2 14  ? -24.168 -0.795  -26.249 1.00 100.76 ? 14  LYS E C   1 
ATOM   4581  O O   . LYS E  2 14  ? -24.477 -0.866  -27.446 1.00 104.40 ? 14  LYS E O   1 
ATOM   4582  C CB  . LYS E  2 14  ? -24.418 -3.303  -25.963 1.00 95.96  ? 14  LYS E CB  1 
ATOM   4583  C CG  . LYS E  2 14  ? -22.984 -3.824  -26.072 1.00 108.36 ? 14  LYS E CG  1 
ATOM   4584  C CD  . LYS E  2 14  ? -22.835 -4.878  -27.147 1.00 115.77 ? 14  LYS E CD  1 
ATOM   4585  C CE  . LYS E  2 14  ? -21.435 -5.427  -27.243 1.00 123.27 ? 14  LYS E CE  1 
ATOM   4586  N NZ  . LYS E  2 14  ? -21.184 -6.472  -26.226 1.00 127.80 ? 14  LYS E NZ  1 
ATOM   4587  N N   . GLU E  2 15  ? -23.582 0.284   -25.688 1.00 97.46  ? 15  GLU E N   1 
ATOM   4588  C CA  . GLU E  2 15  ? -23.191 1.529   -26.361 1.00 101.10 ? 15  GLU E CA  1 
ATOM   4589  C C   . GLU E  2 15  ? -22.386 1.294   -27.635 1.00 108.71 ? 15  GLU E C   1 
ATOM   4590  O O   . GLU E  2 15  ? -22.625 1.965   -28.638 1.00 112.43 ? 15  GLU E O   1 
ATOM   4591  C CB  . GLU E  2 15  ? -22.401 2.427   -25.386 1.00 101.19 ? 15  GLU E CB  1 
ATOM   4592  C CG  . GLU E  2 15  ? -22.772 3.899   -25.448 1.00 112.76 ? 15  GLU E CG  1 
ATOM   4593  C CD  . GLU E  2 15  ? -21.964 4.788   -24.521 1.00 129.81 ? 15  GLU E CD  1 
ATOM   4594  O OE1 . GLU E  2 15  ? -22.355 4.926   -23.340 1.00 121.55 ? 15  GLU E OE1 1 
ATOM   4595  O OE2 . GLU E  2 15  ? -20.940 5.348   -24.975 1.00 125.68 ? 15  GLU E OE2 1 
ATOM   4596  N N   . GLU E  2 16  ? -21.462 0.319   -27.593 1.00 104.58 ? 16  GLU E N   1 
ATOM   4597  C CA  . GLU E  2 16  ? -20.562 -0.049  -28.684 1.00 109.43 ? 16  GLU E CA  1 
ATOM   4598  C C   . GLU E  2 16  ? -21.239 -0.792  -29.860 1.00 116.08 ? 16  GLU E C   1 
ATOM   4599  O O   . GLU E  2 16  ? -20.600 -0.935  -30.903 1.00 121.04 ? 16  GLU E O   1 
ATOM   4600  C CB  . GLU E  2 16  ? -19.337 -0.836  -28.164 1.00 109.97 ? 16  GLU E CB  1 
ATOM   4601  C CG  . GLU E  2 16  ? -19.636 -2.091  -27.352 1.00 115.00 ? 16  GLU E CG  1 
ATOM   4602  C CD  . GLU E  2 16  ? -19.769 -1.922  -25.848 1.00 127.94 ? 16  GLU E CD  1 
ATOM   4603  O OE1 . GLU E  2 16  ? -19.722 -0.770  -25.357 1.00 121.46 ? 16  GLU E OE1 1 
ATOM   4604  O OE2 . GLU E  2 16  ? -19.916 -2.955  -25.156 1.00 117.25 ? 16  GLU E OE2 1 
ATOM   4605  N N   . CYS E  2 17  ? -22.505 -1.245  -29.713 1.00 109.73 ? 17  CYS E N   1 
ATOM   4606  C CA  . CYS E  2 17  ? -23.229 -1.925  -30.800 1.00 112.89 ? 17  CYS E CA  1 
ATOM   4607  C C   . CYS E  2 17  ? -24.545 -1.210  -31.192 1.00 116.38 ? 17  CYS E C   1 
ATOM   4608  O O   . CYS E  2 17  ? -25.246 -1.656  -32.107 1.00 118.90 ? 17  CYS E O   1 
ATOM   4609  C CB  . CYS E  2 17  ? -23.450 -3.406  -30.500 1.00 111.15 ? 17  CYS E CB  1 
ATOM   4610  S SG  . CYS E  2 17  ? -22.000 -4.459  -30.794 1.00 117.10 ? 17  CYS E SG  1 
ATOM   4611  N N   . ARG E  2 18  ? -24.841 -0.078  -30.517 1.00 109.85 ? 18  ARG E N   1 
ATOM   4612  C CA  . ARG E  2 18  ? -25.983 0.815   -30.746 1.00 110.25 ? 18  ARG E CA  1 
ATOM   4613  C C   . ARG E  2 18  ? -27.353 0.115   -30.622 1.00 110.89 ? 18  ARG E C   1 
ATOM   4614  O O   . ARG E  2 18  ? -28.275 0.407   -31.390 1.00 113.86 ? 18  ARG E O   1 
ATOM   4615  C CB  . ARG E  2 18  ? -25.846 1.571   -32.092 1.00 118.23 ? 18  ARG E CB  1 
ATOM   4616  C CG  . ARG E  2 18  ? -24.533 2.344   -32.272 1.00 133.82 ? 18  ARG E CG  1 
ATOM   4617  C CD  . ARG E  2 18  ? -24.565 3.735   -31.658 1.00 144.27 ? 18  ARG E CD  1 
ATOM   4618  N NE  . ARG E  2 18  ? -24.797 4.772   -32.665 1.00 158.83 ? 18  ARG E NE  1 
ATOM   4619  C CZ  . ARG E  2 18  ? -25.985 5.296   -32.954 1.00 172.41 ? 18  ARG E CZ  1 
ATOM   4620  N NH1 . ARG E  2 18  ? -27.073 4.890   -32.311 1.00 150.50 ? 18  ARG E NH1 1 
ATOM   4621  N NH2 . ARG E  2 18  ? -26.094 6.232   -33.886 1.00 168.63 ? 18  ARG E NH2 1 
ATOM   4622  N N   . PHE E  2 19  ? -27.487 -0.788  -29.632 1.00 101.65 ? 19  PHE E N   1 
ATOM   4623  C CA  . PHE E  2 19  ? -28.734 -1.498  -29.328 1.00 99.26  ? 19  PHE E CA  1 
ATOM   4624  C C   . PHE E  2 19  ? -28.803 -1.885  -27.856 1.00 96.66  ? 19  PHE E C   1 
ATOM   4625  O O   . PHE E  2 19  ? -27.775 -1.912  -27.182 1.00 93.80  ? 19  PHE E O   1 
ATOM   4626  C CB  . PHE E  2 19  ? -28.955 -2.728  -30.241 1.00 104.25 ? 19  PHE E CB  1 
ATOM   4627  C CG  . PHE E  2 19  ? -27.953 -3.861  -30.156 1.00 105.24 ? 19  PHE E CG  1 
ATOM   4628  C CD1 . PHE E  2 19  ? -27.788 -4.583  -28.976 1.00 103.85 ? 19  PHE E CD1 1 
ATOM   4629  C CD2 . PHE E  2 19  ? -27.248 -4.271  -31.279 1.00 112.20 ? 19  PHE E CD2 1 
ATOM   4630  C CE1 . PHE E  2 19  ? -26.874 -5.634  -28.900 1.00 104.48 ? 19  PHE E CE1 1 
ATOM   4631  C CE2 . PHE E  2 19  ? -26.363 -5.348  -31.214 1.00 114.79 ? 19  PHE E CE2 1 
ATOM   4632  C CZ  . PHE E  2 19  ? -26.173 -6.014  -30.021 1.00 108.23 ? 19  PHE E CZ  1 
ATOM   4633  N N   . CYS E  2 20  ? -30.007 -2.214  -27.371 1.00 91.52  ? 20  CYS E N   1 
ATOM   4634  C CA  . CYS E  2 20  ? -30.244 -2.666  -26.000 1.00 86.77  ? 20  CYS E CA  1 
ATOM   4635  C C   . CYS E  2 20  ? -30.803 -4.066  -26.036 1.00 88.51  ? 20  CYS E C   1 
ATOM   4636  O O   . CYS E  2 20  ? -31.449 -4.440  -27.015 1.00 91.86  ? 20  CYS E O   1 
ATOM   4637  C CB  . CYS E  2 20  ? -31.206 -1.733  -25.268 1.00 85.95  ? 20  CYS E CB  1 
ATOM   4638  S SG  . CYS E  2 20  ? -30.636 -0.024  -25.125 1.00 90.14  ? 20  CYS E SG  1 
ATOM   4639  N N   . ILE E  2 21  ? -30.614 -4.823  -24.956 1.00 80.19  ? 21  ILE E N   1 
ATOM   4640  C CA  . ILE E  2 21  ? -31.219 -6.148  -24.839 1.00 80.03  ? 21  ILE E CA  1 
ATOM   4641  C C   . ILE E  2 21  ? -32.179 -6.123  -23.654 1.00 82.39  ? 21  ILE E C   1 
ATOM   4642  O O   . ILE E  2 21  ? -31.860 -5.528  -22.619 1.00 78.81  ? 21  ILE E O   1 
ATOM   4643  C CB  . ILE E  2 21  ? -30.248 -7.375  -24.858 1.00 82.45  ? 21  ILE E CB  1 
ATOM   4644  C CG1 . ILE E  2 21  ? -29.266 -7.391  -23.662 1.00 78.78  ? 21  ILE E CG1 1 
ATOM   4645  C CG2 . ILE E  2 21  ? -29.516 -7.479  -26.188 1.00 86.28  ? 21  ILE E CG2 1 
ATOM   4646  C CD1 . ILE E  2 21  ? -28.587 -8.785  -23.375 1.00 81.52  ? 21  ILE E CD1 1 
ATOM   4647  N N   . SER E  2 22  ? -33.372 -6.707  -23.827 1.00 81.28  ? 22  SER E N   1 
ATOM   4648  C CA  . SER E  2 22  ? -34.375 -6.741  -22.771 1.00 79.84  ? 22  SER E CA  1 
ATOM   4649  C C   . SER E  2 22  ? -34.322 -8.029  -21.979 1.00 84.09  ? 22  SER E C   1 
ATOM   4650  O O   . SER E  2 22  ? -34.345 -9.120  -22.544 1.00 86.74  ? 22  SER E O   1 
ATOM   4651  C CB  . SER E  2 22  ? -35.772 -6.473  -23.319 1.00 86.89  ? 22  SER E CB  1 
ATOM   4652  O OG  . SER E  2 22  ? -35.887 -5.123  -23.746 1.00 97.21  ? 22  SER E OG  1 
ATOM   4653  N N   . ILE E  2 23  ? -34.207 -7.894  -20.665 1.00 78.53  ? 23  ILE E N   1 
ATOM   4654  C CA  . ILE E  2 23  ? -34.143 -9.014  -19.732 1.00 78.43  ? 23  ILE E CA  1 
ATOM   4655  C C   . ILE E  2 23  ? -35.263 -8.862  -18.698 1.00 82.56  ? 23  ILE E C   1 
ATOM   4656  O O   . ILE E  2 23  ? -35.505 -7.748  -18.222 1.00 79.87  ? 23  ILE E O   1 
ATOM   4657  C CB  . ILE E  2 23  ? -32.692 -9.142  -19.133 1.00 79.20  ? 23  ILE E CB  1 
ATOM   4658  C CG1 . ILE E  2 23  ? -31.868 -10.170 -19.896 1.00 82.68  ? 23  ILE E CG1 1 
ATOM   4659  C CG2 . ILE E  2 23  ? -32.635 -9.455  -17.644 1.00 76.84  ? 23  ILE E CG2 1 
ATOM   4660  C CD1 . ILE E  2 23  ? -31.263 -9.680  -21.168 1.00 97.04  ? 23  ILE E CD1 1 
ATOM   4661  N N   . ASN E  2 24  ? -35.975 -9.970  -18.397 1.00 82.04  ? 24  ASN E N   1 
ATOM   4662  C CA  . ASN E  2 24  ? -37.024 -9.998  -17.382 1.00 82.04  ? 24  ASN E CA  1 
ATOM   4663  C C   . ASN E  2 24  ? -36.399 -10.351 -16.032 1.00 83.85  ? 24  ASN E C   1 
ATOM   4664  O O   . ASN E  2 24  ? -35.590 -11.284 -15.926 1.00 83.74  ? 24  ASN E O   1 
ATOM   4665  C CB  . ASN E  2 24  ? -38.128 -10.989 -17.718 1.00 88.00  ? 24  ASN E CB  1 
ATOM   4666  C CG  . ASN E  2 24  ? -39.097 -10.576 -18.793 1.00 130.38 ? 24  ASN E CG  1 
ATOM   4667  O OD1 . ASN E  2 24  ? -39.114 -9.435  -19.275 1.00 121.55 ? 24  ASN E OD1 1 
ATOM   4668  N ND2 . ASN E  2 24  ? -39.924 -11.546 -19.165 1.00 139.39 ? 24  ASN E ND2 1 
ATOM   4669  N N   . THR E  2 25  ? -36.769 -9.580  -15.005 1.00 78.02  ? 25  THR E N   1 
ATOM   4670  C CA  . THR E  2 25  ? -36.289 -9.736  -13.639 1.00 75.58  ? 25  THR E CA  1 
ATOM   4671  C C   . THR E  2 25  ? -37.429 -9.401  -12.648 1.00 79.63  ? 25  THR E C   1 
ATOM   4672  O O   . THR E  2 25  ? -38.536 -9.048  -13.071 1.00 79.50  ? 25  THR E O   1 
ATOM   4673  C CB  . THR E  2 25  ? -34.966 -8.950  -13.456 1.00 78.75  ? 25  THR E CB  1 
ATOM   4674  O OG1 . THR E  2 25  ? -34.361 -9.293  -12.214 1.00 78.07  ? 25  THR E OG1 1 
ATOM   4675  C CG2 . THR E  2 25  ? -35.133 -7.434  -13.573 1.00 75.40  ? 25  THR E CG2 1 
ATOM   4676  N N   . THR E  2 26  ? -37.166 -9.573  -11.341 1.00 76.74  ? 26  THR E N   1 
ATOM   4677  C CA  . THR E  2 26  ? -38.113 -9.274  -10.264 1.00 77.22  ? 26  THR E CA  1 
ATOM   4678  C C   . THR E  2 26  ? -37.610 -8.072  -9.468  1.00 76.88  ? 26  THR E C   1 
ATOM   4679  O O   . THR E  2 26  ? -36.479 -8.084  -8.975  1.00 74.05  ? 26  THR E O   1 
ATOM   4680  C CB  . THR E  2 26  ? -38.384 -10.501 -9.369  1.00 90.42  ? 26  THR E CB  1 
ATOM   4681  O OG1 . THR E  2 26  ? -37.151 -11.056 -8.908  1.00 89.45  ? 26  THR E OG1 1 
ATOM   4682  C CG2 . THR E  2 26  ? -39.191 -11.568 -10.071 1.00 95.34  ? 26  THR E CG2 1 
ATOM   4683  N N   . TRP E  2 27  ? -38.436 -7.021  -9.385  1.00 72.98  ? 27  TRP E N   1 
ATOM   4684  C CA  . TRP E  2 27  ? -38.115 -5.803  -8.646  1.00 69.18  ? 27  TRP E CA  1 
ATOM   4685  C C   . TRP E  2 27  ? -39.295 -5.341  -7.797  1.00 72.48  ? 27  TRP E C   1 
ATOM   4686  O O   . TRP E  2 27  ? -40.254 -6.093  -7.635  1.00 74.92  ? 27  TRP E O   1 
ATOM   4687  C CB  . TRP E  2 27  ? -37.543 -4.707  -9.557  1.00 65.48  ? 27  TRP E CB  1 
ATOM   4688  C CG  . TRP E  2 27  ? -36.051 -4.780  -9.576  1.00 65.27  ? 27  TRP E CG  1 
ATOM   4689  C CD1 . TRP E  2 27  ? -35.279 -5.523  -10.423 1.00 69.18  ? 27  TRP E CD1 1 
ATOM   4690  C CD2 . TRP E  2 27  ? -35.168 -4.286  -8.561  1.00 63.25  ? 27  TRP E CD2 1 
ATOM   4691  N NE1 . TRP E  2 27  ? -33.963 -5.489  -10.020 1.00 67.05  ? 27  TRP E NE1 1 
ATOM   4692  C CE2 . TRP E  2 27  ? -33.864 -4.715  -8.893  1.00 66.84  ? 27  TRP E CE2 1 
ATOM   4693  C CE3 . TRP E  2 27  ? -35.349 -3.493  -7.413  1.00 63.20  ? 27  TRP E CE3 1 
ATOM   4694  C CZ2 . TRP E  2 27  ? -32.746 -4.361  -8.132  1.00 64.94  ? 27  TRP E CZ2 1 
ATOM   4695  C CZ3 . TRP E  2 27  ? -34.245 -3.164  -6.648  1.00 63.24  ? 27  TRP E CZ3 1 
ATOM   4696  C CH2 . TRP E  2 27  ? -32.962 -3.593  -7.009  1.00 63.96  ? 27  TRP E CH2 1 
ATOM   4697  N N   . CYS E  2 28  ? -39.188 -4.156  -7.185  1.00 65.70  ? 28  CYS E N   1 
ATOM   4698  C CA  . CYS E  2 28  ? -40.222 -3.625  -6.298  1.00 65.23  ? 28  CYS E CA  1 
ATOM   4699  C C   . CYS E  2 28  ? -41.112 -2.600  -6.953  1.00 66.92  ? 28  CYS E C   1 
ATOM   4700  O O   . CYS E  2 28  ? -40.676 -1.857  -7.839  1.00 65.33  ? 28  CYS E O   1 
ATOM   4701  C CB  . CYS E  2 28  ? -39.603 -3.086  -5.012  1.00 63.38  ? 28  CYS E CB  1 
ATOM   4702  S SG  . CYS E  2 28  ? -38.582 -4.294  -4.133  1.00 68.15  ? 28  CYS E SG  1 
ATOM   4703  N N   . ALA E  2 29  ? -42.370 -2.571  -6.495  1.00 63.51  ? 29  ALA E N   1 
ATOM   4704  C CA  . ALA E  2 29  ? -43.429 -1.658  -6.911  1.00 63.47  ? 29  ALA E CA  1 
ATOM   4705  C C   . ALA E  2 29  ? -44.607 -1.815  -5.956  1.00 70.18  ? 29  ALA E C   1 
ATOM   4706  O O   . ALA E  2 29  ? -44.811 -2.893  -5.382  1.00 73.29  ? 29  ALA E O   1 
ATOM   4707  C CB  . ALA E  2 29  ? -43.872 -1.961  -8.338  1.00 66.31  ? 29  ALA E CB  1 
ATOM   4708  N N   . GLY E  2 30  ? -45.379 -0.746  -5.806  1.00 65.38  ? 30  GLY E N   1 
ATOM   4709  C CA  . GLY E  2 30  ? -46.551 -0.749  -4.953  1.00 67.45  ? 30  GLY E CA  1 
ATOM   4710  C C   . GLY E  2 30  ? -46.726 0.512   -4.149  1.00 70.15  ? 30  GLY E C   1 
ATOM   4711  O O   . GLY E  2 30  ? -46.023 1.504   -4.368  1.00 66.99  ? 30  GLY E O   1 
ATOM   4712  N N   . TYR E  2 31  ? -47.665 0.472   -3.199  1.00 69.03  ? 31  TYR E N   1 
ATOM   4713  C CA  . TYR E  2 31  ? -47.976 1.623   -2.365  1.00 67.43  ? 31  TYR E CA  1 
ATOM   4714  C C   . TYR E  2 31  ? -47.550 1.422   -0.915  1.00 69.72  ? 31  TYR E C   1 
ATOM   4715  O O   . TYR E  2 31  ? -47.608 0.307   -0.397  1.00 70.52  ? 31  TYR E O   1 
ATOM   4716  C CB  . TYR E  2 31  ? -49.474 1.975   -2.471  1.00 72.35  ? 31  TYR E CB  1 
ATOM   4717  C CG  . TYR E  2 31  ? -49.969 2.292   -3.873  1.00 74.56  ? 31  TYR E CG  1 
ATOM   4718  C CD1 . TYR E  2 31  ? -50.133 1.285   -4.823  1.00 78.73  ? 31  TYR E CD1 1 
ATOM   4719  C CD2 . TYR E  2 31  ? -50.380 3.581   -4.215  1.00 73.92  ? 31  TYR E CD2 1 
ATOM   4720  C CE1 . TYR E  2 31  ? -50.611 1.566   -6.102  1.00 80.59  ? 31  TYR E CE1 1 
ATOM   4721  C CE2 . TYR E  2 31  ? -50.862 3.873   -5.491  1.00 76.16  ? 31  TYR E CE2 1 
ATOM   4722  C CZ  . TYR E  2 31  ? -50.982 2.858   -6.430  1.00 86.34  ? 31  TYR E CZ  1 
ATOM   4723  O OH  . TYR E  2 31  ? -51.469 3.117   -7.688  1.00 90.66  ? 31  TYR E OH  1 
ATOM   4724  N N   . CYS E  2 32  ? -47.120 2.524   -0.275  1.00 64.90  ? 32  CYS E N   1 
ATOM   4725  C CA  . CYS E  2 32  ? -46.669 2.629   1.118   1.00 64.84  ? 32  CYS E CA  1 
ATOM   4726  C C   . CYS E  2 32  ? -47.477 3.724   1.790   1.00 67.43  ? 32  CYS E C   1 
ATOM   4727  O O   . CYS E  2 32  ? -47.792 4.719   1.133   1.00 65.90  ? 32  CYS E O   1 
ATOM   4728  C CB  . CYS E  2 32  ? -45.178 2.953   1.168   1.00 62.55  ? 32  CYS E CB  1 
ATOM   4729  S SG  . CYS E  2 32  ? -44.099 1.621   0.573   1.00 67.03  ? 32  CYS E SG  1 
ATOM   4730  N N   . TYR E  2 33  ? -47.770 3.582   3.095   1.00 65.07  ? 33  TYR E N   1 
ATOM   4731  C CA  . TYR E  2 33  ? -48.518 4.600   3.853   1.00 65.38  ? 33  TYR E CA  1 
ATOM   4732  C C   . TYR E  2 33  ? -47.587 5.704   4.330   1.00 65.65  ? 33  TYR E C   1 
ATOM   4733  O O   . TYR E  2 33  ? -46.446 5.404   4.707   1.00 65.30  ? 33  TYR E O   1 
ATOM   4734  C CB  . TYR E  2 33  ? -49.196 3.958   5.068   1.00 71.12  ? 33  TYR E CB  1 
ATOM   4735  C CG  . TYR E  2 33  ? -50.266 4.801   5.733   1.00 75.13  ? 33  TYR E CG  1 
ATOM   4736  C CD1 . TYR E  2 33  ? -51.593 4.732   5.318   1.00 80.27  ? 33  TYR E CD1 1 
ATOM   4737  C CD2 . TYR E  2 33  ? -49.974 5.582   6.847   1.00 75.33  ? 33  TYR E CD2 1 
ATOM   4738  C CE1 . TYR E  2 33  ? -52.592 5.463   5.958   1.00 83.45  ? 33  TYR E CE1 1 
ATOM   4739  C CE2 . TYR E  2 33  ? -50.964 6.320   7.494   1.00 78.27  ? 33  TYR E CE2 1 
ATOM   4740  C CZ  . TYR E  2 33  ? -52.274 6.254   7.049   1.00 89.02  ? 33  TYR E CZ  1 
ATOM   4741  O OH  . TYR E  2 33  ? -53.266 6.959   7.695   1.00 91.87  ? 33  TYR E OH  1 
ATOM   4742  N N   . THR E  2 34  ? -48.066 6.976   4.326   1.00 59.95  ? 34  THR E N   1 
ATOM   4743  C CA  . THR E  2 34  ? -47.315 8.161   4.809   1.00 56.71  ? 34  THR E CA  1 
ATOM   4744  C C   . THR E  2 34  ? -48.245 9.218   5.431   1.00 60.15  ? 34  THR E C   1 
ATOM   4745  O O   . THR E  2 34  ? -49.442 9.297   5.121   1.00 61.32  ? 34  THR E O   1 
ATOM   4746  C CB  . THR E  2 34  ? -46.329 8.780   3.764   1.00 61.64  ? 34  THR E CB  1 
ATOM   4747  O OG1 . THR E  2 34  ? -46.781 8.571   2.420   1.00 66.26  ? 34  THR E OG1 1 
ATOM   4748  C CG2 . THR E  2 34  ? -44.909 8.234   3.913   1.00 55.44  ? 34  THR E CG2 1 
ATOM   4749  N N   . ARG E  2 35  ? -47.674 10.005  6.351   1.00 54.74  ? 35  ARG E N   1 
ATOM   4750  C CA  . ARG E  2 35  ? -48.358 11.079  7.078   1.00 54.24  ? 35  ARG E CA  1 
ATOM   4751  C C   . ARG E  2 35  ? -47.539 12.350  6.916   1.00 53.75  ? 35  ARG E C   1 
ATOM   4752  O O   . ARG E  2 35  ? -46.303 12.286  6.878   1.00 51.95  ? 35  ARG E O   1 
ATOM   4753  C CB  . ARG E  2 35  ? -48.430 10.731  8.572   1.00 55.69  ? 35  ARG E CB  1 
ATOM   4754  C CG  . ARG E  2 35  ? -49.838 10.612  9.121   1.00 75.77  ? 35  ARG E CG  1 
ATOM   4755  C CD  . ARG E  2 35  ? -49.864 10.036  10.530  1.00 95.50  ? 35  ARG E CD  1 
ATOM   4756  N NE  . ARG E  2 35  ? -49.462 8.624   10.559  1.00 113.70 ? 35  ARG E NE  1 
ATOM   4757  C CZ  . ARG E  2 35  ? -50.301 7.595   10.665  1.00 132.26 ? 35  ARG E CZ  1 
ATOM   4758  N NH1 . ARG E  2 35  ? -51.610 7.802   10.767  1.00 119.41 ? 35  ARG E NH1 1 
ATOM   4759  N NH2 . ARG E  2 35  ? -49.838 6.352   10.675  1.00 120.22 ? 35  ARG E NH2 1 
ATOM   4760  N N   . ASP E  2 36  ? -48.211 13.499  6.812   1.00 48.83  ? 36  ASP E N   1 
ATOM   4761  C CA  . ASP E  2 36  ? -47.538 14.797  6.762   1.00 45.74  ? 36  ASP E CA  1 
ATOM   4762  C C   . ASP E  2 36  ? -47.814 15.387  8.135   1.00 51.80  ? 36  ASP E C   1 
ATOM   4763  O O   . ASP E  2 36  ? -48.976 15.583  8.498   1.00 55.09  ? 36  ASP E O   1 
ATOM   4764  C CB  . ASP E  2 36  ? -48.075 15.694  5.641   1.00 46.52  ? 36  ASP E CB  1 
ATOM   4765  C CG  . ASP E  2 36  ? -47.242 16.927  5.358   1.00 57.36  ? 36  ASP E CG  1 
ATOM   4766  O OD1 . ASP E  2 36  ? -46.408 17.294  6.208   1.00 59.01  ? 36  ASP E OD1 1 
ATOM   4767  O OD2 . ASP E  2 36  ? -47.431 17.535  4.290   1.00 65.12  ? 36  ASP E OD2 1 
ATOM   4768  N N   . LEU E  2 37  ? -46.757 15.568  8.938   1.00 45.51  ? 37  LEU E N   1 
ATOM   4769  C CA  . LEU E  2 37  ? -46.888 16.042  10.309  1.00 45.22  ? 37  LEU E CA  1 
ATOM   4770  C C   . LEU E  2 37  ? -47.447 17.416  10.353  1.00 48.76  ? 37  LEU E C   1 
ATOM   4771  O O   . LEU E  2 37  ? -47.105 18.255  9.543   1.00 45.33  ? 37  LEU E O   1 
ATOM   4772  C CB  . LEU E  2 37  ? -45.593 15.899  11.120  1.00 44.58  ? 37  LEU E CB  1 
ATOM   4773  C CG  . LEU E  2 37  ? -44.956 14.488  11.160  1.00 49.29  ? 37  LEU E CG  1 
ATOM   4774  C CD1 . LEU E  2 37  ? -44.152 14.306  12.384  1.00 51.42  ? 37  LEU E CD1 1 
ATOM   4775  C CD2 . LEU E  2 37  ? -45.993 13.362  11.162  1.00 53.67  ? 37  LEU E CD2 1 
ATOM   4776  N N   . VAL E  2 38  ? -48.421 17.587  11.222  1.00 51.31  ? 38  VAL E N   1 
ATOM   4777  C CA  . VAL E  2 38  ? -49.203 18.795  11.434  1.00 52.59  ? 38  VAL E CA  1 
ATOM   4778  C C   . VAL E  2 38  ? -48.472 19.791  12.333  1.00 58.67  ? 38  VAL E C   1 
ATOM   4779  O O   . VAL E  2 38  ? -48.641 20.986  12.132  1.00 58.68  ? 38  VAL E O   1 
ATOM   4780  C CB  . VAL E  2 38  ? -50.586 18.343  11.955  1.00 59.65  ? 38  VAL E CB  1 
ATOM   4781  C CG1 . VAL E  2 38  ? -51.059 19.135  13.159  1.00 62.33  ? 38  VAL E CG1 1 
ATOM   4782  C CG2 . VAL E  2 38  ? -51.619 18.334  10.841  1.00 59.50  ? 38  VAL E CG2 1 
ATOM   4783  N N   . TYR E  2 39  ? -47.650 19.296  13.303  1.00 57.46  ? 39  TYR E N   1 
ATOM   4784  C CA  . TYR E  2 39  ? -46.828 20.060  14.265  1.00 58.06  ? 39  TYR E CA  1 
ATOM   4785  C C   . TYR E  2 39  ? -45.355 19.900  13.881  1.00 60.83  ? 39  TYR E C   1 
ATOM   4786  O O   . TYR E  2 39  ? -44.790 18.801  13.970  1.00 59.75  ? 39  TYR E O   1 
ATOM   4787  C CB  . TYR E  2 39  ? -47.089 19.565  15.709  1.00 62.58  ? 39  TYR E CB  1 
ATOM   4788  C CG  . TYR E  2 39  ? -46.400 20.338  16.817  1.00 65.84  ? 39  TYR E CG  1 
ATOM   4789  C CD1 . TYR E  2 39  ? -46.763 21.648  17.111  1.00 68.67  ? 39  TYR E CD1 1 
ATOM   4790  C CD2 . TYR E  2 39  ? -45.456 19.727  17.638  1.00 68.18  ? 39  TYR E CD2 1 
ATOM   4791  C CE1 . TYR E  2 39  ? -46.162 22.351  18.155  1.00 72.04  ? 39  TYR E CE1 1 
ATOM   4792  C CE2 . TYR E  2 39  ? -44.851 20.419  18.688  1.00 71.05  ? 39  TYR E CE2 1 
ATOM   4793  C CZ  . TYR E  2 39  ? -45.221 21.725  18.954  1.00 79.63  ? 39  TYR E CZ  1 
ATOM   4794  O OH  . TYR E  2 39  ? -44.638 22.407  19.990  1.00 85.03  ? 39  TYR E OH  1 
ATOM   4795  N N   . LYS E  2 40  ? -44.739 20.997  13.437  1.00 57.89  ? 40  LYS E N   1 
ATOM   4796  C CA  . LYS E  2 40  ? -43.357 20.972  12.944  1.00 57.29  ? 40  LYS E CA  1 
ATOM   4797  C C   . LYS E  2 40  ? -42.274 21.115  14.061  1.00 62.85  ? 40  LYS E C   1 
ATOM   4798  O O   . LYS E  2 40  ? -41.467 22.057  14.039  1.00 63.40  ? 40  LYS E O   1 
ATOM   4799  C CB  . LYS E  2 40  ? -43.173 22.016  11.803  1.00 58.69  ? 40  LYS E CB  1 
ATOM   4800  C CG  . LYS E  2 40  ? -44.141 21.848  10.592  1.00 74.72  ? 40  LYS E CG  1 
ATOM   4801  C CD  . LYS E  2 40  ? -44.232 20.397  10.017  1.00 76.06  ? 40  LYS E CD  1 
ATOM   4802  C CE  . LYS E  2 40  ? -44.709 20.337  8.587   1.00 73.45  ? 40  LYS E CE  1 
ATOM   4803  N NZ  . LYS E  2 40  ? -44.672 18.954  8.056   1.00 80.67  ? 40  LYS E NZ  1 
ATOM   4804  N N   . ASP E  2 41  ? -42.226 20.144  14.996  1.00 59.76  ? 41  ASP E N   1 
ATOM   4805  C CA  . ASP E  2 41  ? -41.233 20.152  16.077  1.00 62.14  ? 41  ASP E CA  1 
ATOM   4806  C C   . ASP E  2 41  ? -39.847 19.706  15.547  1.00 65.05  ? 41  ASP E C   1 
ATOM   4807  O O   . ASP E  2 41  ? -39.779 18.630  14.967  1.00 62.86  ? 41  ASP E O   1 
ATOM   4808  C CB  . ASP E  2 41  ? -41.676 19.230  17.221  1.00 67.11  ? 41  ASP E CB  1 
ATOM   4809  C CG  . ASP E  2 41  ? -40.779 19.300  18.437  1.00 80.32  ? 41  ASP E CG  1 
ATOM   4810  O OD1 . ASP E  2 41  ? -40.394 20.423  18.825  1.00 83.55  ? 41  ASP E OD1 1 
ATOM   4811  O OD2 . ASP E  2 41  ? -40.519 18.244  19.040  1.00 85.11  ? 41  ASP E OD2 1 
ATOM   4812  N N   . PRO E  2 42  ? -38.724 20.451  15.737  1.00 61.66  ? 42  PRO E N   1 
ATOM   4813  C CA  . PRO E  2 42  ? -37.431 19.985  15.190  1.00 60.82  ? 42  PRO E CA  1 
ATOM   4814  C C   . PRO E  2 42  ? -37.051 18.534  15.555  1.00 68.96  ? 42  PRO E C   1 
ATOM   4815  O O   . PRO E  2 42  ? -36.442 17.825  14.737  1.00 65.73  ? 42  PRO E O   1 
ATOM   4816  C CB  . PRO E  2 42  ? -36.428 21.016  15.719  1.00 64.14  ? 42  PRO E CB  1 
ATOM   4817  C CG  . PRO E  2 42  ? -37.131 21.724  16.815  1.00 70.76  ? 42  PRO E CG  1 
ATOM   4818  C CD  . PRO E  2 42  ? -38.565 21.752  16.404  1.00 64.50  ? 42  PRO E CD  1 
ATOM   4819  N N   . ALA E  2 43  ? -37.490 18.082  16.759  1.00 71.23  ? 43  ALA E N   1 
ATOM   4820  C CA  . ALA E  2 43  ? -37.287 16.742  17.321  1.00 73.71  ? 43  ALA E CA  1 
ATOM   4821  C C   . ALA E  2 43  ? -38.447 15.763  17.039  1.00 79.75  ? 43  ALA E C   1 
ATOM   4822  O O   . ALA E  2 43  ? -38.446 14.663  17.576  1.00 82.03  ? 43  ALA E O   1 
ATOM   4823  C CB  . ALA E  2 43  ? -37.046 16.849  18.818  1.00 78.97  ? 43  ALA E CB  1 
ATOM   4824  N N   . ARG E  2 44  ? -39.431 16.149  16.208  1.00 76.53  ? 44  ARG E N   1 
ATOM   4825  C CA  . ARG E  2 44  ? -40.551 15.274  15.849  1.00 77.77  ? 44  ARG E CA  1 
ATOM   4826  C C   . ARG E  2 44  ? -40.059 14.200  14.850  1.00 84.24  ? 44  ARG E C   1 
ATOM   4827  O O   . ARG E  2 44  ? -39.004 14.405  14.235  1.00 83.24  ? 44  ARG E O   1 
ATOM   4828  C CB  . ARG E  2 44  ? -41.737 16.098  15.288  1.00 77.69  ? 44  ARG E CB  1 
ATOM   4829  C CG  . ARG E  2 44  ? -41.864 16.205  13.754  1.00 88.80  ? 44  ARG E CG  1 
ATOM   4830  C CD  . ARG E  2 44  ? -40.964 17.230  13.087  1.00 103.21 ? 44  ARG E CD  1 
ATOM   4831  N NE  . ARG E  2 44  ? -41.409 17.606  11.741  1.00 112.48 ? 44  ARG E NE  1 
ATOM   4832  C CZ  . ARG E  2 44  ? -40.820 18.528  10.982  1.00 120.63 ? 44  ARG E CZ  1 
ATOM   4833  N NH1 . ARG E  2 44  ? -39.757 19.190  11.430  1.00 104.31 ? 44  ARG E NH1 1 
ATOM   4834  N NH2 . ARG E  2 44  ? -41.281 18.788  9.766   1.00 102.97 ? 44  ARG E NH2 1 
ATOM   4835  N N   . PRO E  2 45  ? -40.767 13.062  14.642  1.00 82.93  ? 45  PRO E N   1 
ATOM   4836  C CA  . PRO E  2 45  ? -40.253 12.077  13.684  1.00 80.87  ? 45  PRO E CA  1 
ATOM   4837  C C   . PRO E  2 45  ? -40.790 12.287  12.256  1.00 79.36  ? 45  PRO E C   1 
ATOM   4838  O O   . PRO E  2 45  ? -41.802 11.689  11.858  1.00 79.13  ? 45  PRO E O   1 
ATOM   4839  C CB  . PRO E  2 45  ? -40.649 10.742  14.324  1.00 86.30  ? 45  PRO E CB  1 
ATOM   4840  C CG  . PRO E  2 45  ? -41.908 11.078  15.175  1.00 93.62  ? 45  PRO E CG  1 
ATOM   4841  C CD  . PRO E  2 45  ? -42.032 12.588  15.252  1.00 87.49  ? 45  PRO E CD  1 
ATOM   4842  N N   . LYS E  2 46  ? -40.125 13.187  11.492  1.00 71.46  ? 46  LYS E N   1 
ATOM   4843  C CA  . LYS E  2 46  ? -40.438 13.452  10.076  1.00 67.39  ? 46  LYS E CA  1 
ATOM   4844  C C   . LYS E  2 46  ? -39.805 12.270  9.330   1.00 69.89  ? 46  LYS E C   1 
ATOM   4845  O O   . LYS E  2 46  ? -38.590 12.271  9.049   1.00 69.49  ? 46  LYS E O   1 
ATOM   4846  C CB  . LYS E  2 46  ? -39.861 14.810  9.573   1.00 67.34  ? 46  LYS E CB  1 
ATOM   4847  C CG  . LYS E  2 46  ? -38.900 15.557  10.518  1.00 74.22  ? 46  LYS E CG  1 
ATOM   4848  C CD  . LYS E  2 46  ? -37.431 15.164  10.363  1.00 85.18  ? 46  LYS E CD  1 
ATOM   4849  C CE  . LYS E  2 46  ? -36.594 15.597  11.550  1.00 92.66  ? 46  LYS E CE  1 
ATOM   4850  N NZ  . LYS E  2 46  ? -36.716 14.700  12.736  1.00 95.25  ? 46  LYS E NZ  1 
ATOM   4851  N N   . ILE E  2 47  ? -40.594 11.202  9.138   1.00 64.54  ? 47  ILE E N   1 
ATOM   4852  C CA  . ILE E  2 47  ? -40.065 9.987   8.523   1.00 63.09  ? 47  ILE E CA  1 
ATOM   4853  C C   . ILE E  2 47  ? -41.022 9.421   7.483   1.00 63.27  ? 47  ILE E C   1 
ATOM   4854  O O   . ILE E  2 47  ? -42.219 9.266   7.753   1.00 65.56  ? 47  ILE E O   1 
ATOM   4855  C CB  . ILE E  2 47  ? -39.625 8.941   9.593   1.00 69.44  ? 47  ILE E CB  1 
ATOM   4856  C CG1 . ILE E  2 47  ? -39.215 7.579   8.959   1.00 70.49  ? 47  ILE E CG1 1 
ATOM   4857  C CG2 . ILE E  2 47  ? -40.684 8.753   10.709  1.00 73.28  ? 47  ILE E CG2 1 
ATOM   4858  C CD1 . ILE E  2 47  ? -37.945 7.574   8.035   1.00 78.55  ? 47  ILE E CD1 1 
ATOM   4859  N N   . GLN E  2 48  ? -40.479 9.113   6.295   1.00 53.71  ? 48  GLN E N   1 
ATOM   4860  C CA  . GLN E  2 48  ? -41.253 8.600   5.172   1.00 51.39  ? 48  GLN E CA  1 
ATOM   4861  C C   . GLN E  2 48  ? -40.781 7.241   4.659   1.00 55.91  ? 48  GLN E C   1 
ATOM   4862  O O   . GLN E  2 48  ? -39.583 7.014   4.498   1.00 55.34  ? 48  GLN E O   1 
ATOM   4863  C CB  . GLN E  2 48  ? -41.268 9.615   4.019   1.00 49.02  ? 48  GLN E CB  1 
ATOM   4864  C CG  . GLN E  2 48  ? -42.130 10.812  4.294   1.00 29.30  ? 48  GLN E CG  1 
ATOM   4865  C CD  . GLN E  2 48  ? -41.781 11.992  3.425   1.00 52.53  ? 48  GLN E CD  1 
ATOM   4866  O OE1 . GLN E  2 48  ? -40.616 12.331  3.208   1.00 42.88  ? 48  GLN E OE1 1 
ATOM   4867  N NE2 . GLN E  2 48  ? -42.799 12.713  2.982   1.00 51.84  ? 48  GLN E NE2 1 
ATOM   4868  N N   . LYS E  2 49  ? -41.734 6.355   4.357   1.00 53.18  ? 49  LYS E N   1 
ATOM   4869  C CA  . LYS E  2 49  ? -41.419 5.057   3.785   1.00 53.34  ? 49  LYS E CA  1 
ATOM   4870  C C   . LYS E  2 49  ? -41.702 5.043   2.272   1.00 56.62  ? 49  LYS E C   1 
ATOM   4871  O O   . LYS E  2 49  ? -42.633 5.701   1.797   1.00 56.69  ? 49  LYS E O   1 
ATOM   4872  C CB  . LYS E  2 49  ? -42.121 3.908   4.543   1.00 58.01  ? 49  LYS E CB  1 
ATOM   4873  C CG  . LYS E  2 49  ? -41.441 3.603   5.880   1.00 63.34  ? 49  LYS E CG  1 
ATOM   4874  C CD  . LYS E  2 49  ? -42.205 2.636   6.778   1.00 71.88  ? 49  LYS E CD  1 
ATOM   4875  C CE  . LYS E  2 49  ? -41.431 2.324   8.044   1.00 76.62  ? 49  LYS E CE  1 
ATOM   4876  N NZ  . LYS E  2 49  ? -42.215 1.473   8.978   1.00 87.53  ? 49  LYS E NZ  1 
ATOM   4877  N N   . THR E  2 50  ? -40.857 4.326   1.528   1.00 52.02  ? 50  THR E N   1 
ATOM   4878  C CA  . THR E  2 50  ? -40.939 4.113   0.082   1.00 50.70  ? 50  THR E CA  1 
ATOM   4879  C C   . THR E  2 50  ? -40.880 2.593   -0.185  1.00 54.20  ? 50  THR E C   1 
ATOM   4880  O O   . THR E  2 50  ? -40.356 1.851   0.650   1.00 53.10  ? 50  THR E O   1 
ATOM   4881  C CB  . THR E  2 50  ? -39.842 4.942   -0.672  1.00 60.89  ? 50  THR E CB  1 
ATOM   4882  O OG1 . THR E  2 50  ? -39.670 4.456   -2.012  1.00 67.29  ? 50  THR E OG1 1 
ATOM   4883  C CG2 . THR E  2 50  ? -38.482 4.913   0.017   1.00 57.59  ? 50  THR E CG2 1 
ATOM   4884  N N   . CYS E  2 51  ? -41.442 2.133   -1.322  1.00 52.39  ? 51  CYS E N   1 
ATOM   4885  C CA  . CYS E  2 51  ? -41.377 0.723   -1.713  1.00 55.13  ? 51  CYS E CA  1 
ATOM   4886  C C   . CYS E  2 51  ? -40.009 0.509   -2.364  1.00 57.27  ? 51  CYS E C   1 
ATOM   4887  O O   . CYS E  2 51  ? -39.661 1.237   -3.298  1.00 55.83  ? 51  CYS E O   1 
ATOM   4888  C CB  . CYS E  2 51  ? -42.522 0.348   -2.648  1.00 58.35  ? 51  CYS E CB  1 
ATOM   4889  S SG  . CYS E  2 51  ? -42.570 -1.408  -3.097  1.00 66.03  ? 51  CYS E SG  1 
ATOM   4890  N N   . THR E  2 52  ? -39.190 -0.407  -1.793  1.00 53.71  ? 52  THR E N   1 
ATOM   4891  C CA  . THR E  2 52  ? -37.792 -0.669  -2.205  1.00 51.31  ? 52  THR E CA  1 
ATOM   4892  C C   . THR E  2 52  ? -37.284 -2.040  -1.770  1.00 55.56  ? 52  THR E C   1 
ATOM   4893  O O   . THR E  2 52  ? -37.874 -2.677  -0.892  1.00 57.24  ? 52  THR E O   1 
ATOM   4894  C CB  . THR E  2 52  ? -36.844 0.429   -1.650  1.00 51.93  ? 52  THR E CB  1 
ATOM   4895  O OG1 . THR E  2 52  ? -35.573 0.319   -2.293  1.00 52.60  ? 52  THR E OG1 1 
ATOM   4896  C CG2 . THR E  2 52  ? -36.658 0.351   -0.124  1.00 47.57  ? 52  THR E CG2 1 
ATOM   4897  N N   . PHE E  2 53  ? -36.145 -2.454  -2.340  1.00 51.53  ? 53  PHE E N   1 
ATOM   4898  C CA  . PHE E  2 53  ? -35.526 -3.730  -2.015  1.00 54.40  ? 53  PHE E CA  1 
ATOM   4899  C C   . PHE E  2 53  ? -35.142 -3.843  -0.523  1.00 60.44  ? 53  PHE E C   1 
ATOM   4900  O O   . PHE E  2 53  ? -34.495 -2.950  0.019   1.00 58.62  ? 53  PHE E O   1 
ATOM   4901  C CB  . PHE E  2 53  ? -34.336 -4.043  -2.957  1.00 55.78  ? 53  PHE E CB  1 
ATOM   4902  C CG  . PHE E  2 53  ? -33.052 -3.283  -2.703  1.00 56.57  ? 53  PHE E CG  1 
ATOM   4903  C CD1 . PHE E  2 53  ? -32.081 -3.790  -1.842  1.00 61.56  ? 53  PHE E CD1 1 
ATOM   4904  C CD2 . PHE E  2 53  ? -32.803 -2.070  -3.337  1.00 56.53  ? 53  PHE E CD2 1 
ATOM   4905  C CE1 . PHE E  2 53  ? -30.909 -3.068  -1.579  1.00 61.42  ? 53  PHE E CE1 1 
ATOM   4906  C CE2 . PHE E  2 53  ? -31.619 -1.368  -3.095  1.00 58.23  ? 53  PHE E CE2 1 
ATOM   4907  C CZ  . PHE E  2 53  ? -30.681 -1.872  -2.217  1.00 57.40  ? 53  PHE E CZ  1 
ATOM   4908  N N   . LYS E  2 54  ? -35.612 -4.908  0.144   1.00 60.94  ? 54  LYS E N   1 
ATOM   4909  C CA  . LYS E  2 54  ? -35.265 -5.204  1.527   1.00 62.80  ? 54  LYS E CA  1 
ATOM   4910  C C   . LYS E  2 54  ? -33.944 -5.957  1.446   1.00 68.43  ? 54  LYS E C   1 
ATOM   4911  O O   . LYS E  2 54  ? -33.063 -5.714  2.269   1.00 69.46  ? 54  LYS E O   1 
ATOM   4912  C CB  . LYS E  2 54  ? -36.367 -6.020  2.232   1.00 68.30  ? 54  LYS E CB  1 
ATOM   4913  C CG  . LYS E  2 54  ? -35.903 -6.726  3.499   1.00 82.10  ? 54  LYS E CG  1 
ATOM   4914  C CD  . LYS E  2 54  ? -36.739 -6.420  4.719   1.00 93.16  ? 54  LYS E CD  1 
ATOM   4915  C CE  . LYS E  2 54  ? -36.164 -7.094  5.945   1.00 109.72 ? 54  LYS E CE  1 
ATOM   4916  N NZ  . LYS E  2 54  ? -34.888 -6.467  6.396   1.00 117.69 ? 54  LYS E NZ  1 
ATOM   4917  N N   . GLU E  2 55  ? -33.800 -6.835  0.423   1.00 65.35  ? 55  GLU E N   1 
ATOM   4918  C CA  . GLU E  2 55  ? -32.599 -7.633  0.113   1.00 66.76  ? 55  GLU E CA  1 
ATOM   4919  C C   . GLU E  2 55  ? -32.521 -7.832  -1.415  1.00 68.82  ? 55  GLU E C   1 
ATOM   4920  O O   . GLU E  2 55  ? -33.557 -7.836  -2.092  1.00 68.11  ? 55  GLU E O   1 
ATOM   4921  C CB  . GLU E  2 55  ? -32.641 -9.041  0.775   1.00 73.08  ? 55  GLU E CB  1 
ATOM   4922  C CG  . GLU E  2 55  ? -32.955 -9.116  2.268   1.00 92.17  ? 55  GLU E CG  1 
ATOM   4923  C CD  . GLU E  2 55  ? -31.859 -8.826  3.282   1.00 124.71 ? 55  GLU E CD  1 
ATOM   4924  O OE1 . GLU E  2 55  ? -30.694 -8.600  2.877   1.00 132.23 ? 55  GLU E OE1 1 
ATOM   4925  O OE2 . GLU E  2 55  ? -32.171 -8.843  4.496   1.00 117.33 ? 55  GLU E OE2 1 
ATOM   4926  N N   . LEU E  2 56  ? -31.304 -8.028  -1.955  1.00 64.22  ? 56  LEU E N   1 
ATOM   4927  C CA  . LEU E  2 56  ? -31.124 -8.286  -3.389  1.00 62.63  ? 56  LEU E CA  1 
ATOM   4928  C C   . LEU E  2 56  ? -29.981 -9.284  -3.682  1.00 66.75  ? 56  LEU E C   1 
ATOM   4929  O O   . LEU E  2 56  ? -29.311 -9.771  -2.770  1.00 67.36  ? 56  LEU E O   1 
ATOM   4930  C CB  . LEU E  2 56  ? -31.000 -6.989  -4.251  1.00 59.54  ? 56  LEU E CB  1 
ATOM   4931  C CG  . LEU E  2 56  ? -29.874 -5.956  -4.002  1.00 62.99  ? 56  LEU E CG  1 
ATOM   4932  C CD1 . LEU E  2 56  ? -28.533 -6.403  -4.604  1.00 64.04  ? 56  LEU E CD1 1 
ATOM   4933  C CD2 . LEU E  2 56  ? -30.210 -4.655  -4.684  1.00 62.45  ? 56  LEU E CD2 1 
ATOM   4934  N N   . VAL E  2 57  ? -29.816 -9.618  -4.964  1.00 63.51  ? 57  VAL E N   1 
ATOM   4935  C CA  . VAL E  2 57  ? -28.791 -10.510 -5.507  1.00 65.15  ? 57  VAL E CA  1 
ATOM   4936  C C   . VAL E  2 57  ? -28.281 -9.894  -6.798  1.00 70.00  ? 57  VAL E C   1 
ATOM   4937  O O   . VAL E  2 57  ? -28.908 -8.974  -7.307  1.00 68.08  ? 57  VAL E O   1 
ATOM   4938  C CB  . VAL E  2 57  ? -29.276 -11.966 -5.715  1.00 71.38  ? 57  VAL E CB  1 
ATOM   4939  C CG1 . VAL E  2 57  ? -29.218 -12.751 -4.419  1.00 74.12  ? 57  VAL E CG1 1 
ATOM   4940  C CG2 . VAL E  2 57  ? -30.672 -12.018 -6.323  1.00 71.38  ? 57  VAL E CG2 1 
ATOM   4941  N N   . TYR E  2 58  ? -27.148 -10.368 -7.317  1.00 69.53  ? 58  TYR E N   1 
ATOM   4942  C CA  . TYR E  2 58  ? -26.594 -9.850  -8.565  1.00 69.08  ? 58  TYR E CA  1 
ATOM   4943  C C   . TYR E  2 58  ? -26.470 -10.993 -9.598  1.00 75.49  ? 58  TYR E C   1 
ATOM   4944  O O   . TYR E  2 58  ? -25.750 -11.965 -9.359  1.00 77.74  ? 58  TYR E O   1 
ATOM   4945  C CB  . TYR E  2 58  ? -25.241 -9.151  -8.309  1.00 70.45  ? 58  TYR E CB  1 
ATOM   4946  C CG  . TYR E  2 58  ? -25.321 -7.655  -8.061  1.00 70.46  ? 58  TYR E CG  1 
ATOM   4947  C CD1 . TYR E  2 58  ? -25.446 -6.757  -9.119  1.00 71.25  ? 58  TYR E CD1 1 
ATOM   4948  C CD2 . TYR E  2 58  ? -25.169 -7.134  -6.781  1.00 70.83  ? 58  TYR E CD2 1 
ATOM   4949  C CE1 . TYR E  2 58  ? -25.472 -5.380  -8.904  1.00 70.06  ? 58  TYR E CE1 1 
ATOM   4950  C CE2 . TYR E  2 58  ? -25.199 -5.759  -6.551  1.00 70.06  ? 58  TYR E CE2 1 
ATOM   4951  C CZ  . TYR E  2 58  ? -25.352 -4.883  -7.617  1.00 76.61  ? 58  TYR E CZ  1 
ATOM   4952  O OH  . TYR E  2 58  ? -25.381 -3.520  -7.402  1.00 74.83  ? 58  TYR E OH  1 
ATOM   4953  N N   . GLU E  2 59  ? -27.212 -10.902 -10.711 1.00 71.38  ? 59  GLU E N   1 
ATOM   4954  C CA  . GLU E  2 59  ? -27.181 -11.915 -11.766 1.00 73.32  ? 59  GLU E CA  1 
ATOM   4955  C C   . GLU E  2 59  ? -26.316 -11.447 -12.922 1.00 78.23  ? 59  GLU E C   1 
ATOM   4956  O O   . GLU E  2 59  ? -26.360 -10.279 -13.286 1.00 77.42  ? 59  GLU E O   1 
ATOM   4957  C CB  . GLU E  2 59  ? -28.595 -12.264 -12.245 1.00 75.40  ? 59  GLU E CB  1 
ATOM   4958  C CG  . GLU E  2 59  ? -29.177 -13.482 -11.552 1.00 89.03  ? 59  GLU E CG  1 
ATOM   4959  C CD  . GLU E  2 59  ? -30.687 -13.522 -11.393 1.00 117.46 ? 59  GLU E CD  1 
ATOM   4960  O OE1 . GLU E  2 59  ? -31.412 -13.101 -12.325 1.00 111.86 ? 59  GLU E OE1 1 
ATOM   4961  O OE2 . GLU E  2 59  ? -31.146 -14.004 -10.332 1.00 119.43 ? 59  GLU E OE2 1 
ATOM   4962  N N   . THR E  2 60  ? -25.515 -12.339 -13.486 1.00 76.84  ? 60  THR E N   1 
ATOM   4963  C CA  . THR E  2 60  ? -24.644 -11.965 -14.589 1.00 76.68  ? 60  THR E CA  1 
ATOM   4964  C C   . THR E  2 60  ? -25.170 -12.593 -15.849 1.00 80.47  ? 60  THR E C   1 
ATOM   4965  O O   . THR E  2 60  ? -25.426 -13.795 -15.879 1.00 81.98  ? 60  THR E O   1 
ATOM   4966  C CB  . THR E  2 60  ? -23.176 -12.257 -14.248 1.00 88.16  ? 60  THR E CB  1 
ATOM   4967  O OG1 . THR E  2 60  ? -22.846 -11.533 -13.057 1.00 88.19  ? 60  THR E OG1 1 
ATOM   4968  C CG2 . THR E  2 60  ? -22.214 -11.860 -15.364 1.00 86.25  ? 60  THR E CG2 1 
ATOM   4969  N N   . VAL E  2 61  ? -25.376 -11.751 -16.869 1.00 75.41  ? 61  VAL E N   1 
ATOM   4970  C CA  . VAL E  2 61  ? -25.906 -12.104 -18.183 1.00 76.31  ? 61  VAL E CA  1 
ATOM   4971  C C   . VAL E  2 61  ? -24.877 -11.833 -19.301 1.00 81.18  ? 61  VAL E C   1 
ATOM   4972  O O   . VAL E  2 61  ? -24.040 -10.931 -19.165 1.00 79.43  ? 61  VAL E O   1 
ATOM   4973  C CB  . VAL E  2 61  ? -27.268 -11.394 -18.419 1.00 79.07  ? 61  VAL E CB  1 
ATOM   4974  C CG1 . VAL E  2 61  ? -27.100 -9.926  -18.829 1.00 77.28  ? 61  VAL E CG1 1 
ATOM   4975  C CG2 . VAL E  2 61  ? -28.137 -12.156 -19.413 1.00 81.76  ? 61  VAL E CG2 1 
ATOM   4976  N N   . ARG E  2 62  ? -24.930 -12.637 -20.392 1.00 80.17  ? 62  ARG E N   1 
ATOM   4977  C CA  . ARG E  2 62  ? -24.049 -12.462 -21.541 1.00 81.05  ? 62  ARG E CA  1 
ATOM   4978  C C   . ARG E  2 62  ? -24.797 -11.652 -22.581 1.00 83.39  ? 62  ARG E C   1 
ATOM   4979  O O   . ARG E  2 62  ? -25.883 -12.035 -23.011 1.00 83.78  ? 62  ARG E O   1 
ATOM   4980  C CB  . ARG E  2 62  ? -23.552 -13.802 -22.090 1.00 84.98  ? 62  ARG E CB  1 
ATOM   4981  C CG  . ARG E  2 62  ? -22.388 -13.668 -23.075 1.00 102.04 ? 62  ARG E CG  1 
ATOM   4982  C CD  . ARG E  2 62  ? -21.038 -13.950 -22.438 1.00 114.77 ? 62  ARG E CD  1 
ATOM   4983  N NE  . ARG E  2 62  ? -20.421 -15.155 -22.995 1.00 126.55 ? 62  ARG E NE  1 
ATOM   4984  C CZ  . ARG E  2 62  ? -20.354 -16.325 -22.367 1.00 142.29 ? 62  ARG E CZ  1 
ATOM   4985  N NH1 . ARG E  2 62  ? -20.851 -16.460 -21.142 1.00 126.43 ? 62  ARG E NH1 1 
ATOM   4986  N NH2 . ARG E  2 62  ? -19.780 -17.367 -22.955 1.00 133.73 ? 62  ARG E NH2 1 
ATOM   4987  N N   . VAL E  2 63  ? -24.240 -10.488 -22.915 1.00 78.99  ? 63  VAL E N   1 
ATOM   4988  C CA  . VAL E  2 63  ? -24.792 -9.526  -23.864 1.00 79.62  ? 63  VAL E CA  1 
ATOM   4989  C C   . VAL E  2 63  ? -24.152 -9.754  -25.251 1.00 88.73  ? 63  VAL E C   1 
ATOM   4990  O O   . VAL E  2 63  ? -22.918 -9.825  -25.350 1.00 89.32  ? 63  VAL E O   1 
ATOM   4991  C CB  . VAL E  2 63  ? -24.566 -8.090  -23.346 1.00 80.81  ? 63  VAL E CB  1 
ATOM   4992  C CG1 . VAL E  2 63  ? -25.152 -7.052  -24.293 1.00 82.13  ? 63  VAL E CG1 1 
ATOM   4993  C CG2 . VAL E  2 63  ? -25.134 -7.925  -21.943 1.00 76.90  ? 63  VAL E CG2 1 
ATOM   4994  N N   . PRO E  2 64  ? -24.972 -9.881  -26.325 1.00 88.44  ? 64  PRO E N   1 
ATOM   4995  C CA  . PRO E  2 64  ? -24.403 -10.122 -27.661 1.00 92.83  ? 64  PRO E CA  1 
ATOM   4996  C C   . PRO E  2 64  ? -23.578 -8.967  -28.205 1.00 100.05 ? 64  PRO E C   1 
ATOM   4997  O O   . PRO E  2 64  ? -23.805 -7.820  -27.840 1.00 98.41  ? 64  PRO E O   1 
ATOM   4998  C CB  . PRO E  2 64  ? -25.640 -10.348 -28.540 1.00 97.06  ? 64  PRO E CB  1 
ATOM   4999  C CG  . PRO E  2 64  ? -26.761 -10.608 -27.601 1.00 98.28  ? 64  PRO E CG  1 
ATOM   5000  C CD  . PRO E  2 64  ? -26.448 -9.838  -26.377 1.00 89.68  ? 64  PRO E CD  1 
ATOM   5001  N N   . GLY E  2 65  ? -22.633 -9.292  -29.074 1.00 101.69 ? 65  GLY E N   1 
ATOM   5002  C CA  . GLY E  2 65  ? -21.800 -8.311  -29.752 1.00 105.10 ? 65  GLY E CA  1 
ATOM   5003  C C   . GLY E  2 65  ? -22.357 -8.018  -31.132 1.00 115.66 ? 65  GLY E C   1 
ATOM   5004  O O   . GLY E  2 65  ? -23.552 -8.223  -31.387 1.00 115.59 ? 65  GLY E O   1 
ATOM   5005  N N   . CYS E  2 66  ? -21.490 -7.529  -32.032 1.00 117.39 ? 66  CYS E N   1 
ATOM   5006  C CA  . CYS E  2 66  ? -21.826 -7.195  -33.417 1.00 123.19 ? 66  CYS E CA  1 
ATOM   5007  C C   . CYS E  2 66  ? -20.566 -7.267  -34.298 1.00 133.53 ? 66  CYS E C   1 
ATOM   5008  O O   . CYS E  2 66  ? -19.667 -8.062  -34.005 1.00 132.61 ? 66  CYS E O   1 
ATOM   5009  C CB  . CYS E  2 66  ? -22.527 -5.836  -33.508 1.00 123.73 ? 66  CYS E CB  1 
ATOM   5010  S SG  . CYS E  2 66  ? -21.596 -4.449  -32.797 1.00 125.97 ? 66  CYS E SG  1 
ATOM   5011  N N   . ALA E  2 67  ? -20.507 -6.481  -35.383 1.00 136.64 ? 67  ALA E N   1 
ATOM   5012  C CA  . ALA E  2 67  ? -19.331 -6.461  -36.245 1.00 142.65 ? 67  ALA E CA  1 
ATOM   5013  C C   . ALA E  2 67  ? -18.285 -5.550  -35.610 1.00 147.01 ? 67  ALA E C   1 
ATOM   5014  O O   . ALA E  2 67  ? -18.635 -4.478  -35.103 1.00 145.23 ? 67  ALA E O   1 
ATOM   5015  C CB  . ALA E  2 67  ? -19.703 -5.954  -37.627 1.00 150.31 ? 67  ALA E CB  1 
ATOM   5016  N N   . HIS E  2 68  ? -17.015 -6.006  -35.584 1.00 145.39 ? 68  HIS E N   1 
ATOM   5017  C CA  . HIS E  2 68  ? -15.850 -5.290  -35.033 1.00 145.45 ? 68  HIS E CA  1 
ATOM   5018  C C   . HIS E  2 68  ? -16.029 -4.864  -33.552 1.00 143.54 ? 68  HIS E C   1 
ATOM   5019  O O   . HIS E  2 68  ? -15.415 -3.893  -33.100 1.00 143.86 ? 68  HIS E O   1 
ATOM   5020  C CB  . HIS E  2 68  ? -15.456 -4.098  -35.933 1.00 152.39 ? 68  HIS E CB  1 
ATOM   5021  C CG  . HIS E  2 68  ? -15.232 -4.476  -37.366 1.00 162.67 ? 68  HIS E CG  1 
ATOM   5022  N ND1 . HIS E  2 68  ? -13.969 -4.774  -37.844 1.00 168.85 ? 68  HIS E ND1 1 
ATOM   5023  C CD2 . HIS E  2 68  ? -16.123 -4.601  -38.377 1.00 167.72 ? 68  HIS E CD2 1 
ATOM   5024  C CE1 . HIS E  2 68  ? -14.130 -5.065  -39.125 1.00 174.01 ? 68  HIS E CE1 1 
ATOM   5025  N NE2 . HIS E  2 68  ? -15.408 -4.974  -39.491 1.00 173.99 ? 68  HIS E NE2 1 
ATOM   5026  N N   . HIS E  2 69  ? -16.864 -5.612  -32.806 1.00 134.53 ? 69  HIS E N   1 
ATOM   5027  C CA  . HIS E  2 69  ? -17.150 -5.403  -31.385 1.00 128.14 ? 69  HIS E CA  1 
ATOM   5028  C C   . HIS E  2 69  ? -17.599 -6.706  -30.723 1.00 126.47 ? 69  HIS E C   1 
ATOM   5029  O O   . HIS E  2 69  ? -18.657 -7.249  -31.057 1.00 125.79 ? 69  HIS E O   1 
ATOM   5030  C CB  . HIS E  2 69  ? -18.164 -4.274  -31.165 1.00 127.47 ? 69  HIS E CB  1 
ATOM   5031  C CG  . HIS E  2 69  ? -17.513 -2.950  -30.936 1.00 132.73 ? 69  HIS E CG  1 
ATOM   5032  N ND1 . HIS E  2 69  ? -17.419 -2.010  -31.946 1.00 139.82 ? 69  HIS E ND1 1 
ATOM   5033  C CD2 . HIS E  2 69  ? -16.895 -2.471  -29.831 1.00 132.24 ? 69  HIS E CD2 1 
ATOM   5034  C CE1 . HIS E  2 69  ? -16.785 -0.977  -31.414 1.00 139.72 ? 69  HIS E CE1 1 
ATOM   5035  N NE2 . HIS E  2 69  ? -16.457 -1.205  -30.140 1.00 135.52 ? 69  HIS E NE2 1 
ATOM   5036  N N   . ALA E  2 70  ? -16.761 -7.214  -29.803 1.00 119.01 ? 70  ALA E N   1 
ATOM   5037  C CA  . ALA E  2 70  ? -16.964 -8.466  -29.074 1.00 114.52 ? 70  ALA E CA  1 
ATOM   5038  C C   . ALA E  2 70  ? -18.147 -8.446  -28.106 1.00 111.23 ? 70  ALA E C   1 
ATOM   5039  O O   . ALA E  2 70  ? -18.558 -7.380  -27.623 1.00 108.86 ? 70  ALA E O   1 
ATOM   5040  C CB  . ALA E  2 70  ? -15.690 -8.843  -28.331 1.00 114.98 ? 70  ALA E CB  1 
ATOM   5041  N N   . ASP E  2 71  ? -18.684 -9.645  -27.821 1.00 104.17 ? 71  ASP E N   1 
ATOM   5042  C CA  . ASP E  2 71  ? -19.773 -9.838  -26.874 1.00 98.90  ? 71  ASP E CA  1 
ATOM   5043  C C   . ASP E  2 71  ? -19.241 -9.580  -25.469 1.00 96.69  ? 71  ASP E C   1 
ATOM   5044  O O   . ASP E  2 71  ? -18.155 -10.050 -25.118 1.00 96.83  ? 71  ASP E O   1 
ATOM   5045  C CB  . ASP E  2 71  ? -20.377 -11.248 -27.001 1.00 101.03 ? 71  ASP E CB  1 
ATOM   5046  C CG  . ASP E  2 71  ? -19.375 -12.377 -26.893 1.00 112.16 ? 71  ASP E CG  1 
ATOM   5047  O OD1 . ASP E  2 71  ? -19.042 -12.768 -25.753 1.00 109.00 ? 71  ASP E OD1 1 
ATOM   5048  O OD2 . ASP E  2 71  ? -18.931 -12.877 -27.949 1.00 124.47 ? 71  ASP E OD2 1 
ATOM   5049  N N   . SER E  2 72  ? -19.970 -8.778  -24.699 1.00 88.01  ? 72  SER E N   1 
ATOM   5050  C CA  . SER E  2 72  ? -19.575 -8.421  -23.345 1.00 84.20  ? 72  SER E CA  1 
ATOM   5051  C C   . SER E  2 72  ? -20.416 -9.168  -22.296 1.00 84.61  ? 72  SER E C   1 
ATOM   5052  O O   . SER E  2 72  ? -21.248 -10.003 -22.660 1.00 84.46  ? 72  SER E O   1 
ATOM   5053  C CB  . SER E  2 72  ? -19.640 -6.905  -23.156 1.00 85.81  ? 72  SER E CB  1 
ATOM   5054  O OG  . SER E  2 72  ? -20.922 -6.368  -23.435 1.00 90.31  ? 72  SER E OG  1 
ATOM   5055  N N   . LEU E  2 73  ? -20.154 -8.900  -20.999 1.00 78.20  ? 73  LEU E N   1 
ATOM   5056  C CA  . LEU E  2 73  ? -20.859 -9.456  -19.841 1.00 74.75  ? 73  LEU E CA  1 
ATOM   5057  C C   . LEU E  2 73  ? -21.445 -8.316  -18.985 1.00 76.47  ? 73  LEU E C   1 
ATOM   5058  O O   . LEU E  2 73  ? -20.733 -7.351  -18.688 1.00 75.48  ? 73  LEU E O   1 
ATOM   5059  C CB  . LEU E  2 73  ? -19.901 -10.300 -18.984 1.00 74.66  ? 73  LEU E CB  1 
ATOM   5060  C CG  . LEU E  2 73  ? -19.805 -11.761 -19.342 1.00 81.45  ? 73  LEU E CG  1 
ATOM   5061  C CD1 . LEU E  2 73  ? -18.496 -12.341 -18.890 1.00 83.31  ? 73  LEU E CD1 1 
ATOM   5062  C CD2 . LEU E  2 73  ? -20.949 -12.550 -18.747 1.00 84.03  ? 73  LEU E CD2 1 
ATOM   5063  N N   . TYR E  2 74  ? -22.725 -8.431  -18.576 1.00 71.68  ? 74  TYR E N   1 
ATOM   5064  C CA  . TYR E  2 74  ? -23.353 -7.417  -17.733 1.00 69.32  ? 74  TYR E CA  1 
ATOM   5065  C C   . TYR E  2 74  ? -23.952 -7.997  -16.443 1.00 70.17  ? 74  TYR E C   1 
ATOM   5066  O O   . TYR E  2 74  ? -24.676 -8.987  -16.500 1.00 69.26  ? 74  TYR E O   1 
ATOM   5067  C CB  . TYR E  2 74  ? -24.376 -6.574  -18.517 1.00 71.46  ? 74  TYR E CB  1 
ATOM   5068  C CG  . TYR E  2 74  ? -24.917 -5.410  -17.718 1.00 72.79  ? 74  TYR E CG  1 
ATOM   5069  C CD1 . TYR E  2 74  ? -24.093 -4.349  -17.347 1.00 74.99  ? 74  TYR E CD1 1 
ATOM   5070  C CD2 . TYR E  2 74  ? -26.230 -5.405  -17.260 1.00 72.74  ? 74  TYR E CD2 1 
ATOM   5071  C CE1 . TYR E  2 74  ? -24.569 -3.303  -16.552 1.00 74.47  ? 74  TYR E CE1 1 
ATOM   5072  C CE2 . TYR E  2 74  ? -26.728 -4.347  -16.495 1.00 72.12  ? 74  TYR E CE2 1 
ATOM   5073  C CZ  . TYR E  2 74  ? -25.892 -3.299  -16.140 1.00 80.55  ? 74  TYR E CZ  1 
ATOM   5074  O OH  . TYR E  2 74  ? -26.381 -2.260  -15.386 1.00 82.31  ? 74  TYR E OH  1 
ATOM   5075  N N   . THR E  2 75  ? -23.632 -7.369  -15.276 1.00 65.67  ? 75  THR E N   1 
ATOM   5076  C CA  . THR E  2 75  ? -24.097 -7.776  -13.942 1.00 64.15  ? 75  THR E CA  1 
ATOM   5077  C C   . THR E  2 75  ? -25.115 -6.808  -13.428 1.00 66.46  ? 75  THR E C   1 
ATOM   5078  O O   . THR E  2 75  ? -24.818 -5.623  -13.287 1.00 68.31  ? 75  THR E O   1 
ATOM   5079  C CB  . THR E  2 75  ? -22.935 -7.976  -12.961 1.00 71.89  ? 75  THR E CB  1 
ATOM   5080  O OG1 . THR E  2 75  ? -22.049 -8.953  -13.505 1.00 80.98  ? 75  THR E OG1 1 
ATOM   5081  C CG2 . THR E  2 75  ? -23.401 -8.456  -11.597 1.00 66.03  ? 75  THR E CG2 1 
ATOM   5082  N N   . TYR E  2 76  ? -26.309 -7.306  -13.125 1.00 60.55  ? 76  TYR E N   1 
ATOM   5083  C CA  . TYR E  2 76  ? -27.401 -6.465  -12.655 1.00 58.29  ? 76  TYR E CA  1 
ATOM   5084  C C   . TYR E  2 76  ? -28.032 -6.977  -11.343 1.00 60.14  ? 76  TYR E C   1 
ATOM   5085  O O   . TYR E  2 76  ? -28.013 -8.195  -11.088 1.00 59.71  ? 76  TYR E O   1 
ATOM   5086  C CB  . TYR E  2 76  ? -28.453 -6.288  -13.773 1.00 59.74  ? 76  TYR E CB  1 
ATOM   5087  C CG  . TYR E  2 76  ? -29.227 -7.547  -14.091 1.00 62.57  ? 76  TYR E CG  1 
ATOM   5088  C CD1 . TYR E  2 76  ? -28.739 -8.477  -15.003 1.00 66.42  ? 76  TYR E CD1 1 
ATOM   5089  C CD2 . TYR E  2 76  ? -30.448 -7.810  -13.477 1.00 63.57  ? 76  TYR E CD2 1 
ATOM   5090  C CE1 . TYR E  2 76  ? -29.436 -9.655  -15.275 1.00 69.48  ? 76  TYR E CE1 1 
ATOM   5091  C CE2 . TYR E  2 76  ? -31.154 -8.980  -13.743 1.00 66.82  ? 76  TYR E CE2 1 
ATOM   5092  C CZ  . TYR E  2 76  ? -30.643 -9.902  -14.638 1.00 76.94  ? 76  TYR E CZ  1 
ATOM   5093  O OH  . TYR E  2 76  ? -31.352 -11.049 -14.884 1.00 82.48  ? 76  TYR E OH  1 
ATOM   5094  N N   . PRO E  2 77  ? -28.612 -6.066  -10.509 1.00 53.77  ? 77  PRO E N   1 
ATOM   5095  C CA  . PRO E  2 77  ? -29.227 -6.522  -9.258  1.00 53.15  ? 77  PRO E CA  1 
ATOM   5096  C C   . PRO E  2 77  ? -30.654 -7.006  -9.450  1.00 58.94  ? 77  PRO E C   1 
ATOM   5097  O O   . PRO E  2 77  ? -31.373 -6.514  -10.328 1.00 59.11  ? 77  PRO E O   1 
ATOM   5098  C CB  . PRO E  2 77  ? -29.159 -5.294  -8.357  1.00 52.61  ? 77  PRO E CB  1 
ATOM   5099  C CG  . PRO E  2 77  ? -29.149 -4.136  -9.280  1.00 55.55  ? 77  PRO E CG  1 
ATOM   5100  C CD  . PRO E  2 77  ? -28.705 -4.597  -10.643 1.00 52.88  ? 77  PRO E CD  1 
ATOM   5101  N N   . VAL E  2 78  ? -31.057 -7.985  -8.630  1.00 56.56  ? 78  VAL E N   1 
ATOM   5102  C CA  . VAL E  2 78  ? -32.394 -8.574  -8.638  1.00 57.51  ? 78  VAL E CA  1 
ATOM   5103  C C   . VAL E  2 78  ? -32.900 -8.518  -7.218  1.00 61.61  ? 78  VAL E C   1 
ATOM   5104  O O   . VAL E  2 78  ? -32.173 -8.900  -6.309  1.00 61.11  ? 78  VAL E O   1 
ATOM   5105  C CB  . VAL E  2 78  ? -32.410 -10.027 -9.164  1.00 63.40  ? 78  VAL E CB  1 
ATOM   5106  C CG1 . VAL E  2 78  ? -33.838 -10.546 -9.268  1.00 65.26  ? 78  VAL E CG1 1 
ATOM   5107  C CG2 . VAL E  2 78  ? -31.703 -10.141 -10.504 1.00 63.09  ? 78  VAL E CG2 1 
ATOM   5108  N N   . ALA E  2 79  ? -34.144 -8.056  -7.026  1.00 58.91  ? 79  ALA E N   1 
ATOM   5109  C CA  . ALA E  2 79  ? -34.768 -7.965  -5.707  1.00 59.15  ? 79  ALA E CA  1 
ATOM   5110  C C   . ALA E  2 79  ? -35.162 -9.352  -5.228  1.00 66.47  ? 79  ALA E C   1 
ATOM   5111  O O   . ALA E  2 79  ? -35.701 -10.153 -5.994  1.00 68.19  ? 79  ALA E O   1 
ATOM   5112  C CB  . ALA E  2 79  ? -35.975 -7.041  -5.751  1.00 58.92  ? 79  ALA E CB  1 
ATOM   5113  N N   . THR E  2 80  ? -34.813 -9.646  -3.978  1.00 63.97  ? 80  THR E N   1 
ATOM   5114  C CA  . THR E  2 80  ? -35.044 -10.910 -3.282  1.00 67.21  ? 80  THR E CA  1 
ATOM   5115  C C   . THR E  2 80  ? -36.257 -10.737 -2.358  1.00 73.99  ? 80  THR E C   1 
ATOM   5116  O O   . THR E  2 80  ? -37.059 -11.653 -2.199  1.00 77.58  ? 80  THR E O   1 
ATOM   5117  C CB  . THR E  2 80  ? -33.712 -11.310 -2.615  1.00 72.66  ? 80  THR E CB  1 
ATOM   5118  O OG1 . THR E  2 80  ? -33.014 -12.200 -3.488  1.00 69.97  ? 80  THR E OG1 1 
ATOM   5119  C CG2 . THR E  2 80  ? -33.862 -11.914 -1.223  1.00 76.39  ? 80  THR E CG2 1 
ATOM   5120  N N   . GLN E  2 81  ? -36.381 -9.536  -1.776  1.00 69.31  ? 81  GLN E N   1 
ATOM   5121  C CA  . GLN E  2 81  ? -37.432 -9.082  -0.870  1.00 70.18  ? 81  GLN E CA  1 
ATOM   5122  C C   . GLN E  2 81  ? -37.661 -7.601  -1.111  1.00 70.72  ? 81  GLN E C   1 
ATOM   5123  O O   . GLN E  2 81  ? -36.725 -6.867  -1.424  1.00 65.24  ? 81  GLN E O   1 
ATOM   5124  C CB  . GLN E  2 81  ? -36.984 -9.252  0.585   1.00 73.50  ? 81  GLN E CB  1 
ATOM   5125  C CG  . GLN E  2 81  ? -36.988 -10.680 1.108   1.00 93.85  ? 81  GLN E CG  1 
ATOM   5126  C CD  . GLN E  2 81  ? -36.123 -10.838 2.334   1.00 115.25 ? 81  GLN E CD  1 
ATOM   5127  O OE1 . GLN E  2 81  ? -35.197 -11.659 2.354   1.00 116.68 ? 81  GLN E OE1 1 
ATOM   5128  N NE2 . GLN E  2 81  ? -36.405 -10.073 3.391   1.00 100.58 ? 81  GLN E NE2 1 
ATOM   5129  N N   . CYS E  2 82  ? -38.910 -7.171  -0.951  1.00 70.81  ? 82  CYS E N   1 
ATOM   5130  C CA  . CYS E  2 82  ? -39.363 -5.786  -1.068  1.00 68.41  ? 82  CYS E CA  1 
ATOM   5131  C C   . CYS E  2 82  ? -39.942 -5.421  0.279   1.00 72.49  ? 82  CYS E C   1 
ATOM   5132  O O   . CYS E  2 82  ? -40.400 -6.306  1.008   1.00 76.73  ? 82  CYS E O   1 
ATOM   5133  C CB  . CYS E  2 82  ? -40.432 -5.659  -2.152  1.00 70.12  ? 82  CYS E CB  1 
ATOM   5134  S SG  . CYS E  2 82  ? -39.825 -5.887  -3.841  1.00 73.34  ? 82  CYS E SG  1 
ATOM   5135  N N   . HIS E  2 83  ? -39.997 -4.122  0.583   1.00 65.14  ? 83  HIS E N   1 
ATOM   5136  C CA  . HIS E  2 83  ? -40.622 -3.599  1.799   1.00 65.55  ? 83  HIS E CA  1 
ATOM   5137  C C   . HIS E  2 83  ? -40.873 -2.100  1.699   1.00 67.18  ? 83  HIS E C   1 
ATOM   5138  O O   . HIS E  2 83  ? -40.335 -1.432  0.810   1.00 62.83  ? 83  HIS E O   1 
ATOM   5139  C CB  . HIS E  2 83  ? -39.800 -3.953  3.070   1.00 67.26  ? 83  HIS E CB  1 
ATOM   5140  C CG  . HIS E  2 83  ? -38.544 -3.157  3.292   1.00 67.22  ? 83  HIS E CG  1 
ATOM   5141  N ND1 . HIS E  2 83  ? -37.847 -2.564  2.241   1.00 65.32  ? 83  HIS E ND1 1 
ATOM   5142  C CD2 . HIS E  2 83  ? -37.874 -2.924  4.441   1.00 69.02  ? 83  HIS E CD2 1 
ATOM   5143  C CE1 . HIS E  2 83  ? -36.800 -1.975  2.792   1.00 63.05  ? 83  HIS E CE1 1 
ATOM   5144  N NE2 . HIS E  2 83  ? -36.769 -2.171  4.110   1.00 65.73  ? 83  HIS E NE2 1 
ATOM   5145  N N   . CYS E  2 84  ? -41.685 -1.576  2.622   1.00 66.50  ? 84  CYS E N   1 
ATOM   5146  C CA  . CYS E  2 84  ? -41.895 -0.145  2.771   1.00 63.84  ? 84  CYS E CA  1 
ATOM   5147  C C   . CYS E  2 84  ? -40.913 0.258   3.850   1.00 64.32  ? 84  CYS E C   1 
ATOM   5148  O O   . CYS E  2 84  ? -41.034 -0.141  5.016   1.00 65.23  ? 84  CYS E O   1 
ATOM   5149  C CB  . CYS E  2 84  ? -43.330 0.178   3.159   1.00 66.90  ? 84  CYS E CB  1 
ATOM   5150  S SG  . CYS E  2 84  ? -44.499 0.049   1.792   1.00 71.89  ? 84  CYS E SG  1 
ATOM   5151  N N   . GLY E  2 85  ? -39.879 0.944   3.428   1.00 57.90  ? 85  GLY E N   1 
ATOM   5152  C CA  . GLY E  2 85  ? -38.832 1.347   4.343   1.00 57.70  ? 85  GLY E CA  1 
ATOM   5153  C C   . GLY E  2 85  ? -38.093 2.565   3.869   1.00 58.54  ? 85  GLY E C   1 
ATOM   5154  O O   . GLY E  2 85  ? -38.618 3.367   3.093   1.00 55.00  ? 85  GLY E O   1 
ATOM   5155  N N   . LYS E  2 86  ? -36.868 2.705   4.352   1.00 56.52  ? 86  LYS E N   1 
ATOM   5156  C CA  . LYS E  2 86  ? -36.063 3.839   3.968   1.00 54.54  ? 86  LYS E CA  1 
ATOM   5157  C C   . LYS E  2 86  ? -35.478 3.559   2.608   1.00 56.06  ? 86  LYS E C   1 
ATOM   5158  O O   . LYS E  2 86  ? -35.291 2.394   2.248   1.00 55.30  ? 86  LYS E O   1 
ATOM   5159  C CB  . LYS E  2 86  ? -34.940 4.107   4.998   1.00 59.20  ? 86  LYS E CB  1 
ATOM   5160  C CG  . LYS E  2 86  ? -33.744 3.140   4.907   1.00 83.16  ? 86  LYS E CG  1 
ATOM   5161  C CD  . LYS E  2 86  ? -32.555 3.588   5.728   1.00 98.62  ? 86  LYS E CD  1 
ATOM   5162  C CE  . LYS E  2 86  ? -31.394 2.629   5.626   1.00 118.23 ? 86  LYS E CE  1 
ATOM   5163  N NZ  . LYS E  2 86  ? -30.634 2.808   4.360   1.00 131.03 ? 86  LYS E NZ  1 
ATOM   5164  N N   . CYS E  2 87  ? -35.166 4.630   1.867   1.00 51.40  ? 87  CYS E N   1 
ATOM   5165  C CA  . CYS E  2 87  ? -34.459 4.512   0.614   1.00 50.07  ? 87  CYS E CA  1 
ATOM   5166  C C   . CYS E  2 87  ? -32.961 4.494   0.971   1.00 52.02  ? 87  CYS E C   1 
ATOM   5167  O O   . CYS E  2 87  ? -32.483 5.428   1.619   1.00 51.33  ? 87  CYS E O   1 
ATOM   5168  C CB  . CYS E  2 87  ? -34.799 5.665   -0.314  1.00 49.52  ? 87  CYS E CB  1 
ATOM   5169  S SG  . CYS E  2 87  ? -34.003 5.537   -1.932  1.00 53.54  ? 87  CYS E SG  1 
ATOM   5170  N N   . ASP E  2 88  ? -32.244 3.410   0.618   1.00 47.61  ? 88  ASP E N   1 
ATOM   5171  C CA  . ASP E  2 88  ? -30.826 3.299   0.934   1.00 48.01  ? 88  ASP E CA  1 
ATOM   5172  C C   . ASP E  2 88  ? -29.943 4.104   -0.019  1.00 52.61  ? 88  ASP E C   1 
ATOM   5173  O O   . ASP E  2 88  ? -29.432 3.567   -0.996  1.00 52.43  ? 88  ASP E O   1 
ATOM   5174  C CB  . ASP E  2 88  ? -30.395 1.834   1.002   1.00 51.01  ? 88  ASP E CB  1 
ATOM   5175  C CG  . ASP E  2 88  ? -28.949 1.656   1.390   1.00 54.81  ? 88  ASP E CG  1 
ATOM   5176  O OD1 . ASP E  2 88  ? -28.501 2.336   2.350   1.00 55.76  ? 88  ASP E OD1 1 
ATOM   5177  O OD2 . ASP E  2 88  ? -28.252 0.872   0.712   1.00 56.00  ? 88  ASP E OD2 1 
ATOM   5178  N N   . SER E  2 89  ? -29.727 5.386   0.302   1.00 50.56  ? 89  SER E N   1 
ATOM   5179  C CA  . SER E  2 89  ? -28.926 6.352   -0.477  1.00 51.00  ? 89  SER E CA  1 
ATOM   5180  C C   . SER E  2 89  ? -27.533 5.841   -0.866  1.00 55.35  ? 89  SER E C   1 
ATOM   5181  O O   . SER E  2 89  ? -26.968 6.304   -1.853  1.00 54.04  ? 89  SER E O   1 
ATOM   5182  C CB  . SER E  2 89  ? -28.801 7.673   0.282   1.00 56.28  ? 89  SER E CB  1 
ATOM   5183  O OG  . SER E  2 89  ? -28.216 7.464   1.558   1.00 69.19  ? 89  SER E OG  1 
ATOM   5184  N N   . ASP E  2 90  ? -27.001 4.893   -0.065  1.00 53.21  ? 90  ASP E N   1 
ATOM   5185  C CA  . ASP E  2 90  ? -25.728 4.199   -0.205  1.00 54.10  ? 90  ASP E CA  1 
ATOM   5186  C C   . ASP E  2 90  ? -25.655 3.419   -1.524  1.00 56.59  ? 90  ASP E C   1 
ATOM   5187  O O   . ASP E  2 90  ? -24.613 3.441   -2.189  1.00 58.30  ? 90  ASP E O   1 
ATOM   5188  C CB  . ASP E  2 90  ? -25.570 3.218   0.964   1.00 57.63  ? 90  ASP E CB  1 
ATOM   5189  C CG  . ASP E  2 90  ? -24.890 3.764   2.191   1.00 74.49  ? 90  ASP E CG  1 
ATOM   5190  O OD1 . ASP E  2 90  ? -25.421 4.735   2.788   1.00 76.53  ? 90  ASP E OD1 1 
ATOM   5191  O OD2 . ASP E  2 90  ? -23.875 3.177   2.608   1.00 84.28  ? 90  ASP E OD2 1 
ATOM   5192  N N   . SER E  2 91  ? -26.755 2.729   -1.890  1.00 50.06  ? 91  SER E N   1 
ATOM   5193  C CA  . SER E  2 91  ? -26.852 1.895   -3.088  1.00 49.62  ? 91  SER E CA  1 
ATOM   5194  C C   . SER E  2 91  ? -27.862 2.400   -4.099  1.00 55.19  ? 91  SER E C   1 
ATOM   5195  O O   . SER E  2 91  ? -27.899 1.903   -5.234  1.00 55.21  ? 91  SER E O   1 
ATOM   5196  C CB  . SER E  2 91  ? -27.292 0.492   -2.691  1.00 51.26  ? 91  SER E CB  1 
ATOM   5197  O OG  . SER E  2 91  ? -28.632 0.517   -2.230  1.00 52.81  ? 91  SER E OG  1 
ATOM   5198  N N   . THR E  2 92  ? -28.737 3.312   -3.661  1.00 52.37  ? 92  THR E N   1 
ATOM   5199  C CA  . THR E  2 92  ? -29.871 3.754   -4.454  1.00 51.34  ? 92  THR E CA  1 
ATOM   5200  C C   . THR E  2 92  ? -29.908 5.234   -4.766  1.00 55.20  ? 92  THR E C   1 
ATOM   5201  O O   . THR E  2 92  ? -29.485 6.061   -3.951  1.00 55.82  ? 92  THR E O   1 
ATOM   5202  C CB  . THR E  2 92  ? -31.172 3.325   -3.770  1.00 55.58  ? 92  THR E CB  1 
ATOM   5203  O OG1 . THR E  2 92  ? -30.983 2.077   -3.107  1.00 48.58  ? 92  THR E OG1 1 
ATOM   5204  C CG2 . THR E  2 92  ? -32.306 3.196   -4.731  1.00 59.15  ? 92  THR E CG2 1 
ATOM   5205  N N   . ASP E  2 93  ? -30.441 5.548   -5.967  1.00 50.31  ? 93  ASP E N   1 
ATOM   5206  C CA  . ASP E  2 93  ? -30.688 6.895   -6.431  1.00 49.77  ? 93  ASP E CA  1 
ATOM   5207  C C   . ASP E  2 93  ? -32.107 7.184   -5.974  1.00 53.66  ? 93  ASP E C   1 
ATOM   5208  O O   . ASP E  2 93  ? -33.079 6.692   -6.570  1.00 53.01  ? 93  ASP E O   1 
ATOM   5209  C CB  . ASP E  2 93  ? -30.565 6.992   -7.959  1.00 52.15  ? 93  ASP E CB  1 
ATOM   5210  C CG  . ASP E  2 93  ? -30.841 8.383   -8.511  1.00 55.14  ? 93  ASP E CG  1 
ATOM   5211  O OD1 . ASP E  2 93  ? -30.265 9.367   -7.977  1.00 53.13  ? 93  ASP E OD1 1 
ATOM   5212  O OD2 . ASP E  2 93  ? -31.600 8.485   -9.496  1.00 61.02  ? 93  ASP E OD2 1 
ATOM   5213  N N   . CYS E  2 94  ? -32.210 7.898   -4.844  1.00 50.59  ? 94  CYS E N   1 
ATOM   5214  C CA  . CYS E  2 94  ? -33.479 8.251   -4.209  1.00 49.83  ? 94  CYS E CA  1 
ATOM   5215  C C   . CYS E  2 94  ? -34.025 9.526   -4.860  1.00 55.59  ? 94  CYS E C   1 
ATOM   5216  O O   . CYS E  2 94  ? -33.718 10.642  -4.416  1.00 57.54  ? 94  CYS E O   1 
ATOM   5217  C CB  . CYS E  2 94  ? -33.308 8.396   -2.695  1.00 49.28  ? 94  CYS E CB  1 
ATOM   5218  S SG  . CYS E  2 94  ? -32.555 6.954   -1.887  1.00 53.36  ? 94  CYS E SG  1 
ATOM   5219  N N   . THR E  2 95  ? -34.773 9.347   -5.963  1.00 51.03  ? 95  THR E N   1 
ATOM   5220  C CA  . THR E  2 95  ? -35.358 10.427  -6.757  1.00 51.20  ? 95  THR E CA  1 
ATOM   5221  C C   . THR E  2 95  ? -36.904 10.355  -6.757  1.00 55.88  ? 95  THR E C   1 
ATOM   5222  O O   . THR E  2 95  ? -37.484 9.544   -6.026  1.00 55.87  ? 95  THR E O   1 
ATOM   5223  C CB  . THR E  2 95  ? -34.731 10.469  -8.171  1.00 56.63  ? 95  THR E CB  1 
ATOM   5224  O OG1 . THR E  2 95  ? -35.201 11.638  -8.844  1.00 63.69  ? 95  THR E OG1 1 
ATOM   5225  C CG2 . THR E  2 95  ? -35.049 9.221   -9.020  1.00 53.00  ? 95  THR E CG2 1 
ATOM   5226  N N   . VAL E  2 96  ? -37.552 11.231  -7.549  1.00 52.35  ? 96  VAL E N   1 
ATOM   5227  C CA  . VAL E  2 96  ? -38.994 11.279  -7.715  1.00 52.30  ? 96  VAL E CA  1 
ATOM   5228  C C   . VAL E  2 96  ? -39.327 10.450  -8.946  1.00 58.73  ? 96  VAL E C   1 
ATOM   5229  O O   . VAL E  2 96  ? -40.198 9.593   -8.880  1.00 59.88  ? 96  VAL E O   1 
ATOM   5230  C CB  . VAL E  2 96  ? -39.510 12.727  -7.821  1.00 56.49  ? 96  VAL E CB  1 
ATOM   5231  C CG1 . VAL E  2 96  ? -40.976 12.754  -8.238  1.00 58.04  ? 96  VAL E CG1 1 
ATOM   5232  C CG2 . VAL E  2 96  ? -39.309 13.478  -6.506  1.00 54.67  ? 96  VAL E CG2 1 
ATOM   5233  N N   . ARG E  2 97  ? -38.626 10.700  -10.061 1.00 56.52  ? 97  ARG E N   1 
ATOM   5234  C CA  . ARG E  2 97  ? -38.785 9.982   -11.325 1.00 57.92  ? 97  ARG E CA  1 
ATOM   5235  C C   . ARG E  2 97  ? -37.399 9.721   -11.902 1.00 62.30  ? 97  ARG E C   1 
ATOM   5236  O O   . ARG E  2 97  ? -36.563 10.627  -11.926 1.00 62.99  ? 97  ARG E O   1 
ATOM   5237  C CB  . ARG E  2 97  ? -39.599 10.811  -12.345 1.00 60.37  ? 97  ARG E CB  1 
ATOM   5238  C CG  . ARG E  2 97  ? -41.076 11.010  -11.998 1.00 73.14  ? 97  ARG E CG  1 
ATOM   5239  C CD  . ARG E  2 97  ? -41.698 12.245  -12.641 1.00 79.96  ? 97  ARG E CD  1 
ATOM   5240  N NE  . ARG E  2 97  ? -41.023 13.487  -12.250 1.00 85.44  ? 97  ARG E NE  1 
ATOM   5241  C CZ  . ARG E  2 97  ? -41.533 14.401  -11.429 1.00 103.30 ? 97  ARG E CZ  1 
ATOM   5242  N NH1 . ARG E  2 97  ? -42.743 14.237  -10.907 1.00 91.65  ? 97  ARG E NH1 1 
ATOM   5243  N NH2 . ARG E  2 97  ? -40.844 15.499  -11.142 1.00 92.45  ? 97  ARG E NH2 1 
ATOM   5244  N N   . GLY E  2 98  ? -37.177 8.490   -12.355 1.00 57.93  ? 98  GLY E N   1 
ATOM   5245  C CA  . GLY E  2 98  ? -35.963 8.067   -13.042 1.00 57.80  ? 98  GLY E CA  1 
ATOM   5246  C C   . GLY E  2 98  ? -36.236 7.906   -14.530 1.00 63.05  ? 98  GLY E C   1 
ATOM   5247  O O   . GLY E  2 98  ? -37.319 8.284   -14.999 1.00 64.92  ? 98  GLY E O   1 
ATOM   5248  N N   . LEU E  2 99  ? -35.277 7.345   -15.295 1.00 58.59  ? 99  LEU E N   1 
ATOM   5249  C CA  . LEU E  2 99  ? -35.473 7.150   -16.740 1.00 61.18  ? 99  LEU E CA  1 
ATOM   5250  C C   . LEU E  2 99  ? -36.444 6.009   -17.097 1.00 64.96  ? 99  LEU E C   1 
ATOM   5251  O O   . LEU E  2 99  ? -36.973 5.983   -18.215 1.00 67.39  ? 99  LEU E O   1 
ATOM   5252  C CB  . LEU E  2 99  ? -34.137 6.940   -17.473 1.00 62.46  ? 99  LEU E CB  1 
ATOM   5253  C CG  . LEU E  2 99  ? -33.131 8.076   -17.469 1.00 68.21  ? 99  LEU E CG  1 
ATOM   5254  C CD1 . LEU E  2 99  ? -31.973 7.761   -18.372 1.00 70.79  ? 99  LEU E CD1 1 
ATOM   5255  C CD2 . LEU E  2 99  ? -33.752 9.410   -17.868 1.00 73.05  ? 99  LEU E CD2 1 
ATOM   5256  N N   . GLY E  2 100 ? -36.649 5.086   -16.155 1.00 58.30  ? 100 GLY E N   1 
ATOM   5257  C CA  . GLY E  2 100 ? -37.475 3.901   -16.341 1.00 58.75  ? 100 GLY E CA  1 
ATOM   5258  C C   . GLY E  2 100 ? -36.588 2.674   -16.439 1.00 61.90  ? 100 GLY E C   1 
ATOM   5259  O O   . GLY E  2 100 ? -35.455 2.792   -16.915 1.00 61.04  ? 100 GLY E O   1 
ATOM   5260  N N   . PRO E  2 101 ? -37.054 1.481   -15.978 1.00 58.86  ? 101 PRO E N   1 
ATOM   5261  C CA  . PRO E  2 101 ? -36.191 0.276   -16.009 1.00 58.58  ? 101 PRO E CA  1 
ATOM   5262  C C   . PRO E  2 101 ? -35.749 -0.149  -17.399 1.00 65.95  ? 101 PRO E C   1 
ATOM   5263  O O   . PRO E  2 101 ? -34.613 -0.577  -17.588 1.00 66.56  ? 101 PRO E O   1 
ATOM   5264  C CB  . PRO E  2 101 ? -37.075 -0.805  -15.364 1.00 60.43  ? 101 PRO E CB  1 
ATOM   5265  C CG  . PRO E  2 101 ? -38.491 -0.311  -15.547 1.00 66.18  ? 101 PRO E CG  1 
ATOM   5266  C CD  . PRO E  2 101 ? -38.374 1.173   -15.389 1.00 60.68  ? 101 PRO E CD  1 
ATOM   5267  N N   . SER E  2 102 ? -36.672 -0.006  -18.360 1.00 64.58  ? 102 SER E N   1 
ATOM   5268  C CA  . SER E  2 102 ? -36.584 -0.358  -19.761 1.00 66.99  ? 102 SER E CA  1 
ATOM   5269  C C   . SER E  2 102 ? -36.128 0.832   -20.604 1.00 70.91  ? 102 SER E C   1 
ATOM   5270  O O   . SER E  2 102 ? -36.397 0.866   -21.804 1.00 74.57  ? 102 SER E O   1 
ATOM   5271  C CB  . SER E  2 102 ? -37.952 -0.845  -20.232 1.00 74.33  ? 102 SER E CB  1 
ATOM   5272  O OG  . SER E  2 102 ? -38.976 0.065   -19.853 1.00 85.45  ? 102 SER E OG  1 
ATOM   5273  N N   . TYR E  2 103 ? -35.429 1.803   -20.006 1.00 64.48  ? 103 TYR E N   1 
ATOM   5274  C CA  . TYR E  2 103 ? -34.971 2.920   -20.810 1.00 66.41  ? 103 TYR E CA  1 
ATOM   5275  C C   . TYR E  2 103 ? -33.793 2.540   -21.703 1.00 75.87  ? 103 TYR E C   1 
ATOM   5276  O O   . TYR E  2 103 ? -32.781 2.016   -21.235 1.00 73.28  ? 103 TYR E O   1 
ATOM   5277  C CB  . TYR E  2 103 ? -34.679 4.194   -19.999 1.00 64.42  ? 103 TYR E CB  1 
ATOM   5278  C CG  . TYR E  2 103 ? -34.183 5.306   -20.899 1.00 68.46  ? 103 TYR E CG  1 
ATOM   5279  C CD1 . TYR E  2 103 ? -32.844 5.374   -21.286 1.00 70.96  ? 103 TYR E CD1 1 
ATOM   5280  C CD2 . TYR E  2 103 ? -35.069 6.219   -21.461 1.00 72.00  ? 103 TYR E CD2 1 
ATOM   5281  C CE1 . TYR E  2 103 ? -32.403 6.317   -22.211 1.00 75.69  ? 103 TYR E CE1 1 
ATOM   5282  C CE2 . TYR E  2 103 ? -34.632 7.191   -22.361 1.00 76.69  ? 103 TYR E CE2 1 
ATOM   5283  C CZ  . TYR E  2 103 ? -33.298 7.238   -22.732 1.00 85.98  ? 103 TYR E CZ  1 
ATOM   5284  O OH  . TYR E  2 103 ? -32.862 8.188   -23.625 1.00 90.42  ? 103 TYR E OH  1 
ATOM   5285  N N   . CYS E  2 104 ? -33.926 2.865   -22.989 1.00 79.96  ? 104 CYS E N   1 
ATOM   5286  C CA  . CYS E  2 104 ? -32.903 2.647   -23.996 1.00 83.45  ? 104 CYS E CA  1 
ATOM   5287  C C   . CYS E  2 104 ? -32.656 3.908   -24.829 1.00 91.49  ? 104 CYS E C   1 
ATOM   5288  O O   . CYS E  2 104 ? -33.607 4.583   -25.249 1.00 93.19  ? 104 CYS E O   1 
ATOM   5289  C CB  . CYS E  2 104 ? -33.263 1.459   -24.874 1.00 86.76  ? 104 CYS E CB  1 
ATOM   5290  S SG  . CYS E  2 104 ? -32.017 1.081   -26.126 1.00 94.71  ? 104 CYS E SG  1 
ATOM   5291  N N   . SER E  2 105 ? -31.368 4.198   -25.091 1.00 89.43  ? 105 SER E N   1 
ATOM   5292  C CA  . SER E  2 105 ? -30.929 5.349   -25.882 1.00 93.82  ? 105 SER E CA  1 
ATOM   5293  C C   . SER E  2 105 ? -30.956 5.039   -27.389 1.00 105.58 ? 105 SER E C   1 
ATOM   5294  O O   . SER E  2 105 ? -30.529 5.871   -28.195 1.00 109.54 ? 105 SER E O   1 
ATOM   5295  C CB  . SER E  2 105 ? -29.525 5.773   -25.462 1.00 96.13  ? 105 SER E CB  1 
ATOM   5296  O OG  . SER E  2 105 ? -29.404 5.855   -24.052 1.00 100.23 ? 105 SER E OG  1 
ATOM   5297  N N   . PHE E  2 106 ? -31.467 3.844   -27.762 1.00 104.08 ? 106 PHE E N   1 
ATOM   5298  C CA  . PHE E  2 106 ? -31.541 3.362   -29.142 1.00 109.90 ? 106 PHE E CA  1 
ATOM   5299  C C   . PHE E  2 106 ? -32.949 2.884   -29.563 1.00 117.81 ? 106 PHE E C   1 
ATOM   5300  O O   . PHE E  2 106 ? -33.091 2.168   -30.562 1.00 121.58 ? 106 PHE E O   1 
ATOM   5301  C CB  . PHE E  2 106 ? -30.487 2.261   -29.355 1.00 111.43 ? 106 PHE E CB  1 
ATOM   5302  C CG  . PHE E  2 106 ? -29.095 2.612   -28.882 1.00 111.26 ? 106 PHE E CG  1 
ATOM   5303  C CD1 . PHE E  2 106 ? -28.383 3.653   -29.469 1.00 118.36 ? 106 PHE E CD1 1 
ATOM   5304  C CD2 . PHE E  2 106 ? -28.489 1.894   -27.862 1.00 108.64 ? 106 PHE E CD2 1 
ATOM   5305  C CE1 . PHE E  2 106 ? -27.093 3.973   -29.037 1.00 118.35 ? 106 PHE E CE1 1 
ATOM   5306  C CE2 . PHE E  2 106 ? -27.187 2.198   -27.450 1.00 110.73 ? 106 PHE E CE2 1 
ATOM   5307  C CZ  . PHE E  2 106 ? -26.502 3.241   -28.032 1.00 112.66 ? 106 PHE E CZ  1 
ATOM   5308  N N   . GLY E  2 107 ? -33.969 3.318   -28.821 1.00 113.79 ? 107 GLY E N   1 
ATOM   5309  C CA  . GLY E  2 107 ? -35.366 2.972   -29.073 1.00 116.63 ? 107 GLY E CA  1 
ATOM   5310  C C   . GLY E  2 107 ? -35.929 1.983   -28.072 1.00 118.46 ? 107 GLY E C   1 
ATOM   5311  O O   . GLY E  2 107 ? -35.161 1.320   -27.368 1.00 114.72 ? 107 GLY E O   1 
ATOM   5312  N N   . GLU E  2 108 ? -37.282 1.873   -27.993 1.00 116.73 ? 108 GLU E N   1 
ATOM   5313  C CA  . GLU E  2 108 ? -37.955 0.958   -27.055 1.00 142.69 ? 108 GLU E CA  1 
ATOM   5314  C C   . GLU E  2 108 ? -39.098 0.162   -27.685 1.00 168.22 ? 108 GLU E C   1 
ATOM   5315  O O   . GLU E  2 108 ? -39.387 -0.951  -27.240 1.00 123.10 ? 108 GLU E O   1 
ATOM   5316  C CB  . GLU E  2 108 ? -38.431 1.702   -25.795 1.00 139.94 ? 108 GLU E CB  1 
ATOM   5317  C CG  . GLU E  2 108 ? -37.327 1.920   -24.774 1.00 141.74 ? 108 GLU E CG  1 
ATOM   5318  C CD  . GLU E  2 108 ? -37.222 3.338   -24.251 1.00 147.97 ? 108 GLU E CD  1 
ATOM   5319  O OE1 . GLU E  2 108 ? -37.845 3.628   -23.205 1.00 133.68 ? 108 GLU E OE1 1 
ATOM   5320  O OE2 . GLU E  2 108 ? -36.520 4.159   -24.886 1.00 134.41 ? 108 GLU E OE2 1 
ATOM   5321  N N   . CYS F  3 3   ? -52.513 20.326  -24.337 1.00 159.26 ? 18  CYS Y N   1 
ATOM   5322  C CA  . CYS F  3 3   ? -51.283 21.106  -24.236 1.00 155.29 ? 18  CYS Y CA  1 
ATOM   5323  C C   . CYS F  3 3   ? -50.071 20.408  -24.865 1.00 157.31 ? 18  CYS Y C   1 
ATOM   5324  O O   . CYS F  3 3   ? -49.746 19.267  -24.517 1.00 153.09 ? 18  CYS Y O   1 
ATOM   5325  C CB  . CYS F  3 3   ? -51.005 21.525  -22.796 1.00 148.18 ? 18  CYS Y CB  1 
ATOM   5326  S SG  . CYS F  3 3   ? -49.494 22.505  -22.591 1.00 147.92 ? 18  CYS Y SG  1 
ATOM   5327  N N   . HIS F  3 4   ? -49.388 21.137  -25.767 1.00 156.67 ? 19  HIS Y N   1 
ATOM   5328  C CA  . HIS F  3 4   ? -48.217 20.681  -26.515 1.00 156.76 ? 19  HIS Y CA  1 
ATOM   5329  C C   . HIS F  3 4   ? -47.221 21.828  -26.776 1.00 159.00 ? 19  HIS Y C   1 
ATOM   5330  O O   . HIS F  3 4   ? -47.637 22.937  -27.128 1.00 162.25 ? 19  HIS Y O   1 
ATOM   5331  C CB  . HIS F  3 4   ? -48.678 20.007  -27.832 1.00 163.88 ? 19  HIS Y CB  1 
ATOM   5332  C CG  . HIS F  3 4   ? -47.898 20.390  -29.052 1.00 168.03 ? 19  HIS Y CG  1 
ATOM   5333  N ND1 . HIS F  3 4   ? -46.715 19.753  -29.378 1.00 168.39 ? 19  HIS Y ND1 1 
ATOM   5334  C CD2 . HIS F  3 4   ? -48.159 21.335  -29.984 1.00 170.98 ? 19  HIS Y CD2 1 
ATOM   5335  C CE1 . HIS F  3 4   ? -46.295 20.328  -30.492 1.00 169.54 ? 19  HIS Y CE1 1 
ATOM   5336  N NE2 . HIS F  3 4   ? -47.132 21.286  -30.895 1.00 171.21 ? 19  HIS Y NE2 1 
ATOM   5337  N N   . HIS F  3 5   ? -45.907 21.539  -26.631 1.00 150.55 ? 20  HIS Y N   1 
ATOM   5338  C CA  . HIS F  3 5   ? -44.816 22.490  -26.884 1.00 149.53 ? 20  HIS Y CA  1 
ATOM   5339  C C   . HIS F  3 5   ? -43.903 22.007  -28.030 1.00 155.63 ? 20  HIS Y C   1 
ATOM   5340  O O   . HIS F  3 5   ? -43.793 20.797  -28.270 1.00 155.37 ? 20  HIS Y O   1 
ATOM   5341  C CB  . HIS F  3 5   ? -44.003 22.769  -25.600 1.00 142.13 ? 20  HIS Y CB  1 
ATOM   5342  C CG  . HIS F  3 5   ? -43.000 23.879  -25.742 1.00 145.72 ? 20  HIS Y CG  1 
ATOM   5343  N ND1 . HIS F  3 5   ? -41.682 23.624  -26.078 1.00 146.49 ? 20  HIS Y ND1 1 
ATOM   5344  C CD2 . HIS F  3 5   ? -43.167 25.217  -25.618 1.00 149.14 ? 20  HIS Y CD2 1 
ATOM   5345  C CE1 . HIS F  3 5   ? -41.090 24.806  -26.132 1.00 147.25 ? 20  HIS Y CE1 1 
ATOM   5346  N NE2 . HIS F  3 5   ? -41.942 25.794  -25.862 1.00 149.19 ? 20  HIS Y NE2 1 
ATOM   5347  N N   . ARG F  3 6   ? -43.264 22.974  -28.732 1.00 153.84 ? 21  ARG Y N   1 
ATOM   5348  C CA  . ARG F  3 6   ? -42.326 22.789  -29.843 1.00 155.76 ? 21  ARG Y CA  1 
ATOM   5349  C C   . ARG F  3 6   ? -41.338 21.636  -29.583 1.00 156.80 ? 21  ARG Y C   1 
ATOM   5350  O O   . ARG F  3 6   ? -41.310 20.679  -30.361 1.00 157.82 ? 21  ARG Y O   1 
ATOM   5351  C CB  . ARG F  3 6   ? -41.589 24.118  -30.128 1.00 156.12 ? 21  ARG Y CB  1 
ATOM   5352  C CG  . ARG F  3 6   ? -40.409 24.018  -31.099 1.00 162.54 ? 21  ARG Y CG  1 
ATOM   5353  C CD  . ARG F  3 6   ? -39.626 25.317  -31.191 1.00 172.48 ? 21  ARG Y CD  1 
ATOM   5354  N NE  . ARG F  3 6   ? -38.835 25.582  -29.987 1.00 179.49 ? 21  ARG Y NE  1 
ATOM   5355  C CZ  . ARG F  3 6   ? -38.155 26.703  -29.765 1.00 190.59 ? 21  ARG Y CZ  1 
ATOM   5356  N NH1 . ARG F  3 6   ? -38.161 27.681  -30.663 1.00 186.49 ? 21  ARG Y NH1 1 
ATOM   5357  N NH2 . ARG F  3 6   ? -37.467 26.857  -28.641 1.00 180.14 ? 21  ARG Y NH2 1 
ATOM   5358  N N   . ILE F  3 7   ? -40.564 21.717  -28.475 1.00 146.19 ? 22  ILE Y N   1 
ATOM   5359  C CA  . ILE F  3 7   ? -39.573 20.703  -28.103 1.00 141.60 ? 22  ILE Y CA  1 
ATOM   5360  C C   . ILE F  3 7   ? -40.078 19.874  -26.934 1.00 138.50 ? 22  ILE Y C   1 
ATOM   5361  O O   . ILE F  3 7   ? -40.260 18.663  -27.082 1.00 137.80 ? 22  ILE Y O   1 
ATOM   5362  C CB  . ILE F  3 7   ? -38.151 21.287  -27.816 1.00 142.93 ? 22  ILE Y CB  1 
ATOM   5363  C CG1 . ILE F  3 7   ? -37.848 22.552  -28.650 1.00 150.27 ? 22  ILE Y CG1 1 
ATOM   5364  C CG2 . ILE F  3 7   ? -37.073 20.208  -28.011 1.00 141.99 ? 22  ILE Y CG2 1 
ATOM   5365  C CD1 . ILE F  3 7   ? -36.791 23.485  -28.060 1.00 157.38 ? 22  ILE Y CD1 1 
ATOM   5366  N N   . CYS F  3 8   ? -40.301 20.533  -25.776 1.00 130.29 ? 23  CYS Y N   1 
ATOM   5367  C CA  . CYS F  3 8   ? -40.745 19.927  -24.514 1.00 123.42 ? 23  CYS Y CA  1 
ATOM   5368  C C   . CYS F  3 8   ? -42.139 19.286  -24.599 1.00 130.64 ? 23  CYS Y C   1 
ATOM   5369  O O   . CYS F  3 8   ? -42.934 19.632  -25.484 1.00 135.96 ? 23  CYS Y O   1 
ATOM   5370  C CB  . CYS F  3 8   ? -40.657 20.928  -23.362 1.00 118.41 ? 23  CYS Y CB  1 
ATOM   5371  S SG  . CYS F  3 8   ? -39.143 21.924  -23.351 1.00 121.39 ? 23  CYS Y SG  1 
ATOM   5372  N N   . HIS F  3 9   ? -42.415 18.333  -23.681 1.00 123.24 ? 24  HIS Y N   1 
ATOM   5373  C CA  . HIS F  3 9   ? -43.691 17.622  -23.583 1.00 124.61 ? 24  HIS Y CA  1 
ATOM   5374  C C   . HIS F  3 9   ? -44.522 18.291  -22.495 1.00 127.28 ? 24  HIS Y C   1 
ATOM   5375  O O   . HIS F  3 9   ? -43.974 18.682  -21.463 1.00 121.55 ? 24  HIS Y O   1 
ATOM   5376  C CB  . HIS F  3 9   ? -43.472 16.122  -23.305 1.00 122.84 ? 24  HIS Y CB  1 
ATOM   5377  C CG  . HIS F  3 9   ? -42.433 15.486  -24.188 1.00 128.57 ? 24  HIS Y CG  1 
ATOM   5378  N ND1 . HIS F  3 9   ? -41.306 14.878  -23.657 1.00 125.87 ? 24  HIS Y ND1 1 
ATOM   5379  C CD2 . HIS F  3 9   ? -42.368 15.414  -25.540 1.00 136.82 ? 24  HIS Y CD2 1 
ATOM   5380  C CE1 . HIS F  3 9   ? -40.606 14.449  -24.694 1.00 129.14 ? 24  HIS Y CE1 1 
ATOM   5381  N NE2 . HIS F  3 9   ? -41.201 14.752  -25.848 1.00 136.14 ? 24  HIS Y NE2 1 
ATOM   5382  N N   . CYS F  3 10  ? -45.824 18.489  -22.751 1.00 129.37 ? 25  CYS Y N   1 
ATOM   5383  C CA  . CYS F  3 10  ? -46.697 19.183  -21.810 1.00 128.32 ? 25  CYS Y CA  1 
ATOM   5384  C C   . CYS F  3 10  ? -47.893 18.368  -21.348 1.00 129.94 ? 25  CYS Y C   1 
ATOM   5385  O O   . CYS F  3 10  ? -48.538 17.697  -22.157 1.00 134.82 ? 25  CYS Y O   1 
ATOM   5386  C CB  . CYS F  3 10  ? -47.142 20.529  -22.376 1.00 134.64 ? 25  CYS Y CB  1 
ATOM   5387  S SG  . CYS F  3 10  ? -48.340 21.405  -21.330 1.00 138.30 ? 25  CYS Y SG  1 
ATOM   5388  N N   . SER F  3 11  ? -48.235 18.508  -20.051 1.00 119.23 ? 26  SER Y N   1 
ATOM   5389  C CA  . SER F  3 11  ? -49.406 17.892  -19.426 1.00 117.93 ? 26  SER Y CA  1 
ATOM   5390  C C   . SER F  3 11  ? -49.852 18.726  -18.226 1.00 115.89 ? 26  SER Y C   1 
ATOM   5391  O O   . SER F  3 11  ? -49.218 18.678  -17.171 1.00 108.93 ? 26  SER Y O   1 
ATOM   5392  C CB  . SER F  3 11  ? -49.135 16.445  -19.025 1.00 118.77 ? 26  SER Y CB  1 
ATOM   5393  O OG  . SER F  3 11  ? -50.336 15.810  -18.616 1.00 128.92 ? 26  SER Y OG  1 
ATOM   5394  N N   . ASN F  3 12  ? -50.937 19.514  -18.411 1.00 115.46 ? 27  ASN Y N   1 
ATOM   5395  C CA  . ASN F  3 12  ? -51.535 20.404  -17.411 1.00 113.04 ? 27  ASN Y CA  1 
ATOM   5396  C C   . ASN F  3 12  ? -50.489 21.287  -16.697 1.00 111.08 ? 27  ASN Y C   1 
ATOM   5397  O O   . ASN F  3 12  ? -50.074 20.997  -15.563 1.00 106.28 ? 27  ASN Y O   1 
ATOM   5398  C CB  . ASN F  3 12  ? -52.417 19.627  -16.425 1.00 111.95 ? 27  ASN Y CB  1 
ATOM   5399  C CG  . ASN F  3 12  ? -53.856 19.526  -16.854 1.00 138.54 ? 27  ASN Y CG  1 
ATOM   5400  O OD1 . ASN F  3 12  ? -54.611 20.509  -16.850 1.00 135.90 ? 27  ASN Y OD1 1 
ATOM   5401  N ND2 . ASN F  3 12  ? -54.276 18.325  -17.208 1.00 132.17 ? 27  ASN Y ND2 1 
ATOM   5402  N N   . ARG F  3 13  ? -50.018 22.324  -17.425 1.00 107.68 ? 28  ARG Y N   1 
ATOM   5403  C CA  . ARG F  3 13  ? -49.037 23.352  -17.022 1.00 103.43 ? 28  ARG Y CA  1 
ATOM   5404  C C   . ARG F  3 13  ? -47.691 22.782  -16.445 1.00 97.92  ? 28  ARG Y C   1 
ATOM   5405  O O   . ARG F  3 13  ? -46.956 23.505  -15.767 1.00 92.84  ? 28  ARG Y O   1 
ATOM   5406  C CB  . ARG F  3 13  ? -49.681 24.392  -16.074 1.00 102.52 ? 28  ARG Y CB  1 
ATOM   5407  C CG  . ARG F  3 13  ? -50.883 25.127  -16.699 1.00 117.64 ? 28  ARG Y CG  1 
ATOM   5408  C CD  . ARG F  3 13  ? -51.120 26.520  -16.138 1.00 123.33 ? 28  ARG Y CD  1 
ATOM   5409  N NE  . ARG F  3 13  ? -51.784 26.504  -14.834 1.00 123.97 ? 28  ARG Y NE  1 
ATOM   5410  C CZ  . ARG F  3 13  ? -51.712 27.488  -13.941 1.00 136.04 ? 28  ARG Y CZ  1 
ATOM   5411  N NH1 . ARG F  3 13  ? -50.986 28.571  -14.192 1.00 121.61 ? 28  ARG Y NH1 1 
ATOM   5412  N NH2 . ARG F  3 13  ? -52.341 27.385  -12.778 1.00 123.66 ? 28  ARG Y NH2 1 
ATOM   5413  N N   . VAL F  3 14  ? -47.363 21.509  -16.784 1.00 92.98  ? 29  VAL Y N   1 
ATOM   5414  C CA  . VAL F  3 14  ? -46.123 20.800  -16.417 1.00 88.04  ? 29  VAL Y CA  1 
ATOM   5415  C C   . VAL F  3 14  ? -45.341 20.578  -17.719 1.00 95.94  ? 29  VAL Y C   1 
ATOM   5416  O O   . VAL F  3 14  ? -45.899 20.051  -18.690 1.00 100.02 ? 29  VAL Y O   1 
ATOM   5417  C CB  . VAL F  3 14  ? -46.378 19.475  -15.652 1.00 87.85  ? 29  VAL Y CB  1 
ATOM   5418  C CG1 . VAL F  3 14  ? -45.082 18.714  -15.405 1.00 83.35  ? 29  VAL Y CG1 1 
ATOM   5419  C CG2 . VAL F  3 14  ? -47.103 19.727  -14.340 1.00 84.95  ? 29  VAL Y CG2 1 
ATOM   5420  N N   . PHE F  3 15  ? -44.065 21.007  -17.748 1.00 90.80  ? 30  PHE Y N   1 
ATOM   5421  C CA  . PHE F  3 15  ? -43.243 20.940  -18.951 1.00 94.16  ? 30  PHE Y CA  1 
ATOM   5422  C C   . PHE F  3 15  ? -41.923 20.195  -18.780 1.00 94.96  ? 30  PHE Y C   1 
ATOM   5423  O O   . PHE F  3 15  ? -40.994 20.701  -18.150 1.00 91.21  ? 30  PHE Y O   1 
ATOM   5424  C CB  . PHE F  3 15  ? -42.999 22.355  -19.497 1.00 99.65  ? 30  PHE Y CB  1 
ATOM   5425  C CG  . PHE F  3 15  ? -44.245 23.103  -19.899 1.00 106.33 ? 30  PHE Y CG  1 
ATOM   5426  C CD1 . PHE F  3 15  ? -45.017 23.765  -18.949 1.00 108.33 ? 30  PHE Y CD1 1 
ATOM   5427  C CD2 . PHE F  3 15  ? -44.626 23.182  -21.232 1.00 115.44 ? 30  PHE Y CD2 1 
ATOM   5428  C CE1 . PHE F  3 15  ? -46.174 24.456  -19.321 1.00 114.09 ? 30  PHE Y CE1 1 
ATOM   5429  C CE2 . PHE F  3 15  ? -45.768 23.898  -21.608 1.00 123.24 ? 30  PHE Y CE2 1 
ATOM   5430  C CZ  . PHE F  3 15  ? -46.540 24.522  -20.648 1.00 119.55 ? 30  PHE Y CZ  1 
ATOM   5431  N N   . LEU F  3 16  ? -41.831 19.002  -19.376 1.00 93.38  ? 31  LEU Y N   1 
ATOM   5432  C CA  . LEU F  3 16  ? -40.621 18.187  -19.341 1.00 91.14  ? 31  LEU Y CA  1 
ATOM   5433  C C   . LEU F  3 16  ? -39.889 18.330  -20.660 1.00 102.24 ? 31  LEU Y C   1 
ATOM   5434  O O   . LEU F  3 16  ? -40.469 18.074  -21.718 1.00 107.37 ? 31  LEU Y O   1 
ATOM   5435  C CB  . LEU F  3 16  ? -40.953 16.708  -19.078 1.00 89.26  ? 31  LEU Y CB  1 
ATOM   5436  C CG  . LEU F  3 16  ? -39.818 15.714  -19.309 1.00 91.84  ? 31  LEU Y CG  1 
ATOM   5437  C CD1 . LEU F  3 16  ? -39.375 15.093  -18.021 1.00 85.47  ? 31  LEU Y CD1 1 
ATOM   5438  C CD2 . LEU F  3 16  ? -40.226 14.665  -20.314 1.00 98.56  ? 31  LEU Y CD2 1 
ATOM   5439  N N   . CYS F  3 17  ? -38.613 18.720  -20.588 1.00 98.69  ? 32  CYS Y N   1 
ATOM   5440  C CA  . CYS F  3 17  ? -37.737 18.851  -21.741 1.00 103.55 ? 32  CYS Y CA  1 
ATOM   5441  C C   . CYS F  3 17  ? -36.712 17.739  -21.560 1.00 104.39 ? 32  CYS Y C   1 
ATOM   5442  O O   . CYS F  3 17  ? -35.904 17.784  -20.628 1.00 99.57  ? 32  CYS Y O   1 
ATOM   5443  C CB  . CYS F  3 17  ? -37.096 20.237  -21.784 1.00 105.82 ? 32  CYS Y CB  1 
ATOM   5444  S SG  . CYS F  3 17  ? -38.268 21.609  -21.543 1.00 111.80 ? 32  CYS Y SG  1 
ATOM   5445  N N   . GLN F  3 18  ? -36.849 16.671  -22.367 1.00 103.31 ? 33  GLN Y N   1 
ATOM   5446  C CA  . GLN F  3 18  ? -36.018 15.468  -22.296 1.00 101.03 ? 33  GLN Y CA  1 
ATOM   5447  C C   . GLN F  3 18  ? -35.223 15.190  -23.577 1.00 110.53 ? 33  GLN Y C   1 
ATOM   5448  O O   . GLN F  3 18  ? -35.537 15.742  -24.633 1.00 115.76 ? 33  GLN Y O   1 
ATOM   5449  C CB  . GLN F  3 18  ? -36.873 14.241  -21.909 1.00 100.35 ? 33  GLN Y CB  1 
ATOM   5450  C CG  . GLN F  3 18  ? -36.142 13.227  -21.015 1.00 102.12 ? 33  GLN Y CG  1 
ATOM   5451  C CD  . GLN F  3 18  ? -36.783 11.858  -20.934 1.00 111.09 ? 33  GLN Y CD  1 
ATOM   5452  O OE1 . GLN F  3 18  ? -37.245 11.279  -21.931 1.00 113.04 ? 33  GLN Y OE1 1 
ATOM   5453  N NE2 . GLN F  3 18  ? -36.750 11.275  -19.746 1.00 87.43  ? 33  GLN Y NE2 1 
ATOM   5454  N N   . GLU F  3 19  ? -34.183 14.328  -23.465 1.00 105.92 ? 34  GLU Y N   1 
ATOM   5455  C CA  . GLU F  3 19  ? -33.296 13.835  -24.534 1.00 110.20 ? 34  GLU Y CA  1 
ATOM   5456  C C   . GLU F  3 19  ? -32.350 14.886  -25.134 1.00 116.87 ? 34  GLU Y C   1 
ATOM   5457  O O   . GLU F  3 19  ? -32.452 16.083  -24.844 1.00 115.83 ? 34  GLU Y O   1 
ATOM   5458  C CB  . GLU F  3 19  ? -34.083 13.132  -25.662 1.00 117.05 ? 34  GLU Y CB  1 
ATOM   5459  C CG  . GLU F  3 19  ? -34.938 11.956  -25.218 1.00 123.05 ? 34  GLU Y CG  1 
ATOM   5460  C CD  . GLU F  3 19  ? -34.195 10.766  -24.645 1.00 127.75 ? 34  GLU Y CD  1 
ATOM   5461  O OE1 . GLU F  3 19  ? -33.165 10.354  -25.228 1.00 118.17 ? 34  GLU Y OE1 1 
ATOM   5462  O OE2 . GLU F  3 19  ? -34.674 10.221  -23.626 1.00 107.46 ? 34  GLU Y OE2 1 
ATOM   5463  N N   . SER F  3 20  ? -31.427 14.400  -25.986 1.00 116.77 ? 35  SER Y N   1 
ATOM   5464  C CA  . SER F  3 20  ? -30.389 15.158  -26.685 1.00 120.49 ? 35  SER Y CA  1 
ATOM   5465  C C   . SER F  3 20  ? -30.907 16.288  -27.596 1.00 128.13 ? 35  SER Y C   1 
ATOM   5466  O O   . SER F  3 20  ? -30.137 17.199  -27.906 1.00 129.95 ? 35  SER Y O   1 
ATOM   5467  C CB  . SER F  3 20  ? -29.483 14.209  -27.464 1.00 128.84 ? 35  SER Y CB  1 
ATOM   5468  O OG  . SER F  3 20  ? -28.907 13.246  -26.595 1.00 134.60 ? 35  SER Y OG  1 
ATOM   5469  N N   . LYS F  3 21  ? -32.204 16.262  -27.986 1.00 125.81 ? 36  LYS Y N   1 
ATOM   5470  C CA  . LYS F  3 21  ? -32.806 17.320  -28.810 1.00 130.77 ? 36  LYS Y CA  1 
ATOM   5471  C C   . LYS F  3 21  ? -32.939 18.662  -28.041 1.00 132.06 ? 36  LYS Y C   1 
ATOM   5472  O O   . LYS F  3 21  ? -33.317 19.678  -28.635 1.00 136.06 ? 36  LYS Y O   1 
ATOM   5473  C CB  . LYS F  3 21  ? -34.144 16.866  -29.445 1.00 136.40 ? 36  LYS Y CB  1 
ATOM   5474  C CG  . LYS F  3 21  ? -35.329 16.740  -28.483 1.00 144.77 ? 36  LYS Y CG  1 
ATOM   5475  C CD  . LYS F  3 21  ? -36.628 16.406  -29.217 1.00 157.00 ? 36  LYS Y CD  1 
ATOM   5476  C CE  . LYS F  3 21  ? -37.790 16.245  -28.264 1.00 161.05 ? 36  LYS Y CE  1 
ATOM   5477  N NZ  . LYS F  3 21  ? -39.059 15.949  -28.983 1.00 170.22 ? 36  LYS Y NZ  1 
ATOM   5478  N N   . VAL F  3 22  ? -32.613 18.656  -26.726 1.00 121.95 ? 37  VAL Y N   1 
ATOM   5479  C CA  . VAL F  3 22  ? -32.647 19.835  -25.857 1.00 118.78 ? 37  VAL Y CA  1 
ATOM   5480  C C   . VAL F  3 22  ? -31.212 20.278  -25.537 1.00 122.64 ? 37  VAL Y C   1 
ATOM   5481  O O   . VAL F  3 22  ? -30.546 19.662  -24.704 1.00 116.78 ? 37  VAL Y O   1 
ATOM   5482  C CB  . VAL F  3 22  ? -33.508 19.646  -24.580 1.00 115.91 ? 37  VAL Y CB  1 
ATOM   5483  C CG1 . VAL F  3 22  ? -33.668 20.965  -23.832 1.00 113.76 ? 37  VAL Y CG1 1 
ATOM   5484  C CG2 . VAL F  3 22  ? -34.875 19.058  -24.911 1.00 117.13 ? 37  VAL Y CG2 1 
ATOM   5485  N N   . THR F  3 23  ? -30.749 21.346  -26.220 1.00 125.66 ? 38  THR Y N   1 
ATOM   5486  C CA  . THR F  3 23  ? -29.407 21.937  -26.087 1.00 126.54 ? 38  THR Y CA  1 
ATOM   5487  C C   . THR F  3 23  ? -29.461 23.284  -25.329 1.00 127.50 ? 38  THR Y C   1 
ATOM   5488  O O   . THR F  3 23  ? -28.475 23.678  -24.700 1.00 125.43 ? 38  THR Y O   1 
ATOM   5489  C CB  . THR F  3 23  ? -28.737 22.050  -27.471 1.00 146.88 ? 38  THR Y CB  1 
ATOM   5490  O OG1 . THR F  3 23  ? -29.095 20.915  -28.260 1.00 151.02 ? 38  THR Y OG1 1 
ATOM   5491  C CG2 . THR F  3 23  ? -27.217 22.145  -27.388 1.00 147.76 ? 38  THR Y CG2 1 
ATOM   5492  N N   . GLU F  3 24  ? -30.619 23.965  -25.376 1.00 123.60 ? 39  GLU Y N   1 
ATOM   5493  C CA  . GLU F  3 24  ? -30.853 25.234  -24.687 1.00 121.80 ? 39  GLU Y CA  1 
ATOM   5494  C C   . GLU F  3 24  ? -32.280 25.318  -24.155 1.00 121.23 ? 39  GLU Y C   1 
ATOM   5495  O O   . GLU F  3 24  ? -33.187 24.733  -24.751 1.00 122.00 ? 39  GLU Y O   1 
ATOM   5496  C CB  . GLU F  3 24  ? -30.511 26.432  -25.587 1.00 130.48 ? 39  GLU Y CB  1 
ATOM   5497  C CG  . GLU F  3 24  ? -31.168 26.421  -26.958 1.00 145.42 ? 39  GLU Y CG  1 
ATOM   5498  C CD  . GLU F  3 24  ? -30.554 27.411  -27.924 1.00 162.50 ? 39  GLU Y CD  1 
ATOM   5499  O OE1 . GLU F  3 24  ? -31.144 28.498  -28.114 1.00 159.25 ? 39  GLU Y OE1 1 
ATOM   5500  O OE2 . GLU F  3 24  ? -29.467 27.111  -28.470 1.00 160.62 ? 39  GLU Y OE2 1 
ATOM   5501  N N   . ILE F  3 25  ? -32.476 26.037  -23.036 1.00 113.49 ? 40  ILE Y N   1 
ATOM   5502  C CA  . ILE F  3 25  ? -33.796 26.211  -22.420 1.00 110.87 ? 40  ILE Y CA  1 
ATOM   5503  C C   . ILE F  3 25  ? -34.721 27.014  -23.368 1.00 123.92 ? 40  ILE Y C   1 
ATOM   5504  O O   . ILE F  3 25  ? -34.354 28.126  -23.769 1.00 128.51 ? 40  ILE Y O   1 
ATOM   5505  C CB  . ILE F  3 25  ? -33.699 26.809  -20.991 1.00 108.31 ? 40  ILE Y CB  1 
ATOM   5506  C CG1 . ILE F  3 25  ? -32.878 25.884  -20.069 1.00 102.83 ? 40  ILE Y CG1 1 
ATOM   5507  C CG2 . ILE F  3 25  ? -35.091 27.073  -20.399 1.00 106.23 ? 40  ILE Y CG2 1 
ATOM   5508  C CD1 . ILE F  3 25  ? -32.173 26.576  -18.900 1.00 105.46 ? 40  ILE Y CD1 1 
ATOM   5509  N N   . PRO F  3 26  ? -35.893 26.449  -23.769 1.00 122.56 ? 41  PRO Y N   1 
ATOM   5510  C CA  . PRO F  3 26  ? -36.767 27.150  -24.729 1.00 128.86 ? 41  PRO Y CA  1 
ATOM   5511  C C   . PRO F  3 26  ? -37.258 28.524  -24.291 1.00 133.32 ? 41  PRO Y C   1 
ATOM   5512  O O   . PRO F  3 26  ? -37.825 28.682  -23.206 1.00 128.59 ? 41  PRO Y O   1 
ATOM   5513  C CB  . PRO F  3 26  ? -37.926 26.168  -24.945 1.00 130.26 ? 41  PRO Y CB  1 
ATOM   5514  C CG  . PRO F  3 26  ? -37.385 24.856  -24.565 1.00 130.42 ? 41  PRO Y CG  1 
ATOM   5515  C CD  . PRO F  3 26  ? -36.451 25.127  -23.426 1.00 120.54 ? 41  PRO Y CD  1 
ATOM   5516  N N   . SER F  3 27  ? -37.028 29.521  -25.157 1.00 135.35 ? 42  SER Y N   1 
ATOM   5517  C CA  . SER F  3 27  ? -37.435 30.900  -24.916 1.00 137.30 ? 42  SER Y CA  1 
ATOM   5518  C C   . SER F  3 27  ? -38.955 31.053  -24.986 1.00 142.22 ? 42  SER Y C   1 
ATOM   5519  O O   . SER F  3 27  ? -39.503 31.951  -24.343 1.00 142.06 ? 42  SER Y O   1 
ATOM   5520  C CB  . SER F  3 27  ? -36.760 31.833  -25.913 1.00 147.91 ? 42  SER Y CB  1 
ATOM   5521  O OG  . SER F  3 27  ? -36.990 31.407  -27.245 1.00 160.22 ? 42  SER Y OG  1 
ATOM   5522  N N   . ASP F  3 28  ? -39.633 30.158  -25.743 1.00 139.78 ? 43  ASP Y N   1 
ATOM   5523  C CA  . ASP F  3 28  ? -41.089 30.166  -25.934 1.00 141.30 ? 43  ASP Y CA  1 
ATOM   5524  C C   . ASP F  3 28  ? -41.865 29.340  -24.869 1.00 136.28 ? 43  ASP Y C   1 
ATOM   5525  O O   . ASP F  3 28  ? -43.051 29.045  -25.071 1.00 137.83 ? 43  ASP Y O   1 
ATOM   5526  C CB  . ASP F  3 28  ? -41.458 29.741  -27.378 1.00 150.35 ? 43  ASP Y CB  1 
ATOM   5527  C CG  . ASP F  3 28  ? -41.033 28.343  -27.807 1.00 158.07 ? 43  ASP Y CG  1 
ATOM   5528  O OD1 . ASP F  3 28  ? -40.113 27.773  -27.172 1.00 156.19 ? 43  ASP Y OD1 1 
ATOM   5529  O OD2 . ASP F  3 28  ? -41.599 27.830  -28.800 1.00 164.30 ? 43  ASP Y OD2 1 
ATOM   5530  N N   . LEU F  3 29  ? -41.214 29.026  -23.720 1.00 123.27 ? 44  LEU Y N   1 
ATOM   5531  C CA  . LEU F  3 29  ? -41.842 28.300  -22.613 1.00 115.90 ? 44  LEU Y CA  1 
ATOM   5532  C C   . LEU F  3 29  ? -42.953 29.155  -21.966 1.00 118.17 ? 44  LEU Y C   1 
ATOM   5533  O O   . LEU F  3 29  ? -42.661 30.268  -21.515 1.00 117.15 ? 44  LEU Y O   1 
ATOM   5534  C CB  . LEU F  3 29  ? -40.807 27.876  -21.550 1.00 109.05 ? 44  LEU Y CB  1 
ATOM   5535  C CG  . LEU F  3 29  ? -40.009 26.591  -21.801 1.00 111.41 ? 44  LEU Y CG  1 
ATOM   5536  C CD1 . LEU F  3 29  ? -38.851 26.485  -20.839 1.00 105.89 ? 44  LEU Y CD1 1 
ATOM   5537  C CD2 . LEU F  3 29  ? -40.880 25.347  -21.683 1.00 112.11 ? 44  LEU Y CD2 1 
ATOM   5538  N N   . PRO F  3 30  ? -44.226 28.663  -21.938 1.00 114.58 ? 45  PRO Y N   1 
ATOM   5539  C CA  . PRO F  3 30  ? -45.326 29.452  -21.342 1.00 114.63 ? 45  PRO Y CA  1 
ATOM   5540  C C   . PRO F  3 30  ? -45.033 29.921  -19.924 1.00 113.18 ? 45  PRO Y C   1 
ATOM   5541  O O   . PRO F  3 30  ? -44.503 29.141  -19.141 1.00 107.50 ? 45  PRO Y O   1 
ATOM   5542  C CB  . PRO F  3 30  ? -46.505 28.476  -21.367 1.00 116.42 ? 45  PRO Y CB  1 
ATOM   5543  C CG  . PRO F  3 30  ? -46.206 27.559  -22.484 1.00 123.93 ? 45  PRO Y CG  1 
ATOM   5544  C CD  . PRO F  3 30  ? -44.722 27.365  -22.441 1.00 116.61 ? 45  PRO Y CD  1 
ATOM   5545  N N   . ARG F  3 31  ? -45.342 31.192  -19.605 1.00 111.97 ? 46  ARG Y N   1 
ATOM   5546  C CA  . ARG F  3 31  ? -45.069 31.785  -18.282 1.00 107.77 ? 46  ARG Y CA  1 
ATOM   5547  C C   . ARG F  3 31  ? -45.934 31.197  -17.174 1.00 107.60 ? 46  ARG Y C   1 
ATOM   5548  O O   . ARG F  3 31  ? -45.463 31.063  -16.038 1.00 102.37 ? 46  ARG Y O   1 
ATOM   5549  C CB  . ARG F  3 31  ? -45.150 33.331  -18.290 1.00 112.72 ? 46  ARG Y CB  1 
ATOM   5550  C CG  . ARG F  3 31  ? -44.595 34.034  -19.542 1.00 129.23 ? 46  ARG Y CG  1 
ATOM   5551  C CD  . ARG F  3 31  ? -43.160 33.664  -19.882 1.00 135.50 ? 46  ARG Y CD  1 
ATOM   5552  N NE  . ARG F  3 31  ? -42.191 34.409  -19.086 1.00 140.39 ? 46  ARG Y NE  1 
ATOM   5553  C CZ  . ARG F  3 31  ? -40.881 34.198  -19.117 1.00 153.59 ? 46  ARG Y CZ  1 
ATOM   5554  N NH1 . ARG F  3 31  ? -40.374 33.242  -19.888 1.00 142.94 ? 46  ARG Y NH1 1 
ATOM   5555  N NH2 . ARG F  3 31  ? -40.067 34.936  -18.381 1.00 138.82 ? 46  ARG Y NH2 1 
ATOM   5556  N N   . ASN F  3 32  ? -47.175 30.796  -17.524 1.00 106.54 ? 47  ASN Y N   1 
ATOM   5557  C CA  . ASN F  3 32  ? -48.154 30.185  -16.623 1.00 103.86 ? 47  ASN Y CA  1 
ATOM   5558  C C   . ASN F  3 32  ? -47.700 28.820  -16.052 1.00 103.87 ? 47  ASN Y C   1 
ATOM   5559  O O   . ASN F  3 32  ? -48.371 28.286  -15.167 1.00 101.81 ? 47  ASN Y O   1 
ATOM   5560  C CB  . ASN F  3 32  ? -49.532 30.075  -17.309 1.00 109.48 ? 47  ASN Y CB  1 
ATOM   5561  C CG  . ASN F  3 32  ? -49.683 29.008  -18.385 1.00 139.96 ? 47  ASN Y CG  1 
ATOM   5562  O OD1 . ASN F  3 32  ? -48.725 28.352  -18.822 1.00 138.59 ? 47  ASN Y OD1 1 
ATOM   5563  N ND2 . ASN F  3 32  ? -50.913 28.804  -18.840 1.00 133.23 ? 47  ASN Y ND2 1 
ATOM   5564  N N   . ALA F  3 33  ? -46.570 28.262  -16.564 1.00 98.63  ? 48  ALA Y N   1 
ATOM   5565  C CA  . ALA F  3 33  ? -45.994 26.980  -16.146 1.00 93.10  ? 48  ALA Y CA  1 
ATOM   5566  C C   . ALA F  3 33  ? -45.872 26.900  -14.645 1.00 91.54  ? 48  ALA Y C   1 
ATOM   5567  O O   . ALA F  3 33  ? -45.516 27.887  -13.994 1.00 89.88  ? 48  ALA Y O   1 
ATOM   5568  C CB  . ALA F  3 33  ? -44.637 26.763  -16.789 1.00 93.36  ? 48  ALA Y CB  1 
ATOM   5569  N N   . ILE F  3 34  ? -46.219 25.722  -14.109 1.00 85.10  ? 49  ILE Y N   1 
ATOM   5570  C CA  . ILE F  3 34  ? -46.243 25.368  -12.693 1.00 79.50  ? 49  ILE Y CA  1 
ATOM   5571  C C   . ILE F  3 34  ? -45.011 24.508  -12.379 1.00 79.24  ? 49  ILE Y C   1 
ATOM   5572  O O   . ILE F  3 34  ? -44.429 24.611  -11.294 1.00 76.19  ? 49  ILE Y O   1 
ATOM   5573  C CB  . ILE F  3 34  ? -47.600 24.632  -12.425 1.00 83.33  ? 49  ILE Y CB  1 
ATOM   5574  C CG1 . ILE F  3 34  ? -48.842 25.547  -12.689 1.00 88.82  ? 49  ILE Y CG1 1 
ATOM   5575  C CG2 . ILE F  3 34  ? -47.676 23.983  -11.052 1.00 79.72  ? 49  ILE Y CG2 1 
ATOM   5576  C CD1 . ILE F  3 34  ? -49.010 26.887  -11.795 1.00 98.73  ? 49  ILE Y CD1 1 
ATOM   5577  N N   . GLU F  3 35  ? -44.591 23.692  -13.356 1.00 75.23  ? 50  GLU Y N   1 
ATOM   5578  C CA  . GLU F  3 35  ? -43.459 22.789  -13.236 1.00 70.38  ? 50  GLU Y CA  1 
ATOM   5579  C C   . GLU F  3 35  ? -42.649 22.762  -14.535 1.00 75.53  ? 50  GLU Y C   1 
ATOM   5580  O O   . GLU F  3 35  ? -43.226 22.673  -15.629 1.00 78.59  ? 50  GLU Y O   1 
ATOM   5581  C CB  . GLU F  3 35  ? -43.963 21.385  -12.875 1.00 69.75  ? 50  GLU Y CB  1 
ATOM   5582  C CG  . GLU F  3 35  ? -42.957 20.543  -12.111 1.00 76.90  ? 50  GLU Y CG  1 
ATOM   5583  C CD  . GLU F  3 35  ? -43.485 19.244  -11.529 1.00 98.55  ? 50  GLU Y CD  1 
ATOM   5584  O OE1 . GLU F  3 35  ? -44.665 19.208  -11.104 1.00 97.10  ? 50  GLU Y OE1 1 
ATOM   5585  O OE2 . GLU F  3 35  ? -42.699 18.270  -11.464 1.00 86.15  ? 50  GLU Y OE2 1 
ATOM   5586  N N   . LEU F  3 36  ? -41.301 22.837  -14.398 1.00 69.31  ? 51  LEU Y N   1 
ATOM   5587  C CA  . LEU F  3 36  ? -40.326 22.771  -15.488 1.00 70.58  ? 51  LEU Y CA  1 
ATOM   5588  C C   . LEU F  3 36  ? -39.292 21.700  -15.169 1.00 71.68  ? 51  LEU Y C   1 
ATOM   5589  O O   . LEU F  3 36  ? -38.643 21.769  -14.122 1.00 68.45  ? 51  LEU Y O   1 
ATOM   5590  C CB  . LEU F  3 36  ? -39.636 24.132  -15.728 1.00 72.18  ? 51  LEU Y CB  1 
ATOM   5591  C CG  . LEU F  3 36  ? -40.435 25.230  -16.440 1.00 80.78  ? 51  LEU Y CG  1 
ATOM   5592  C CD1 . LEU F  3 36  ? -39.681 26.514  -16.414 1.00 82.19  ? 51  LEU Y CD1 1 
ATOM   5593  C CD2 . LEU F  3 36  ? -40.713 24.875  -17.886 1.00 86.26  ? 51  LEU Y CD2 1 
ATOM   5594  N N   . ARG F  3 37  ? -39.151 20.704  -16.057 1.00 69.71  ? 52  ARG Y N   1 
ATOM   5595  C CA  . ARG F  3 37  ? -38.199 19.604  -15.904 1.00 66.77  ? 52  ARG Y CA  1 
ATOM   5596  C C   . ARG F  3 37  ? -37.214 19.577  -17.052 1.00 75.55  ? 52  ARG Y C   1 
ATOM   5597  O O   . ARG F  3 37  ? -37.601 19.727  -18.206 1.00 79.89  ? 52  ARG Y O   1 
ATOM   5598  C CB  . ARG F  3 37  ? -38.923 18.254  -15.853 1.00 64.43  ? 52  ARG Y CB  1 
ATOM   5599  C CG  . ARG F  3 37  ? -39.702 17.997  -14.582 1.00 64.73  ? 52  ARG Y CG  1 
ATOM   5600  C CD  . ARG F  3 37  ? -40.441 16.688  -14.691 1.00 67.85  ? 52  ARG Y CD  1 
ATOM   5601  N NE  . ARG F  3 37  ? -41.764 16.745  -14.073 1.00 75.94  ? 52  ARG Y NE  1 
ATOM   5602  C CZ  . ARG F  3 37  ? -42.700 15.811  -14.219 1.00 94.24  ? 52  ARG Y CZ  1 
ATOM   5603  N NH1 . ARG F  3 37  ? -42.463 14.733  -14.956 1.00 86.90  ? 52  ARG Y NH1 1 
ATOM   5604  N NH2 . ARG F  3 37  ? -43.872 15.938  -13.612 1.00 80.03  ? 52  ARG Y NH2 1 
ATOM   5605  N N   . PHE F  3 38  ? -35.947 19.336  -16.732 1.00 72.01  ? 53  PHE Y N   1 
ATOM   5606  C CA  . PHE F  3 38  ? -34.838 19.210  -17.673 1.00 75.44  ? 53  PHE Y CA  1 
ATOM   5607  C C   . PHE F  3 38  ? -34.080 17.906  -17.361 1.00 80.14  ? 53  PHE Y C   1 
ATOM   5608  O O   . PHE F  3 38  ? -33.241 17.854  -16.446 1.00 76.41  ? 53  PHE Y O   1 
ATOM   5609  C CB  . PHE F  3 38  ? -33.943 20.458  -17.632 1.00 77.96  ? 53  PHE Y CB  1 
ATOM   5610  C CG  . PHE F  3 38  ? -34.673 21.694  -18.110 1.00 83.20  ? 53  PHE Y CG  1 
ATOM   5611  C CD1 . PHE F  3 38  ? -34.800 21.967  -19.470 1.00 91.72  ? 53  PHE Y CD1 1 
ATOM   5612  C CD2 . PHE F  3 38  ? -35.258 22.571  -17.204 1.00 83.11  ? 53  PHE Y CD2 1 
ATOM   5613  C CE1 . PHE F  3 38  ? -35.485 23.103  -19.911 1.00 95.89  ? 53  PHE Y CE1 1 
ATOM   5614  C CE2 . PHE F  3 38  ? -35.949 23.703  -17.651 1.00 89.24  ? 53  PHE Y CE2 1 
ATOM   5615  C CZ  . PHE F  3 38  ? -36.066 23.953  -18.999 1.00 92.86  ? 53  PHE Y CZ  1 
ATOM   5616  N N   . VAL F  3 39  ? -34.469 16.826  -18.079 1.00 79.76  ? 54  VAL Y N   1 
ATOM   5617  C CA  . VAL F  3 39  ? -33.927 15.469  -17.943 1.00 78.08  ? 54  VAL Y CA  1 
ATOM   5618  C C   . VAL F  3 39  ? -33.264 15.072  -19.257 1.00 85.33  ? 54  VAL Y C   1 
ATOM   5619  O O   . VAL F  3 39  ? -33.818 15.355  -20.311 1.00 89.66  ? 54  VAL Y O   1 
ATOM   5620  C CB  . VAL F  3 39  ? -35.029 14.454  -17.530 1.00 81.37  ? 54  VAL Y CB  1 
ATOM   5621  C CG1 . VAL F  3 39  ? -34.422 13.131  -17.057 1.00 78.88  ? 54  VAL Y CG1 1 
ATOM   5622  C CG2 . VAL F  3 39  ? -35.947 15.035  -16.452 1.00 78.35  ? 54  VAL Y CG2 1 
ATOM   5623  N N   . LEU F  3 40  ? -32.067 14.455  -19.192 1.00 80.15  ? 55  LEU Y N   1 
ATOM   5624  C CA  . LEU F  3 40  ? -31.248 13.987  -20.325 1.00 84.23  ? 55  LEU Y CA  1 
ATOM   5625  C C   . LEU F  3 40  ? -30.933 15.047  -21.395 1.00 92.31  ? 55  LEU Y C   1 
ATOM   5626  O O   . LEU F  3 40  ? -30.621 14.696  -22.536 1.00 96.42  ? 55  LEU Y O   1 
ATOM   5627  C CB  . LEU F  3 40  ? -31.848 12.733  -20.987 1.00 86.96  ? 55  LEU Y CB  1 
ATOM   5628  C CG  . LEU F  3 40  ? -31.585 11.373  -20.321 1.00 89.07  ? 55  LEU Y CG  1 
ATOM   5629  C CD1 . LEU F  3 40  ? -31.853 10.255  -21.293 1.00 93.20  ? 55  LEU Y CD1 1 
ATOM   5630  C CD2 . LEU F  3 40  ? -30.145 11.239  -19.791 1.00 89.70  ? 55  LEU Y CD2 1 
ATOM   5631  N N   . THR F  3 41  ? -30.958 16.332  -21.014 1.00 88.29  ? 56  THR Y N   1 
ATOM   5632  C CA  . THR F  3 41  ? -30.688 17.437  -21.934 1.00 92.89  ? 56  THR Y CA  1 
ATOM   5633  C C   . THR F  3 41  ? -29.199 17.613  -22.176 1.00 97.74  ? 56  THR Y C   1 
ATOM   5634  O O   . THR F  3 41  ? -28.387 17.524  -21.242 1.00 93.18  ? 56  THR Y O   1 
ATOM   5635  C CB  . THR F  3 41  ? -31.315 18.757  -21.455 1.00 99.98  ? 56  THR Y CB  1 
ATOM   5636  O OG1 . THR F  3 41  ? -30.493 19.336  -20.445 1.00 97.26  ? 56  THR Y OG1 1 
ATOM   5637  C CG2 . THR F  3 41  ? -32.742 18.596  -20.947 1.00 96.44  ? 56  THR Y CG2 1 
ATOM   5638  N N   . LYS F  3 42  ? -28.851 17.903  -23.436 1.00 100.05 ? 57  LYS Y N   1 
ATOM   5639  C CA  . LYS F  3 42  ? -27.481 18.182  -23.841 1.00 102.44 ? 57  LYS Y CA  1 
ATOM   5640  C C   . LYS F  3 42  ? -27.208 19.694  -23.714 1.00 108.01 ? 57  LYS Y C   1 
ATOM   5641  O O   . LYS F  3 42  ? -26.718 20.363  -24.629 1.00 113.37 ? 57  LYS Y O   1 
ATOM   5642  C CB  . LYS F  3 42  ? -27.140 17.569  -25.212 1.00 110.23 ? 57  LYS Y CB  1 
ATOM   5643  C CG  . LYS F  3 42  ? -27.006 16.044  -25.176 1.00 111.64 ? 57  LYS Y CG  1 
ATOM   5644  C CD  . LYS F  3 42  ? -25.721 15.573  -24.502 1.00 114.82 ? 57  LYS Y CD  1 
ATOM   5645  C CE  . LYS F  3 42  ? -25.775 14.111  -24.135 1.00 120.34 ? 57  LYS Y CE  1 
ATOM   5646  N NZ  . LYS F  3 42  ? -24.453 13.610  -23.668 1.00 123.87 ? 57  LYS Y NZ  1 
ATOM   5647  N N   . LEU F  3 43  ? -27.548 20.200  -22.522 1.00 99.42  ? 58  LEU Y N   1 
ATOM   5648  C CA  . LEU F  3 43  ? -27.412 21.568  -22.055 1.00 99.40  ? 58  LEU Y CA  1 
ATOM   5649  C C   . LEU F  3 43  ? -26.049 21.686  -21.421 1.00 99.36  ? 58  LEU Y C   1 
ATOM   5650  O O   . LEU F  3 43  ? -25.681 20.859  -20.597 1.00 94.08  ? 58  LEU Y O   1 
ATOM   5651  C CB  . LEU F  3 43  ? -28.478 21.808  -20.976 1.00 94.92  ? 58  LEU Y CB  1 
ATOM   5652  C CG  . LEU F  3 43  ? -29.452 22.960  -21.167 1.00 103.11 ? 58  LEU Y CG  1 
ATOM   5653  C CD1 . LEU F  3 43  ? -30.628 22.553  -22.044 1.00 106.00 ? 58  LEU Y CD1 1 
ATOM   5654  C CD2 . LEU F  3 43  ? -30.001 23.379  -19.835 1.00 102.73 ? 58  LEU Y CD2 1 
ATOM   5655  N N   . ARG F  3 44  ? -25.308 22.705  -21.792 1.00 99.68  ? 59  ARG Y N   1 
ATOM   5656  C CA  . ARG F  3 44  ? -23.981 22.920  -21.246 1.00 99.41  ? 59  ARG Y CA  1 
ATOM   5657  C C   . ARG F  3 44  ? -23.993 24.008  -20.194 1.00 101.38 ? 59  ARG Y C   1 
ATOM   5658  O O   . ARG F  3 44  ? -23.188 23.973  -19.269 1.00 97.91  ? 59  ARG Y O   1 
ATOM   5659  C CB  . ARG F  3 44  ? -23.014 23.297  -22.374 1.00 106.62 ? 59  ARG Y CB  1 
ATOM   5660  C CG  . ARG F  3 44  ? -22.499 22.100  -23.176 1.00 115.10 ? 59  ARG Y CG  1 
ATOM   5661  C CD  . ARG F  3 44  ? -21.797 22.482  -24.473 1.00 126.62 ? 59  ARG Y CD  1 
ATOM   5662  N NE  . ARG F  3 44  ? -21.086 23.763  -24.404 1.00 134.43 ? 59  ARG Y NE  1 
ATOM   5663  C CZ  . ARG F  3 44  ? -19.849 23.925  -23.941 1.00 144.99 ? 59  ARG Y CZ  1 
ATOM   5664  N NH1 . ARG F  3 44  ? -19.161 22.884  -23.484 1.00 121.02 ? 59  ARG Y NH1 1 
ATOM   5665  N NH2 . ARG F  3 44  ? -19.300 25.132  -23.910 1.00 137.47 ? 59  ARG Y NH2 1 
ATOM   5666  N N   . VAL F  3 45  ? -24.882 25.004  -20.367 1.00 100.39 ? 60  VAL Y N   1 
ATOM   5667  C CA  . VAL F  3 45  ? -24.995 26.203  -19.527 1.00 99.24  ? 60  VAL Y CA  1 
ATOM   5668  C C   . VAL F  3 45  ? -26.468 26.531  -19.224 1.00 100.36 ? 60  VAL Y C   1 
ATOM   5669  O O   . VAL F  3 45  ? -27.295 26.526  -20.137 1.00 102.10 ? 60  VAL Y O   1 
ATOM   5670  C CB  . VAL F  3 45  ? -24.305 27.405  -20.270 1.00 110.03 ? 60  VAL Y CB  1 
ATOM   5671  C CG1 . VAL F  3 45  ? -24.403 28.713  -19.490 1.00 109.49 ? 60  VAL Y CG1 1 
ATOM   5672  C CG2 . VAL F  3 45  ? -22.851 27.100  -20.608 1.00 113.11 ? 60  VAL Y CG2 1 
ATOM   5673  N N   . ILE F  3 46  ? -26.785 26.859  -17.959 1.00 93.16  ? 61  ILE Y N   1 
ATOM   5674  C CA  . ILE F  3 46  ? -28.123 27.341  -17.612 1.00 91.78  ? 61  ILE Y CA  1 
ATOM   5675  C C   . ILE F  3 46  ? -27.989 28.874  -17.595 1.00 102.65 ? 61  ILE Y C   1 
ATOM   5676  O O   . ILE F  3 46  ? -27.571 29.459  -16.594 1.00 101.07 ? 61  ILE Y O   1 
ATOM   5677  C CB  . ILE F  3 46  ? -28.780 26.689  -16.366 1.00 87.39  ? 61  ILE Y CB  1 
ATOM   5678  C CG1 . ILE F  3 46  ? -29.175 25.246  -16.695 1.00 85.57  ? 61  ILE Y CG1 1 
ATOM   5679  C CG2 . ILE F  3 46  ? -30.033 27.440  -15.970 1.00 87.40  ? 61  ILE Y CG2 1 
ATOM   5680  C CD1 . ILE F  3 46  ? -29.325 24.298  -15.506 1.00 88.40  ? 61  ILE Y CD1 1 
ATOM   5681  N N   . GLN F  3 47  ? -28.234 29.482  -18.780 1.00 106.34 ? 62  GLN Y N   1 
ATOM   5682  C CA  . GLN F  3 47  ? -28.114 30.901  -19.155 1.00 112.71 ? 62  GLN Y CA  1 
ATOM   5683  C C   . GLN F  3 47  ? -28.661 31.897  -18.121 1.00 115.72 ? 62  GLN Y C   1 
ATOM   5684  O O   . GLN F  3 47  ? -29.616 31.587  -17.407 1.00 110.51 ? 62  GLN Y O   1 
ATOM   5685  C CB  . GLN F  3 47  ? -28.751 31.177  -20.541 1.00 120.54 ? 62  GLN Y CB  1 
ATOM   5686  C CG  . GLN F  3 47  ? -28.897 29.965  -21.491 1.00 145.08 ? 62  GLN Y CG  1 
ATOM   5687  C CD  . GLN F  3 47  ? -30.070 29.036  -21.181 1.00 161.80 ? 62  GLN Y CD  1 
ATOM   5688  O OE1 . GLN F  3 47  ? -31.039 29.396  -20.494 1.00 156.52 ? 62  GLN Y OE1 1 
ATOM   5689  N NE2 . GLN F  3 47  ? -30.008 27.809  -21.690 1.00 150.95 ? 62  GLN Y NE2 1 
ATOM   5690  N N   . LYS F  3 48  ? -28.051 33.103  -18.070 1.00 117.14 ? 63  LYS Y N   1 
ATOM   5691  C CA  . LYS F  3 48  ? -28.390 34.203  -17.161 1.00 116.97 ? 63  LYS Y CA  1 
ATOM   5692  C C   . LYS F  3 48  ? -29.884 34.521  -17.180 1.00 121.64 ? 63  LYS Y C   1 
ATOM   5693  O O   . LYS F  3 48  ? -30.458 34.722  -18.254 1.00 125.75 ? 63  LYS Y O   1 
ATOM   5694  C CB  . LYS F  3 48  ? -27.548 35.452  -17.487 1.00 125.99 ? 63  LYS Y CB  1 
ATOM   5695  C CG  . LYS F  3 48  ? -27.322 36.384  -16.303 1.00 136.41 ? 63  LYS Y CG  1 
ATOM   5696  C CD  . LYS F  3 48  ? -26.282 37.435  -16.633 1.00 152.96 ? 63  LYS Y CD  1 
ATOM   5697  C CE  . LYS F  3 48  ? -25.926 38.309  -15.456 1.00 161.01 ? 63  LYS Y CE  1 
ATOM   5698  N NZ  . LYS F  3 48  ? -24.973 39.386  -15.848 1.00 169.82 ? 63  LYS Y NZ  1 
ATOM   5699  N N   . GLY F  3 49  ? -30.495 34.510  -15.994 1.00 114.05 ? 64  GLY Y N   1 
ATOM   5700  C CA  . GLY F  3 49  ? -31.921 34.761  -15.802 1.00 113.26 ? 64  GLY Y CA  1 
ATOM   5701  C C   . GLY F  3 49  ? -32.796 33.837  -16.619 1.00 116.74 ? 64  GLY Y C   1 
ATOM   5702  O O   . GLY F  3 49  ? -33.680 34.303  -17.345 1.00 120.70 ? 64  GLY Y O   1 
ATOM   5703  N N   . ALA F  3 50  ? -32.507 32.528  -16.548 1.00 108.35 ? 65  ALA Y N   1 
ATOM   5704  C CA  . ALA F  3 50  ? -33.196 31.494  -17.310 1.00 107.41 ? 65  ALA Y CA  1 
ATOM   5705  C C   . ALA F  3 50  ? -34.646 31.356  -16.915 1.00 108.23 ? 65  ALA Y C   1 
ATOM   5706  O O   . ALA F  3 50  ? -35.515 31.383  -17.783 1.00 111.20 ? 65  ALA Y O   1 
ATOM   5707  C CB  . ALA F  3 50  ? -32.483 30.158  -17.149 1.00 104.22 ? 65  ALA Y CB  1 
ATOM   5708  N N   . PHE F  3 51  ? -34.908 31.221  -15.612 1.00 99.51  ? 66  PHE Y N   1 
ATOM   5709  C CA  . PHE F  3 51  ? -36.255 31.020  -15.087 1.00 97.12  ? 66  PHE Y CA  1 
ATOM   5710  C C   . PHE F  3 51  ? -36.884 32.313  -14.535 1.00 103.78 ? 66  PHE Y C   1 
ATOM   5711  O O   . PHE F  3 51  ? -37.903 32.250  -13.845 1.00 101.71 ? 66  PHE Y O   1 
ATOM   5712  C CB  . PHE F  3 51  ? -36.265 29.866  -14.054 1.00 92.27  ? 66  PHE Y CB  1 
ATOM   5713  C CG  . PHE F  3 51  ? -35.479 28.641  -14.477 1.00 91.54  ? 66  PHE Y CG  1 
ATOM   5714  C CD1 . PHE F  3 51  ? -35.958 27.796  -15.471 1.00 95.85  ? 66  PHE Y CD1 1 
ATOM   5715  C CD2 . PHE F  3 51  ? -34.253 28.348  -13.898 1.00 90.50  ? 66  PHE Y CD2 1 
ATOM   5716  C CE1 . PHE F  3 51  ? -35.215 26.690  -15.887 1.00 95.64  ? 66  PHE Y CE1 1 
ATOM   5717  C CE2 . PHE F  3 51  ? -33.513 27.238  -14.310 1.00 92.11  ? 66  PHE Y CE2 1 
ATOM   5718  C CZ  . PHE F  3 51  ? -33.999 26.415  -15.301 1.00 91.86  ? 66  PHE Y CZ  1 
ATOM   5719  N N   . SER F  3 52  ? -36.315 33.484  -14.880 1.00 104.95 ? 67  SER Y N   1 
ATOM   5720  C CA  . SER F  3 52  ? -36.859 34.775  -14.443 1.00 107.40 ? 67  SER Y CA  1 
ATOM   5721  C C   . SER F  3 52  ? -38.145 35.069  -15.200 1.00 113.03 ? 67  SER Y C   1 
ATOM   5722  O O   . SER F  3 52  ? -38.120 35.116  -16.431 1.00 117.07 ? 67  SER Y O   1 
ATOM   5723  C CB  . SER F  3 52  ? -35.859 35.904  -14.694 1.00 116.86 ? 67  SER Y CB  1 
ATOM   5724  O OG  . SER F  3 52  ? -34.665 35.737  -13.948 1.00 126.56 ? 67  SER Y OG  1 
ATOM   5725  N N   . GLY F  3 53  ? -39.247 35.237  -14.468 1.00 106.61 ? 68  GLY Y N   1 
ATOM   5726  C CA  . GLY F  3 53  ? -40.536 35.578  -15.061 1.00 109.67 ? 68  GLY Y CA  1 
ATOM   5727  C C   . GLY F  3 53  ? -41.692 34.624  -14.855 1.00 109.78 ? 68  GLY Y C   1 
ATOM   5728  O O   . GLY F  3 53  ? -42.845 35.032  -15.001 1.00 110.88 ? 68  GLY Y O   1 
ATOM   5729  N N   . PHE F  3 54  ? -41.417 33.349  -14.536 1.00 102.41 ? 69  PHE Y N   1 
ATOM   5730  C CA  . PHE F  3 54  ? -42.486 32.371  -14.317 1.00 99.80  ? 69  PHE Y CA  1 
ATOM   5731  C C   . PHE F  3 54  ? -43.045 32.533  -12.899 1.00 101.06 ? 69  PHE Y C   1 
ATOM   5732  O O   . PHE F  3 54  ? -42.620 31.849  -11.965 1.00 96.51  ? 69  PHE Y O   1 
ATOM   5733  C CB  . PHE F  3 54  ? -42.007 30.941  -14.590 1.00 98.23  ? 69  PHE Y CB  1 
ATOM   5734  C CG  . PHE F  3 54  ? -41.383 30.699  -15.943 1.00 103.32 ? 69  PHE Y CG  1 
ATOM   5735  C CD1 . PHE F  3 54  ? -40.026 30.917  -16.149 1.00 106.66 ? 69  PHE Y CD1 1 
ATOM   5736  C CD2 . PHE F  3 54  ? -42.135 30.190  -16.991 1.00 108.89 ? 69  PHE Y CD2 1 
ATOM   5737  C CE1 . PHE F  3 54  ? -39.448 30.683  -17.395 1.00 111.37 ? 69  PHE Y CE1 1 
ATOM   5738  C CE2 . PHE F  3 54  ? -41.555 29.958  -18.239 1.00 115.44 ? 69  PHE Y CE2 1 
ATOM   5739  C CZ  . PHE F  3 54  ? -40.216 30.202  -18.431 1.00 113.90 ? 69  PHE Y CZ  1 
ATOM   5740  N N   . GLY F  3 55  ? -43.971 33.475  -12.756 1.00 100.52 ? 70  GLY Y N   1 
ATOM   5741  C CA  . GLY F  3 55  ? -44.605 33.812  -11.487 1.00 98.65  ? 70  GLY Y CA  1 
ATOM   5742  C C   . GLY F  3 55  ? -45.583 32.783  -10.957 1.00 100.98 ? 70  GLY Y C   1 
ATOM   5743  O O   . GLY F  3 55  ? -46.061 32.911  -9.825  1.00 98.70  ? 70  GLY Y O   1 
ATOM   5744  N N   . ASP F  3 56  ? -45.901 31.767  -11.773 1.00 98.48  ? 71  ASP Y N   1 
ATOM   5745  C CA  . ASP F  3 56  ? -46.817 30.697  -11.395 1.00 96.52  ? 71  ASP Y CA  1 
ATOM   5746  C C   . ASP F  3 56  ? -46.045 29.470  -10.936 1.00 95.34  ? 71  ASP Y C   1 
ATOM   5747  O O   . ASP F  3 56  ? -46.563 28.702  -10.119 1.00 92.21  ? 71  ASP Y O   1 
ATOM   5748  C CB  . ASP F  3 56  ? -47.746 30.340  -12.570 1.00 102.99 ? 71  ASP Y CB  1 
ATOM   5749  C CG  . ASP F  3 56  ? -49.120 30.990  -12.512 1.00 120.19 ? 71  ASP Y CG  1 
ATOM   5750  O OD1 . ASP F  3 56  ? -49.817 30.819  -11.485 1.00 119.85 ? 71  ASP Y OD1 1 
ATOM   5751  O OD2 . ASP F  3 56  ? -49.516 31.636  -13.512 1.00 131.64 ? 71  ASP Y OD2 1 
ATOM   5752  N N   . LEU F  3 57  ? -44.799 29.307  -11.469 1.00 90.55  ? 72  LEU Y N   1 
ATOM   5753  C CA  . LEU F  3 57  ? -43.843 28.211  -11.265 1.00 85.29  ? 72  LEU Y CA  1 
ATOM   5754  C C   . LEU F  3 57  ? -43.574 27.889  -9.809  1.00 82.11  ? 72  LEU Y C   1 
ATOM   5755  O O   . LEU F  3 57  ? -43.225 28.772  -9.025  1.00 81.34  ? 72  LEU Y O   1 
ATOM   5756  C CB  . LEU F  3 57  ? -42.538 28.509  -12.023 1.00 86.39  ? 72  LEU Y CB  1 
ATOM   5757  C CG  . LEU F  3 57  ? -41.529 27.372  -12.264 1.00 89.35  ? 72  LEU Y CG  1 
ATOM   5758  C CD1 . LEU F  3 57  ? -42.097 26.267  -13.141 1.00 91.20  ? 72  LEU Y CD1 1 
ATOM   5759  C CD2 . LEU F  3 57  ? -40.318 27.896  -12.979 1.00 94.00  ? 72  LEU Y CD2 1 
ATOM   5760  N N   . GLU F  3 58  ? -43.738 26.605  -9.471  1.00 73.57  ? 73  GLU Y N   1 
ATOM   5761  C CA  . GLU F  3 58  ? -43.595 26.028  -8.139  1.00 67.82  ? 73  GLU Y CA  1 
ATOM   5762  C C   . GLU F  3 58  ? -42.415 25.079  -8.019  1.00 67.81  ? 73  GLU Y C   1 
ATOM   5763  O O   . GLU F  3 58  ? -41.855 24.969  -6.929  1.00 64.98  ? 73  GLU Y O   1 
ATOM   5764  C CB  . GLU F  3 58  ? -44.858 25.238  -7.802  1.00 68.72  ? 73  GLU Y CB  1 
ATOM   5765  C CG  . GLU F  3 58  ? -45.990 26.037  -7.201  1.00 76.10  ? 73  GLU Y CG  1 
ATOM   5766  C CD  . GLU F  3 58  ? -47.315 25.306  -7.266  1.00 99.70  ? 73  GLU Y CD  1 
ATOM   5767  O OE1 . GLU F  3 58  ? -47.302 24.054  -7.324  1.00 85.81  ? 73  GLU Y OE1 1 
ATOM   5768  O OE2 . GLU F  3 58  ? -48.368 25.983  -7.280  1.00 108.56 ? 73  GLU Y OE2 1 
ATOM   5769  N N   . LYS F  3 59  ? -42.087 24.325  -9.099  1.00 64.22  ? 74  LYS Y N   1 
ATOM   5770  C CA  . LYS F  3 59  ? -41.006 23.319  -9.088  1.00 60.34  ? 74  LYS Y CA  1 
ATOM   5771  C C   . LYS F  3 59  ? -40.092 23.384  -10.316 1.00 66.04  ? 74  LYS Y C   1 
ATOM   5772  O O   . LYS F  3 59  ? -40.571 23.505  -11.445 1.00 69.59  ? 74  LYS Y O   1 
ATOM   5773  C CB  . LYS F  3 59  ? -41.582 21.893  -9.000  1.00 60.33  ? 74  LYS Y CB  1 
ATOM   5774  C CG  . LYS F  3 59  ? -42.360 21.539  -7.744  1.00 62.37  ? 74  LYS Y CG  1 
ATOM   5775  C CD  . LYS F  3 59  ? -42.861 20.095  -7.822  1.00 66.78  ? 74  LYS Y CD  1 
ATOM   5776  C CE  . LYS F  3 59  ? -43.940 19.787  -6.810  1.00 80.83  ? 74  LYS Y CE  1 
ATOM   5777  N NZ  . LYS F  3 59  ? -43.412 19.745  -5.416  1.00 92.07  ? 74  LYS Y NZ  1 
ATOM   5778  N N   . ILE F  3 60  ? -38.779 23.232  -10.087 1.00 60.62  ? 75  ILE Y N   1 
ATOM   5779  C CA  . ILE F  3 60  ? -37.725 23.196  -11.110 1.00 62.15  ? 75  ILE Y CA  1 
ATOM   5780  C C   . ILE F  3 60  ? -36.921 21.923  -10.900 1.00 63.04  ? 75  ILE Y C   1 
ATOM   5781  O O   . ILE F  3 60  ? -36.437 21.694  -9.793  1.00 59.17  ? 75  ILE Y O   1 
ATOM   5782  C CB  . ILE F  3 60  ? -36.845 24.476  -11.058 1.00 66.49  ? 75  ILE Y CB  1 
ATOM   5783  C CG1 . ILE F  3 60  ? -37.591 25.667  -11.696 1.00 71.26  ? 75  ILE Y CG1 1 
ATOM   5784  C CG2 . ILE F  3 60  ? -35.468 24.266  -11.705 1.00 67.50  ? 75  ILE Y CG2 1 
ATOM   5785  C CD1 . ILE F  3 60  ? -37.010 27.071  -11.386 1.00 83.07  ? 75  ILE Y CD1 1 
ATOM   5786  N N   . GLU F  3 61  ? -36.802 21.089  -11.952 1.00 61.96  ? 76  GLU Y N   1 
ATOM   5787  C CA  . GLU F  3 61  ? -36.054 19.820  -11.910 1.00 59.63  ? 76  GLU Y CA  1 
ATOM   5788  C C   . GLU F  3 61  ? -34.918 19.803  -12.945 1.00 64.66  ? 76  GLU Y C   1 
ATOM   5789  O O   . GLU F  3 61  ? -35.187 19.848  -14.141 1.00 68.16  ? 76  GLU Y O   1 
ATOM   5790  C CB  . GLU F  3 61  ? -37.006 18.618  -12.131 1.00 60.77  ? 76  GLU Y CB  1 
ATOM   5791  C CG  . GLU F  3 61  ? -36.492 17.295  -11.571 1.00 67.01  ? 76  GLU Y CG  1 
ATOM   5792  C CD  . GLU F  3 61  ? -37.018 16.025  -12.222 1.00 87.91  ? 76  GLU Y CD  1 
ATOM   5793  O OE1 . GLU F  3 61  ? -38.244 15.776  -12.158 1.00 91.62  ? 76  GLU Y OE1 1 
ATOM   5794  O OE2 . GLU F  3 61  ? -36.193 15.257  -12.765 1.00 76.62  ? 76  GLU Y OE2 1 
ATOM   5795  N N   . ILE F  3 62  ? -33.662 19.765  -12.485 1.00 59.21  ? 77  ILE Y N   1 
ATOM   5796  C CA  . ILE F  3 62  ? -32.467 19.671  -13.346 1.00 61.92  ? 77  ILE Y CA  1 
ATOM   5797  C C   . ILE F  3 62  ? -31.700 18.347  -13.033 1.00 66.20  ? 77  ILE Y C   1 
ATOM   5798  O O   . ILE F  3 62  ? -30.707 18.330  -12.287 1.00 63.86  ? 77  ILE Y O   1 
ATOM   5799  C CB  . ILE F  3 62  ? -31.578 20.944  -13.334 1.00 65.69  ? 77  ILE Y CB  1 
ATOM   5800  C CG1 . ILE F  3 62  ? -32.403 22.187  -13.730 1.00 68.83  ? 77  ILE Y CG1 1 
ATOM   5801  C CG2 . ILE F  3 62  ? -30.380 20.778  -14.269 1.00 68.17  ? 77  ILE Y CG2 1 
ATOM   5802  C CD1 . ILE F  3 62  ? -32.086 23.422  -12.942 1.00 74.72  ? 77  ILE Y CD1 1 
ATOM   5803  N N   . SER F  3 63  ? -32.208 17.238  -13.600 1.00 63.87  ? 78  SER Y N   1 
ATOM   5804  C CA  . SER F  3 63  ? -31.657 15.908  -13.394 1.00 61.85  ? 78  SER Y CA  1 
ATOM   5805  C C   . SER F  3 63  ? -31.043 15.299  -14.658 1.00 67.52  ? 78  SER Y C   1 
ATOM   5806  O O   . SER F  3 63  ? -31.471 15.607  -15.775 1.00 70.51  ? 78  SER Y O   1 
ATOM   5807  C CB  . SER F  3 63  ? -32.703 14.977  -12.768 1.00 63.49  ? 78  SER Y CB  1 
ATOM   5808  O OG  . SER F  3 63  ? -33.540 14.296  -13.694 1.00 74.14  ? 78  SER Y OG  1 
ATOM   5809  N N   . GLN F  3 64  ? -30.033 14.437  -14.454 1.00 61.77  ? 79  GLN Y N   1 
ATOM   5810  C CA  . GLN F  3 64  ? -29.315 13.651  -15.453 1.00 64.29  ? 79  GLN Y CA  1 
ATOM   5811  C C   . GLN F  3 64  ? -28.815 14.469  -16.675 1.00 73.83  ? 79  GLN Y C   1 
ATOM   5812  O O   . GLN F  3 64  ? -29.129 14.163  -17.829 1.00 77.19  ? 79  GLN Y O   1 
ATOM   5813  C CB  . GLN F  3 64  ? -30.142 12.430  -15.865 1.00 65.89  ? 79  GLN Y CB  1 
ATOM   5814  C CG  . GLN F  3 64  ? -30.044 11.324  -14.832 1.00 66.75  ? 79  GLN Y CG  1 
ATOM   5815  C CD  . GLN F  3 64  ? -31.320 10.561  -14.668 1.00 78.43  ? 79  GLN Y CD  1 
ATOM   5816  O OE1 . GLN F  3 64  ? -31.469 9.458   -15.185 1.00 65.52  ? 79  GLN Y OE1 1 
ATOM   5817  N NE2 . GLN F  3 64  ? -32.258 11.122  -13.910 1.00 80.03  ? 79  GLN Y NE2 1 
ATOM   5818  N N   . ASN F  3 65  ? -27.982 15.483  -16.397 1.00 70.96  ? 80  ASN Y N   1 
ATOM   5819  C CA  . ASN F  3 65  ? -27.376 16.334  -17.421 1.00 75.52  ? 80  ASN Y CA  1 
ATOM   5820  C C   . ASN F  3 65  ? -25.842 16.229  -17.348 1.00 80.57  ? 80  ASN Y C   1 
ATOM   5821  O O   . ASN F  3 65  ? -25.172 16.934  -16.578 1.00 77.99  ? 80  ASN Y O   1 
ATOM   5822  C CB  . ASN F  3 65  ? -27.908 17.759  -17.323 1.00 75.33  ? 80  ASN Y CB  1 
ATOM   5823  C CG  . ASN F  3 65  ? -29.410 17.793  -17.323 1.00 84.95  ? 80  ASN Y CG  1 
ATOM   5824  O OD1 . ASN F  3 65  ? -30.068 17.550  -18.346 1.00 71.91  ? 80  ASN Y OD1 1 
ATOM   5825  N ND2 . ASN F  3 65  ? -29.979 17.981  -16.145 1.00 76.75  ? 80  ASN Y ND2 1 
ATOM   5826  N N   . ASP F  3 66  ? -25.306 15.287  -18.137 1.00 80.52  ? 81  ASP Y N   1 
ATOM   5827  C CA  . ASP F  3 66  ? -23.889 14.951  -18.153 1.00 82.15  ? 81  ASP Y CA  1 
ATOM   5828  C C   . ASP F  3 66  ? -22.992 15.946  -18.895 1.00 89.76  ? 81  ASP Y C   1 
ATOM   5829  O O   . ASP F  3 66  ? -21.775 15.768  -18.870 1.00 90.57  ? 81  ASP Y O   1 
ATOM   5830  C CB  . ASP F  3 66  ? -23.675 13.516  -18.685 1.00 86.41  ? 81  ASP Y CB  1 
ATOM   5831  C CG  . ASP F  3 66  ? -24.253 13.185  -20.055 1.00 110.00 ? 81  ASP Y CG  1 
ATOM   5832  O OD1 . ASP F  3 66  ? -24.935 14.055  -20.641 1.00 115.16 ? 81  ASP Y OD1 1 
ATOM   5833  O OD2 . ASP F  3 66  ? -24.025 12.045  -20.539 1.00 118.62 ? 81  ASP Y OD2 1 
ATOM   5834  N N   . VAL F  3 67  ? -23.560 16.985  -19.539 1.00 88.92  ? 82  VAL Y N   1 
ATOM   5835  C CA  . VAL F  3 67  ? -22.742 17.963  -20.276 1.00 93.45  ? 82  VAL Y CA  1 
ATOM   5836  C C   . VAL F  3 67  ? -22.921 19.399  -19.724 1.00 97.32  ? 82  VAL Y C   1 
ATOM   5837  O O   . VAL F  3 67  ? -22.260 20.326  -20.210 1.00 101.34 ? 82  VAL Y O   1 
ATOM   5838  C CB  . VAL F  3 67  ? -22.904 17.889  -21.818 1.00 102.81 ? 82  VAL Y CB  1 
ATOM   5839  C CG1 . VAL F  3 67  ? -22.527 16.509  -22.351 1.00 103.71 ? 82  VAL Y CG1 1 
ATOM   5840  C CG2 . VAL F  3 67  ? -24.305 18.275  -22.258 1.00 103.06 ? 82  VAL Y CG2 1 
ATOM   5841  N N   . LEU F  3 68  ? -23.779 19.564  -18.687 1.00 88.62  ? 83  LEU Y N   1 
ATOM   5842  C CA  . LEU F  3 68  ? -24.004 20.845  -18.009 1.00 87.32  ? 83  LEU Y CA  1 
ATOM   5843  C C   . LEU F  3 68  ? -22.797 21.146  -17.121 1.00 90.70  ? 83  LEU Y C   1 
ATOM   5844  O O   . LEU F  3 68  ? -22.414 20.304  -16.314 1.00 87.14  ? 83  LEU Y O   1 
ATOM   5845  C CB  . LEU F  3 68  ? -25.316 20.804  -17.205 1.00 82.16  ? 83  LEU Y CB  1 
ATOM   5846  C CG  . LEU F  3 68  ? -25.613 21.989  -16.293 1.00 84.93  ? 83  LEU Y CG  1 
ATOM   5847  C CD1 . LEU F  3 68  ? -26.060 23.223  -17.085 1.00 89.39  ? 83  LEU Y CD1 1 
ATOM   5848  C CD2 . LEU F  3 68  ? -26.638 21.610  -15.260 1.00 82.54  ? 83  LEU Y CD2 1 
ATOM   5849  N N   . GLU F  3 69  ? -22.187 22.322  -17.304 1.00 91.19  ? 84  GLU Y N   1 
ATOM   5850  C CA  . GLU F  3 69  ? -20.969 22.741  -16.613 1.00 91.84  ? 84  GLU Y CA  1 
ATOM   5851  C C   . GLU F  3 69  ? -21.150 23.954  -15.698 1.00 95.53  ? 84  GLU Y C   1 
ATOM   5852  O O   . GLU F  3 69  ? -20.458 24.042  -14.682 1.00 93.06  ? 84  GLU Y O   1 
ATOM   5853  C CB  . GLU F  3 69  ? -19.850 23.032  -17.638 1.00 99.83  ? 84  GLU Y CB  1 
ATOM   5854  C CG  . GLU F  3 69  ? -19.362 21.831  -18.442 1.00 110.37 ? 84  GLU Y CG  1 
ATOM   5855  C CD  . GLU F  3 69  ? -18.785 22.133  -19.817 1.00 131.79 ? 84  GLU Y CD  1 
ATOM   5856  O OE1 . GLU F  3 69  ? -17.792 22.893  -19.905 1.00 116.26 ? 84  GLU Y OE1 1 
ATOM   5857  O OE2 . GLU F  3 69  ? -19.299 21.564  -20.808 1.00 127.28 ? 84  GLU Y OE2 1 
ATOM   5858  N N   . VAL F  3 70  ? -22.020 24.914  -16.081 1.00 94.87  ? 85  VAL Y N   1 
ATOM   5859  C CA  . VAL F  3 70  ? -22.248 26.150  -15.312 1.00 94.63  ? 85  VAL Y CA  1 
ATOM   5860  C C   . VAL F  3 70  ? -23.704 26.569  -15.222 1.00 96.32  ? 85  VAL Y C   1 
ATOM   5861  O O   . VAL F  3 70  ? -24.449 26.465  -16.200 1.00 97.73  ? 85  VAL Y O   1 
ATOM   5862  C CB  . VAL F  3 70  ? -21.395 27.365  -15.794 1.00 105.17 ? 85  VAL Y CB  1 
ATOM   5863  C CG1 . VAL F  3 70  ? -19.928 27.239  -15.395 1.00 106.61 ? 85  VAL Y CG1 1 
ATOM   5864  C CG2 . VAL F  3 70  ? -21.534 27.604  -17.293 1.00 110.90 ? 85  VAL Y CG2 1 
ATOM   5865  N N   . ILE F  3 71  ? -24.076 27.113  -14.054 1.00 89.62  ? 86  ILE Y N   1 
ATOM   5866  C CA  . ILE F  3 71  ? -25.385 27.713  -13.783 1.00 87.77  ? 86  ILE Y CA  1 
ATOM   5867  C C   . ILE F  3 71  ? -25.084 29.212  -13.566 1.00 95.99  ? 86  ILE Y C   1 
ATOM   5868  O O   . ILE F  3 71  ? -24.438 29.579  -12.579 1.00 94.20  ? 86  ILE Y O   1 
ATOM   5869  C CB  . ILE F  3 71  ? -26.165 27.014  -12.618 1.00 83.50  ? 86  ILE Y CB  1 
ATOM   5870  C CG1 . ILE F  3 71  ? -26.667 25.621  -13.063 1.00 80.36  ? 86  ILE Y CG1 1 
ATOM   5871  C CG2 . ILE F  3 71  ? -27.345 27.869  -12.130 1.00 83.01  ? 86  ILE Y CG2 1 
ATOM   5872  C CD1 . ILE F  3 71  ? -26.913 24.626  -11.930 1.00 74.81  ? 86  ILE Y CD1 1 
ATOM   5873  N N   . GLU F  3 72  ? -25.480 30.050  -14.543 1.00 98.27  ? 87  GLU Y N   1 
ATOM   5874  C CA  . GLU F  3 72  ? -25.234 31.498  -14.564 1.00 103.74 ? 87  GLU Y CA  1 
ATOM   5875  C C   . GLU F  3 72  ? -25.989 32.294  -13.469 1.00 106.77 ? 87  GLU Y C   1 
ATOM   5876  O O   . GLU F  3 72  ? -26.724 31.717  -12.672 1.00 100.79 ? 87  GLU Y O   1 
ATOM   5877  C CB  . GLU F  3 72  ? -25.529 32.075  -15.967 1.00 111.42 ? 87  GLU Y CB  1 
ATOM   5878  C CG  . GLU F  3 72  ? -24.496 31.747  -17.034 1.00 125.72 ? 87  GLU Y CG  1 
ATOM   5879  C CD  . GLU F  3 72  ? -23.374 32.753  -17.204 1.00 155.78 ? 87  GLU Y CD  1 
ATOM   5880  O OE1 . GLU F  3 72  ? -23.655 33.976  -17.189 1.00 157.56 ? 87  GLU Y OE1 1 
ATOM   5881  O OE2 . GLU F  3 72  ? -22.218 32.315  -17.415 1.00 149.19 ? 87  GLU Y OE2 1 
ATOM   5882  N N   . ALA F  3 73  ? -25.783 33.621  -13.432 1.00 109.15 ? 88  ALA Y N   1 
ATOM   5883  C CA  . ALA F  3 73  ? -26.420 34.513  -12.471 1.00 108.75 ? 88  ALA Y CA  1 
ATOM   5884  C C   . ALA F  3 73  ? -27.916 34.681  -12.755 1.00 113.75 ? 88  ALA Y C   1 
ATOM   5885  O O   . ALA F  3 73  ? -28.374 34.417  -13.867 1.00 115.56 ? 88  ALA Y O   1 
ATOM   5886  C CB  . ALA F  3 73  ? -25.731 35.864  -12.494 1.00 115.58 ? 88  ALA Y CB  1 
ATOM   5887  N N   . ASP F  3 74  ? -28.675 35.101  -11.720 1.00 108.51 ? 89  ASP Y N   1 
ATOM   5888  C CA  . ASP F  3 74  ? -30.116 35.362  -11.701 1.00 107.65 ? 89  ASP Y CA  1 
ATOM   5889  C C   . ASP F  3 74  ? -30.986 34.220  -12.247 1.00 106.80 ? 89  ASP Y C   1 
ATOM   5890  O O   . ASP F  3 74  ? -32.164 34.440  -12.537 1.00 107.52 ? 89  ASP Y O   1 
ATOM   5891  C CB  . ASP F  3 74  ? -30.433 36.681  -12.409 1.00 116.79 ? 89  ASP Y CB  1 
ATOM   5892  C CG  . ASP F  3 74  ? -30.106 37.889  -11.565 1.00 137.51 ? 89  ASP Y CG  1 
ATOM   5893  O OD1 . ASP F  3 74  ? -28.905 38.097  -11.266 1.00 141.04 ? 89  ASP Y OD1 1 
ATOM   5894  O OD2 . ASP F  3 74  ? -31.049 38.646  -11.219 1.00 145.69 ? 89  ASP Y OD2 1 
ATOM   5895  N N   . VAL F  3 75  ? -30.431 33.000  -12.338 1.00 98.50  ? 90  VAL Y N   1 
ATOM   5896  C CA  . VAL F  3 75  ? -31.163 31.826  -12.808 1.00 95.19  ? 90  VAL Y CA  1 
ATOM   5897  C C   . VAL F  3 75  ? -32.391 31.598  -11.921 1.00 95.09  ? 90  VAL Y C   1 
ATOM   5898  O O   . VAL F  3 75  ? -33.507 31.509  -12.439 1.00 95.99  ? 90  VAL Y O   1 
ATOM   5899  C CB  . VAL F  3 75  ? -30.233 30.599  -12.921 1.00 96.04  ? 90  VAL Y CB  1 
ATOM   5900  C CG1 . VAL F  3 75  ? -31.005 29.292  -12.877 1.00 91.29  ? 90  VAL Y CG1 1 
ATOM   5901  C CG2 . VAL F  3 75  ? -29.412 30.683  -14.194 1.00 100.95 ? 90  VAL Y CG2 1 
ATOM   5902  N N   . PHE F  3 76  ? -32.193 31.604  -10.591 1.00 86.95  ? 91  PHE Y N   1 
ATOM   5903  C CA  . PHE F  3 76  ? -33.291 31.447  -9.652  1.00 82.66  ? 91  PHE Y CA  1 
ATOM   5904  C C   . PHE F  3 76  ? -33.626 32.789  -9.013  1.00 89.35  ? 91  PHE Y C   1 
ATOM   5905  O O   . PHE F  3 76  ? -33.268 33.054  -7.863  1.00 87.52  ? 91  PHE Y O   1 
ATOM   5906  C CB  . PHE F  3 76  ? -33.002 30.332  -8.639  1.00 78.48  ? 91  PHE Y CB  1 
ATOM   5907  C CG  . PHE F  3 76  ? -32.606 29.023  -9.283  1.00 77.62  ? 91  PHE Y CG  1 
ATOM   5908  C CD1 . PHE F  3 76  ? -33.543 28.250  -9.961  1.00 79.54  ? 91  PHE Y CD1 1 
ATOM   5909  C CD2 . PHE F  3 76  ? -31.291 28.579  -9.238  1.00 78.02  ? 91  PHE Y CD2 1 
ATOM   5910  C CE1 . PHE F  3 76  ? -33.169 27.055  -10.580 1.00 79.04  ? 91  PHE Y CE1 1 
ATOM   5911  C CE2 . PHE F  3 76  ? -30.924 27.372  -9.835  1.00 79.11  ? 91  PHE Y CE2 1 
ATOM   5912  C CZ  . PHE F  3 76  ? -31.863 26.623  -10.510 1.00 76.88  ? 91  PHE Y CZ  1 
ATOM   5913  N N   . SER F  3 77  ? -34.278 33.655  -9.814  1.00 90.35  ? 92  SER Y N   1 
ATOM   5914  C CA  . SER F  3 77  ? -34.728 35.003  -9.450  1.00 93.34  ? 92  SER Y CA  1 
ATOM   5915  C C   . SER F  3 77  ? -36.130 35.256  -9.992  1.00 98.36  ? 92  SER Y C   1 
ATOM   5916  O O   . SER F  3 77  ? -36.492 34.688  -11.027 1.00 98.81  ? 92  SER Y O   1 
ATOM   5917  C CB  . SER F  3 77  ? -33.772 36.062  -9.997  1.00 102.50 ? 92  SER Y CB  1 
ATOM   5918  O OG  . SER F  3 77  ? -33.865 36.247  -11.400 1.00 115.76 ? 92  SER Y OG  1 
ATOM   5919  N N   . ASN F  3 78  ? -36.900 36.130  -9.312  1.00 95.50  ? 93  ASN Y N   1 
ATOM   5920  C CA  . ASN F  3 78  ? -38.270 36.510  -9.691  1.00 97.90  ? 93  ASN Y CA  1 
ATOM   5921  C C   . ASN F  3 78  ? -39.159 35.272  -9.914  1.00 99.04  ? 93  ASN Y C   1 
ATOM   5922  O O   . ASN F  3 78  ? -39.640 35.033  -11.030 1.00 101.60 ? 93  ASN Y O   1 
ATOM   5923  C CB  . ASN F  3 78  ? -38.293 37.485  -10.903 1.00 103.91 ? 93  ASN Y CB  1 
ATOM   5924  C CG  . ASN F  3 78  ? -37.338 38.662  -10.801 1.00 121.34 ? 93  ASN Y CG  1 
ATOM   5925  O OD1 . ASN F  3 78  ? -37.434 39.507  -9.904  1.00 111.96 ? 93  ASN Y OD1 1 
ATOM   5926  N ND2 . ASN F  3 78  ? -36.400 38.755  -11.733 1.00 114.06 ? 93  ASN Y ND2 1 
ATOM   5927  N N   . LEU F  3 79  ? -39.300 34.447  -8.851  1.00 89.55  ? 94  LEU Y N   1 
ATOM   5928  C CA  . LEU F  3 79  ? -40.105 33.220  -8.841  1.00 85.64  ? 94  LEU Y CA  1 
ATOM   5929  C C   . LEU F  3 79  ? -40.829 33.151  -7.487  1.00 86.13  ? 94  LEU Y C   1 
ATOM   5930  O O   . LEU F  3 79  ? -40.527 32.276  -6.686  1.00 80.56  ? 94  LEU Y O   1 
ATOM   5931  C CB  . LEU F  3 79  ? -39.188 31.998  -9.040  1.00 82.28  ? 94  LEU Y CB  1 
ATOM   5932  C CG  . LEU F  3 79  ? -38.529 31.829  -10.407 1.00 89.09  ? 94  LEU Y CG  1 
ATOM   5933  C CD1 . LEU F  3 79  ? -37.076 31.469  -10.265 1.00 87.14  ? 94  LEU Y CD1 1 
ATOM   5934  C CD2 . LEU F  3 79  ? -39.230 30.775  -11.204 1.00 90.76  ? 94  LEU Y CD2 1 
ATOM   5935  N N   . PRO F  3 80  ? -41.768 34.083  -7.186  1.00 87.64  ? 95  PRO Y N   1 
ATOM   5936  C CA  . PRO F  3 80  ? -42.403 34.094  -5.854  1.00 86.09  ? 95  PRO Y CA  1 
ATOM   5937  C C   . PRO F  3 80  ? -43.187 32.848  -5.425  1.00 88.60  ? 95  PRO Y C   1 
ATOM   5938  O O   . PRO F  3 80  ? -43.482 32.726  -4.230  1.00 86.57  ? 95  PRO Y O   1 
ATOM   5939  C CB  . PRO F  3 80  ? -43.323 35.325  -5.913  1.00 91.99  ? 95  PRO Y CB  1 
ATOM   5940  C CG  . PRO F  3 80  ? -43.548 35.565  -7.351  1.00 99.67  ? 95  PRO Y CG  1 
ATOM   5941  C CD  . PRO F  3 80  ? -42.247 35.228  -7.991  1.00 94.56  ? 95  PRO Y CD  1 
ATOM   5942  N N   . LYS F  3 81  ? -43.525 31.939  -6.360  1.00 85.71  ? 96  LYS Y N   1 
ATOM   5943  C CA  . LYS F  3 81  ? -44.290 30.730  -6.025  1.00 83.26  ? 96  LYS Y CA  1 
ATOM   5944  C C   . LYS F  3 81  ? -43.418 29.468  -5.891  1.00 83.47  ? 96  LYS Y C   1 
ATOM   5945  O O   . LYS F  3 81  ? -43.886 28.452  -5.356  1.00 80.97  ? 96  LYS Y O   1 
ATOM   5946  C CB  . LYS F  3 81  ? -45.453 30.516  -7.014  1.00 88.67  ? 96  LYS Y CB  1 
ATOM   5947  C CG  . LYS F  3 81  ? -46.640 31.427  -6.744  1.00 96.84  ? 96  LYS Y CG  1 
ATOM   5948  C CD  . LYS F  3 81  ? -47.941 30.835  -7.254  1.00 106.65 ? 96  LYS Y CD  1 
ATOM   5949  C CE  . LYS F  3 81  ? -49.148 31.593  -6.743  1.00 116.59 ? 96  LYS Y CE  1 
ATOM   5950  N NZ  . LYS F  3 81  ? -49.374 31.369  -5.287  1.00 118.11 ? 96  LYS Y NZ  1 
ATOM   5951  N N   . LEU F  3 82  ? -42.148 29.549  -6.354  1.00 79.40  ? 97  LEU Y N   1 
ATOM   5952  C CA  . LEU F  3 82  ? -41.177 28.452  -6.327  1.00 75.72  ? 97  LEU Y CA  1 
ATOM   5953  C C   . LEU F  3 82  ? -40.827 28.018  -4.903  1.00 76.42  ? 97  LEU Y C   1 
ATOM   5954  O O   . LEU F  3 82  ? -40.318 28.810  -4.107  1.00 76.24  ? 97  LEU Y O   1 
ATOM   5955  C CB  . LEU F  3 82  ? -39.917 28.816  -7.133  1.00 76.64  ? 97  LEU Y CB  1 
ATOM   5956  C CG  . LEU F  3 82  ? -38.817 27.762  -7.249  1.00 77.44  ? 97  LEU Y CG  1 
ATOM   5957  C CD1 . LEU F  3 82  ? -39.140 26.742  -8.333  1.00 77.92  ? 97  LEU Y CD1 1 
ATOM   5958  C CD2 . LEU F  3 82  ? -37.495 28.417  -7.530  1.00 79.13  ? 97  LEU Y CD2 1 
ATOM   5959  N N   . HIS F  3 83  ? -41.124 26.752  -4.598  1.00 69.92  ? 98  HIS Y N   1 
ATOM   5960  C CA  . HIS F  3 83  ? -40.887 26.159  -3.290  1.00 66.08  ? 98  HIS Y CA  1 
ATOM   5961  C C   . HIS F  3 83  ? -39.898 24.993  -3.348  1.00 64.85  ? 98  HIS Y C   1 
ATOM   5962  O O   . HIS F  3 83  ? -39.430 24.521  -2.307  1.00 61.23  ? 98  HIS Y O   1 
ATOM   5963  C CB  . HIS F  3 83  ? -42.232 25.746  -2.658  1.00 67.10  ? 98  HIS Y CB  1 
ATOM   5964  C CG  . HIS F  3 83  ? -42.902 24.598  -3.340  1.00 70.80  ? 98  HIS Y CG  1 
ATOM   5965  N ND1 . HIS F  3 83  ? -43.437 24.724  -4.606  1.00 75.70  ? 98  HIS Y ND1 1 
ATOM   5966  C CD2 . HIS F  3 83  ? -43.107 23.335  -2.900  1.00 70.53  ? 98  HIS Y CD2 1 
ATOM   5967  C CE1 . HIS F  3 83  ? -43.931 23.531  -4.903  1.00 74.76  ? 98  HIS Y CE1 1 
ATOM   5968  N NE2 . HIS F  3 83  ? -43.763 22.667  -3.905  1.00 72.07  ? 98  HIS Y NE2 1 
ATOM   5969  N N   . GLU F  3 84  ? -39.558 24.548  -4.567  1.00 61.51  ? 99  GLU Y N   1 
ATOM   5970  C CA  . GLU F  3 84  ? -38.677 23.399  -4.744  1.00 58.61  ? 99  GLU Y CA  1 
ATOM   5971  C C   . GLU F  3 84  ? -37.774 23.460  -6.001  1.00 63.03  ? 99  GLU Y C   1 
ATOM   5972  O O   . GLU F  3 84  ? -38.263 23.728  -7.105  1.00 65.78  ? 99  GLU Y O   1 
ATOM   5973  C CB  . GLU F  3 84  ? -39.548 22.140  -4.765  1.00 58.62  ? 99  GLU Y CB  1 
ATOM   5974  C CG  . GLU F  3 84  ? -38.828 20.850  -4.479  1.00 60.68  ? 99  GLU Y CG  1 
ATOM   5975  C CD  . GLU F  3 84  ? -39.676 19.677  -4.906  1.00 83.01  ? 99  GLU Y CD  1 
ATOM   5976  O OE1 . GLU F  3 84  ? -40.593 19.292  -4.141  1.00 74.90  ? 99  GLU Y OE1 1 
ATOM   5977  O OE2 . GLU F  3 84  ? -39.487 19.208  -6.053  1.00 82.50  ? 99  GLU Y OE2 1 
ATOM   5978  N N   . ILE F  3 85  ? -36.459 23.193  -5.808  1.00 55.74  ? 100 ILE Y N   1 
ATOM   5979  C CA  . ILE F  3 85  ? -35.448 23.108  -6.865  1.00 56.67  ? 100 ILE Y CA  1 
ATOM   5980  C C   . ILE F  3 85  ? -34.672 21.816  -6.628  1.00 59.79  ? 100 ILE Y C   1 
ATOM   5981  O O   . ILE F  3 85  ? -34.049 21.659  -5.574  1.00 57.53  ? 100 ILE Y O   1 
ATOM   5982  C CB  . ILE F  3 85  ? -34.440 24.305  -6.988  1.00 60.80  ? 100 ILE Y CB  1 
ATOM   5983  C CG1 . ILE F  3 85  ? -35.096 25.687  -6.830  1.00 62.37  ? 100 ILE Y CG1 1 
ATOM   5984  C CG2 . ILE F  3 85  ? -33.657 24.207  -8.312  1.00 63.45  ? 100 ILE Y CG2 1 
ATOM   5985  C CD1 . ILE F  3 85  ? -34.094 26.861  -6.534  1.00 61.34  ? 100 ILE Y CD1 1 
ATOM   5986  N N   . ARG F  3 86  ? -34.656 20.926  -7.633  1.00 57.52  ? 101 ARG Y N   1 
ATOM   5987  C CA  . ARG F  3 86  ? -33.924 19.666  -7.581  1.00 54.97  ? 101 ARG Y CA  1 
ATOM   5988  C C   . ARG F  3 86  ? -32.868 19.560  -8.699  1.00 59.79  ? 101 ARG Y C   1 
ATOM   5989  O O   . ARG F  3 86  ? -33.220 19.368  -9.861  1.00 61.33  ? 101 ARG Y O   1 
ATOM   5990  C CB  . ARG F  3 86  ? -34.890 18.475  -7.586  1.00 53.34  ? 101 ARG Y CB  1 
ATOM   5991  C CG  . ARG F  3 86  ? -35.624 18.285  -6.262  1.00 56.08  ? 101 ARG Y CG  1 
ATOM   5992  C CD  . ARG F  3 86  ? -36.310 16.936  -6.186  1.00 55.27  ? 101 ARG Y CD  1 
ATOM   5993  N NE  . ARG F  3 86  ? -37.433 16.848  -7.119  1.00 64.23  ? 101 ARG Y NE  1 
ATOM   5994  C CZ  . ARG F  3 86  ? -37.467 16.045  -8.177  1.00 76.90  ? 101 ARG Y CZ  1 
ATOM   5995  N NH1 . ARG F  3 86  ? -36.451 15.227  -8.434  1.00 65.93  ? 101 ARG Y NH1 1 
ATOM   5996  N NH2 . ARG F  3 86  ? -38.531 16.032  -8.972  1.00 55.67  ? 101 ARG Y NH2 1 
ATOM   5997  N N   . ILE F  3 87  ? -31.578 19.734  -8.327  1.00 55.09  ? 102 ILE Y N   1 
ATOM   5998  C CA  . ILE F  3 87  ? -30.387 19.643  -9.185  1.00 56.51  ? 102 ILE Y CA  1 
ATOM   5999  C C   . ILE F  3 87  ? -29.781 18.267  -8.854  1.00 59.28  ? 102 ILE Y C   1 
ATOM   6000  O O   . ILE F  3 87  ? -29.120 18.093  -7.824  1.00 57.09  ? 102 ILE Y O   1 
ATOM   6001  C CB  . ILE F  3 87  ? -29.396 20.840  -8.947  1.00 60.41  ? 102 ILE Y CB  1 
ATOM   6002  C CG1 . ILE F  3 87  ? -30.014 22.183  -9.365  1.00 62.55  ? 102 ILE Y CG1 1 
ATOM   6003  C CG2 . ILE F  3 87  ? -28.030 20.622  -9.643  1.00 63.65  ? 102 ILE Y CG2 1 
ATOM   6004  C CD1 . ILE F  3 87  ? -29.428 23.385  -8.658  1.00 66.33  ? 102 ILE Y CD1 1 
ATOM   6005  N N   . GLU F  3 88  ? -30.104 17.274  -9.691  1.00 56.62  ? 103 GLU Y N   1 
ATOM   6006  C CA  . GLU F  3 88  ? -29.701 15.875  -9.527  1.00 53.88  ? 103 GLU Y CA  1 
ATOM   6007  C C   . GLU F  3 88  ? -28.834 15.400  -10.675 1.00 60.89  ? 103 GLU Y C   1 
ATOM   6008  O O   . GLU F  3 88  ? -28.953 15.895  -11.802 1.00 65.16  ? 103 GLU Y O   1 
ATOM   6009  C CB  . GLU F  3 88  ? -30.943 14.978  -9.506  1.00 53.98  ? 103 GLU Y CB  1 
ATOM   6010  C CG  . GLU F  3 88  ? -31.818 15.052  -8.266  1.00 59.95  ? 103 GLU Y CG  1 
ATOM   6011  C CD  . GLU F  3 88  ? -33.060 14.176  -8.304  1.00 75.83  ? 103 GLU Y CD  1 
ATOM   6012  O OE1 . GLU F  3 88  ? -33.299 13.505  -9.334  1.00 75.19  ? 103 GLU Y OE1 1 
ATOM   6013  O OE2 . GLU F  3 88  ? -33.806 14.170  -7.301  1.00 67.45  ? 103 GLU Y OE2 1 
ATOM   6014  N N   . LYS F  3 89  ? -27.991 14.401  -10.385 1.00 55.45  ? 104 LYS Y N   1 
ATOM   6015  C CA  . LYS F  3 89  ? -27.135 13.669  -11.318 1.00 57.20  ? 104 LYS Y CA  1 
ATOM   6016  C C   . LYS F  3 89  ? -26.599 14.531  -12.487 1.00 65.35  ? 104 LYS Y C   1 
ATOM   6017  O O   . LYS F  3 89  ? -26.966 14.332  -13.649 1.00 67.84  ? 104 LYS Y O   1 
ATOM   6018  C CB  . LYS F  3 89  ? -27.870 12.407  -11.819 1.00 59.02  ? 104 LYS Y CB  1 
ATOM   6019  C CG  . LYS F  3 89  ? -28.391 11.514  -10.703 1.00 58.99  ? 104 LYS Y CG  1 
ATOM   6020  C CD  . LYS F  3 89  ? -29.680 10.790  -11.100 1.00 70.57  ? 104 LYS Y CD  1 
ATOM   6021  C CE  . LYS F  3 89  ? -30.961 11.532  -10.778 1.00 81.31  ? 104 LYS Y CE  1 
ATOM   6022  N NZ  . LYS F  3 89  ? -31.203 11.619  -9.314  1.00 89.95  ? 104 LYS Y NZ  1 
ATOM   6023  N N   . ALA F  3 90  ? -25.743 15.506  -12.153 1.00 62.04  ? 105 ALA Y N   1 
ATOM   6024  C CA  . ALA F  3 90  ? -25.104 16.407  -13.110 1.00 65.37  ? 105 ALA Y CA  1 
ATOM   6025  C C   . ALA F  3 90  ? -23.588 16.335  -12.854 1.00 68.81  ? 105 ALA Y C   1 
ATOM   6026  O O   . ALA F  3 90  ? -22.996 17.232  -12.246 1.00 67.87  ? 105 ALA Y O   1 
ATOM   6027  C CB  . ALA F  3 90  ? -25.644 17.821  -12.929 1.00 66.43  ? 105 ALA Y CB  1 
ATOM   6028  N N   . ASN F  3 91  ? -22.982 15.216  -13.285 1.00 66.37  ? 106 ASN Y N   1 
ATOM   6029  C CA  . ASN F  3 91  ? -21.577 14.885  -13.054 1.00 67.72  ? 106 ASN Y CA  1 
ATOM   6030  C C   . ASN F  3 91  ? -20.549 15.906  -13.615 1.00 77.16  ? 106 ASN Y C   1 
ATOM   6031  O O   . ASN F  3 91  ? -19.472 16.059  -13.028 1.00 76.74  ? 106 ASN Y O   1 
ATOM   6032  C CB  . ASN F  3 91  ? -21.269 13.474  -13.555 1.00 68.62  ? 106 ASN Y CB  1 
ATOM   6033  C CG  . ASN F  3 91  ? -21.223 13.327  -15.062 1.00 84.79  ? 106 ASN Y CG  1 
ATOM   6034  O OD1 . ASN F  3 91  ? -22.197 13.610  -15.763 1.00 71.36  ? 106 ASN Y OD1 1 
ATOM   6035  N ND2 . ASN F  3 91  ? -20.087 12.859  -15.587 1.00 77.52  ? 106 ASN Y ND2 1 
ATOM   6036  N N   . ASN F  3 92  ? -20.857 16.597  -14.722 1.00 78.24  ? 107 ASN Y N   1 
ATOM   6037  C CA  . ASN F  3 92  ? -19.878 17.540  -15.250 1.00 82.84  ? 107 ASN Y CA  1 
ATOM   6038  C C   . ASN F  3 92  ? -20.164 18.983  -14.829 1.00 89.34  ? 107 ASN Y C   1 
ATOM   6039  O O   . ASN F  3 92  ? -19.504 19.908  -15.314 1.00 93.77  ? 107 ASN Y O   1 
ATOM   6040  C CB  . ASN F  3 92  ? -19.694 17.384  -16.755 1.00 85.91  ? 107 ASN Y CB  1 
ATOM   6041  C CG  . ASN F  3 92  ? -18.662 16.330  -17.117 1.00 103.03 ? 107 ASN Y CG  1 
ATOM   6042  O OD1 . ASN F  3 92  ? -17.514 16.347  -16.643 1.00 95.38  ? 107 ASN Y OD1 1 
ATOM   6043  N ND2 . ASN F  3 92  ? -19.039 15.397  -17.982 1.00 94.11  ? 107 ASN Y ND2 1 
ATOM   6044  N N   . LEU F  3 93  ? -21.117 19.175  -13.893 1.00 82.43  ? 108 LEU Y N   1 
ATOM   6045  C CA  . LEU F  3 93  ? -21.428 20.488  -13.334 1.00 82.74  ? 108 LEU Y CA  1 
ATOM   6046  C C   . LEU F  3 93  ? -20.448 20.723  -12.184 1.00 86.99  ? 108 LEU Y C   1 
ATOM   6047  O O   . LEU F  3 93  ? -20.488 19.991  -11.195 1.00 83.17  ? 108 LEU Y O   1 
ATOM   6048  C CB  . LEU F  3 93  ? -22.889 20.526  -12.850 1.00 79.09  ? 108 LEU Y CB  1 
ATOM   6049  C CG  . LEU F  3 93  ? -23.361 21.801  -12.151 1.00 82.69  ? 108 LEU Y CG  1 
ATOM   6050  C CD1 . LEU F  3 93  ? -23.700 22.897  -13.160 1.00 87.02  ? 108 LEU Y CD1 1 
ATOM   6051  C CD2 . LEU F  3 93  ? -24.524 21.501  -11.217 1.00 79.99  ? 108 LEU Y CD2 1 
ATOM   6052  N N   . LEU F  3 94  ? -19.555 21.718  -12.334 1.00 87.95  ? 109 LEU Y N   1 
ATOM   6053  C CA  . LEU F  3 94  ? -18.491 22.030  -11.369 1.00 88.40  ? 109 LEU Y CA  1 
ATOM   6054  C C   . LEU F  3 94  ? -18.612 23.406  -10.693 1.00 96.15  ? 109 LEU Y C   1 
ATOM   6055  O O   . LEU F  3 94  ? -18.154 23.573  -9.555  1.00 94.58  ? 109 LEU Y O   1 
ATOM   6056  C CB  . LEU F  3 94  ? -17.118 21.925  -12.068 1.00 93.08  ? 109 LEU Y CB  1 
ATOM   6057  C CG  . LEU F  3 94  ? -16.880 20.669  -12.922 1.00 98.12  ? 109 LEU Y CG  1 
ATOM   6058  C CD1 . LEU F  3 94  ? -15.856 20.916  -14.005 1.00 103.68 ? 109 LEU Y CD1 1 
ATOM   6059  C CD2 . LEU F  3 94  ? -16.558 19.443  -12.059 1.00 97.54  ? 109 LEU Y CD2 1 
ATOM   6060  N N   . TYR F  3 95  ? -19.199 24.391  -11.411 1.00 96.65  ? 110 TYR Y N   1 
ATOM   6061  C CA  . TYR F  3 95  ? -19.347 25.776  -10.971 1.00 98.13  ? 110 TYR Y CA  1 
ATOM   6062  C C   . TYR F  3 95  ? -20.797 26.273  -10.943 1.00 96.30  ? 110 TYR Y C   1 
ATOM   6063  O O   . TYR F  3 95  ? -21.525 26.168  -11.936 1.00 96.26  ? 110 TYR Y O   1 
ATOM   6064  C CB  . TYR F  3 95  ? -18.469 26.689  -11.873 1.00 107.78 ? 110 TYR Y CB  1 
ATOM   6065  C CG  . TYR F  3 95  ? -18.557 28.186  -11.612 1.00 114.70 ? 110 TYR Y CG  1 
ATOM   6066  C CD1 . TYR F  3 95  ? -17.728 28.803  -10.676 1.00 118.36 ? 110 TYR Y CD1 1 
ATOM   6067  C CD2 . TYR F  3 95  ? -19.413 28.997  -12.356 1.00 118.26 ? 110 TYR Y CD2 1 
ATOM   6068  C CE1 . TYR F  3 95  ? -17.786 30.181  -10.451 1.00 122.96 ? 110 TYR Y CE1 1 
ATOM   6069  C CE2 . TYR F  3 95  ? -19.473 30.376  -12.146 1.00 122.59 ? 110 TYR Y CE2 1 
ATOM   6070  C CZ  . TYR F  3 95  ? -18.659 30.963  -11.192 1.00 131.94 ? 110 TYR Y CZ  1 
ATOM   6071  O OH  . TYR F  3 95  ? -18.712 32.321  -10.993 1.00 138.85 ? 110 TYR Y OH  1 
ATOM   6072  N N   . ILE F  3 96  ? -21.193 26.845  -9.804  1.00 88.92  ? 111 ILE Y N   1 
ATOM   6073  C CA  . ILE F  3 96  ? -22.473 27.526  -9.650  1.00 87.44  ? 111 ILE Y CA  1 
ATOM   6074  C C   . ILE F  3 96  ? -22.127 28.956  -9.245  1.00 95.92  ? 111 ILE Y C   1 
ATOM   6075  O O   . ILE F  3 96  ? -21.499 29.176  -8.198  1.00 95.16  ? 111 ILE Y O   1 
ATOM   6076  C CB  . ILE F  3 96  ? -23.520 26.870  -8.713  1.00 84.16  ? 111 ILE Y CB  1 
ATOM   6077  C CG1 . ILE F  3 96  ? -23.888 25.450  -9.189  1.00 81.88  ? 111 ILE Y CG1 1 
ATOM   6078  C CG2 . ILE F  3 96  ? -24.785 27.757  -8.626  1.00 84.13  ? 111 ILE Y CG2 1 
ATOM   6079  C CD1 . ILE F  3 96  ? -24.795 24.619  -8.217  1.00 82.16  ? 111 ILE Y CD1 1 
ATOM   6080  N N   . ASN F  3 97  ? -22.500 29.913  -10.113 1.00 96.29  ? 112 ASN Y N   1 
ATOM   6081  C CA  . ASN F  3 97  ? -22.280 31.340  -9.932  1.00 100.46 ? 112 ASN Y CA  1 
ATOM   6082  C C   . ASN F  3 97  ? -22.868 31.800  -8.593  1.00 101.39 ? 112 ASN Y C   1 
ATOM   6083  O O   . ASN F  3 97  ? -23.990 31.407  -8.257  1.00 96.21  ? 112 ASN Y O   1 
ATOM   6084  C CB  . ASN F  3 97  ? -22.904 32.111  -11.101 1.00 105.75 ? 112 ASN Y CB  1 
ATOM   6085  C CG  . ASN F  3 97  ? -22.618 33.585  -11.118 1.00 124.48 ? 112 ASN Y CG  1 
ATOM   6086  O OD1 . ASN F  3 97  ? -23.386 34.390  -10.594 1.00 118.46 ? 112 ASN Y OD1 1 
ATOM   6087  N ND2 . ASN F  3 97  ? -21.526 33.972  -11.749 1.00 119.40 ? 112 ASN Y ND2 1 
ATOM   6088  N N   . PRO F  3 98  ? -22.123 32.618  -7.808  1.00 100.75 ? 113 PRO Y N   1 
ATOM   6089  C CA  . PRO F  3 98  ? -22.642 33.070  -6.499  1.00 98.39  ? 113 PRO Y CA  1 
ATOM   6090  C C   . PRO F  3 98  ? -23.850 34.022  -6.563  1.00 103.11 ? 113 PRO Y C   1 
ATOM   6091  O O   . PRO F  3 98  ? -24.332 34.487  -5.524  1.00 100.97 ? 113 PRO Y O   1 
ATOM   6092  C CB  . PRO F  3 98  ? -21.417 33.721  -5.834  1.00 103.51 ? 113 PRO Y CB  1 
ATOM   6093  C CG  . PRO F  3 98  ? -20.234 33.290  -6.662  1.00 110.29 ? 113 PRO Y CG  1 
ATOM   6094  C CD  . PRO F  3 98  ? -20.768 33.146  -8.045  1.00 107.02 ? 113 PRO Y CD  1 
ATOM   6095  N N   . GLU F  3 99  ? -24.343 34.297  -7.784  1.00 102.37 ? 114 GLU Y N   1 
ATOM   6096  C CA  . GLU F  3 99  ? -25.502 35.150  -8.029  1.00 103.57 ? 114 GLU Y CA  1 
ATOM   6097  C C   . GLU F  3 99  ? -26.642 34.385  -8.722  1.00 104.96 ? 114 GLU Y C   1 
ATOM   6098  O O   . GLU F  3 99  ? -27.571 35.016  -9.226  1.00 106.58 ? 114 GLU Y O   1 
ATOM   6099  C CB  . GLU F  3 99  ? -25.102 36.420  -8.803  1.00 111.92 ? 114 GLU Y CB  1 
ATOM   6100  C CG  . GLU F  3 99  ? -24.146 37.332  -8.053  1.00 123.73 ? 114 GLU Y CG  1 
ATOM   6101  C CD  . GLU F  3 99  ? -24.741 38.053  -6.862  1.00 135.06 ? 114 GLU Y CD  1 
ATOM   6102  O OE1 . GLU F  3 99  ? -25.255 39.178  -7.047  1.00 128.56 ? 114 GLU Y OE1 1 
ATOM   6103  O OE2 . GLU F  3 99  ? -24.682 37.499  -5.741  1.00 125.00 ? 114 GLU Y OE2 1 
ATOM   6104  N N   . ALA F  3 100 ? -26.596 33.024  -8.693  1.00 96.89  ? 115 ALA Y N   1 
ATOM   6105  C CA  . ALA F  3 100 ? -27.607 32.134  -9.283  1.00 93.10  ? 115 ALA Y CA  1 
ATOM   6106  C C   . ALA F  3 100 ? -28.841 32.042  -8.405  1.00 90.80  ? 115 ALA Y C   1 
ATOM   6107  O O   . ALA F  3 100 ? -29.960 32.045  -8.923  1.00 89.79  ? 115 ALA Y O   1 
ATOM   6108  C CB  . ALA F  3 100 ? -27.027 30.751  -9.494  1.00 90.88  ? 115 ALA Y CB  1 
ATOM   6109  N N   . PHE F  3 101 ? -28.638 31.950  -7.079  1.00 83.71  ? 116 PHE Y N   1 
ATOM   6110  C CA  . PHE F  3 101 ? -29.750 31.885  -6.139  1.00 80.36  ? 116 PHE Y CA  1 
ATOM   6111  C C   . PHE F  3 101 ? -30.087 33.260  -5.560  1.00 84.68  ? 116 PHE Y C   1 
ATOM   6112  O O   . PHE F  3 101 ? -29.363 33.767  -4.692  1.00 83.91  ? 116 PHE Y O   1 
ATOM   6113  C CB  . PHE F  3 101 ? -29.495 30.856  -5.032  1.00 77.61  ? 116 PHE Y CB  1 
ATOM   6114  C CG  . PHE F  3 101 ? -29.421 29.433  -5.508  1.00 76.34  ? 116 PHE Y CG  1 
ATOM   6115  C CD1 . PHE F  3 101 ? -30.576 28.702  -5.739  1.00 77.03  ? 116 PHE Y CD1 1 
ATOM   6116  C CD2 . PHE F  3 101 ? -28.194 28.813  -5.701  1.00 79.39  ? 116 PHE Y CD2 1 
ATOM   6117  C CE1 . PHE F  3 101 ? -30.507 27.372  -6.157  1.00 76.08  ? 116 PHE Y CE1 1 
ATOM   6118  C CE2 . PHE F  3 101 ? -28.124 27.485  -6.128  1.00 80.07  ? 116 PHE Y CE2 1 
ATOM   6119  C CZ  . PHE F  3 101 ? -29.285 26.769  -6.344  1.00 75.67  ? 116 PHE Y CZ  1 
ATOM   6120  N N   . GLN F  3 102 ? -31.194 33.854  -6.061  1.00 82.25  ? 117 GLN Y N   1 
ATOM   6121  C CA  . GLN F  3 102 ? -31.708 35.171  -5.662  1.00 84.65  ? 117 GLN Y CA  1 
ATOM   6122  C C   . GLN F  3 102 ? -32.881 35.058  -4.656  1.00 85.29  ? 117 GLN Y C   1 
ATOM   6123  O O   . GLN F  3 102 ? -33.036 34.007  -4.041  1.00 80.06  ? 117 GLN Y O   1 
ATOM   6124  C CB  . GLN F  3 102 ? -32.094 36.008  -6.899  1.00 90.58  ? 117 GLN Y CB  1 
ATOM   6125  C CG  . GLN F  3 102 ? -30.922 36.440  -7.783  1.00 98.68  ? 117 GLN Y CG  1 
ATOM   6126  C CD  . GLN F  3 102 ? -30.015 37.455  -7.135  1.00 115.30 ? 117 GLN Y CD  1 
ATOM   6127  O OE1 . GLN F  3 102 ? -30.455 38.369  -6.423  1.00 113.61 ? 117 GLN Y OE1 1 
ATOM   6128  N NE2 . GLN F  3 102 ? -28.722 37.327  -7.392  1.00 105.46 ? 117 GLN Y NE2 1 
ATOM   6129  N N   . ASN F  3 103 ? -33.687 36.131  -4.477  1.00 84.79  ? 118 ASN Y N   1 
ATOM   6130  C CA  . ASN F  3 103 ? -34.800 36.110  -3.531  1.00 82.62  ? 118 ASN Y CA  1 
ATOM   6131  C C   . ASN F  3 103 ? -35.921 35.205  -3.973  1.00 83.17  ? 118 ASN Y C   1 
ATOM   6132  O O   . ASN F  3 103 ? -36.651 35.501  -4.927  1.00 85.26  ? 118 ASN Y O   1 
ATOM   6133  C CB  . ASN F  3 103 ? -35.320 37.512  -3.182  1.00 89.07  ? 118 ASN Y CB  1 
ATOM   6134  C CG  . ASN F  3 103 ? -35.958 37.627  -1.806  1.00 111.21 ? 118 ASN Y CG  1 
ATOM   6135  O OD1 . ASN F  3 103 ? -35.636 38.533  -1.026  1.00 104.82 ? 118 ASN Y OD1 1 
ATOM   6136  N ND2 . ASN F  3 103 ? -36.882 36.729  -1.467  1.00 101.04 ? 118 ASN Y ND2 1 
ATOM   6137  N N   . LEU F  3 104 ? -36.033 34.086  -3.256  1.00 74.70  ? 119 LEU Y N   1 
ATOM   6138  C CA  . LEU F  3 104 ? -37.049 33.059  -3.436  1.00 71.95  ? 119 LEU Y CA  1 
ATOM   6139  C C   . LEU F  3 104 ? -37.750 32.950  -2.070  1.00 74.08  ? 119 LEU Y C   1 
ATOM   6140  O O   . LEU F  3 104 ? -37.274 32.222  -1.202  1.00 70.44  ? 119 LEU Y O   1 
ATOM   6141  C CB  . LEU F  3 104 ? -36.401 31.731  -3.886  1.00 69.02  ? 119 LEU Y CB  1 
ATOM   6142  C CG  . LEU F  3 104 ? -35.405 31.809  -5.074  1.00 75.84  ? 119 LEU Y CG  1 
ATOM   6143  C CD1 . LEU F  3 104 ? -34.495 30.600  -5.116  1.00 72.54  ? 119 LEU Y CD1 1 
ATOM   6144  C CD2 . LEU F  3 104 ? -36.118 32.029  -6.411  1.00 81.60  ? 119 LEU Y CD2 1 
ATOM   6145  N N   . PRO F  3 105 ? -38.796 33.783  -1.814  1.00 73.85  ? 120 PRO Y N   1 
ATOM   6146  C CA  . PRO F  3 105 ? -39.441 33.788  -0.480  1.00 72.48  ? 120 PRO Y CA  1 
ATOM   6147  C C   . PRO F  3 105 ? -40.211 32.523  -0.103  1.00 73.64  ? 120 PRO Y C   1 
ATOM   6148  O O   . PRO F  3 105 ? -40.532 32.319  1.071   1.00 71.55  ? 120 PRO Y O   1 
ATOM   6149  C CB  . PRO F  3 105 ? -40.405 34.978  -0.574  1.00 77.80  ? 120 PRO Y CB  1 
ATOM   6150  C CG  . PRO F  3 105 ? -40.742 35.065  -2.022  1.00 83.95  ? 120 PRO Y CG  1 
ATOM   6151  C CD  . PRO F  3 105 ? -39.447 34.763  -2.715  1.00 79.17  ? 120 PRO Y CD  1 
ATOM   6152  N N   . ASN F  3 106 ? -40.567 31.716  -1.110  1.00 69.71  ? 121 ASN Y N   1 
ATOM   6153  C CA  . ASN F  3 106 ? -41.358 30.514  -0.924  1.00 66.80  ? 121 ASN Y CA  1 
ATOM   6154  C C   . ASN F  3 106 ? -40.558 29.239  -1.000  1.00 64.23  ? 121 ASN Y C   1 
ATOM   6155  O O   . ASN F  3 106 ? -41.149 28.174  -0.889  1.00 62.25  ? 121 ASN Y O   1 
ATOM   6156  C CB  . ASN F  3 106 ? -42.523 30.484  -1.911  1.00 73.57  ? 121 ASN Y CB  1 
ATOM   6157  C CG  . ASN F  3 106 ? -43.822 30.083  -1.266  1.00 105.97 ? 121 ASN Y CG  1 
ATOM   6158  O OD1 . ASN F  3 106 ? -44.043 28.912  -0.911  1.00 101.98 ? 121 ASN Y OD1 1 
ATOM   6159  N ND2 . ASN F  3 106 ? -44.705 31.058  -1.088  1.00 99.68  ? 121 ASN Y ND2 1 
ATOM   6160  N N   . LEU F  3 107 ? -39.228 29.327  -1.158  1.00 58.66  ? 122 LEU Y N   1 
ATOM   6161  C CA  . LEU F  3 107 ? -38.372 28.145  -1.228  1.00 55.13  ? 122 LEU Y CA  1 
ATOM   6162  C C   . LEU F  3 107 ? -38.459 27.309  0.082   1.00 59.73  ? 122 LEU Y C   1 
ATOM   6163  O O   . LEU F  3 107 ? -38.450 27.867  1.178   1.00 60.74  ? 122 LEU Y O   1 
ATOM   6164  C CB  . LEU F  3 107 ? -36.924 28.538  -1.583  1.00 54.63  ? 122 LEU Y CB  1 
ATOM   6165  C CG  . LEU F  3 107 ? -35.943 27.388  -1.907  1.00 55.29  ? 122 LEU Y CG  1 
ATOM   6166  C CD1 . LEU F  3 107 ? -36.156 26.847  -3.304  1.00 55.55  ? 122 LEU Y CD1 1 
ATOM   6167  C CD2 . LEU F  3 107 ? -34.510 27.833  -1.756  1.00 55.98  ? 122 LEU Y CD2 1 
ATOM   6168  N N   . GLN F  3 108 ? -38.637 25.991  -0.045  1.00 54.84  ? 123 GLN Y N   1 
ATOM   6169  C CA  . GLN F  3 108 ? -38.748 25.085  1.104   1.00 52.56  ? 123 GLN Y CA  1 
ATOM   6170  C C   . GLN F  3 108 ? -37.722 23.989  1.023   1.00 53.87  ? 123 GLN Y C   1 
ATOM   6171  O O   . GLN F  3 108 ? -37.354 23.417  2.054   1.00 50.44  ? 123 GLN Y O   1 
ATOM   6172  C CB  . GLN F  3 108 ? -40.121 24.404  1.127   1.00 53.85  ? 123 GLN Y CB  1 
ATOM   6173  C CG  . GLN F  3 108 ? -41.253 25.250  1.666   1.00 66.46  ? 123 GLN Y CG  1 
ATOM   6174  C CD  . GLN F  3 108 ? -42.566 24.681  1.195   1.00 80.79  ? 123 GLN Y CD  1 
ATOM   6175  O OE1 . GLN F  3 108 ? -42.821 23.467  1.282   1.00 77.51  ? 123 GLN Y OE1 1 
ATOM   6176  N NE2 . GLN F  3 108 ? -43.397 25.531  0.613   1.00 65.44  ? 123 GLN Y NE2 1 
ATOM   6177  N N   . TYR F  3 109 ? -37.332 23.638  -0.217  1.00 51.87  ? 124 TYR Y N   1 
ATOM   6178  C CA  . TYR F  3 109 ? -36.432 22.541  -0.491  1.00 50.70  ? 124 TYR Y CA  1 
ATOM   6179  C C   . TYR F  3 109 ? -35.502 22.836  -1.646  1.00 55.67  ? 124 TYR Y C   1 
ATOM   6180  O O   . TYR F  3 109 ? -35.958 23.146  -2.748  1.00 56.62  ? 124 TYR Y O   1 
ATOM   6181  C CB  . TYR F  3 109 ? -37.273 21.278  -0.766  1.00 52.21  ? 124 TYR Y CB  1 
ATOM   6182  C CG  . TYR F  3 109 ? -36.525 19.970  -0.937  1.00 54.14  ? 124 TYR Y CG  1 
ATOM   6183  C CD1 . TYR F  3 109 ? -35.721 19.464  0.084   1.00 54.97  ? 124 TYR Y CD1 1 
ATOM   6184  C CD2 . TYR F  3 109 ? -36.726 19.173  -2.061  1.00 56.15  ? 124 TYR Y CD2 1 
ATOM   6185  C CE1 . TYR F  3 109 ? -35.075 18.232  -0.043  1.00 55.72  ? 124 TYR Y CE1 1 
ATOM   6186  C CE2 . TYR F  3 109 ? -36.118 17.921  -2.184  1.00 56.64  ? 124 TYR Y CE2 1 
ATOM   6187  C CZ  . TYR F  3 109 ? -35.276 17.462  -1.180  1.00 63.58  ? 124 TYR Y CZ  1 
ATOM   6188  O OH  . TYR F  3 109 ? -34.649 16.243  -1.306  1.00 60.38  ? 124 TYR Y OH  1 
ATOM   6189  N N   . LEU F  3 110 ? -34.191 22.744  -1.383  1.00 52.84  ? 125 LEU Y N   1 
ATOM   6190  C CA  . LEU F  3 110 ? -33.143 22.875  -2.389  1.00 55.06  ? 125 LEU Y CA  1 
ATOM   6191  C C   . LEU F  3 110 ? -32.265 21.619  -2.346  1.00 57.90  ? 125 LEU Y C   1 
ATOM   6192  O O   . LEU F  3 110 ? -31.430 21.464  -1.451  1.00 58.46  ? 125 LEU Y O   1 
ATOM   6193  C CB  . LEU F  3 110 ? -32.309 24.173  -2.259  1.00 57.49  ? 125 LEU Y CB  1 
ATOM   6194  C CG  . LEU F  3 110 ? -31.059 24.298  -3.168  1.00 64.69  ? 125 LEU Y CG  1 
ATOM   6195  C CD1 . LEU F  3 110 ? -31.420 24.209  -4.648  1.00 67.51  ? 125 LEU Y CD1 1 
ATOM   6196  C CD2 . LEU F  3 110 ? -30.314 25.584  -2.903  1.00 69.28  ? 125 LEU Y CD2 1 
ATOM   6197  N N   . LEU F  3 111 ? -32.482 20.718  -3.300  1.00 52.25  ? 126 LEU Y N   1 
ATOM   6198  C CA  . LEU F  3 111 ? -31.711 19.500  -3.387  1.00 50.20  ? 126 LEU Y CA  1 
ATOM   6199  C C   . LEU F  3 111 ? -30.627 19.601  -4.483  1.00 56.00  ? 126 LEU Y C   1 
ATOM   6200  O O   . LEU F  3 111 ? -30.928 19.942  -5.632  1.00 58.38  ? 126 LEU Y O   1 
ATOM   6201  C CB  . LEU F  3 111 ? -32.630 18.286  -3.600  1.00 49.27  ? 126 LEU Y CB  1 
ATOM   6202  C CG  . LEU F  3 111 ? -31.937 16.972  -3.956  1.00 53.46  ? 126 LEU Y CG  1 
ATOM   6203  C CD1 . LEU F  3 111 ? -31.584 16.187  -2.732  1.00 51.86  ? 126 LEU Y CD1 1 
ATOM   6204  C CD2 . LEU F  3 111 ? -32.782 16.146  -4.854  1.00 56.05  ? 126 LEU Y CD2 1 
ATOM   6205  N N   . ILE F  3 112 ? -29.359 19.342  -4.087  1.00 49.71  ? 127 ILE Y N   1 
ATOM   6206  C CA  . ILE F  3 112 ? -28.182 19.274  -4.945  1.00 49.71  ? 127 ILE Y CA  1 
ATOM   6207  C C   . ILE F  3 112 ? -27.516 17.945  -4.615  1.00 52.29  ? 127 ILE Y C   1 
ATOM   6208  O O   . ILE F  3 112 ? -26.878 17.798  -3.568  1.00 49.16  ? 127 ILE Y O   1 
ATOM   6209  C CB  . ILE F  3 112 ? -27.190 20.456  -4.851  1.00 53.90  ? 127 ILE Y CB  1 
ATOM   6210  C CG1 . ILE F  3 112 ? -27.902 21.821  -4.833  1.00 55.43  ? 127 ILE Y CG1 1 
ATOM   6211  C CG2 . ILE F  3 112 ? -26.187 20.358  -6.007  1.00 57.46  ? 127 ILE Y CG2 1 
ATOM   6212  C CD1 . ILE F  3 112 ? -27.011 23.063  -4.576  1.00 57.05  ? 127 ILE Y CD1 1 
ATOM   6213  N N   . SER F  3 113 ? -27.709 16.964  -5.489  1.00 50.82  ? 128 SER Y N   1 
ATOM   6214  C CA  . SER F  3 113 ? -27.150 15.647  -5.281  1.00 50.16  ? 128 SER Y CA  1 
ATOM   6215  C C   . SER F  3 113 ? -26.471 15.131  -6.513  1.00 56.91  ? 128 SER Y C   1 
ATOM   6216  O O   . SER F  3 113 ? -26.934 15.385  -7.626  1.00 59.18  ? 128 SER Y O   1 
ATOM   6217  C CB  . SER F  3 113 ? -28.227 14.672  -4.808  1.00 53.53  ? 128 SER Y CB  1 
ATOM   6218  O OG  . SER F  3 113 ? -29.009 14.170  -5.879  1.00 67.53  ? 128 SER Y OG  1 
ATOM   6219  N N   . ASN F  3 114 ? -25.387 14.370  -6.307  1.00 53.53  ? 129 ASN Y N   1 
ATOM   6220  C CA  . ASN F  3 114 ? -24.586 13.729  -7.342  1.00 55.32  ? 129 ASN Y CA  1 
ATOM   6221  C C   . ASN F  3 114 ? -24.139 14.696  -8.431  1.00 65.22  ? 129 ASN Y C   1 
ATOM   6222  O O   . ASN F  3 114 ? -24.491 14.536  -9.599  1.00 67.77  ? 129 ASN Y O   1 
ATOM   6223  C CB  . ASN F  3 114 ? -25.290 12.507  -7.915  1.00 51.15  ? 129 ASN Y CB  1 
ATOM   6224  C CG  . ASN F  3 114 ? -24.429 11.280  -7.923  1.00 63.83  ? 129 ASN Y CG  1 
ATOM   6225  O OD1 . ASN F  3 114 ? -23.203 11.351  -8.025  1.00 53.75  ? 129 ASN Y OD1 1 
ATOM   6226  N ND2 . ASN F  3 114 ? -25.057 10.119  -7.826  1.00 56.33  ? 129 ASN Y ND2 1 
ATOM   6227  N N   . THR F  3 115 ? -23.399 15.740  -8.018  1.00 63.71  ? 130 THR Y N   1 
ATOM   6228  C CA  . THR F  3 115 ? -22.810 16.757  -8.897  1.00 67.61  ? 130 THR Y CA  1 
ATOM   6229  C C   . THR F  3 115 ? -21.313 16.946  -8.544  1.00 72.09  ? 130 THR Y C   1 
ATOM   6230  O O   . THR F  3 115 ? -20.847 16.497  -7.491  1.00 69.11  ? 130 THR Y O   1 
ATOM   6231  C CB  . THR F  3 115 ? -23.606 18.094  -8.888  1.00 81.16  ? 130 THR Y CB  1 
ATOM   6232  O OG1 . THR F  3 115 ? -23.113 18.953  -7.860  1.00 82.31  ? 130 THR Y OG1 1 
ATOM   6233  C CG2 . THR F  3 115 ? -25.127 17.914  -8.769  1.00 78.71  ? 130 THR Y CG2 1 
ATOM   6234  N N   . GLY F  3 116 ? -20.582 17.615  -9.416  1.00 72.59  ? 131 GLY Y N   1 
ATOM   6235  C CA  . GLY F  3 116 ? -19.176 17.868  -9.162  1.00 75.18  ? 131 GLY Y CA  1 
ATOM   6236  C C   . GLY F  3 116 ? -18.924 19.262  -8.650  1.00 81.00  ? 131 GLY Y C   1 
ATOM   6237  O O   . GLY F  3 116 ? -17.831 19.797  -8.873  1.00 85.16  ? 131 GLY Y O   1 
ATOM   6238  N N   . ILE F  3 117 ? -19.944 19.882  -8.000  1.00 73.89  ? 132 ILE Y N   1 
ATOM   6239  C CA  . ILE F  3 117 ? -19.795 21.242  -7.478  1.00 75.08  ? 132 ILE Y CA  1 
ATOM   6240  C C   . ILE F  3 117 ? -18.682 21.222  -6.418  1.00 79.23  ? 132 ILE Y C   1 
ATOM   6241  O O   . ILE F  3 117 ? -18.637 20.307  -5.587  1.00 76.68  ? 132 ILE Y O   1 
ATOM   6242  C CB  . ILE F  3 117 ? -21.118 21.967  -7.056  1.00 75.66  ? 132 ILE Y CB  1 
ATOM   6243  C CG1 . ILE F  3 117 ? -21.819 21.318  -5.849  1.00 70.11  ? 132 ILE Y CG1 1 
ATOM   6244  C CG2 . ILE F  3 117 ? -22.078 22.101  -8.254  1.00 77.86  ? 132 ILE Y CG2 1 
ATOM   6245  C CD1 . ILE F  3 117 ? -22.930 22.219  -5.170  1.00 65.98  ? 132 ILE Y CD1 1 
ATOM   6246  N N   . LYS F  3 118 ? -17.698 22.122  -6.590  1.00 78.41  ? 133 LYS Y N   1 
ATOM   6247  C CA  . LYS F  3 118 ? -16.466 22.200  -5.793  1.00 79.33  ? 133 LYS Y CA  1 
ATOM   6248  C C   . LYS F  3 118 ? -16.624 22.911  -4.447  1.00 80.89  ? 133 LYS Y C   1 
ATOM   6249  O O   . LYS F  3 118 ? -15.760 22.802  -3.560  1.00 80.35  ? 133 LYS Y O   1 
ATOM   6250  C CB  . LYS F  3 118 ? -15.340 22.857  -6.629  1.00 87.01  ? 133 LYS Y CB  1 
ATOM   6251  C CG  . LYS F  3 118 ? -14.918 22.068  -7.873  1.00 96.88  ? 133 LYS Y CG  1 
ATOM   6252  C CD  . LYS F  3 118 ? -13.812 21.047  -7.566  1.00 107.64 ? 133 LYS Y CD  1 
ATOM   6253  C CE  . LYS F  3 118 ? -13.324 20.287  -8.780  1.00 119.60 ? 133 LYS Y CE  1 
ATOM   6254  N NZ  . LYS F  3 118 ? -12.397 21.099  -9.613  1.00 135.38 ? 133 LYS Y NZ  1 
ATOM   6255  N N   . HIS F  3 119 ? -17.707 23.674  -4.325  1.00 75.96  ? 134 HIS Y N   1 
ATOM   6256  C CA  . HIS F  3 119 ? -18.026 24.488  -3.160  1.00 75.11  ? 134 HIS Y CA  1 
ATOM   6257  C C   . HIS F  3 119 ? -19.516 24.381  -2.902  1.00 72.74  ? 134 HIS Y C   1 
ATOM   6258  O O   . HIS F  3 119 ? -20.243 23.838  -3.737  1.00 70.74  ? 134 HIS Y O   1 
ATOM   6259  C CB  . HIS F  3 119 ? -17.646 25.965  -3.429  1.00 81.18  ? 134 HIS Y CB  1 
ATOM   6260  C CG  . HIS F  3 119 ? -16.178 26.205  -3.657  1.00 89.76  ? 134 HIS Y CG  1 
ATOM   6261  N ND1 . HIS F  3 119 ? -15.540 25.775  -4.816  1.00 94.44  ? 134 HIS Y ND1 1 
ATOM   6262  C CD2 . HIS F  3 119 ? -15.278 26.863  -2.888  1.00 94.61  ? 134 HIS Y CD2 1 
ATOM   6263  C CE1 . HIS F  3 119 ? -14.275 26.154  -4.698  1.00 98.29  ? 134 HIS Y CE1 1 
ATOM   6264  N NE2 . HIS F  3 119 ? -14.066 26.808  -3.555  1.00 98.96  ? 134 HIS Y NE2 1 
ATOM   6265  N N   . LEU F  3 120 ? -19.971 24.895  -1.748  1.00 65.76  ? 135 LEU Y N   1 
ATOM   6266  C CA  . LEU F  3 120 ? -21.383 24.889  -1.378  1.00 61.10  ? 135 LEU Y CA  1 
ATOM   6267  C C   . LEU F  3 120 ? -22.127 25.960  -2.207  1.00 66.96  ? 135 LEU Y C   1 
ATOM   6268  O O   . LEU F  3 120 ? -21.453 26.851  -2.746  1.00 71.78  ? 135 LEU Y O   1 
ATOM   6269  C CB  . LEU F  3 120 ? -21.532 25.185  0.133   1.00 59.17  ? 135 LEU Y CB  1 
ATOM   6270  C CG  . LEU F  3 120 ? -21.254 24.039  1.111   1.00 59.63  ? 135 LEU Y CG  1 
ATOM   6271  C CD1 . LEU F  3 120 ? -21.442 24.494  2.521   1.00 59.27  ? 135 LEU Y CD1 1 
ATOM   6272  C CD2 . LEU F  3 120 ? -22.174 22.862  0.878   1.00 56.31  ? 135 LEU Y CD2 1 
ATOM   6273  N N   . PRO F  3 121 ? -23.485 25.922  -2.336  1.00 59.26  ? 136 PRO Y N   1 
ATOM   6274  C CA  . PRO F  3 121 ? -24.166 26.982  -3.101  1.00 61.41  ? 136 PRO Y CA  1 
ATOM   6275  C C   . PRO F  3 121 ? -24.219 28.294  -2.319  1.00 68.11  ? 136 PRO Y C   1 
ATOM   6276  O O   . PRO F  3 121 ? -24.179 28.264  -1.081  1.00 66.56  ? 136 PRO Y O   1 
ATOM   6277  C CB  . PRO F  3 121 ? -25.561 26.405  -3.342  1.00 59.74  ? 136 PRO Y CB  1 
ATOM   6278  C CG  . PRO F  3 121 ? -25.786 25.505  -2.206  1.00 60.21  ? 136 PRO Y CG  1 
ATOM   6279  C CD  . PRO F  3 121 ? -24.455 24.951  -1.793  1.00 55.81  ? 136 PRO Y CD  1 
ATOM   6280  N N   . ASP F  3 122 ? -24.292 29.431  -3.027  1.00 68.76  ? 137 ASP Y N   1 
ATOM   6281  C CA  . ASP F  3 122 ? -24.353 30.733  -2.362  1.00 72.77  ? 137 ASP Y CA  1 
ATOM   6282  C C   . ASP F  3 122 ? -25.793 31.052  -2.061  1.00 77.01  ? 137 ASP Y C   1 
ATOM   6283  O O   . ASP F  3 122 ? -26.513 31.552  -2.939  1.00 79.66  ? 137 ASP Y O   1 
ATOM   6284  C CB  . ASP F  3 122 ? -23.701 31.850  -3.205  1.00 80.81  ? 137 ASP Y CB  1 
ATOM   6285  C CG  . ASP F  3 122 ? -23.604 33.182  -2.486  1.00 94.03  ? 137 ASP Y CG  1 
ATOM   6286  O OD1 . ASP F  3 122 ? -24.668 33.747  -2.135  1.00 93.27  ? 137 ASP Y OD1 1 
ATOM   6287  O OD2 . ASP F  3 122 ? -22.463 33.673  -2.291  1.00 104.85 ? 137 ASP Y OD2 1 
ATOM   6288  N N   . VAL F  3 123 ? -26.193 30.830  -0.802  1.00 70.53  ? 138 VAL Y N   1 
ATOM   6289  C CA  . VAL F  3 123 ? -27.585 30.993  -0.367  1.00 68.53  ? 138 VAL Y CA  1 
ATOM   6290  C C   . VAL F  3 123 ? -27.934 32.326  0.369   1.00 75.29  ? 138 VAL Y C   1 
ATOM   6291  O O   . VAL F  3 123 ? -29.110 32.541  0.659   1.00 73.91  ? 138 VAL Y O   1 
ATOM   6292  C CB  . VAL F  3 123 ? -28.009 29.769  0.490   1.00 67.04  ? 138 VAL Y CB  1 
ATOM   6293  C CG1 . VAL F  3 123 ? -27.846 28.474  -0.297  1.00 64.32  ? 138 VAL Y CG1 1 
ATOM   6294  C CG2 . VAL F  3 123 ? -27.233 29.707  1.805   1.00 66.35  ? 138 VAL Y CG2 1 
ATOM   6295  N N   . HIS F  3 124 ? -26.955 33.207  0.643   1.00 75.65  ? 139 HIS Y N   1 
ATOM   6296  C CA  . HIS F  3 124 ? -27.160 34.417  1.439   1.00 78.74  ? 139 HIS Y CA  1 
ATOM   6297  C C   . HIS F  3 124 ? -28.226 35.423  0.897   1.00 84.34  ? 139 HIS Y C   1 
ATOM   6298  O O   . HIS F  3 124 ? -28.623 36.336  1.631   1.00 85.47  ? 139 HIS Y O   1 
ATOM   6299  C CB  . HIS F  3 124 ? -25.817 35.120  1.726   1.00 84.27  ? 139 HIS Y CB  1 
ATOM   6300  C CG  . HIS F  3 124 ? -25.253 35.983  0.629   1.00 92.84  ? 139 HIS Y CG  1 
ATOM   6301  N ND1 . HIS F  3 124 ? -24.109 35.615  -0.061  1.00 95.99  ? 139 HIS Y ND1 1 
ATOM   6302  C CD2 . HIS F  3 124 ? -25.617 37.222  0.229   1.00 98.54  ? 139 HIS Y CD2 1 
ATOM   6303  C CE1 . HIS F  3 124 ? -23.864 36.605  -0.903  1.00 100.05 ? 139 HIS Y CE1 1 
ATOM   6304  N NE2 . HIS F  3 124 ? -24.750 37.587  -0.771  1.00 102.28 ? 139 HIS Y NE2 1 
ATOM   6305  N N   . LYS F  3 125 ? -28.723 35.217  -0.332  1.00 80.33  ? 140 LYS Y N   1 
ATOM   6306  C CA  . LYS F  3 125 ? -29.712 36.098  -0.960  1.00 82.07  ? 140 LYS Y CA  1 
ATOM   6307  C C   . LYS F  3 125 ? -31.105 35.466  -1.136  1.00 82.16  ? 140 LYS Y C   1 
ATOM   6308  O O   . LYS F  3 125 ? -31.991 36.106  -1.700  1.00 83.94  ? 140 LYS Y O   1 
ATOM   6309  C CB  . LYS F  3 125 ? -29.165 36.617  -2.307  1.00 88.10  ? 140 LYS Y CB  1 
ATOM   6310  C CG  . LYS F  3 125 ? -28.111 37.707  -2.154  1.00 102.83 ? 140 LYS Y CG  1 
ATOM   6311  C CD  . LYS F  3 125 ? -27.234 37.878  -3.395  1.00 111.87 ? 140 LYS Y CD  1 
ATOM   6312  C CE  . LYS F  3 125 ? -26.780 39.315  -3.617  1.00 117.75 ? 140 LYS Y CE  1 
ATOM   6313  N NZ  . LYS F  3 125 ? -25.756 39.777  -2.632  1.00 118.69 ? 140 LYS Y NZ  1 
ATOM   6314  N N   . ILE F  3 126 ? -31.310 34.228  -0.661  1.00 74.11  ? 141 ILE Y N   1 
ATOM   6315  C CA  . ILE F  3 126 ? -32.601 33.546  -0.823  1.00 71.22  ? 141 ILE Y CA  1 
ATOM   6316  C C   . ILE F  3 126 ? -33.667 34.205  0.044   1.00 74.25  ? 141 ILE Y C   1 
ATOM   6317  O O   . ILE F  3 126 ? -34.707 34.600  -0.480  1.00 74.78  ? 141 ILE Y O   1 
ATOM   6318  C CB  . ILE F  3 126 ? -32.513 31.998  -0.644  1.00 69.85  ? 141 ILE Y CB  1 
ATOM   6319  C CG1 . ILE F  3 126 ? -31.661 31.361  -1.798  1.00 69.81  ? 141 ILE Y CG1 1 
ATOM   6320  C CG2 . ILE F  3 126 ? -33.931 31.375  -0.572  1.00 68.35  ? 141 ILE Y CG2 1 
ATOM   6321  C CD1 . ILE F  3 126 ? -31.229 29.872  -1.623  1.00 69.53  ? 141 ILE Y CD1 1 
ATOM   6322  N N   . HIS F  3 127 ? -33.374 34.356  1.353   1.00 70.03  ? 142 HIS Y N   1 
ATOM   6323  C CA  . HIS F  3 127 ? -34.218 34.994  2.365   1.00 70.54  ? 142 HIS Y CA  1 
ATOM   6324  C C   . HIS F  3 127 ? -35.648 34.494  2.372   1.00 71.49  ? 142 HIS Y C   1 
ATOM   6325  O O   . HIS F  3 127 ? -36.579 35.298  2.434   1.00 74.22  ? 142 HIS Y O   1 
ATOM   6326  C CB  . HIS F  3 127 ? -34.164 36.514  2.213   1.00 76.61  ? 142 HIS Y CB  1 
ATOM   6327  C CG  . HIS F  3 127 ? -32.857 37.121  2.597   1.00 82.52  ? 142 HIS Y CG  1 
ATOM   6328  N ND1 . HIS F  3 127 ? -32.342 36.979  3.877   1.00 83.57  ? 142 HIS Y ND1 1 
ATOM   6329  C CD2 . HIS F  3 127 ? -32.029 37.909  1.875   1.00 87.77  ? 142 HIS Y CD2 1 
ATOM   6330  C CE1 . HIS F  3 127 ? -31.221 37.683  3.887   1.00 86.17  ? 142 HIS Y CE1 1 
ATOM   6331  N NE2 . HIS F  3 127 ? -30.986 38.249  2.702   1.00 89.15  ? 142 HIS Y NE2 1 
ATOM   6332  N N   . SER F  3 128 ? -35.821 33.165  2.291   1.00 63.25  ? 143 SER Y N   1 
ATOM   6333  C CA  . SER F  3 128 ? -37.124 32.509  2.268   1.00 61.55  ? 143 SER Y CA  1 
ATOM   6334  C C   . SER F  3 128 ? -37.887 32.759  3.558   1.00 66.92  ? 143 SER Y C   1 
ATOM   6335  O O   . SER F  3 128 ? -37.277 32.816  4.632   1.00 67.51  ? 143 SER Y O   1 
ATOM   6336  C CB  . SER F  3 128 ? -36.962 31.006  2.047   1.00 60.94  ? 143 SER Y CB  1 
ATOM   6337  O OG  . SER F  3 128 ? -38.208 30.325  2.083   1.00 66.95  ? 143 SER Y OG  1 
ATOM   6338  N N   . LEU F  3 129 ? -39.221 32.896  3.451   1.00 63.22  ? 144 LEU Y N   1 
ATOM   6339  C CA  . LEU F  3 129 ? -40.108 33.103  4.600   1.00 62.88  ? 144 LEU Y CA  1 
ATOM   6340  C C   . LEU F  3 129 ? -40.524 31.774  5.217   1.00 62.36  ? 144 LEU Y C   1 
ATOM   6341  O O   . LEU F  3 129 ? -41.155 31.743  6.281   1.00 61.64  ? 144 LEU Y O   1 
ATOM   6342  C CB  . LEU F  3 129 ? -41.367 33.863  4.175   1.00 65.66  ? 144 LEU Y CB  1 
ATOM   6343  C CG  . LEU F  3 129 ? -41.208 35.195  3.467   1.00 72.84  ? 144 LEU Y CG  1 
ATOM   6344  C CD1 . LEU F  3 129 ? -42.567 35.837  3.268   1.00 75.20  ? 144 LEU Y CD1 1 
ATOM   6345  C CD2 . LEU F  3 129 ? -40.267 36.114  4.221   1.00 76.17  ? 144 LEU Y CD2 1 
ATOM   6346  N N   . GLN F  3 130 ? -40.170 30.684  4.524   1.00 56.06  ? 145 GLN Y N   1 
ATOM   6347  C CA  . GLN F  3 130 ? -40.500 29.308  4.847   1.00 52.96  ? 145 GLN Y CA  1 
ATOM   6348  C C   . GLN F  3 130 ? -39.337 28.623  5.516   1.00 55.66  ? 145 GLN Y C   1 
ATOM   6349  O O   . GLN F  3 130 ? -38.193 29.042  5.321   1.00 56.69  ? 145 GLN Y O   1 
ATOM   6350  C CB  . GLN F  3 130 ? -40.813 28.564  3.533   1.00 53.26  ? 145 GLN Y CB  1 
ATOM   6351  C CG  . GLN F  3 130 ? -41.978 29.133  2.706   1.00 67.79  ? 145 GLN Y CG  1 
ATOM   6352  C CD  . GLN F  3 130 ? -43.281 29.218  3.467   1.00 93.38  ? 145 GLN Y CD  1 
ATOM   6353  O OE1 . GLN F  3 130 ? -43.752 28.247  4.082   1.00 87.62  ? 145 GLN Y OE1 1 
ATOM   6354  N NE2 . GLN F  3 130 ? -43.878 30.400  3.461   1.00 94.03  ? 145 GLN Y NE2 1 
ATOM   6355  N N   . LYS F  3 131 ? -39.611 27.538  6.272   1.00 49.39  ? 146 LYS Y N   1 
ATOM   6356  C CA  . LYS F  3 131 ? -38.543 26.705  6.839   1.00 46.41  ? 146 LYS Y CA  1 
ATOM   6357  C C   . LYS F  3 131 ? -37.904 26.017  5.638   1.00 52.81  ? 146 LYS Y C   1 
ATOM   6358  O O   . LYS F  3 131 ? -38.629 25.561  4.757   1.00 54.55  ? 146 LYS Y O   1 
ATOM   6359  C CB  . LYS F  3 131 ? -39.068 25.666  7.855   1.00 44.40  ? 146 LYS Y CB  1 
ATOM   6360  C CG  . LYS F  3 131 ? -39.315 26.289  9.222   1.00 40.25  ? 146 LYS Y CG  1 
ATOM   6361  C CD  . LYS F  3 131 ? -39.664 25.304  10.303  1.00 36.54  ? 146 LYS Y CD  1 
ATOM   6362  C CE  . LYS F  3 131 ? -40.190 26.011  11.533  1.00 53.35  ? 146 LYS Y CE  1 
ATOM   6363  N NZ  . LYS F  3 131 ? -40.978 25.104  12.415  1.00 74.51  ? 146 LYS Y NZ  1 
ATOM   6364  N N   . VAL F  3 132 ? -36.569 26.027  5.546   1.00 49.12  ? 147 VAL Y N   1 
ATOM   6365  C CA  . VAL F  3 132 ? -35.868 25.456  4.398   1.00 47.72  ? 147 VAL Y CA  1 
ATOM   6366  C C   . VAL F  3 132 ? -35.100 24.176  4.745   1.00 50.57  ? 147 VAL Y C   1 
ATOM   6367  O O   . VAL F  3 132 ? -34.433 24.108  5.783   1.00 50.01  ? 147 VAL Y O   1 
ATOM   6368  C CB  . VAL F  3 132 ? -34.968 26.537  3.743   1.00 52.64  ? 147 VAL Y CB  1 
ATOM   6369  C CG1 . VAL F  3 132 ? -34.136 25.987  2.587   1.00 51.22  ? 147 VAL Y CG1 1 
ATOM   6370  C CG2 . VAL F  3 132 ? -35.815 27.704  3.273   1.00 55.19  ? 147 VAL Y CG2 1 
ATOM   6371  N N   . LEU F  3 133 ? -35.226 23.157  3.872   1.00 46.01  ? 148 LEU Y N   1 
ATOM   6372  C CA  . LEU F  3 133 ? -34.476 21.905  3.942   1.00 43.56  ? 148 LEU Y CA  1 
ATOM   6373  C C   . LEU F  3 133 ? -33.453 21.968  2.805   1.00 51.00  ? 148 LEU Y C   1 
ATOM   6374  O O   . LEU F  3 133 ? -33.816 21.886  1.624   1.00 51.96  ? 148 LEU Y O   1 
ATOM   6375  C CB  . LEU F  3 133 ? -35.372 20.636  3.853   1.00 41.50  ? 148 LEU Y CB  1 
ATOM   6376  C CG  . LEU F  3 133 ? -34.703 19.270  3.540   1.00 43.14  ? 148 LEU Y CG  1 
ATOM   6377  C CD1 . LEU F  3 133 ? -33.580 18.940  4.484   1.00 42.82  ? 148 LEU Y CD1 1 
ATOM   6378  C CD2 . LEU F  3 133 ? -35.689 18.161  3.597   1.00 42.62  ? 148 LEU Y CD2 1 
ATOM   6379  N N   . LEU F  3 134 ? -32.185 22.204  3.170   1.00 47.95  ? 149 LEU Y N   1 
ATOM   6380  C CA  . LEU F  3 134 ? -31.099 22.253  2.216   1.00 47.59  ? 149 LEU Y CA  1 
ATOM   6381  C C   . LEU F  3 134 ? -30.517 20.846  2.238   1.00 48.82  ? 149 LEU Y C   1 
ATOM   6382  O O   . LEU F  3 134 ? -29.987 20.409  3.263   1.00 47.72  ? 149 LEU Y O   1 
ATOM   6383  C CB  . LEU F  3 134 ? -30.073 23.310  2.621   1.00 49.38  ? 149 LEU Y CB  1 
ATOM   6384  C CG  . LEU F  3 134 ? -28.959 23.611  1.611   1.00 56.51  ? 149 LEU Y CG  1 
ATOM   6385  C CD1 . LEU F  3 134 ? -29.507 24.190  0.321   1.00 58.88  ? 149 LEU Y CD1 1 
ATOM   6386  C CD2 . LEU F  3 134 ? -27.930 24.575  2.182   1.00 60.24  ? 149 LEU Y CD2 1 
ATOM   6387  N N   . ASP F  3 135 ? -30.698 20.116  1.131   1.00 44.42  ? 150 ASP Y N   1 
ATOM   6388  C CA  . ASP F  3 135 ? -30.258 18.740  0.983   1.00 43.43  ? 150 ASP Y CA  1 
ATOM   6389  C C   . ASP F  3 135 ? -29.131 18.648  -0.045  1.00 49.90  ? 150 ASP Y C   1 
ATOM   6390  O O   . ASP F  3 135 ? -29.380 18.728  -1.249  1.00 50.99  ? 150 ASP Y O   1 
ATOM   6391  C CB  . ASP F  3 135 ? -31.463 17.870  0.591   1.00 44.49  ? 150 ASP Y CB  1 
ATOM   6392  C CG  . ASP F  3 135 ? -31.301 16.383  0.792   1.00 48.51  ? 150 ASP Y CG  1 
ATOM   6393  O OD1 . ASP F  3 135 ? -30.150 15.932  0.977   1.00 49.57  ? 150 ASP Y OD1 1 
ATOM   6394  O OD2 . ASP F  3 135 ? -32.324 15.661  0.724   1.00 49.34  ? 150 ASP Y OD2 1 
ATOM   6395  N N   . ILE F  3 136 ? -27.885 18.511  0.441   1.00 46.96  ? 151 ILE Y N   1 
ATOM   6396  C CA  . ILE F  3 136 ? -26.669 18.440  -0.379  1.00 48.87  ? 151 ILE Y CA  1 
ATOM   6397  C C   . ILE F  3 136 ? -25.872 17.162  -0.064  1.00 54.66  ? 151 ILE Y C   1 
ATOM   6398  O O   . ILE F  3 136 ? -25.154 17.106  0.939   1.00 55.23  ? 151 ILE Y O   1 
ATOM   6399  C CB  . ILE F  3 136 ? -25.819 19.742  -0.246  1.00 53.89  ? 151 ILE Y CB  1 
ATOM   6400  C CG1 . ILE F  3 136 ? -26.635 20.985  -0.679  1.00 55.01  ? 151 ILE Y CG1 1 
ATOM   6401  C CG2 . ILE F  3 136 ? -24.474 19.637  -1.012  1.00 55.84  ? 151 ILE Y CG2 1 
ATOM   6402  C CD1 . ILE F  3 136 ? -26.197 22.191  -0.096  1.00 61.60  ? 151 ILE Y CD1 1 
ATOM   6403  N N   . GLN F  3 137 ? -26.015 16.131  -0.916  1.00 50.96  ? 152 GLN Y N   1 
ATOM   6404  C CA  . GLN F  3 137 ? -25.326 14.859  -0.714  1.00 49.78  ? 152 GLN Y CA  1 
ATOM   6405  C C   . GLN F  3 137 ? -24.772 14.277  -2.019  1.00 54.85  ? 152 GLN Y C   1 
ATOM   6406  O O   . GLN F  3 137 ? -25.228 14.652  -3.103  1.00 55.71  ? 152 GLN Y O   1 
ATOM   6407  C CB  . GLN F  3 137 ? -26.177 13.835  0.067   1.00 48.91  ? 152 GLN Y CB  1 
ATOM   6408  C CG  . GLN F  3 137 ? -27.691 13.998  -0.014  1.00 63.84  ? 152 GLN Y CG  1 
ATOM   6409  C CD  . GLN F  3 137 ? -28.385 13.047  0.931   1.00 80.73  ? 152 GLN Y CD  1 
ATOM   6410  O OE1 . GLN F  3 137 ? -28.343 11.817  0.761   1.00 80.40  ? 152 GLN Y OE1 1 
ATOM   6411  N NE2 . GLN F  3 137 ? -29.024 13.591  1.961   1.00 60.79  ? 152 GLN Y NE2 1 
ATOM   6412  N N   . ASP F  3 138 ? -23.732 13.414  -1.900  1.00 50.27  ? 153 ASP Y N   1 
ATOM   6413  C CA  . ASP F  3 138 ? -23.031 12.748  -2.994  1.00 51.44  ? 153 ASP Y CA  1 
ATOM   6414  C C   . ASP F  3 138 ? -22.327 13.758  -3.939  1.00 59.99  ? 153 ASP Y C   1 
ATOM   6415  O O   . ASP F  3 138 ? -22.274 13.545  -5.149  1.00 62.20  ? 153 ASP Y O   1 
ATOM   6416  C CB  . ASP F  3 138 ? -23.944 11.745  -3.726  1.00 52.63  ? 153 ASP Y CB  1 
ATOM   6417  C CG  . ASP F  3 138 ? -24.340 10.548  -2.852  1.00 65.11  ? 153 ASP Y CG  1 
ATOM   6418  O OD1 . ASP F  3 138 ? -23.431 9.755   -2.474  1.00 66.70  ? 153 ASP Y OD1 1 
ATOM   6419  O OD2 . ASP F  3 138 ? -25.563 10.404  -2.540  1.00 66.84  ? 153 ASP Y OD2 1 
ATOM   6420  N N   . ASN F  3 139 ? -21.718 14.822  -3.352  1.00 57.96  ? 154 ASN Y N   1 
ATOM   6421  C CA  . ASN F  3 139 ? -20.953 15.874  -4.058  1.00 61.26  ? 154 ASN Y CA  1 
ATOM   6422  C C   . ASN F  3 139 ? -19.486 15.866  -3.557  1.00 67.04  ? 154 ASN Y C   1 
ATOM   6423  O O   . ASN F  3 139 ? -19.015 16.825  -2.939  1.00 66.41  ? 154 ASN Y O   1 
ATOM   6424  C CB  . ASN F  3 139 ? -21.587 17.262  -3.853  1.00 61.34  ? 154 ASN Y CB  1 
ATOM   6425  C CG  . ASN F  3 139 ? -23.015 17.385  -4.292  1.00 74.85  ? 154 ASN Y CG  1 
ATOM   6426  O OD1 . ASN F  3 139 ? -23.304 17.670  -5.455  1.00 59.53  ? 154 ASN Y OD1 1 
ATOM   6427  N ND2 . ASN F  3 139 ? -23.937 17.220  -3.357  1.00 71.28  ? 154 ASN Y ND2 1 
ATOM   6428  N N   . ILE F  3 140 ? -18.783 14.756  -3.834  1.00 65.43  ? 155 ILE Y N   1 
ATOM   6429  C CA  . ILE F  3 140 ? -17.404 14.429  -3.425  1.00 67.04  ? 155 ILE Y CA  1 
ATOM   6430  C C   . ILE F  3 140 ? -16.356 15.541  -3.682  1.00 75.62  ? 155 ILE Y C   1 
ATOM   6431  O O   . ILE F  3 140 ? -15.228 15.436  -3.182  1.00 78.39  ? 155 ILE Y O   1 
ATOM   6432  C CB  . ILE F  3 140 ? -16.960 13.075  -4.049  1.00 70.49  ? 155 ILE Y CB  1 
ATOM   6433  C CG1 . ILE F  3 140 ? -17.225 13.031  -5.578  1.00 72.12  ? 155 ILE Y CG1 1 
ATOM   6434  C CG2 . ILE F  3 140 ? -17.668 11.920  -3.329  1.00 67.98  ? 155 ILE Y CG2 1 
ATOM   6435  C CD1 . ILE F  3 140 ? -16.293 12.173  -6.374  1.00 76.68  ? 155 ILE Y CD1 1 
ATOM   6436  N N   . ASN F  3 141 ? -16.722 16.598  -4.420  1.00 72.57  ? 156 ASN Y N   1 
ATOM   6437  C CA  . ASN F  3 141 ? -15.820 17.712  -4.677  1.00 76.01  ? 156 ASN Y CA  1 
ATOM   6438  C C   . ASN F  3 141 ? -15.983 18.849  -3.660  1.00 79.00  ? 156 ASN Y C   1 
ATOM   6439  O O   . ASN F  3 141 ? -15.137 19.743  -3.631  1.00 82.80  ? 156 ASN Y O   1 
ATOM   6440  C CB  . ASN F  3 141 ? -15.942 18.198  -6.126  1.00 79.34  ? 156 ASN Y CB  1 
ATOM   6441  C CG  . ASN F  3 141 ? -15.401 17.211  -7.141  1.00 90.46  ? 156 ASN Y CG  1 
ATOM   6442  O OD1 . ASN F  3 141 ? -14.575 16.340  -6.829  1.00 76.85  ? 156 ASN Y OD1 1 
ATOM   6443  N ND2 . ASN F  3 141 ? -15.843 17.333  -8.389  1.00 82.19  ? 156 ASN Y ND2 1 
ATOM   6444  N N   . ILE F  3 142 ? -17.062 18.829  -2.834  1.00 70.70  ? 157 ILE Y N   1 
ATOM   6445  C CA  . ILE F  3 142 ? -17.290 19.826  -1.777  1.00 69.65  ? 157 ILE Y CA  1 
ATOM   6446  C C   . ILE F  3 142 ? -16.433 19.358  -0.610  1.00 75.41  ? 157 ILE Y C   1 
ATOM   6447  O O   . ILE F  3 142 ? -16.761 18.350  0.011   1.00 72.03  ? 157 ILE Y O   1 
ATOM   6448  C CB  . ILE F  3 142 ? -18.788 19.971  -1.375  1.00 68.52  ? 157 ILE Y CB  1 
ATOM   6449  C CG1 . ILE F  3 142 ? -19.640 20.432  -2.551  1.00 69.55  ? 157 ILE Y CG1 1 
ATOM   6450  C CG2 . ILE F  3 142 ? -18.963 20.895  -0.165  1.00 68.25  ? 157 ILE Y CG2 1 
ATOM   6451  C CD1 . ILE F  3 142 ? -21.093 20.549  -2.268  1.00 77.03  ? 157 ILE Y CD1 1 
ATOM   6452  N N   . HIS F  3 143 ? -15.318 20.056  -0.345  1.00 77.44  ? 158 HIS Y N   1 
ATOM   6453  C CA  . HIS F  3 143 ? -14.375 19.687  0.716   1.00 78.61  ? 158 HIS Y CA  1 
ATOM   6454  C C   . HIS F  3 143 ? -14.426 20.638  1.917   1.00 83.23  ? 158 HIS Y C   1 
ATOM   6455  O O   . HIS F  3 143 ? -13.858 20.312  2.968   1.00 83.05  ? 158 HIS Y O   1 
ATOM   6456  C CB  . HIS F  3 143 ? -12.921 19.684  0.186   1.00 84.17  ? 158 HIS Y CB  1 
ATOM   6457  C CG  . HIS F  3 143 ? -12.682 18.939  -1.090  1.00 88.59  ? 158 HIS Y CG  1 
ATOM   6458  N ND1 . HIS F  3 143 ? -12.697 17.557  -1.135  1.00 88.54  ? 158 HIS Y ND1 1 
ATOM   6459  C CD2 . HIS F  3 143 ? -12.338 19.410  -2.309  1.00 93.60  ? 158 HIS Y CD2 1 
ATOM   6460  C CE1 . HIS F  3 143 ? -12.410 17.235  -2.388  1.00 89.63  ? 158 HIS Y CE1 1 
ATOM   6461  N NE2 . HIS F  3 143 ? -12.183 18.317  -3.130  1.00 93.19  ? 158 HIS Y NE2 1 
ATOM   6462  N N   . THR F  3 144 ? -15.036 21.831  1.762   1.00 80.15  ? 159 THR Y N   1 
ATOM   6463  C CA  . THR F  3 144 ? -14.960 22.817  2.838   1.00 81.47  ? 159 THR Y CA  1 
ATOM   6464  C C   . THR F  3 144 ? -16.245 23.646  3.081   1.00 82.54  ? 159 THR Y C   1 
ATOM   6465  O O   . THR F  3 144 ? -16.922 24.074  2.143   1.00 82.02  ? 159 THR Y O   1 
ATOM   6466  C CB  . THR F  3 144 ? -13.715 23.740  2.607   1.00 93.86  ? 159 THR Y CB  1 
ATOM   6467  O OG1 . THR F  3 144 ? -13.821 24.956  3.360   1.00 96.16  ? 159 THR Y OG1 1 
ATOM   6468  C CG2 . THR F  3 144 ? -13.454 24.054  1.126   1.00 92.47  ? 159 THR Y CG2 1 
ATOM   6469  N N   . ILE F  3 145 ? -16.545 23.880  4.374   1.00 77.25  ? 160 ILE Y N   1 
ATOM   6470  C CA  . ILE F  3 145 ? -17.640 24.736  4.789   1.00 75.88  ? 160 ILE Y CA  1 
ATOM   6471  C C   . ILE F  3 145 ? -17.018 26.068  5.201   1.00 85.08  ? 160 ILE Y C   1 
ATOM   6472  O O   . ILE F  3 145 ? -16.361 26.156  6.245   1.00 85.33  ? 160 ILE Y O   1 
ATOM   6473  C CB  . ILE F  3 145 ? -18.576 24.181  5.893   1.00 75.36  ? 160 ILE Y CB  1 
ATOM   6474  C CG1 . ILE F  3 145 ? -19.046 22.735  5.614   1.00 72.01  ? 160 ILE Y CG1 1 
ATOM   6475  C CG2 . ILE F  3 145 ? -19.777 25.118  6.030   1.00 75.94  ? 160 ILE Y CG2 1 
ATOM   6476  C CD1 . ILE F  3 145 ? -20.091 22.155  6.650   1.00 70.86  ? 160 ILE Y CD1 1 
ATOM   6477  N N   . GLU F  3 146 ? -17.235 27.102  4.376   1.00 85.67  ? 161 GLU Y N   1 
ATOM   6478  C CA  . GLU F  3 146 ? -16.751 28.457  4.631   1.00 91.82  ? 161 GLU Y CA  1 
ATOM   6479  C C   . GLU F  3 146 ? -17.509 29.085  5.814   1.00 96.62  ? 161 GLU Y C   1 
ATOM   6480  O O   . GLU F  3 146 ? -18.603 28.630  6.155   1.00 92.09  ? 161 GLU Y O   1 
ATOM   6481  C CB  . GLU F  3 146 ? -16.968 29.339  3.384   1.00 96.16  ? 161 GLU Y CB  1 
ATOM   6482  C CG  . GLU F  3 146 ? -16.219 28.910  2.133   1.00 108.89 ? 161 GLU Y CG  1 
ATOM   6483  C CD  . GLU F  3 146 ? -14.740 29.228  2.130   1.00 133.72 ? 161 GLU Y CD  1 
ATOM   6484  O OE1 . GLU F  3 146 ? -14.382 30.426  2.206   1.00 128.85 ? 161 GLU Y OE1 1 
ATOM   6485  O OE2 . GLU F  3 146 ? -13.936 28.274  2.024   1.00 132.35 ? 161 GLU Y OE2 1 
ATOM   6486  N N   . ARG F  3 147 ? -16.942 30.143  6.419   1.00 98.69  ? 162 ARG Y N   1 
ATOM   6487  C CA  . ARG F  3 147 ? -17.615 30.873  7.496   1.00 99.82  ? 162 ARG Y CA  1 
ATOM   6488  C C   . ARG F  3 147 ? -18.823 31.621  6.898   1.00 103.66 ? 162 ARG Y C   1 
ATOM   6489  O O   . ARG F  3 147 ? -18.737 32.067  5.749   1.00 106.42 ? 162 ARG Y O   1 
ATOM   6490  C CB  . ARG F  3 147 ? -16.654 31.855  8.196   1.00 106.83 ? 162 ARG Y CB  1 
ATOM   6491  C CG  . ARG F  3 147 ? -15.947 32.861  7.278   1.00 123.46 ? 162 ARG Y CG  1 
ATOM   6492  C CD  . ARG F  3 147 ? -15.189 33.922  8.057   1.00 138.20 ? 162 ARG Y CD  1 
ATOM   6493  N NE  . ARG F  3 147 ? -16.093 34.886  8.690   1.00 145.38 ? 162 ARG Y NE  1 
ATOM   6494  C CZ  . ARG F  3 147 ? -16.515 36.010  8.119   1.00 161.41 ? 162 ARG Y CZ  1 
ATOM   6495  N NH1 . ARG F  3 147 ? -16.115 36.334  6.895   1.00 148.46 ? 162 ARG Y NH1 1 
ATOM   6496  N NH2 . ARG F  3 147 ? -17.340 36.819  8.769   1.00 151.50 ? 162 ARG Y NH2 1 
ATOM   6497  N N   . ASN F  3 148 ? -19.944 31.722  7.651   1.00 96.14  ? 163 ASN Y N   1 
ATOM   6498  C CA  . ASN F  3 148 ? -21.183 32.400  7.226   1.00 94.87  ? 163 ASN Y CA  1 
ATOM   6499  C C   . ASN F  3 148 ? -21.867 31.722  5.996   1.00 94.17  ? 163 ASN Y C   1 
ATOM   6500  O O   . ASN F  3 148 ? -22.635 32.374  5.277   1.00 94.83  ? 163 ASN Y O   1 
ATOM   6501  C CB  . ASN F  3 148 ? -20.943 33.919  6.968   1.00 101.18 ? 163 ASN Y CB  1 
ATOM   6502  C CG  . ASN F  3 148 ? -20.595 34.787  8.163   1.00 129.31 ? 163 ASN Y CG  1 
ATOM   6503  O OD1 . ASN F  3 148 ? -21.209 35.839  8.390   1.00 126.93 ? 163 ASN Y OD1 1 
ATOM   6504  N ND2 . ASN F  3 148 ? -19.548 34.440  8.898   1.00 122.48 ? 163 ASN Y ND2 1 
ATOM   6505  N N   . SER F  3 149 ? -21.620 30.412  5.786   1.00 85.75  ? 164 SER Y N   1 
ATOM   6506  C CA  . SER F  3 149 ? -22.139 29.634  4.651   1.00 81.92  ? 164 SER Y CA  1 
ATOM   6507  C C   . SER F  3 149 ? -23.665 29.481  4.568   1.00 80.77  ? 164 SER Y C   1 
ATOM   6508  O O   . SER F  3 149 ? -24.168 29.175  3.484   1.00 80.19  ? 164 SER Y O   1 
ATOM   6509  C CB  . SER F  3 149 ? -21.496 28.250  4.610   1.00 83.36  ? 164 SER Y CB  1 
ATOM   6510  O OG  . SER F  3 149 ? -20.220 28.273  3.990   1.00 95.62  ? 164 SER Y OG  1 
ATOM   6511  N N   . PHE F  3 150 ? -24.398 29.672  5.681   1.00 73.43  ? 165 PHE Y N   1 
ATOM   6512  C CA  . PHE F  3 150 ? -25.850 29.466  5.697   1.00 68.78  ? 165 PHE Y CA  1 
ATOM   6513  C C   . PHE F  3 150 ? -26.671 30.673  6.136   1.00 75.69  ? 165 PHE Y C   1 
ATOM   6514  O O   . PHE F  3 150 ? -27.908 30.595  6.166   1.00 74.39  ? 165 PHE Y O   1 
ATOM   6515  C CB  . PHE F  3 150 ? -26.196 28.239  6.548   1.00 65.86  ? 165 PHE Y CB  1 
ATOM   6516  C CG  . PHE F  3 150 ? -25.458 27.013  6.082   1.00 64.36  ? 165 PHE Y CG  1 
ATOM   6517  C CD1 . PHE F  3 150 ? -25.851 26.341  4.934   1.00 64.77  ? 165 PHE Y CD1 1 
ATOM   6518  C CD2 . PHE F  3 150 ? -24.323 26.572  6.748   1.00 65.87  ? 165 PHE Y CD2 1 
ATOM   6519  C CE1 . PHE F  3 150 ? -25.130 25.236  4.474   1.00 64.34  ? 165 PHE Y CE1 1 
ATOM   6520  C CE2 . PHE F  3 150 ? -23.608 25.465  6.289   1.00 66.70  ? 165 PHE Y CE2 1 
ATOM   6521  C CZ  . PHE F  3 150 ? -24.012 24.807  5.154   1.00 62.87  ? 165 PHE Y CZ  1 
ATOM   6522  N N   . VAL F  3 151 ? -26.008 31.795  6.445   1.00 75.74  ? 166 VAL Y N   1 
ATOM   6523  C CA  . VAL F  3 151 ? -26.723 33.006  6.845   1.00 78.02  ? 166 VAL Y CA  1 
ATOM   6524  C C   . VAL F  3 151 ? -27.488 33.558  5.626   1.00 81.54  ? 166 VAL Y C   1 
ATOM   6525  O O   . VAL F  3 151 ? -26.993 33.445  4.501   1.00 82.56  ? 166 VAL Y O   1 
ATOM   6526  C CB  . VAL F  3 151 ? -25.788 34.042  7.557   1.00 86.42  ? 166 VAL Y CB  1 
ATOM   6527  C CG1 . VAL F  3 151 ? -24.733 34.618  6.619   1.00 89.60  ? 166 VAL Y CG1 1 
ATOM   6528  C CG2 . VAL F  3 151 ? -26.571 35.147  8.266   1.00 88.70  ? 166 VAL Y CG2 1 
ATOM   6529  N N   . GLY F  3 152 ? -28.704 34.052  5.859   1.00 75.90  ? 167 GLY Y N   1 
ATOM   6530  C CA  . GLY F  3 152 ? -29.544 34.630  4.819   1.00 76.26  ? 167 GLY Y CA  1 
ATOM   6531  C C   . GLY F  3 152 ? -30.426 33.666  4.049   1.00 75.91  ? 167 GLY Y C   1 
ATOM   6532  O O   . GLY F  3 152 ? -31.321 34.115  3.325   1.00 75.94  ? 167 GLY Y O   1 
ATOM   6533  N N   . LEU F  3 153 ? -30.175 32.334  4.184   1.00 68.04  ? 168 LEU Y N   1 
ATOM   6534  C CA  . LEU F  3 153 ? -30.937 31.272  3.514   1.00 63.65  ? 168 LEU Y CA  1 
ATOM   6535  C C   . LEU F  3 153 ? -32.415 31.399  3.824   1.00 66.91  ? 168 LEU Y C   1 
ATOM   6536  O O   . LEU F  3 153 ? -33.226 31.316  2.904   1.00 67.45  ? 168 LEU Y O   1 
ATOM   6537  C CB  . LEU F  3 153 ? -30.412 29.858  3.883   1.00 59.59  ? 168 LEU Y CB  1 
ATOM   6538  C CG  . LEU F  3 153 ? -31.263 28.636  3.446   1.00 59.86  ? 168 LEU Y CG  1 
ATOM   6539  C CD1 . LEU F  3 153 ? -31.397 28.553  1.937   1.00 61.00  ? 168 LEU Y CD1 1 
ATOM   6540  C CD2 . LEU F  3 153 ? -30.665 27.343  3.946   1.00 56.88  ? 168 LEU Y CD2 1 
ATOM   6541  N N   . SER F  3 154 ? -32.765 31.606  5.109   1.00 62.39  ? 169 SER Y N   1 
ATOM   6542  C CA  . SER F  3 154 ? -34.158 31.743  5.538   1.00 61.79  ? 169 SER Y CA  1 
ATOM   6543  C C   . SER F  3 154 ? -34.295 32.586  6.821   1.00 69.25  ? 169 SER Y C   1 
ATOM   6544  O O   . SER F  3 154 ? -33.340 32.686  7.608   1.00 70.44  ? 169 SER Y O   1 
ATOM   6545  C CB  . SER F  3 154 ? -34.775 30.362  5.741   1.00 60.46  ? 169 SER Y CB  1 
ATOM   6546  O OG  . SER F  3 154 ? -36.059 30.391  6.335   1.00 68.77  ? 169 SER Y OG  1 
ATOM   6547  N N   . PHE F  3 155 ? -35.492 33.194  7.020   1.00 65.81  ? 170 PHE Y N   1 
ATOM   6548  C CA  . PHE F  3 155 ? -35.840 33.942  8.229   1.00 66.92  ? 170 PHE Y CA  1 
ATOM   6549  C C   . PHE F  3 155 ? -36.372 32.960  9.281   1.00 69.83  ? 170 PHE Y C   1 
ATOM   6550  O O   . PHE F  3 155 ? -36.521 33.303  10.460  1.00 71.42  ? 170 PHE Y O   1 
ATOM   6551  C CB  . PHE F  3 155 ? -36.883 35.006  7.921   1.00 70.80  ? 170 PHE Y CB  1 
ATOM   6552  C CG  . PHE F  3 155 ? -36.321 36.192  7.186   1.00 75.13  ? 170 PHE Y CG  1 
ATOM   6553  C CD1 . PHE F  3 155 ? -35.614 37.179  7.862   1.00 80.73  ? 170 PHE Y CD1 1 
ATOM   6554  C CD2 . PHE F  3 155 ? -36.504 36.331  5.818   1.00 77.40  ? 170 PHE Y CD2 1 
ATOM   6555  C CE1 . PHE F  3 155 ? -35.108 38.289  7.183   1.00 85.11  ? 170 PHE Y CE1 1 
ATOM   6556  C CE2 . PHE F  3 155 ? -36.001 37.442  5.141   1.00 83.56  ? 170 PHE Y CE2 1 
ATOM   6557  C CZ  . PHE F  3 155 ? -35.302 38.411  5.827   1.00 84.80  ? 170 PHE Y CZ  1 
ATOM   6558  N N   . GLU F  3 156 ? -36.639 31.728  8.826   1.00 63.33  ? 171 GLU Y N   1 
ATOM   6559  C CA  . GLU F  3 156 ? -37.166 30.611  9.591   1.00 61.73  ? 171 GLU Y CA  1 
ATOM   6560  C C   . GLU F  3 156 ? -36.071 29.606  9.880   1.00 65.55  ? 171 GLU Y C   1 
ATOM   6561  O O   . GLU F  3 156 ? -35.001 29.666  9.253   1.00 66.00  ? 171 GLU Y O   1 
ATOM   6562  C CB  . GLU F  3 156 ? -38.278 29.916  8.778   1.00 61.41  ? 171 GLU Y CB  1 
ATOM   6563  C CG  . GLU F  3 156 ? -39.680 30.312  9.189   1.00 71.18  ? 171 GLU Y CG  1 
ATOM   6564  C CD  . GLU F  3 156 ? -40.138 29.776  10.530  1.00 85.19  ? 171 GLU Y CD  1 
ATOM   6565  O OE1 . GLU F  3 156 ? -39.354 29.059  11.198  1.00 74.69  ? 171 GLU Y OE1 1 
ATOM   6566  O OE2 . GLU F  3 156 ? -41.294 30.074  10.910  1.00 75.45  ? 171 GLU Y OE2 1 
ATOM   6567  N N   . SER F  3 157 ? -36.355 28.632  10.787  1.00 59.73  ? 172 SER Y N   1 
ATOM   6568  C CA  . SER F  3 157 ? -35.383 27.590  11.104  1.00 56.42  ? 172 SER Y CA  1 
ATOM   6569  C C   . SER F  3 157 ? -35.102 26.721  9.889   1.00 58.04  ? 172 SER Y C   1 
ATOM   6570  O O   . SER F  3 157 ? -35.880 26.686  8.936   1.00 56.37  ? 172 SER Y O   1 
ATOM   6571  C CB  . SER F  3 157 ? -35.765 26.797  12.345  1.00 58.32  ? 172 SER Y CB  1 
ATOM   6572  O OG  . SER F  3 157 ? -36.919 26.005  12.143  1.00 63.64  ? 172 SER Y OG  1 
ATOM   6573  N N   . VAL F  3 158 ? -33.932 26.092  9.890   1.00 54.61  ? 173 VAL Y N   1 
ATOM   6574  C CA  . VAL F  3 158 ? -33.391 25.396  8.739   1.00 51.26  ? 173 VAL Y CA  1 
ATOM   6575  C C   . VAL F  3 158 ? -32.864 23.972  9.059   1.00 50.59  ? 173 VAL Y C   1 
ATOM   6576  O O   . VAL F  3 158 ? -32.417 23.715  10.177  1.00 50.92  ? 173 VAL Y O   1 
ATOM   6577  C CB  . VAL F  3 158 ? -32.321 26.406  8.196   1.00 55.72  ? 173 VAL Y CB  1 
ATOM   6578  C CG1 . VAL F  3 158 ? -30.930 25.826  8.016   1.00 54.66  ? 173 VAL Y CG1 1 
ATOM   6579  C CG2 . VAL F  3 158 ? -32.818 27.121  6.951   1.00 56.15  ? 173 VAL Y CG2 1 
ATOM   6580  N N   . ILE F  3 159 ? -32.989 23.045  8.085   1.00 43.49  ? 174 ILE Y N   1 
ATOM   6581  C CA  . ILE F  3 159 ? -32.464 21.677  8.186   1.00 41.03  ? 174 ILE Y CA  1 
ATOM   6582  C C   . ILE F  3 159 ? -31.338 21.595  7.178   1.00 45.91  ? 174 ILE Y C   1 
ATOM   6583  O O   . ILE F  3 159 ? -31.546 21.865  5.988   1.00 45.48  ? 174 ILE Y O   1 
ATOM   6584  C CB  . ILE F  3 159 ? -33.487 20.541  7.935   1.00 42.25  ? 174 ILE Y CB  1 
ATOM   6585  C CG1 . ILE F  3 159 ? -34.653 20.585  8.904   1.00 42.54  ? 174 ILE Y CG1 1 
ATOM   6586  C CG2 . ILE F  3 159 ? -32.795 19.162  7.978   1.00 42.68  ? 174 ILE Y CG2 1 
ATOM   6587  C CD1 . ILE F  3 159 ? -35.726 19.666  8.516   1.00 48.52  ? 174 ILE Y CD1 1 
ATOM   6588  N N   . LEU F  3 160 ? -30.155 21.190  7.651   1.00 42.92  ? 175 LEU Y N   1 
ATOM   6589  C CA  . LEU F  3 160 ? -28.973 21.095  6.817   1.00 42.51  ? 175 LEU Y CA  1 
ATOM   6590  C C   . LEU F  3 160 ? -28.467 19.684  6.710   1.00 46.77  ? 175 LEU Y C   1 
ATOM   6591  O O   . LEU F  3 160 ? -27.949 19.126  7.687   1.00 46.18  ? 175 LEU Y O   1 
ATOM   6592  C CB  . LEU F  3 160 ? -27.869 22.039  7.329   1.00 44.31  ? 175 LEU Y CB  1 
ATOM   6593  C CG  . LEU F  3 160 ? -28.182 23.520  7.315   1.00 50.10  ? 175 LEU Y CG  1 
ATOM   6594  C CD1 . LEU F  3 160 ? -27.037 24.305  7.864   1.00 52.46  ? 175 LEU Y CD1 1 
ATOM   6595  C CD2 . LEU F  3 160 ? -28.501 23.987  5.928   1.00 53.14  ? 175 LEU Y CD2 1 
ATOM   6596  N N   . TRP F  3 161 ? -28.624 19.098  5.510   1.00 44.34  ? 176 TRP Y N   1 
ATOM   6597  C CA  . TRP F  3 161 ? -28.128 17.757  5.218   1.00 43.87  ? 176 TRP Y CA  1 
ATOM   6598  C C   . TRP F  3 161 ? -26.982 17.943  4.264   1.00 50.49  ? 176 TRP Y C   1 
ATOM   6599  O O   . TRP F  3 161 ? -27.207 18.203  3.084   1.00 51.56  ? 176 TRP Y O   1 
ATOM   6600  C CB  . TRP F  3 161 ? -29.217 16.829  4.652   1.00 41.11  ? 176 TRP Y CB  1 
ATOM   6601  C CG  . TRP F  3 161 ? -30.313 16.481  5.623   1.00 41.85  ? 176 TRP Y CG  1 
ATOM   6602  C CD1 . TRP F  3 161 ? -30.274 16.579  6.986   1.00 45.12  ? 176 TRP Y CD1 1 
ATOM   6603  C CD2 . TRP F  3 161 ? -31.612 15.967  5.296   1.00 41.31  ? 176 TRP Y CD2 1 
ATOM   6604  N NE1 . TRP F  3 161 ? -31.472 16.169  7.526   1.00 44.14  ? 176 TRP Y NE1 1 
ATOM   6605  C CE2 . TRP F  3 161 ? -32.313 15.792  6.511   1.00 44.83  ? 176 TRP Y CE2 1 
ATOM   6606  C CE3 . TRP F  3 161 ? -32.256 15.641  4.089   1.00 42.32  ? 176 TRP Y CE3 1 
ATOM   6607  C CZ2 . TRP F  3 161 ? -33.629 15.313  6.551   1.00 43.69  ? 176 TRP Y CZ2 1 
ATOM   6608  C CZ3 . TRP F  3 161 ? -33.549 15.146  4.134   1.00 43.31  ? 176 TRP Y CZ3 1 
ATOM   6609  C CH2 . TRP F  3 161 ? -34.219 14.983  5.353   1.00 43.78  ? 176 TRP Y CH2 1 
ATOM   6610  N N   . LEU F  3 162 ? -25.757 17.932  4.808   1.00 47.18  ? 177 LEU Y N   1 
ATOM   6611  C CA  . LEU F  3 162 ? -24.518 18.106  4.050   1.00 48.70  ? 177 LEU Y CA  1 
ATOM   6612  C C   . LEU F  3 162 ? -23.716 16.801  4.134   1.00 52.46  ? 177 LEU Y C   1 
ATOM   6613  O O   . LEU F  3 162 ? -22.489 16.786  3.984   1.00 51.89  ? 177 LEU Y O   1 
ATOM   6614  C CB  . LEU F  3 162 ? -23.709 19.306  4.590   1.00 50.88  ? 177 LEU Y CB  1 
ATOM   6615  C CG  . LEU F  3 162 ? -24.519 20.497  5.106   1.00 54.91  ? 177 LEU Y CG  1 
ATOM   6616  C CD1 . LEU F  3 162 ? -23.764 21.249  6.168   1.00 56.31  ? 177 LEU Y CD1 1 
ATOM   6617  C CD2 . LEU F  3 162 ? -24.991 21.376  3.973   1.00 57.56  ? 177 LEU Y CD2 1 
ATOM   6618  N N   . ASN F  3 163 ? -24.447 15.688  4.327   1.00 49.26  ? 178 ASN Y N   1 
ATOM   6619  C CA  . ASN F  3 163 ? -23.869 14.343  4.449   1.00 49.05  ? 178 ASN Y CA  1 
ATOM   6620  C C   . ASN F  3 163 ? -23.370 13.769  3.104   1.00 51.65  ? 178 ASN Y C   1 
ATOM   6621  O O   . ASN F  3 163 ? -23.660 14.335  2.051   1.00 52.89  ? 178 ASN Y O   1 
ATOM   6622  C CB  . ASN F  3 163 ? -24.862 13.382  5.160   1.00 47.70  ? 178 ASN Y CB  1 
ATOM   6623  C CG  . ASN F  3 163 ? -26.150 13.119  4.428   1.00 60.81  ? 178 ASN Y CG  1 
ATOM   6624  O OD1 . ASN F  3 163 ? -26.925 14.032  4.108   1.00 54.39  ? 178 ASN Y OD1 1 
ATOM   6625  N ND2 . ASN F  3 163 ? -26.403 11.851  4.170   1.00 50.20  ? 178 ASN Y ND2 1 
ATOM   6626  N N   . LYS F  3 164 ? -22.579 12.688  3.150   1.00 45.78  ? 179 LYS Y N   1 
ATOM   6627  C CA  . LYS F  3 164 ? -22.070 11.984  1.975   1.00 46.19  ? 179 LYS Y CA  1 
ATOM   6628  C C   . LYS F  3 164 ? -21.319 12.853  0.925   1.00 54.36  ? 179 LYS Y C   1 
ATOM   6629  O O   . LYS F  3 164 ? -21.272 12.481  -0.242  1.00 56.23  ? 179 LYS Y O   1 
ATOM   6630  C CB  . LYS F  3 164 ? -23.219 11.213  1.308   1.00 46.52  ? 179 LYS Y CB  1 
ATOM   6631  C CG  . LYS F  3 164 ? -23.291 9.757   1.705   1.00 45.96  ? 179 LYS Y CG  1 
ATOM   6632  C CD  . LYS F  3 164 ? -24.700 9.316   2.040   1.00 48.59  ? 179 LYS Y CD  1 
ATOM   6633  C CE  . LYS F  3 164 ? -24.893 7.838   1.778   1.00 55.21  ? 179 LYS Y CE  1 
ATOM   6634  N NZ  . LYS F  3 164 ? -24.909 7.524   0.323   1.00 65.22  ? 179 LYS Y NZ  1 
ATOM   6635  N N   . ASN F  3 165 ? -20.709 13.969  1.322   1.00 52.20  ? 180 ASN Y N   1 
ATOM   6636  C CA  . ASN F  3 165 ? -19.967 14.771  0.355   1.00 54.76  ? 180 ASN Y CA  1 
ATOM   6637  C C   . ASN F  3 165 ? -18.473 14.422  0.473   1.00 64.36  ? 180 ASN Y C   1 
ATOM   6638  O O   . ASN F  3 165 ? -18.136 13.226  0.499   1.00 66.22  ? 180 ASN Y O   1 
ATOM   6639  C CB  . ASN F  3 165 ? -20.258 16.255  0.531   1.00 52.49  ? 180 ASN Y CB  1 
ATOM   6640  C CG  . ASN F  3 165 ? -21.696 16.618  0.273   1.00 62.05  ? 180 ASN Y CG  1 
ATOM   6641  O OD1 . ASN F  3 165 ? -22.225 16.445  -0.823  1.00 56.54  ? 180 ASN Y OD1 1 
ATOM   6642  N ND2 . ASN F  3 165 ? -22.356 17.160  1.272   1.00 48.29  ? 180 ASN Y ND2 1 
ATOM   6643  N N   . GLY F  3 166 ? -17.603 15.431  0.550   1.00 61.52  ? 181 GLY Y N   1 
ATOM   6644  C CA  . GLY F  3 166 ? -16.168 15.232  0.730   1.00 63.37  ? 181 GLY Y CA  1 
ATOM   6645  C C   . GLY F  3 166 ? -15.582 16.222  1.723   1.00 66.93  ? 181 GLY Y C   1 
ATOM   6646  O O   . GLY F  3 166 ? -14.365 16.466  1.724   1.00 69.08  ? 181 GLY Y O   1 
ATOM   6647  N N   . ILE F  3 167 ? -16.477 16.829  2.550   1.00 59.90  ? 182 ILE Y N   1 
ATOM   6648  C CA  . ILE F  3 167 ? -16.168 17.830  3.570   1.00 61.18  ? 182 ILE Y CA  1 
ATOM   6649  C C   . ILE F  3 167 ? -15.081 17.320  4.528   1.00 65.94  ? 182 ILE Y C   1 
ATOM   6650  O O   . ILE F  3 167 ? -15.178 16.216  5.050   1.00 63.92  ? 182 ILE Y O   1 
ATOM   6651  C CB  . ILE F  3 167 ? -17.467 18.325  4.273   1.00 62.53  ? 182 ILE Y CB  1 
ATOM   6652  C CG1 . ILE F  3 167 ? -18.362 19.079  3.256   1.00 63.28  ? 182 ILE Y CG1 1 
ATOM   6653  C CG2 . ILE F  3 167 ? -17.190 19.222  5.507   1.00 64.81  ? 182 ILE Y CG2 1 
ATOM   6654  C CD1 . ILE F  3 167 ? -19.847 18.891  3.403   1.00 68.91  ? 182 ILE Y CD1 1 
ATOM   6655  N N   . GLN F  3 168 ? -14.011 18.110  4.676   1.00 65.88  ? 183 GLN Y N   1 
ATOM   6656  C CA  . GLN F  3 168 ? -12.855 17.823  5.525   1.00 67.64  ? 183 GLN Y CA  1 
ATOM   6657  C C   . GLN F  3 168 ? -12.432 19.044  6.347   1.00 73.51  ? 183 GLN Y C   1 
ATOM   6658  O O   . GLN F  3 168 ? -11.663 18.884  7.299   1.00 74.24  ? 183 GLN Y O   1 
ATOM   6659  C CB  . GLN F  3 168 ? -11.689 17.266  4.697   1.00 71.45  ? 183 GLN Y CB  1 
ATOM   6660  C CG  . GLN F  3 168 ? -11.513 17.940  3.337   1.00 81.74  ? 183 GLN Y CG  1 
ATOM   6661  C CD  . GLN F  3 168 ? -10.570 17.206  2.409   1.00 87.67  ? 183 GLN Y CD  1 
ATOM   6662  O OE1 . GLN F  3 168 ? -10.673 15.989  2.194   1.00 72.98  ? 183 GLN Y OE1 1 
ATOM   6663  N NE2 . GLN F  3 168 ? -9.673  17.956  1.785   1.00 78.64  ? 183 GLN Y NE2 1 
ATOM   6664  N N   . GLU F  3 169 ? -12.983 20.246  6.011   1.00 70.90  ? 184 GLU Y N   1 
ATOM   6665  C CA  . GLU F  3 169 ? -12.705 21.534  6.661   1.00 74.65  ? 184 GLU Y CA  1 
ATOM   6666  C C   . GLU F  3 169 ? -13.971 22.318  7.021   1.00 78.91  ? 184 GLU Y C   1 
ATOM   6667  O O   . GLU F  3 169 ? -14.635 22.814  6.115   1.00 78.46  ? 184 GLU Y O   1 
ATOM   6668  C CB  . GLU F  3 169 ? -11.866 22.419  5.723   1.00 80.70  ? 184 GLU Y CB  1 
ATOM   6669  C CG  . GLU F  3 169 ? -10.397 22.039  5.606   1.00 97.03  ? 184 GLU Y CG  1 
ATOM   6670  C CD  . GLU F  3 169 ? -9.553  22.218  6.854   1.00 116.54 ? 184 GLU Y CD  1 
ATOM   6671  O OE1 . GLU F  3 169 ? -8.641  21.384  7.071   1.00 100.62 ? 184 GLU Y OE1 1 
ATOM   6672  O OE2 . GLU F  3 169 ? -9.810  23.180  7.617   1.00 106.24 ? 184 GLU Y OE2 1 
ATOM   6673  N N   . ILE F  3 170 ? -14.294 22.475  8.324   1.00 75.82  ? 185 ILE Y N   1 
ATOM   6674  C CA  . ILE F  3 170 ? -15.445 23.293  8.743   1.00 74.28  ? 185 ILE Y CA  1 
ATOM   6675  C C   . ILE F  3 170 ? -14.911 24.483  9.539   1.00 84.18  ? 185 ILE Y C   1 
ATOM   6676  O O   . ILE F  3 170 ? -14.423 24.303  10.647  1.00 85.38  ? 185 ILE Y O   1 
ATOM   6677  C CB  . ILE F  3 170 ? -16.582 22.537  9.499   1.00 72.66  ? 185 ILE Y CB  1 
ATOM   6678  C CG1 . ILE F  3 170 ? -17.085 21.324  8.722   1.00 67.92  ? 185 ILE Y CG1 1 
ATOM   6679  C CG2 . ILE F  3 170 ? -17.753 23.485  9.850   1.00 72.99  ? 185 ILE Y CG2 1 
ATOM   6680  C CD1 . ILE F  3 170 ? -17.780 20.355  9.581   1.00 61.86  ? 185 ILE Y CD1 1 
ATOM   6681  N N   . HIS F  3 171 ? -15.010 25.687  8.976   1.00 84.76  ? 186 HIS Y N   1 
ATOM   6682  C CA  . HIS F  3 171 ? -14.525 26.905  9.613   1.00 90.99  ? 186 HIS Y CA  1 
ATOM   6683  C C   . HIS F  3 171 ? -15.344 27.373  10.810  1.00 95.54  ? 186 HIS Y C   1 
ATOM   6684  O O   . HIS F  3 171 ? -16.511 27.020  10.954  1.00 92.24  ? 186 HIS Y O   1 
ATOM   6685  C CB  . HIS F  3 171 ? -14.411 28.045  8.578   1.00 95.73  ? 186 HIS Y CB  1 
ATOM   6686  C CG  . HIS F  3 171 ? -13.443 27.782  7.461   1.00 101.67 ? 186 HIS Y CG  1 
ATOM   6687  N ND1 . HIS F  3 171 ? -13.589 28.396  6.228   1.00 105.02 ? 186 HIS Y ND1 1 
ATOM   6688  C CD2 . HIS F  3 171 ? -12.348 26.983  7.424   1.00 105.11 ? 186 HIS Y CD2 1 
ATOM   6689  C CE1 . HIS F  3 171 ? -12.592 27.945  5.484   1.00 106.61 ? 186 HIS Y CE1 1 
ATOM   6690  N NE2 . HIS F  3 171 ? -11.818 27.092  6.161   1.00 106.95 ? 186 HIS Y NE2 1 
ATOM   6691  N N   . ASN F  3 172 ? -14.736 28.212  11.653  1.00 97.21  ? 187 ASN Y N   1 
ATOM   6692  C CA  . ASN F  3 172 ? -15.418 28.827  12.781  1.00 97.76  ? 187 ASN Y CA  1 
ATOM   6693  C C   . ASN F  3 172 ? -16.472 29.757  12.196  1.00 103.15 ? 187 ASN Y C   1 
ATOM   6694  O O   . ASN F  3 172 ? -16.205 30.435  11.200  1.00 105.63 ? 187 ASN Y O   1 
ATOM   6695  C CB  . ASN F  3 172 ? -14.438 29.616  13.647  1.00 98.76  ? 187 ASN Y CB  1 
ATOM   6696  C CG  . ASN F  3 172 ? -13.650 28.757  14.596  1.00 111.07 ? 187 ASN Y CG  1 
ATOM   6697  O OD1 . ASN F  3 172 ? -14.210 28.002  15.394  1.00 94.69  ? 187 ASN Y OD1 1 
ATOM   6698  N ND2 . ASN F  3 172 ? -12.327 28.847  14.528  1.00 109.71 ? 187 ASN Y ND2 1 
ATOM   6699  N N   . SER F  3 173 ? -17.682 29.731  12.774  1.00 96.91  ? 188 SER Y N   1 
ATOM   6700  C CA  . SER F  3 173 ? -18.853 30.526  12.395  1.00 95.21  ? 188 SER Y CA  1 
ATOM   6701  C C   . SER F  3 173 ? -19.412 30.132  11.017  1.00 96.07  ? 188 SER Y C   1 
ATOM   6702  O O   . SER F  3 173 ? -20.075 30.939  10.352  1.00 97.16  ? 188 SER Y O   1 
ATOM   6703  C CB  . SER F  3 173 ? -18.574 32.024  12.513  1.00 100.87 ? 188 SER Y CB  1 
ATOM   6704  O OG  . SER F  3 173 ? -18.311 32.346  13.867  1.00 105.35 ? 188 SER Y OG  1 
ATOM   6705  N N   . ALA F  3 174 ? -19.199 28.862  10.625  1.00 87.83  ? 189 ALA Y N   1 
ATOM   6706  C CA  . ALA F  3 174 ? -19.732 28.321  9.372   1.00 83.61  ? 189 ALA Y CA  1 
ATOM   6707  C C   . ALA F  3 174 ? -21.267 28.376  9.391   1.00 82.01  ? 189 ALA Y C   1 
ATOM   6708  O O   . ALA F  3 174 ? -21.891 28.583  8.347   1.00 80.02  ? 189 ALA Y O   1 
ATOM   6709  C CB  . ALA F  3 174 ? -19.269 26.882  9.180   1.00 81.43  ? 189 ALA Y CB  1 
ATOM   6710  N N   . PHE F  3 175 ? -21.853 28.234  10.594  1.00 76.12  ? 190 PHE Y N   1 
ATOM   6711  C CA  . PHE F  3 175 ? -23.296 28.215  10.808  1.00 72.74  ? 190 PHE Y CA  1 
ATOM   6712  C C   . PHE F  3 175 ? -23.821 29.462  11.513  1.00 79.59  ? 190 PHE Y C   1 
ATOM   6713  O O   . PHE F  3 175 ? -24.931 29.435  12.036  1.00 77.75  ? 190 PHE Y O   1 
ATOM   6714  C CB  . PHE F  3 175 ? -23.710 26.933  11.568  1.00 70.71  ? 190 PHE Y CB  1 
ATOM   6715  C CG  . PHE F  3 175 ? -23.161 25.666  10.970  1.00 68.78  ? 190 PHE Y CG  1 
ATOM   6716  C CD1 . PHE F  3 175 ? -23.760 25.086  9.861   1.00 68.20  ? 190 PHE Y CD1 1 
ATOM   6717  C CD2 . PHE F  3 175 ? -22.024 25.068  11.495  1.00 71.13  ? 190 PHE Y CD2 1 
ATOM   6718  C CE1 . PHE F  3 175 ? -23.209 23.947  9.269   1.00 66.77  ? 190 PHE Y CE1 1 
ATOM   6719  C CE2 . PHE F  3 175 ? -21.496 23.908  10.920  1.00 71.34  ? 190 PHE Y CE2 1 
ATOM   6720  C CZ  . PHE F  3 175 ? -22.087 23.361  9.807   1.00 66.10  ? 190 PHE Y CZ  1 
ATOM   6721  N N   . ASN F  3 176 ? -23.061 30.559  11.506  1.00 81.01  ? 191 ASN Y N   1 
ATOM   6722  C CA  . ASN F  3 176 ? -23.513 31.785  12.167  1.00 85.06  ? 191 ASN Y CA  1 
ATOM   6723  C C   . ASN F  3 176 ? -24.734 32.405  11.448  1.00 88.26  ? 191 ASN Y C   1 
ATOM   6724  O O   . ASN F  3 176 ? -24.874 32.246  10.238  1.00 86.33  ? 191 ASN Y O   1 
ATOM   6725  C CB  . ASN F  3 176 ? -22.336 32.769  12.374  1.00 92.59  ? 191 ASN Y CB  1 
ATOM   6726  C CG  . ASN F  3 176 ? -22.490 34.172  11.855  1.00 115.88 ? 191 ASN Y CG  1 
ATOM   6727  O OD1 . ASN F  3 176 ? -22.479 34.402  10.637  1.00 114.16 ? 191 ASN Y OD1 1 
ATOM   6728  N ND2 . ASN F  3 176 ? -22.579 35.119  12.802  1.00 108.83 ? 191 ASN Y ND2 1 
ATOM   6729  N N   . GLY F  3 177 ? -25.616 33.040  12.223  1.00 85.84  ? 192 GLY Y N   1 
ATOM   6730  C CA  . GLY F  3 177 ? -26.849 33.667  11.749  1.00 85.00  ? 192 GLY Y CA  1 
ATOM   6731  C C   . GLY F  3 177 ? -27.828 32.684  11.137  1.00 82.64  ? 192 GLY Y C   1 
ATOM   6732  O O   . GLY F  3 177 ? -28.498 33.001  10.150  1.00 81.70  ? 192 GLY Y O   1 
ATOM   6733  N N   . THR F  3 178 ? -27.903 31.480  11.714  1.00 75.08  ? 193 THR Y N   1 
ATOM   6734  C CA  . THR F  3 178 ? -28.742 30.393  11.225  1.00 70.53  ? 193 THR Y CA  1 
ATOM   6735  C C   . THR F  3 178 ? -29.507 29.755  12.367  1.00 73.46  ? 193 THR Y C   1 
ATOM   6736  O O   . THR F  3 178 ? -28.908 29.400  13.389  1.00 74.62  ? 193 THR Y O   1 
ATOM   6737  C CB  . THR F  3 178 ? -27.848 29.346  10.497  1.00 71.93  ? 193 THR Y CB  1 
ATOM   6738  O OG1 . THR F  3 178 ? -27.372 29.892  9.268   1.00 72.36  ? 193 THR Y OG1 1 
ATOM   6739  C CG2 . THR F  3 178 ? -28.553 28.019  10.228  1.00 64.08  ? 193 THR Y CG2 1 
ATOM   6740  N N   . GLN F  3 179 ? -30.815 29.549  12.172  1.00 67.51  ? 194 GLN Y N   1 
ATOM   6741  C CA  . GLN F  3 179 ? -31.593 28.817  13.157  1.00 66.42  ? 194 GLN Y CA  1 
ATOM   6742  C C   . GLN F  3 179 ? -31.481 27.300  12.812  1.00 65.76  ? 194 GLN Y C   1 
ATOM   6743  O O   . GLN F  3 179 ? -32.260 26.786  12.012  1.00 63.13  ? 194 GLN Y O   1 
ATOM   6744  C CB  . GLN F  3 179 ? -33.041 29.304  13.178  1.00 68.40  ? 194 GLN Y CB  1 
ATOM   6745  C CG  . GLN F  3 179 ? -33.345 30.283  14.287  1.00 87.09  ? 194 GLN Y CG  1 
ATOM   6746  C CD  . GLN F  3 179 ? -34.827 30.510  14.386  1.00 113.63 ? 194 GLN Y CD  1 
ATOM   6747  O OE1 . GLN F  3 179 ? -35.542 29.776  15.078  1.00 113.93 ? 194 GLN Y OE1 1 
ATOM   6748  N NE2 . GLN F  3 179 ? -35.329 31.500  13.654  1.00 104.50 ? 194 GLN Y NE2 1 
ATOM   6749  N N   . LEU F  3 180 ? -30.465 26.609  13.367  1.00 61.20  ? 195 LEU Y N   1 
ATOM   6750  C CA  . LEU F  3 180 ? -30.236 25.183  13.102  1.00 57.83  ? 195 LEU Y CA  1 
ATOM   6751  C C   . LEU F  3 180 ? -31.191 24.291  13.832  1.00 62.37  ? 195 LEU Y C   1 
ATOM   6752  O O   . LEU F  3 180 ? -31.237 24.282  15.066  1.00 64.58  ? 195 LEU Y O   1 
ATOM   6753  C CB  . LEU F  3 180 ? -28.801 24.740  13.430  1.00 57.87  ? 195 LEU Y CB  1 
ATOM   6754  C CG  . LEU F  3 180 ? -27.826 24.752  12.296  1.00 60.89  ? 195 LEU Y CG  1 
ATOM   6755  C CD1 . LEU F  3 180 ? -26.433 24.564  12.812  1.00 61.79  ? 195 LEU Y CD1 1 
ATOM   6756  C CD2 . LEU F  3 180 ? -28.182 23.701  11.277  1.00 61.59  ? 195 LEU Y CD2 1 
ATOM   6757  N N   . ASP F  3 181 ? -31.945 23.523  13.067  1.00 57.10  ? 196 ASP Y N   1 
ATOM   6758  C CA  . ASP F  3 181 ? -32.875 22.546  13.606  1.00 55.74  ? 196 ASP Y CA  1 
ATOM   6759  C C   . ASP F  3 181 ? -32.156 21.218  13.639  1.00 55.53  ? 196 ASP Y C   1 
ATOM   6760  O O   . ASP F  3 181 ? -32.052 20.578  14.678  1.00 54.51  ? 196 ASP Y O   1 
ATOM   6761  C CB  . ASP F  3 181 ? -34.082 22.413  12.683  1.00 56.23  ? 196 ASP Y CB  1 
ATOM   6762  C CG  . ASP F  3 181 ? -35.220 23.348  12.943  1.00 71.87  ? 196 ASP Y CG  1 
ATOM   6763  O OD1 . ASP F  3 181 ? -35.277 23.926  14.065  1.00 74.43  ? 196 ASP Y OD1 1 
ATOM   6764  O OD2 . ASP F  3 181 ? -36.094 23.464  12.054  1.00 80.72  ? 196 ASP Y OD2 1 
ATOM   6765  N N   . GLU F  3 182 ? -31.667 20.819  12.471  1.00 49.94  ? 197 GLU Y N   1 
ATOM   6766  C CA  . GLU F  3 182 ? -31.019 19.555  12.247  1.00 48.44  ? 197 GLU Y CA  1 
ATOM   6767  C C   . GLU F  3 182 ? -29.793 19.797  11.399  1.00 51.54  ? 197 GLU Y C   1 
ATOM   6768  O O   . GLU F  3 182 ? -29.834 20.652  10.501  1.00 51.59  ? 197 GLU Y O   1 
ATOM   6769  C CB  . GLU F  3 182 ? -32.024 18.636  11.532  1.00 48.32  ? 197 GLU Y CB  1 
ATOM   6770  C CG  . GLU F  3 182 ? -31.513 17.262  11.148  1.00 56.10  ? 197 GLU Y CG  1 
ATOM   6771  C CD  . GLU F  3 182 ? -32.586 16.244  10.836  1.00 75.28  ? 197 GLU Y CD  1 
ATOM   6772  O OE1 . GLU F  3 182 ? -33.788 16.555  11.003  1.00 56.43  ? 197 GLU Y OE1 1 
ATOM   6773  O OE2 . GLU F  3 182 ? -32.216 15.115  10.445  1.00 77.96  ? 197 GLU Y OE2 1 
ATOM   6774  N N   . LEU F  3 183 ? -28.699 19.058  11.702  1.00 46.78  ? 198 LEU Y N   1 
ATOM   6775  C CA  . LEU F  3 183 ? -27.443 19.125  10.964  1.00 47.03  ? 198 LEU Y CA  1 
ATOM   6776  C C   . LEU F  3 183 ? -26.885 17.726  10.726  1.00 52.72  ? 198 LEU Y C   1 
ATOM   6777  O O   . LEU F  3 183 ? -26.492 17.069  11.698  1.00 54.08  ? 198 LEU Y O   1 
ATOM   6778  C CB  . LEU F  3 183 ? -26.404 20.014  11.692  1.00 49.19  ? 198 LEU Y CB  1 
ATOM   6779  C CG  . LEU F  3 183 ? -25.024 20.161  11.040  1.00 53.13  ? 198 LEU Y CG  1 
ATOM   6780  C CD1 . LEU F  3 183 ? -25.076 21.108  9.872   1.00 53.57  ? 198 LEU Y CD1 1 
ATOM   6781  C CD2 . LEU F  3 183 ? -24.037 20.685  12.010  1.00 56.08  ? 198 LEU Y CD2 1 
ATOM   6782  N N   . ASN F  3 184 ? -26.841 17.275  9.438   1.00 48.00  ? 199 ASN Y N   1 
ATOM   6783  C CA  . ASN F  3 184 ? -26.278 15.971  9.078   1.00 47.22  ? 199 ASN Y CA  1 
ATOM   6784  C C   . ASN F  3 184 ? -24.924 16.112  8.370   1.00 53.76  ? 199 ASN Y C   1 
ATOM   6785  O O   . ASN F  3 184 ? -24.882 16.420  7.173   1.00 54.56  ? 199 ASN Y O   1 
ATOM   6786  C CB  . ASN F  3 184 ? -27.245 15.143  8.237   1.00 45.41  ? 199 ASN Y CB  1 
ATOM   6787  C CG  . ASN F  3 184 ? -26.929 13.659  8.166   1.00 62.19  ? 199 ASN Y CG  1 
ATOM   6788  O OD1 . ASN F  3 184 ? -25.834 13.203  8.492   1.00 55.88  ? 199 ASN Y OD1 1 
ATOM   6789  N ND2 . ASN F  3 184 ? -27.892 12.865  7.733   1.00 48.81  ? 199 ASN Y ND2 1 
ATOM   6790  N N   . LEU F  3 185 ? -23.820 15.887  9.120   1.00 50.39  ? 200 LEU Y N   1 
ATOM   6791  C CA  . LEU F  3 185 ? -22.446 15.926  8.599   1.00 50.89  ? 200 LEU Y CA  1 
ATOM   6792  C C   . LEU F  3 185 ? -21.891 14.502  8.312   1.00 52.71  ? 200 LEU Y C   1 
ATOM   6793  O O   . LEU F  3 185 ? -20.759 14.380  7.837   1.00 53.65  ? 200 LEU Y O   1 
ATOM   6794  C CB  . LEU F  3 185 ? -21.499 16.689  9.558   1.00 53.24  ? 200 LEU Y CB  1 
ATOM   6795  C CG  . LEU F  3 185 ? -21.625 18.207  9.583   1.00 58.83  ? 200 LEU Y CG  1 
ATOM   6796  C CD1 . LEU F  3 185 ? -20.894 18.808  10.781  1.00 59.98  ? 200 LEU Y CD1 1 
ATOM   6797  C CD2 . LEU F  3 185 ? -21.179 18.830  8.267   1.00 63.64  ? 200 LEU Y CD2 1 
ATOM   6798  N N   . SER F  3 186 ? -22.699 13.441  8.579   1.00 45.36  ? 201 SER Y N   1 
ATOM   6799  C CA  . SER F  3 186 ? -22.362 12.026  8.400   1.00 43.54  ? 201 SER Y CA  1 
ATOM   6800  C C   . SER F  3 186 ? -21.794 11.647  7.025   1.00 48.18  ? 201 SER Y C   1 
ATOM   6801  O O   . SER F  3 186 ? -21.988 12.357  6.044   1.00 48.80  ? 201 SER Y O   1 
ATOM   6802  C CB  . SER F  3 186 ? -23.563 11.142  8.719   1.00 44.54  ? 201 SER Y CB  1 
ATOM   6803  O OG  . SER F  3 186 ? -24.495 11.060  7.651   1.00 51.91  ? 201 SER Y OG  1 
ATOM   6804  N N   . ASP F  3 187 ? -21.067 10.530  6.973   1.00 44.68  ? 202 ASP Y N   1 
ATOM   6805  C CA  . ASP F  3 187 ? -20.480 9.937   5.781   1.00 45.43  ? 202 ASP Y CA  1 
ATOM   6806  C C   . ASP F  3 187 ? -19.471 10.821  5.038   1.00 53.99  ? 202 ASP Y C   1 
ATOM   6807  O O   . ASP F  3 187 ? -19.061 10.450  3.928   1.00 55.02  ? 202 ASP Y O   1 
ATOM   6808  C CB  . ASP F  3 187 ? -21.553 9.415   4.838   1.00 46.06  ? 202 ASP Y CB  1 
ATOM   6809  C CG  . ASP F  3 187 ? -22.399 8.320   5.459   1.00 62.13  ? 202 ASP Y CG  1 
ATOM   6810  O OD1 . ASP F  3 187 ? -21.898 7.170   5.563   1.00 62.86  ? 202 ASP Y OD1 1 
ATOM   6811  O OD2 . ASP F  3 187 ? -23.573 8.613   5.841   1.00 72.05  ? 202 ASP Y OD2 1 
ATOM   6812  N N   . ASN F  3 188 ? -19.008 11.935  5.673   1.00 53.46  ? 203 ASN Y N   1 
ATOM   6813  C CA  . ASN F  3 188 ? -17.910 12.791  5.182   1.00 56.11  ? 203 ASN Y CA  1 
ATOM   6814  C C   . ASN F  3 188 ? -16.734 12.193  5.942   1.00 64.94  ? 203 ASN Y C   1 
ATOM   6815  O O   . ASN F  3 188 ? -16.468 12.560  7.086   1.00 66.73  ? 203 ASN Y O   1 
ATOM   6816  C CB  . ASN F  3 188 ? -18.115 14.259  5.541   1.00 52.46  ? 203 ASN Y CB  1 
ATOM   6817  C CG  . ASN F  3 188 ? -19.119 14.941  4.666   1.00 64.22  ? 203 ASN Y CG  1 
ATOM   6818  O OD1 . ASN F  3 188 ? -18.812 15.340  3.545   1.00 57.55  ? 203 ASN Y OD1 1 
ATOM   6819  N ND2 . ASN F  3 188 ? -20.342 15.092  5.163   1.00 53.37  ? 203 ASN Y ND2 1 
ATOM   6820  N N   . ASN F  3 189 ? -16.126 11.163  5.346   1.00 62.61  ? 204 ASN Y N   1 
ATOM   6821  C CA  . ASN F  3 189 ? -15.114 10.315  5.963   1.00 64.06  ? 204 ASN Y CA  1 
ATOM   6822  C C   . ASN F  3 189 ? -13.844 11.017  6.401   1.00 69.33  ? 204 ASN Y C   1 
ATOM   6823  O O   . ASN F  3 189 ? -13.327 10.661  7.459   1.00 69.68  ? 204 ASN Y O   1 
ATOM   6824  C CB  . ASN F  3 189 ? -14.795 9.138   5.057   1.00 67.52  ? 204 ASN Y CB  1 
ATOM   6825  C CG  . ASN F  3 189 ? -16.042 8.374   4.681   1.00 95.59  ? 204 ASN Y CG  1 
ATOM   6826  O OD1 . ASN F  3 189 ? -16.684 8.644   3.655   1.00 88.84  ? 204 ASN Y OD1 1 
ATOM   6827  N ND2 . ASN F  3 189 ? -16.489 7.506   5.576   1.00 90.20  ? 204 ASN Y ND2 1 
ATOM   6828  N N   . ASN F  3 190 ? -13.355 12.012  5.627   1.00 67.12  ? 205 ASN Y N   1 
ATOM   6829  C CA  . ASN F  3 190 ? -12.100 12.734  5.905   1.00 70.07  ? 205 ASN Y CA  1 
ATOM   6830  C C   . ASN F  3 190 ? -12.259 13.903  6.873   1.00 73.10  ? 205 ASN Y C   1 
ATOM   6831  O O   . ASN F  3 190 ? -11.301 14.657  7.097   1.00 77.00  ? 205 ASN Y O   1 
ATOM   6832  C CB  . ASN F  3 190 ? -11.440 13.207  4.603   1.00 71.21  ? 205 ASN Y CB  1 
ATOM   6833  C CG  . ASN F  3 190 ? -11.171 12.135  3.582   1.00 100.89 ? 205 ASN Y CG  1 
ATOM   6834  O OD1 . ASN F  3 190 ? -11.174 10.924  3.865   1.00 94.54  ? 205 ASN Y OD1 1 
ATOM   6835  N ND2 . ASN F  3 190 ? -10.920 12.573  2.360   1.00 98.16  ? 205 ASN Y ND2 1 
ATOM   6836  N N   . LEU F  3 191 ? -13.453 14.053  7.451   1.00 63.98  ? 206 LEU Y N   1 
ATOM   6837  C CA  . LEU F  3 191 ? -13.718 15.138  8.380   1.00 64.06  ? 206 LEU Y CA  1 
ATOM   6838  C C   . LEU F  3 191 ? -13.180 14.739  9.745   1.00 69.79  ? 206 LEU Y C   1 
ATOM   6839  O O   . LEU F  3 191 ? -13.696 13.793  10.335  1.00 68.14  ? 206 LEU Y O   1 
ATOM   6840  C CB  . LEU F  3 191 ? -15.236 15.417  8.401   1.00 60.29  ? 206 LEU Y CB  1 
ATOM   6841  C CG  . LEU F  3 191 ? -15.756 16.640  9.137   1.00 64.07  ? 206 LEU Y CG  1 
ATOM   6842  C CD1 . LEU F  3 191 ? -15.136 17.942  8.599   1.00 66.65  ? 206 LEU Y CD1 1 
ATOM   6843  C CD2 . LEU F  3 191 ? -17.233 16.681  9.043   1.00 60.43  ? 206 LEU Y CD2 1 
ATOM   6844  N N   . GLU F  3 192 ? -12.117 15.425  10.223  1.00 69.86  ? 207 GLU Y N   1 
ATOM   6845  C CA  . GLU F  3 192 ? -11.471 15.097  11.501  1.00 72.09  ? 207 GLU Y CA  1 
ATOM   6846  C C   . GLU F  3 192 ? -11.680 16.130  12.611  1.00 78.40  ? 207 GLU Y C   1 
ATOM   6847  O O   . GLU F  3 192 ? -11.655 15.745  13.785  1.00 78.74  ? 207 GLU Y O   1 
ATOM   6848  C CB  . GLU F  3 192 ? -9.953  14.830  11.331  1.00 77.51  ? 207 GLU Y CB  1 
ATOM   6849  C CG  . GLU F  3 192 ? -9.565  13.757  10.322  1.00 86.49  ? 207 GLU Y CG  1 
ATOM   6850  C CD  . GLU F  3 192 ? -8.525  12.734  10.758  1.00 111.12 ? 207 GLU Y CD  1 
ATOM   6851  O OE1 . GLU F  3 192 ? -8.742  12.046  11.782  1.00 102.39 ? 207 GLU Y OE1 1 
ATOM   6852  O OE2 . GLU F  3 192 ? -7.527  12.562  10.023  1.00 109.86 ? 207 GLU Y OE2 1 
ATOM   6853  N N   . GLU F  3 193 ? -11.844 17.433  12.267  1.00 76.75  ? 208 GLU Y N   1 
ATOM   6854  C CA  . GLU F  3 193 ? -11.936 18.482  13.301  1.00 79.15  ? 208 GLU Y CA  1 
ATOM   6855  C C   . GLU F  3 193 ? -13.118 19.460  13.206  1.00 79.75  ? 208 GLU Y C   1 
ATOM   6856  O O   . GLU F  3 193 ? -13.252 20.211  12.229  1.00 77.76  ? 208 GLU Y O   1 
ATOM   6857  C CB  . GLU F  3 193 ? -10.621 19.293  13.404  1.00 86.01  ? 208 GLU Y CB  1 
ATOM   6858  C CG  . GLU F  3 193 ? -9.998  19.707  12.075  1.00 100.39 ? 208 GLU Y CG  1 
ATOM   6859  C CD  . GLU F  3 193 ? -8.522  20.069  12.099  1.00 130.34 ? 208 GLU Y CD  1 
ATOM   6860  O OE1 . GLU F  3 193 ? -8.174  21.137  12.656  1.00 135.71 ? 208 GLU Y OE1 1 
ATOM   6861  O OE2 . GLU F  3 193 ? -7.706  19.267  11.587  1.00 119.51 ? 208 GLU Y OE2 1 
ATOM   6862  N N   . LEU F  3 194 ? -13.919 19.488  14.303  1.00 75.77  ? 209 LEU Y N   1 
ATOM   6863  C CA  . LEU F  3 194 ? -15.042 20.405  14.561  1.00 74.23  ? 209 LEU Y CA  1 
ATOM   6864  C C   . LEU F  3 194 ? -14.529 21.536  15.509  1.00 88.13  ? 209 LEU Y C   1 
ATOM   6865  O O   . LEU F  3 194 ? -14.532 21.316  16.726  1.00 90.07  ? 209 LEU Y O   1 
ATOM   6866  C CB  . LEU F  3 194 ? -16.201 19.674  15.282  1.00 69.82  ? 209 LEU Y CB  1 
ATOM   6867  C CG  . LEU F  3 194 ? -17.366 19.092  14.484  1.00 67.11  ? 209 LEU Y CG  1 
ATOM   6868  C CD1 . LEU F  3 194 ? -18.525 18.757  15.414  1.00 64.24  ? 209 LEU Y CD1 1 
ATOM   6869  C CD2 . LEU F  3 194 ? -17.831 20.029  13.395  1.00 66.40  ? 209 LEU Y CD2 1 
ATOM   6870  N N   . PRO F  3 195 ? -14.090 22.735  15.031  1.00 90.26  ? 210 PRO Y N   1 
ATOM   6871  C CA  . PRO F  3 195 ? -13.606 23.765  15.979  1.00 95.91  ? 210 PRO Y CA  1 
ATOM   6872  C C   . PRO F  3 195 ? -14.685 24.241  16.949  1.00 100.77 ? 210 PRO Y C   1 
ATOM   6873  O O   . PRO F  3 195 ? -15.863 24.062  16.660  1.00 96.15  ? 210 PRO Y O   1 
ATOM   6874  C CB  . PRO F  3 195 ? -13.091 24.887  15.073  1.00 100.35 ? 210 PRO Y CB  1 
ATOM   6875  C CG  . PRO F  3 195 ? -13.769 24.687  13.783  1.00 100.41 ? 210 PRO Y CG  1 
ATOM   6876  C CD  . PRO F  3 195 ? -13.987 23.205  13.636  1.00 91.82  ? 210 PRO Y CD  1 
ATOM   6877  N N   . ASN F  3 196 ? -14.285 24.792  18.111  1.00 103.00 ? 211 ASN Y N   1 
ATOM   6878  C CA  . ASN F  3 196 ? -15.208 25.232  19.163  1.00 104.08 ? 211 ASN Y CA  1 
ATOM   6879  C C   . ASN F  3 196 ? -16.281 26.200  18.696  1.00 107.08 ? 211 ASN Y C   1 
ATOM   6880  O O   . ASN F  3 196 ? -17.463 26.023  19.031  1.00 104.26 ? 211 ASN Y O   1 
ATOM   6881  C CB  . ASN F  3 196 ? -14.449 25.809  20.346  1.00 113.67 ? 211 ASN Y CB  1 
ATOM   6882  C CG  . ASN F  3 196 ? -14.404 24.862  21.509  1.00 142.62 ? 211 ASN Y CG  1 
ATOM   6883  O OD1 . ASN F  3 196 ? -15.420 24.608  22.173  1.00 136.16 ? 211 ASN Y OD1 1 
ATOM   6884  N ND2 . ASN F  3 196 ? -13.228 24.296  21.760  1.00 135.29 ? 211 ASN Y ND2 1 
ATOM   6885  N N   . ASP F  3 197 ? -15.883 27.193  17.886  1.00 105.47 ? 212 ASP Y N   1 
ATOM   6886  C CA  . ASP F  3 197 ? -16.823 28.174  17.371  1.00 104.64 ? 212 ASP Y CA  1 
ATOM   6887  C C   . ASP F  3 197 ? -17.538 27.702  16.086  1.00 103.25 ? 212 ASP Y C   1 
ATOM   6888  O O   . ASP F  3 197 ? -17.747 28.518  15.195  1.00 104.18 ? 212 ASP Y O   1 
ATOM   6889  C CB  . ASP F  3 197 ? -16.156 29.557  17.194  1.00 112.09 ? 212 ASP Y CB  1 
ATOM   6890  C CG  . ASP F  3 197 ? -15.405 30.098  18.404  1.00 132.65 ? 212 ASP Y CG  1 
ATOM   6891  O OD1 . ASP F  3 197 ? -15.958 30.035  19.528  1.00 134.60 ? 212 ASP Y OD1 1 
ATOM   6892  O OD2 . ASP F  3 197 ? -14.287 30.637  18.218  1.00 143.07 ? 212 ASP Y OD2 1 
ATOM   6893  N N   . VAL F  3 198 ? -17.948 26.414  15.991  1.00 93.48  ? 213 VAL Y N   1 
ATOM   6894  C CA  . VAL F  3 198 ? -18.707 25.971  14.817  1.00 88.46  ? 213 VAL Y CA  1 
ATOM   6895  C C   . VAL F  3 198 ? -20.133 26.458  14.974  1.00 90.45  ? 213 VAL Y C   1 
ATOM   6896  O O   . VAL F  3 198 ? -20.710 27.033  14.045  1.00 89.03  ? 213 VAL Y O   1 
ATOM   6897  C CB  . VAL F  3 198 ? -18.677 24.449  14.476  1.00 88.91  ? 213 VAL Y CB  1 
ATOM   6898  C CG1 . VAL F  3 198 ? -17.478 24.093  13.618  1.00 89.96  ? 213 VAL Y CG1 1 
ATOM   6899  C CG2 . VAL F  3 198 ? -18.789 23.544  15.706  1.00 88.27  ? 213 VAL Y CG2 1 
ATOM   6900  N N   . PHE F  3 199 ? -20.681 26.262  16.180  1.00 86.95  ? 214 PHE Y N   1 
ATOM   6901  C CA  . PHE F  3 199 ? -22.041 26.634  16.513  1.00 85.41  ? 214 PHE Y CA  1 
ATOM   6902  C C   . PHE F  3 199 ? -22.112 28.032  17.137  1.00 96.34  ? 214 PHE Y C   1 
ATOM   6903  O O   . PHE F  3 199 ? -23.023 28.305  17.923  1.00 97.43  ? 214 PHE Y O   1 
ATOM   6904  C CB  . PHE F  3 199 ? -22.710 25.534  17.368  1.00 84.54  ? 214 PHE Y CB  1 
ATOM   6905  C CG  . PHE F  3 199 ? -22.603 24.153  16.745  1.00 82.02  ? 214 PHE Y CG  1 
ATOM   6906  C CD1 . PHE F  3 199 ? -23.047 23.916  15.446  1.00 81.05  ? 214 PHE Y CD1 1 
ATOM   6907  C CD2 . PHE F  3 199 ? -22.040 23.096  17.448  1.00 83.82  ? 214 PHE Y CD2 1 
ATOM   6908  C CE1 . PHE F  3 199 ? -22.907 22.659  14.858  1.00 77.95  ? 214 PHE Y CE1 1 
ATOM   6909  C CE2 . PHE F  3 199 ? -21.911 21.836  16.859  1.00 82.94  ? 214 PHE Y CE2 1 
ATOM   6910  C CZ  . PHE F  3 199 ? -22.347 21.628  15.571  1.00 77.41  ? 214 PHE Y CZ  1 
ATOM   6911  N N   . HIS F  3 200 ? -21.176 28.937  16.749  1.00 97.28  ? 215 HIS Y N   1 
ATOM   6912  C CA  . HIS F  3 200 ? -21.206 30.331  17.201  1.00 102.57 ? 215 HIS Y CA  1 
ATOM   6913  C C   . HIS F  3 200 ? -22.260 31.034  16.356  1.00 105.44 ? 215 HIS Y C   1 
ATOM   6914  O O   . HIS F  3 200 ? -22.375 30.727  15.165  1.00 102.59 ? 215 HIS Y O   1 
ATOM   6915  C CB  . HIS F  3 200 ? -19.851 31.029  17.029  1.00 108.23 ? 215 HIS Y CB  1 
ATOM   6916  C CG  . HIS F  3 200 ? -19.821 32.415  17.609  1.00 117.30 ? 215 HIS Y CG  1 
ATOM   6917  N ND1 . HIS F  3 200 ? -20.511 33.466  17.018  1.00 120.11 ? 215 HIS Y ND1 1 
ATOM   6918  C CD2 . HIS F  3 200 ? -19.180 32.880  18.708  1.00 124.24 ? 215 HIS Y CD2 1 
ATOM   6919  C CE1 . HIS F  3 200 ? -20.270 34.525  17.774  1.00 124.99 ? 215 HIS Y CE1 1 
ATOM   6920  N NE2 . HIS F  3 200 ? -19.470 34.224  18.799  1.00 128.06 ? 215 HIS Y NE2 1 
ATOM   6921  N N   . GLY F  3 201 ? -23.026 31.933  16.981  1.00 103.73 ? 216 GLY Y N   1 
ATOM   6922  C CA  . GLY F  3 201 ? -24.118 32.660  16.334  1.00 103.01 ? 216 GLY Y CA  1 
ATOM   6923  C C   . GLY F  3 201 ? -25.222 31.779  15.751  1.00 100.76 ? 216 GLY Y C   1 
ATOM   6924  O O   . GLY F  3 201 ? -25.963 32.207  14.861  1.00 99.41  ? 216 GLY Y O   1 
ATOM   6925  N N   . ALA F  3 202 ? -25.346 30.542  16.234  1.00 92.99  ? 217 ALA Y N   1 
ATOM   6926  C CA  . ALA F  3 202 ? -26.349 29.643  15.699  1.00 88.26  ? 217 ALA Y CA  1 
ATOM   6927  C C   . ALA F  3 202 ? -27.219 29.069  16.774  1.00 91.35  ? 217 ALA Y C   1 
ATOM   6928  O O   . ALA F  3 202 ? -26.713 28.538  17.769  1.00 93.23  ? 217 ALA Y O   1 
ATOM   6929  C CB  . ALA F  3 202 ? -25.685 28.510  14.926  1.00 86.04  ? 217 ALA Y CB  1 
ATOM   6930  N N   . SER F  3 203 ? -28.536 29.139  16.556  1.00 84.62  ? 218 SER Y N   1 
ATOM   6931  C CA  . SER F  3 203 ? -29.504 28.509  17.434  1.00 83.36  ? 218 SER Y CA  1 
ATOM   6932  C C   . SER F  3 203 ? -29.389 27.018  17.101  1.00 84.21  ? 218 SER Y C   1 
ATOM   6933  O O   . SER F  3 203 ? -29.142 26.675  15.942  1.00 81.23  ? 218 SER Y O   1 
ATOM   6934  C CB  . SER F  3 203 ? -30.905 29.003  17.111  1.00 85.27  ? 218 SER Y CB  1 
ATOM   6935  O OG  . SER F  3 203 ? -30.969 30.406  17.288  1.00 98.08  ? 218 SER Y OG  1 
ATOM   6936  N N   . GLY F  3 204 ? -29.480 26.162  18.112  1.00 80.52  ? 219 GLY Y N   1 
ATOM   6937  C CA  . GLY F  3 204 ? -29.373 24.719  17.918  1.00 76.59  ? 219 GLY Y CA  1 
ATOM   6938  C C   . GLY F  3 204 ? -27.974 24.248  17.566  1.00 77.14  ? 219 GLY Y C   1 
ATOM   6939  O O   . GLY F  3 204 ? -27.011 24.921  17.925  1.00 80.30  ? 219 GLY Y O   1 
ATOM   6940  N N   . PRO F  3 205 ? -27.790 23.093  16.888  1.00 68.56  ? 220 PRO Y N   1 
ATOM   6941  C CA  . PRO F  3 205 ? -28.811 22.175  16.348  1.00 64.37  ? 220 PRO Y CA  1 
ATOM   6942  C C   . PRO F  3 205 ? -29.538 21.364  17.414  1.00 66.01  ? 220 PRO Y C   1 
ATOM   6943  O O   . PRO F  3 205 ? -29.031 21.190  18.516  1.00 67.96  ? 220 PRO Y O   1 
ATOM   6944  C CB  . PRO F  3 205 ? -28.009 21.314  15.360  1.00 63.52  ? 220 PRO Y CB  1 
ATOM   6945  C CG  . PRO F  3 205 ? -26.645 21.260  15.951  1.00 69.84  ? 220 PRO Y CG  1 
ATOM   6946  C CD  . PRO F  3 205 ? -26.428 22.626  16.554  1.00 69.35  ? 220 PRO Y CD  1 
ATOM   6947  N N   . VAL F  3 206 ? -30.748 20.923  17.092  1.00 58.79  ? 221 VAL Y N   1 
ATOM   6948  C CA  . VAL F  3 206 ? -31.594 20.106  17.970  1.00 57.78  ? 221 VAL Y CA  1 
ATOM   6949  C C   . VAL F  3 206 ? -31.302 18.637  17.629  1.00 58.58  ? 221 VAL Y C   1 
ATOM   6950  O O   . VAL F  3 206 ? -31.345 17.760  18.500  1.00 58.59  ? 221 VAL Y O   1 
ATOM   6951  C CB  . VAL F  3 206 ? -33.088 20.493  17.824  1.00 59.58  ? 221 VAL Y CB  1 
ATOM   6952  C CG1 . VAL F  3 206 ? -33.920 19.905  18.949  1.00 60.86  ? 221 VAL Y CG1 1 
ATOM   6953  C CG2 . VAL F  3 206 ? -33.242 22.003  17.795  1.00 60.41  ? 221 VAL Y CG2 1 
ATOM   6954  N N   . ILE F  3 207 ? -30.970 18.398  16.347  1.00 52.60  ? 222 ILE Y N   1 
ATOM   6955  C CA  . ILE F  3 207 ? -30.556 17.108  15.811  1.00 50.71  ? 222 ILE Y CA  1 
ATOM   6956  C C   . ILE F  3 207 ? -29.171 17.276  15.172  1.00 54.77  ? 222 ILE Y C   1 
ATOM   6957  O O   . ILE F  3 207 ? -28.961 18.193  14.363  1.00 54.02  ? 222 ILE Y O   1 
ATOM   6958  C CB  . ILE F  3 207 ? -31.587 16.458  14.852  1.00 51.44  ? 222 ILE Y CB  1 
ATOM   6959  C CG1 . ILE F  3 207 ? -32.929 16.263  15.560  1.00 53.17  ? 222 ILE Y CG1 1 
ATOM   6960  C CG2 . ILE F  3 207 ? -31.055 15.115  14.322  1.00 50.49  ? 222 ILE Y CG2 1 
ATOM   6961  C CD1 . ILE F  3 207 ? -33.987 15.779  14.733  1.00 63.75  ? 222 ILE Y CD1 1 
ATOM   6962  N N   . LEU F  3 208 ? -28.224 16.398  15.562  1.00 51.00  ? 223 LEU Y N   1 
ATOM   6963  C CA  . LEU F  3 208 ? -26.864 16.382  15.037  1.00 49.68  ? 223 LEU Y CA  1 
ATOM   6964  C C   . LEU F  3 208 ? -26.470 14.962  14.731  1.00 51.49  ? 223 LEU Y C   1 
ATOM   6965  O O   . LEU F  3 208 ? -26.496 14.109  15.625  1.00 52.62  ? 223 LEU Y O   1 
ATOM   6966  C CB  . LEU F  3 208 ? -25.871 17.025  16.027  1.00 52.12  ? 223 LEU Y CB  1 
ATOM   6967  C CG  . LEU F  3 208 ? -24.384 17.076  15.638  1.00 56.82  ? 223 LEU Y CG  1 
ATOM   6968  C CD1 . LEU F  3 208 ? -24.129 18.091  14.559  1.00 56.25  ? 223 LEU Y CD1 1 
ATOM   6969  C CD2 . LEU F  3 208 ? -23.536 17.457  16.822  1.00 61.70  ? 223 LEU Y CD2 1 
ATOM   6970  N N   . ASP F  3 209 ? -26.150 14.701  13.455  1.00 44.76  ? 224 ASP Y N   1 
ATOM   6971  C CA  . ASP F  3 209 ? -25.659 13.407  13.017  1.00 43.24  ? 224 ASP Y CA  1 
ATOM   6972  C C   . ASP F  3 209 ? -24.261 13.615  12.495  1.00 47.00  ? 224 ASP Y C   1 
ATOM   6973  O O   . ASP F  3 209 ? -24.066 14.331  11.504  1.00 46.54  ? 224 ASP Y O   1 
ATOM   6974  C CB  . ASP F  3 209 ? -26.548 12.739  11.955  1.00 43.24  ? 224 ASP Y CB  1 
ATOM   6975  C CG  . ASP F  3 209 ? -26.168 11.295  11.641  1.00 52.06  ? 224 ASP Y CG  1 
ATOM   6976  O OD1 . ASP F  3 209 ? -24.987 10.954  11.773  1.00 52.85  ? 224 ASP Y OD1 1 
ATOM   6977  O OD2 . ASP F  3 209 ? -27.064 10.509  11.262  1.00 57.16  ? 224 ASP Y OD2 1 
ATOM   6978  N N   . ILE F  3 210 ? -23.286 13.003  13.196  1.00 43.35  ? 225 ILE Y N   1 
ATOM   6979  C CA  . ILE F  3 210 ? -21.870 13.007  12.851  1.00 43.62  ? 225 ILE Y CA  1 
ATOM   6980  C C   . ILE F  3 210 ? -21.367 11.563  12.618  1.00 45.15  ? 225 ILE Y C   1 
ATOM   6981  O O   . ILE F  3 210 ? -20.183 11.300  12.749  1.00 46.03  ? 225 ILE Y O   1 
ATOM   6982  C CB  . ILE F  3 210 ? -21.008 13.809  13.870  1.00 50.23  ? 225 ILE Y CB  1 
ATOM   6983  C CG1 . ILE F  3 210 ? -21.224 13.322  15.319  1.00 52.01  ? 225 ILE Y CG1 1 
ATOM   6984  C CG2 . ILE F  3 210 ? -21.212 15.338  13.730  1.00 52.25  ? 225 ILE Y CG2 1 
ATOM   6985  C CD1 . ILE F  3 210 ? -19.936 13.290  16.132  1.00 61.46  ? 225 ILE Y CD1 1 
ATOM   6986  N N   . SER F  3 211 ? -22.267 10.645  12.236  1.00 39.91  ? 226 SER Y N   1 
ATOM   6987  C CA  . SER F  3 211 ? -21.970 9.237   11.959  1.00 40.12  ? 226 SER Y CA  1 
ATOM   6988  C C   . SER F  3 211 ? -20.926 9.054   10.867  1.00 47.35  ? 226 SER Y C   1 
ATOM   6989  O O   . SER F  3 211 ? -20.926 9.805   9.901   1.00 48.85  ? 226 SER Y O   1 
ATOM   6990  C CB  . SER F  3 211 ? -23.232 8.495   11.541  1.00 39.86  ? 226 SER Y CB  1 
ATOM   6991  O OG  . SER F  3 211 ? -24.155 8.444   12.611  1.00 47.04  ? 226 SER Y OG  1 
ATOM   6992  N N   . ARG F  3 212 ? -20.047 8.054   11.003  1.00 43.75  ? 227 ARG Y N   1 
ATOM   6993  C CA  . ARG F  3 212 ? -19.031 7.743   10.004  1.00 43.86  ? 227 ARG Y CA  1 
ATOM   6994  C C   . ARG F  3 212 ? -18.191 8.987   9.586   1.00 51.48  ? 227 ARG Y C   1 
ATOM   6995  O O   . ARG F  3 212 ? -18.097 9.348   8.411   1.00 50.68  ? 227 ARG Y O   1 
ATOM   6996  C CB  . ARG F  3 212 ? -19.666 7.006   8.813   1.00 39.50  ? 227 ARG Y CB  1 
ATOM   6997  C CG  . ARG F  3 212 ? -20.309 5.683   9.257   1.00 42.20  ? 227 ARG Y CG  1 
ATOM   6998  C CD  . ARG F  3 212 ? -21.365 5.150   8.320   1.00 39.17  ? 227 ARG Y CD  1 
ATOM   6999  N NE  . ARG F  3 212 ? -22.418 6.134   8.088   1.00 49.39  ? 227 ARG Y NE  1 
ATOM   7000  C CZ  . ARG F  3 212 ? -23.564 6.193   8.755   1.00 55.95  ? 227 ARG Y CZ  1 
ATOM   7001  N NH1 . ARG F  3 212 ? -23.839 5.294   9.696   1.00 31.35  ? 227 ARG Y NH1 1 
ATOM   7002  N NH2 . ARG F  3 212 ? -24.440 7.156   8.495   1.00 41.66  ? 227 ARG Y NH2 1 
ATOM   7003  N N   . THR F  3 213 ? -17.605 9.645   10.595  1.00 52.01  ? 228 THR Y N   1 
ATOM   7004  C CA  . THR F  3 213 ? -16.688 10.778  10.467  1.00 54.82  ? 228 THR Y CA  1 
ATOM   7005  C C   . THR F  3 213 ? -15.510 10.584  11.449  1.00 64.97  ? 228 THR Y C   1 
ATOM   7006  O O   . THR F  3 213 ? -15.708 10.203  12.613  1.00 66.16  ? 228 THR Y O   1 
ATOM   7007  C CB  . THR F  3 213 ? -17.372 12.148  10.689  1.00 60.33  ? 228 THR Y CB  1 
ATOM   7008  O OG1 . THR F  3 213 ? -17.787 12.287  12.048  1.00 60.00  ? 228 THR Y OG1 1 
ATOM   7009  C CG2 . THR F  3 213 ? -18.524 12.424  9.724   1.00 55.64  ? 228 THR Y CG2 1 
ATOM   7010  N N   . ARG F  3 214 ? -14.289 10.907  10.985  1.00 63.87  ? 229 ARG Y N   1 
ATOM   7011  C CA  . ARG F  3 214 ? -13.058 10.853  11.779  1.00 66.33  ? 229 ARG Y CA  1 
ATOM   7012  C C   . ARG F  3 214 ? -13.043 11.928  12.914  1.00 71.49  ? 229 ARG Y C   1 
ATOM   7013  O O   . ARG F  3 214 ? -12.005 12.123  13.553  1.00 74.44  ? 229 ARG Y O   1 
ATOM   7014  C CB  . ARG F  3 214 ? -11.848 11.008  10.851  1.00 67.15  ? 229 ARG Y CB  1 
ATOM   7015  C CG  . ARG F  3 214 ? -11.632 9.818   9.944   1.00 81.34  ? 229 ARG Y CG  1 
ATOM   7016  C CD  . ARG F  3 214 ? -10.414 9.933   9.043   1.00 97.83  ? 229 ARG Y CD  1 
ATOM   7017  N NE  . ARG F  3 214 ? -10.138 8.632   8.431   1.00 113.17 ? 229 ARG Y NE  1 
ATOM   7018  C CZ  . ARG F  3 214 ? -10.559 8.250   7.227   1.00 126.13 ? 229 ARG Y CZ  1 
ATOM   7019  N NH1 . ARG F  3 214 ? -11.229 9.093   6.452   1.00 112.05 ? 229 ARG Y NH1 1 
ATOM   7020  N NH2 . ARG F  3 214 ? -10.281 7.033   6.777   1.00 111.95 ? 229 ARG Y NH2 1 
ATOM   7021  N N   . ILE F  3 215 ? -14.197 12.607  13.167  1.00 65.11  ? 230 ILE Y N   1 
ATOM   7022  C CA  . ILE F  3 215 ? -14.329 13.629  14.206  1.00 67.10  ? 230 ILE Y CA  1 
ATOM   7023  C C   . ILE F  3 215 ? -13.868 13.031  15.545  1.00 78.16  ? 230 ILE Y C   1 
ATOM   7024  O O   . ILE F  3 215 ? -14.272 11.916  15.897  1.00 76.82  ? 230 ILE Y O   1 
ATOM   7025  C CB  . ILE F  3 215 ? -15.745 14.314  14.227  1.00 66.52  ? 230 ILE Y CB  1 
ATOM   7026  C CG1 . ILE F  3 215 ? -15.994 15.120  12.914  1.00 64.56  ? 230 ILE Y CG1 1 
ATOM   7027  C CG2 . ILE F  3 215 ? -15.946 15.212  15.464  1.00 68.07  ? 230 ILE Y CG2 1 
ATOM   7028  C CD1 . ILE F  3 215 ? -17.432 15.668  12.677  1.00 57.96  ? 230 ILE Y CD1 1 
ATOM   7029  N N   . HIS F  3 216 ? -12.934 13.752  16.212  1.00 81.71  ? 231 HIS Y N   1 
ATOM   7030  C CA  . HIS F  3 216 ? -12.253 13.412  17.465  1.00 86.48  ? 231 HIS Y CA  1 
ATOM   7031  C C   . HIS F  3 216 ? -12.936 13.863  18.760  1.00 91.95  ? 231 HIS Y C   1 
ATOM   7032  O O   . HIS F  3 216 ? -12.690 13.247  19.806  1.00 93.76  ? 231 HIS Y O   1 
ATOM   7033  C CB  . HIS F  3 216 ? -10.822 13.969  17.436  1.00 92.57  ? 231 HIS Y CB  1 
ATOM   7034  C CG  . HIS F  3 216 ? -9.974  13.311  16.402  1.00 96.65  ? 231 HIS Y CG  1 
ATOM   7035  N ND1 . HIS F  3 216 ? -9.308  12.124  16.664  1.00 100.36 ? 231 HIS Y ND1 1 
ATOM   7036  C CD2 . HIS F  3 216 ? -9.752  13.665  15.117  1.00 97.78  ? 231 HIS Y CD2 1 
ATOM   7037  C CE1 . HIS F  3 216 ? -8.719  11.787  15.528  1.00 99.67  ? 231 HIS Y CE1 1 
ATOM   7038  N NE2 . HIS F  3 216 ? -8.943  12.693  14.573  1.00 98.58  ? 231 HIS Y NE2 1 
ATOM   7039  N N   . SER F  3 217 ? -13.724 14.967  18.716  1.00 87.58  ? 232 SER Y N   1 
ATOM   7040  C CA  . SER F  3 217 ? -14.388 15.552  19.893  1.00 89.21  ? 232 SER Y CA  1 
ATOM   7041  C C   . SER F  3 217 ? -15.508 16.507  19.489  1.00 91.25  ? 232 SER Y C   1 
ATOM   7042  O O   . SER F  3 217 ? -15.544 16.961  18.347  1.00 88.53  ? 232 SER Y O   1 
ATOM   7043  C CB  . SER F  3 217 ? -13.369 16.295  20.764  1.00 98.27  ? 232 SER Y CB  1 
ATOM   7044  O OG  . SER F  3 217 ? -13.917 16.811  21.968  1.00 107.97 ? 232 SER Y OG  1 
ATOM   7045  N N   . LEU F  3 218 ? -16.394 16.840  20.447  1.00 89.70  ? 233 LEU Y N   1 
ATOM   7046  C CA  . LEU F  3 218 ? -17.500 17.780  20.266  1.00 88.50  ? 233 LEU Y CA  1 
ATOM   7047  C C   . LEU F  3 218 ? -17.204 19.148  20.891  1.00 98.95  ? 233 LEU Y C   1 
ATOM   7048  O O   . LEU F  3 218 ? -16.523 19.186  21.921  1.00 103.72 ? 233 LEU Y O   1 
ATOM   7049  C CB  . LEU F  3 218 ? -18.778 17.209  20.888  1.00 86.76  ? 233 LEU Y CB  1 
ATOM   7050  C CG  . LEU F  3 218 ? -19.564 16.240  20.021  1.00 86.75  ? 233 LEU Y CG  1 
ATOM   7051  C CD1 . LEU F  3 218 ? -20.729 15.670  20.795  1.00 86.41  ? 233 LEU Y CD1 1 
ATOM   7052  C CD2 . LEU F  3 218 ? -20.047 16.909  18.728  1.00 85.20  ? 233 LEU Y CD2 1 
ATOM   7053  N N   . PRO F  3 219 ? -17.726 20.279  20.340  1.00 95.80  ? 234 PRO Y N   1 
ATOM   7054  C CA  . PRO F  3 219 ? -17.456 21.585  20.967  1.00 100.18 ? 234 PRO Y CA  1 
ATOM   7055  C C   . PRO F  3 219 ? -18.108 21.728  22.341  1.00 107.68 ? 234 PRO Y C   1 
ATOM   7056  O O   . PRO F  3 219 ? -19.202 21.210  22.562  1.00 104.09 ? 234 PRO Y O   1 
ATOM   7057  C CB  . PRO F  3 219 ? -18.001 22.592  19.955  1.00 99.96  ? 234 PRO Y CB  1 
ATOM   7058  C CG  . PRO F  3 219 ? -19.022 21.850  19.195  1.00 98.98  ? 234 PRO Y CG  1 
ATOM   7059  C CD  . PRO F  3 219 ? -18.552 20.433  19.125  1.00 93.34  ? 234 PRO Y CD  1 
ATOM   7060  N N   . SER F  3 220 ? -17.407 22.415  23.268  1.00 111.57 ? 235 SER Y N   1 
ATOM   7061  C CA  . SER F  3 220 ? -17.811 22.660  24.662  1.00 115.61 ? 235 SER Y CA  1 
ATOM   7062  C C   . SER F  3 220 ? -19.156 23.365  24.795  1.00 119.70 ? 235 SER Y C   1 
ATOM   7063  O O   . SER F  3 220 ? -19.816 23.221  25.829  1.00 121.48 ? 235 SER Y O   1 
ATOM   7064  C CB  . SER F  3 220 ? -16.747 23.479  25.392  1.00 125.25 ? 235 SER Y CB  1 
ATOM   7065  O OG  . SER F  3 220 ? -16.887 24.875  25.166  1.00 135.90 ? 235 SER Y OG  1 
ATOM   7066  N N   . TYR F  3 221 ? -19.525 24.166  23.768  1.00 113.82 ? 236 TYR Y N   1 
ATOM   7067  C CA  . TYR F  3 221 ? -20.741 24.972  23.736  1.00 112.11 ? 236 TYR Y CA  1 
ATOM   7068  C C   . TYR F  3 221 ? -21.440 24.934  22.376  1.00 105.62 ? 236 TYR Y C   1 
ATOM   7069  O O   . TYR F  3 221 ? -20.826 24.574  21.364  1.00 100.90 ? 236 TYR Y O   1 
ATOM   7070  C CB  . TYR F  3 221 ? -20.438 26.428  24.198  1.00 119.33 ? 236 TYR Y CB  1 
ATOM   7071  C CG  . TYR F  3 221 ? -19.973 27.369  23.102  1.00 122.19 ? 236 TYR Y CG  1 
ATOM   7072  C CD1 . TYR F  3 221 ? -18.634 27.422  22.721  1.00 126.38 ? 236 TYR Y CD1 1 
ATOM   7073  C CD2 . TYR F  3 221 ? -20.869 28.219  22.458  1.00 121.72 ? 236 TYR Y CD2 1 
ATOM   7074  C CE1 . TYR F  3 221 ? -18.205 28.274  21.703  1.00 127.83 ? 236 TYR Y CE1 1 
ATOM   7075  C CE2 . TYR F  3 221 ? -20.453 29.072  21.438  1.00 123.19 ? 236 TYR Y CE2 1 
ATOM   7076  C CZ  . TYR F  3 221 ? -19.118 29.103  21.071  1.00 133.49 ? 236 TYR Y CZ  1 
ATOM   7077  O OH  . TYR F  3 221 ? -18.709 29.960  20.079  1.00 137.10 ? 236 TYR Y OH  1 
ATOM   7078  N N   . GLY F  3 222 ? -22.698 25.374  22.387  1.00 99.39  ? 237 GLY Y N   1 
ATOM   7079  C CA  . GLY F  3 222 ? -23.576 25.423  21.226  1.00 94.16  ? 237 GLY Y CA  1 
ATOM   7080  C C   . GLY F  3 222 ? -24.621 24.328  21.255  1.00 92.26  ? 237 GLY Y C   1 
ATOM   7081  O O   . GLY F  3 222 ? -25.701 24.490  20.693  1.00 89.89  ? 237 GLY Y O   1 
ATOM   7082  N N   . LEU F  3 223 ? -24.306 23.217  21.946  1.00 86.95  ? 238 LEU Y N   1 
ATOM   7083  C CA  . LEU F  3 223 ? -25.117 22.000  22.088  1.00 82.62  ? 238 LEU Y CA  1 
ATOM   7084  C C   . LEU F  3 223 ? -26.156 22.062  23.232  1.00 84.42  ? 238 LEU Y C   1 
ATOM   7085  O O   . LEU F  3 223 ? -26.783 21.051  23.576  1.00 81.43  ? 238 LEU Y O   1 
ATOM   7086  C CB  . LEU F  3 223 ? -24.179 20.779  22.235  1.00 82.43  ? 238 LEU Y CB  1 
ATOM   7087  C CG  . LEU F  3 223 ? -23.028 20.660  21.217  1.00 85.86  ? 238 LEU Y CG  1 
ATOM   7088  C CD1 . LEU F  3 223 ? -22.035 19.591  21.631  1.00 87.41  ? 238 LEU Y CD1 1 
ATOM   7089  C CD2 . LEU F  3 223 ? -23.545 20.373  19.817  1.00 83.94  ? 238 LEU Y CD2 1 
ATOM   7090  N N   . GLU F  3 224 ? -26.367 23.263  23.784  1.00 83.11  ? 239 GLU Y N   1 
ATOM   7091  C CA  . GLU F  3 224 ? -27.333 23.500  24.856  1.00 85.72  ? 239 GLU Y CA  1 
ATOM   7092  C C   . GLU F  3 224 ? -28.791 23.188  24.433  1.00 85.72  ? 239 GLU Y C   1 
ATOM   7093  O O   . GLU F  3 224 ? -29.633 22.928  25.297  1.00 87.65  ? 239 GLU Y O   1 
ATOM   7094  C CB  . GLU F  3 224 ? -27.193 24.921  25.458  1.00 91.69  ? 239 GLU Y CB  1 
ATOM   7095  C CG  . GLU F  3 224 ? -27.226 26.084  24.470  1.00 104.12 ? 239 GLU Y CG  1 
ATOM   7096  C CD  . GLU F  3 224 ? -25.914 26.510  23.829  1.00 131.65 ? 239 GLU Y CD  1 
ATOM   7097  O OE1 . GLU F  3 224 ? -24.830 26.137  24.340  1.00 120.41 ? 239 GLU Y OE1 1 
ATOM   7098  O OE2 . GLU F  3 224 ? -25.977 27.248  22.818  1.00 130.83 ? 239 GLU Y OE2 1 
ATOM   7099  N N   . ASN F  3 225 ? -29.062 23.160  23.110  1.00 76.08  ? 240 ASN Y N   1 
ATOM   7100  C CA  . ASN F  3 225 ? -30.382 22.871  22.546  1.00 72.22  ? 240 ASN Y CA  1 
ATOM   7101  C C   . ASN F  3 225 ? -30.453 21.477  21.872  1.00 68.98  ? 240 ASN Y C   1 
ATOM   7102  O O   . ASN F  3 225 ? -31.524 21.055  21.417  1.00 66.67  ? 240 ASN Y O   1 
ATOM   7103  C CB  . ASN F  3 225 ? -30.804 23.988  21.568  1.00 73.91  ? 240 ASN Y CB  1 
ATOM   7104  C CG  . ASN F  3 225 ? -30.589 25.394  22.077  1.00 98.51  ? 240 ASN Y CG  1 
ATOM   7105  O OD1 . ASN F  3 225 ? -31.144 25.805  23.107  1.00 91.75  ? 240 ASN Y OD1 1 
ATOM   7106  N ND2 . ASN F  3 225 ? -29.765 26.157  21.360  1.00 91.96  ? 240 ASN Y ND2 1 
ATOM   7107  N N   . LEU F  3 226 ? -29.324 20.757  21.844  1.00 62.55  ? 241 LEU Y N   1 
ATOM   7108  C CA  . LEU F  3 226 ? -29.225 19.423  21.259  1.00 58.14  ? 241 LEU Y CA  1 
ATOM   7109  C C   . LEU F  3 226 ? -30.053 18.358  22.003  1.00 61.64  ? 241 LEU Y C   1 
ATOM   7110  O O   . LEU F  3 226 ? -29.746 18.037  23.154  1.00 64.32  ? 241 LEU Y O   1 
ATOM   7111  C CB  . LEU F  3 226 ? -27.738 19.017  21.141  1.00 57.66  ? 241 LEU Y CB  1 
ATOM   7112  C CG  . LEU F  3 226 ? -27.397 17.640  20.579  1.00 58.89  ? 241 LEU Y CG  1 
ATOM   7113  C CD1 . LEU F  3 226 ? -27.915 17.468  19.162  1.00 54.96  ? 241 LEU Y CD1 1 
ATOM   7114  C CD2 . LEU F  3 226 ? -25.913 17.414  20.619  1.00 61.85  ? 241 LEU Y CD2 1 
ATOM   7115  N N   . LYS F  3 227 ? -31.080 17.807  21.320  1.00 54.67  ? 242 LYS Y N   1 
ATOM   7116  C CA  . LYS F  3 227 ? -31.958 16.750  21.820  1.00 55.00  ? 242 LYS Y CA  1 
ATOM   7117  C C   . LYS F  3 227 ? -31.567 15.368  21.260  1.00 60.55  ? 242 LYS Y C   1 
ATOM   7118  O O   . LYS F  3 227 ? -31.695 14.380  21.981  1.00 62.92  ? 242 LYS Y O   1 
ATOM   7119  C CB  . LYS F  3 227 ? -33.415 17.041  21.475  1.00 55.96  ? 242 LYS Y CB  1 
ATOM   7120  C CG  . LYS F  3 227 ? -34.059 18.137  22.297  1.00 68.32  ? 242 LYS Y CG  1 
ATOM   7121  C CD  . LYS F  3 227 ? -35.534 18.248  21.959  1.00 73.95  ? 242 LYS Y CD  1 
ATOM   7122  C CE  . LYS F  3 227 ? -36.331 19.045  22.959  1.00 83.19  ? 242 LYS Y CE  1 
ATOM   7123  N NZ  . LYS F  3 227 ? -37.777 18.686  22.912  1.00 91.58  ? 242 LYS Y NZ  1 
ATOM   7124  N N   . LYS F  3 228 ? -31.123 15.277  19.982  1.00 55.55  ? 243 LYS Y N   1 
ATOM   7125  C CA  . LYS F  3 228 ? -30.744 13.974  19.397  1.00 54.53  ? 243 LYS Y CA  1 
ATOM   7126  C C   . LYS F  3 228 ? -29.306 13.918  18.848  1.00 61.67  ? 243 LYS Y C   1 
ATOM   7127  O O   . LYS F  3 228 ? -28.966 14.648  17.907  1.00 61.52  ? 243 LYS Y O   1 
ATOM   7128  C CB  . LYS F  3 228 ? -31.737 13.516  18.323  1.00 53.01  ? 243 LYS Y CB  1 
ATOM   7129  C CG  . LYS F  3 228 ? -33.106 13.139  18.857  1.00 56.23  ? 243 LYS Y CG  1 
ATOM   7130  C CD  . LYS F  3 228 ? -34.211 13.671  17.949  1.00 55.28  ? 243 LYS Y CD  1 
ATOM   7131  C CE  . LYS F  3 228 ? -35.588 13.313  18.427  1.00 63.03  ? 243 LYS Y CE  1 
ATOM   7132  N NZ  . LYS F  3 228 ? -36.022 11.977  17.946  1.00 74.38  ? 243 LYS Y NZ  1 
ATOM   7133  N N   . LEU F  3 229 ? -28.471 13.032  19.421  1.00 59.10  ? 244 LEU Y N   1 
ATOM   7134  C CA  . LEU F  3 229 ? -27.094 12.862  18.966  1.00 58.05  ? 244 LEU Y CA  1 
ATOM   7135  C C   . LEU F  3 229 ? -26.917 11.522  18.258  1.00 60.02  ? 244 LEU Y C   1 
ATOM   7136  O O   . LEU F  3 229 ? -27.250 10.459  18.806  1.00 60.85  ? 244 LEU Y O   1 
ATOM   7137  C CB  . LEU F  3 229 ? -26.087 13.031  20.120  1.00 61.24  ? 244 LEU Y CB  1 
ATOM   7138  C CG  . LEU F  3 229 ? -24.587 12.963  19.798  1.00 65.96  ? 244 LEU Y CG  1 
ATOM   7139  C CD1 . LEU F  3 229 ? -24.178 13.977  18.734  1.00 64.53  ? 244 LEU Y CD1 1 
ATOM   7140  C CD2 . LEU F  3 229 ? -23.783 13.243  21.038  1.00 73.22  ? 244 LEU Y CD2 1 
ATOM   7141  N N   . ARG F  3 230 ? -26.434 11.588  17.011  1.00 52.88  ? 245 ARG Y N   1 
ATOM   7142  C CA  . ARG F  3 230 ? -26.202 10.399  16.203  1.00 50.50  ? 245 ARG Y CA  1 
ATOM   7143  C C   . ARG F  3 230 ? -24.725 10.380  15.824  1.00 50.42  ? 245 ARG Y C   1 
ATOM   7144  O O   . ARG F  3 230 ? -24.242 11.304  15.179  1.00 47.53  ? 245 ARG Y O   1 
ATOM   7145  C CB  . ARG F  3 230 ? -27.160 10.331  14.988  1.00 49.49  ? 245 ARG Y CB  1 
ATOM   7146  C CG  . ARG F  3 230 ? -28.624 10.602  15.347  1.00 66.21  ? 245 ARG Y CG  1 
ATOM   7147  C CD  . ARG F  3 230 ? -29.604 10.257  14.243  1.00 83.14  ? 245 ARG Y CD  1 
ATOM   7148  N NE  . ARG F  3 230 ? -30.827 11.069  14.288  1.00 93.66  ? 245 ARG Y NE  1 
ATOM   7149  C CZ  . ARG F  3 230 ? -31.904 10.790  15.023  1.00 113.61 ? 245 ARG Y CZ  1 
ATOM   7150  N NH1 . ARG F  3 230 ? -31.916 9.729   15.824  1.00 104.58 ? 245 ARG Y NH1 1 
ATOM   7151  N NH2 . ARG F  3 230 ? -32.971 11.578  14.973  1.00 101.29 ? 245 ARG Y NH2 1 
ATOM   7152  N N   . ALA F  3 231 ? -24.001 9.371   16.328  1.00 48.22  ? 246 ALA Y N   1 
ATOM   7153  C CA  . ALA F  3 231 ? -22.567 9.166   16.135  1.00 49.40  ? 246 ALA Y CA  1 
ATOM   7154  C C   . ALA F  3 231 ? -22.268 7.660   15.944  1.00 55.41  ? 246 ALA Y C   1 
ATOM   7155  O O   . ALA F  3 231 ? -21.475 7.052   16.670  1.00 55.26  ? 246 ALA Y O   1 
ATOM   7156  C CB  . ALA F  3 231 ? -21.787 9.756   17.312  1.00 52.81  ? 246 ALA Y CB  1 
ATOM   7157  N N   . ARG F  3 232 ? -22.942 7.068   14.948  1.00 53.82  ? 247 ARG Y N   1 
ATOM   7158  C CA  . ARG F  3 232 ? -22.793 5.661   14.567  1.00 55.64  ? 247 ARG Y CA  1 
ATOM   7159  C C   . ARG F  3 232 ? -21.455 5.518   13.838  1.00 62.37  ? 247 ARG Y C   1 
ATOM   7160  O O   . ARG F  3 232 ? -21.185 6.269   12.902  1.00 61.57  ? 247 ARG Y O   1 
ATOM   7161  C CB  . ARG F  3 232 ? -23.927 5.209   13.618  1.00 55.35  ? 247 ARG Y CB  1 
ATOM   7162  C CG  . ARG F  3 232 ? -25.347 5.633   14.006  1.00 73.98  ? 247 ARG Y CG  1 
ATOM   7163  C CD  . ARG F  3 232 ? -26.178 4.486   14.543  1.00 94.74  ? 247 ARG Y CD  1 
ATOM   7164  N NE  . ARG F  3 232 ? -25.631 3.982   15.803  1.00 112.82 ? 247 ARG Y NE  1 
ATOM   7165  C CZ  . ARG F  3 232 ? -26.238 3.100   16.587  1.00 131.81 ? 247 ARG Y CZ  1 
ATOM   7166  N NH1 . ARG F  3 232 ? -27.434 2.620   16.258  1.00 119.08 ? 247 ARG Y NH1 1 
ATOM   7167  N NH2 . ARG F  3 232 ? -25.659 2.693   17.709  1.00 121.81 ? 247 ARG Y NH2 1 
ATOM   7168  N N   . SER F  3 233 ? -20.618 4.569   14.267  1.00 61.65  ? 248 SER Y N   1 
ATOM   7169  C CA  . SER F  3 233 ? -19.310 4.289   13.669  1.00 62.52  ? 248 SER Y CA  1 
ATOM   7170  C C   . SER F  3 233 ? -18.432 5.553   13.557  1.00 65.68  ? 248 SER Y C   1 
ATOM   7171  O O   . SER F  3 233 ? -17.937 5.882   12.478  1.00 64.53  ? 248 SER Y O   1 
ATOM   7172  C CB  . SER F  3 233 ? -19.460 3.552   12.335  1.00 65.84  ? 248 SER Y CB  1 
ATOM   7173  O OG  . SER F  3 233 ? -20.408 2.496   12.415  1.00 76.47  ? 248 SER Y OG  1 
ATOM   7174  N N   . THR F  3 234 ? -18.304 6.285   14.683  1.00 63.00  ? 249 THR Y N   1 
ATOM   7175  C CA  . THR F  3 234 ? -17.468 7.487   14.829  1.00 64.21  ? 249 THR Y CA  1 
ATOM   7176  C C   . THR F  3 234 ? -16.438 7.168   15.930  1.00 72.02  ? 249 THR Y C   1 
ATOM   7177  O O   . THR F  3 234 ? -16.498 7.663   17.074  1.00 73.52  ? 249 THR Y O   1 
ATOM   7178  C CB  . THR F  3 234 ? -18.286 8.781   15.029  1.00 69.24  ? 249 THR Y CB  1 
ATOM   7179  O OG1 . THR F  3 234 ? -18.774 8.874   16.362  1.00 73.41  ? 249 THR Y OG1 1 
ATOM   7180  C CG2 . THR F  3 234 ? -19.403 8.899   14.084  1.00 62.49  ? 249 THR Y CG2 1 
ATOM   7181  N N   . TYR F  3 235 ? -15.501 6.296   15.546  1.00 68.52  ? 250 TYR Y N   1 
ATOM   7182  C CA  . TYR F  3 235 ? -14.505 5.682   16.407  1.00 71.20  ? 250 TYR Y CA  1 
ATOM   7183  C C   . TYR F  3 235 ? -13.553 6.649   17.094  1.00 77.92  ? 250 TYR Y C   1 
ATOM   7184  O O   . TYR F  3 235 ? -13.150 6.358   18.218  1.00 80.55  ? 250 TYR Y O   1 
ATOM   7185  C CB  . TYR F  3 235 ? -13.748 4.588   15.648  1.00 72.25  ? 250 TYR Y CB  1 
ATOM   7186  C CG  . TYR F  3 235 ? -14.677 3.502   15.142  1.00 70.59  ? 250 TYR Y CG  1 
ATOM   7187  C CD1 . TYR F  3 235 ? -15.171 2.520   16.001  1.00 73.00  ? 250 TYR Y CD1 1 
ATOM   7188  C CD2 . TYR F  3 235 ? -15.125 3.501   13.825  1.00 68.30  ? 250 TYR Y CD2 1 
ATOM   7189  C CE1 . TYR F  3 235 ? -16.071 1.552   15.552  1.00 70.48  ? 250 TYR Y CE1 1 
ATOM   7190  C CE2 . TYR F  3 235 ? -16.024 2.540   13.367  1.00 67.38  ? 250 TYR Y CE2 1 
ATOM   7191  C CZ  . TYR F  3 235 ? -16.492 1.567   14.232  1.00 72.61  ? 250 TYR Y CZ  1 
ATOM   7192  O OH  . TYR F  3 235 ? -17.379 0.637   13.757  1.00 70.18  ? 250 TYR Y OH  1 
ATOM   7193  N N   . ASN F  3 236 ? -13.238 7.805   16.487  1.00 74.47  ? 251 ASN Y N   1 
ATOM   7194  C CA  . ASN F  3 236 ? -12.332 8.765   17.128  1.00 77.58  ? 251 ASN Y CA  1 
ATOM   7195  C C   . ASN F  3 236 ? -12.981 9.517   18.293  1.00 82.52  ? 251 ASN Y C   1 
ATOM   7196  O O   . ASN F  3 236 ? -12.275 9.943   19.208  1.00 85.32  ? 251 ASN Y O   1 
ATOM   7197  C CB  . ASN F  3 236 ? -11.716 9.718   16.114  1.00 76.05  ? 251 ASN Y CB  1 
ATOM   7198  C CG  . ASN F  3 236 ? -10.751 9.067   15.157  1.00 90.83  ? 251 ASN Y CG  1 
ATOM   7199  O OD1 . ASN F  3 236 ? -10.529 9.553   14.044  1.00 81.00  ? 251 ASN Y OD1 1 
ATOM   7200  N ND2 . ASN F  3 236 ? -10.130 7.970   15.567  1.00 88.85  ? 251 ASN Y ND2 1 
ATOM   7201  N N   . LEU F  3 237 ? -14.325 9.647   18.279  1.00 76.94  ? 252 LEU Y N   1 
ATOM   7202  C CA  . LEU F  3 237 ? -15.064 10.310  19.354  1.00 77.84  ? 252 LEU Y CA  1 
ATOM   7203  C C   . LEU F  3 237 ? -15.020 9.432   20.587  1.00 84.92  ? 252 LEU Y C   1 
ATOM   7204  O O   . LEU F  3 237 ? -15.856 8.543   20.758  1.00 83.73  ? 252 LEU Y O   1 
ATOM   7205  C CB  . LEU F  3 237 ? -16.508 10.598  18.941  1.00 73.80  ? 252 LEU Y CB  1 
ATOM   7206  C CG  . LEU F  3 237 ? -17.030 11.922  19.436  1.00 78.48  ? 252 LEU Y CG  1 
ATOM   7207  C CD1 . LEU F  3 237 ? -16.582 13.029  18.518  1.00 78.74  ? 252 LEU Y CD1 1 
ATOM   7208  C CD2 . LEU F  3 237 ? -18.538 11.906  19.535  1.00 75.66  ? 252 LEU Y CD2 1 
ATOM   7209  N N   . LYS F  3 238 ? -14.000 9.648   21.412  1.00 85.83  ? 253 LYS Y N   1 
ATOM   7210  C CA  . LYS F  3 238 ? -13.768 8.829   22.588  1.00 89.45  ? 253 LYS Y CA  1 
ATOM   7211  C C   . LYS F  3 238 ? -14.211 9.472   23.899  1.00 96.91  ? 253 LYS Y C   1 
ATOM   7212  O O   . LYS F  3 238 ? -14.560 8.737   24.823  1.00 98.59  ? 253 LYS Y O   1 
ATOM   7213  C CB  . LYS F  3 238 ? -12.296 8.402   22.644  1.00 95.60  ? 253 LYS Y CB  1 
ATOM   7214  C CG  . LYS F  3 238 ? -11.889 7.466   21.502  1.00 105.12 ? 253 LYS Y CG  1 
ATOM   7215  C CD  . LYS F  3 238 ? -10.509 7.811   20.940  1.00 115.58 ? 253 LYS Y CD  1 
ATOM   7216  C CE  . LYS F  3 238 ? -10.174 6.957   19.742  1.00 118.72 ? 253 LYS Y CE  1 
ATOM   7217  N NZ  . LYS F  3 238 ? -8.968  7.447   19.030  1.00 125.25 ? 253 LYS Y NZ  1 
ATOM   7218  N N   . LYS F  3 239 ? -14.221 10.821  23.992  1.00 94.53  ? 254 LYS Y N   1 
ATOM   7219  C CA  . LYS F  3 239 ? -14.606 11.472  25.247  1.00 98.06  ? 254 LYS Y CA  1 
ATOM   7220  C C   . LYS F  3 239 ? -16.122 11.748  25.381  1.00 98.92  ? 254 LYS Y C   1 
ATOM   7221  O O   . LYS F  3 239 ? -16.771 11.097  26.205  1.00 99.50  ? 254 LYS Y O   1 
ATOM   7222  C CB  . LYS F  3 239 ? -13.769 12.749  25.553  1.00 104.78 ? 254 LYS Y CB  1 
ATOM   7223  C CG  . LYS F  3 239 ? -13.713 13.833  24.457  1.00 122.70 ? 254 LYS Y CG  1 
ATOM   7224  C CD  . LYS F  3 239 ? -14.500 15.116  24.817  1.00 133.13 ? 254 LYS Y CD  1 
ATOM   7225  C CE  . LYS F  3 239 ? -13.632 16.253  25.304  1.00 145.26 ? 254 LYS Y CE  1 
ATOM   7226  N NZ  . LYS F  3 239 ? -14.273 17.575  25.067  1.00 151.52 ? 254 LYS Y NZ  1 
ATOM   7227  N N   . LEU F  3 240 ? -16.667 12.712  24.597  1.00 92.62  ? 255 LEU Y N   1 
ATOM   7228  C CA  . LEU F  3 240 ? -18.037 13.233  24.645  1.00 91.16  ? 255 LEU Y CA  1 
ATOM   7229  C C   . LEU F  3 240 ? -18.214 14.213  25.833  1.00 101.00 ? 255 LEU Y C   1 
ATOM   7230  O O   . LEU F  3 240 ? -17.591 14.019  26.887  1.00 105.20 ? 255 LEU Y O   1 
ATOM   7231  C CB  . LEU F  3 240 ? -19.117 12.126  24.719  1.00 89.23  ? 255 LEU Y CB  1 
ATOM   7232  C CG  . LEU F  3 240 ? -19.617 11.502  23.419  1.00 88.87  ? 255 LEU Y CG  1 
ATOM   7233  C CD1 . LEU F  3 240 ? -20.451 10.297  23.716  1.00 88.43  ? 255 LEU Y CD1 1 
ATOM   7234  C CD2 . LEU F  3 240 ? -20.504 12.455  22.658  1.00 88.26  ? 255 LEU Y CD2 1 
ATOM   7235  N N   . PRO F  3 241 ? -19.079 15.253  25.711  1.00 97.45  ? 256 PRO Y N   1 
ATOM   7236  C CA  . PRO F  3 241 ? -19.290 16.162  26.852  1.00 102.01 ? 256 PRO Y CA  1 
ATOM   7237  C C   . PRO F  3 241 ? -20.210 15.547  27.908  1.00 109.36 ? 256 PRO Y C   1 
ATOM   7238  O O   . PRO F  3 241 ? -20.877 14.547  27.638  1.00 105.98 ? 256 PRO Y O   1 
ATOM   7239  C CB  . PRO F  3 241 ? -19.920 17.407  26.213  1.00 101.33 ? 256 PRO Y CB  1 
ATOM   7240  C CG  . PRO F  3 241 ? -20.023 17.115  24.726  1.00 100.21 ? 256 PRO Y CG  1 
ATOM   7241  C CD  . PRO F  3 241 ? -19.914 15.650  24.560  1.00 93.97  ? 256 PRO Y CD  1 
ATOM   7242  N N   . THR F  3 242 ? -20.237 16.128  29.115  1.00 112.63 ? 257 THR Y N   1 
ATOM   7243  C CA  . THR F  3 242 ? -21.083 15.623  30.200  1.00 116.03 ? 257 THR Y CA  1 
ATOM   7244  C C   . THR F  3 242 ? -22.518 16.116  30.054  1.00 120.72 ? 257 THR Y C   1 
ATOM   7245  O O   . THR F  3 242 ? -22.732 17.187  29.477  1.00 118.76 ? 257 THR Y O   1 
ATOM   7246  C CB  . THR F  3 242 ? -20.494 15.984  31.571  1.00 128.40 ? 257 THR Y CB  1 
ATOM   7247  O OG1 . THR F  3 242 ? -20.146 17.368  31.594  1.00 129.31 ? 257 THR Y OG1 1 
ATOM   7248  C CG2 . THR F  3 242 ? -19.291 15.134  31.929  1.00 129.43 ? 257 THR Y CG2 1 
ATOM   7249  N N   . LEU F  3 243 ? -23.503 15.361  30.619  1.00 120.00 ? 258 LEU Y N   1 
ATOM   7250  C CA  . LEU F  3 243 ? -24.941 15.709  30.616  1.00 119.29 ? 258 LEU Y CA  1 
ATOM   7251  C C   . LEU F  3 243 ? -25.184 17.083  31.302  1.00 125.23 ? 258 LEU Y C   1 
ATOM   7252  O O   . LEU F  3 243 ? -26.294 17.628  31.274  1.00 123.58 ? 258 LEU Y O   1 
ATOM   7253  C CB  . LEU F  3 243 ? -25.764 14.589  31.281  1.00 121.67 ? 258 LEU Y CB  1 
ATOM   7254  C CG  . LEU F  3 243 ? -27.240 14.506  30.885  1.00 124.24 ? 258 LEU Y CG  1 
ATOM   7255  C CD1 . LEU F  3 243 ? -27.593 13.118  30.394  1.00 122.44 ? 258 LEU Y CD1 1 
ATOM   7256  C CD2 . LEU F  3 243 ? -28.141 14.915  32.045  1.00 131.34 ? 258 LEU Y CD2 1 
ATOM   7257  N N   . GLU F  3 244 ? -24.104 17.635  31.883  1.00 125.17 ? 259 GLU Y N   1 
ATOM   7258  C CA  . GLU F  3 244 ? -23.996 18.940  32.515  1.00 128.77 ? 259 GLU Y CA  1 
ATOM   7259  C C   . GLU F  3 244 ? -24.235 20.009  31.435  1.00 127.45 ? 259 GLU Y C   1 
ATOM   7260  O O   . GLU F  3 244 ? -25.091 20.874  31.618  1.00 127.72 ? 259 GLU Y O   1 
ATOM   7261  C CB  . GLU F  3 244 ? -22.588 19.068  33.140  1.00 135.26 ? 259 GLU Y CB  1 
ATOM   7262  C CG  . GLU F  3 244 ? -22.111 20.481  33.455  1.00 149.75 ? 259 GLU Y CG  1 
ATOM   7263  C CD  . GLU F  3 244 ? -20.625 20.729  33.248  1.00 170.75 ? 259 GLU Y CD  1 
ATOM   7264  O OE1 . GLU F  3 244 ? -19.896 19.778  32.878  1.00 150.55 ? 259 GLU Y OE1 1 
ATOM   7265  O OE2 . GLU F  3 244 ? -20.189 21.884  33.463  1.00 171.18 ? 259 GLU Y OE2 1 
ATOM   7266  N N   . LYS F  3 245 ? -23.493 19.928  30.311  1.00 119.15 ? 260 LYS Y N   1 
ATOM   7267  C CA  . LYS F  3 245 ? -23.618 20.864  29.190  1.00 115.25 ? 260 LYS Y CA  1 
ATOM   7268  C C   . LYS F  3 245 ? -24.509 20.300  28.055  1.00 111.76 ? 260 LYS Y C   1 
ATOM   7269  O O   . LYS F  3 245 ? -24.819 21.015  27.092  1.00 108.52 ? 260 LYS Y O   1 
ATOM   7270  C CB  . LYS F  3 245 ? -22.240 21.356  28.689  1.00 118.62 ? 260 LYS Y CB  1 
ATOM   7271  C CG  . LYS F  3 245 ? -21.213 20.269  28.373  1.00 132.98 ? 260 LYS Y CG  1 
ATOM   7272  C CD  . LYS F  3 245 ? -19.789 20.819  28.423  1.00 149.02 ? 260 LYS Y CD  1 
ATOM   7273  C CE  . LYS F  3 245 ? -19.169 20.690  29.798  1.00 169.18 ? 260 LYS Y CE  1 
ATOM   7274  N NZ  . LYS F  3 245 ? -17.886 21.433  29.914  1.00 183.19 ? 260 LYS Y NZ  1 
ATOM   7275  N N   . LEU F  3 246 ? -24.953 19.035  28.202  1.00 105.03 ? 261 LEU Y N   1 
ATOM   7276  C CA  . LEU F  3 246 ? -25.863 18.386  27.264  1.00 98.82  ? 261 LEU Y CA  1 
ATOM   7277  C C   . LEU F  3 246 ? -27.274 18.260  27.885  1.00 103.14 ? 261 LEU Y C   1 
ATOM   7278  O O   . LEU F  3 246 ? -28.002 17.310  27.591  1.00 101.22 ? 261 LEU Y O   1 
ATOM   7279  C CB  . LEU F  3 246 ? -25.306 17.023  26.811  1.00 96.21  ? 261 LEU Y CB  1 
ATOM   7280  C CG  . LEU F  3 246 ? -24.153 17.055  25.795  1.00 98.27  ? 261 LEU Y CG  1 
ATOM   7281  C CD1 . LEU F  3 246 ? -23.606 15.653  25.545  1.00 97.41  ? 261 LEU Y CD1 1 
ATOM   7282  C CD2 . LEU F  3 246 ? -24.578 17.679  24.469  1.00 95.30  ? 261 LEU Y CD2 1 
ATOM   7283  N N   . VAL F  3 247 ? -27.658 19.260  28.722  1.00 101.78 ? 262 VAL Y N   1 
ATOM   7284  C CA  . VAL F  3 247 ? -28.930 19.373  29.468  1.00 102.96 ? 262 VAL Y CA  1 
ATOM   7285  C C   . VAL F  3 247 ? -30.185 18.999  28.672  1.00 101.80 ? 262 VAL Y C   1 
ATOM   7286  O O   . VAL F  3 247 ? -31.135 18.474  29.264  1.00 103.26 ? 262 VAL Y O   1 
ATOM   7287  C CB  . VAL F  3 247 ? -29.130 20.763  30.129  1.00 109.95 ? 262 VAL Y CB  1 
ATOM   7288  C CG1 . VAL F  3 247 ? -28.451 20.830  31.487  1.00 116.01 ? 262 VAL Y CG1 1 
ATOM   7289  C CG2 . VAL F  3 247 ? -28.678 21.905  29.220  1.00 107.71 ? 262 VAL Y CG2 1 
ATOM   7290  N N   . ALA F  3 248 ? -30.192 19.284  27.351  1.00 92.22  ? 263 ALA Y N   1 
ATOM   7291  C CA  . ALA F  3 248 ? -31.331 19.048  26.464  1.00 87.72  ? 263 ALA Y CA  1 
ATOM   7292  C C   . ALA F  3 248 ? -31.428 17.632  25.891  1.00 88.18  ? 263 ALA Y C   1 
ATOM   7293  O O   . ALA F  3 248 ? -32.547 17.199  25.612  1.00 87.35  ? 263 ALA Y O   1 
ATOM   7294  C CB  . ALA F  3 248 ? -31.342 20.073  25.344  1.00 85.27  ? 263 ALA Y CB  1 
ATOM   7295  N N   . LEU F  3 249 ? -30.281 16.913  25.721  1.00 82.35  ? 264 LEU Y N   1 
ATOM   7296  C CA  . LEU F  3 249 ? -30.197 15.555  25.151  1.00 78.99  ? 264 LEU Y CA  1 
ATOM   7297  C C   . LEU F  3 249 ? -31.272 14.583  25.648  1.00 83.88  ? 264 LEU Y C   1 
ATOM   7298  O O   . LEU F  3 249 ? -31.515 14.479  26.848  1.00 87.06  ? 264 LEU Y O   1 
ATOM   7299  C CB  . LEU F  3 249 ? -28.802 14.960  25.344  1.00 79.57  ? 264 LEU Y CB  1 
ATOM   7300  C CG  . LEU F  3 249 ? -28.387 13.898  24.330  1.00 80.81  ? 264 LEU Y CG  1 
ATOM   7301  C CD1 . LEU F  3 249 ? -27.993 14.524  22.989  1.00 77.00  ? 264 LEU Y CD1 1 
ATOM   7302  C CD2 . LEU F  3 249 ? -27.272 13.041  24.882  1.00 84.24  ? 264 LEU Y CD2 1 
ATOM   7303  N N   . MET F  3 250 ? -31.918 13.891  24.698  1.00 78.38  ? 265 MET Y N   1 
ATOM   7304  C CA  . MET F  3 250 ? -33.028 12.958  24.912  1.00 80.16  ? 265 MET Y CA  1 
ATOM   7305  C C   . MET F  3 250 ? -32.743 11.586  24.327  1.00 78.63  ? 265 MET Y C   1 
ATOM   7306  O O   . MET F  3 250 ? -33.209 10.569  24.847  1.00 78.82  ? 265 MET Y O   1 
ATOM   7307  C CB  . MET F  3 250 ? -34.292 13.511  24.236  1.00 82.23  ? 265 MET Y CB  1 
ATOM   7308  C CG  . MET F  3 250 ? -34.823 14.742  24.887  1.00 90.23  ? 265 MET Y CG  1 
ATOM   7309  S SD  . MET F  3 250 ? -36.277 15.365  24.023  1.00 95.10  ? 265 MET Y SD  1 
ATOM   7310  C CE  . MET F  3 250 ? -37.068 16.365  25.384  1.00 96.85  ? 265 MET Y CE  1 
ATOM   7311  N N   . GLU F  3 251 ? -32.029 11.576  23.205  1.00 71.00  ? 266 GLU Y N   1 
ATOM   7312  C CA  . GLU F  3 251 ? -31.690 10.376  22.458  1.00 68.86  ? 266 GLU Y CA  1 
ATOM   7313  C C   . GLU F  3 251 ? -30.224 10.465  22.030  1.00 71.08  ? 266 GLU Y C   1 
ATOM   7314  O O   . GLU F  3 251 ? -29.750 11.530  21.613  1.00 69.27  ? 266 GLU Y O   1 
ATOM   7315  C CB  . GLU F  3 251 ? -32.605 10.296  21.232  1.00 67.23  ? 266 GLU Y CB  1 
ATOM   7316  C CG  . GLU F  3 251 ? -32.812 8.927   20.617  1.00 76.34  ? 266 GLU Y CG  1 
ATOM   7317  C CD  . GLU F  3 251 ? -33.679 9.020   19.373  1.00 100.30 ? 266 GLU Y CD  1 
ATOM   7318  O OE1 . GLU F  3 251 ? -33.123 8.973   18.251  1.00 89.99  ? 266 GLU Y OE1 1 
ATOM   7319  O OE2 . GLU F  3 251 ? -34.904 9.238   19.524  1.00 98.94  ? 266 GLU Y OE2 1 
ATOM   7320  N N   . ALA F  3 252 ? -29.502 9.346   22.168  1.00 67.70  ? 267 ALA Y N   1 
ATOM   7321  C CA  . ALA F  3 252 ? -28.103 9.251   21.782  1.00 65.74  ? 267 ALA Y CA  1 
ATOM   7322  C C   . ALA F  3 252 ? -27.825 7.888   21.195  1.00 66.12  ? 267 ALA Y C   1 
ATOM   7323  O O   . ALA F  3 252 ? -27.976 6.888   21.885  1.00 67.27  ? 267 ALA Y O   1 
ATOM   7324  C CB  . ALA F  3 252 ? -27.206 9.506   22.979  1.00 70.14  ? 267 ALA Y CB  1 
ATOM   7325  N N   . SER F  3 253 ? -27.490 7.846   19.900  1.00 59.29  ? 268 SER Y N   1 
ATOM   7326  C CA  . SER F  3 253 ? -27.111 6.617   19.196  1.00 58.21  ? 268 SER Y CA  1 
ATOM   7327  C C   . SER F  3 253 ? -25.621 6.757   18.825  1.00 60.91  ? 268 SER Y C   1 
ATOM   7328  O O   . SER F  3 253 ? -25.235 7.453   17.885  1.00 58.09  ? 268 SER Y O   1 
ATOM   7329  C CB  . SER F  3 253 ? -28.026 6.323   18.009  1.00 59.46  ? 268 SER Y CB  1 
ATOM   7330  O OG  . SER F  3 253 ? -28.501 7.508   17.393  1.00 73.15  ? 268 SER Y OG  1 
ATOM   7331  N N   . LEU F  3 254 ? -24.793 6.165   19.668  1.00 59.22  ? 269 LEU Y N   1 
ATOM   7332  C CA  . LEU F  3 254 ? -23.349 6.260   19.643  1.00 59.85  ? 269 LEU Y CA  1 
ATOM   7333  C C   . LEU F  3 254 ? -22.604 5.012   19.135  1.00 65.10  ? 269 LEU Y C   1 
ATOM   7334  O O   . LEU F  3 254 ? -23.223 4.067   18.623  1.00 64.32  ? 269 LEU Y O   1 
ATOM   7335  C CB  . LEU F  3 254 ? -22.897 6.631   21.061  1.00 63.39  ? 269 LEU Y CB  1 
ATOM   7336  C CG  . LEU F  3 254 ? -23.677 7.765   21.705  1.00 67.82  ? 269 LEU Y CG  1 
ATOM   7337  C CD1 . LEU F  3 254 ? -23.673 7.631   23.188  1.00 72.43  ? 269 LEU Y CD1 1 
ATOM   7338  C CD2 . LEU F  3 254 ? -23.187 9.134   21.232  1.00 67.19  ? 269 LEU Y CD2 1 
ATOM   7339  N N   . THR F  3 255 ? -21.259 5.036   19.261  1.00 62.55  ? 270 THR Y N   1 
ATOM   7340  C CA  . THR F  3 255 ? -20.386 3.961   18.809  1.00 62.72  ? 270 THR Y CA  1 
ATOM   7341  C C   . THR F  3 255 ? -20.019 3.021   19.958  1.00 69.39  ? 270 THR Y C   1 
ATOM   7342  O O   . THR F  3 255 ? -20.233 1.811   19.854  1.00 68.87  ? 270 THR Y O   1 
ATOM   7343  C CB  . THR F  3 255 ? -19.181 4.567   18.072  1.00 68.16  ? 270 THR Y CB  1 
ATOM   7344  O OG1 . THR F  3 255 ? -19.630 5.060   16.813  1.00 61.14  ? 270 THR Y OG1 1 
ATOM   7345  C CG2 . THR F  3 255 ? -18.069 3.576   17.843  1.00 69.49  ? 270 THR Y CG2 1 
ATOM   7346  N N   . TYR F  3 256 ? -19.481 3.591   21.048  1.00 68.58  ? 271 TYR Y N   1 
ATOM   7347  C CA  . TYR F  3 256 ? -19.006 2.869   22.226  1.00 72.10  ? 271 TYR Y CA  1 
ATOM   7348  C C   . TYR F  3 256 ? -20.070 2.720   23.303  1.00 79.65  ? 271 TYR Y C   1 
ATOM   7349  O O   . TYR F  3 256 ? -20.668 3.729   23.697  1.00 79.63  ? 271 TYR Y O   1 
ATOM   7350  C CB  . TYR F  3 256 ? -17.755 3.551   22.780  1.00 74.73  ? 271 TYR Y CB  1 
ATOM   7351  C CG  . TYR F  3 256 ? -16.653 3.628   21.750  1.00 73.88  ? 271 TYR Y CG  1 
ATOM   7352  C CD1 . TYR F  3 256 ? -15.823 2.539   21.508  1.00 77.31  ? 271 TYR Y CD1 1 
ATOM   7353  C CD2 . TYR F  3 256 ? -16.453 4.783   20.997  1.00 71.60  ? 271 TYR Y CD2 1 
ATOM   7354  C CE1 . TYR F  3 256 ? -14.825 2.590   20.541  1.00 76.28  ? 271 TYR Y CE1 1 
ATOM   7355  C CE2 . TYR F  3 256 ? -15.454 4.846   20.027  1.00 71.73  ? 271 TYR Y CE2 1 
ATOM   7356  C CZ  . TYR F  3 256 ? -14.648 3.742   19.799  1.00 79.15  ? 271 TYR Y CZ  1 
ATOM   7357  O OH  . TYR F  3 256 ? -13.649 3.765   18.863  1.00 79.36  ? 271 TYR Y OH  1 
ATOM   7358  N N   . PRO F  3 257 ? -20.309 1.475   23.799  1.00 78.94  ? 272 PRO Y N   1 
ATOM   7359  C CA  . PRO F  3 257 ? -21.345 1.260   24.834  1.00 81.54  ? 272 PRO Y CA  1 
ATOM   7360  C C   . PRO F  3 257 ? -21.016 1.848   26.204  1.00 89.89  ? 272 PRO Y C   1 
ATOM   7361  O O   . PRO F  3 257 ? -21.901 1.962   27.057  1.00 90.31  ? 272 PRO Y O   1 
ATOM   7362  C CB  . PRO F  3 257 ? -21.472 -0.268  24.896  1.00 85.55  ? 272 PRO Y CB  1 
ATOM   7363  C CG  . PRO F  3 257 ? -20.822 -0.763  23.640  1.00 87.10  ? 272 PRO Y CG  1 
ATOM   7364  C CD  . PRO F  3 257 ? -19.706 0.194   23.404  1.00 81.48  ? 272 PRO Y CD  1 
ATOM   7365  N N   . SER F  3 258 ? -19.737 2.231   26.400  1.00 90.10  ? 273 SER Y N   1 
ATOM   7366  C CA  . SER F  3 258 ? -19.196 2.855   27.616  1.00 95.07  ? 273 SER Y CA  1 
ATOM   7367  C C   . SER F  3 258 ? -19.826 4.253   27.808  1.00 98.50  ? 273 SER Y C   1 
ATOM   7368  O O   . SER F  3 258 ? -19.982 4.725   28.938  1.00 102.13 ? 273 SER Y O   1 
ATOM   7369  C CB  . SER F  3 258 ? -17.672 2.971   27.522  1.00 100.01 ? 273 SER Y CB  1 
ATOM   7370  O OG  . SER F  3 258 ? -17.084 1.968   26.705  1.00 107.40 ? 273 SER Y OG  1 
ATOM   7371  N N   . HIS F  3 259 ? -20.189 4.892   26.685  1.00 89.99  ? 274 HIS Y N   1 
ATOM   7372  C CA  . HIS F  3 259 ? -20.819 6.198   26.625  1.00 88.20  ? 274 HIS Y CA  1 
ATOM   7373  C C   . HIS F  3 259 ? -22.273 6.145   27.098  1.00 96.52  ? 274 HIS Y C   1 
ATOM   7374  O O   . HIS F  3 259 ? -22.771 7.148   27.609  1.00 96.95  ? 274 HIS Y O   1 
ATOM   7375  C CB  . HIS F  3 259 ? -20.733 6.753   25.197  1.00 82.93  ? 274 HIS Y CB  1 
ATOM   7376  C CG  . HIS F  3 259 ? -19.355 7.157   24.764  1.00 85.60  ? 274 HIS Y CG  1 
ATOM   7377  N ND1 . HIS F  3 259 ? -19.026 7.251   23.426  1.00 83.06  ? 274 HIS Y ND1 1 
ATOM   7378  C CD2 . HIS F  3 259 ? -18.283 7.527   25.503  1.00 90.33  ? 274 HIS Y CD2 1 
ATOM   7379  C CE1 . HIS F  3 259 ? -17.773 7.670   23.396  1.00 83.85  ? 274 HIS Y CE1 1 
ATOM   7380  N NE2 . HIS F  3 259 ? -17.285 7.845   24.621  1.00 88.63  ? 274 HIS Y NE2 1 
ATOM   7381  N N   . CYS F  3 260 ? -22.950 4.982   26.940  1.00 95.84  ? 275 CYS Y N   1 
ATOM   7382  C CA  . CYS F  3 260 ? -24.347 4.779   27.357  1.00 97.81  ? 275 CYS Y CA  1 
ATOM   7383  C C   . CYS F  3 260 ? -24.501 4.757   28.862  1.00 111.60 ? 275 CYS Y C   1 
ATOM   7384  O O   . CYS F  3 260 ? -25.568 5.088   29.386  1.00 112.63 ? 275 CYS Y O   1 
ATOM   7385  C CB  . CYS F  3 260 ? -24.927 3.519   26.727  1.00 96.60  ? 275 CYS Y CB  1 
ATOM   7386  S SG  . CYS F  3 260 ? -25.253 3.669   24.957  1.00 93.87  ? 275 CYS Y SG  1 
ATOM   7387  N N   . CYS F  3 261 ? -23.430 4.344   29.542  1.00 115.11 ? 276 CYS Y N   1 
ATOM   7388  C CA  . CYS F  3 261 ? -23.314 4.242   30.987  1.00 122.79 ? 276 CYS Y CA  1 
ATOM   7389  C C   . CYS F  3 261 ? -23.504 5.597   31.640  1.00 126.28 ? 276 CYS Y C   1 
ATOM   7390  O O   . CYS F  3 261 ? -24.233 5.696   32.628  1.00 129.90 ? 276 CYS Y O   1 
ATOM   7391  C CB  . CYS F  3 261 ? -21.972 3.619   31.353  1.00 128.16 ? 276 CYS Y CB  1 
ATOM   7392  S SG  . CYS F  3 261 ? -21.696 1.996   30.598  1.00 132.40 ? 276 CYS Y SG  1 
ATOM   7393  N N   . ALA F  3 262 ? -22.902 6.649   31.047  1.00 118.69 ? 277 ALA Y N   1 
ATOM   7394  C CA  . ALA F  3 262 ? -23.005 8.032   31.513  1.00 119.49 ? 277 ALA Y CA  1 
ATOM   7395  C C   . ALA F  3 262 ? -24.459 8.527   31.536  1.00 122.22 ? 277 ALA Y C   1 
ATOM   7396  O O   . ALA F  3 262 ? -24.834 9.294   32.422  1.00 124.98 ? 277 ALA Y O   1 
ATOM   7397  C CB  . ALA F  3 262 ? -22.160 8.939   30.631  1.00 116.92 ? 277 ALA Y CB  1 
ATOM   7398  N N   . PHE F  3 263 ? -25.277 8.046   30.587  1.00 115.02 ? 278 PHE Y N   1 
ATOM   7399  C CA  . PHE F  3 263 ? -26.676 8.432   30.423  1.00 113.64 ? 278 PHE Y CA  1 
ATOM   7400  C C   . PHE F  3 263 ? -27.677 7.538   31.177  1.00 122.66 ? 278 PHE Y C   1 
ATOM   7401  O O   . PHE F  3 263 ? -28.836 7.942   31.337  1.00 122.90 ? 278 PHE Y O   1 
ATOM   7402  C CB  . PHE F  3 263 ? -27.025 8.531   28.921  1.00 108.85 ? 278 PHE Y CB  1 
ATOM   7403  C CG  . PHE F  3 263 ? -26.075 9.393   28.113  1.00 106.73 ? 278 PHE Y CG  1 
ATOM   7404  C CD1 . PHE F  3 263 ? -25.791 10.699  28.499  1.00 111.03 ? 278 PHE Y CD1 1 
ATOM   7405  C CD2 . PHE F  3 263 ? -25.472 8.903   26.967  1.00 104.45 ? 278 PHE Y CD2 1 
ATOM   7406  C CE1 . PHE F  3 263 ? -24.911 11.490  27.757  1.00 109.30 ? 278 PHE Y CE1 1 
ATOM   7407  C CE2 . PHE F  3 263 ? -24.601 9.698   26.220  1.00 104.66 ? 278 PHE Y CE2 1 
ATOM   7408  C CZ  . PHE F  3 263 ? -24.324 10.985  26.621  1.00 104.11 ? 278 PHE Y CZ  1 
ATOM   7409  N N   . ALA F  3 264 ? -27.232 6.353   31.663  1.00 123.03 ? 279 ALA Y N   1 
ATOM   7410  C CA  . ALA F  3 264 ? -28.068 5.408   32.422  1.00 127.43 ? 279 ALA Y CA  1 
ATOM   7411  C C   . ALA F  3 264 ? -28.589 6.038   33.723  1.00 137.73 ? 279 ALA Y C   1 
ATOM   7412  O O   . ALA F  3 264 ? -29.746 5.826   34.099  1.00 139.24 ? 279 ALA Y O   1 
ATOM   7413  C CB  . ALA F  3 264 ? -27.290 4.137   32.721  1.00 131.05 ? 279 ALA Y CB  1 
ATOM   7414  N N   . ASN F  3 265 ? -27.734 6.842   34.379  1.00 137.49 ? 280 ASN Y N   1 
ATOM   7415  C CA  . ASN F  3 265 ? -28.051 7.598   35.585  1.00 142.65 ? 280 ASN Y CA  1 
ATOM   7416  C C   . ASN F  3 265 ? -27.966 9.091   35.223  1.00 143.79 ? 280 ASN Y C   1 
ATOM   7417  O O   . ASN F  3 265 ? -26.913 9.546   34.763  1.00 141.58 ? 280 ASN Y O   1 
ATOM   7418  C CB  . ASN F  3 265 ? -27.081 7.239   36.715  1.00 149.88 ? 280 ASN Y CB  1 
ATOM   7419  N N   . TRP F  3 266 ? -29.096 9.830   35.376  1.00 139.86 ? 281 TRP Y N   1 
ATOM   7420  C CA  . TRP F  3 266 ? -29.263 11.266  35.078  1.00 151.29 ? 281 TRP Y CA  1 
ATOM   7421  C C   . TRP F  3 266 ? -28.908 11.636  33.637  1.00 141.60 ? 281 TRP Y C   1 
ATOM   7422  O O   . TRP F  3 266 ? -29.688 11.374  32.724  1.00 87.01  ? 281 TRP Y O   1 
ATOM   7423  C CB  . TRP F  3 266 ? -28.503 12.156  36.078  1.00 154.64 ? 281 TRP Y CB  1 
ATOM   7424  N N   . ASP F  3 319 ? -47.615 9.115   16.908  1.00 136.54 ? 334 ASP Y N   1 
ATOM   7425  C CA  . ASP F  3 319 ? -47.868 8.557   18.239  1.00 140.91 ? 334 ASP Y CA  1 
ATOM   7426  C C   . ASP F  3 319 ? -47.361 9.453   19.383  1.00 145.05 ? 334 ASP Y C   1 
ATOM   7427  O O   . ASP F  3 319 ? -47.894 9.384   20.494  1.00 148.58 ? 334 ASP Y O   1 
ATOM   7428  C CB  . ASP F  3 319 ? -47.282 7.131   18.359  1.00 143.52 ? 334 ASP Y CB  1 
ATOM   7429  C CG  . ASP F  3 319 ? -45.761 7.046   18.388  1.00 149.60 ? 334 ASP Y CG  1 
ATOM   7430  O OD1 . ASP F  3 319 ? -45.115 7.557   17.441  1.00 145.40 ? 334 ASP Y OD1 1 
ATOM   7431  O OD2 . ASP F  3 319 ? -45.220 6.429   19.334  1.00 156.51 ? 334 ASP Y OD2 1 
HETATM 7432  N N   . TYS F  3 320 ? -46.316 10.268  19.091  1.00 137.55 ? 335 TYS Y N   1 
HETATM 7433  C CA  . TYS F  3 320 ? -45.586 11.227  19.943  1.00 136.67 ? 335 TYS Y CA  1 
HETATM 7434  C CB  . TYS F  3 320 ? -44.924 12.288  18.966  1.00 131.25 ? 335 TYS Y CB  1 
HETATM 7435  C CG  . TYS F  3 320 ? -45.816 13.138  17.982  1.00 129.52 ? 335 TYS Y CG  1 
HETATM 7436  C CD1 . TYS F  3 320 ? -45.195 14.020  17.003  1.00 124.45 ? 335 TYS Y CD1 1 
HETATM 7437  C CD2 . TYS F  3 320 ? -47.281 13.098  18.012  1.00 132.48 ? 335 TYS Y CD2 1 
HETATM 7438  C CE1 . TYS F  3 320 ? -46.041 14.798  16.126  1.00 123.26 ? 335 TYS Y CE1 1 
HETATM 7439  C CE2 . TYS F  3 320 ? -48.116 13.843  17.168  1.00 131.14 ? 335 TYS Y CE2 1 
HETATM 7440  C CZ  . TYS F  3 320 ? -47.519 14.687  16.214  1.00 125.66 ? 335 TYS Y CZ  1 
HETATM 7441  O OH  . TYS F  3 320 ? -48.474 15.354  15.477  1.00 123.01 ? 335 TYS Y OH  1 
HETATM 7442  S S   . TYS F  3 320 ? -48.523 15.059  14.066  1.00 117.94 ? 335 TYS Y S   1 
HETATM 7443  O O1  . TYS F  3 320 ? -49.770 15.521  13.597  1.00 120.20 ? 335 TYS Y O1  1 
HETATM 7444  O O2  . TYS F  3 320 ? -48.021 13.730  13.781  1.00 116.37 ? 335 TYS Y O2  1 
HETATM 7445  O O3  . TYS F  3 320 ? -47.642 16.068  13.567  1.00 114.04 ? 335 TYS Y O3  1 
HETATM 7446  C C   . TYS F  3 320 ? -46.383 11.953  21.043  1.00 145.53 ? 335 TYS Y C   1 
HETATM 7447  O O   . TYS F  3 320 ? -47.596 12.149  20.915  1.00 147.35 ? 335 TYS Y O   1 
ATOM   7448  N N   . ASP F  3 321 ? -45.681 12.374  22.113  1.00 144.23 ? 336 ASP Y N   1 
ATOM   7449  C CA  . ASP F  3 321 ? -46.295 13.099  23.231  1.00 149.05 ? 336 ASP Y CA  1 
ATOM   7450  C C   . ASP F  3 321 ? -45.365 14.172  23.843  1.00 152.49 ? 336 ASP Y C   1 
ATOM   7451  O O   . ASP F  3 321 ? -44.234 14.355  23.377  1.00 148.08 ? 336 ASP Y O   1 
ATOM   7452  C CB  . ASP F  3 321 ? -46.837 12.122  24.305  1.00 156.37 ? 336 ASP Y CB  1 
ATOM   7453  C CG  . ASP F  3 321 ? -45.778 11.331  25.053  1.00 167.59 ? 336 ASP Y CG  1 
ATOM   7454  O OD1 . ASP F  3 321 ? -44.961 10.647  24.386  1.00 164.65 ? 336 ASP Y OD1 1 
ATOM   7455  O OD2 . ASP F  3 321 ? -45.793 11.358  26.305  1.00 177.18 ? 336 ASP Y OD2 1 
ATOM   7456  N N   . LEU F  3 322 ? -45.877 14.906  24.863  1.00 153.03 ? 337 LEU Y N   1 
ATOM   7457  C CA  . LEU F  3 322 ? -45.169 15.960  25.596  1.00 172.02 ? 337 LEU Y CA  1 
ATOM   7458  C C   . LEU F  3 322 ? -45.750 16.111  27.005  1.00 176.08 ? 337 LEU Y C   1 
ATOM   7459  O O   . LEU F  3 322 ? -46.050 15.115  27.664  1.00 127.14 ? 337 LEU Y O   1 
ATOM   7460  C CB  . LEU F  3 322 ? -45.241 17.297  24.842  1.00 169.72 ? 337 LEU Y CB  1 
ATOM   7461  N N   . VAL F  3 327 ? -38.423 8.352   32.699  1.00 134.42 ? 342 VAL Y N   1 
ATOM   7462  C CA  . VAL F  3 327 ? -38.297 8.283   31.239  1.00 127.66 ? 342 VAL Y CA  1 
ATOM   7463  C C   . VAL F  3 327 ? -36.826 8.054   30.830  1.00 128.96 ? 342 VAL Y C   1 
ATOM   7464  O O   . VAL F  3 327 ? -36.533 7.056   30.163  1.00 126.77 ? 342 VAL Y O   1 
ATOM   7465  C CB  . VAL F  3 327 ? -38.966 9.493   30.507  1.00 127.71 ? 342 VAL Y CB  1 
ATOM   7466  C CG1 . VAL F  3 327 ? -38.688 9.470   29.004  1.00 120.87 ? 342 VAL Y CG1 1 
ATOM   7467  C CG2 . VAL F  3 327 ? -40.471 9.534   30.766  1.00 130.95 ? 342 VAL Y CG2 1 
ATOM   7468  N N   . ASP F  3 328 ? -35.914 8.982   31.233  1.00 125.26 ? 343 ASP Y N   1 
ATOM   7469  C CA  . ASP F  3 328 ? -34.454 8.988   30.980  1.00 122.23 ? 343 ASP Y CA  1 
ATOM   7470  C C   . ASP F  3 328 ? -34.062 9.071   29.467  1.00 117.68 ? 343 ASP Y C   1 
ATOM   7471  O O   . ASP F  3 328 ? -34.929 9.086   28.585  1.00 114.47 ? 343 ASP Y O   1 
ATOM   7472  C CB  . ASP F  3 328 ? -33.731 7.809   31.687  1.00 127.27 ? 343 ASP Y CB  1 
ATOM   7473  C CG  . ASP F  3 328 ? -33.311 8.087   33.122  1.00 138.96 ? 343 ASP Y CG  1 
ATOM   7474  O OD1 . ASP F  3 328 ? -34.204 8.300   33.972  1.00 142.99 ? 343 ASP Y OD1 1 
ATOM   7475  O OD2 . ASP F  3 328 ? -32.091 8.048   33.403  1.00 144.18 ? 343 ASP Y OD2 1 
ATOM   7476  N N   . VAL F  3 329 ? -32.741 9.175   29.202  1.00 110.38 ? 344 VAL Y N   1 
ATOM   7477  C CA  . VAL F  3 329 ? -32.136 9.312   27.874  1.00 103.78 ? 344 VAL Y CA  1 
ATOM   7478  C C   . VAL F  3 329 ? -32.005 7.948   27.187  1.00 105.07 ? 344 VAL Y C   1 
ATOM   7479  O O   . VAL F  3 329 ? -31.374 7.049   27.747  1.00 107.82 ? 344 VAL Y O   1 
ATOM   7480  C CB  . VAL F  3 329 ? -30.769 10.056  27.985  1.00 106.81 ? 344 VAL Y CB  1 
ATOM   7481  C CG1 . VAL F  3 329 ? -29.970 9.998   26.684  1.00 101.65 ? 344 VAL Y CG1 1 
ATOM   7482  C CG2 . VAL F  3 329 ? -30.962 11.501  28.430  1.00 107.83 ? 344 VAL Y CG2 1 
ATOM   7483  N N   . THR F  3 330 ? -32.589 7.799   25.972  1.00 96.44  ? 345 THR Y N   1 
ATOM   7484  C CA  . THR F  3 330 ? -32.496 6.563   25.180  1.00 93.99  ? 345 THR Y CA  1 
ATOM   7485  C C   . THR F  3 330 ? -31.090 6.476   24.620  1.00 95.19  ? 345 THR Y C   1 
ATOM   7486  O O   . THR F  3 330 ? -30.632 7.409   23.952  1.00 92.91  ? 345 THR Y O   1 
ATOM   7487  C CB  . THR F  3 330 ? -33.575 6.505   24.083  1.00 96.78  ? 345 THR Y CB  1 
ATOM   7488  O OG1 . THR F  3 330 ? -34.837 6.263   24.699  1.00 98.72  ? 345 THR Y OG1 1 
ATOM   7489  C CG2 . THR F  3 330 ? -33.307 5.413   23.038  1.00 92.53  ? 345 THR Y CG2 1 
ATOM   7490  N N   . CYS F  3 331 ? -30.394 5.374   24.906  1.00 91.89  ? 346 CYS Y N   1 
ATOM   7491  C CA  . CYS F  3 331 ? -29.033 5.268   24.427  1.00 89.04  ? 346 CYS Y CA  1 
ATOM   7492  C C   . CYS F  3 331 ? -28.738 3.987   23.651  1.00 90.33  ? 346 CYS Y C   1 
ATOM   7493  O O   . CYS F  3 331 ? -29.380 2.955   23.848  1.00 92.04  ? 346 CYS Y O   1 
ATOM   7494  C CB  . CYS F  3 331 ? -28.036 5.489   25.552  1.00 92.64  ? 346 CYS Y CB  1 
ATOM   7495  S SG  . CYS F  3 331 ? -26.472 6.188   24.988  1.00 94.29  ? 346 CYS Y SG  1 
ATOM   7496  N N   . SER F  3 332 ? -27.774 4.089   22.733  1.00 82.69  ? 347 SER Y N   1 
ATOM   7497  C CA  . SER F  3 332 ? -27.350 3.019   21.853  1.00 80.99  ? 347 SER Y CA  1 
ATOM   7498  C C   . SER F  3 332 ? -25.842 3.117   21.640  1.00 85.33  ? 347 SER Y C   1 
ATOM   7499  O O   . SER F  3 332 ? -25.350 4.218   21.441  1.00 83.00  ? 347 SER Y O   1 
ATOM   7500  C CB  . SER F  3 332 ? -28.076 3.139   20.520  1.00 80.71  ? 347 SER Y CB  1 
ATOM   7501  O OG  . SER F  3 332 ? -27.629 2.177   19.582  1.00 90.96  ? 347 SER Y OG  1 
ATOM   7502  N N   . PRO F  3 333 ? -25.069 2.015   21.725  1.00 85.62  ? 348 PRO Y N   1 
ATOM   7503  C CA  . PRO F  3 333 ? -25.480 0.631   22.013  1.00 88.94  ? 348 PRO Y CA  1 
ATOM   7504  C C   . PRO F  3 333 ? -25.536 0.337   23.515  1.00 100.51 ? 348 PRO Y C   1 
ATOM   7505  O O   . PRO F  3 333 ? -24.622 0.711   24.250  1.00 102.11 ? 348 PRO Y O   1 
ATOM   7506  C CB  . PRO F  3 333 ? -24.428 -0.201  21.263  1.00 90.12  ? 348 PRO Y CB  1 
ATOM   7507  C CG  . PRO F  3 333 ? -23.207 0.700   21.113  1.00 93.44  ? 348 PRO Y CG  1 
ATOM   7508  C CD  . PRO F  3 333 ? -23.611 2.105   21.526  1.00 87.68  ? 348 PRO Y CD  1 
ATOM   7509  N N   . LYS F  3 334 ? -26.608 -0.327  23.975  1.00 101.58 ? 349 LYS Y N   1 
ATOM   7510  C CA  . LYS F  3 334 ? -26.794 -0.658  25.394  1.00 107.66 ? 349 LYS Y CA  1 
ATOM   7511  C C   . LYS F  3 334 ? -25.681 -1.575  25.955  1.00 118.51 ? 349 LYS Y C   1 
ATOM   7512  O O   . LYS F  3 334 ? -25.172 -2.413  25.201  1.00 116.76 ? 349 LYS Y O   1 
ATOM   7513  C CB  . LYS F  3 334 ? -28.195 -1.232  25.634  1.00 111.77 ? 349 LYS Y CB  1 
ATOM   7514  C CG  . LYS F  3 334 ? -29.266 -0.151  25.579  1.00 120.18 ? 349 LYS Y CG  1 
ATOM   7515  C CD  . LYS F  3 334 ? -30.591 -0.680  25.056  1.00 129.02 ? 349 LYS Y CD  1 
ATOM   7516  C CE  . LYS F  3 334 ? -31.299 0.290   24.130  1.00 131.52 ? 349 LYS Y CE  1 
ATOM   7517  N NZ  . LYS F  3 334 ? -31.815 1.499   24.835  1.00 136.15 ? 349 LYS Y NZ  1 
ATOM   7518  N N   . PRO F  3 335 ? -25.266 -1.417  27.251  1.00 122.44 ? 350 PRO Y N   1 
ATOM   7519  C CA  . PRO F  3 335 ? -24.166 -2.251  27.792  1.00 127.28 ? 350 PRO Y CA  1 
ATOM   7520  C C   . PRO F  3 335 ? -24.523 -3.722  28.085  1.00 138.14 ? 350 PRO Y C   1 
ATOM   7521  O O   . PRO F  3 335 ? -24.044 -4.296  29.073  1.00 143.44 ? 350 PRO Y O   1 
ATOM   7522  C CB  . PRO F  3 335 ? -23.746 -1.488  29.057  1.00 132.51 ? 350 PRO Y CB  1 
ATOM   7523  C CG  . PRO F  3 335 ? -24.980 -0.822  29.510  1.00 136.56 ? 350 PRO Y CG  1 
ATOM   7524  C CD  . PRO F  3 335 ? -25.736 -0.443  28.261  1.00 126.14 ? 350 PRO Y CD  1 
ATOM   7525  N N   . ASP F  3 336 ? -25.322 -4.343  27.193  1.00 134.16 ? 351 ASP Y N   1 
ATOM   7526  C CA  . ASP F  3 336 ? -25.802 -5.725  27.279  1.00 138.25 ? 351 ASP Y CA  1 
ATOM   7527  C C   . ASP F  3 336 ? -24.726 -6.805  27.066  1.00 145.59 ? 351 ASP Y C   1 
ATOM   7528  O O   . ASP F  3 336 ? -24.846 -7.895  27.639  1.00 150.32 ? 351 ASP Y O   1 
ATOM   7529  C CB  . ASP F  3 336 ? -26.973 -5.941  26.315  1.00 136.95 ? 351 ASP Y CB  1 
ATOM   7530  C CG  . ASP F  3 336 ? -28.229 -6.380  27.029  1.00 150.87 ? 351 ASP Y CG  1 
ATOM   7531  O OD1 . ASP F  3 336 ? -28.328 -7.581  27.372  1.00 155.50 ? 351 ASP Y OD1 1 
ATOM   7532  O OD2 . ASP F  3 336 ? -29.098 -5.518  27.279  1.00 155.85 ? 351 ASP Y OD2 1 
ATOM   7533  N N   . ALA F  3 337 ? -23.682 -6.503  26.257  1.00 139.17 ? 352 ALA Y N   1 
ATOM   7534  C CA  . ALA F  3 337 ? -22.572 -7.413  25.938  1.00 140.62 ? 352 ALA Y CA  1 
ATOM   7535  C C   . ALA F  3 337 ? -21.588 -7.628  27.121  1.00 149.16 ? 352 ALA Y C   1 
ATOM   7536  O O   . ALA F  3 337 ? -20.366 -7.579  26.933  1.00 148.10 ? 352 ALA Y O   1 
ATOM   7537  C CB  . ALA F  3 337 ? -21.839 -6.926  24.691  1.00 136.22 ? 352 ALA Y CB  1 
ATOM   7538  N N   . PHE F  3 338 ? -22.145 -7.899  28.331  1.00 151.33 ? 353 PHE Y N   1 
ATOM   7539  C CA  . PHE F  3 338 ? -21.446 -8.147  29.602  1.00 157.56 ? 353 PHE Y CA  1 
ATOM   7540  C C   . PHE F  3 338 ? -20.553 -6.960  30.011  1.00 159.76 ? 353 PHE Y C   1 
ATOM   7541  O O   . PHE F  3 338 ? -19.322 -7.073  30.022  1.00 160.87 ? 353 PHE Y O   1 
ATOM   7542  C CB  . PHE F  3 338 ? -20.680 -9.490  29.573  1.00 163.61 ? 353 PHE Y CB  1 
ATOM   7543  C CG  . PHE F  3 338 ? -21.549 -10.724 29.482  1.00 168.14 ? 353 PHE Y CG  1 
ATOM   7544  C CD1 . PHE F  3 338 ? -22.124 -11.105 28.272  1.00 167.11 ? 353 PHE Y CD1 1 
ATOM   7545  C CD2 . PHE F  3 338 ? -21.758 -11.531 30.595  1.00 177.39 ? 353 PHE Y CD2 1 
ATOM   7546  C CE1 . PHE F  3 338 ? -22.923 -12.250 28.189  1.00 171.20 ? 353 PHE Y CE1 1 
ATOM   7547  C CE2 . PHE F  3 338 ? -22.548 -12.683 30.508  1.00 183.44 ? 353 PHE Y CE2 1 
ATOM   7548  C CZ  . PHE F  3 338 ? -23.124 -13.036 29.306  1.00 177.82 ? 353 PHE Y CZ  1 
ATOM   7549  N N   . ASN F  3 339 ? -21.190 -5.813  30.331  1.00 153.87 ? 354 ASN Y N   1 
ATOM   7550  C CA  . ASN F  3 339 ? -20.486 -4.581  30.697  1.00 153.00 ? 354 ASN Y CA  1 
ATOM   7551  C C   . ASN F  3 339 ? -20.881 -4.031  32.079  1.00 160.03 ? 354 ASN Y C   1 
ATOM   7552  O O   . ASN F  3 339 ? -22.031 -3.606  32.256  1.00 157.48 ? 354 ASN Y O   1 
ATOM   7553  C CB  . ASN F  3 339 ? -20.652 -3.510  29.604  1.00 148.48 ? 354 ASN Y CB  1 
ATOM   7554  C CG  . ASN F  3 339 ? -20.193 -3.937  28.226  1.00 170.52 ? 354 ASN Y CG  1 
ATOM   7555  O OD1 . ASN F  3 339 ? -19.047 -4.359  28.020  1.00 169.59 ? 354 ASN Y OD1 1 
ATOM   7556  N ND2 . ASN F  3 339 ? -21.074 -3.808  27.244  1.00 156.81 ? 354 ASN Y ND2 1 
ATOM   7557  N N   . PRO F  3 340 ? -19.929 -3.996  33.060  1.00 162.36 ? 355 PRO Y N   1 
ATOM   7558  C CA  . PRO F  3 340 ? -20.259 -3.459  34.402  1.00 166.64 ? 355 PRO Y CA  1 
ATOM   7559  C C   . PRO F  3 340 ? -20.352 -1.932  34.433  1.00 164.59 ? 355 PRO Y C   1 
ATOM   7560  O O   . PRO F  3 340 ? -20.667 -1.343  35.475  1.00 167.50 ? 355 PRO Y O   1 
ATOM   7561  C CB  . PRO F  3 340 ? -19.119 -3.980  35.285  1.00 175.37 ? 355 PRO Y CB  1 
ATOM   7562  C CG  . PRO F  3 340 ? -17.965 -4.129  34.365  1.00 177.64 ? 355 PRO Y CG  1 
ATOM   7563  C CD  . PRO F  3 340 ? -18.519 -4.445  32.993  1.00 166.71 ? 355 PRO Y CD  1 
ATOM   7564  N N   . CYS F  3 341 ? -20.051 -1.313  33.268  1.00 152.22 ? 356 CYS Y N   1 
ATOM   7565  C CA  . CYS F  3 341 ? -20.063 0.105   32.915  1.00 146.43 ? 356 CYS Y CA  1 
ATOM   7566  C C   . CYS F  3 341 ? -18.849 0.895   33.431  1.00 154.38 ? 356 CYS Y C   1 
ATOM   7567  O O   . CYS F  3 341 ? -18.635 1.040   34.642  1.00 160.65 ? 356 CYS Y O   1 
ATOM   7568  C CB  . CYS F  3 341 ? -21.383 0.774   33.280  1.00 144.42 ? 356 CYS Y CB  1 
ATOM   7569  S SG  . CYS F  3 341 ? -22.588 0.751   31.932  1.00 139.96 ? 356 CYS Y SG  1 
ATOM   7570  N N   . GLU F  3 342 ? -18.048 1.385   32.457  1.00 146.41 ? 357 GLU Y N   1 
ATOM   7571  C CA  . GLU F  3 342 ? -16.826 2.168   32.642  1.00 180.84 ? 357 GLU Y CA  1 
ATOM   7572  C C   . GLU F  3 342 ? -17.106 3.638   32.339  1.00 206.10 ? 357 GLU Y C   1 
ATOM   7573  O O   . GLU F  3 342 ? -17.779 3.951   31.355  1.00 162.26 ? 357 GLU Y O   1 
ATOM   7574  C CB  . GLU F  3 342 ? -15.702 1.650   31.721  1.00 180.49 ? 357 GLU Y CB  1 
ATOM   7575  C CG  . GLU F  3 342 ? -15.098 0.318   32.140  1.00 193.08 ? 357 GLU Y CG  1 
ATOM   7576  C CD  . GLU F  3 342 ? -15.907 -0.919  31.797  1.00 208.91 ? 357 GLU Y CD  1 
ATOM   7577  O OE1 . GLU F  3 342 ? -16.238 -1.110  30.603  1.00 201.09 ? 357 GLU Y OE1 1 
ATOM   7578  O OE2 . GLU F  3 342 ? -16.194 -1.711  32.724  1.00 207.17 ? 357 GLU Y OE2 1 
ATOM   7579  N N   . GLN G  1 5   ? 4.682   52.176  1.758   1.00 121.05 ? 5   GLN G N   1 
ATOM   7580  C CA  . GLN G  1 5   ? 5.121   53.179  0.784   1.00 124.90 ? 5   GLN G CA  1 
ATOM   7581  C C   . GLN G  1 5   ? 6.633   53.092  0.507   1.00 124.58 ? 5   GLN G C   1 
ATOM   7582  O O   . GLN G  1 5   ? 7.035   52.585  -0.548  1.00 120.48 ? 5   GLN G O   1 
ATOM   7583  C CB  . GLN G  1 5   ? 4.694   54.602  1.212   1.00 135.34 ? 5   GLN G CB  1 
ATOM   7584  C CG  . GLN G  1 5   ? 3.224   54.930  0.923   1.00 158.62 ? 5   GLN G CG  1 
ATOM   7585  C CD  . GLN G  1 5   ? 2.310   54.688  2.102   1.00 176.37 ? 5   GLN G CD  1 
ATOM   7586  O OE1 . GLN G  1 5   ? 2.273   55.465  3.063   1.00 176.46 ? 5   GLN G OE1 1 
ATOM   7587  N NE2 . GLN G  1 5   ? 1.510   53.631  2.031   1.00 163.02 ? 5   GLN G NE2 1 
ATOM   7588  N N   . ASP G  1 6   ? 7.464   53.574  1.459   1.00 121.81 ? 6   ASP G N   1 
ATOM   7589  C CA  . ASP G  1 6   ? 8.925   53.532  1.362   1.00 118.57 ? 6   ASP G CA  1 
ATOM   7590  C C   . ASP G  1 6   ? 9.456   52.175  1.833   1.00 111.53 ? 6   ASP G C   1 
ATOM   7591  O O   . ASP G  1 6   ? 9.266   51.787  2.994   1.00 110.38 ? 6   ASP G O   1 
ATOM   7592  C CB  . ASP G  1 6   ? 9.575   54.694  2.148   1.00 126.21 ? 6   ASP G CB  1 
ATOM   7593  C CG  . ASP G  1 6   ? 11.046  54.483  2.470   1.00 133.24 ? 6   ASP G CG  1 
ATOM   7594  O OD1 . ASP G  1 6   ? 11.839  54.277  1.523   1.00 131.72 ? 6   ASP G OD1 1 
ATOM   7595  O OD2 . ASP G  1 6   ? 11.397  54.495  3.668   1.00 139.36 ? 6   ASP G OD2 1 
ATOM   7596  N N   . CYS G  1 7   ? 10.122  51.457  0.925   1.00 100.01 ? 7   CYS G N   1 
ATOM   7597  C CA  . CYS G  1 7   ? 10.707  50.164  1.246   1.00 90.86  ? 7   CYS G CA  1 
ATOM   7598  C C   . CYS G  1 7   ? 12.202  50.176  0.917   1.00 92.78  ? 7   CYS G C   1 
ATOM   7599  O O   . CYS G  1 7   ? 12.582  49.913  -0.230  1.00 90.79  ? 7   CYS G O   1 
ATOM   7600  C CB  . CYS G  1 7   ? 9.970   49.033  0.542   1.00 85.78  ? 7   CYS G CB  1 
ATOM   7601  S SG  . CYS G  1 7   ? 9.775   47.548  1.560   1.00 83.23  ? 7   CYS G SG  1 
ATOM   7602  N N   . PRO G  1 8   ? 13.059  50.515  1.918   1.00 90.21  ? 8   PRO G N   1 
ATOM   7603  C CA  . PRO G  1 8   ? 14.507  50.607  1.660   1.00 89.23  ? 8   PRO G CA  1 
ATOM   7604  C C   . PRO G  1 8   ? 15.127  49.337  1.108   1.00 85.69  ? 8   PRO G C   1 
ATOM   7605  O O   . PRO G  1 8   ? 14.962  48.279  1.690   1.00 80.33  ? 8   PRO G O   1 
ATOM   7606  C CB  . PRO G  1 8   ? 15.094  50.990  3.026   1.00 92.73  ? 8   PRO G CB  1 
ATOM   7607  C CG  . PRO G  1 8   ? 14.050  50.612  4.019   1.00 96.68  ? 8   PRO G CG  1 
ATOM   7608  C CD  . PRO G  1 8   ? 12.752  50.870  3.318   1.00 93.95  ? 8   PRO G CD  1 
ATOM   7609  N N   . GLU G  1 9   ? 15.806  49.461  -0.041  1.00 83.49  ? 9   GLU G N   1 
ATOM   7610  C CA  . GLU G  1 9   ? 16.498  48.399  -0.766  1.00 80.07  ? 9   GLU G CA  1 
ATOM   7611  C C   . GLU G  1 9   ? 17.495  47.699  0.130   1.00 79.91  ? 9   GLU G C   1 
ATOM   7612  O O   . GLU G  1 9   ? 18.235  48.353  0.863   1.00 81.72  ? 9   GLU G O   1 
ATOM   7613  C CB  . GLU G  1 9   ? 17.196  48.980  -2.019  1.00 85.45  ? 9   GLU G CB  1 
ATOM   7614  C CG  . GLU G  1 9   ? 18.202  48.082  -2.737  1.00 95.78  ? 9   GLU G CG  1 
ATOM   7615  C CD  . GLU G  1 9   ? 18.865  48.732  -3.940  1.00 125.40 ? 9   GLU G CD  1 
ATOM   7616  O OE1 . GLU G  1 9   ? 19.681  49.666  -3.746  1.00 124.39 ? 9   GLU G OE1 1 
ATOM   7617  O OE2 . GLU G  1 9   ? 18.556  48.313  -5.080  1.00 117.01 ? 9   GLU G OE2 1 
ATOM   7618  N N   . CYS G  1 10  ? 17.477  46.365  0.072   1.00 71.17  ? 10  CYS G N   1 
ATOM   7619  C CA  . CYS G  1 10  ? 18.350  45.435  0.779   1.00 67.82  ? 10  CYS G CA  1 
ATOM   7620  C C   . CYS G  1 10  ? 19.833  45.885  0.773   1.00 72.98  ? 10  CYS G C   1 
ATOM   7621  O O   . CYS G  1 10  ? 20.457  45.981  -0.293  1.00 73.60  ? 10  CYS G O   1 
ATOM   7622  C CB  . CYS G  1 10  ? 18.173  44.038  0.192   1.00 64.49  ? 10  CYS G CB  1 
ATOM   7623  S SG  . CYS G  1 10  ? 19.422  42.845  0.707   1.00 66.07  ? 10  CYS G SG  1 
ATOM   7624  N N   . THR G  1 11  ? 20.361  46.213  1.972   1.00 70.13  ? 11  THR G N   1 
ATOM   7625  C CA  . THR G  1 11  ? 21.746  46.662  2.172   1.00 72.69  ? 11  THR G CA  1 
ATOM   7626  C C   . THR G  1 11  ? 22.319  46.265  3.533   1.00 74.29  ? 11  THR G C   1 
ATOM   7627  O O   . THR G  1 11  ? 21.602  45.729  4.379   1.00 71.80  ? 11  THR G O   1 
ATOM   7628  C CB  . THR G  1 11  ? 21.890  48.182  1.922   1.00 92.22  ? 11  THR G CB  1 
ATOM   7629  O OG1 . THR G  1 11  ? 23.274  48.488  1.755   1.00 95.61  ? 11  THR G OG1 1 
ATOM   7630  C CG2 . THR G  1 11  ? 21.298  49.041  3.054   1.00 94.33  ? 11  THR G CG2 1 
ATOM   7631  N N   . LEU G  1 12  ? 23.613  46.555  3.737   1.00 71.86  ? 12  LEU G N   1 
ATOM   7632  C CA  . LEU G  1 12  ? 24.318  46.308  4.989   1.00 71.35  ? 12  LEU G CA  1 
ATOM   7633  C C   . LEU G  1 12  ? 23.956  47.377  6.013   1.00 76.98  ? 12  LEU G C   1 
ATOM   7634  O O   . LEU G  1 12  ? 24.000  48.570  5.709   1.00 80.19  ? 12  LEU G O   1 
ATOM   7635  C CB  . LEU G  1 12  ? 25.837  46.348  4.771   1.00 73.20  ? 12  LEU G CB  1 
ATOM   7636  C CG  . LEU G  1 12  ? 26.502  45.173  4.088   1.00 74.99  ? 12  LEU G CG  1 
ATOM   7637  C CD1 . LEU G  1 12  ? 27.829  45.597  3.484   1.00 78.80  ? 12  LEU G CD1 1 
ATOM   7638  C CD2 . LEU G  1 12  ? 26.710  44.053  5.046   1.00 72.55  ? 12  LEU G CD2 1 
ATOM   7639  N N   . GLN G  1 13  ? 23.632  46.940  7.231   1.00 72.09  ? 13  GLN G N   1 
ATOM   7640  C CA  . GLN G  1 13  ? 23.302  47.780  8.383   1.00 75.25  ? 13  GLN G CA  1 
ATOM   7641  C C   . GLN G  1 13  ? 24.015  47.191  9.609   1.00 81.31  ? 13  GLN G C   1 
ATOM   7642  O O   . GLN G  1 13  ? 24.434  46.035  9.574   1.00 78.52  ? 13  GLN G O   1 
ATOM   7643  C CB  . GLN G  1 13  ? 21.781  47.813  8.619   1.00 75.69  ? 13  GLN G CB  1 
ATOM   7644  C CG  . GLN G  1 13  ? 20.960  48.503  7.520   1.00 87.47  ? 13  GLN G CG  1 
ATOM   7645  C CD  . GLN G  1 13  ? 20.665  49.966  7.767   1.00 108.43 ? 13  GLN G CD  1 
ATOM   7646  O OE1 . GLN G  1 13  ? 20.645  50.453  8.907   1.00 108.15 ? 13  GLN G OE1 1 
ATOM   7647  N NE2 . GLN G  1 13  ? 20.376  50.697  6.695   1.00 96.16  ? 13  GLN G NE2 1 
ATOM   7648  N N   . GLU G  1 14  ? 24.170  47.969  10.684  1.00 82.57  ? 14  GLU G N   1 
ATOM   7649  C CA  . GLU G  1 14  ? 24.796  47.446  11.899  1.00 83.32  ? 14  GLU G CA  1 
ATOM   7650  C C   . GLU G  1 14  ? 23.747  46.650  12.657  1.00 86.20  ? 14  GLU G C   1 
ATOM   7651  O O   . GLU G  1 14  ? 22.596  47.086  12.727  1.00 87.21  ? 14  GLU G O   1 
ATOM   7652  C CB  . GLU G  1 14  ? 25.264  48.585  12.815  1.00 90.28  ? 14  GLU G CB  1 
ATOM   7653  C CG  . GLU G  1 14  ? 26.421  49.417  12.294  1.00 101.04 ? 14  GLU G CG  1 
ATOM   7654  C CD  . GLU G  1 14  ? 26.907  50.484  13.258  1.00 119.91 ? 14  GLU G CD  1 
ATOM   7655  O OE1 . GLU G  1 14  ? 26.553  50.413  14.458  1.00 101.33 ? 14  GLU G OE1 1 
ATOM   7656  O OE2 . GLU G  1 14  ? 27.658  51.384  12.816  1.00 119.45 ? 14  GLU G OE2 1 
ATOM   7657  N N   . ASN G  1 15  ? 24.132  45.503  13.234  1.00 80.40  ? 15  ASN G N   1 
ATOM   7658  C CA  . ASN G  1 15  ? 23.233  44.704  14.065  1.00 79.08  ? 15  ASN G CA  1 
ATOM   7659  C C   . ASN G  1 15  ? 23.216  45.378  15.458  1.00 88.55  ? 15  ASN G C   1 
ATOM   7660  O O   . ASN G  1 15  ? 24.295  45.614  15.998  1.00 90.26  ? 15  ASN G O   1 
ATOM   7661  C CB  . ASN G  1 15  ? 23.769  43.280  14.176  1.00 76.48  ? 15  ASN G CB  1 
ATOM   7662  C CG  . ASN G  1 15  ? 22.806  42.236  14.706  1.00 97.41  ? 15  ASN G CG  1 
ATOM   7663  O OD1 . ASN G  1 15  ? 22.147  42.399  15.738  1.00 91.31  ? 15  ASN G OD1 1 
ATOM   7664  N ND2 . ASN G  1 15  ? 22.786  41.083  14.057  1.00 87.14  ? 15  ASN G ND2 1 
ATOM   7665  N N   . PRO G  1 16  ? 22.049  45.745  16.049  1.00 88.40  ? 16  PRO G N   1 
ATOM   7666  C CA  . PRO G  1 16  ? 22.075  46.401  17.379  1.00 94.25  ? 16  PRO G CA  1 
ATOM   7667  C C   . PRO G  1 16  ? 22.782  45.547  18.437  1.00 99.20  ? 16  PRO G C   1 
ATOM   7668  O O   . PRO G  1 16  ? 23.728  46.026  19.071  1.00 102.51 ? 16  PRO G O   1 
ATOM   7669  C CB  . PRO G  1 16  ? 20.596  46.653  17.698  1.00 97.92  ? 16  PRO G CB  1 
ATOM   7670  C CG  . PRO G  1 16  ? 19.842  45.728  16.796  1.00 96.88  ? 16  PRO G CG  1 
ATOM   7671  C CD  . PRO G  1 16  ? 20.666  45.574  15.558  1.00 88.19  ? 16  PRO G CD  1 
ATOM   7672  N N   . LEU G  1 17  ? 22.369  44.266  18.568  1.00 92.45  ? 17  LEU G N   1 
ATOM   7673  C CA  . LEU G  1 17  ? 22.995  43.273  19.440  1.00 93.12  ? 17  LEU G CA  1 
ATOM   7674  C C   . LEU G  1 17  ? 24.268  42.816  18.711  1.00 94.77  ? 17  LEU G C   1 
ATOM   7675  O O   . LEU G  1 17  ? 24.244  42.667  17.485  1.00 91.18  ? 17  LEU G O   1 
ATOM   7676  C CB  . LEU G  1 17  ? 22.058  42.065  19.602  1.00 91.16  ? 17  LEU G CB  1 
ATOM   7677  C CG  . LEU G  1 17  ? 22.037  41.362  20.960  1.00 100.03 ? 17  LEU G CG  1 
ATOM   7678  C CD1 . LEU G  1 17  ? 20.773  40.555  21.112  1.00 99.72  ? 17  LEU G CD1 1 
ATOM   7679  C CD2 . LEU G  1 17  ? 23.246  40.444  21.158  1.00 102.31 ? 17  LEU G CD2 1 
ATOM   7680  N N   . PHE G  1 18  ? 25.370  42.588  19.457  1.00 92.28  ? 18  PHE G N   1 
ATOM   7681  C CA  . PHE G  1 18  ? 26.680  42.140  18.943  1.00 89.60  ? 18  PHE G CA  1 
ATOM   7682  C C   . PHE G  1 18  ? 27.577  43.270  18.456  1.00 93.27  ? 18  PHE G C   1 
ATOM   7683  O O   . PHE G  1 18  ? 28.781  43.216  18.714  1.00 95.86  ? 18  PHE G O   1 
ATOM   7684  C CB  . PHE G  1 18  ? 26.599  41.045  17.852  1.00 86.18  ? 18  PHE G CB  1 
ATOM   7685  C CG  . PHE G  1 18  ? 25.759  39.811  18.088  1.00 86.23  ? 18  PHE G CG  1 
ATOM   7686  C CD1 . PHE G  1 18  ? 26.030  38.957  19.151  1.00 91.81  ? 18  PHE G CD1 1 
ATOM   7687  C CD2 . PHE G  1 18  ? 24.770  39.445  17.185  1.00 84.94  ? 18  PHE G CD2 1 
ATOM   7688  C CE1 . PHE G  1 18  ? 25.286  37.794  19.341  1.00 92.12  ? 18  PHE G CE1 1 
ATOM   7689  C CE2 . PHE G  1 18  ? 24.031  38.277  17.371  1.00 86.95  ? 18  PHE G CE2 1 
ATOM   7690  C CZ  . PHE G  1 18  ? 24.288  37.462  18.452  1.00 87.89  ? 18  PHE G CZ  1 
ATOM   7691  N N   . SER G  1 19  ? 27.037  44.262  17.714  1.00 86.59  ? 19  SER G N   1 
ATOM   7692  C CA  . SER G  1 19  ? 27.876  45.364  17.241  1.00 87.01  ? 19  SER G CA  1 
ATOM   7693  C C   . SER G  1 19  ? 28.422  46.133  18.432  1.00 94.83  ? 19  SER G C   1 
ATOM   7694  O O   . SER G  1 19  ? 27.686  46.417  19.381  1.00 97.33  ? 19  SER G O   1 
ATOM   7695  C CB  . SER G  1 19  ? 27.110  46.295  16.312  1.00 88.70  ? 19  SER G CB  1 
ATOM   7696  O OG  . SER G  1 19  ? 26.908  45.720  15.031  1.00 89.84  ? 19  SER G OG  1 
ATOM   7697  N N   . GLN G  1 20  ? 29.722  46.402  18.415  1.00 92.22  ? 20  GLN G N   1 
ATOM   7698  C CA  . GLN G  1 20  ? 30.375  47.130  19.499  1.00 97.57  ? 20  GLN G CA  1 
ATOM   7699  C C   . GLN G  1 20  ? 31.168  48.335  18.984  1.00 100.98 ? 20  GLN G C   1 
ATOM   7700  O O   . GLN G  1 20  ? 31.506  48.349  17.802  1.00 96.35  ? 20  GLN G O   1 
ATOM   7701  C CB  . GLN G  1 20  ? 31.251  46.177  20.336  1.00 100.40 ? 20  GLN G CB  1 
ATOM   7702  C CG  . GLN G  1 20  ? 30.459  45.306  21.317  1.00 116.51 ? 20  GLN G CG  1 
ATOM   7703  C CD  . GLN G  1 20  ? 29.671  46.135  22.306  1.00 143.86 ? 20  GLN G CD  1 
ATOM   7704  O OE1 . GLN G  1 20  ? 28.443  46.239  22.217  1.00 138.40 ? 20  GLN G OE1 1 
ATOM   7705  N NE2 . GLN G  1 20  ? 30.363  46.789  23.233  1.00 143.24 ? 20  GLN G NE2 1 
ATOM   7706  N N   . PRO G  1 21  ? 31.455  49.374  19.811  1.00 103.71 ? 21  PRO G N   1 
ATOM   7707  C CA  . PRO G  1 21  ? 32.208  50.540  19.289  1.00 106.36 ? 21  PRO G CA  1 
ATOM   7708  C C   . PRO G  1 21  ? 33.592  50.141  18.771  1.00 107.25 ? 21  PRO G C   1 
ATOM   7709  O O   . PRO G  1 21  ? 34.362  49.502  19.497  1.00 108.09 ? 21  PRO G O   1 
ATOM   7710  C CB  . PRO G  1 21  ? 32.270  51.496  20.488  1.00 115.26 ? 21  PRO G CB  1 
ATOM   7711  C CG  . PRO G  1 21  ? 31.151  51.066  21.379  1.00 120.23 ? 21  PRO G CG  1 
ATOM   7712  C CD  . PRO G  1 21  ? 31.109  49.570  21.233  1.00 110.20 ? 21  PRO G CD  1 
ATOM   7713  N N   . GLY G  1 22  ? 33.838  50.419  17.490  1.00 99.79  ? 22  GLY G N   1 
ATOM   7714  C CA  . GLY G  1 22  ? 35.074  50.037  16.816  1.00 98.15  ? 22  GLY G CA  1 
ATOM   7715  C C   . GLY G  1 22  ? 35.020  48.639  16.222  1.00 95.57  ? 22  GLY G C   1 
ATOM   7716  O O   . GLY G  1 22  ? 35.785  48.326  15.305  1.00 94.19  ? 22  GLY G O   1 
ATOM   7717  N N   . ALA G  1 23  ? 34.095  47.789  16.726  1.00 87.72  ? 23  ALA G N   1 
ATOM   7718  C CA  . ALA G  1 23  ? 33.896  46.418  16.259  1.00 81.66  ? 23  ALA G CA  1 
ATOM   7719  C C   . ALA G  1 23  ? 32.394  46.159  15.895  1.00 83.75  ? 23  ALA G C   1 
ATOM   7720  O O   . ALA G  1 23  ? 31.729  45.280  16.483  1.00 82.05  ? 23  ALA G O   1 
ATOM   7721  C CB  . ALA G  1 23  ? 34.396  45.439  17.312  1.00 82.59  ? 23  ALA G CB  1 
ATOM   7722  N N   . PRO G  1 24  ? 31.810  46.933  14.942  1.00 79.44  ? 24  PRO G N   1 
ATOM   7723  C CA  . PRO G  1 24  ? 30.402  46.685  14.609  1.00 75.99  ? 24  PRO G CA  1 
ATOM   7724  C C   . PRO G  1 24  ? 30.249  45.466  13.715  1.00 75.82  ? 24  PRO G C   1 
ATOM   7725  O O   . PRO G  1 24  ? 31.094  45.223  12.860  1.00 74.91  ? 24  PRO G O   1 
ATOM   7726  C CB  . PRO G  1 24  ? 29.973  47.973  13.904  1.00 79.37  ? 24  PRO G CB  1 
ATOM   7727  C CG  . PRO G  1 24  ? 31.225  48.536  13.319  1.00 85.73  ? 24  PRO G CG  1 
ATOM   7728  C CD  . PRO G  1 24  ? 32.388  48.009  14.101  1.00 82.76  ? 24  PRO G CD  1 
ATOM   7729  N N   . ILE G  1 25  ? 29.216  44.674  13.927  1.00 70.32  ? 25  ILE G N   1 
ATOM   7730  C CA  . ILE G  1 25  ? 29.035  43.560  13.015  1.00 66.64  ? 25  ILE G CA  1 
ATOM   7731  C C   . ILE G  1 25  ? 27.931  43.964  12.041  1.00 69.69  ? 25  ILE G C   1 
ATOM   7732  O O   . ILE G  1 25  ? 26.920  44.569  12.437  1.00 71.30  ? 25  ILE G O   1 
ATOM   7733  C CB  . ILE G  1 25  ? 28.901  42.139  13.629  1.00 68.16  ? 25  ILE G CB  1 
ATOM   7734  C CG1 . ILE G  1 25  ? 27.817  42.064  14.674  1.00 70.05  ? 25  ILE G CG1 1 
ATOM   7735  C CG2 . ILE G  1 25  ? 30.222  41.603  14.168  1.00 69.82  ? 25  ILE G CG2 1 
ATOM   7736  C CD1 . ILE G  1 25  ? 26.801  41.163  14.265  1.00 77.82  ? 25  ILE G CD1 1 
ATOM   7737  N N   . LEU G  1 26  ? 28.185  43.720  10.754  1.00 62.51  ? 26  LEU G N   1 
ATOM   7738  C CA  . LEU G  1 26  ? 27.290  44.134  9.687   1.00 59.94  ? 26  LEU G CA  1 
ATOM   7739  C C   . LEU G  1 26  ? 26.305  43.051  9.306   1.00 58.52  ? 26  LEU G C   1 
ATOM   7740  O O   . LEU G  1 26  ? 26.621  41.868  9.400   1.00 55.19  ? 26  LEU G O   1 
ATOM   7741  C CB  . LEU G  1 26  ? 28.097  44.654  8.488   1.00 60.78  ? 26  LEU G CB  1 
ATOM   7742  C CG  . LEU G  1 26  ? 29.265  45.553  8.861   1.00 68.83  ? 26  LEU G CG  1 
ATOM   7743  C CD1 . LEU G  1 26  ? 30.378  45.415  7.888   1.00 70.50  ? 26  LEU G CD1 1 
ATOM   7744  C CD2 . LEU G  1 26  ? 28.838  46.971  9.052   1.00 71.89  ? 26  LEU G CD2 1 
ATOM   7745  N N   . GLN G  1 27  ? 25.106  43.468  8.885   1.00 55.17  ? 27  GLN G N   1 
ATOM   7746  C CA  . GLN G  1 27  ? 23.987  42.591  8.553   1.00 52.33  ? 27  GLN G CA  1 
ATOM   7747  C C   . GLN G  1 27  ? 23.218  43.058  7.337   1.00 57.69  ? 27  GLN G C   1 
ATOM   7748  O O   . GLN G  1 27  ? 22.915  44.239  7.202   1.00 59.64  ? 27  GLN G O   1 
ATOM   7749  C CB  . GLN G  1 27  ? 23.025  42.492  9.754   1.00 53.49  ? 27  GLN G CB  1 
ATOM   7750  C CG  . GLN G  1 27  ? 21.996  41.387  9.640   1.00 56.80  ? 27  GLN G CG  1 
ATOM   7751  C CD  . GLN G  1 27  ? 21.080  41.250  10.835  1.00 71.54  ? 27  GLN G CD  1 
ATOM   7752  O OE1 . GLN G  1 27  ? 21.231  41.925  11.862  1.00 69.83  ? 27  GLN G OE1 1 
ATOM   7753  N NE2 . GLN G  1 27  ? 20.090  40.369  10.719  1.00 52.20  ? 27  GLN G NE2 1 
ATOM   7754  N N   . CYS G  1 28  ? 22.836  42.104  6.498   1.00 53.42  ? 28  CYS G N   1 
ATOM   7755  C CA  . CYS G  1 28  ? 22.029  42.359  5.323   1.00 53.52  ? 28  CYS G CA  1 
ATOM   7756  C C   . CYS G  1 28  ? 20.581  42.427  5.704   1.00 59.57  ? 28  CYS G C   1 
ATOM   7757  O O   . CYS G  1 28  ? 20.043  41.483  6.304   1.00 58.91  ? 28  CYS G O   1 
ATOM   7758  C CB  . CYS G  1 28  ? 22.286  41.304  4.256   1.00 51.73  ? 28  CYS G CB  1 
ATOM   7759  S SG  . CYS G  1 28  ? 23.952  41.391  3.568   1.00 57.63  ? 28  CYS G SG  1 
ATOM   7760  N N   . MET G  1 29  ? 19.957  43.570  5.396   1.00 57.86  ? 29  MET G N   1 
ATOM   7761  C CA  . MET G  1 29  ? 18.541  43.811  5.665   1.00 57.85  ? 29  MET G CA  1 
ATOM   7762  C C   . MET G  1 29  ? 17.945  44.800  4.697   1.00 63.06  ? 29  MET G C   1 
ATOM   7763  O O   . MET G  1 29  ? 18.666  45.588  4.084   1.00 66.14  ? 29  MET G O   1 
ATOM   7764  C CB  . MET G  1 29  ? 18.289  44.232  7.105   1.00 62.44  ? 29  MET G CB  1 
ATOM   7765  C CG  . MET G  1 29  ? 19.150  45.350  7.552   1.00 70.21  ? 29  MET G CG  1 
ATOM   7766  S SD  . MET G  1 29  ? 18.855  45.627  9.283   1.00 78.10  ? 29  MET G SD  1 
ATOM   7767  C CE  . MET G  1 29  ? 19.830  44.380  9.982   1.00 72.67  ? 29  MET G CE  1 
ATOM   7768  N N   . GLY G  1 30  ? 16.636  44.743  4.562   1.00 57.77  ? 30  GLY G N   1 
ATOM   7769  C CA  . GLY G  1 30  ? 15.918  45.600  3.645   1.00 59.97  ? 30  GLY G CA  1 
ATOM   7770  C C   . GLY G  1 30  ? 14.991  44.844  2.725   1.00 63.69  ? 30  GLY G C   1 
ATOM   7771  O O   . GLY G  1 30  ? 14.869  43.616  2.779   1.00 58.87  ? 30  GLY G O   1 
ATOM   7772  N N   . CYS G  1 31  ? 14.364  45.599  1.851   1.00 66.10  ? 31  CYS G N   1 
ATOM   7773  C CA  . CYS G  1 31  ? 13.340  45.157  0.932   1.00 66.19  ? 31  CYS G CA  1 
ATOM   7774  C C   . CYS G  1 31  ? 13.862  44.565  -0.354  1.00 66.75  ? 31  CYS G C   1 
ATOM   7775  O O   . CYS G  1 31  ? 14.883  45.005  -0.896  1.00 66.82  ? 31  CYS G O   1 
ATOM   7776  C CB  . CYS G  1 31  ? 12.359  46.290  0.663   1.00 71.72  ? 31  CYS G CB  1 
ATOM   7777  S SG  . CYS G  1 31  ? 11.649  47.014  2.161   1.00 79.23  ? 31  CYS G SG  1 
ATOM   7778  N N   . CYS G  1 32  ? 13.099  43.562  -0.840  1.00 60.13  ? 32  CYS G N   1 
ATOM   7779  C CA  . CYS G  1 32  ? 13.290  42.815  -2.074  1.00 58.20  ? 32  CYS G CA  1 
ATOM   7780  C C   . CYS G  1 32  ? 11.954  42.647  -2.829  1.00 60.22  ? 32  CYS G C   1 
ATOM   7781  O O   . CYS G  1 32  ? 10.897  42.780  -2.217  1.00 59.72  ? 32  CYS G O   1 
ATOM   7782  C CB  . CYS G  1 32  ? 13.958  41.484  -1.776  1.00 55.36  ? 32  CYS G CB  1 
ATOM   7783  S SG  . CYS G  1 32  ? 15.679  41.647  -1.236  1.00 60.06  ? 32  CYS G SG  1 
ATOM   7784  N N   . PHE G  1 33  ? 11.997  42.463  -4.163  1.00 56.00  ? 33  PHE G N   1 
ATOM   7785  C CA  . PHE G  1 33  ? 10.783  42.332  -4.957  1.00 55.60  ? 33  PHE G CA  1 
ATOM   7786  C C   . PHE G  1 33  ? 10.184  40.943  -4.886  1.00 56.51  ? 33  PHE G C   1 
ATOM   7787  O O   . PHE G  1 33  ? 10.892  39.946  -5.013  1.00 53.75  ? 33  PHE G O   1 
ATOM   7788  C CB  . PHE G  1 33  ? 10.976  42.759  -6.419  1.00 60.40  ? 33  PHE G CB  1 
ATOM   7789  C CG  . PHE G  1 33  ? 9.675   42.704  -7.194  1.00 63.66  ? 33  PHE G CG  1 
ATOM   7790  C CD1 . PHE G  1 33  ? 8.708   43.697  -7.037  1.00 69.66  ? 33  PHE G CD1 1 
ATOM   7791  C CD2 . PHE G  1 33  ? 9.381   41.623  -8.018  1.00 64.96  ? 33  PHE G CD2 1 
ATOM   7792  C CE1 . PHE G  1 33  ? 7.484   43.620  -7.711  1.00 71.77  ? 33  PHE G CE1 1 
ATOM   7793  C CE2 . PHE G  1 33  ? 8.163   41.556  -8.706  1.00 69.34  ? 33  PHE G CE2 1 
ATOM   7794  C CZ  . PHE G  1 33  ? 7.227   42.561  -8.555  1.00 69.84  ? 33  PHE G CZ  1 
ATOM   7795  N N   . SER G  1 34  ? 8.856   40.890  -4.739  1.00 53.14  ? 34  SER G N   1 
ATOM   7796  C CA  . SER G  1 34  ? 8.083   39.656  -4.689  1.00 50.50  ? 34  SER G CA  1 
ATOM   7797  C C   . SER G  1 34  ? 6.738   39.886  -5.350  1.00 57.34  ? 34  SER G C   1 
ATOM   7798  O O   . SER G  1 34  ? 6.225   41.008  -5.357  1.00 60.14  ? 34  SER G O   1 
ATOM   7799  C CB  . SER G  1 34  ? 7.908   39.149  -3.253  1.00 51.23  ? 34  SER G CB  1 
ATOM   7800  O OG  . SER G  1 34  ? 8.346   40.038  -2.232  1.00 61.17  ? 34  SER G OG  1 
ATOM   7801  N N   . ARG G  1 35  ? 6.182   38.829  -5.943  1.00 53.71  ? 35  ARG G N   1 
ATOM   7802  C CA  . ARG G  1 35  ? 4.878   38.881  -6.606  1.00 55.37  ? 35  ARG G CA  1 
ATOM   7803  C C   . ARG G  1 35  ? 4.172   37.506  -6.615  1.00 58.34  ? 35  ARG G C   1 
ATOM   7804  O O   . ARG G  1 35  ? 4.784   36.477  -6.287  1.00 57.05  ? 35  ARG G O   1 
ATOM   7805  C CB  . ARG G  1 35  ? 4.979   39.513  -8.020  1.00 55.52  ? 35  ARG G CB  1 
ATOM   7806  C CG  . ARG G  1 35  ? 5.759   38.703  -9.039  1.00 53.41  ? 35  ARG G CG  1 
ATOM   7807  C CD  . ARG G  1 35  ? 5.124   38.864  -10.392 1.00 59.58  ? 35  ARG G CD  1 
ATOM   7808  N NE  . ARG G  1 35  ? 6.006   38.400  -11.456 1.00 63.86  ? 35  ARG G NE  1 
ATOM   7809  C CZ  . ARG G  1 35  ? 5.779   38.565  -12.755 1.00 71.61  ? 35  ARG G CZ  1 
ATOM   7810  N NH1 . ARG G  1 35  ? 4.685   39.194  -13.172 1.00 63.59  ? 35  ARG G NH1 1 
ATOM   7811  N NH2 . ARG G  1 35  ? 6.644   38.101  -13.649 1.00 46.33  ? 35  ARG G NH2 1 
ATOM   7812  N N   . ALA G  1 36  ? 2.869   37.518  -6.930  1.00 55.38  ? 36  ALA G N   1 
ATOM   7813  C CA  . ALA G  1 36  ? 2.015   36.332  -7.047  1.00 54.15  ? 36  ALA G CA  1 
ATOM   7814  C C   . ALA G  1 36  ? 1.121   36.542  -8.248  1.00 61.01  ? 36  ALA G C   1 
ATOM   7815  O O   . ALA G  1 36  ? 0.897   37.691  -8.653  1.00 65.18  ? 36  ALA G O   1 
ATOM   7816  C CB  . ALA G  1 36  ? 1.172   36.138  -5.796  1.00 53.86  ? 36  ALA G CB  1 
ATOM   7817  N N   . TYR G  1 37  ? 0.655   35.434  -8.847  1.00 54.87  ? 37  TYR G N   1 
ATOM   7818  C CA  . TYR G  1 37  ? -0.204  35.410  -10.033 1.00 56.31  ? 37  TYR G CA  1 
ATOM   7819  C C   . TYR G  1 37  ? -0.693  33.977  -10.288 1.00 58.19  ? 37  TYR G C   1 
ATOM   7820  O O   . TYR G  1 37  ? -0.072  33.041  -9.776  1.00 54.12  ? 37  TYR G O   1 
ATOM   7821  C CB  . TYR G  1 37  ? 0.537   35.990  -11.268 1.00 59.22  ? 37  TYR G CB  1 
ATOM   7822  C CG  . TYR G  1 37  ? 1.831   35.297  -11.622 1.00 58.82  ? 37  TYR G CG  1 
ATOM   7823  C CD1 . TYR G  1 37  ? 1.833   34.126  -12.376 1.00 61.14  ? 37  TYR G CD1 1 
ATOM   7824  C CD2 . TYR G  1 37  ? 3.059   35.834  -11.247 1.00 58.44  ? 37  TYR G CD2 1 
ATOM   7825  C CE1 . TYR G  1 37  ? 3.021   33.488  -12.721 1.00 60.75  ? 37  TYR G CE1 1 
ATOM   7826  C CE2 . TYR G  1 37  ? 4.258   35.211  -11.599 1.00 58.86  ? 37  TYR G CE2 1 
ATOM   7827  C CZ  . TYR G  1 37  ? 4.231   34.038  -12.340 1.00 65.69  ? 37  TYR G CZ  1 
ATOM   7828  O OH  . TYR G  1 37  ? 5.387   33.405  -12.723 1.00 65.79  ? 37  TYR G OH  1 
ATOM   7829  N N   . PRO G  1 38  ? -1.792  33.751  -11.047 1.00 58.53  ? 38  PRO G N   1 
ATOM   7830  C CA  . PRO G  1 38  ? -2.233  32.366  -11.269 1.00 58.38  ? 38  PRO G CA  1 
ATOM   7831  C C   . PRO G  1 38  ? -1.233  31.627  -12.131 1.00 64.56  ? 38  PRO G C   1 
ATOM   7832  O O   . PRO G  1 38  ? -0.684  32.210  -13.065 1.00 66.87  ? 38  PRO G O   1 
ATOM   7833  C CB  . PRO G  1 38  ? -3.584  32.513  -11.982 1.00 63.14  ? 38  PRO G CB  1 
ATOM   7834  C CG  . PRO G  1 38  ? -3.968  33.943  -11.857 1.00 69.33  ? 38  PRO G CG  1 
ATOM   7835  C CD  . PRO G  1 38  ? -2.683  34.708  -11.732 1.00 63.94  ? 38  PRO G CD  1 
ATOM   7836  N N   . THR G  1 39  ? -0.977  30.356  -11.787 1.00 60.53  ? 39  THR G N   1 
ATOM   7837  C CA  . THR G  1 39  ? -0.061  29.454  -12.493 1.00 61.22  ? 39  THR G CA  1 
ATOM   7838  C C   . THR G  1 39  ? -0.528  29.272  -13.937 1.00 68.90  ? 39  THR G C   1 
ATOM   7839  O O   . THR G  1 39  ? -1.653  28.800  -14.147 1.00 70.14  ? 39  THR G O   1 
ATOM   7840  C CB  . THR G  1 39  ? -0.076  28.074  -11.818 1.00 65.31  ? 39  THR G CB  1 
ATOM   7841  O OG1 . THR G  1 39  ? -0.046  28.234  -10.406 1.00 65.37  ? 39  THR G OG1 1 
ATOM   7842  C CG2 . THR G  1 39  ? 1.048   27.181  -12.277 1.00 59.51  ? 39  THR G CG2 1 
ATOM   7843  N N   . PRO G  1 40  ? 0.309   29.609  -14.945 1.00 67.14  ? 40  PRO G N   1 
ATOM   7844  C CA  . PRO G  1 40  ? -0.117  29.382  -16.337 1.00 71.21  ? 40  PRO G CA  1 
ATOM   7845  C C   . PRO G  1 40  ? -0.396  27.903  -16.609 1.00 75.54  ? 40  PRO G C   1 
ATOM   7846  O O   . PRO G  1 40  ? 0.204   27.028  -15.982 1.00 71.90  ? 40  PRO G O   1 
ATOM   7847  C CB  . PRO G  1 40  ? 1.050   29.915  -17.172 1.00 75.40  ? 40  PRO G CB  1 
ATOM   7848  C CG  . PRO G  1 40  ? 2.216   29.963  -16.246 1.00 76.36  ? 40  PRO G CG  1 
ATOM   7849  C CD  . PRO G  1 40  ? 1.665   30.195  -14.875 1.00 67.59  ? 40  PRO G CD  1 
ATOM   7850  N N   . LEU G  1 41  ? -1.336  27.634  -17.524 1.00 77.34  ? 41  LEU G N   1 
ATOM   7851  C CA  . LEU G  1 41  ? -1.738  26.281  -17.909 1.00 80.62  ? 41  LEU G CA  1 
ATOM   7852  C C   . LEU G  1 41  ? -0.583  25.423  -18.455 1.00 86.59  ? 41  LEU G C   1 
ATOM   7853  O O   . LEU G  1 41  ? -0.720  24.201  -18.517 1.00 89.66  ? 41  LEU G O   1 
ATOM   7854  C CB  . LEU G  1 41  ? -2.912  26.316  -18.892 1.00 85.40  ? 41  LEU G CB  1 
ATOM   7855  C CG  . LEU G  1 41  ? -4.255  26.736  -18.298 1.00 89.86  ? 41  LEU G CG  1 
ATOM   7856  C CD1 . LEU G  1 41  ? -5.142  27.376  -19.353 1.00 93.99  ? 41  LEU G CD1 1 
ATOM   7857  C CD2 . LEU G  1 41  ? -4.965  25.554  -17.634 1.00 93.80  ? 41  LEU G CD2 1 
ATOM   7858  N N   . ARG G  1 42  ? 0.547   26.052  -18.819 1.00 80.68  ? 42  ARG G N   1 
ATOM   7859  C CA  . ARG G  1 42  ? 1.718   25.345  -19.301 1.00 82.71  ? 42  ARG G CA  1 
ATOM   7860  C C   . ARG G  1 42  ? 2.449   24.717  -18.118 1.00 82.65  ? 42  ARG G C   1 
ATOM   7861  O O   . ARG G  1 42  ? 2.791   23.535  -18.171 1.00 84.54  ? 42  ARG G O   1 
ATOM   7862  C CB  . ARG G  1 42  ? 2.640   26.295  -20.096 1.00 85.08  ? 42  ARG G CB  1 
ATOM   7863  C CG  . ARG G  1 42  ? 4.013   25.715  -20.476 1.00 94.14  ? 42  ARG G CG  1 
ATOM   7864  C CD  . ARG G  1 42  ? 3.968   24.747  -21.649 1.00 106.54 ? 42  ARG G CD  1 
ATOM   7865  N NE  . ARG G  1 42  ? 5.249   24.067  -21.835 1.00 109.13 ? 42  ARG G NE  1 
ATOM   7866  C CZ  . ARG G  1 42  ? 5.551   22.883  -21.313 1.00 119.64 ? 42  ARG G CZ  1 
ATOM   7867  N NH1 . ARG G  1 42  ? 4.661   22.231  -20.572 1.00 99.64  ? 42  ARG G NH1 1 
ATOM   7868  N NH2 . ARG G  1 42  ? 6.742   22.344  -21.523 1.00 112.77 ? 42  ARG G NH2 1 
ATOM   7869  N N   . SER G  1 43  ? 2.685   25.511  -17.050 1.00 74.13  ? 43  SER G N   1 
ATOM   7870  C CA  . SER G  1 43  ? 3.382   25.093  -15.824 1.00 69.49  ? 43  SER G CA  1 
ATOM   7871  C C   . SER G  1 43  ? 2.663   23.934  -15.187 1.00 70.31  ? 43  SER G C   1 
ATOM   7872  O O   . SER G  1 43  ? 3.300   22.988  -14.740 1.00 69.31  ? 43  SER G O   1 
ATOM   7873  C CB  . SER G  1 43  ? 3.449   26.245  -14.829 1.00 68.72  ? 43  SER G CB  1 
ATOM   7874  O OG  . SER G  1 43  ? 4.123   27.383  -15.344 1.00 81.54  ? 43  SER G OG  1 
ATOM   7875  N N   . LYS G  1 44  ? 1.322   23.986  -15.218 1.00 66.25  ? 44  LYS G N   1 
ATOM   7876  C CA  . LYS G  1 44  ? 0.447   22.980  -14.646 1.00 65.93  ? 44  LYS G CA  1 
ATOM   7877  C C   . LYS G  1 44  ? 0.706   21.595  -15.210 1.00 75.49  ? 44  LYS G C   1 
ATOM   7878  O O   . LYS G  1 44  ? 0.654   20.623  -14.452 1.00 75.54  ? 44  LYS G O   1 
ATOM   7879  C CB  . LYS G  1 44  ? -1.027  23.390  -14.764 1.00 67.46  ? 44  LYS G CB  1 
ATOM   7880  C CG  . LYS G  1 44  ? -1.483  24.359  -13.675 1.00 61.39  ? 44  LYS G CG  1 
ATOM   7881  C CD  . LYS G  1 44  ? -2.960  24.724  -13.817 1.00 69.75  ? 44  LYS G CD  1 
ATOM   7882  C CE  . LYS G  1 44  ? -3.382  25.818  -12.870 1.00 71.95  ? 44  LYS G CE  1 
ATOM   7883  N NZ  . LYS G  1 44  ? -4.842  26.035  -12.919 1.00 85.68  ? 44  LYS G NZ  1 
ATOM   7884  N N   . LYS G  1 45  ? 1.066   21.508  -16.508 1.00 76.56  ? 45  LYS G N   1 
ATOM   7885  C CA  . LYS G  1 45  ? 1.371   20.241  -17.175 1.00 81.90  ? 45  LYS G CA  1 
ATOM   7886  C C   . LYS G  1 45  ? 2.550   19.527  -16.524 1.00 86.88  ? 45  LYS G C   1 
ATOM   7887  O O   . LYS G  1 45  ? 2.600   18.295  -16.555 1.00 90.41  ? 45  LYS G O   1 
ATOM   7888  C CB  . LYS G  1 45  ? 1.619   20.442  -18.684 1.00 89.75  ? 45  LYS G CB  1 
ATOM   7889  C CG  . LYS G  1 45  ? 0.340   20.761  -19.485 1.00 113.31 ? 45  LYS G CG  1 
ATOM   7890  C CD  . LYS G  1 45  ? 0.412   20.393  -20.977 1.00 132.79 ? 45  LYS G CD  1 
ATOM   7891  C CE  . LYS G  1 45  ? 1.173   21.394  -21.820 1.00 149.87 ? 45  LYS G CE  1 
ATOM   7892  N NZ  . LYS G  1 45  ? 2.351   20.775  -22.491 1.00 166.21 ? 45  LYS G NZ  1 
ATOM   7893  N N   . THR G  1 46  ? 3.456   20.303  -15.877 1.00 80.08  ? 46  THR G N   1 
ATOM   7894  C CA  . THR G  1 46  ? 4.689   19.831  -15.224 1.00 79.69  ? 46  THR G CA  1 
ATOM   7895  C C   . THR G  1 46  ? 4.566   19.604  -13.701 1.00 79.06  ? 46  THR G C   1 
ATOM   7896  O O   . THR G  1 46  ? 5.530   19.199  -13.049 1.00 77.37  ? 46  THR G O   1 
ATOM   7897  C CB  . THR G  1 46  ? 5.838   20.795  -15.543 1.00 87.96  ? 46  THR G CB  1 
ATOM   7898  O OG1 . THR G  1 46  ? 5.777   21.908  -14.650 1.00 81.76  ? 46  THR G OG1 1 
ATOM   7899  C CG2 . THR G  1 46  ? 5.832   21.267  -17.002 1.00 91.11  ? 46  THR G CG2 1 
ATOM   7900  N N   . MET G  1 47  ? 3.395   19.869  -13.141 1.00 74.30  ? 47  MET G N   1 
ATOM   7901  C CA  . MET G  1 47  ? 3.185   19.715  -11.705 1.00 71.31  ? 47  MET G CA  1 
ATOM   7902  C C   . MET G  1 47  ? 2.446   18.417  -11.349 1.00 79.08  ? 47  MET G C   1 
ATOM   7903  O O   . MET G  1 47  ? 1.317   18.202  -11.805 1.00 80.72  ? 47  MET G O   1 
ATOM   7904  C CB  . MET G  1 47  ? 2.439   20.934  -11.136 1.00 68.74  ? 47  MET G CB  1 
ATOM   7905  C CG  . MET G  1 47  ? 2.943   22.244  -11.677 1.00 70.11  ? 47  MET G CG  1 
ATOM   7906  S SD  . MET G  1 47  ? 2.426   23.668  -10.723 1.00 69.24  ? 47  MET G SD  1 
ATOM   7907  C CE  . MET G  1 47  ? 0.708   23.527  -10.898 1.00 67.57  ? 47  MET G CE  1 
ATOM   7908  N N   . LEU G  1 48  ? 3.081   17.556  -10.533 1.00 75.44  ? 48  LEU G N   1 
ATOM   7909  C CA  . LEU G  1 48  ? 2.435   16.329  -10.067 1.00 77.19  ? 48  LEU G CA  1 
ATOM   7910  C C   . LEU G  1 48  ? 1.384   16.715  -9.012  1.00 74.97  ? 48  LEU G C   1 
ATOM   7911  O O   . LEU G  1 48  ? 0.269   16.206  -9.039  1.00 76.68  ? 48  LEU G O   1 
ATOM   7912  C CB  . LEU G  1 48  ? 3.474   15.366  -9.480  1.00 79.99  ? 48  LEU G CB  1 
ATOM   7913  C CG  . LEU G  1 48  ? 3.445   13.945  -10.037 1.00 91.35  ? 48  LEU G CG  1 
ATOM   7914  C CD1 . LEU G  1 48  ? 4.630   13.156  -9.549  1.00 93.77  ? 48  LEU G CD1 1 
ATOM   7915  C CD2 . LEU G  1 48  ? 2.149   13.226  -9.679  1.00 95.88  ? 48  LEU G CD2 1 
ATOM   7916  N N   . VAL G  1 49  ? 1.752   17.640  -8.102  1.00 65.22  ? 49  VAL G N   1 
ATOM   7917  C CA  . VAL G  1 49  ? 0.898   18.222  -7.068  1.00 60.80  ? 49  VAL G CA  1 
ATOM   7918  C C   . VAL G  1 49  ? 0.481   19.558  -7.684  1.00 63.59  ? 49  VAL G C   1 
ATOM   7919  O O   . VAL G  1 49  ? 1.329   20.426  -7.937  1.00 60.70  ? 49  VAL G O   1 
ATOM   7920  C CB  . VAL G  1 49  ? 1.591   18.398  -5.678  1.00 60.58  ? 49  VAL G CB  1 
ATOM   7921  C CG1 . VAL G  1 49  ? 0.692   19.141  -4.707  1.00 57.39  ? 49  VAL G CG1 1 
ATOM   7922  C CG2 . VAL G  1 49  ? 2.014   17.066  -5.077  1.00 63.49  ? 49  VAL G CG2 1 
ATOM   7923  N N   . GLN G  1 50  ? -0.819  19.696  -7.988  1.00 61.86  ? 50  GLN G N   1 
ATOM   7924  C CA  . GLN G  1 50  ? -1.313  20.911  -8.617  1.00 60.01  ? 50  GLN G CA  1 
ATOM   7925  C C   . GLN G  1 50  ? -1.322  22.091  -7.655  1.00 59.93  ? 50  GLN G C   1 
ATOM   7926  O O   . GLN G  1 50  ? -1.720  21.937  -6.498  1.00 60.19  ? 50  GLN G O   1 
ATOM   7927  C CB  . GLN G  1 50  ? -2.690  20.682  -9.258  1.00 64.07  ? 50  GLN G CB  1 
ATOM   7928  C CG  . GLN G  1 50  ? -2.707  19.636  -10.380 1.00 86.00  ? 50  GLN G CG  1 
ATOM   7929  C CD  . GLN G  1 50  ? -1.817  19.938  -11.569 1.00 105.46 ? 50  GLN G CD  1 
ATOM   7930  O OE1 . GLN G  1 50  ? -1.568  21.093  -11.942 1.00 96.43  ? 50  GLN G OE1 1 
ATOM   7931  N NE2 . GLN G  1 50  ? -1.351  18.885  -12.217 1.00 104.80 ? 50  GLN G NE2 1 
ATOM   7932  N N   . LYS G  1 51  ? -0.823  23.251  -8.115  1.00 52.70  ? 51  LYS G N   1 
ATOM   7933  C CA  . LYS G  1 51  ? -0.773  24.502  -7.353  1.00 48.86  ? 51  LYS G CA  1 
ATOM   7934  C C   . LYS G  1 51  ? -1.319  25.592  -8.293  1.00 54.78  ? 51  LYS G C   1 
ATOM   7935  O O   . LYS G  1 51  ? -0.641  25.941  -9.259  1.00 53.77  ? 51  LYS G O   1 
ATOM   7936  C CB  . LYS G  1 51  ? 0.665   24.816  -6.883  1.00 48.14  ? 51  LYS G CB  1 
ATOM   7937  C CG  . LYS G  1 51  ? 1.424   23.618  -6.315  1.00 56.40  ? 51  LYS G CG  1 
ATOM   7938  C CD  . LYS G  1 51  ? 1.868   23.822  -4.889  1.00 63.02  ? 51  LYS G CD  1 
ATOM   7939  C CE  . LYS G  1 51  ? 2.363   22.534  -4.283  1.00 75.00  ? 51  LYS G CE  1 
ATOM   7940  N NZ  . LYS G  1 51  ? 1.436   22.034  -3.232  1.00 86.49  ? 51  LYS G NZ  1 
ATOM   7941  N N   . ASN G  1 52  ? -2.579  26.078  -8.057  1.00 53.79  ? 52  ASN G N   1 
ATOM   7942  C CA  . ASN G  1 52  ? -3.248  27.068  -8.927  1.00 54.57  ? 52  ASN G CA  1 
ATOM   7943  C C   . ASN G  1 52  ? -2.682  28.514  -8.884  1.00 58.62  ? 52  ASN G C   1 
ATOM   7944  O O   . ASN G  1 52  ? -2.979  29.302  -9.788  1.00 60.50  ? 52  ASN G O   1 
ATOM   7945  C CB  . ASN G  1 52  ? -4.725  27.079  -8.672  1.00 50.82  ? 52  ASN G CB  1 
ATOM   7946  C CG  . ASN G  1 52  ? -5.427  25.856  -9.199  1.00 74.22  ? 52  ASN G CG  1 
ATOM   7947  O OD1 . ASN G  1 52  ? -4.819  24.999  -9.866  1.00 64.38  ? 52  ASN G OD1 1 
ATOM   7948  N ND2 . ASN G  1 52  ? -6.735  25.757  -8.910  1.00 71.81  ? 52  ASN G ND2 1 
ATOM   7949  N N   . VAL G  1 53  ? -1.839  28.836  -7.882  1.00 52.11  ? 53  VAL G N   1 
ATOM   7950  C CA  . VAL G  1 53  ? -1.201  30.146  -7.709  1.00 50.42  ? 53  VAL G CA  1 
ATOM   7951  C C   . VAL G  1 53  ? 0.317   29.939  -7.778  1.00 53.24  ? 53  VAL G C   1 
ATOM   7952  O O   . VAL G  1 53  ? 0.800   28.876  -7.372  1.00 51.93  ? 53  VAL G O   1 
ATOM   7953  C CB  . VAL G  1 53  ? -1.619  30.827  -6.370  1.00 52.77  ? 53  VAL G CB  1 
ATOM   7954  C CG1 . VAL G  1 53  ? -0.959  32.195  -6.205  1.00 51.99  ? 53  VAL G CG1 1 
ATOM   7955  C CG2 . VAL G  1 53  ? -3.136  30.945  -6.239  1.00 53.98  ? 53  VAL G CG2 1 
ATOM   7956  N N   . THR G  1 54  ? 1.059   30.953  -8.296  1.00 49.37  ? 54  THR G N   1 
ATOM   7957  C CA  . THR G  1 54  ? 2.515   30.939  -8.424  1.00 47.92  ? 54  THR G CA  1 
ATOM   7958  C C   . THR G  1 54  ? 3.108   32.143  -7.712  1.00 52.54  ? 54  THR G C   1 
ATOM   7959  O O   . THR G  1 54  ? 2.722   33.278  -7.999  1.00 53.90  ? 54  THR G O   1 
ATOM   7960  C CB  . THR G  1 54  ? 2.895   30.912  -9.895  1.00 55.26  ? 54  THR G CB  1 
ATOM   7961  O OG1 . THR G  1 54  ? 2.523   29.645  -10.426 1.00 59.06  ? 54  THR G OG1 1 
ATOM   7962  C CG2 . THR G  1 54  ? 4.383   31.156  -10.132 1.00 51.06  ? 54  THR G CG2 1 
ATOM   7963  N N   . SER G  1 55  ? 4.058   31.896  -6.792  1.00 47.49  ? 55  SER G N   1 
ATOM   7964  C CA  . SER G  1 55  ? 4.747   32.945  -6.048  1.00 45.97  ? 55  SER G CA  1 
ATOM   7965  C C   . SER G  1 55  ? 6.194   33.040  -6.478  1.00 51.16  ? 55  SER G C   1 
ATOM   7966  O O   . SER G  1 55  ? 6.958   32.085  -6.277  1.00 51.56  ? 55  SER G O   1 
ATOM   7967  C CB  . SER G  1 55  ? 4.686   32.674  -4.549  1.00 46.60  ? 55  SER G CB  1 
ATOM   7968  O OG  . SER G  1 55  ? 5.547   33.560  -3.850  1.00 58.19  ? 55  SER G OG  1 
ATOM   7969  N N   . GLU G  1 56  ? 6.585   34.200  -7.039  1.00 47.67  ? 56  GLU G N   1 
ATOM   7970  C CA  . GLU G  1 56  ? 7.976   34.471  -7.435  1.00 46.73  ? 56  GLU G CA  1 
ATOM   7971  C C   . GLU G  1 56  ? 8.570   35.364  -6.343  1.00 48.52  ? 56  GLU G C   1 
ATOM   7972  O O   . GLU G  1 56  ? 8.071   36.471  -6.142  1.00 48.34  ? 56  GLU G O   1 
ATOM   7973  C CB  . GLU G  1 56  ? 8.039   35.181  -8.799  1.00 50.72  ? 56  GLU G CB  1 
ATOM   7974  C CG  . GLU G  1 56  ? 7.694   34.324  -10.007 1.00 57.41  ? 56  GLU G CG  1 
ATOM   7975  C CD  . GLU G  1 56  ? 7.767   35.043  -11.344 1.00 82.61  ? 56  GLU G CD  1 
ATOM   7976  O OE1 . GLU G  1 56  ? 7.754   36.295  -11.366 1.00 61.19  ? 56  GLU G OE1 1 
ATOM   7977  O OE2 . GLU G  1 56  ? 7.840   34.350  -12.382 1.00 88.36  ? 56  GLU G OE2 1 
ATOM   7978  N N   . SER G  1 57  ? 9.581   34.878  -5.597  1.00 44.82  ? 57  SER G N   1 
ATOM   7979  C CA  . SER G  1 57  ? 10.176  35.679  -4.512  1.00 44.57  ? 57  SER G CA  1 
ATOM   7980  C C   . SER G  1 57  ? 11.728  35.691  -4.413  1.00 51.17  ? 57  SER G C   1 
ATOM   7981  O O   . SER G  1 57  ? 12.454  34.727  -4.739  1.00 49.04  ? 57  SER G O   1 
ATOM   7982  C CB  . SER G  1 57  ? 9.598   35.298  -3.153  1.00 44.39  ? 57  SER G CB  1 
ATOM   7983  O OG  . SER G  1 57  ? 9.621   33.895  -2.945  1.00 52.32  ? 57  SER G OG  1 
ATOM   7984  N N   . THR G  1 58  ? 12.194  36.842  -3.894  1.00 49.90  ? 58  THR G N   1 
ATOM   7985  C CA  . THR G  1 58  ? 13.568  37.175  -3.594  1.00 49.69  ? 58  THR G CA  1 
ATOM   7986  C C   . THR G  1 58  ? 13.654  37.726  -2.155  1.00 53.48  ? 58  THR G C   1 
ATOM   7987  O O   . THR G  1 58  ? 12.729  38.390  -1.691  1.00 53.93  ? 58  THR G O   1 
ATOM   7988  C CB  . THR G  1 58  ? 14.151  38.038  -4.691  1.00 57.09  ? 58  THR G CB  1 
ATOM   7989  O OG1 . THR G  1 58  ? 15.553  37.954  -4.594  1.00 64.39  ? 58  THR G OG1 1 
ATOM   7990  C CG2 . THR G  1 58  ? 13.734  39.463  -4.614  1.00 52.90  ? 58  THR G CG2 1 
ATOM   7991  N N   . CYS G  1 59  ? 14.697  37.327  -1.418  1.00 50.82  ? 59  CYS G N   1 
ATOM   7992  C CA  . CYS G  1 59  ? 14.932  37.707  -0.024  1.00 51.35  ? 59  CYS G CA  1 
ATOM   7993  C C   . CYS G  1 59  ? 16.305  38.352  0.175   1.00 55.88  ? 59  CYS G C   1 
ATOM   7994  O O   . CYS G  1 59  ? 17.267  38.006  -0.516  1.00 55.33  ? 59  CYS G O   1 
ATOM   7995  C CB  . CYS G  1 59  ? 14.742  36.509  0.900   1.00 51.14  ? 59  CYS G CB  1 
ATOM   7996  S SG  . CYS G  1 59  ? 13.041  35.867  0.969   1.00 54.85  ? 59  CYS G SG  1 
ATOM   7997  N N   . CYS G  1 60  ? 16.392  39.276  1.145   1.00 53.60  ? 60  CYS G N   1 
ATOM   7998  C CA  . CYS G  1 60  ? 17.621  39.994  1.470   1.00 54.67  ? 60  CYS G CA  1 
ATOM   7999  C C   . CYS G  1 60  ? 18.631  39.136  2.221   1.00 57.27  ? 60  CYS G C   1 
ATOM   8000  O O   . CYS G  1 60  ? 18.481  38.882  3.420   1.00 55.07  ? 60  CYS G O   1 
ATOM   8001  C CB  . CYS G  1 60  ? 17.319  41.282  2.215   1.00 57.02  ? 60  CYS G CB  1 
ATOM   8002  S SG  . CYS G  1 60  ? 18.792  42.257  2.543   1.00 63.84  ? 60  CYS G SG  1 
ATOM   8003  N N   . VAL G  1 61  ? 19.666  38.676  1.496   1.00 55.27  ? 61  VAL G N   1 
ATOM   8004  C CA  . VAL G  1 61  ? 20.699  37.758  2.013   1.00 53.90  ? 61  VAL G CA  1 
ATOM   8005  C C   . VAL G  1 61  ? 22.140  38.276  1.810   1.00 58.28  ? 61  VAL G C   1 
ATOM   8006  O O   . VAL G  1 61  ? 22.395  39.063  0.899   1.00 59.41  ? 61  VAL G O   1 
ATOM   8007  C CB  . VAL G  1 61  ? 20.522  36.331  1.426   1.00 55.84  ? 61  VAL G CB  1 
ATOM   8008  C CG1 . VAL G  1 61  ? 19.068  35.878  1.475   1.00 53.38  ? 61  VAL G CG1 1 
ATOM   8009  C CG2 . VAL G  1 61  ? 21.040  36.256  -0.002  1.00 57.28  ? 61  VAL G CG2 1 
ATOM   8010  N N   . ALA G  1 62  ? 23.075  37.801  2.643   1.00 54.49  ? 62  ALA G N   1 
ATOM   8011  C CA  . ALA G  1 62  ? 24.483  38.161  2.515   1.00 56.72  ? 62  ALA G CA  1 
ATOM   8012  C C   . ALA G  1 62  ? 25.103  37.448  1.312   1.00 62.77  ? 62  ALA G C   1 
ATOM   8013  O O   . ALA G  1 62  ? 25.022  36.222  1.215   1.00 61.64  ? 62  ALA G O   1 
ATOM   8014  C CB  . ALA G  1 62  ? 25.253  37.837  3.794   1.00 57.51  ? 62  ALA G CB  1 
ATOM   8015  N N   . LYS G  1 63  ? 25.679  38.226  0.372   1.00 62.25  ? 63  LYS G N   1 
ATOM   8016  C CA  . LYS G  1 63  ? 26.349  37.691  -0.817  1.00 63.80  ? 63  LYS G CA  1 
ATOM   8017  C C   . LYS G  1 63  ? 27.655  37.065  -0.371  1.00 68.44  ? 63  LYS G C   1 
ATOM   8018  O O   . LYS G  1 63  ? 28.084  36.074  -0.952  1.00 69.63  ? 63  LYS G O   1 
ATOM   8019  C CB  . LYS G  1 63  ? 26.615  38.794  -1.859  1.00 68.67  ? 63  LYS G CB  1 
ATOM   8020  C CG  . LYS G  1 63  ? 26.961  38.252  -3.243  1.00 83.54  ? 63  LYS G CG  1 
ATOM   8021  C CD  . LYS G  1 63  ? 27.309  39.366  -4.233  1.00 96.93  ? 63  LYS G CD  1 
ATOM   8022  C CE  . LYS G  1 63  ? 27.530  38.844  -5.638  1.00 109.16 ? 63  LYS G CE  1 
ATOM   8023  N NZ  . LYS G  1 63  ? 26.266  38.377  -6.284  1.00 112.91 ? 63  LYS G NZ  1 
ATOM   8024  N N   . SER G  1 64  ? 28.267  37.643  0.680   1.00 64.70  ? 64  SER G N   1 
ATOM   8025  C CA  . SER G  1 64  ? 29.541  37.228  1.263   1.00 66.21  ? 64  SER G CA  1 
ATOM   8026  C C   . SER G  1 64  ? 29.615  37.690  2.698   1.00 71.29  ? 64  SER G C   1 
ATOM   8027  O O   . SER G  1 64  ? 29.064  38.737  3.038   1.00 71.29  ? 64  SER G O   1 
ATOM   8028  C CB  . SER G  1 64  ? 30.700  37.838  0.483   1.00 71.01  ? 64  SER G CB  1 
ATOM   8029  O OG  . SER G  1 64  ? 30.564  39.245  0.362   1.00 72.86  ? 64  SER G OG  1 
ATOM   8030  N N   . TYR G  1 65  ? 30.311  36.931  3.537   1.00 69.06  ? 65  TYR G N   1 
ATOM   8031  C CA  . TYR G  1 65  ? 30.480  37.282  4.942   1.00 69.64  ? 65  TYR G CA  1 
ATOM   8032  C C   . TYR G  1 65  ? 31.826  36.778  5.474   1.00 78.28  ? 65  TYR G C   1 
ATOM   8033  O O   . TYR G  1 65  ? 32.465  35.940  4.835   1.00 80.60  ? 65  TYR G O   1 
ATOM   8034  C CB  . TYR G  1 65  ? 29.322  36.700  5.783   1.00 68.30  ? 65  TYR G CB  1 
ATOM   8035  C CG  . TYR G  1 65  ? 29.258  35.185  5.789   1.00 70.32  ? 65  TYR G CG  1 
ATOM   8036  C CD1 . TYR G  1 65  ? 30.018  34.437  6.686   1.00 74.24  ? 65  TYR G CD1 1 
ATOM   8037  C CD2 . TYR G  1 65  ? 28.424  34.499  4.911   1.00 69.55  ? 65  TYR G CD2 1 
ATOM   8038  C CE1 . TYR G  1 65  ? 29.984  33.045  6.675   1.00 77.42  ? 65  TYR G CE1 1 
ATOM   8039  C CE2 . TYR G  1 65  ? 28.365  33.106  4.904   1.00 70.98  ? 65  TYR G CE2 1 
ATOM   8040  C CZ  . TYR G  1 65  ? 29.137  32.381  5.798   1.00 84.40  ? 65  TYR G CZ  1 
ATOM   8041  O OH  . TYR G  1 65  ? 29.081  31.001  5.800   1.00 87.53  ? 65  TYR G OH  1 
ATOM   8042  N N   . ASN G  1 66  ? 32.225  37.242  6.665   1.00 75.55  ? 66  ASN G N   1 
ATOM   8043  C CA  . ASN G  1 66  ? 33.417  36.759  7.349   1.00 78.46  ? 66  ASN G CA  1 
ATOM   8044  C C   . ASN G  1 66  ? 33.009  36.369  8.768   1.00 83.29  ? 66  ASN G C   1 
ATOM   8045  O O   . ASN G  1 66  ? 32.396  37.181  9.464   1.00 81.44  ? 66  ASN G O   1 
ATOM   8046  C CB  . ASN G  1 66  ? 34.529  37.814  7.352   1.00 83.32  ? 66  ASN G CB  1 
ATOM   8047  C CG  . ASN G  1 66  ? 35.107  38.192  5.999   1.00 99.91  ? 66  ASN G CG  1 
ATOM   8048  O OD1 . ASN G  1 66  ? 35.687  39.266  5.855   1.00 90.50  ? 66  ASN G OD1 1 
ATOM   8049  N ND2 . ASN G  1 66  ? 35.016  37.320  4.991   1.00 91.72  ? 66  ASN G ND2 1 
ATOM   8050  N N   . ARG G  1 67  ? 33.291  35.113  9.179   1.00 83.02  ? 67  ARG G N   1 
ATOM   8051  C CA  . ARG G  1 67  ? 32.935  34.620  10.513  1.00 84.17  ? 67  ARG G CA  1 
ATOM   8052  C C   . ARG G  1 67  ? 33.836  35.219  11.593  1.00 94.90  ? 67  ARG G C   1 
ATOM   8053  O O   . ARG G  1 67  ? 35.062  35.268  11.422  1.00 97.44  ? 67  ARG G O   1 
ATOM   8054  C CB  . ARG G  1 67  ? 32.942  33.090  10.563  1.00 84.84  ? 67  ARG G CB  1 
ATOM   8055  C CG  . ARG G  1 67  ? 31.611  32.530  11.041  1.00 98.24  ? 67  ARG G CG  1 
ATOM   8056  C CD  . ARG G  1 67  ? 31.482  31.031  10.818  1.00 114.81 ? 67  ARG G CD  1 
ATOM   8057  N NE  . ARG G  1 67  ? 30.981  30.683  9.482   1.00 119.74 ? 67  ARG G NE  1 
ATOM   8058  C CZ  . ARG G  1 67  ? 31.748  30.298  8.464   1.00 128.46 ? 67  ARG G CZ  1 
ATOM   8059  N NH1 . ARG G  1 67  ? 33.069  30.227  8.607   1.00 119.05 ? 67  ARG G NH1 1 
ATOM   8060  N NH2 . ARG G  1 67  ? 31.203  29.985  7.295   1.00 102.73 ? 67  ARG G NH2 1 
ATOM   8061  N N   . VAL G  1 68  ? 33.214  35.721  12.687  1.00 93.24  ? 68  VAL G N   1 
ATOM   8062  C CA  . VAL G  1 68  ? 33.892  36.365  13.834  1.00 96.55  ? 68  VAL G CA  1 
ATOM   8063  C C   . VAL G  1 68  ? 33.351  35.834  15.180  1.00 103.31 ? 68  VAL G C   1 
ATOM   8064  O O   . VAL G  1 68  ? 32.328  35.137  15.185  1.00 101.40 ? 68  VAL G O   1 
ATOM   8065  C CB  . VAL G  1 68  ? 33.834  37.915  13.764  1.00 100.24 ? 68  VAL G CB  1 
ATOM   8066  C CG1 . VAL G  1 68  ? 34.674  38.448  12.614  1.00 100.31 ? 68  VAL G CG1 1 
ATOM   8067  C CG2 . VAL G  1 68  ? 32.396  38.427  13.670  1.00 97.49  ? 68  VAL G CG2 1 
ATOM   8068  N N   . THR G  1 69  ? 34.038  36.149  16.313  1.00 104.11 ? 69  THR G N   1 
ATOM   8069  C CA  . THR G  1 69  ? 33.597  35.716  17.649  1.00 106.43 ? 69  THR G CA  1 
ATOM   8070  C C   . THR G  1 69  ? 33.557  36.913  18.620  1.00 111.93 ? 69  THR G C   1 
ATOM   8071  O O   . THR G  1 69  ? 34.561  37.270  19.239  1.00 114.65 ? 69  THR G O   1 
ATOM   8072  C CB  . THR G  1 69  ? 34.382  34.495  18.163  1.00 119.57 ? 69  THR G CB  1 
ATOM   8073  O OG1 . THR G  1 69  ? 34.355  33.479  17.158  1.00 120.77 ? 69  THR G OG1 1 
ATOM   8074  C CG2 . THR G  1 69  ? 33.787  33.918  19.445  1.00 119.65 ? 69  THR G CG2 1 
ATOM   8075  N N   . VAL G  1 70  ? 32.356  37.500  18.748  1.00 106.70 ? 70  VAL G N   1 
ATOM   8076  C CA  . VAL G  1 70  ? 32.023  38.671  19.568  1.00 108.75 ? 70  VAL G CA  1 
ATOM   8077  C C   . VAL G  1 70  ? 31.532  38.264  20.970  1.00 118.12 ? 70  VAL G C   1 
ATOM   8078  O O   . VAL G  1 70  ? 31.293  37.074  21.203  1.00 118.49 ? 70  VAL G O   1 
ATOM   8079  C CB  . VAL G  1 70  ? 30.954  39.543  18.845  1.00 108.78 ? 70  VAL G CB  1 
ATOM   8080  C CG1 . VAL G  1 70  ? 31.379  39.896  17.422  1.00 105.48 ? 70  VAL G CG1 1 
ATOM   8081  C CG2 . VAL G  1 70  ? 29.587  38.869  18.852  1.00 105.97 ? 70  VAL G CG2 1 
ATOM   8082  N N   . MET G  1 71  ? 31.321  39.267  21.873  1.00 118.63 ? 71  MET G N   1 
ATOM   8083  C CA  . MET G  1 71  ? 30.785  39.119  23.236  1.00 123.16 ? 71  MET G CA  1 
ATOM   8084  C C   . MET G  1 71  ? 31.277  37.833  23.892  1.00 128.66 ? 71  MET G C   1 
ATOM   8085  O O   . MET G  1 71  ? 30.499  36.899  24.137  1.00 127.29 ? 71  MET G O   1 
ATOM   8086  C CB  . MET G  1 71  ? 29.246  39.178  23.222  1.00 124.40 ? 71  MET G CB  1 
ATOM   8087  C CG  . MET G  1 71  ? 28.684  40.570  23.011  1.00 129.01 ? 71  MET G CG  1 
ATOM   8088  S SD  . MET G  1 71  ? 26.962  40.554  22.422  1.00 130.97 ? 71  MET G SD  1 
ATOM   8089  C CE  . MET G  1 71  ? 26.075  40.167  23.949  1.00 133.25 ? 71  MET G CE  1 
ATOM   8090  N N   . GLY G  1 72  ? 32.589  37.777  24.085  1.00 127.93 ? 72  GLY G N   1 
ATOM   8091  C CA  . GLY G  1 72  ? 33.264  36.617  24.644  1.00 130.73 ? 72  GLY G CA  1 
ATOM   8092  C C   . GLY G  1 72  ? 33.290  35.467  23.658  1.00 129.51 ? 72  GLY G C   1 
ATOM   8093  O O   . GLY G  1 72  ? 34.254  35.335  22.892  1.00 128.45 ? 72  GLY G O   1 
ATOM   8094  N N   . GLY G  1 73  ? 32.214  34.672  23.657  1.00 122.21 ? 73  GLY G N   1 
ATOM   8095  C CA  . GLY G  1 73  ? 32.091  33.511  22.786  1.00 118.25 ? 73  GLY G CA  1 
ATOM   8096  C C   . GLY G  1 73  ? 30.783  33.375  22.040  1.00 116.15 ? 73  GLY G C   1 
ATOM   8097  O O   . GLY G  1 73  ? 29.921  32.592  22.445  1.00 117.20 ? 73  GLY G O   1 
ATOM   8098  N N   . PHE G  1 74  ? 30.638  34.107  20.927  1.00 106.90 ? 74  PHE G N   1 
ATOM   8099  C CA  . PHE G  1 74  ? 29.457  34.057  20.059  1.00 101.60 ? 74  PHE G CA  1 
ATOM   8100  C C   . PHE G  1 74  ? 29.902  34.012  18.596  1.00 101.65 ? 74  PHE G C   1 
ATOM   8101  O O   . PHE G  1 74  ? 30.377  35.021  18.070  1.00 100.26 ? 74  PHE G O   1 
ATOM   8102  C CB  . PHE G  1 74  ? 28.535  35.260  20.305  1.00 102.53 ? 74  PHE G CB  1 
ATOM   8103  C CG  . PHE G  1 74  ? 27.417  35.027  21.288  1.00 106.34 ? 74  PHE G CG  1 
ATOM   8104  C CD1 . PHE G  1 74  ? 26.235  34.416  20.888  1.00 107.13 ? 74  PHE G CD1 1 
ATOM   8105  C CD2 . PHE G  1 74  ? 27.523  35.465  22.601  1.00 113.54 ? 74  PHE G CD2 1 
ATOM   8106  C CE1 . PHE G  1 74  ? 25.189  34.215  21.795  1.00 110.75 ? 74  PHE G CE1 1 
ATOM   8107  C CE2 . PHE G  1 74  ? 26.477  35.268  23.507  1.00 119.28 ? 74  PHE G CE2 1 
ATOM   8108  C CZ  . PHE G  1 74  ? 25.316  34.647  23.097  1.00 115.09 ? 74  PHE G CZ  1 
ATOM   8109  N N   . LYS G  1 75  ? 29.792  32.836  17.952  1.00 96.33  ? 75  LYS G N   1 
ATOM   8110  C CA  . LYS G  1 75  ? 30.190  32.664  16.551  1.00 92.79  ? 75  LYS G CA  1 
ATOM   8111  C C   . LYS G  1 75  ? 29.125  33.327  15.673  1.00 90.62  ? 75  LYS G C   1 
ATOM   8112  O O   . LYS G  1 75  ? 28.060  32.732  15.429  1.00 89.76  ? 75  LYS G O   1 
ATOM   8113  C CB  . LYS G  1 75  ? 30.339  31.168  16.191  1.00 96.66  ? 75  LYS G CB  1 
ATOM   8114  C CG  . LYS G  1 75  ? 31.523  30.440  16.828  1.00 119.12 ? 75  LYS G CG  1 
ATOM   8115  C CD  . LYS G  1 75  ? 31.460  28.931  16.519  1.00 129.88 ? 75  LYS G CD  1 
ATOM   8116  C CE  . LYS G  1 75  ? 32.646  28.151  17.043  1.00 140.45 ? 75  LYS G CE  1 
ATOM   8117  N NZ  . LYS G  1 75  ? 32.674  26.763  16.508  1.00 146.47 ? 75  LYS G NZ  1 
ATOM   8118  N N   . VAL G  1 76  ? 29.394  34.577  15.247  1.00 82.74  ? 76  VAL G N   1 
ATOM   8119  C CA  . VAL G  1 76  ? 28.483  35.388  14.421  1.00 78.33  ? 76  VAL G CA  1 
ATOM   8120  C C   . VAL G  1 76  ? 29.069  35.679  13.033  1.00 80.32  ? 76  VAL G C   1 
ATOM   8121  O O   . VAL G  1 76  ? 30.297  35.728  12.884  1.00 82.82  ? 76  VAL G O   1 
ATOM   8122  C CB  . VAL G  1 76  ? 28.028  36.702  15.123  1.00 82.64  ? 76  VAL G CB  1 
ATOM   8123  C CG1 . VAL G  1 76  ? 27.207  36.435  16.372  1.00 84.27  ? 76  VAL G CG1 1 
ATOM   8124  C CG2 . VAL G  1 76  ? 29.196  37.616  15.433  1.00 85.16  ? 76  VAL G CG2 1 
ATOM   8125  N N   . GLU G  1 77  ? 28.197  35.923  12.031  1.00 72.31  ? 77  GLU G N   1 
ATOM   8126  C CA  . GLU G  1 77  ? 28.643  36.268  10.674  1.00 70.45  ? 77  GLU G CA  1 
ATOM   8127  C C   . GLU G  1 77  ? 28.729  37.788  10.522  1.00 72.65  ? 77  GLU G C   1 
ATOM   8128  O O   . GLU G  1 77  ? 27.749  38.472  10.811  1.00 72.22  ? 77  GLU G O   1 
ATOM   8129  C CB  . GLU G  1 77  ? 27.662  35.747  9.613   1.00 69.20  ? 77  GLU G CB  1 
ATOM   8130  C CG  . GLU G  1 77  ? 27.447  34.246  9.567   1.00 81.49  ? 77  GLU G CG  1 
ATOM   8131  C CD  . GLU G  1 77  ? 26.580  33.767  8.414   1.00 100.39 ? 77  GLU G CD  1 
ATOM   8132  O OE1 . GLU G  1 77  ? 25.780  34.573  7.877   1.00 64.26  ? 77  GLU G OE1 1 
ATOM   8133  O OE2 . GLU G  1 77  ? 26.695  32.572  8.056   1.00 105.20 ? 77  GLU G OE2 1 
ATOM   8134  N N   . ASN G  1 78  ? 29.877  38.323  10.060  1.00 68.16  ? 78  ASN G N   1 
ATOM   8135  C CA  . ASN G  1 78  ? 30.025  39.755  9.776   1.00 67.07  ? 78  ASN G CA  1 
ATOM   8136  C C   . ASN G  1 78  ? 29.855  39.869  8.262   1.00 65.92  ? 78  ASN G C   1 
ATOM   8137  O O   . ASN G  1 78  ? 30.723  39.418  7.515   1.00 65.45  ? 78  ASN G O   1 
ATOM   8138  C CB  . ASN G  1 78  ? 31.383  40.277  10.231  1.00 70.00  ? 78  ASN G CB  1 
ATOM   8139  C CG  . ASN G  1 78  ? 31.520  41.787  10.273  1.00 96.11  ? 78  ASN G CG  1 
ATOM   8140  O OD1 . ASN G  1 78  ? 30.595  42.544  9.926   1.00 95.74  ? 78  ASN G OD1 1 
ATOM   8141  N ND2 . ASN G  1 78  ? 32.700  42.234  10.716  1.00 84.31  ? 78  ASN G ND2 1 
ATOM   8142  N N   . HIS G  1 79  ? 28.687  40.359  7.813   1.00 59.33  ? 79  HIS G N   1 
ATOM   8143  C CA  . HIS G  1 79  ? 28.329  40.446  6.399   1.00 58.11  ? 79  HIS G CA  1 
ATOM   8144  C C   . HIS G  1 79  ? 29.128  41.494  5.666   1.00 67.06  ? 79  HIS G C   1 
ATOM   8145  O O   . HIS G  1 79  ? 29.393  42.568  6.224   1.00 70.83  ? 79  HIS G O   1 
ATOM   8146  C CB  . HIS G  1 79  ? 26.818  40.653  6.230   1.00 57.01  ? 79  HIS G CB  1 
ATOM   8147  C CG  . HIS G  1 79  ? 25.972  39.543  6.783   1.00 58.30  ? 79  HIS G CG  1 
ATOM   8148  N ND1 . HIS G  1 79  ? 24.632  39.726  7.031   1.00 58.99  ? 79  HIS G ND1 1 
ATOM   8149  C CD2 . HIS G  1 79  ? 26.304  38.266  7.103   1.00 59.41  ? 79  HIS G CD2 1 
ATOM   8150  C CE1 . HIS G  1 79  ? 24.196  38.575  7.516   1.00 57.04  ? 79  HIS G CE1 1 
ATOM   8151  N NE2 . HIS G  1 79  ? 25.171  37.667  7.574   1.00 57.63  ? 79  HIS G NE2 1 
ATOM   8152  N N   . THR G  1 80  ? 29.555  41.182  4.424   1.00 63.07  ? 80  THR G N   1 
ATOM   8153  C CA  . THR G  1 80  ? 30.411  42.099  3.641   1.00 64.97  ? 80  THR G CA  1 
ATOM   8154  C C   . THR G  1 80  ? 29.719  42.642  2.371   1.00 68.15  ? 80  THR G C   1 
ATOM   8155  O O   . THR G  1 80  ? 30.102  43.709  1.872   1.00 71.97  ? 80  THR G O   1 
ATOM   8156  C CB  . THR G  1 80  ? 31.764  41.446  3.345   1.00 66.01  ? 80  THR G CB  1 
ATOM   8157  O OG1 . THR G  1 80  ? 31.541  40.224  2.648   1.00 62.92  ? 80  THR G OG1 1 
ATOM   8158  C CG2 . THR G  1 80  ? 32.571  41.172  4.619   1.00 61.92  ? 80  THR G CG2 1 
ATOM   8159  N N   . ALA G  1 81  ? 28.688  41.933  1.879   1.00 59.72  ? 81  ALA G N   1 
ATOM   8160  C CA  . ALA G  1 81  ? 27.890  42.303  0.711   1.00 59.35  ? 81  ALA G CA  1 
ATOM   8161  C C   . ALA G  1 81  ? 26.473  41.724  0.836   1.00 62.20  ? 81  ALA G C   1 
ATOM   8162  O O   . ALA G  1 81  ? 26.290  40.699  1.494   1.00 59.12  ? 81  ALA G O   1 
ATOM   8163  C CB  . ALA G  1 81  ? 28.554  41.801  -0.557  1.00 61.67  ? 81  ALA G CB  1 
ATOM   8164  N N   . CYS G  1 82  ? 25.475  42.397  0.216   1.00 60.46  ? 82  CYS G N   1 
ATOM   8165  C CA  . CYS G  1 82  ? 24.053  42.022  0.227   1.00 57.41  ? 82  CYS G CA  1 
ATOM   8166  C C   . CYS G  1 82  ? 23.463  42.007  -1.171  1.00 65.42  ? 82  CYS G C   1 
ATOM   8167  O O   . CYS G  1 82  ? 23.782  42.871  -2.000  1.00 69.47  ? 82  CYS G O   1 
ATOM   8168  C CB  . CYS G  1 82  ? 23.254  42.965  1.123   1.00 57.20  ? 82  CYS G CB  1 
ATOM   8169  S SG  . CYS G  1 82  ? 23.988  43.249  2.746   1.00 61.36  ? 82  CYS G SG  1 
ATOM   8170  N N   . HIS G  1 83  ? 22.532  41.074  -1.401  1.00 60.51  ? 83  HIS G N   1 
ATOM   8171  C CA  . HIS G  1 83  ? 21.773  40.963  -2.644  1.00 61.28  ? 83  HIS G CA  1 
ATOM   8172  C C   . HIS G  1 83  ? 20.442  40.326  -2.400  1.00 61.65  ? 83  HIS G C   1 
ATOM   8173  O O   . HIS G  1 83  ? 20.278  39.637  -1.391  1.00 59.63  ? 83  HIS G O   1 
ATOM   8174  C CB  . HIS G  1 83  ? 22.554  40.282  -3.800  1.00 64.34  ? 83  HIS G CB  1 
ATOM   8175  C CG  . HIS G  1 83  ? 22.944  38.840  -3.637  1.00 66.22  ? 83  HIS G CG  1 
ATOM   8176  N ND1 . HIS G  1 83  ? 22.728  38.140  -2.462  1.00 65.58  ? 83  HIS G ND1 1 
ATOM   8177  C CD2 . HIS G  1 83  ? 23.562  38.023  -4.521  1.00 69.84  ? 83  HIS G CD2 1 
ATOM   8178  C CE1 . HIS G  1 83  ? 23.208  36.923  -2.676  1.00 65.09  ? 83  HIS G CE1 1 
ATOM   8179  N NE2 . HIS G  1 83  ? 23.718  36.808  -3.901  1.00 68.03  ? 83  HIS G NE2 1 
ATOM   8180  N N   . CYS G  1 84  ? 19.470  40.598  -3.282  1.00 57.89  ? 84  CYS G N   1 
ATOM   8181  C CA  . CYS G  1 84  ? 18.151  39.986  -3.194  1.00 54.67  ? 84  CYS G CA  1 
ATOM   8182  C C   . CYS G  1 84  ? 18.309  38.684  -3.942  1.00 54.92  ? 84  CYS G C   1 
ATOM   8183  O O   . CYS G  1 84  ? 18.621  38.700  -5.138  1.00 56.79  ? 84  CYS G O   1 
ATOM   8184  C CB  . CYS G  1 84  ? 17.087  40.877  -3.824  1.00 57.44  ? 84  CYS G CB  1 
ATOM   8185  S SG  . CYS G  1 84  ? 16.691  42.354  -2.854  1.00 63.52  ? 84  CYS G SG  1 
ATOM   8186  N N   . SER G  1 85  ? 18.190  37.556  -3.220  1.00 47.22  ? 85  SER G N   1 
ATOM   8187  C CA  . SER G  1 85  ? 18.370  36.222  -3.781  1.00 46.60  ? 85  SER G CA  1 
ATOM   8188  C C   . SER G  1 85  ? 17.288  35.224  -3.324  1.00 49.61  ? 85  SER G C   1 
ATOM   8189  O O   . SER G  1 85  ? 16.208  35.634  -2.915  1.00 47.59  ? 85  SER G O   1 
ATOM   8190  C CB  . SER G  1 85  ? 19.783  35.712  -3.503  1.00 49.59  ? 85  SER G CB  1 
ATOM   8191  O OG  . SER G  1 85  ? 20.105  34.553  -4.255  1.00 56.79  ? 85  SER G OG  1 
ATOM   8192  N N   . THR G  1 86  ? 17.567  33.918  -3.447  1.00 47.11  ? 86  THR G N   1 
ATOM   8193  C CA  . THR G  1 86  ? 16.669  32.815  -3.143  1.00 45.83  ? 86  THR G CA  1 
ATOM   8194  C C   . THR G  1 86  ? 16.253  32.822  -1.683  1.00 50.97  ? 86  THR G C   1 
ATOM   8195  O O   . THR G  1 86  ? 17.089  32.960  -0.790  1.00 50.52  ? 86  THR G O   1 
ATOM   8196  C CB  . THR G  1 86  ? 17.348  31.514  -3.577  1.00 52.90  ? 86  THR G CB  1 
ATOM   8197  O OG1 . THR G  1 86  ? 17.847  31.664  -4.911  1.00 58.03  ? 86  THR G OG1 1 
ATOM   8198  C CG2 . THR G  1 86  ? 16.450  30.314  -3.493  1.00 49.02  ? 86  THR G CG2 1 
ATOM   8199  N N   . CYS G  1 87  ? 14.949  32.700  -1.456  1.00 49.09  ? 87  CYS G N   1 
ATOM   8200  C CA  . CYS G  1 87  ? 14.352  32.608  -0.131  1.00 48.81  ? 87  CYS G CA  1 
ATOM   8201  C C   . CYS G  1 87  ? 14.336  31.170  0.255   1.00 51.44  ? 87  CYS G C   1 
ATOM   8202  O O   . CYS G  1 87  ? 13.922  30.327  -0.533  1.00 51.66  ? 87  CYS G O   1 
ATOM   8203  C CB  . CYS G  1 87  ? 12.938  33.161  -0.145  1.00 49.73  ? 87  CYS G CB  1 
ATOM   8204  S SG  . CYS G  1 87  ? 12.824  34.842  -0.762  1.00 54.84  ? 87  CYS G SG  1 
ATOM   8205  N N   . TYR G  1 88  ? 14.753  30.881  1.463   1.00 47.82  ? 88  TYR G N   1 
ATOM   8206  C CA  . TYR G  1 88  ? 14.766  29.515  1.931   1.00 48.59  ? 88  TYR G CA  1 
ATOM   8207  C C   . TYR G  1 88  ? 13.646  29.304  2.985   1.00 53.04  ? 88  TYR G C   1 
ATOM   8208  O O   . TYR G  1 88  ? 13.046  28.230  3.038   1.00 53.60  ? 88  TYR G O   1 
ATOM   8209  C CB  . TYR G  1 88  ? 16.154  29.164  2.517   1.00 50.86  ? 88  TYR G CB  1 
ATOM   8210  C CG  . TYR G  1 88  ? 17.376  29.203  1.608   1.00 54.73  ? 88  TYR G CG  1 
ATOM   8211  C CD1 . TYR G  1 88  ? 17.248  29.355  0.227   1.00 57.01  ? 88  TYR G CD1 1 
ATOM   8212  C CD2 . TYR G  1 88  ? 18.659  29.021  2.123   1.00 57.75  ? 88  TYR G CD2 1 
ATOM   8213  C CE1 . TYR G  1 88  ? 18.373  29.404  -0.606  1.00 60.09  ? 88  TYR G CE1 1 
ATOM   8214  C CE2 . TYR G  1 88  ? 19.791  29.063  1.301   1.00 60.34  ? 88  TYR G CE2 1 
ATOM   8215  C CZ  . TYR G  1 88  ? 19.644  29.250  -0.065  1.00 67.44  ? 88  TYR G CZ  1 
ATOM   8216  O OH  . TYR G  1 88  ? 20.765  29.276  -0.871  1.00 66.31  ? 88  TYR G OH  1 
ATOM   8217  N N   . TYR G  1 89  ? 13.340  30.350  3.777   1.00 49.03  ? 89  TYR G N   1 
ATOM   8218  C CA  . TYR G  1 89  ? 12.424  30.312  4.918   1.00 49.53  ? 89  TYR G CA  1 
ATOM   8219  C C   . TYR G  1 89  ? 11.119  31.093  4.737   1.00 53.72  ? 89  TYR G C   1 
ATOM   8220  O O   . TYR G  1 89  ? 10.494  31.490  5.733   1.00 53.80  ? 89  TYR G O   1 
ATOM   8221  C CB  . TYR G  1 89  ? 13.178  30.796  6.175   1.00 51.30  ? 89  TYR G CB  1 
ATOM   8222  C CG  . TYR G  1 89  ? 14.586  30.250  6.256   1.00 53.61  ? 89  TYR G CG  1 
ATOM   8223  C CD1 . TYR G  1 89  ? 14.825  28.949  6.683   1.00 57.06  ? 89  TYR G CD1 1 
ATOM   8224  C CD2 . TYR G  1 89  ? 15.675  31.010  5.837   1.00 53.79  ? 89  TYR G CD2 1 
ATOM   8225  C CE1 . TYR G  1 89  ? 16.109  28.414  6.691   1.00 59.03  ? 89  TYR G CE1 1 
ATOM   8226  C CE2 . TYR G  1 89  ? 16.965  30.491  5.855   1.00 55.58  ? 89  TYR G CE2 1 
ATOM   8227  C CZ  . TYR G  1 89  ? 17.179  29.193  6.288   1.00 65.71  ? 89  TYR G CZ  1 
ATOM   8228  O OH  . TYR G  1 89  ? 18.452  28.671  6.313   1.00 71.94  ? 89  TYR G OH  1 
ATOM   8229  N N   . HIS G  1 90  ? 10.664  31.243  3.480   1.00 49.69  ? 90  HIS G N   1 
ATOM   8230  C CA  . HIS G  1 90  ? 9.473   32.031  3.164   1.00 49.37  ? 90  HIS G CA  1 
ATOM   8231  C C   . HIS G  1 90  ? 8.144   31.253  3.117   1.00 50.73  ? 90  HIS G C   1 
ATOM   8232  O O   . HIS G  1 90  ? 7.088   31.888  3.061   1.00 50.10  ? 90  HIS G O   1 
ATOM   8233  C CB  . HIS G  1 90  ? 9.693   32.809  1.848   1.00 50.38  ? 90  HIS G CB  1 
ATOM   8234  C CG  . HIS G  1 90  ? 9.781   31.943  0.625   1.00 54.58  ? 90  HIS G CG  1 
ATOM   8235  N ND1 . HIS G  1 90  ? 10.499  30.746  0.622   1.00 56.95  ? 90  HIS G ND1 1 
ATOM   8236  C CD2 . HIS G  1 90  ? 9.262   32.144  -0.610  1.00 57.28  ? 90  HIS G CD2 1 
ATOM   8237  C CE1 . HIS G  1 90  ? 10.360  30.253  -0.599  1.00 57.20  ? 90  HIS G CE1 1 
ATOM   8238  N NE2 . HIS G  1 90  ? 9.639   31.069  -1.381  1.00 57.66  ? 90  HIS G NE2 1 
ATOM   8239  N N   . LYS G  1 91  ? 8.185   29.904  3.129   1.00 45.57  ? 91  LYS G N   1 
ATOM   8240  C CA  . LYS G  1 91  ? 6.967   29.096  3.006   1.00 44.41  ? 91  LYS G CA  1 
ATOM   8241  C C   . LYS G  1 91  ? 6.557   28.420  4.305   1.00 50.23  ? 91  LYS G C   1 
ATOM   8242  O O   . LYS G  1 91  ? 7.301   28.461  5.283   1.00 50.24  ? 91  LYS G O   1 
ATOM   8243  C CB  . LYS G  1 91  ? 7.059   28.087  1.833   1.00 44.56  ? 91  LYS G CB  1 
ATOM   8244  C CG  . LYS G  1 91  ? 8.384   27.364  1.715   1.00 48.76  ? 91  LYS G CG  1 
ATOM   8245  C CD  . LYS G  1 91  ? 8.641   26.862  0.312   1.00 54.30  ? 91  LYS G CD  1 
ATOM   8246  C CE  . LYS G  1 91  ? 9.930   26.073  0.211   1.00 57.26  ? 91  LYS G CE  1 
ATOM   8247  N NZ  . LYS G  1 91  ? 10.421  25.989  -1.194  1.00 64.93  ? 91  LYS G NZ  1 
ATOM   8248  N N   . SER G  1 92  ? 5.335   27.843  4.314   1.00 48.89  ? 92  SER G N   1 
ATOM   8249  C CA  . SER G  1 92  ? 4.723   27.117  5.427   1.00 73.19  ? 92  SER G CA  1 
ATOM   8250  C C   . SER G  1 92  ? 5.165   25.651  5.445   1.00 106.00 ? 92  SER G C   1 
ATOM   8251  O O   . SER G  1 92  ? 6.258   25.336  5.912   1.00 72.87  ? 92  SER G O   1 
ATOM   8252  C CB  . SER G  1 92  ? 3.201   27.198  5.336   1.00 77.45  ? 92  SER G CB  1 
ATOM   8253  O OG  . SER G  1 92  ? 2.692   26.755  4.087   1.00 82.56  ? 92  SER G OG  1 
ATOM   8254  N N   . ASN H  2 1   ? 7.331   45.714  3.495   1.00 80.47  ? 1   ASN H N   1 
ATOM   8255  C CA  . ASN H  2 1   ? 6.347   46.764  3.752   1.00 84.76  ? 1   ASN H CA  1 
ATOM   8256  C C   . ASN H  2 1   ? 5.336   46.970  2.569   1.00 88.41  ? 1   ASN H C   1 
ATOM   8257  O O   . ASN H  2 1   ? 4.211   46.460  2.665   1.00 87.55  ? 1   ASN H O   1 
ATOM   8258  C CB  . ASN H  2 1   ? 7.027   48.100  4.190   1.00 90.05  ? 1   ASN H CB  1 
ATOM   8259  C CG  . ASN H  2 1   ? 7.276   48.247  5.693   1.00 107.98 ? 1   ASN H CG  1 
ATOM   8260  O OD1 . ASN H  2 1   ? 6.344   48.323  6.506   1.00 99.09  ? 1   ASN H OD1 1 
ATOM   8261  N ND2 . ASN H  2 1   ? 8.541   48.356  6.095   1.00 97.81  ? 1   ASN H ND2 1 
ATOM   8262  N N   . SER H  2 2   ? 5.733   47.697  1.476   1.00 85.12  ? 2   SER H N   1 
ATOM   8263  C CA  . SER H  2 2   ? 4.897   48.053  0.307   1.00 85.01  ? 2   SER H CA  1 
ATOM   8264  C C   . SER H  2 2   ? 4.514   46.871  -0.623  1.00 83.57  ? 2   SER H C   1 
ATOM   8265  O O   . SER H  2 2   ? 5.129   46.651  -1.668  1.00 81.81  ? 2   SER H O   1 
ATOM   8266  C CB  . SER H  2 2   ? 5.537   49.186  -0.501  1.00 91.67  ? 2   SER H CB  1 
ATOM   8267  O OG  . SER H  2 2   ? 6.677   48.793  -1.252  1.00 97.08  ? 2   SER H OG  1 
ATOM   8268  N N   . CYS H  2 3   ? 3.452   46.154  -0.252  1.00 77.86  ? 3   CYS H N   1 
ATOM   8269  C CA  . CYS H  2 3   ? 2.910   45.015  -0.995  1.00 73.14  ? 3   CYS H CA  1 
ATOM   8270  C C   . CYS H  2 3   ? 1.396   45.227  -1.122  1.00 81.99  ? 3   CYS H C   1 
ATOM   8271  O O   . CYS H  2 3   ? 0.704   45.280  -0.090  1.00 83.83  ? 3   CYS H O   1 
ATOM   8272  C CB  . CYS H  2 3   ? 3.237   43.711  -0.271  1.00 68.50  ? 3   CYS H CB  1 
ATOM   8273  S SG  . CYS H  2 3   ? 2.219   42.295  -0.767  1.00 68.40  ? 3   CYS H SG  1 
ATOM   8274  N N   . GLU H  2 4   ? 0.879   45.365  -2.373  1.00 79.33  ? 4   GLU H N   1 
ATOM   8275  C CA  . GLU H  2 4   ? -0.558  45.579  -2.561  1.00 81.46  ? 4   GLU H CA  1 
ATOM   8276  C C   . GLU H  2 4   ? -1.154  44.981  -3.856  1.00 81.42  ? 4   GLU H C   1 
ATOM   8277  O O   . GLU H  2 4   ? -0.445  44.445  -4.720  1.00 76.59  ? 4   GLU H O   1 
ATOM   8278  C CB  . GLU H  2 4   ? -0.922  47.082  -2.439  1.00 88.56  ? 4   GLU H CB  1 
ATOM   8279  C CG  . GLU H  2 4   ? -0.411  47.949  -3.578  1.00 103.80 ? 4   GLU H CG  1 
ATOM   8280  C CD  . GLU H  2 4   ? -0.277  49.416  -3.234  1.00 137.94 ? 4   GLU H CD  1 
ATOM   8281  O OE1 . GLU H  2 4   ? -0.759  50.257  -4.027  1.00 144.43 ? 4   GLU H OE1 1 
ATOM   8282  O OE2 . GLU H  2 4   ? 0.317   49.726  -2.176  1.00 137.20 ? 4   GLU H OE2 1 
ATOM   8283  N N   . LEU H  2 5   ? -2.499  45.098  -3.949  1.00 79.94  ? 5   LEU H N   1 
ATOM   8284  C CA  . LEU H  2 5   ? -3.312  44.652  -5.065  1.00 78.28  ? 5   LEU H CA  1 
ATOM   8285  C C   . LEU H  2 5   ? -2.983  45.483  -6.277  1.00 86.07  ? 5   LEU H C   1 
ATOM   8286  O O   . LEU H  2 5   ? -3.175  46.705  -6.284  1.00 89.82  ? 5   LEU H O   1 
ATOM   8287  C CB  . LEU H  2 5   ? -4.808  44.727  -4.737  1.00 79.65  ? 5   LEU H CB  1 
ATOM   8288  C CG  . LEU H  2 5   ? -5.319  43.687  -3.764  1.00 82.17  ? 5   LEU H CG  1 
ATOM   8289  C CD1 . LEU H  2 5   ? -6.398  44.249  -2.918  1.00 86.52  ? 5   LEU H CD1 1 
ATOM   8290  C CD2 . LEU H  2 5   ? -5.796  42.436  -4.478  1.00 80.18  ? 5   LEU H CD2 1 
ATOM   8291  N N   . THR H  2 6   ? -2.384  44.826  -7.263  1.00 81.51  ? 6   THR H N   1 
ATOM   8292  C CA  . THR H  2 6   ? -2.008  45.443  -8.525  1.00 83.37  ? 6   THR H CA  1 
ATOM   8293  C C   . THR H  2 6   ? -2.690  44.687  -9.650  1.00 86.68  ? 6   THR H C   1 
ATOM   8294  O O   . THR H  2 6   ? -2.831  43.456  -9.591  1.00 81.24  ? 6   THR H O   1 
ATOM   8295  C CB  . THR H  2 6   ? -0.481  45.548  -8.685  1.00 88.25  ? 6   THR H CB  1 
ATOM   8296  O OG1 . THR H  2 6   ? 0.100   44.266  -8.495  1.00 83.23  ? 6   THR H OG1 1 
ATOM   8297  C CG2 . THR H  2 6   ? 0.150   46.547  -7.718  1.00 89.44  ? 6   THR H CG2 1 
ATOM   8298  N N   . ASN H  2 7   ? -3.165  45.441  -10.650 1.00 88.61  ? 7   ASN H N   1 
ATOM   8299  C CA  . ASN H  2 7   ? -3.833  44.869  -11.811 1.00 88.32  ? 7   ASN H CA  1 
ATOM   8300  C C   . ASN H  2 7   ? -2.804  44.213  -12.700 1.00 89.11  ? 7   ASN H C   1 
ATOM   8301  O O   . ASN H  2 7   ? -1.755  44.801  -12.987 1.00 90.23  ? 7   ASN H O   1 
ATOM   8302  C CB  . ASN H  2 7   ? -4.575  45.935  -12.610 1.00 96.25  ? 7   ASN H CB  1 
ATOM   8303  C CG  . ASN H  2 7   ? -5.899  46.359  -12.051 1.00 133.49 ? 7   ASN H CG  1 
ATOM   8304  O OD1 . ASN H  2 7   ? -6.807  45.540  -11.835 1.00 126.54 ? 7   ASN H OD1 1 
ATOM   8305  N ND2 . ASN H  2 7   ? -6.009  47.675  -11.856 1.00 137.23 ? 7   ASN H ND2 1 
ATOM   8306  N N   . ILE H  2 8   ? -3.098  42.987  -13.113 1.00 81.79  ? 8   ILE H N   1 
ATOM   8307  C CA  . ILE H  2 8   ? -2.253  42.222  -14.016 1.00 80.04  ? 8   ILE H CA  1 
ATOM   8308  C C   . ILE H  2 8   ? -3.079  41.696  -15.174 1.00 83.63  ? 8   ILE H C   1 
ATOM   8309  O O   . ILE H  2 8   ? -4.312  41.778  -15.165 1.00 82.91  ? 8   ILE H O   1 
ATOM   8310  C CB  . ILE H  2 8   ? -1.388  41.114  -13.337 1.00 79.73  ? 8   ILE H CB  1 
ATOM   8311  C CG1 . ILE H  2 8   ? -2.252  40.054  -12.620 1.00 77.46  ? 8   ILE H CG1 1 
ATOM   8312  C CG2 . ILE H  2 8   ? -0.315  41.704  -12.418 1.00 80.70  ? 8   ILE H CG2 1 
ATOM   8313  C CD1 . ILE H  2 8   ? -1.641  38.696  -12.650 1.00 81.47  ? 8   ILE H CD1 1 
ATOM   8314  N N   . THR H  2 9   ? -2.378  41.179  -16.176 1.00 80.77  ? 9   THR H N   1 
ATOM   8315  C CA  . THR H  2 9   ? -2.940  40.604  -17.383 1.00 81.53  ? 9   THR H CA  1 
ATOM   8316  C C   . THR H  2 9   ? -2.456  39.164  -17.408 1.00 82.69  ? 9   THR H C   1 
ATOM   8317  O O   . THR H  2 9   ? -1.248  38.926  -17.353 1.00 82.82  ? 9   THR H O   1 
ATOM   8318  C CB  . THR H  2 9   ? -2.473  41.420  -18.613 1.00 93.18  ? 9   THR H CB  1 
ATOM   8319  O OG1 . THR H  2 9   ? -2.779  42.811  -18.430 1.00 93.76  ? 9   THR H OG1 1 
ATOM   8320  C CG2 . THR H  2 9   ? -3.067  40.912  -19.920 1.00 93.09  ? 9   THR H CG2 1 
ATOM   8321  N N   . ILE H  2 10  ? -3.392  38.210  -17.448 1.00 76.82  ? 10  ILE H N   1 
ATOM   8322  C CA  . ILE H  2 10  ? -3.070  36.779  -17.481 1.00 74.09  ? 10  ILE H CA  1 
ATOM   8323  C C   . ILE H  2 10  ? -3.437  36.140  -18.805 1.00 76.93  ? 10  ILE H C   1 
ATOM   8324  O O   . ILE H  2 10  ? -4.364  36.593  -19.481 1.00 77.31  ? 10  ILE H O   1 
ATOM   8325  C CB  . ILE H  2 10  ? -3.651  35.969  -16.280 1.00 74.89  ? 10  ILE H CB  1 
ATOM   8326  C CG1 . ILE H  2 10  ? -5.208  36.063  -16.182 1.00 75.38  ? 10  ILE H CG1 1 
ATOM   8327  C CG2 . ILE H  2 10  ? -2.973  36.360  -14.975 1.00 74.70  ? 10  ILE H CG2 1 
ATOM   8328  C CD1 . ILE H  2 10  ? -5.892  34.876  -15.512 1.00 73.61  ? 10  ILE H CD1 1 
ATOM   8329  N N   . ALA H  2 11  ? -2.729  35.054  -19.141 1.00 72.37  ? 11  ALA H N   1 
ATOM   8330  C CA  . ALA H  2 11  ? -2.956  34.259  -20.341 1.00 73.82  ? 11  ALA H CA  1 
ATOM   8331  C C   . ALA H  2 11  ? -3.765  32.985  -20.018 1.00 76.17  ? 11  ALA H C   1 
ATOM   8332  O O   . ALA H  2 11  ? -3.411  32.233  -19.101 1.00 73.28  ? 11  ALA H O   1 
ATOM   8333  C CB  . ALA H  2 11  ? -1.627  33.890  -20.977 1.00 75.89  ? 11  ALA H CB  1 
ATOM   8334  N N   . ILE H  2 12  ? -4.874  32.777  -20.752 1.00 74.25  ? 12  ILE H N   1 
ATOM   8335  C CA  . ILE H  2 12  ? -5.717  31.590  -20.644 1.00 74.10  ? 12  ILE H CA  1 
ATOM   8336  C C   . ILE H  2 12  ? -5.481  30.847  -21.960 1.00 83.75  ? 12  ILE H C   1 
ATOM   8337  O O   . ILE H  2 12  ? -5.820  31.359  -23.026 1.00 86.32  ? 12  ILE H O   1 
ATOM   8338  C CB  . ILE H  2 12  ? -7.200  31.948  -20.376 1.00 76.93  ? 12  ILE H CB  1 
ATOM   8339  C CG1 . ILE H  2 12  ? -7.375  32.628  -19.003 1.00 74.54  ? 12  ILE H CG1 1 
ATOM   8340  C CG2 . ILE H  2 12  ? -8.095  30.709  -20.492 1.00 78.75  ? 12  ILE H CG2 1 
ATOM   8341  C CD1 . ILE H  2 12  ? -8.378  33.727  -18.980 1.00 79.46  ? 12  ILE H CD1 1 
ATOM   8342  N N   . GLU H  2 13  ? -4.840  29.671  -21.874 1.00 82.00  ? 13  GLU H N   1 
ATOM   8343  C CA  . GLU H  2 13  ? -4.382  28.831  -22.990 1.00 85.56  ? 13  GLU H CA  1 
ATOM   8344  C C   . GLU H  2 13  ? -5.345  27.697  -23.404 1.00 93.34  ? 13  GLU H C   1 
ATOM   8345  O O   . GLU H  2 13  ? -5.585  26.770  -22.623 1.00 92.22  ? 13  GLU H O   1 
ATOM   8346  C CB  . GLU H  2 13  ? -3.000  28.271  -22.600 1.00 86.29  ? 13  GLU H CB  1 
ATOM   8347  C CG  . GLU H  2 13  ? -2.261  27.409  -23.604 1.00 97.47  ? 13  GLU H CG  1 
ATOM   8348  C CD  . GLU H  2 13  ? -0.866  27.094  -23.095 1.00 111.46 ? 13  GLU H CD  1 
ATOM   8349  O OE1 . GLU H  2 13  ? 0.019   27.970  -23.226 1.00 110.31 ? 13  GLU H OE1 1 
ATOM   8350  O OE2 . GLU H  2 13  ? -0.682  26.022  -22.473 1.00 96.42  ? 13  GLU H OE2 1 
ATOM   8351  N N   . LYS H  2 14  ? -5.862  27.759  -24.649 1.00 93.92  ? 14  LYS H N   1 
ATOM   8352  C CA  . LYS H  2 14  ? -6.734  26.724  -25.209 1.00 96.69  ? 14  LYS H CA  1 
ATOM   8353  C C   . LYS H  2 14  ? -5.866  25.875  -26.132 1.00 107.50 ? 14  LYS H C   1 
ATOM   8354  O O   . LYS H  2 14  ? -5.555  26.297  -27.254 1.00 110.83 ? 14  LYS H O   1 
ATOM   8355  C CB  . LYS H  2 14  ? -7.937  27.334  -25.959 1.00 100.12 ? 14  LYS H CB  1 
ATOM   8356  C CG  . LYS H  2 14  ? -9.119  26.376  -26.092 1.00 105.33 ? 14  LYS H CG  1 
ATOM   8357  C CD  . LYS H  2 14  ? -10.284 27.003  -26.824 1.00 108.16 ? 14  LYS H CD  1 
ATOM   8358  C CE  . LYS H  2 14  ? -11.400 26.023  -27.102 1.00 113.28 ? 14  LYS H CE  1 
ATOM   8359  N NZ  . LYS H  2 14  ? -12.354 25.906  -25.972 1.00 113.87 ? 14  LYS H NZ  1 
ATOM   8360  N N   . GLU H  2 15  ? -5.427  24.702  -25.621 1.00 105.68 ? 15  GLU H N   1 
ATOM   8361  C CA  . GLU H  2 15  ? -4.534  23.746  -26.294 1.00 109.66 ? 15  GLU H CA  1 
ATOM   8362  C C   . GLU H  2 15  ? -4.993  23.297  -27.700 1.00 117.39 ? 15  GLU H C   1 
ATOM   8363  O O   . GLU H  2 15  ? -4.193  23.370  -28.639 1.00 120.59 ? 15  GLU H O   1 
ATOM   8364  C CB  . GLU H  2 15  ? -4.272  22.518  -25.402 1.00 110.75 ? 15  GLU H CB  1 
ATOM   8365  C CG  . GLU H  2 15  ? -3.245  22.744  -24.304 1.00 120.24 ? 15  GLU H CG  1 
ATOM   8366  C CD  . GLU H  2 15  ? -2.583  21.477  -23.792 1.00 150.45 ? 15  GLU H CD  1 
ATOM   8367  O OE1 . GLU H  2 15  ? -2.848  21.097  -22.628 1.00 151.16 ? 15  GLU H OE1 1 
ATOM   8368  O OE2 . GLU H  2 15  ? -1.791  20.868  -24.548 1.00 147.43 ? 15  GLU H OE2 1 
ATOM   8369  N N   . GLU H  2 16  ? -6.266  22.845  -27.844 1.00 113.10 ? 16  GLU H N   1 
ATOM   8370  C CA  . GLU H  2 16  ? -6.813  22.352  -29.117 1.00 117.43 ? 16  GLU H CA  1 
ATOM   8371  C C   . GLU H  2 16  ? -7.095  23.454  -30.152 1.00 122.11 ? 16  GLU H C   1 
ATOM   8372  O O   . GLU H  2 16  ? -7.349  23.133  -31.318 1.00 126.94 ? 16  GLU H O   1 
ATOM   8373  C CB  . GLU H  2 16  ? -8.061  21.457  -28.912 1.00 119.38 ? 16  GLU H CB  1 
ATOM   8374  C CG  . GLU H  2 16  ? -9.271  22.148  -28.304 1.00 125.25 ? 16  GLU H CG  1 
ATOM   8375  C CD  . GLU H  2 16  ? -9.358  22.083  -26.792 1.00 139.52 ? 16  GLU H CD  1 
ATOM   8376  O OE1 . GLU H  2 16  ? -10.313 21.453  -26.284 1.00 138.80 ? 16  GLU H OE1 1 
ATOM   8377  O OE2 . GLU H  2 16  ? -8.481  22.667  -26.115 1.00 123.57 ? 16  GLU H OE2 1 
ATOM   8378  N N   . CYS H  2 17  ? -7.058  24.733  -29.741 1.00 114.11 ? 17  CYS H N   1 
ATOM   8379  C CA  . CYS H  2 17  ? -7.298  25.846  -30.660 1.00 115.36 ? 17  CYS H CA  1 
ATOM   8380  C C   . CYS H  2 17  ? -6.016  26.588  -31.051 1.00 120.75 ? 17  CYS H C   1 
ATOM   8381  O O   . CYS H  2 17  ? -6.045  27.445  -31.940 1.00 123.06 ? 17  CYS H O   1 
ATOM   8382  C CB  . CYS H  2 17  ? -8.366  26.790  -30.119 1.00 111.91 ? 17  CYS H CB  1 
ATOM   8383  S SG  . CYS H  2 17  ? -10.062 26.278  -30.503 1.00 117.18 ? 17  CYS H SG  1 
ATOM   8384  N N   . ARG H  2 18  ? -4.888  26.210  -30.418 1.00 115.90 ? 18  ARG H N   1 
ATOM   8385  C CA  . ARG H  2 18  ? -3.539  26.739  -30.642 1.00 117.17 ? 18  ARG H CA  1 
ATOM   8386  C C   . ARG H  2 18  ? -3.447  28.266  -30.430 1.00 118.93 ? 18  ARG H C   1 
ATOM   8387  O O   . ARG H  2 18  ? -2.724  28.954  -31.162 1.00 121.97 ? 18  ARG H O   1 
ATOM   8388  C CB  . ARG H  2 18  ? -2.951  26.304  -32.018 1.00 124.36 ? 18  ARG H CB  1 
ATOM   8389  C CG  . ARG H  2 18  ? -2.859  24.784  -32.285 1.00 137.79 ? 18  ARG H CG  1 
ATOM   8390  C CD  . ARG H  2 18  ? -2.044  24.017  -31.249 1.00 145.45 ? 18  ARG H CD  1 
ATOM   8391  N NE  . ARG H  2 18  ? -1.217  22.960  -31.838 1.00 158.94 ? 18  ARG H NE  1 
ATOM   8392  C CZ  . ARG H  2 18  ? 0.113   22.990  -31.902 1.00 173.18 ? 18  ARG H CZ  1 
ATOM   8393  N NH1 . ARG H  2 18  ? 0.786   24.029  -31.421 1.00 154.50 ? 18  ARG H NH1 1 
ATOM   8394  N NH2 . ARG H  2 18  ? 0.779   21.980  -32.445 1.00 165.66 ? 18  ARG H NH2 1 
ATOM   8395  N N   . PHE H  2 19  ? -4.161  28.784  -29.404 1.00 110.20 ? 19  PHE H N   1 
ATOM   8396  C CA  . PHE H  2 19  ? -4.146  30.206  -29.044 1.00 108.07 ? 19  PHE H CA  1 
ATOM   8397  C C   . PHE H  2 19  ? -4.391  30.464  -27.550 1.00 106.52 ? 19  PHE H C   1 
ATOM   8398  O O   . PHE H  2 19  ? -4.810  29.564  -26.821 1.00 103.84 ? 19  PHE H O   1 
ATOM   8399  C CB  . PHE H  2 19  ? -5.115  31.041  -29.918 1.00 112.36 ? 19  PHE H CB  1 
ATOM   8400  C CG  . PHE H  2 19  ? -6.604  30.781  -29.806 1.00 112.66 ? 19  PHE H CG  1 
ATOM   8401  C CD1 . PHE H  2 19  ? -7.271  30.954  -28.596 1.00 111.13 ? 19  PHE H CD1 1 
ATOM   8402  C CD2 . PHE H  2 19  ? -7.359  30.484  -30.934 1.00 118.76 ? 19  PHE H CD2 1 
ATOM   8403  C CE1 . PHE H  2 19  ? -8.647  30.737  -28.499 1.00 111.65 ? 19  PHE H CE1 1 
ATOM   8404  C CE2 . PHE H  2 19  ? -8.740  30.298  -30.843 1.00 120.93 ? 19  PHE H CE2 1 
ATOM   8405  C CZ  . PHE H  2 19  ? -9.374  30.418  -29.624 1.00 114.63 ? 19  PHE H CZ  1 
ATOM   8406  N N   . CYS H  2 20  ? -4.151  31.713  -27.113 1.00 101.67 ? 20  CYS H N   1 
ATOM   8407  C CA  . CYS H  2 20  ? -4.385  32.178  -25.746 1.00 97.02  ? 20  CYS H CA  1 
ATOM   8408  C C   . CYS H  2 20  ? -5.184  33.457  -25.760 1.00 98.51  ? 20  CYS H C   1 
ATOM   8409  O O   . CYS H  2 20  ? -5.022  34.295  -26.654 1.00 101.61 ? 20  CYS H O   1 
ATOM   8410  C CB  . CYS H  2 20  ? -3.082  32.372  -24.976 1.00 96.18  ? 20  CYS H CB  1 
ATOM   8411  S SG  . CYS H  2 20  ? -2.039  30.900  -24.886 1.00 100.62 ? 20  CYS H SG  1 
ATOM   8412  N N   . ILE H  2 21  ? -6.013  33.627  -24.737 1.00 89.62  ? 21  ILE H N   1 
ATOM   8413  C CA  . ILE H  2 21  ? -6.787  34.841  -24.538 1.00 88.44  ? 21  ILE H CA  1 
ATOM   8414  C C   . ILE H  2 21  ? -6.207  35.551  -23.316 1.00 88.83  ? 21  ILE H C   1 
ATOM   8415  O O   . ILE H  2 21  ? -5.733  34.888  -22.386 1.00 86.12  ? 21  ILE H O   1 
ATOM   8416  C CB  . ILE H  2 21  ? -8.341  34.628  -24.487 1.00 90.80  ? 21  ILE H CB  1 
ATOM   8417  C CG1 . ILE H  2 21  ? -8.800  33.767  -23.293 1.00 87.65  ? 21  ILE H CG1 1 
ATOM   8418  C CG2 . ILE H  2 21  ? -8.861  34.066  -25.807 1.00 94.47  ? 21  ILE H CG2 1 
ATOM   8419  C CD1 . ILE H  2 21  ? -10.275 33.939  -22.890 1.00 94.05  ? 21  ILE H CD1 1 
ATOM   8420  N N   . SER H  2 22  ? -6.188  36.883  -23.339 1.00 85.50  ? 22  SER H N   1 
ATOM   8421  C CA  . SER H  2 22  ? -5.663  37.655  -22.225 1.00 83.32  ? 22  SER H CA  1 
ATOM   8422  C C   . SER H  2 22  ? -6.784  38.294  -21.435 1.00 87.31  ? 22  SER H C   1 
ATOM   8423  O O   . SER H  2 22  ? -7.643  38.971  -22.005 1.00 89.67  ? 22  SER H O   1 
ATOM   8424  C CB  . SER H  2 22  ? -4.644  38.682  -22.700 1.00 88.80  ? 22  SER H CB  1 
ATOM   8425  O OG  . SER H  2 22  ? -3.508  38.020  -23.234 1.00 96.13  ? 22  SER H OG  1 
ATOM   8426  N N   . ILE H  2 23  ? -6.812  38.020  -20.126 1.00 81.34  ? 23  ILE H N   1 
ATOM   8427  C CA  . ILE H  2 23  ? -7.833  38.542  -19.217 1.00 80.63  ? 23  ILE H CA  1 
ATOM   8428  C C   . ILE H  2 23  ? -7.163  39.415  -18.156 1.00 84.61  ? 23  ILE H C   1 
ATOM   8429  O O   . ILE H  2 23  ? -6.084  39.071  -17.668 1.00 81.84  ? 23  ILE H O   1 
ATOM   8430  C CB  . ILE H  2 23  ? -8.753  37.390  -18.666 1.00 81.30  ? 23  ILE H CB  1 
ATOM   8431  C CG1 . ILE H  2 23  ? -10.185 37.507  -19.183 1.00 83.70  ? 23  ILE H CG1 1 
ATOM   8432  C CG2 . ILE H  2 23  ? -8.745  37.234  -17.154 1.00 79.27  ? 23  ILE H CG2 1 
ATOM   8433  C CD1 . ILE H  2 23  ? -10.424 36.901  -20.540 1.00 95.04  ? 23  ILE H CD1 1 
ATOM   8434  N N   . ASN H  2 24  ? -7.767  40.570  -17.853 1.00 84.76  ? 24  ASN H N   1 
ATOM   8435  C CA  . ASN H  2 24  ? -7.230  41.478  -16.843 1.00 85.44  ? 24  ASN H CA  1 
ATOM   8436  C C   . ASN H  2 24  ? -7.824  41.168  -15.483 1.00 86.95  ? 24  ASN H C   1 
ATOM   8437  O O   . ASN H  2 24  ? -9.048  41.145  -15.318 1.00 87.36  ? 24  ASN H O   1 
ATOM   8438  C CB  . ASN H  2 24  ? -7.401  42.945  -17.230 1.00 92.70  ? 24  ASN H CB  1 
ATOM   8439  C CG  . ASN H  2 24  ? -6.475  43.397  -18.334 1.00 129.80 ? 24  ASN H CG  1 
ATOM   8440  O OD1 . ASN H  2 24  ? -5.900  42.588  -19.079 1.00 122.29 ? 24  ASN H OD1 1 
ATOM   8441  N ND2 . ASN H  2 24  ? -6.333  44.714  -18.477 1.00 133.55 ? 24  ASN H ND2 1 
ATOM   8442  N N   . THR H  2 25  ? -6.943  40.874  -14.524 1.00 80.26  ? 25  THR H N   1 
ATOM   8443  C CA  . THR H  2 25  ? -7.334  40.505  -13.173 1.00 78.04  ? 25  THR H CA  1 
ATOM   8444  C C   . THR H  2 25  ? -6.528  41.306  -12.133 1.00 81.33  ? 25  THR H C   1 
ATOM   8445  O O   . THR H  2 25  ? -5.718  42.163  -12.511 1.00 82.57  ? 25  THR H O   1 
ATOM   8446  C CB  . THR H  2 25  ? -7.280  38.983  -13.030 1.00 84.04  ? 25  THR H CB  1 
ATOM   8447  O OG1 . THR H  2 25  ? -8.021  38.592  -11.878 1.00 85.82  ? 25  THR H OG1 1 
ATOM   8448  C CG2 . THR H  2 25  ? -5.856  38.422  -13.017 1.00 80.90  ? 25  THR H CG2 1 
ATOM   8449  N N   . THR H  2 26  ? -6.796  41.068  -10.835 1.00 76.24  ? 26  THR H N   1 
ATOM   8450  C CA  . THR H  2 26  ? -6.141  41.779  -9.736  1.00 76.93  ? 26  THR H CA  1 
ATOM   8451  C C   . THR H  2 26  ? -5.317  40.821  -8.874  1.00 77.77  ? 26  THR H C   1 
ATOM   8452  O O   . THR H  2 26  ? -5.892  39.929  -8.240  1.00 76.73  ? 26  THR H O   1 
ATOM   8453  C CB  . THR H  2 26  ? -7.182  42.584  -8.947  1.00 90.58  ? 26  THR H CB  1 
ATOM   8454  O OG1 . THR H  2 26  ? -7.963  43.344  -9.869  1.00 97.21  ? 26  THR H OG1 1 
ATOM   8455  C CG2 . THR H  2 26  ? -6.556  43.524  -7.936  1.00 91.37  ? 26  THR H CG2 1 
ATOM   8456  N N   . TRP H  2 27  ? -3.975  40.996  -8.858  1.00 72.39  ? 27  TRP H N   1 
ATOM   8457  C CA  . TRP H  2 27  ? -3.091  40.131  -8.070  1.00 69.11  ? 27  TRP H CA  1 
ATOM   8458  C C   . TRP H  2 27  ? -2.143  40.904  -7.150  1.00 72.65  ? 27  TRP H C   1 
ATOM   8459  O O   . TRP H  2 27  ? -2.388  42.080  -6.867  1.00 74.78  ? 27  TRP H O   1 
ATOM   8460  C CB  . TRP H  2 27  ? -2.342  39.136  -8.965  1.00 65.59  ? 27  TRP H CB  1 
ATOM   8461  C CG  . TRP H  2 27  ? -3.099  37.862  -9.076  1.00 65.50  ? 27  TRP H CG  1 
ATOM   8462  C CD1 . TRP H  2 27  ? -4.068  37.567  -9.988  1.00 69.13  ? 27  TRP H CD1 1 
ATOM   8463  C CD2 . TRP H  2 27  ? -3.133  36.813  -8.103  1.00 64.03  ? 27  TRP H CD2 1 
ATOM   8464  N NE1 . TRP H  2 27  ? -4.674  36.375  -9.669  1.00 67.47  ? 27  TRP H NE1 1 
ATOM   8465  C CE2 . TRP H  2 27  ? -4.101  35.877  -8.528  1.00 67.64  ? 27  TRP H CE2 1 
ATOM   8466  C CE3 . TRP H  2 27  ? -2.420  36.559  -6.916  1.00 64.13  ? 27  TRP H CE3 1 
ATOM   8467  C CZ2 . TRP H  2 27  ? -4.347  34.691  -7.834  1.00 65.63  ? 27  TRP H CZ2 1 
ATOM   8468  C CZ3 . TRP H  2 27  ? -2.696  35.404  -6.209  1.00 64.04  ? 27  TRP H CZ3 1 
ATOM   8469  C CH2 . TRP H  2 27  ? -3.633  34.477  -6.678  1.00 64.63  ? 27  TRP H CH2 1 
ATOM   8470  N N   . CYS H  2 28  ? -1.084  40.229  -6.655  1.00 66.36  ? 28  CYS H N   1 
ATOM   8471  C CA  . CYS H  2 28  ? -0.090  40.827  -5.758  1.00 66.07  ? 28  CYS H CA  1 
ATOM   8472  C C   . CYS H  2 28  ? 1.262   41.059  -6.400  1.00 66.78  ? 28  CYS H C   1 
ATOM   8473  O O   . CYS H  2 28  ? 1.722   40.271  -7.233  1.00 64.14  ? 28  CYS H O   1 
ATOM   8474  C CB  . CYS H  2 28  ? 0.044   40.013  -4.478  1.00 64.84  ? 28  CYS H CB  1 
ATOM   8475  S SG  . CYS H  2 28  ? -1.532  39.696  -3.651  1.00 69.92  ? 28  CYS H SG  1 
ATOM   8476  N N   . ALA H  2 29  ? 1.898   42.148  -5.974  1.00 63.82  ? 29  ALA H N   1 
ATOM   8477  C CA  . ALA H  2 29  ? 3.231   42.574  -6.376  1.00 64.15  ? 29  ALA H CA  1 
ATOM   8478  C C   . ALA H  2 29  ? 3.719   43.614  -5.379  1.00 68.04  ? 29  ALA H C   1 
ATOM   8479  O O   . ALA H  2 29  ? 2.916   44.380  -4.837  1.00 70.63  ? 29  ALA H O   1 
ATOM   8480  C CB  . ALA H  2 29  ? 3.198   43.171  -7.776  1.00 67.42  ? 29  ALA H CB  1 
ATOM   8481  N N   . GLY H  2 30  ? 5.016   43.635  -5.134  1.00 61.91  ? 30  GLY H N   1 
ATOM   8482  C CA  . GLY H  2 30  ? 5.565   44.591  -4.196  1.00 63.92  ? 30  GLY H CA  1 
ATOM   8483  C C   . GLY H  2 30  ? 6.857   44.182  -3.534  1.00 67.81  ? 30  GLY H C   1 
ATOM   8484  O O   . GLY H  2 30  ? 7.566   43.284  -4.001  1.00 64.81  ? 30  GLY H O   1 
ATOM   8485  N N   . TYR H  2 31  ? 7.168   44.874  -2.439  1.00 67.10  ? 31  TYR H N   1 
ATOM   8486  C CA  . TYR H  2 31  ? 8.399   44.695  -1.689  1.00 66.18  ? 31  TYR H CA  1 
ATOM   8487  C C   . TYR H  2 31  ? 8.137   44.380  -0.234  1.00 67.63  ? 31  TYR H C   1 
ATOM   8488  O O   . TYR H  2 31  ? 7.195   44.893  0.363   1.00 68.04  ? 31  TYR H O   1 
ATOM   8489  C CB  . TYR H  2 31  ? 9.291   45.950  -1.829  1.00 71.82  ? 31  TYR H CB  1 
ATOM   8490  C CG  . TYR H  2 31  ? 9.758   46.225  -3.243  1.00 74.80  ? 31  TYR H CG  1 
ATOM   8491  C CD1 . TYR H  2 31  ? 8.895   46.775  -4.190  1.00 78.57  ? 31  TYR H CD1 1 
ATOM   8492  C CD2 . TYR H  2 31  ? 11.071  45.966  -3.628  1.00 75.06  ? 31  TYR H CD2 1 
ATOM   8493  C CE1 . TYR H  2 31  ? 9.305   46.991  -5.502  1.00 81.04  ? 31  TYR H CE1 1 
ATOM   8494  C CE2 . TYR H  2 31  ? 11.501  46.202  -4.933  1.00 77.73  ? 31  TYR H CE2 1 
ATOM   8495  C CZ  . TYR H  2 31  ? 10.614  46.722  -5.865  1.00 88.55  ? 31  TYR H CZ  1 
ATOM   8496  O OH  . TYR H  2 31  ? 11.017  46.966  -7.154  1.00 94.06  ? 31  TYR H OH  1 
ATOM   8497  N N   . CYS H  2 32  ? 8.980   43.526  0.330   1.00 62.81  ? 32  CYS H N   1 
ATOM   8498  C CA  . CYS H  2 32  ? 8.899   43.106  1.714   1.00 62.69  ? 32  CYS H CA  1 
ATOM   8499  C C   . CYS H  2 32  ? 10.280  43.208  2.323   1.00 63.77  ? 32  CYS H C   1 
ATOM   8500  O O   . CYS H  2 32  ? 11.265  42.794  1.706   1.00 61.32  ? 32  CYS H O   1 
ATOM   8501  C CB  . CYS H  2 32  ? 8.353   41.683  1.812   1.00 61.05  ? 32  CYS H CB  1 
ATOM   8502  S SG  . CYS H  2 32  ? 6.711   41.452  1.072   1.00 65.59  ? 32  CYS H SG  1 
ATOM   8503  N N   . TYR H  2 33  ? 10.349  43.754  3.540   1.00 60.91  ? 33  TYR H N   1 
ATOM   8504  C CA  . TYR H  2 33  ? 11.581  43.880  4.318   1.00 60.04  ? 33  TYR H CA  1 
ATOM   8505  C C   . TYR H  2 33  ? 11.996  42.494  4.790   1.00 59.52  ? 33  TYR H C   1 
ATOM   8506  O O   . TYR H  2 33  ? 11.137  41.700  5.179   1.00 58.42  ? 33  TYR H O   1 
ATOM   8507  C CB  . TYR H  2 33  ? 11.307  44.777  5.524   1.00 64.56  ? 33  TYR H CB  1 
ATOM   8508  C CG  . TYR H  2 33  ? 12.500  45.055  6.405   1.00 66.55  ? 33  TYR H CG  1 
ATOM   8509  C CD1 . TYR H  2 33  ? 13.305  46.173  6.191   1.00 70.09  ? 33  TYR H CD1 1 
ATOM   8510  C CD2 . TYR H  2 33  ? 12.773  44.257  7.513   1.00 66.84  ? 33  TYR H CD2 1 
ATOM   8511  C CE1 . TYR H  2 33  ? 14.381  46.460  7.025   1.00 71.33  ? 33  TYR H CE1 1 
ATOM   8512  C CE2 . TYR H  2 33  ? 13.856  44.525  8.350   1.00 69.60  ? 33  TYR H CE2 1 
ATOM   8513  C CZ  . TYR H  2 33  ? 14.651  45.637  8.110   1.00 79.34  ? 33  TYR H CZ  1 
ATOM   8514  O OH  . TYR H  2 33  ? 15.702  45.919  8.954   1.00 81.39  ? 33  TYR H OH  1 
ATOM   8515  N N   . THR H  2 34  ? 13.295  42.185  4.719   1.00 54.08  ? 34  THR H N   1 
ATOM   8516  C CA  . THR H  2 34  ? 13.835  40.889  5.164   1.00 50.57  ? 34  THR H CA  1 
ATOM   8517  C C   . THR H  2 34  ? 15.169  41.096  5.871   1.00 53.08  ? 34  THR H C   1 
ATOM   8518  O O   . THR H  2 34  ? 15.772  42.166  5.777   1.00 54.15  ? 34  THR H O   1 
ATOM   8519  C CB  . THR H  2 34  ? 13.861  39.794  4.051   1.00 56.62  ? 34  THR H CB  1 
ATOM   8520  O OG1 . THR H  2 34  ? 14.003  40.365  2.751   1.00 59.26  ? 34  THR H OG1 1 
ATOM   8521  C CG2 . THR H  2 34  ? 12.606  38.946  4.055   1.00 55.24  ? 34  THR H CG2 1 
ATOM   8522  N N   . ARG H  2 35  ? 15.578  40.098  6.658   1.00 47.54  ? 35  ARG H N   1 
ATOM   8523  C CA  . ARG H  2 35  ? 16.833  40.111  7.403   1.00 47.34  ? 35  ARG H CA  1 
ATOM   8524  C C   . ARG H  2 35  ? 17.583  38.790  7.205   1.00 51.81  ? 35  ARG H C   1 
ATOM   8525  O O   . ARG H  2 35  ? 16.989  37.739  6.883   1.00 49.79  ? 35  ARG H O   1 
ATOM   8526  C CB  . ARG H  2 35  ? 16.578  40.361  8.891   1.00 46.70  ? 35  ARG H CB  1 
ATOM   8527  C CG  . ARG H  2 35  ? 16.859  41.793  9.319   1.00 62.13  ? 35  ARG H CG  1 
ATOM   8528  C CD  . ARG H  2 35  ? 16.750  41.993  10.818  1.00 73.66  ? 35  ARG H CD  1 
ATOM   8529  N NE  . ARG H  2 35  ? 15.356  42.126  11.234  1.00 91.28  ? 35  ARG H NE  1 
ATOM   8530  C CZ  . ARG H  2 35  ? 14.749  43.283  11.477  1.00 110.56 ? 35  ARG H CZ  1 
ATOM   8531  N NH1 . ARG H  2 35  ? 15.419  44.427  11.380  1.00 100.87 ? 35  ARG H NH1 1 
ATOM   8532  N NH2 . ARG H  2 35  ? 13.471  43.307  11.833  1.00 97.02  ? 35  ARG H NH2 1 
ATOM   8533  N N   . ASP H  2 36  ? 18.903  38.861  7.329   1.00 50.31  ? 36  ASP H N   1 
ATOM   8534  C CA  . ASP H  2 36  ? 19.725  37.669  7.246   1.00 48.68  ? 36  ASP H CA  1 
ATOM   8535  C C   . ASP H  2 36  ? 20.414  37.603  8.570   1.00 54.06  ? 36  ASP H C   1 
ATOM   8536  O O   . ASP H  2 36  ? 21.173  38.495  8.934   1.00 56.00  ? 36  ASP H O   1 
ATOM   8537  C CB  . ASP H  2 36  ? 20.710  37.678  6.070   1.00 50.08  ? 36  ASP H CB  1 
ATOM   8538  C CG  . ASP H  2 36  ? 21.247  36.301  5.725   1.00 57.87  ? 36  ASP H CG  1 
ATOM   8539  O OD1 . ASP H  2 36  ? 20.839  35.313  6.390   1.00 59.05  ? 36  ASP H OD1 1 
ATOM   8540  O OD2 . ASP H  2 36  ? 22.032  36.198  4.759   1.00 61.62  ? 36  ASP H OD2 1 
ATOM   8541  N N   . LEU H  2 37  ? 20.054  36.595  9.332   1.00 49.42  ? 37  LEU H N   1 
ATOM   8542  C CA  . LEU H  2 37  ? 20.552  36.389  10.673  1.00 50.09  ? 37  LEU H CA  1 
ATOM   8543  C C   . LEU H  2 37  ? 22.040  36.201  10.691  1.00 55.08  ? 37  LEU H C   1 
ATOM   8544  O O   . LEU H  2 37  ? 22.604  35.487  9.863   1.00 52.57  ? 37  LEU H O   1 
ATOM   8545  C CB  . LEU H  2 37  ? 19.798  35.251  11.381  1.00 49.29  ? 37  LEU H CB  1 
ATOM   8546  C CG  . LEU H  2 37  ? 18.257  35.353  11.398  1.00 53.32  ? 37  LEU H CG  1 
ATOM   8547  C CD1 . LEU H  2 37  ? 17.692  34.482  12.445  1.00 54.59  ? 37  LEU H CD1 1 
ATOM   8548  C CD2 . LEU H  2 37  ? 17.754  36.786  11.673  1.00 57.38  ? 37  LEU H CD2 1 
ATOM   8549  N N   . VAL H  2 38  ? 22.672  36.950  11.577  1.00 55.60  ? 38  VAL H N   1 
ATOM   8550  C CA  . VAL H  2 38  ? 24.109  36.975  11.770  1.00 56.95  ? 38  VAL H CA  1 
ATOM   8551  C C   . VAL H  2 38  ? 24.506  35.784  12.642  1.00 62.48  ? 38  VAL H C   1 
ATOM   8552  O O   . VAL H  2 38  ? 25.510  35.120  12.356  1.00 61.40  ? 38  VAL H O   1 
ATOM   8553  C CB  . VAL H  2 38  ? 24.460  38.336  12.395  1.00 64.46  ? 38  VAL H CB  1 
ATOM   8554  C CG1 . VAL H  2 38  ? 25.763  38.281  13.166  1.00 66.40  ? 38  VAL H CG1 1 
ATOM   8555  C CG2 . VAL H  2 38  ? 24.491  39.429  11.334  1.00 64.70  ? 38  VAL H CG2 1 
ATOM   8556  N N   . TYR H  2 39  ? 23.700  35.515  13.698  1.00 61.34  ? 39  TYR H N   1 
ATOM   8557  C CA  . TYR H  2 39  ? 23.890  34.406  14.628  1.00 61.77  ? 39  TYR H CA  1 
ATOM   8558  C C   . TYR H  2 39  ? 23.039  33.251  14.151  1.00 63.65  ? 39  TYR H C   1 
ATOM   8559  O O   . TYR H  2 39  ? 21.811  33.325  14.189  1.00 61.97  ? 39  TYR H O   1 
ATOM   8560  C CB  . TYR H  2 39  ? 23.521  34.827  16.068  1.00 66.23  ? 39  TYR H CB  1 
ATOM   8561  C CG  . TYR H  2 39  ? 23.832  33.801  17.143  1.00 69.84  ? 39  TYR H CG  1 
ATOM   8562  C CD1 . TYR H  2 39  ? 25.084  33.187  17.213  1.00 71.10  ? 39  TYR H CD1 1 
ATOM   8563  C CD2 . TYR H  2 39  ? 22.891  33.475  18.117  1.00 72.93  ? 39  TYR H CD2 1 
ATOM   8564  C CE1 . TYR H  2 39  ? 25.380  32.260  18.210  1.00 72.73  ? 39  TYR H CE1 1 
ATOM   8565  C CE2 . TYR H  2 39  ? 23.180  32.554  19.125  1.00 75.68  ? 39  TYR H CE2 1 
ATOM   8566  C CZ  . TYR H  2 39  ? 24.427  31.954  19.170  1.00 83.80  ? 39  TYR H CZ  1 
ATOM   8567  O OH  . TYR H  2 39  ? 24.714  31.059  20.169  1.00 90.41  ? 39  TYR H OH  1 
ATOM   8568  N N   . LYS H  2 40  ? 23.697  32.197  13.663  1.00 60.63  ? 40  LYS H N   1 
ATOM   8569  C CA  . LYS H  2 40  ? 23.003  31.026  13.126  1.00 59.79  ? 40  LYS H CA  1 
ATOM   8570  C C   . LYS H  2 40  ? 22.720  29.952  14.210  1.00 64.37  ? 40  LYS H C   1 
ATOM   8571  O O   . LYS H  2 40  ? 23.351  28.885  14.210  1.00 63.74  ? 40  LYS H O   1 
ATOM   8572  C CB  . LYS H  2 40  ? 23.746  30.445  11.886  1.00 61.48  ? 40  LYS H CB  1 
ATOM   8573  C CG  . LYS H  2 40  ? 24.119  31.459  10.770  1.00 72.54  ? 40  LYS H CG  1 
ATOM   8574  C CD  . LYS H  2 40  ? 22.896  32.055  10.051  1.00 79.34  ? 40  LYS H CD  1 
ATOM   8575  C CE  . LYS H  2 40  ? 23.190  32.587  8.669   1.00 75.35  ? 40  LYS H CE  1 
ATOM   8576  N NZ  . LYS H  2 40  ? 22.001  33.287  8.105   1.00 74.66  ? 40  LYS H NZ  1 
ATOM   8577  N N   . ASP H  2 41  ? 21.767  30.255  15.136  1.00 61.80  ? 41  ASP H N   1 
ATOM   8578  C CA  . ASP H  2 41  ? 21.321  29.349  16.214  1.00 63.40  ? 41  ASP H CA  1 
ATOM   8579  C C   . ASP H  2 41  ? 20.248  28.382  15.704  1.00 62.46  ? 41  ASP H C   1 
ATOM   8580  O O   . ASP H  2 41  ? 19.335  28.837  15.034  1.00 58.18  ? 41  ASP H O   1 
ATOM   8581  C CB  . ASP H  2 41  ? 20.747  30.135  17.414  1.00 68.43  ? 41  ASP H CB  1 
ATOM   8582  C CG  . ASP H  2 41  ? 20.584  29.294  18.681  1.00 78.41  ? 41  ASP H CG  1 
ATOM   8583  O OD1 . ASP H  2 41  ? 21.629  28.847  19.248  1.00 79.90  ? 41  ASP H OD1 1 
ATOM   8584  O OD2 . ASP H  2 41  ? 19.427  29.116  19.129  1.00 79.25  ? 41  ASP H OD2 1 
ATOM   8585  N N   . PRO H  2 42  ? 20.281  27.070  16.043  1.00 60.65  ? 42  PRO H N   1 
ATOM   8586  C CA  . PRO H  2 42  ? 19.228  26.150  15.552  1.00 61.40  ? 42  PRO H CA  1 
ATOM   8587  C C   . PRO H  2 42  ? 17.778  26.550  15.908  1.00 69.75  ? 42  PRO H C   1 
ATOM   8588  O O   . PRO H  2 42  ? 16.875  26.368  15.085  1.00 66.95  ? 42  PRO H O   1 
ATOM   8589  C CB  . PRO H  2 42  ? 19.634  24.809  16.161  1.00 65.12  ? 42  PRO H CB  1 
ATOM   8590  C CG  . PRO H  2 42  ? 21.100  24.935  16.380  1.00 68.39  ? 42  PRO H CG  1 
ATOM   8591  C CD  . PRO H  2 42  ? 21.282  26.336  16.836  1.00 63.62  ? 42  PRO H CD  1 
ATOM   8592  N N   . ALA H  2 43  ? 17.584  27.163  17.106  1.00 72.13  ? 43  ALA H N   1 
ATOM   8593  C CA  . ALA H  2 43  ? 16.309  27.661  17.633  1.00 75.12  ? 43  ALA H CA  1 
ATOM   8594  C C   . ALA H  2 43  ? 15.966  29.109  17.178  1.00 82.00  ? 43  ALA H C   1 
ATOM   8595  O O   . ALA H  2 43  ? 14.859  29.584  17.432  1.00 82.94  ? 43  ALA H O   1 
ATOM   8596  C CB  . ALA H  2 43  ? 16.310  27.566  19.151  1.00 80.10  ? 43  ALA H CB  1 
ATOM   8597  N N   . ARG H  2 44  ? 16.901  29.794  16.492  1.00 80.43  ? 44  ARG H N   1 
ATOM   8598  C CA  . ARG H  2 44  ? 16.710  31.157  15.981  1.00 81.49  ? 44  ARG H CA  1 
ATOM   8599  C C   . ARG H  2 44  ? 15.450  31.264  15.095  1.00 87.00  ? 44  ARG H C   1 
ATOM   8600  O O   . ARG H  2 44  ? 15.006  30.241  14.554  1.00 85.74  ? 44  ARG H O   1 
ATOM   8601  C CB  . ARG H  2 44  ? 17.962  31.641  15.207  1.00 82.20  ? 44  ARG H CB  1 
ATOM   8602  C CG  . ARG H  2 44  ? 18.078  31.114  13.764  1.00 96.75  ? 44  ARG H CG  1 
ATOM   8603  C CD  . ARG H  2 44  ? 19.450  31.371  13.154  1.00 118.76 ? 44  ARG H CD  1 
ATOM   8604  N NE  . ARG H  2 44  ? 19.593  30.878  11.779  1.00 132.38 ? 44  ARG H NE  1 
ATOM   8605  C CZ  . ARG H  2 44  ? 19.943  29.638  11.441  1.00 149.47 ? 44  ARG H CZ  1 
ATOM   8606  N NH1 . ARG H  2 44  ? 20.041  29.295  10.163  1.00 137.37 ? 44  ARG H NH1 1 
ATOM   8607  N NH2 . ARG H  2 44  ? 20.184  28.728  12.377  1.00 137.63 ? 44  ARG H NH2 1 
ATOM   8608  N N   . PRO H  2 45  ? 14.876  32.476  14.895  1.00 85.78  ? 45  PRO H N   1 
ATOM   8609  C CA  . PRO H  2 45  ? 13.688  32.569  14.045  1.00 84.76  ? 45  PRO H CA  1 
ATOM   8610  C C   . PRO H  2 45  ? 14.059  32.975  12.610  1.00 85.35  ? 45  PRO H C   1 
ATOM   8611  O O   . PRO H  2 45  ? 14.133  34.176  12.288  1.00 84.69  ? 45  PRO H O   1 
ATOM   8612  C CB  . PRO H  2 45  ? 12.847  33.620  14.769  1.00 89.87  ? 45  PRO H CB  1 
ATOM   8613  C CG  . PRO H  2 45  ? 13.909  34.547  15.453  1.00 96.01  ? 45  PRO H CG  1 
ATOM   8614  C CD  . PRO H  2 45  ? 15.237  33.809  15.432  1.00 89.47  ? 45  PRO H CD  1 
ATOM   8615  N N   . LYS H  2 46  ? 14.351  31.966  11.757  1.00 79.50  ? 46  LYS H N   1 
ATOM   8616  C CA  . LYS H  2 46  ? 14.657  32.205  10.335  1.00 76.49  ? 46  LYS H CA  1 
ATOM   8617  C C   . LYS H  2 46  ? 13.274  32.316  9.662   1.00 79.07  ? 46  LYS H C   1 
ATOM   8618  O O   . LYS H  2 46  ? 12.566  31.303  9.491   1.00 79.68  ? 46  LYS H O   1 
ATOM   8619  C CB  . LYS H  2 46  ? 15.493  31.073  9.681   1.00 77.04  ? 46  LYS H CB  1 
ATOM   8620  C CG  . LYS H  2 46  ? 16.487  30.332  10.581  1.00 90.33  ? 46  LYS H CG  1 
ATOM   8621  C CD  . LYS H  2 46  ? 15.891  29.151  11.401  1.00 98.75  ? 46  LYS H CD  1 
ATOM   8622  C CE  . LYS H  2 46  ? 15.603  27.907  10.599  1.00 94.28  ? 46  LYS H CE  1 
ATOM   8623  N NZ  . LYS H  2 46  ? 14.149  27.747  10.372  1.00 98.47  ? 46  LYS H NZ  1 
ATOM   8624  N N   . ILE H  2 47  ? 12.838  33.558  9.423   1.00 72.38  ? 47  ILE H N   1 
ATOM   8625  C CA  . ILE H  2 47  ? 11.530  33.822  8.828   1.00 70.64  ? 47  ILE H CA  1 
ATOM   8626  C C   . ILE H  2 47  ? 11.681  34.790  7.702   1.00 67.63  ? 47  ILE H C   1 
ATOM   8627  O O   . ILE H  2 47  ? 12.431  35.770  7.825   1.00 69.56  ? 47  ILE H O   1 
ATOM   8628  C CB  . ILE H  2 47  ? 10.437  34.278  9.840   1.00 77.10  ? 47  ILE H CB  1 
ATOM   8629  C CG1 . ILE H  2 47  ? 10.980  35.338  10.859  1.00 80.73  ? 47  ILE H CG1 1 
ATOM   8630  C CG2 . ILE H  2 47  ? 9.798   33.071  10.526  1.00 77.65  ? 47  ILE H CG2 1 
ATOM   8631  C CD1 . ILE H  2 47  ? 9.926   36.379  11.414  1.00 92.10  ? 47  ILE H CD1 1 
ATOM   8632  N N   . GLN H  2 48  ? 10.992  34.515  6.595   1.00 56.03  ? 48  GLN H N   1 
ATOM   8633  C CA  . GLN H  2 48  ? 11.050  35.396  5.440   1.00 52.78  ? 48  GLN H CA  1 
ATOM   8634  C C   . GLN H  2 48  ? 9.672   35.669  4.909   1.00 54.72  ? 48  GLN H C   1 
ATOM   8635  O O   . GLN H  2 48  ? 8.917   34.741  4.635   1.00 54.41  ? 48  GLN H O   1 
ATOM   8636  C CB  . GLN H  2 48  ? 11.969  34.852  4.346   1.00 51.07  ? 48  GLN H CB  1 
ATOM   8637  C CG  . GLN H  2 48  ? 13.435  35.121  4.607   1.00 40.25  ? 48  GLN H CG  1 
ATOM   8638  C CD  . GLN H  2 48  ? 14.339  34.154  3.873   1.00 52.79  ? 48  GLN H CD  1 
ATOM   8639  O OE1 . GLN H  2 48  ? 14.008  32.959  3.706   1.00 39.16  ? 48  GLN H OE1 1 
ATOM   8640  N NE2 . GLN H  2 48  ? 15.540  34.641  3.482   1.00 39.12  ? 48  GLN H NE2 1 
ATOM   8641  N N   . LYS H  2 49  ? 9.316   36.940  4.807   1.00 50.28  ? 49  LYS H N   1 
ATOM   8642  C CA  . LYS H  2 49  ? 8.013   37.259  4.264   1.00 49.75  ? 49  LYS H CA  1 
ATOM   8643  C C   . LYS H  2 49  ? 8.166   37.508  2.764   1.00 51.22  ? 49  LYS H C   1 
ATOM   8644  O O   . LYS H  2 49  ? 9.243   37.888  2.297   1.00 50.50  ? 49  LYS H O   1 
ATOM   8645  C CB  . LYS H  2 49  ? 7.369   38.451  5.010   1.00 54.52  ? 49  LYS H CB  1 
ATOM   8646  C CG  . LYS H  2 49  ? 6.857   38.070  6.395   1.00 57.93  ? 49  LYS H CG  1 
ATOM   8647  C CD  . LYS H  2 49  ? 6.525   39.267  7.265   1.00 69.11  ? 49  LYS H CD  1 
ATOM   8648  C CE  . LYS H  2 49  ? 5.964   38.836  8.605   1.00 77.95  ? 49  LYS H CE  1 
ATOM   8649  N NZ  . LYS H  2 49  ? 5.646   39.998  9.475   1.00 91.47  ? 49  LYS H NZ  1 
ATOM   8650  N N   . THR H  2 50  ? 7.115   37.236  2.010   1.00 46.61  ? 50  THR H N   1 
ATOM   8651  C CA  . THR H  2 50  ? 7.061   37.511  0.579   1.00 45.44  ? 50  THR H CA  1 
ATOM   8652  C C   . THR H  2 50  ? 5.712   38.146  0.305   1.00 48.56  ? 50  THR H C   1 
ATOM   8653  O O   . THR H  2 50  ? 4.769   37.900  1.066   1.00 44.59  ? 50  THR H O   1 
ATOM   8654  C CB  . THR H  2 50  ? 7.409   36.277  -0.310  1.00 54.03  ? 50  THR H CB  1 
ATOM   8655  O OG1 . THR H  2 50  ? 6.898   36.471  -1.640  1.00 60.03  ? 50  THR H OG1 1 
ATOM   8656  C CG2 . THR H  2 50  ? 6.859   34.965  0.225   1.00 49.66  ? 50  THR H CG2 1 
ATOM   8657  N N   . CYS H  2 51  ? 5.637   38.989  -0.749  1.00 49.76  ? 51  CYS H N   1 
ATOM   8658  C CA  . CYS H  2 51  ? 4.383   39.610  -1.167  1.00 53.70  ? 51  CYS H CA  1 
ATOM   8659  C C   . CYS H  2 51  ? 3.516   38.580  -1.901  1.00 57.28  ? 51  CYS H C   1 
ATOM   8660  O O   . CYS H  2 51  ? 3.898   38.109  -2.972  1.00 57.26  ? 51  CYS H O   1 
ATOM   8661  C CB  . CYS H  2 51  ? 4.615   40.853  -2.017  1.00 57.33  ? 51  CYS H CB  1 
ATOM   8662  S SG  . CYS H  2 51  ? 3.081   41.686  -2.509  1.00 65.12  ? 51  CYS H SG  1 
ATOM   8663  N N   . THR H  2 52  ? 2.383   38.190  -1.291  1.00 53.01  ? 52  THR H N   1 
ATOM   8664  C CA  . THR H  2 52  ? 1.449   37.191  -1.831  1.00 50.62  ? 52  THR H CA  1 
ATOM   8665  C C   . THR H  2 52  ? 0.023   37.455  -1.385  1.00 53.97  ? 52  THR H C   1 
ATOM   8666  O O   . THR H  2 52  ? -0.217  38.286  -0.505  1.00 54.58  ? 52  THR H O   1 
ATOM   8667  C CB  . THR H  2 52  ? 1.892   35.747  -1.484  1.00 55.54  ? 52  THR H CB  1 
ATOM   8668  O OG1 . THR H  2 52  ? 1.146   34.836  -2.294  1.00 55.95  ? 52  THR H OG1 1 
ATOM   8669  C CG2 . THR H  2 52  ? 1.675   35.386  -0.003  1.00 53.78  ? 52  THR H CG2 1 
ATOM   8670  N N   . PHE H  2 53  ? -0.912  36.699  -1.967  1.00 50.54  ? 53  PHE H N   1 
ATOM   8671  C CA  . PHE H  2 53  ? -2.337  36.773  -1.663  1.00 52.78  ? 53  PHE H CA  1 
ATOM   8672  C C   . PHE H  2 53  ? -2.654  36.450  -0.200  1.00 56.79  ? 53  PHE H C   1 
ATOM   8673  O O   . PHE H  2 53  ? -2.120  35.481  0.352   1.00 54.39  ? 53  PHE H O   1 
ATOM   8674  C CB  . PHE H  2 53  ? -3.168  35.899  -2.640  1.00 54.01  ? 53  PHE H CB  1 
ATOM   8675  C CG  . PHE H  2 53  ? -3.228  34.413  -2.352  1.00 54.83  ? 53  PHE H CG  1 
ATOM   8676  C CD1 . PHE H  2 53  ? -2.256  33.549  -2.849  1.00 56.27  ? 53  PHE H CD1 1 
ATOM   8677  C CD2 . PHE H  2 53  ? -4.279  33.871  -1.615  1.00 58.24  ? 53  PHE H CD2 1 
ATOM   8678  C CE1 . PHE H  2 53  ? -2.327  32.168  -2.598  1.00 56.59  ? 53  PHE H CE1 1 
ATOM   8679  C CE2 . PHE H  2 53  ? -4.325  32.500  -1.334  1.00 60.47  ? 53  PHE H CE2 1 
ATOM   8680  C CZ  . PHE H  2 53  ? -3.358  31.657  -1.841  1.00 56.50  ? 53  PHE H CZ  1 
ATOM   8681  N N   . LYS H  2 54  ? -3.493  37.290  0.428   1.00 55.75  ? 54  LYS H N   1 
ATOM   8682  C CA  . LYS H  2 54  ? -3.955  37.042  1.779   1.00 57.25  ? 54  LYS H CA  1 
ATOM   8683  C C   . LYS H  2 54  ? -5.283  36.306  1.622   1.00 62.68  ? 54  LYS H C   1 
ATOM   8684  O O   . LYS H  2 54  ? -5.467  35.259  2.246   1.00 63.07  ? 54  LYS H O   1 
ATOM   8685  C CB  . LYS H  2 54  ? -4.086  38.323  2.610   1.00 62.10  ? 54  LYS H CB  1 
ATOM   8686  C CG  . LYS H  2 54  ? -4.464  38.008  4.049   1.00 76.08  ? 54  LYS H CG  1 
ATOM   8687  C CD  . LYS H  2 54  ? -4.537  39.221  4.947   1.00 89.12  ? 54  LYS H CD  1 
ATOM   8688  C CE  . LYS H  2 54  ? -4.907  38.810  6.357   1.00 105.67 ? 54  LYS H CE  1 
ATOM   8689  N NZ  . LYS H  2 54  ? -3.856  37.967  7.004   1.00 112.27 ? 54  LYS H NZ  1 
ATOM   8690  N N   . GLU H  2 55  ? -6.183  36.831  0.752   1.00 59.55  ? 55  GLU H N   1 
ATOM   8691  C CA  . GLU H  2 55  ? -7.490  36.234  0.429   1.00 60.41  ? 55  GLU H CA  1 
ATOM   8692  C C   . GLU H  2 55  ? -7.637  36.206  -1.083  1.00 60.49  ? 55  GLU H C   1 
ATOM   8693  O O   . GLU H  2 55  ? -7.058  37.042  -1.787  1.00 57.85  ? 55  GLU H O   1 
ATOM   8694  C CB  . GLU H  2 55  ? -8.683  37.024  1.023   1.00 66.48  ? 55  GLU H CB  1 
ATOM   8695  C CG  . GLU H  2 55  ? -8.606  37.390  2.498   1.00 82.95  ? 55  GLU H CG  1 
ATOM   8696  C CD  . GLU H  2 55  ? -8.839  36.294  3.519   1.00 108.21 ? 55  GLU H CD  1 
ATOM   8697  O OE1 . GLU H  2 55  ? -9.976  35.773  3.588   1.00 113.45 ? 55  GLU H OE1 1 
ATOM   8698  O OE2 . GLU H  2 55  ? -7.910  36.033  4.319   1.00 96.79  ? 55  GLU H OE2 1 
ATOM   8699  N N   . LEU H  2 56  ? -8.408  35.240  -1.581  1.00 57.00  ? 56  LEU H N   1 
ATOM   8700  C CA  . LEU H  2 56  ? -8.647  35.118  -3.008  1.00 56.02  ? 56  LEU H CA  1 
ATOM   8701  C C   . LEU H  2 56  ? -10.034 34.581  -3.333  1.00 62.21  ? 56  LEU H C   1 
ATOM   8702  O O   . LEU H  2 56  ? -10.693 33.969  -2.489  1.00 64.53  ? 56  LEU H O   1 
ATOM   8703  C CB  . LEU H  2 56  ? -7.527  34.308  -3.745  1.00 53.19  ? 56  LEU H CB  1 
ATOM   8704  C CG  . LEU H  2 56  ? -7.386  32.755  -3.605  1.00 56.71  ? 56  LEU H CG  1 
ATOM   8705  C CD1 . LEU H  2 56  ? -8.536  31.976  -4.291  1.00 57.36  ? 56  LEU H CD1 1 
ATOM   8706  C CD2 . LEU H  2 56  ? -6.143  32.297  -4.318  1.00 56.59  ? 56  LEU H CD2 1 
ATOM   8707  N N   . VAL H  2 57  ? -10.458 34.799  -4.575  1.00 59.05  ? 57  VAL H N   1 
ATOM   8708  C CA  . VAL H  2 57  ? -11.709 34.290  -5.131  1.00 60.81  ? 57  VAL H CA  1 
ATOM   8709  C C   . VAL H  2 57  ? -11.395 33.567  -6.444  1.00 64.49  ? 57  VAL H C   1 
ATOM   8710  O O   . VAL H  2 57  ? -10.361 33.826  -7.058  1.00 61.64  ? 57  VAL H O   1 
ATOM   8711  C CB  . VAL H  2 57  ? -12.792 35.386  -5.330  1.00 66.70  ? 57  VAL H CB  1 
ATOM   8712  C CG1 . VAL H  2 57  ? -13.302 35.920  -3.992  1.00 69.60  ? 57  VAL H CG1 1 
ATOM   8713  C CG2 . VAL H  2 57  ? -12.292 36.516  -6.228  1.00 65.73  ? 57  VAL H CG2 1 
ATOM   8714  N N   . TYR H  2 58  ? -12.266 32.649  -6.859  1.00 63.16  ? 58  TYR H N   1 
ATOM   8715  C CA  . TYR H  2 58  ? -12.103 31.997  -8.149  1.00 62.04  ? 58  TYR H CA  1 
ATOM   8716  C C   . TYR H  2 58  ? -13.090 32.686  -9.073  1.00 67.92  ? 58  TYR H C   1 
ATOM   8717  O O   . TYR H  2 58  ? -14.109 33.191  -8.606  1.00 69.14  ? 58  TYR H O   1 
ATOM   8718  C CB  . TYR H  2 58  ? -12.283 30.462  -8.091  1.00 63.39  ? 58  TYR H CB  1 
ATOM   8719  C CG  . TYR H  2 58  ? -10.991 29.714  -7.813  1.00 63.38  ? 58  TYR H CG  1 
ATOM   8720  C CD1 . TYR H  2 58  ? -10.024 29.545  -8.809  1.00 63.16  ? 58  TYR H CD1 1 
ATOM   8721  C CD2 . TYR H  2 58  ? -10.737 29.165  -6.561  1.00 64.77  ? 58  TYR H CD2 1 
ATOM   8722  C CE1 . TYR H  2 58  ? -8.827  28.869  -8.553  1.00 59.93  ? 58  TYR H CE1 1 
ATOM   8723  C CE2 . TYR H  2 58  ? -9.543  28.495  -6.292  1.00 64.04  ? 58  TYR H CE2 1 
ATOM   8724  C CZ  . TYR H  2 58  ? -8.589  28.356  -7.287  1.00 66.48  ? 58  TYR H CZ  1 
ATOM   8725  O OH  . TYR H  2 58  ? -7.430  27.681  -6.992  1.00 63.75  ? 58  TYR H OH  1 
ATOM   8726  N N   . GLU H  2 59  ? -12.739 32.821  -10.343 1.00 65.46  ? 59  GLU H N   1 
ATOM   8727  C CA  . GLU H  2 59  ? -13.587 33.500  -11.309 1.00 67.80  ? 59  GLU H CA  1 
ATOM   8728  C C   . GLU H  2 59  ? -13.641 32.686  -12.584 1.00 73.34  ? 59  GLU H C   1 
ATOM   8729  O O   . GLU H  2 59  ? -12.619 32.155  -13.015 1.00 71.37  ? 59  GLU H O   1 
ATOM   8730  C CB  . GLU H  2 59  ? -13.080 34.930  -11.561 1.00 69.34  ? 59  GLU H CB  1 
ATOM   8731  C CG  . GLU H  2 59  ? -13.995 35.995  -10.981 1.00 82.70  ? 59  GLU H CG  1 
ATOM   8732  C CD  . GLU H  2 59  ? -13.398 37.382  -10.835 1.00 108.41 ? 59  GLU H CD  1 
ATOM   8733  O OE1 . GLU H  2 59  ? -12.771 37.872  -11.804 1.00 112.82 ? 59  GLU H OE1 1 
ATOM   8734  O OE2 . GLU H  2 59  ? -13.596 37.998  -9.762  1.00 101.44 ? 59  GLU H OE2 1 
ATOM   8735  N N   . THR H  2 60  ? -14.835 32.551  -13.164 1.00 72.95  ? 60  THR H N   1 
ATOM   8736  C CA  . THR H  2 60  ? -15.003 31.771  -14.380 1.00 73.50  ? 60  THR H CA  1 
ATOM   8737  C C   . THR H  2 60  ? -15.155 32.692  -15.568 1.00 79.36  ? 60  THR H C   1 
ATOM   8738  O O   . THR H  2 60  ? -15.799 33.737  -15.476 1.00 80.31  ? 60  THR H O   1 
ATOM   8739  C CB  . THR H  2 60  ? -16.116 30.741  -14.211 1.00 81.34  ? 60  THR H CB  1 
ATOM   8740  O OG1 . THR H  2 60  ? -15.840 30.003  -13.020 1.00 82.62  ? 60  THR H OG1 1 
ATOM   8741  C CG2 . THR H  2 60  ? -16.201 29.769  -15.377 1.00 78.40  ? 60  THR H CG2 1 
ATOM   8742  N N   . VAL H  2 61  ? -14.504 32.309  -16.668 1.00 76.45  ? 61  VAL H N   1 
ATOM   8743  C CA  . VAL H  2 61  ? -14.475 33.013  -17.943 1.00 77.77  ? 61  VAL H CA  1 
ATOM   8744  C C   . VAL H  2 61  ? -14.749 31.986  -19.061 1.00 83.27  ? 61  VAL H C   1 
ATOM   8745  O O   . VAL H  2 61  ? -14.325 30.828  -18.957 1.00 82.20  ? 61  VAL H O   1 
ATOM   8746  C CB  . VAL H  2 61  ? -13.120 33.785  -18.089 1.00 80.89  ? 61  VAL H CB  1 
ATOM   8747  C CG1 . VAL H  2 61  ? -12.639 33.886  -19.540 1.00 82.28  ? 61  VAL H CG1 1 
ATOM   8748  C CG2 . VAL H  2 61  ? -13.197 35.169  -17.442 1.00 80.97  ? 61  VAL H CG2 1 
ATOM   8749  N N   . ARG H  2 62  ? -15.502 32.410  -20.096 1.00 82.65  ? 62  ARG H N   1 
ATOM   8750  C CA  . ARG H  2 62  ? -15.835 31.597  -21.260 1.00 84.74  ? 62  ARG H CA  1 
ATOM   8751  C C   . ARG H  2 62  ? -14.722 31.770  -22.284 1.00 89.85  ? 62  ARG H C   1 
ATOM   8752  O O   . ARG H  2 62  ? -14.542 32.861  -22.830 1.00 91.15  ? 62  ARG H O   1 
ATOM   8753  C CB  . ARG H  2 62  ? -17.204 32.011  -21.836 1.00 89.26  ? 62  ARG H CB  1 
ATOM   8754  C CG  . ARG H  2 62  ? -17.858 30.980  -22.764 1.00 105.41 ? 62  ARG H CG  1 
ATOM   8755  C CD  . ARG H  2 62  ? -18.482 29.790  -22.043 1.00 117.10 ? 62  ARG H CD  1 
ATOM   8756  N NE  . ARG H  2 62  ? -19.717 29.390  -22.709 1.00 132.94 ? 62  ARG H NE  1 
ATOM   8757  C CZ  . ARG H  2 62  ? -20.933 29.587  -22.214 1.00 152.82 ? 62  ARG H CZ  1 
ATOM   8758  N NH1 . ARG H  2 62  ? -21.090 30.109  -21.002 1.00 139.53 ? 62  ARG H NH1 1 
ATOM   8759  N NH2 . ARG H  2 62  ? -22.005 29.232  -22.913 1.00 142.95 ? 62  ARG H NH2 1 
ATOM   8760  N N   . VAL H  2 63  ? -13.930 30.711  -22.482 1.00 85.89  ? 63  VAL H N   1 
ATOM   8761  C CA  . VAL H  2 63  ? -12.809 30.696  -23.420 1.00 86.39  ? 63  VAL H CA  1 
ATOM   8762  C C   . VAL H  2 63  ? -13.377 30.384  -24.802 1.00 94.50  ? 63  VAL H C   1 
ATOM   8763  O O   . VAL H  2 63  ? -14.091 29.385  -24.947 1.00 96.21  ? 63  VAL H O   1 
ATOM   8764  C CB  . VAL H  2 63  ? -11.731 29.676  -23.011 1.00 88.78  ? 63  VAL H CB  1 
ATOM   8765  C CG1 . VAL H  2 63  ? -10.394 30.007  -23.655 1.00 89.11  ? 63  VAL H CG1 1 
ATOM   8766  C CG2 . VAL H  2 63  ? -11.594 29.614  -21.500 1.00 85.79  ? 63  VAL H CG2 1 
ATOM   8767  N N   . PRO H  2 64  ? -13.125 31.238  -25.820 1.00 92.46  ? 64  PRO H N   1 
ATOM   8768  C CA  . PRO H  2 64  ? -13.713 30.983  -27.149 1.00 95.80  ? 64  PRO H CA  1 
ATOM   8769  C C   . PRO H  2 64  ? -13.118 29.783  -27.882 1.00 102.33 ? 64  PRO H C   1 
ATOM   8770  O O   . PRO H  2 64  ? -11.926 29.515  -27.750 1.00 101.80 ? 64  PRO H O   1 
ATOM   8771  C CB  . PRO H  2 64  ? -13.471 32.294  -27.911 1.00 99.34  ? 64  PRO H CB  1 
ATOM   8772  C CG  . PRO H  2 64  ? -12.955 33.280  -26.894 1.00 100.88 ? 64  PRO H CG  1 
ATOM   8773  C CD  . PRO H  2 64  ? -12.330 32.482  -25.813 1.00 93.29  ? 64  PRO H CD  1 
ATOM   8774  N N   . GLY H  2 65  ? -13.958 29.088  -28.647 1.00 102.03 ? 65  GLY H N   1 
ATOM   8775  C CA  . GLY H  2 65  ? -13.571 27.933  -29.451 1.00 105.25 ? 65  GLY H CA  1 
ATOM   8776  C C   . GLY H  2 65  ? -13.048 28.311  -30.826 1.00 114.51 ? 65  GLY H C   1 
ATOM   8777  O O   . GLY H  2 65  ? -12.724 29.477  -31.075 1.00 114.50 ? 65  GLY H O   1 
ATOM   8778  N N   . CYS H  2 66  ? -12.945 27.320  -31.729 1.00 115.52 ? 66  CYS H N   1 
ATOM   8779  C CA  . CYS H  2 66  ? -12.457 27.509  -33.100 1.00 120.44 ? 66  CYS H CA  1 
ATOM   8780  C C   . CYS H  2 66  ? -13.036 26.459  -34.058 1.00 129.66 ? 66  CYS H C   1 
ATOM   8781  O O   . CYS H  2 66  ? -13.805 25.597  -33.625 1.00 128.80 ? 66  CYS H O   1 
ATOM   8782  C CB  . CYS H  2 66  ? -10.930 27.534  -33.142 1.00 121.11 ? 66  CYS H CB  1 
ATOM   8783  S SG  . CYS H  2 66  ? -10.145 26.025  -32.523 1.00 124.66 ? 66  CYS H SG  1 
ATOM   8784  N N   . ALA H  2 67  ? -12.672 26.557  -35.358 1.00 131.53 ? 67  ALA H N   1 
ATOM   8785  C CA  . ALA H  2 67  ? -13.067 25.719  -36.498 1.00 137.17 ? 67  ALA H CA  1 
ATOM   8786  C C   . ALA H  2 67  ? -13.914 24.454  -36.167 1.00 141.41 ? 67  ALA H C   1 
ATOM   8787  O O   . ALA H  2 67  ? -15.121 24.461  -36.431 1.00 142.21 ? 67  ALA H O   1 
ATOM   8788  C CB  . ALA H  2 67  ? -11.837 25.332  -37.303 1.00 142.49 ? 67  ALA H CB  1 
ATOM   8789  N N   . HIS H  2 68  ? -13.294 23.388  -35.603 1.00 137.17 ? 68  HIS H N   1 
ATOM   8790  C CA  . HIS H  2 68  ? -13.990 22.140  -35.265 1.00 137.32 ? 68  HIS H CA  1 
ATOM   8791  C C   . HIS H  2 68  ? -13.804 21.755  -33.786 1.00 135.94 ? 68  HIS H C   1 
ATOM   8792  O O   . HIS H  2 68  ? -13.624 20.579  -33.450 1.00 136.65 ? 68  HIS H O   1 
ATOM   8793  C CB  . HIS H  2 68  ? -13.594 21.006  -36.230 1.00 144.38 ? 68  HIS H CB  1 
ATOM   8794  C CG  . HIS H  2 68  ? -13.929 21.279  -37.668 1.00 153.53 ? 68  HIS H CG  1 
ATOM   8795  N ND1 . HIS H  2 68  ? -15.152 20.910  -38.210 1.00 158.59 ? 68  HIS H ND1 1 
ATOM   8796  C CD2 . HIS H  2 68  ? -13.183 21.863  -38.635 1.00 158.64 ? 68  HIS H CD2 1 
ATOM   8797  C CE1 . HIS H  2 68  ? -15.111 21.283  -39.481 1.00 162.78 ? 68  HIS H CE1 1 
ATOM   8798  N NE2 . HIS H  2 68  ? -13.946 21.861  -39.783 1.00 163.54 ? 68  HIS H NE2 1 
ATOM   8799  N N   . HIS H  2 69  ? -13.875 22.776  -32.904 1.00 127.22 ? 69  HIS H N   1 
ATOM   8800  C CA  . HIS H  2 69  ? -13.749 22.664  -31.450 1.00 122.16 ? 69  HIS H CA  1 
ATOM   8801  C C   . HIS H  2 69  ? -14.655 23.626  -30.702 1.00 121.10 ? 69  HIS H C   1 
ATOM   8802  O O   . HIS H  2 69  ? -14.567 24.845  -30.879 1.00 119.41 ? 69  HIS H O   1 
ATOM   8803  C CB  . HIS H  2 69  ? -12.305 22.857  -30.996 1.00 121.15 ? 69  HIS H CB  1 
ATOM   8804  C CG  . HIS H  2 69  ? -11.495 21.621  -31.121 1.00 127.81 ? 69  HIS H CG  1 
ATOM   8805  N ND1 . HIS H  2 69  ? -10.499 21.511  -32.066 1.00 133.78 ? 69  HIS H ND1 1 
ATOM   8806  C CD2 . HIS H  2 69  ? -11.584 20.461  -30.433 1.00 130.01 ? 69  HIS H CD2 1 
ATOM   8807  C CE1 . HIS H  2 69  ? -9.995  20.299  -31.912 1.00 135.67 ? 69  HIS H CE1 1 
ATOM   8808  N NE2 . HIS H  2 69  ? -10.616 19.631  -30.939 1.00 133.86 ? 69  HIS H NE2 1 
ATOM   8809  N N   . ALA H  2 70  ? -15.503 23.062  -29.832 1.00 115.18 ? 70  ALA H N   1 
ATOM   8810  C CA  . ALA H  2 70  ? -16.455 23.789  -29.001 1.00 111.03 ? 70  ALA H CA  1 
ATOM   8811  C C   . ALA H  2 70  ? -15.743 24.667  -27.978 1.00 108.81 ? 70  ALA H C   1 
ATOM   8812  O O   . ALA H  2 70  ? -14.567 24.438  -27.664 1.00 106.77 ? 70  ALA H O   1 
ATOM   8813  C CB  . ALA H  2 70  ? -17.376 22.804  -28.294 1.00 112.15 ? 70  ALA H CB  1 
ATOM   8814  N N   . ASP H  2 71  ? -16.460 25.687  -27.480 1.00 102.71 ? 71  ASP H N   1 
ATOM   8815  C CA  . ASP H  2 71  ? -15.970 26.595  -26.452 1.00 98.49  ? 71  ASP H CA  1 
ATOM   8816  C C   . ASP H  2 71  ? -15.913 25.854  -25.120 1.00 99.38  ? 71  ASP H C   1 
ATOM   8817  O O   . ASP H  2 71  ? -16.687 24.915  -24.893 1.00 99.58  ? 71  ASP H O   1 
ATOM   8818  C CB  . ASP H  2 71  ? -16.841 27.870  -26.353 1.00 99.90  ? 71  ASP H CB  1 
ATOM   8819  C CG  . ASP H  2 71  ? -18.321 27.650  -26.059 1.00 113.41 ? 71  ASP H CG  1 
ATOM   8820  O OD1 . ASP H  2 71  ? -19.107 27.515  -27.025 1.00 117.10 ? 71  ASP H OD1 1 
ATOM   8821  O OD2 . ASP H  2 71  ? -18.704 27.697  -24.868 1.00 118.29 ? 71  ASP H OD2 1 
ATOM   8822  N N   . SER H  2 72  ? -14.956 26.235  -24.270 1.00 93.05  ? 72  SER H N   1 
ATOM   8823  C CA  . SER H  2 72  ? -14.783 25.639  -22.949 1.00 90.71  ? 72  SER H CA  1 
ATOM   8824  C C   . SER H  2 72  ? -14.915 26.726  -21.879 1.00 91.85  ? 72  SER H C   1 
ATOM   8825  O O   . SER H  2 72  ? -15.201 27.885  -22.198 1.00 91.40  ? 72  SER H O   1 
ATOM   8826  C CB  . SER H  2 72  ? -13.435 24.927  -22.854 1.00 93.51  ? 72  SER H CB  1 
ATOM   8827  O OG  . SER H  2 72  ? -12.354 25.818  -23.067 1.00 100.18 ? 72  SER H OG  1 
ATOM   8828  N N   . LEU H  2 73  ? -14.755 26.343  -20.612 1.00 86.44  ? 73  LEU H N   1 
ATOM   8829  C CA  . LEU H  2 73  ? -14.801 27.263  -19.484 1.00 83.53  ? 73  LEU H CA  1 
ATOM   8830  C C   . LEU H  2 73  ? -13.487 27.142  -18.733 1.00 84.72  ? 73  LEU H C   1 
ATOM   8831  O O   . LEU H  2 73  ? -12.932 26.041  -18.632 1.00 84.68  ? 73  LEU H O   1 
ATOM   8832  C CB  . LEU H  2 73  ? -15.969 26.918  -18.543 1.00 84.13  ? 73  LEU H CB  1 
ATOM   8833  C CG  . LEU H  2 73  ? -17.370 27.216  -19.064 1.00 91.20  ? 73  LEU H CG  1 
ATOM   8834  C CD1 . LEU H  2 73  ? -18.301 26.085  -18.773 1.00 93.56  ? 73  LEU H CD1 1 
ATOM   8835  C CD2 . LEU H  2 73  ? -17.928 28.490  -18.469 1.00 93.36  ? 73  LEU H CD2 1 
ATOM   8836  N N   . TYR H  2 74  ? -12.986 28.260  -18.210 1.00 79.01  ? 74  TYR H N   1 
ATOM   8837  C CA  . TYR H  2 74  ? -11.775 28.232  -17.399 1.00 76.90  ? 74  TYR H CA  1 
ATOM   8838  C C   . TYR H  2 74  ? -11.937 29.098  -16.167 1.00 76.99  ? 74  TYR H C   1 
ATOM   8839  O O   . TYR H  2 74  ? -12.252 30.287  -16.279 1.00 76.10  ? 74  TYR H O   1 
ATOM   8840  C CB  . TYR H  2 74  ? -10.505 28.563  -18.209 1.00 78.84  ? 74  TYR H CB  1 
ATOM   8841  C CG  . TYR H  2 74  ? -9.205  28.476  -17.434 1.00 80.43  ? 74  TYR H CG  1 
ATOM   8842  C CD1 . TYR H  2 74  ? -8.823  27.297  -16.795 1.00 83.32  ? 74  TYR H CD1 1 
ATOM   8843  C CD2 . TYR H  2 74  ? -8.342  29.563  -17.361 1.00 79.82  ? 74  TYR H CD2 1 
ATOM   8844  C CE1 . TYR H  2 74  ? -7.630  27.219  -16.070 1.00 83.50  ? 74  TYR H CE1 1 
ATOM   8845  C CE2 . TYR H  2 74  ? -7.132  29.485  -16.674 1.00 79.13  ? 74  TYR H CE2 1 
ATOM   8846  C CZ  . TYR H  2 74  ? -6.776  28.310  -16.034 1.00 87.75  ? 74  TYR H CZ  1 
ATOM   8847  O OH  . TYR H  2 74  ? -5.576  28.246  -15.366 1.00 89.22  ? 74  TYR H OH  1 
ATOM   8848  N N   . THR H  2 75  ? -11.790 28.472  -14.985 1.00 71.30  ? 75  THR H N   1 
ATOM   8849  C CA  . THR H  2 75  ? -11.896 29.155  -13.699 1.00 69.52  ? 75  THR H CA  1 
ATOM   8850  C C   . THR H  2 75  ? -10.505 29.459  -13.205 1.00 67.68  ? 75  THR H C   1 
ATOM   8851  O O   . THR H  2 75  ? -9.657  28.574  -13.223 1.00 68.31  ? 75  THR H O   1 
ATOM   8852  C CB  . THR H  2 75  ? -12.751 28.356  -12.710 1.00 82.78  ? 75  THR H CB  1 
ATOM   8853  O OG1 . THR H  2 75  ? -14.007 28.063  -13.325 1.00 89.57  ? 75  THR H OG1 1 
ATOM   8854  C CG2 . THR H  2 75  ? -13.006 29.111  -11.418 1.00 80.16  ? 75  THR H CG2 1 
ATOM   8855  N N   . TYR H  2 76  ? -10.256 30.703  -12.795 1.00 59.78  ? 76  TYR H N   1 
ATOM   8856  C CA  . TYR H  2 76  ? -8.931  31.120  -12.335 1.00 56.69  ? 76  TYR H CA  1 
ATOM   8857  C C   . TYR H  2 76  ? -8.974  31.856  -10.984 1.00 58.51  ? 76  TYR H C   1 
ATOM   8858  O O   . TYR H  2 76  ? -10.003 32.459  -10.665 1.00 58.35  ? 76  TYR H O   1 
ATOM   8859  C CB  . TYR H  2 76  ? -8.226  31.969  -13.419 1.00 56.88  ? 76  TYR H CB  1 
ATOM   8860  C CG  . TYR H  2 76  ? -8.919  33.279  -13.718 1.00 58.43  ? 76  TYR H CG  1 
ATOM   8861  C CD1 . TYR H  2 76  ? -8.587  34.442  -13.024 1.00 59.96  ? 76  TYR H CD1 1 
ATOM   8862  C CD2 . TYR H  2 76  ? -9.915  33.359  -14.686 1.00 60.22  ? 76  TYR H CD2 1 
ATOM   8863  C CE1 . TYR H  2 76  ? -9.227  35.650  -13.290 1.00 61.91  ? 76  TYR H CE1 1 
ATOM   8864  C CE2 . TYR H  2 76  ? -10.583 34.555  -14.939 1.00 62.52  ? 76  TYR H CE2 1 
ATOM   8865  C CZ  . TYR H  2 76  ? -10.243 35.696  -14.229 1.00 71.45  ? 76  TYR H CZ  1 
ATOM   8866  O OH  . TYR H  2 76  ? -10.893 36.881  -14.469 1.00 77.71  ? 76  TYR H OH  1 
ATOM   8867  N N   . PRO H  2 77  ? -7.884  31.837  -10.176 1.00 53.04  ? 77  PRO H N   1 
ATOM   8868  C CA  . PRO H  2 77  ? -7.922  32.566  -8.901  1.00 53.12  ? 77  PRO H CA  1 
ATOM   8869  C C   . PRO H  2 77  ? -7.667  34.058  -9.092  1.00 59.65  ? 77  PRO H C   1 
ATOM   8870  O O   . PRO H  2 77  ? -6.950  34.453  -10.021 1.00 60.18  ? 77  PRO H O   1 
ATOM   8871  C CB  . PRO H  2 77  ? -6.827  31.892  -8.071  1.00 52.56  ? 77  PRO H CB  1 
ATOM   8872  C CG  . PRO H  2 77  ? -5.888  31.337  -9.051  1.00 55.29  ? 77  PRO H CG  1 
ATOM   8873  C CD  . PRO H  2 77  ? -6.576  31.180  -10.376 1.00 52.35  ? 77  PRO H CD  1 
ATOM   8874  N N   . VAL H  2 78  ? -8.270  34.882  -8.222  1.00 56.70  ? 78  VAL H N   1 
ATOM   8875  C CA  . VAL H  2 78  ? -8.162  36.346  -8.218  1.00 57.37  ? 78  VAL H CA  1 
ATOM   8876  C C   . VAL H  2 78  ? -7.865  36.756  -6.783  1.00 62.08  ? 78  VAL H C   1 
ATOM   8877  O O   . VAL H  2 78  ? -8.559  36.297  -5.887  1.00 62.05  ? 78  VAL H O   1 
ATOM   8878  C CB  . VAL H  2 78  ? -9.456  37.050  -8.718  1.00 62.61  ? 78  VAL H CB  1 
ATOM   8879  C CG1 . VAL H  2 78  ? -9.289  38.561  -8.744  1.00 63.76  ? 78  VAL H CG1 1 
ATOM   8880  C CG2 . VAL H  2 78  ? -9.883  36.546  -10.081 1.00 62.19  ? 78  VAL H CG2 1 
ATOM   8881  N N   . ALA H  2 79  ? -6.862  37.632  -6.567  1.00 58.63  ? 79  ALA H N   1 
ATOM   8882  C CA  . ALA H  2 79  ? -6.529  38.107  -5.226  1.00 58.78  ? 79  ALA H CA  1 
ATOM   8883  C C   . ALA H  2 79  ? -7.557  39.137  -4.807  1.00 64.90  ? 79  ALA H C   1 
ATOM   8884  O O   . ALA H  2 79  ? -8.157  39.801  -5.652  1.00 65.96  ? 79  ALA H O   1 
ATOM   8885  C CB  . ALA H  2 79  ? -5.125  38.693  -5.194  1.00 58.62  ? 79  ALA H CB  1 
ATOM   8886  N N   . THR H  2 80  ? -7.799  39.213  -3.506  1.00 62.53  ? 80  THR H N   1 
ATOM   8887  C CA  . THR H  2 80  ? -8.796  40.065  -2.868  1.00 65.76  ? 80  THR H CA  1 
ATOM   8888  C C   . THR H  2 80  ? -8.089  40.929  -1.833  1.00 72.16  ? 80  THR H C   1 
ATOM   8889  O O   . THR H  2 80  ? -8.535  42.030  -1.500  1.00 75.21  ? 80  THR H O   1 
ATOM   8890  C CB  . THR H  2 80  ? -9.891  39.117  -2.339  1.00 69.73  ? 80  THR H CB  1 
ATOM   8891  O OG1 . THR H  2 80  ? -10.857 38.965  -3.371  1.00 67.39  ? 80  THR H OG1 1 
ATOM   8892  C CG2 . THR H  2 80  ? -10.548 39.560  -1.026  1.00 72.16  ? 80  THR H CG2 1 
ATOM   8893  N N   . GLN H  2 81  ? -6.963  40.409  -1.351  1.00 67.43  ? 81  GLN H N   1 
ATOM   8894  C CA  . GLN H  2 81  ? -6.097  40.992  -0.349  1.00 68.89  ? 81  GLN H CA  1 
ATOM   8895  C C   . GLN H  2 81  ? -4.686  40.504  -0.619  1.00 69.47  ? 81  GLN H C   1 
ATOM   8896  O O   . GLN H  2 81  ? -4.489  39.377  -1.067  1.00 64.19  ? 81  GLN H O   1 
ATOM   8897  C CB  . GLN H  2 81  ? -6.524  40.509  1.047   1.00 72.57  ? 81  GLN H CB  1 
ATOM   8898  C CG  . GLN H  2 81  ? -7.649  41.281  1.719   1.00 89.26  ? 81  GLN H CG  1 
ATOM   8899  C CD  . GLN H  2 81  ? -7.458  41.244  3.217   1.00 110.84 ? 81  GLN H CD  1 
ATOM   8900  O OE1 . GLN H  2 81  ? -7.869  40.302  3.904   1.00 102.96 ? 81  GLN H OE1 1 
ATOM   8901  N NE2 . GLN H  2 81  ? -6.769  42.244  3.752   1.00 110.92 ? 81  GLN H NE2 1 
ATOM   8902  N N   . CYS H  2 82  ? -3.712  41.352  -0.324  1.00 70.03  ? 82  CYS H N   1 
ATOM   8903  C CA  . CYS H  2 82  ? -2.292  41.074  -0.475  1.00 68.71  ? 82  CYS H CA  1 
ATOM   8904  C C   . CYS H  2 82  ? -1.616  41.373  0.833   1.00 72.85  ? 82  CYS H C   1 
ATOM   8905  O O   . CYS H  2 82  ? -1.948  42.373  1.480   1.00 76.88  ? 82  CYS H O   1 
ATOM   8906  C CB  . CYS H  2 82  ? -1.697  41.927  -1.588  1.00 70.61  ? 82  CYS H CB  1 
ATOM   8907  S SG  . CYS H  2 82  ? -2.314  41.533  -3.237  1.00 74.29  ? 82  CYS H SG  1 
ATOM   8908  N N   . HIS H  2 83  ? -0.616  40.568  1.191   1.00 65.57  ? 83  HIS H N   1 
ATOM   8909  C CA  . HIS H  2 83  ? 0.170   40.794  2.404   1.00 65.91  ? 83  HIS H CA  1 
ATOM   8910  C C   . HIS H  2 83  ? 1.608   40.301  2.272   1.00 66.74  ? 83  HIS H C   1 
ATOM   8911  O O   . HIS H  2 83  ? 1.884   39.409  1.471   1.00 62.25  ? 83  HIS H O   1 
ATOM   8912  C CB  . HIS H  2 83  ? -0.523  40.173  3.647   1.00 67.73  ? 83  HIS H CB  1 
ATOM   8913  C CG  . HIS H  2 83  ? -0.484  38.672  3.734   1.00 67.92  ? 83  HIS H CG  1 
ATOM   8914  N ND1 . HIS H  2 83  ? -0.565  37.868  2.602   1.00 66.49  ? 83  HIS H ND1 1 
ATOM   8915  C CD2 . HIS H  2 83  ? -0.434  37.877  4.826   1.00 69.51  ? 83  HIS H CD2 1 
ATOM   8916  C CE1 . HIS H  2 83  ? -0.516  36.624  3.042   1.00 64.31  ? 83  HIS H CE1 1 
ATOM   8917  N NE2 . HIS H  2 83  ? -0.434  36.578  4.370   1.00 66.61  ? 83  HIS H NE2 1 
ATOM   8918  N N   . CYS H  2 84  ? 2.519   40.897  3.053   1.00 65.84  ? 84  CYS H N   1 
ATOM   8919  C CA  . CYS H  2 84  ? 3.893   40.428  3.164   1.00 63.89  ? 84  CYS H CA  1 
ATOM   8920  C C   . CYS H  2 84  ? 3.765   39.381  4.279   1.00 68.35  ? 84  CYS H C   1 
ATOM   8921  O O   . CYS H  2 84  ? 3.615   39.715  5.459   1.00 71.06  ? 84  CYS H O   1 
ATOM   8922  C CB  . CYS H  2 84  ? 4.853   41.550  3.557   1.00 66.02  ? 84  CYS H CB  1 
ATOM   8923  S SG  . CYS H  2 84  ? 5.424   42.578  2.181   1.00 70.07  ? 84  CYS H SG  1 
ATOM   8924  N N   . GLY H  2 85  ? 3.685   38.135  3.879   1.00 62.49  ? 85  GLY H N   1 
ATOM   8925  C CA  . GLY H  2 85  ? 3.529   37.043  4.823   1.00 62.48  ? 85  GLY H CA  1 
ATOM   8926  C C   . GLY H  2 85  ? 4.204   35.796  4.317   1.00 63.84  ? 85  GLY H C   1 
ATOM   8927  O O   . GLY H  2 85  ? 5.098   35.861  3.464   1.00 61.90  ? 85  GLY H O   1 
ATOM   8928  N N   . LYS H  2 86  ? 3.778   34.655  4.836   1.00 59.92  ? 86  LYS H N   1 
ATOM   8929  C CA  . LYS H  2 86  ? 4.361   33.412  4.395   1.00 57.35  ? 86  LYS H CA  1 
ATOM   8930  C C   . LYS H  2 86  ? 3.682   32.958  3.136   1.00 57.65  ? 86  LYS H C   1 
ATOM   8931  O O   . LYS H  2 86  ? 2.488   33.202  2.949   1.00 57.56  ? 86  LYS H O   1 
ATOM   8932  C CB  . LYS H  2 86  ? 4.326   32.328  5.491   1.00 61.87  ? 86  LYS H CB  1 
ATOM   8933  C CG  . LYS H  2 86  ? 5.715   32.072  6.111   1.00 84.18  ? 86  LYS H CG  1 
ATOM   8934  C CD  . LYS H  2 86  ? 5.736   30.868  7.079   1.00 94.83  ? 86  LYS H CD  1 
ATOM   8935  C CE  . LYS H  2 86  ? 7.109   30.664  7.695   1.00 94.89  ? 86  LYS H CE  1 
ATOM   8936  N NZ  . LYS H  2 86  ? 7.322   29.267  8.169   1.00 89.43  ? 86  LYS H NZ  1 
ATOM   8937  N N   . CYS H  2 87  ? 4.475   32.343  2.248   1.00 51.08  ? 87  CYS H N   1 
ATOM   8938  C CA  . CYS H  2 87  ? 4.041   31.740  1.004   1.00 49.15  ? 87  CYS H CA  1 
ATOM   8939  C C   . CYS H  2 87  ? 3.321   30.446  1.373   1.00 49.78  ? 87  CYS H C   1 
ATOM   8940  O O   . CYS H  2 87  ? 3.943   29.571  1.982   1.00 47.49  ? 87  CYS H O   1 
ATOM   8941  C CB  . CYS H  2 87  ? 5.247   31.463  0.121   1.00 48.76  ? 87  CYS H CB  1 
ATOM   8942  S SG  . CYS H  2 87  ? 4.815   30.891  -1.535  1.00 52.69  ? 87  CYS H SG  1 
ATOM   8943  N N   . ASP H  2 88  ? 2.011   30.338  1.067   1.00 46.86  ? 88  ASP H N   1 
ATOM   8944  C CA  . ASP H  2 88  ? 1.271   29.139  1.450   1.00 48.68  ? 88  ASP H CA  1 
ATOM   8945  C C   . ASP H  2 88  ? 1.405   28.008  0.412   1.00 52.58  ? 88  ASP H C   1 
ATOM   8946  O O   . ASP H  2 88  ? 0.593   27.878  -0.505  1.00 52.26  ? 88  ASP H O   1 
ATOM   8947  C CB  . ASP H  2 88  ? -0.189  29.444  1.817   1.00 52.50  ? 88  ASP H CB  1 
ATOM   8948  C CG  . ASP H  2 88  ? -1.029  28.224  2.142   1.00 62.59  ? 88  ASP H CG  1 
ATOM   8949  O OD1 . ASP H  2 88  ? -0.520  27.313  2.854   1.00 63.24  ? 88  ASP H OD1 1 
ATOM   8950  O OD2 . ASP H  2 88  ? -2.186  28.168  1.678   1.00 69.97  ? 88  ASP H OD2 1 
ATOM   8951  N N   . SER H  2 89  ? 2.423   27.154  0.635   1.00 48.77  ? 89  SER H N   1 
ATOM   8952  C CA  . SER H  2 89  ? 2.823   26.029  -0.199  1.00 48.78  ? 89  SER H CA  1 
ATOM   8953  C C   . SER H  2 89  ? 1.728   24.992  -0.454  1.00 55.07  ? 89  SER H C   1 
ATOM   8954  O O   . SER H  2 89  ? 1.877   24.212  -1.398  1.00 55.44  ? 89  SER H O   1 
ATOM   8955  C CB  . SER H  2 89  ? 4.081   25.363  0.358   1.00 54.15  ? 89  SER H CB  1 
ATOM   8956  O OG  . SER H  2 89  ? 4.020   25.081  1.747   1.00 68.37  ? 89  SER H OG  1 
ATOM   8957  N N   . ASP H  2 90  ? 0.620   24.999  0.346   1.00 52.77  ? 90  ASP H N   1 
ATOM   8958  C CA  . ASP H  2 90  ? -0.535  24.097  0.164   1.00 53.68  ? 90  ASP H CA  1 
ATOM   8959  C C   . ASP H  2 90  ? -1.323  24.461  -1.092  1.00 54.78  ? 90  ASP H C   1 
ATOM   8960  O O   . ASP H  2 90  ? -2.011  23.596  -1.638  1.00 56.01  ? 90  ASP H O   1 
ATOM   8961  C CB  . ASP H  2 90  ? -1.473  24.116  1.387   1.00 57.74  ? 90  ASP H CB  1 
ATOM   8962  C CG  . ASP H  2 90  ? -0.960  23.286  2.530   1.00 80.77  ? 90  ASP H CG  1 
ATOM   8963  O OD1 . ASP H  2 90  ? -0.022  23.741  3.221   1.00 83.95  ? 90  ASP H OD1 1 
ATOM   8964  O OD2 . ASP H  2 90  ? -1.443  22.149  2.697   1.00 93.24  ? 90  ASP H OD2 1 
ATOM   8965  N N   . SER H  2 91  ? -1.208  25.738  -1.552  1.00 47.81  ? 91  SER H N   1 
ATOM   8966  C CA  . SER H  2 91  ? -1.943  26.312  -2.685  1.00 46.77  ? 91  SER H CA  1 
ATOM   8967  C C   . SER H  2 91  ? -1.087  26.966  -3.746  1.00 50.47  ? 91  SER H C   1 
ATOM   8968  O O   . SER H  2 91  ? -1.511  27.038  -4.904  1.00 49.81  ? 91  SER H O   1 
ATOM   8969  C CB  . SER H  2 91  ? -2.932  27.356  -2.179  1.00 49.17  ? 91  SER H CB  1 
ATOM   8970  O OG  . SER H  2 91  ? -2.251  28.393  -1.491  1.00 52.04  ? 91  SER H OG  1 
ATOM   8971  N N   . THR H  2 92  ? 0.063   27.532  -3.329  1.00 47.57  ? 92  THR H N   1 
ATOM   8972  C CA  . THR H  2 92  ? 0.975   28.306  -4.163  1.00 45.84  ? 92  THR H CA  1 
ATOM   8973  C C   . THR H  2 92  ? 2.235   27.546  -4.441  1.00 51.96  ? 92  THR H C   1 
ATOM   8974  O O   . THR H  2 92  ? 2.664   26.744  -3.605  1.00 52.38  ? 92  THR H O   1 
ATOM   8975  C CB  . THR H  2 92  ? 1.404   29.593  -3.448  1.00 48.94  ? 92  THR H CB  1 
ATOM   8976  O OG1 . THR H  2 92  ? 0.399   30.082  -2.556  1.00 47.94  ? 92  THR H OG1 1 
ATOM   8977  C CG2 . THR H  2 92  ? 1.813   30.672  -4.410  1.00 48.80  ? 92  THR H CG2 1 
ATOM   8978  N N   . ASP H  2 93  ? 2.853   27.836  -5.614  1.00 49.59  ? 93  ASP H N   1 
ATOM   8979  C CA  . ASP H  2 93  ? 4.149   27.314  -6.024  1.00 49.62  ? 93  ASP H CA  1 
ATOM   8980  C C   . ASP H  2 93  ? 5.144   28.377  -5.578  1.00 53.57  ? 93  ASP H C   1 
ATOM   8981  O O   . ASP H  2 93  ? 5.234   29.456  -6.177  1.00 53.06  ? 93  ASP H O   1 
ATOM   8982  C CB  . ASP H  2 93  ? 4.217   27.061  -7.542  1.00 52.24  ? 93  ASP H CB  1 
ATOM   8983  C CG  . ASP H  2 93  ? 5.590   26.641  -8.093  1.00 59.84  ? 93  ASP H CG  1 
ATOM   8984  O OD1 . ASP H  2 93  ? 6.363   25.967  -7.351  1.00 56.36  ? 93  ASP H OD1 1 
ATOM   8985  O OD2 . ASP H  2 93  ? 5.867   26.938  -9.282  1.00 68.89  ? 93  ASP H OD2 1 
ATOM   8986  N N   . CYS H  2 94  ? 5.829   28.084  -4.468  1.00 49.98  ? 94  CYS H N   1 
ATOM   8987  C CA  . CYS H  2 94  ? 6.789   28.960  -3.821  1.00 49.01  ? 94  CYS H CA  1 
ATOM   8988  C C   . CYS H  2 94  ? 8.194   28.771  -4.420  1.00 56.04  ? 94  CYS H C   1 
ATOM   8989  O O   . CYS H  2 94  ? 8.997   27.961  -3.929  1.00 57.86  ? 94  CYS H O   1 
ATOM   8990  C CB  . CYS H  2 94  ? 6.754   28.722  -2.314  1.00 48.70  ? 94  CYS H CB  1 
ATOM   8991  S SG  . CYS H  2 94  ? 5.101   28.878  -1.582  1.00 52.94  ? 94  CYS H SG  1 
ATOM   8992  N N   . THR H  2 95  ? 8.465   29.501  -5.525  1.00 52.60  ? 95  THR H N   1 
ATOM   8993  C CA  . THR H  2 95  ? 9.727   29.448  -6.290  1.00 53.02  ? 95  THR H CA  1 
ATOM   8994  C C   . THR H  2 95  ? 10.414  30.819  -6.333  1.00 56.80  ? 95  THR H C   1 
ATOM   8995  O O   . THR H  2 95  ? 9.955   31.752  -5.668  1.00 57.01  ? 95  THR H O   1 
ATOM   8996  C CB  . THR H  2 95  ? 9.453   28.886  -7.730  1.00 61.25  ? 95  THR H CB  1 
ATOM   8997  O OG1 . THR H  2 95  ? 10.696  28.602  -8.396  1.00 65.57  ? 95  THR H OG1 1 
ATOM   8998  C CG2 . THR H  2 95  ? 8.559   29.817  -8.600  1.00 55.91  ? 95  THR H CG2 1 
ATOM   8999  N N   . VAL H  2 96  ? 11.486  30.938  -7.148  1.00 53.02  ? 96  VAL H N   1 
ATOM   9000  C CA  . VAL H  2 96  ? 12.193  32.177  -7.432  1.00 52.57  ? 96  VAL H CA  1 
ATOM   9001  C C   . VAL H  2 96  ? 11.568  32.736  -8.707  1.00 59.25  ? 96  VAL H C   1 
ATOM   9002  O O   . VAL H  2 96  ? 11.177  33.900  -8.720  1.00 60.63  ? 96  VAL H O   1 
ATOM   9003  C CB  . VAL H  2 96  ? 13.726  32.015  -7.569  1.00 56.48  ? 96  VAL H CB  1 
ATOM   9004  C CG1 . VAL H  2 96  ? 14.395  33.364  -7.821  1.00 57.68  ? 96  VAL H CG1 1 
ATOM   9005  C CG2 . VAL H  2 96  ? 14.321  31.364  -6.333  1.00 54.95  ? 96  VAL H CG2 1 
ATOM   9006  N N   . ARG H  2 97  ? 11.467  31.922  -9.772  1.00 57.14  ? 97  ARG H N   1 
ATOM   9007  C CA  . ARG H  2 97  ? 10.889  32.372  -11.041 1.00 59.25  ? 97  ARG H CA  1 
ATOM   9008  C C   . ARG H  2 97  ? 9.970   31.332  -11.684 1.00 65.91  ? 97  ARG H C   1 
ATOM   9009  O O   . ARG H  2 97  ? 10.321  30.148  -11.794 1.00 66.58  ? 97  ARG H O   1 
ATOM   9010  C CB  . ARG H  2 97  ? 11.985  32.746  -12.058 1.00 61.87  ? 97  ARG H CB  1 
ATOM   9011  C CG  . ARG H  2 97  ? 12.836  33.957  -11.714 1.00 72.83  ? 97  ARG H CG  1 
ATOM   9012  C CD  . ARG H  2 97  ? 14.178  33.926  -12.433 1.00 82.67  ? 97  ARG H CD  1 
ATOM   9013  N NE  . ARG H  2 97  ? 15.137  33.001  -11.822 1.00 87.73  ? 97  ARG H NE  1 
ATOM   9014  C CZ  . ARG H  2 97  ? 16.109  33.365  -10.991 1.00 102.99 ? 97  ARG H CZ  1 
ATOM   9015  N NH1 . ARG H  2 97  ? 16.274  34.641  -10.669 1.00 92.33  ? 97  ARG H NH1 1 
ATOM   9016  N NH2 . ARG H  2 97  ? 16.942  32.458  -10.498 1.00 92.61  ? 97  ARG H NH2 1 
ATOM   9017  N N   . GLY H  2 98  ? 8.821   31.815  -12.139 1.00 62.95  ? 98  GLY H N   1 
ATOM   9018  C CA  . GLY H  2 98  ? 7.838   31.063  -12.901 1.00 63.69  ? 98  GLY H CA  1 
ATOM   9019  C C   . GLY H  2 98  ? 7.923   31.510  -14.351 1.00 72.10  ? 98  GLY H C   1 
ATOM   9020  O O   . GLY H  2 98  ? 8.898   32.174  -14.740 1.00 73.73  ? 98  GLY H O   1 
ATOM   9021  N N   . LEU H  2 99  ? 6.912   31.157  -15.169 1.00 69.51  ? 99  LEU H N   1 
ATOM   9022  C CA  . LEU H  2 99  ? 6.910   31.522  -16.589 1.00 72.43  ? 99  LEU H CA  1 
ATOM   9023  C C   . LEU H  2 99  ? 6.260   32.872  -16.856 1.00 76.68  ? 99  LEU H C   1 
ATOM   9024  O O   . LEU H  2 99  ? 6.299   33.362  -17.991 1.00 79.80  ? 99  LEU H O   1 
ATOM   9025  C CB  . LEU H  2 99  ? 6.237   30.448  -17.454 1.00 74.22  ? 99  LEU H CB  1 
ATOM   9026  C CG  . LEU H  2 99  ? 6.580   28.995  -17.204 1.00 79.38  ? 99  LEU H CG  1 
ATOM   9027  C CD1 . LEU H  2 99  ? 5.696   28.093  -18.027 1.00 81.62  ? 99  LEU H CD1 1 
ATOM   9028  C CD2 . LEU H  2 99  ? 8.027   28.712  -17.497 1.00 83.51  ? 99  LEU H CD2 1 
ATOM   9029  N N   . GLY H  2 100 ? 5.666   33.460  -15.826 1.00 70.24  ? 100 GLY H N   1 
ATOM   9030  C CA  . GLY H  2 100 ? 4.991   34.740  -15.961 1.00 71.04  ? 100 GLY H CA  1 
ATOM   9031  C C   . GLY H  2 100 ? 3.492   34.578  -16.094 1.00 75.36  ? 100 GLY H C   1 
ATOM   9032  O O   . GLY H  2 100 ? 3.023   33.569  -16.634 1.00 75.06  ? 100 GLY H O   1 
ATOM   9033  N N   . PRO H  2 101 ? 2.713   35.574  -15.607 1.00 72.44  ? 101 PRO H N   1 
ATOM   9034  C CA  . PRO H  2 101 ? 1.238   35.473  -15.665 1.00 72.17  ? 101 PRO H CA  1 
ATOM   9035  C C   . PRO H  2 101 ? 0.670   35.402  -17.072 1.00 78.70  ? 101 PRO H C   1 
ATOM   9036  O O   . PRO H  2 101 ? -0.399  34.840  -17.292 1.00 78.18  ? 101 PRO H O   1 
ATOM   9037  C CB  . PRO H  2 101 ? 0.778   36.767  -14.978 1.00 74.06  ? 101 PRO H CB  1 
ATOM   9038  C CG  . PRO H  2 101 ? 1.950   37.723  -15.132 1.00 79.95  ? 101 PRO H CG  1 
ATOM   9039  C CD  . PRO H  2 101 ? 3.136   36.832  -14.955 1.00 74.23  ? 101 PRO H CD  1 
ATOM   9040  N N   . SER H  2 102 ? 1.405   36.000  -18.007 1.00 78.08  ? 102 SER H N   1 
ATOM   9041  C CA  . SER H  2 102 ? 1.090   36.176  -19.411 1.00 80.68  ? 102 SER H CA  1 
ATOM   9042  C C   . SER H  2 102 ? 1.733   35.112  -20.288 1.00 85.11  ? 102 SER H C   1 
ATOM   9043  O O   . SER H  2 102 ? 1.780   35.284  -21.505 1.00 88.08  ? 102 SER H O   1 
ATOM   9044  C CB  . SER H  2 102 ? 1.552   37.567  -19.839 1.00 86.97  ? 102 SER H CB  1 
ATOM   9045  O OG  . SER H  2 102 ? 2.784   37.892  -19.209 1.00 95.01  ? 102 SER H OG  1 
ATOM   9046  N N   . TYR H  2 103 ? 2.213   34.006  -19.702 1.00 79.65  ? 103 TYR H N   1 
ATOM   9047  C CA  . TYR H  2 103 ? 2.842   32.998  -20.537 1.00 81.81  ? 103 TYR H CA  1 
ATOM   9048  C C   . TYR H  2 103 ? 1.853   32.220  -21.401 1.00 89.07  ? 103 TYR H C   1 
ATOM   9049  O O   . TYR H  2 103 ? 0.832   31.716  -20.923 1.00 86.33  ? 103 TYR H O   1 
ATOM   9050  C CB  . TYR H  2 103 ? 3.760   32.045  -19.760 1.00 81.18  ? 103 TYR H CB  1 
ATOM   9051  C CG  . TYR H  2 103 ? 4.492   31.115  -20.702 1.00 86.56  ? 103 TYR H CG  1 
ATOM   9052  C CD1 . TYR H  2 103 ? 5.655   31.523  -21.348 1.00 91.79  ? 103 TYR H CD1 1 
ATOM   9053  C CD2 . TYR H  2 103 ? 3.952   29.880  -21.052 1.00 88.29  ? 103 TYR H CD2 1 
ATOM   9054  C CE1 . TYR H  2 103 ? 6.279   30.711  -22.294 1.00 97.29  ? 103 TYR H CE1 1 
ATOM   9055  C CE2 . TYR H  2 103 ? 4.557   29.068  -22.006 1.00 93.21  ? 103 TYR H CE2 1 
ATOM   9056  C CZ  . TYR H  2 103 ? 5.728   29.481  -22.617 1.00 105.89 ? 103 TYR H CZ  1 
ATOM   9057  O OH  . TYR H  2 103 ? 6.334   28.658  -23.538 1.00 112.12 ? 103 TYR H OH  1 
ATOM   9058  N N   . CYS H  2 104 ? 2.209   32.102  -22.681 1.00 91.73  ? 104 CYS H N   1 
ATOM   9059  C CA  . CYS H  2 104 ? 1.469   31.361  -23.693 1.00 94.83  ? 104 CYS H CA  1 
ATOM   9060  C C   . CYS H  2 104 ? 2.417   30.529  -24.554 1.00 102.52 ? 104 CYS H C   1 
ATOM   9061  O O   . CYS H  2 104 ? 3.471   31.016  -24.979 1.00 104.69 ? 104 CYS H O   1 
ATOM   9062  C CB  . CYS H  2 104 ? 0.619   32.295  -24.544 1.00 97.49  ? 104 CYS H CB  1 
ATOM   9063  S SG  . CYS H  2 104 ? -0.323  31.450  -25.835 1.00 104.82 ? 104 CYS H SG  1 
ATOM   9064  N N   . SER H  2 105 ? 2.010   29.286  -24.842 1.00 99.85  ? 105 SER H N   1 
ATOM   9065  C CA  . SER H  2 105 ? 2.781   28.348  -25.652 1.00 103.98 ? 105 SER H CA  1 
ATOM   9066  C C   . SER H  2 105 ? 2.631   28.623  -27.172 1.00 116.17 ? 105 SER H C   1 
ATOM   9067  O O   . SER H  2 105 ? 3.047   27.786  -27.982 1.00 120.31 ? 105 SER H O   1 
ATOM   9068  C CB  . SER H  2 105 ? 2.375   26.911  -25.327 1.00 105.08 ? 105 SER H CB  1 
ATOM   9069  O OG  . SER H  2 105 ? 2.278   26.653  -23.936 1.00 103.85 ? 105 SER H OG  1 
ATOM   9070  N N   . PHE H  2 106 ? 2.054   29.791  -27.563 1.00 114.58 ? 106 PHE H N   1 
ATOM   9071  C CA  . PHE H  2 106 ? 1.833   30.128  -28.977 1.00 120.29 ? 106 PHE H CA  1 
ATOM   9072  C C   . PHE H  2 106 ? 2.370   31.530  -29.382 1.00 129.52 ? 106 PHE H C   1 
ATOM   9073  O O   . PHE H  2 106 ? 2.985   31.659  -30.445 1.00 134.72 ? 106 PHE H O   1 
ATOM   9074  C CB  . PHE H  2 106 ? 0.345   29.943  -29.358 1.00 121.39 ? 106 PHE H CB  1 
ATOM   9075  C CG  . PHE H  2 106 ? -0.232  28.619  -28.893 1.00 120.35 ? 106 PHE H CG  1 
ATOM   9076  C CD1 . PHE H  2 106 ? 0.154   27.424  -29.489 1.00 126.55 ? 106 PHE H CD1 1 
ATOM   9077  C CD2 . PHE H  2 106 ? -1.106  28.563  -27.815 1.00 117.31 ? 106 PHE H CD2 1 
ATOM   9078  C CE1 . PHE H  2 106 ? -0.331  26.201  -29.021 1.00 126.01 ? 106 PHE H CE1 1 
ATOM   9079  C CE2 . PHE H  2 106 ? -1.610  27.339  -27.364 1.00 118.80 ? 106 PHE H CE2 1 
ATOM   9080  C CZ  . PHE H  2 106 ? -1.219  26.166  -27.969 1.00 120.37 ? 106 PHE H CZ  1 
ATOM   9081  N N   . GLY H  2 107 ? 2.157   32.539  -28.533 1.00 124.37 ? 107 GLY H N   1 
ATOM   9082  C CA  . GLY H  2 107 ? 2.622   33.905  -28.772 1.00 126.94 ? 107 GLY H CA  1 
ATOM   9083  C C   . GLY H  2 107 ? 2.607   34.794  -27.541 1.00 127.95 ? 107 GLY H C   1 
ATOM   9084  O O   . GLY H  2 107 ? 2.411   34.305  -26.421 1.00 123.00 ? 107 GLY H O   1 
ATOM   9085  N N   . GLU H  2 108 ? 2.830   36.118  -27.742 1.00 127.11 ? 108 GLU H N   1 
ATOM   9086  C CA  . GLU H  2 108 ? 2.822   37.132  -26.673 1.00 153.49 ? 108 GLU H CA  1 
ATOM   9087  C C   . GLU H  2 108 ? 2.510   38.540  -27.195 1.00 167.83 ? 108 GLU H C   1 
ATOM   9088  O O   . GLU H  2 108 ? 1.503   39.139  -26.808 1.00 118.34 ? 108 GLU H O   1 
ATOM   9089  C CB  . GLU H  2 108 ? 4.132   37.119  -25.864 1.00 153.34 ? 108 GLU H CB  1 
ATOM   9090  C CG  . GLU H  2 108 ? 3.896   36.902  -24.378 1.00 156.52 ? 108 GLU H CG  1 
ATOM   9091  C CD  . GLU H  2 108 ? 4.704   35.778  -23.762 1.00 169.40 ? 108 GLU H CD  1 
ATOM   9092  O OE1 . GLU H  2 108 ? 4.280   34.605  -23.878 1.00 155.40 ? 108 GLU H OE1 1 
ATOM   9093  O OE2 . GLU H  2 108 ? 5.754   36.070  -23.148 1.00 163.66 ? 108 GLU H OE2 1 
ATOM   9094  N N   . CYS I  3 3   ? 25.661  40.043  -24.561 1.00 158.00 ? 18  CYS Z N   1 
ATOM   9095  C CA  . CYS I  3 3   ? 25.957  38.614  -24.513 1.00 154.98 ? 18  CYS Z CA  1 
ATOM   9096  C C   . CYS I  3 3   ? 24.938  37.792  -25.307 1.00 157.81 ? 18  CYS Z C   1 
ATOM   9097  O O   . CYS I  3 3   ? 23.729  38.024  -25.193 1.00 154.89 ? 18  CYS Z O   1 
ATOM   9098  C CB  . CYS I  3 3   ? 26.073  38.125  -23.072 1.00 148.84 ? 18  CYS Z CB  1 
ATOM   9099  S SG  . CYS I  3 3   ? 26.525  36.376  -22.917 1.00 150.10 ? 18  CYS Z SG  1 
ATOM   9100  N N   . HIS I  3 4   ? 25.440  36.817  -26.097 1.00 155.95 ? 19  HIS Z N   1 
ATOM   9101  C CA  . HIS I  3 4   ? 24.624  35.941  -26.942 1.00 156.34 ? 19  HIS Z CA  1 
ATOM   9102  C C   . HIS I  3 4   ? 25.194  34.516  -27.107 1.00 156.03 ? 19  HIS Z C   1 
ATOM   9103  O O   . HIS I  3 4   ? 26.299  34.336  -27.635 1.00 159.71 ? 19  HIS Z O   1 
ATOM   9104  C CB  . HIS I  3 4   ? 24.363  36.603  -28.316 1.00 164.31 ? 19  HIS Z CB  1 
ATOM   9105  C CG  . HIS I  3 4   ? 23.765  35.685  -29.339 1.00 170.50 ? 19  HIS Z CG  1 
ATOM   9106  N ND1 . HIS I  3 4   ? 22.459  35.232  -29.231 1.00 169.50 ? 19  HIS Z ND1 1 
ATOM   9107  C CD2 . HIS I  3 4   ? 24.322  35.156  -30.454 1.00 174.84 ? 19  HIS Z CD2 1 
ATOM   9108  C CE1 . HIS I  3 4   ? 22.266  34.446  -30.277 1.00 172.53 ? 19  HIS Z CE1 1 
ATOM   9109  N NE2 . HIS I  3 4   ? 23.357  34.372  -31.044 1.00 174.64 ? 19  HIS Z NE2 1 
ATOM   9110  N N   . HIS I  3 5   ? 24.399  33.510  -26.685 1.00 145.02 ? 20  HIS Z N   1 
ATOM   9111  C CA  . HIS I  3 5   ? 24.715  32.087  -26.813 1.00 142.72 ? 20  HIS Z CA  1 
ATOM   9112  C C   . HIS I  3 5   ? 23.836  31.449  -27.906 1.00 148.42 ? 20  HIS Z C   1 
ATOM   9113  O O   . HIS I  3 5   ? 22.712  31.907  -28.145 1.00 148.11 ? 20  HIS Z O   1 
ATOM   9114  C CB  . HIS I  3 5   ? 24.545  31.356  -25.464 1.00 135.87 ? 20  HIS Z CB  1 
ATOM   9115  C CG  . HIS I  3 5   ? 24.718  29.868  -25.544 1.00 138.34 ? 20  HIS Z CG  1 
ATOM   9116  N ND1 . HIS I  3 5   ? 23.664  29.035  -25.878 1.00 138.96 ? 20  HIS Z ND1 1 
ATOM   9117  C CD2 . HIS I  3 5   ? 25.827  29.115  -25.363 1.00 140.72 ? 20  HIS Z CD2 1 
ATOM   9118  C CE1 . HIS I  3 5   ? 24.162  27.809  -25.880 1.00 138.88 ? 20  HIS Z CE1 1 
ATOM   9119  N NE2 . HIS I  3 5   ? 25.459  27.807  -25.575 1.00 140.25 ? 20  HIS Z NE2 1 
ATOM   9120  N N   . ARG I  3 6   ? 24.373  30.386  -28.553 1.00 146.60 ? 21  ARG Z N   1 
ATOM   9121  C CA  . ARG I  3 6   ? 23.773  29.543  -29.594 1.00 148.76 ? 21  ARG Z CA  1 
ATOM   9122  C C   . ARG I  3 6   ? 22.246  29.420  -29.403 1.00 149.37 ? 21  ARG Z C   1 
ATOM   9123  O O   . ARG I  3 6   ? 21.488  29.897  -30.250 1.00 152.53 ? 21  ARG Z O   1 
ATOM   9124  C CB  . ARG I  3 6   ? 24.461  28.158  -29.563 1.00 147.32 ? 21  ARG Z CB  1 
ATOM   9125  C CG  . ARG I  3 6   ? 24.106  27.211  -30.696 1.00 156.24 ? 21  ARG Z CG  1 
ATOM   9126  C CD  . ARG I  3 6   ? 24.766  25.860  -30.490 1.00 160.78 ? 21  ARG Z CD  1 
ATOM   9127  N NE  . ARG I  3 6   ? 23.904  24.917  -29.771 1.00 165.75 ? 21  ARG Z NE  1 
ATOM   9128  C CZ  . ARG I  3 6   ? 24.317  23.759  -29.258 1.00 172.09 ? 21  ARG Z CZ  1 
ATOM   9129  N NH1 . ARG I  3 6   ? 25.590  23.396  -29.356 1.00 162.39 ? 21  ARG Z NH1 1 
ATOM   9130  N NH2 . ARG I  3 6   ? 23.461  22.963  -28.630 1.00 153.39 ? 21  ARG Z NH2 1 
ATOM   9131  N N   . ILE I  3 7   ? 21.808  28.852  -28.261 1.00 138.93 ? 22  ILE Z N   1 
ATOM   9132  C CA  . ILE I  3 7   ? 20.389  28.699  -27.947 1.00 135.53 ? 22  ILE Z CA  1 
ATOM   9133  C C   . ILE I  3 7   ? 20.014  29.461  -26.685 1.00 134.66 ? 22  ILE Z C   1 
ATOM   9134  O O   . ILE I  3 7   ? 19.148  30.337  -26.749 1.00 134.16 ? 22  ILE Z O   1 
ATOM   9135  C CB  . ILE I  3 7   ? 19.883  27.230  -27.897 1.00 137.82 ? 22  ILE Z CB  1 
ATOM   9136  C CG1 . ILE I  3 7   ? 20.978  26.198  -28.239 1.00 141.86 ? 22  ILE Z CG1 1 
ATOM   9137  C CG2 . ILE I  3 7   ? 18.649  27.063  -28.777 1.00 140.82 ? 22  ILE Z CG2 1 
ATOM   9138  C CD1 . ILE I  3 7   ? 20.798  24.863  -27.549 1.00 147.95 ? 22  ILE Z CD1 1 
ATOM   9139  N N   . CYS I  3 8   ? 20.661  29.118  -25.538 1.00 127.71 ? 23  CYS Z N   1 
ATOM   9140  C CA  . CYS I  3 8   ? 20.420  29.706  -24.211 1.00 121.97 ? 23  CYS Z CA  1 
ATOM   9141  C C   . CYS I  3 8   ? 20.587  31.225  -24.202 1.00 129.49 ? 23  CYS Z C   1 
ATOM   9142  O O   . CYS I  3 8   ? 21.489  31.752  -24.855 1.00 133.43 ? 23  CYS Z O   1 
ATOM   9143  C CB  . CYS I  3 8   ? 21.284  29.044  -23.134 1.00 118.11 ? 23  CYS Z CB  1 
ATOM   9144  S SG  . CYS I  3 8   ? 21.279  27.230  -23.177 1.00 121.60 ? 23  CYS Z SG  1 
ATOM   9145  N N   . HIS I  3 9   ? 19.697  31.926  -23.488 1.00 124.16 ? 24  HIS Z N   1 
ATOM   9146  C CA  . HIS I  3 9   ? 19.757  33.379  -23.356 1.00 125.38 ? 24  HIS Z CA  1 
ATOM   9147  C C   . HIS I  3 9   ? 20.838  33.698  -22.322 1.00 129.13 ? 24  HIS Z C   1 
ATOM   9148  O O   . HIS I  3 9   ? 21.111  32.873  -21.444 1.00 124.53 ? 24  HIS Z O   1 
ATOM   9149  C CB  . HIS I  3 9   ? 18.383  33.951  -22.965 1.00 123.74 ? 24  HIS Z CB  1 
ATOM   9150  C CG  . HIS I  3 9   ? 17.252  33.458  -23.827 1.00 129.18 ? 24  HIS Z CG  1 
ATOM   9151  N ND1 . HIS I  3 9   ? 16.234  32.669  -23.306 1.00 127.48 ? 24  HIS Z ND1 1 
ATOM   9152  C CD2 . HIS I  3 9   ? 17.029  33.636  -25.152 1.00 136.20 ? 24  HIS Z CD2 1 
ATOM   9153  C CE1 . HIS I  3 9   ? 15.426  32.408  -24.321 1.00 130.13 ? 24  HIS Z CE1 1 
ATOM   9154  N NE2 . HIS I  3 9   ? 15.864  32.965  -25.452 1.00 135.80 ? 24  HIS Z NE2 1 
ATOM   9155  N N   . CYS I  3 10  ? 21.503  34.848  -22.458 1.00 130.65 ? 25  CYS Z N   1 
ATOM   9156  C CA  . CYS I  3 10  ? 22.601  35.186  -21.556 1.00 130.51 ? 25  CYS Z CA  1 
ATOM   9157  C C   . CYS I  3 10  ? 22.530  36.600  -20.989 1.00 132.52 ? 25  CYS Z C   1 
ATOM   9158  O O   . CYS I  3 10  ? 22.178  37.539  -21.706 1.00 135.77 ? 25  CYS Z O   1 
ATOM   9159  C CB  . CYS I  3 10  ? 23.939  34.927  -22.240 1.00 136.33 ? 25  CYS Z CB  1 
ATOM   9160  S SG  . CYS I  3 10  ? 25.358  35.677  -21.403 1.00 141.21 ? 25  CYS Z SG  1 
ATOM   9161  N N   . SER I  3 11  ? 22.929  36.747  -19.707 1.00 123.70 ? 26  SER Z N   1 
ATOM   9162  C CA  . SER I  3 11  ? 22.981  38.019  -18.985 1.00 122.54 ? 26  SER Z CA  1 
ATOM   9163  C C   . SER I  3 11  ? 23.961  37.947  -17.812 1.00 120.97 ? 26  SER Z C   1 
ATOM   9164  O O   . SER I  3 11  ? 23.630  37.395  -16.765 1.00 115.62 ? 26  SER Z O   1 
ATOM   9165  C CB  . SER I  3 11  ? 21.591  38.438  -18.507 1.00 124.80 ? 26  SER Z CB  1 
ATOM   9166  O OG  . SER I  3 11  ? 21.030  37.508  -17.592 1.00 131.72 ? 26  SER Z OG  1 
ATOM   9167  N N   . ASN I  3 12  ? 25.169  38.511  -17.994 1.00 119.28 ? 27  ASN Z N   1 
ATOM   9168  C CA  . ASN I  3 12  ? 26.247  38.561  -16.997 1.00 116.93 ? 27  ASN Z CA  1 
ATOM   9169  C C   . ASN I  3 12  ? 26.532  37.184  -16.362 1.00 113.94 ? 27  ASN Z C   1 
ATOM   9170  O O   . ASN I  3 12  ? 26.182  36.927  -15.203 1.00 109.09 ? 27  ASN Z O   1 
ATOM   9171  C CB  . ASN I  3 12  ? 25.994  39.659  -15.948 1.00 116.41 ? 27  ASN Z CB  1 
ATOM   9172  C CG  . ASN I  3 12  ? 26.158  41.071  -16.475 1.00 144.86 ? 27  ASN Z CG  1 
ATOM   9173  O OD1 . ASN I  3 12  ? 27.123  41.409  -17.183 1.00 144.34 ? 27  ASN Z OD1 1 
ATOM   9174  N ND2 . ASN I  3 12  ? 25.230  41.940  -16.106 1.00 135.08 ? 27  ASN Z ND2 1 
ATOM   9175  N N   . ARG I  3 13  ? 27.118  36.289  -17.186 1.00 110.25 ? 28  ARG Z N   1 
ATOM   9176  C CA  . ARG I  3 13  ? 27.540  34.907  -16.901 1.00 106.92 ? 28  ARG Z CA  1 
ATOM   9177  C C   . ARG I  3 13  ? 26.423  34.026  -16.304 1.00 103.54 ? 28  ARG Z C   1 
ATOM   9178  O O   . ARG I  3 13  ? 26.701  32.993  -15.693 1.00 99.95  ? 28  ARG Z O   1 
ATOM   9179  C CB  . ARG I  3 13  ? 28.822  34.870  -16.050 1.00 106.03 ? 28  ARG Z CB  1 
ATOM   9180  C CG  . ARG I  3 13  ? 30.000  35.619  -16.692 1.00 116.69 ? 28  ARG Z CG  1 
ATOM   9181  C CD  . ARG I  3 13  ? 31.362  35.177  -16.193 1.00 120.44 ? 28  ARG Z CD  1 
ATOM   9182  N NE  . ARG I  3 13  ? 31.477  35.239  -14.735 1.00 121.12 ? 28  ARG Z NE  1 
ATOM   9183  C CZ  . ARG I  3 13  ? 32.610  35.064  -14.065 1.00 135.71 ? 28  ARG Z CZ  1 
ATOM   9184  N NH1 . ARG I  3 13  ? 33.745  34.835  -14.712 1.00 132.49 ? 28  ARG Z NH1 1 
ATOM   9185  N NH2 . ARG I  3 13  ? 32.619  35.130  -12.740 1.00 115.09 ? 28  ARG Z NH2 1 
ATOM   9186  N N   . VAL I  3 14  ? 25.162  34.421  -16.538 1.00 98.57  ? 29  VAL Z N   1 
ATOM   9187  C CA  . VAL I  3 14  ? 23.958  33.700  -16.125 1.00 94.49  ? 29  VAL Z CA  1 
ATOM   9188  C C   . VAL I  3 14  ? 23.326  33.198  -17.425 1.00 101.74 ? 29  VAL Z C   1 
ATOM   9189  O O   . VAL I  3 14  ? 23.078  33.991  -18.343 1.00 105.24 ? 29  VAL Z O   1 
ATOM   9190  C CB  . VAL I  3 14  ? 22.988  34.572  -15.277 1.00 95.17  ? 29  VAL Z CB  1 
ATOM   9191  C CG1 . VAL I  3 14  ? 21.675  33.849  -15.005 1.00 91.52  ? 29  VAL Z CG1 1 
ATOM   9192  C CG2 . VAL I  3 14  ? 23.636  35.006  -13.967 1.00 92.91  ? 29  VAL Z CG2 1 
ATOM   9193  N N   . PHE I  3 15  ? 23.110  31.878  -17.519 1.00 96.70  ? 30  PHE Z N   1 
ATOM   9194  C CA  . PHE I  3 15  ? 22.580  31.267  -18.728 1.00 98.93  ? 30  PHE Z CA  1 
ATOM   9195  C C   . PHE I  3 15  ? 21.283  30.534  -18.501 1.00 99.62  ? 30  PHE Z C   1 
ATOM   9196  O O   . PHE I  3 15  ? 21.240  29.535  -17.779 1.00 95.85  ? 30  PHE Z O   1 
ATOM   9197  C CB  . PHE I  3 15  ? 23.623  30.344  -19.373 1.00 103.91 ? 30  PHE Z CB  1 
ATOM   9198  C CG  . PHE I  3 15  ? 24.928  31.028  -19.678 1.00 108.85 ? 30  PHE Z CG  1 
ATOM   9199  C CD1 . PHE I  3 15  ? 25.946  31.071  -18.732 1.00 110.45 ? 30  PHE Z CD1 1 
ATOM   9200  C CD2 . PHE I  3 15  ? 25.139  31.639  -20.907 1.00 116.19 ? 30  PHE Z CD2 1 
ATOM   9201  C CE1 . PHE I  3 15  ? 27.145  31.729  -19.004 1.00 115.00 ? 30  PHE Z CE1 1 
ATOM   9202  C CE2 . PHE I  3 15  ? 26.349  32.273  -21.188 1.00 122.76 ? 30  PHE Z CE2 1 
ATOM   9203  C CZ  . PHE I  3 15  ? 27.341  32.324  -20.231 1.00 119.31 ? 30  PHE Z CZ  1 
ATOM   9204  N N   . LEU I  3 16  ? 20.224  31.037  -19.139 1.00 97.71  ? 31  LEU Z N   1 
ATOM   9205  C CA  . LEU I  3 16  ? 18.892  30.462  -19.093 1.00 95.51  ? 31  LEU Z CA  1 
ATOM   9206  C C   . LEU I  3 16  ? 18.639  29.718  -20.387 1.00 103.90 ? 31  LEU Z C   1 
ATOM   9207  O O   . LEU I  3 16  ? 18.656  30.327  -21.458 1.00 107.25 ? 31  LEU Z O   1 
ATOM   9208  C CB  . LEU I  3 16  ? 17.829  31.562  -18.892 1.00 94.24  ? 31  LEU Z CB  1 
ATOM   9209  C CG  . LEU I  3 16  ? 16.378  31.180  -19.226 1.00 98.27  ? 31  LEU Z CG  1 
ATOM   9210  C CD1 . LEU I  3 16  ? 15.751  30.327  -18.135 1.00 93.54  ? 31  LEU Z CD1 1 
ATOM   9211  C CD2 . LEU I  3 16  ? 15.552  32.406  -19.515 1.00 102.66 ? 31  LEU Z CD2 1 
ATOM   9212  N N   . CYS I  3 17  ? 18.398  28.407  -20.286 1.00 100.84 ? 32  CYS Z N   1 
ATOM   9213  C CA  . CYS I  3 17  ? 18.065  27.577  -21.437 1.00 105.39 ? 32  CYS Z CA  1 
ATOM   9214  C C   . CYS I  3 17  ? 16.564  27.297  -21.317 1.00 106.10 ? 32  CYS Z C   1 
ATOM   9215  O O   . CYS I  3 17  ? 16.132  26.538  -20.442 1.00 102.02 ? 32  CYS Z O   1 
ATOM   9216  C CB  . CYS I  3 17  ? 18.903  26.301  -21.459 1.00 107.61 ? 32  CYS Z CB  1 
ATOM   9217  S SG  . CYS I  3 17  ? 20.691  26.589  -21.339 1.00 113.72 ? 32  CYS Z SG  1 
ATOM   9218  N N   . GLN I  3 18  ? 15.763  28.025  -22.108 1.00 103.85 ? 33  GLN Z N   1 
ATOM   9219  C CA  . GLN I  3 18  ? 14.309  27.921  -22.025 1.00 102.14 ? 33  GLN Z CA  1 
ATOM   9220  C C   . GLN I  3 18  ? 13.658  27.421  -23.306 1.00 110.04 ? 33  GLN Z C   1 
ATOM   9221  O O   . GLN I  3 18  ? 14.281  27.419  -24.366 1.00 114.45 ? 33  GLN Z O   1 
ATOM   9222  C CB  . GLN I  3 18  ? 13.677  29.259  -21.558 1.00 101.47 ? 33  GLN Z CB  1 
ATOM   9223  C CG  . GLN I  3 18  ? 12.405  29.088  -20.709 1.00 100.47 ? 33  GLN Z CG  1 
ATOM   9224  C CD  . GLN I  3 18  ? 11.641  30.365  -20.456 1.00 108.83 ? 33  GLN Z CD  1 
ATOM   9225  O OE1 . GLN I  3 18  ? 11.004  30.929  -21.357 1.00 104.17 ? 33  GLN Z OE1 1 
ATOM   9226  N NE2 . GLN I  3 18  ? 11.629  30.808  -19.203 1.00 95.02  ? 33  GLN Z NE2 1 
ATOM   9227  N N   . GLU I  3 19  ? 12.398  26.972  -23.177 1.00 105.16 ? 34  GLU Z N   1 
ATOM   9228  C CA  . GLU I  3 19  ? 11.490  26.493  -24.215 1.00 108.81 ? 34  GLU Z CA  1 
ATOM   9229  C C   . GLU I  3 19  ? 11.812  25.100  -24.745 1.00 115.39 ? 34  GLU Z C   1 
ATOM   9230  O O   . GLU I  3 19  ? 12.838  24.496  -24.416 1.00 113.45 ? 34  GLU Z O   1 
ATOM   9231  C CB  . GLU I  3 19  ? 11.348  27.499  -25.377 1.00 114.67 ? 34  GLU Z CB  1 
ATOM   9232  C CG  . GLU I  3 19  ? 10.679  28.809  -24.998 1.00 120.70 ? 34  GLU Z CG  1 
ATOM   9233  C CD  . GLU I  3 19  ? 9.245   28.713  -24.517 1.00 133.82 ? 34  GLU Z CD  1 
ATOM   9234  O OE1 . GLU I  3 19  ? 8.428   28.020  -25.169 1.00 127.94 ? 34  GLU Z OE1 1 
ATOM   9235  O OE2 . GLU I  3 19  ? 8.935   29.357  -23.490 1.00 120.42 ? 34  GLU Z OE2 1 
ATOM   9236  N N   . SER I  3 20  ? 10.875  24.599  -25.558 1.00 116.13 ? 35  SER Z N   1 
ATOM   9237  C CA  . SER I  3 20  ? 10.858  23.296  -26.203 1.00 119.90 ? 35  SER Z CA  1 
ATOM   9238  C C   . SER I  3 20  ? 11.982  23.082  -27.230 1.00 129.19 ? 35  SER Z C   1 
ATOM   9239  O O   . SER I  3 20  ? 12.231  21.937  -27.618 1.00 131.93 ? 35  SER Z O   1 
ATOM   9240  C CB  . SER I  3 20  ? 9.486   23.049  -26.826 1.00 126.47 ? 35  SER Z CB  1 
ATOM   9241  O OG  . SER I  3 20  ? 8.453   23.334  -25.895 1.00 129.58 ? 35  SER Z OG  1 
ATOM   9242  N N   . LYS I  3 21  ? 12.671  24.167  -27.653 1.00 127.03 ? 36  LYS Z N   1 
ATOM   9243  C CA  . LYS I  3 21  ? 13.795  24.107  -28.603 1.00 131.69 ? 36  LYS Z CA  1 
ATOM   9244  C C   . LYS I  3 21  ? 15.014  23.365  -28.018 1.00 133.92 ? 36  LYS Z C   1 
ATOM   9245  O O   . LYS I  3 21  ? 15.844  22.864  -28.774 1.00 138.15 ? 36  LYS Z O   1 
ATOM   9246  C CB  . LYS I  3 21  ? 14.178  25.512  -29.128 1.00 136.17 ? 36  LYS Z CB  1 
ATOM   9247  C CG  . LYS I  3 21  ? 14.625  26.516  -28.056 1.00 147.30 ? 36  LYS Z CG  1 
ATOM   9248  C CD  . LYS I  3 21  ? 14.982  27.873  -28.655 1.00 159.52 ? 36  LYS Z CD  1 
ATOM   9249  C CE  . LYS I  3 21  ? 15.484  28.839  -27.609 1.00 161.99 ? 36  LYS Z CE  1 
ATOM   9250  N NZ  . LYS I  3 21  ? 16.069  30.064  -28.217 1.00 171.35 ? 36  LYS Z NZ  1 
ATOM   9251  N N   . VAL I  3 22  ? 15.099  23.295  -26.673 1.00 124.32 ? 37  VAL Z N   1 
ATOM   9252  C CA  . VAL I  3 22  ? 16.149  22.615  -25.908 1.00 122.07 ? 37  VAL Z CA  1 
ATOM   9253  C C   . VAL I  3 22  ? 15.782  21.122  -25.798 1.00 126.46 ? 37  VAL Z C   1 
ATOM   9254  O O   . VAL I  3 22  ? 14.651  20.811  -25.434 1.00 124.31 ? 37  VAL Z O   1 
ATOM   9255  C CB  . VAL I  3 22  ? 16.331  23.262  -24.505 1.00 119.73 ? 37  VAL Z CB  1 
ATOM   9256  C CG1 . VAL I  3 22  ? 17.571  22.720  -23.804 1.00 118.20 ? 37  VAL Z CG1 1 
ATOM   9257  C CG2 . VAL I  3 22  ? 16.395  24.787  -24.588 1.00 118.99 ? 37  VAL Z CG2 1 
ATOM   9258  N N   . THR I  3 23  ? 16.733  20.209  -26.113 1.00 125.94 ? 38  THR Z N   1 
ATOM   9259  C CA  . THR I  3 23  ? 16.534  18.746  -26.073 1.00 127.13 ? 38  THR Z CA  1 
ATOM   9260  C C   . THR I  3 23  ? 17.676  18.030  -25.299 1.00 126.66 ? 38  THR Z C   1 
ATOM   9261  O O   . THR I  3 23  ? 17.454  16.955  -24.732 1.00 124.78 ? 38  THR Z O   1 
ATOM   9262  C CB  . THR I  3 23  ? 16.307  18.204  -27.503 1.00 148.36 ? 38  THR Z CB  1 
ATOM   9263  O OG1 . THR I  3 23  ? 15.320  19.015  -28.143 1.00 151.37 ? 38  THR Z OG1 1 
ATOM   9264  C CG2 . THR I  3 23  ? 15.844  16.743  -27.531 1.00 150.67 ? 38  THR Z CG2 1 
ATOM   9265  N N   . GLU I  3 24  ? 18.874  18.637  -25.265 1.00 121.90 ? 39  GLU Z N   1 
ATOM   9266  C CA  . GLU I  3 24  ? 20.042  18.126  -24.535 1.00 120.35 ? 39  GLU Z CA  1 
ATOM   9267  C C   . GLU I  3 24  ? 20.852  19.292  -23.966 1.00 119.31 ? 39  GLU Z C   1 
ATOM   9268  O O   . GLU I  3 24  ? 20.787  20.386  -24.527 1.00 119.05 ? 39  GLU Z O   1 
ATOM   9269  C CB  . GLU I  3 24  ? 20.901  17.196  -25.418 1.00 128.14 ? 39  GLU Z CB  1 
ATOM   9270  C CG  . GLU I  3 24  ? 21.421  17.819  -26.707 1.00 143.91 ? 39  GLU Z CG  1 
ATOM   9271  C CD  . GLU I  3 24  ? 21.214  16.975  -27.948 1.00 164.57 ? 39  GLU Z CD  1 
ATOM   9272  O OE1 . GLU I  3 24  ? 22.216  16.438  -28.472 1.00 160.64 ? 39  GLU Z OE1 1 
ATOM   9273  O OE2 . GLU I  3 24  ? 20.052  16.857  -28.403 1.00 161.40 ? 39  GLU Z OE2 1 
ATOM   9274  N N   . ILE I  3 25  ? 21.594  19.076  -22.855 1.00 112.49 ? 40  ILE Z N   1 
ATOM   9275  C CA  . ILE I  3 25  ? 22.395  20.144  -22.229 1.00 109.98 ? 40  ILE Z CA  1 
ATOM   9276  C C   . ILE I  3 25  ? 23.511  20.607  -23.193 1.00 120.98 ? 40  ILE Z C   1 
ATOM   9277  O O   . ILE I  3 25  ? 24.360  19.789  -23.576 1.00 125.10 ? 40  ILE Z O   1 
ATOM   9278  C CB  . ILE I  3 25  ? 22.902  19.806  -20.796 1.00 108.51 ? 40  ILE Z CB  1 
ATOM   9279  C CG1 . ILE I  3 25  ? 21.699  19.625  -19.840 1.00 104.80 ? 40  ILE Z CG1 1 
ATOM   9280  C CG2 . ILE I  3 25  ? 23.824  20.914  -20.264 1.00 105.80 ? 40  ILE Z CG2 1 
ATOM   9281  C CD1 . ILE I  3 25  ? 21.966  18.840  -18.598 1.00 110.49 ? 40  ILE Z CD1 1 
ATOM   9282  N N   . PRO I  3 26  ? 23.488  21.902  -23.626 1.00 118.27 ? 41  PRO Z N   1 
ATOM   9283  C CA  . PRO I  3 26  ? 24.482  22.376  -24.614 1.00 123.14 ? 41  PRO Z CA  1 
ATOM   9284  C C   . PRO I  3 26  ? 25.946  22.091  -24.282 1.00 127.45 ? 41  PRO Z C   1 
ATOM   9285  O O   . PRO I  3 26  ? 26.425  22.399  -23.185 1.00 123.47 ? 41  PRO Z O   1 
ATOM   9286  C CB  . PRO I  3 26  ? 24.198  23.879  -24.717 1.00 123.84 ? 41  PRO Z CB  1 
ATOM   9287  C CG  . PRO I  3 26  ? 22.763  24.006  -24.353 1.00 124.44 ? 41  PRO Z CG  1 
ATOM   9288  C CD  . PRO I  3 26  ? 22.525  22.973  -23.289 1.00 115.98 ? 41  PRO Z CD  1 
ATOM   9289  N N   . SER I  3 27  ? 26.644  21.473  -25.248 1.00 129.21 ? 42  SER Z N   1 
ATOM   9290  C CA  . SER I  3 27  ? 28.058  21.128  -25.136 1.00 131.53 ? 42  SER Z CA  1 
ATOM   9291  C C   . SER I  3 27  ? 28.951  22.377  -25.173 1.00 136.46 ? 42  SER Z C   1 
ATOM   9292  O O   . SER I  3 27  ? 30.048  22.353  -24.611 1.00 136.23 ? 42  SER Z O   1 
ATOM   9293  C CB  . SER I  3 27  ? 28.457  20.138  -26.229 1.00 141.69 ? 42  SER Z CB  1 
ATOM   9294  O OG  . SER I  3 27  ? 28.147  20.593  -27.537 1.00 154.97 ? 42  SER Z OG  1 
ATOM   9295  N N   . ASP I  3 28  ? 28.459  23.472  -25.804 1.00 134.17 ? 43  ASP Z N   1 
ATOM   9296  C CA  . ASP I  3 28  ? 29.178  24.743  -25.973 1.00 135.55 ? 43  ASP Z CA  1 
ATOM   9297  C C   . ASP I  3 28  ? 28.925  25.775  -24.837 1.00 131.82 ? 43  ASP Z C   1 
ATOM   9298  O O   . ASP I  3 28  ? 29.244  26.957  -25.010 1.00 132.53 ? 43  ASP Z O   1 
ATOM   9299  C CB  . ASP I  3 28  ? 28.890  25.353  -27.377 1.00 143.17 ? 43  ASP Z CB  1 
ATOM   9300  C CG  . ASP I  3 28  ? 27.531  26.020  -27.587 1.00 154.27 ? 43  ASP Z CG  1 
ATOM   9301  O OD1 . ASP I  3 28  ? 26.532  25.548  -26.994 1.00 152.02 ? 43  ASP Z OD1 1 
ATOM   9302  O OD2 . ASP I  3 28  ? 27.461  26.988  -28.378 1.00 163.14 ? 43  ASP Z OD2 1 
ATOM   9303  N N   . LEU I  3 29  ? 28.399  25.324  -23.674 1.00 121.07 ? 44  LEU Z N   1 
ATOM   9304  C CA  . LEU I  3 29  ? 28.140  26.210  -22.537 1.00 114.97 ? 44  LEU Z CA  1 
ATOM   9305  C C   . LEU I  3 29  ? 29.446  26.792  -21.961 1.00 118.13 ? 44  LEU Z C   1 
ATOM   9306  O O   . LEU I  3 29  ? 30.352  26.015  -21.632 1.00 118.90 ? 44  LEU Z O   1 
ATOM   9307  C CB  . LEU I  3 29  ? 27.300  25.515  -21.453 1.00 109.49 ? 44  LEU Z CB  1 
ATOM   9308  C CG  . LEU I  3 29  ? 25.771  25.580  -21.625 1.00 112.01 ? 44  LEU Z CG  1 
ATOM   9309  C CD1 . LEU I  3 29  ? 25.083  24.533  -20.778 1.00 108.02 ? 44  LEU Z CD1 1 
ATOM   9310  C CD2 . LEU I  3 29  ? 25.220  26.961  -21.276 1.00 112.14 ? 44  LEU Z CD2 1 
ATOM   9311  N N   . PRO I  3 30  ? 29.576  28.154  -21.911 1.00 113.03 ? 45  PRO Z N   1 
ATOM   9312  C CA  . PRO I  3 30  ? 30.828  28.778  -21.423 1.00 113.06 ? 45  PRO Z CA  1 
ATOM   9313  C C   . PRO I  3 30  ? 31.207  28.366  -20.007 1.00 111.90 ? 45  PRO Z C   1 
ATOM   9314  O O   . PRO I  3 30  ? 30.417  28.547  -19.086 1.00 106.14 ? 45  PRO Z O   1 
ATOM   9315  C CB  . PRO I  3 30  ? 30.538  30.282  -21.517 1.00 114.80 ? 45  PRO Z CB  1 
ATOM   9316  C CG  . PRO I  3 30  ? 29.446  30.402  -22.508 1.00 120.89 ? 45  PRO Z CG  1 
ATOM   9317  C CD  . PRO I  3 30  ? 28.596  29.185  -22.310 1.00 113.78 ? 45  PRO Z CD  1 
ATOM   9318  N N   . ARG I  3 31  ? 32.425  27.823  -19.838 1.00 110.92 ? 46  ARG Z N   1 
ATOM   9319  C CA  . ARG I  3 31  ? 32.931  27.303  -18.557 1.00 107.87 ? 46  ARG Z CA  1 
ATOM   9320  C C   . ARG I  3 31  ? 33.139  28.391  -17.459 1.00 108.76 ? 46  ARG Z C   1 
ATOM   9321  O O   . ARG I  3 31  ? 33.421  28.046  -16.305 1.00 105.28 ? 46  ARG Z O   1 
ATOM   9322  C CB  . ARG I  3 31  ? 34.206  26.446  -18.753 1.00 112.30 ? 46  ARG Z CB  1 
ATOM   9323  C CG  . ARG I  3 31  ? 34.260  25.574  -20.027 1.00 125.74 ? 46  ARG Z CG  1 
ATOM   9324  C CD  . ARG I  3 31  ? 33.134  24.562  -20.201 1.00 131.65 ? 46  ARG Z CD  1 
ATOM   9325  N NE  . ARG I  3 31  ? 33.175  23.485  -19.214 1.00 137.95 ? 46  ARG Z NE  1 
ATOM   9326  C CZ  . ARG I  3 31  ? 32.343  22.448  -19.209 1.00 155.23 ? 46  ARG Z CZ  1 
ATOM   9327  N NH1 . ARG I  3 31  ? 31.406  22.334  -20.146 1.00 143.71 ? 46  ARG Z NH1 1 
ATOM   9328  N NH2 . ARG I  3 31  ? 32.441  21.515  -18.272 1.00 143.16 ? 46  ARG Z NH2 1 
ATOM   9329  N N   . ASN I  3 32  ? 32.953  29.682  -17.812 1.00 106.36 ? 47  ASN Z N   1 
ATOM   9330  C CA  . ASN I  3 32  ? 33.039  30.820  -16.890 1.00 104.07 ? 47  ASN Z CA  1 
ATOM   9331  C C   . ASN I  3 32  ? 31.677  31.088  -16.196 1.00 103.21 ? 47  ASN Z C   1 
ATOM   9332  O O   . ASN I  3 32  ? 31.594  31.971  -15.337 1.00 100.48 ? 47  ASN Z O   1 
ATOM   9333  C CB  . ASN I  3 32  ? 33.554  32.085  -17.619 1.00 108.07 ? 47  ASN Z CB  1 
ATOM   9334  C CG  . ASN I  3 32  ? 32.684  32.646  -18.745 1.00 130.34 ? 47  ASN Z CG  1 
ATOM   9335  O OD1 . ASN I  3 32  ? 31.544  32.220  -19.002 1.00 122.55 ? 47  ASN Z OD1 1 
ATOM   9336  N ND2 . ASN I  3 32  ? 33.204  33.653  -19.436 1.00 122.08 ? 47  ASN Z ND2 1 
ATOM   9337  N N   . ALA I  3 33  ? 30.623  30.314  -16.570 1.00 98.62  ? 48  ALA Z N   1 
ATOM   9338  C CA  . ALA I  3 33  ? 29.246  30.424  -16.055 1.00 94.35  ? 48  ALA Z CA  1 
ATOM   9339  C C   . ALA I  3 33  ? 29.186  30.523  -14.553 1.00 94.19  ? 48  ALA Z C   1 
ATOM   9340  O O   . ALA I  3 33  ? 29.971  29.867  -13.861 1.00 94.01  ? 48  ALA Z O   1 
ATOM   9341  C CB  . ALA I  3 33  ? 28.389  29.258  -16.532 1.00 94.20  ? 48  ALA Z CB  1 
ATOM   9342  N N   . ILE I  3 34  ? 28.278  31.384  -14.067 1.00 87.06  ? 49  ILE Z N   1 
ATOM   9343  C CA  . ILE I  3 34  ? 28.027  31.681  -12.661 1.00 82.58  ? 49  ILE Z CA  1 
ATOM   9344  C C   . ILE I  3 34  ? 26.716  31.005  -12.241 1.00 84.85  ? 49  ILE Z C   1 
ATOM   9345  O O   . ILE I  3 34  ? 26.639  30.426  -11.155 1.00 82.72  ? 49  ILE Z O   1 
ATOM   9346  C CB  . ILE I  3 34  ? 28.057  33.235  -12.468 1.00 85.95  ? 49  ILE Z CB  1 
ATOM   9347  C CG1 . ILE I  3 34  ? 29.493  33.758  -12.264 1.00 89.31  ? 49  ILE Z CG1 1 
ATOM   9348  C CG2 . ILE I  3 34  ? 27.117  33.759  -11.389 1.00 82.75  ? 49  ILE Z CG2 1 
ATOM   9349  C CD1 . ILE I  3 34  ? 30.264  33.297  -10.949 1.00 96.12  ? 49  ILE Z CD1 1 
ATOM   9350  N N   . GLU I  3 35  ? 25.710  31.035  -13.135 1.00 81.64  ? 50  GLU Z N   1 
ATOM   9351  C CA  . GLU I  3 35  ? 24.388  30.454  -12.928 1.00 77.78  ? 50  GLU Z CA  1 
ATOM   9352  C C   . GLU I  3 35  ? 23.892  29.742  -14.203 1.00 83.63  ? 50  GLU Z C   1 
ATOM   9353  O O   . GLU I  3 35  ? 23.928  30.326  -15.292 1.00 86.17  ? 50  GLU Z O   1 
ATOM   9354  C CB  . GLU I  3 35  ? 23.403  31.563  -12.511 1.00 77.06  ? 50  GLU Z CB  1 
ATOM   9355  C CG  . GLU I  3 35  ? 22.248  31.086  -11.649 1.00 83.68  ? 50  GLU Z CG  1 
ATOM   9356  C CD  . GLU I  3 35  ? 21.248  32.146  -11.221 1.00 102.84 ? 50  GLU Z CD  1 
ATOM   9357  O OE1 . GLU I  3 35  ? 21.677  33.247  -10.801 1.00 96.84  ? 50  GLU Z OE1 1 
ATOM   9358  O OE2 . GLU I  3 35  ? 20.030  31.857  -11.267 1.00 94.58  ? 50  GLU Z OE2 1 
ATOM   9359  N N   . LEU I  3 36  ? 23.424  28.483  -14.058 1.00 78.71  ? 51  LEU Z N   1 
ATOM   9360  C CA  . LEU I  3 36  ? 22.837  27.695  -15.148 1.00 79.93  ? 51  LEU Z CA  1 
ATOM   9361  C C   . LEU I  3 36  ? 21.361  27.354  -14.852 1.00 80.50  ? 51  LEU Z C   1 
ATOM   9362  O O   . LEU I  3 36  ? 21.068  26.662  -13.875 1.00 76.53  ? 51  LEU Z O   1 
ATOM   9363  C CB  . LEU I  3 36  ? 23.642  26.418  -15.440 1.00 81.66  ? 51  LEU Z CB  1 
ATOM   9364  C CG  . LEU I  3 36  ? 24.982  26.572  -16.145 1.00 90.16  ? 51  LEU Z CG  1 
ATOM   9365  C CD1 . LEU I  3 36  ? 25.598  25.225  -16.380 1.00 92.31  ? 51  LEU Z CD1 1 
ATOM   9366  C CD2 . LEU I  3 36  ? 24.844  27.277  -17.486 1.00 96.00  ? 51  LEU Z CD2 1 
ATOM   9367  N N   . ARG I  3 37  ? 20.446  27.849  -15.702 1.00 78.67  ? 52  ARG Z N   1 
ATOM   9368  C CA  . ARG I  3 37  ? 19.001  27.634  -15.594 1.00 76.98  ? 52  ARG Z CA  1 
ATOM   9369  C C   . ARG I  3 37  ? 18.483  26.773  -16.742 1.00 86.43  ? 52  ARG Z C   1 
ATOM   9370  O O   . ARG I  3 37  ? 18.932  26.925  -17.884 1.00 90.50  ? 52  ARG Z O   1 
ATOM   9371  C CB  . ARG I  3 37  ? 18.243  28.974  -15.594 1.00 75.14  ? 52  ARG Z CB  1 
ATOM   9372  C CG  . ARG I  3 37  ? 18.547  29.886  -14.415 1.00 80.60  ? 52  ARG Z CG  1 
ATOM   9373  C CD  . ARG I  3 37  ? 17.669  31.115  -14.451 1.00 93.83  ? 52  ARG Z CD  1 
ATOM   9374  N NE  . ARG I  3 37  ? 18.226  32.214  -13.664 1.00 108.84 ? 52  ARG Z NE  1 
ATOM   9375  C CZ  . ARG I  3 37  ? 17.850  33.486  -13.777 1.00 131.36 ? 52  ARG Z CZ  1 
ATOM   9376  N NH1 . ARG I  3 37  ? 16.901  33.832  -14.639 1.00 124.84 ? 52  ARG Z NH1 1 
ATOM   9377  N NH2 . ARG I  3 37  ? 18.408  34.419  -13.018 1.00 120.03 ? 52  ARG Z NH2 1 
ATOM   9378  N N   . PHE I  3 38  ? 17.512  25.890  -16.442 1.00 82.56  ? 53  PHE Z N   1 
ATOM   9379  C CA  . PHE I  3 38  ? 16.860  25.001  -17.413 1.00 85.38  ? 53  PHE Z CA  1 
ATOM   9380  C C   . PHE I  3 38  ? 15.339  24.990  -17.169 1.00 89.05  ? 53  PHE Z C   1 
ATOM   9381  O O   . PHE I  3 38  ? 14.857  24.334  -16.240 1.00 86.02  ? 53  PHE Z O   1 
ATOM   9382  C CB  . PHE I  3 38  ? 17.470  23.587  -17.376 1.00 87.82  ? 53  PHE Z CB  1 
ATOM   9383  C CG  . PHE I  3 38  ? 18.907  23.532  -17.831 1.00 91.82  ? 53  PHE Z CG  1 
ATOM   9384  C CD1 . PHE I  3 38  ? 19.223  23.404  -19.181 1.00 99.51  ? 53  PHE Z CD1 1 
ATOM   9385  C CD2 . PHE I  3 38  ? 19.949  23.600  -16.912 1.00 91.48  ? 53  PHE Z CD2 1 
ATOM   9386  C CE1 . PHE I  3 38  ? 20.556  23.350  -19.603 1.00 102.66 ? 53  PHE Z CE1 1 
ATOM   9387  C CE2 . PHE I  3 38  ? 21.280  23.550  -17.338 1.00 96.70  ? 53  PHE Z CE2 1 
ATOM   9388  C CZ  . PHE I  3 38  ? 21.572  23.421  -18.678 1.00 99.38  ? 53  PHE Z CZ  1 
ATOM   9389  N N   . VAL I  3 39  ? 14.599  25.774  -17.982 1.00 87.81  ? 54  VAL Z N   1 
ATOM   9390  C CA  . VAL I  3 39  ? 13.145  25.965  -17.880 1.00 86.40  ? 54  VAL Z CA  1 
ATOM   9391  C C   . VAL I  3 39  ? 12.460  25.544  -19.187 1.00 94.00  ? 54  VAL Z C   1 
ATOM   9392  O O   . VAL I  3 39  ? 12.940  25.897  -20.257 1.00 97.66  ? 54  VAL Z O   1 
ATOM   9393  C CB  . VAL I  3 39  ? 12.821  27.446  -17.512 1.00 89.12  ? 54  VAL Z CB  1 
ATOM   9394  C CG1 . VAL I  3 39  ? 11.328  27.670  -17.324 1.00 88.05  ? 54  VAL Z CG1 1 
ATOM   9395  C CG2 . VAL I  3 39  ? 13.582  27.902  -16.270 1.00 85.47  ? 54  VAL Z CG2 1 
ATOM   9396  N N   . LEU I  3 40  ? 11.358  24.774  -19.097 1.00 90.15  ? 55  LEU Z N   1 
ATOM   9397  C CA  . LEU I  3 40  ? 10.539  24.285  -20.225 1.00 94.56  ? 55  LEU Z CA  1 
ATOM   9398  C C   . LEU I  3 40  ? 11.298  23.479  -21.273 1.00 103.03 ? 55  LEU Z C   1 
ATOM   9399  O O   . LEU I  3 40  ? 10.812  23.304  -22.394 1.00 107.45 ? 55  LEU Z O   1 
ATOM   9400  C CB  . LEU I  3 40  ? 9.751   25.421  -20.914 1.00 96.77  ? 55  LEU Z CB  1 
ATOM   9401  C CG  . LEU I  3 40  ? 8.682   26.155  -20.100 1.00 98.73  ? 55  LEU Z CG  1 
ATOM   9402  C CD1 . LEU I  3 40  ? 7.942   27.136  -20.974 1.00 101.95 ? 55  LEU Z CD1 1 
ATOM   9403  C CD2 . LEU I  3 40  ? 7.694   25.190  -19.441 1.00 99.55  ? 55  LEU Z CD2 1 
ATOM   9404  N N   . THR I  3 41  ? 12.463  22.959  -20.900 1.00 98.58  ? 56  THR Z N   1 
ATOM   9405  C CA  . THR I  3 41  ? 13.313  22.187  -21.793 1.00 102.47 ? 56  THR Z CA  1 
ATOM   9406  C C   . THR I  3 41  ? 12.687  20.830  -22.086 1.00 108.09 ? 56  THR Z C   1 
ATOM   9407  O O   . THR I  3 41  ? 12.017  20.244  -21.221 1.00 104.76 ? 56  THR Z O   1 
ATOM   9408  C CB  . THR I  3 41  ? 14.738  22.067  -21.222 1.00 108.36 ? 56  THR Z CB  1 
ATOM   9409  O OG1 . THR I  3 41  ? 14.740  21.177  -20.109 1.00 105.52 ? 56  THR Z OG1 1 
ATOM   9410  C CG2 . THR I  3 41  ? 15.321  23.408  -20.798 1.00 103.73 ? 56  THR Z CG2 1 
ATOM   9411  N N   . LYS I  3 42  ? 12.904  20.334  -23.314 1.00 109.14 ? 57  LYS Z N   1 
ATOM   9412  C CA  . LYS I  3 42  ? 12.420  19.018  -23.711 1.00 111.33 ? 57  LYS Z CA  1 
ATOM   9413  C C   . LYS I  3 42  ? 13.489  17.961  -23.410 1.00 114.64 ? 57  LYS Z C   1 
ATOM   9414  O O   . LYS I  3 42  ? 13.630  16.959  -24.119 1.00 119.59 ? 57  LYS Z O   1 
ATOM   9415  C CB  . LYS I  3 42  ? 11.907  18.994  -25.161 1.00 119.47 ? 57  LYS Z CB  1 
ATOM   9416  C CG  . LYS I  3 42  ? 10.624  19.793  -25.371 1.00 133.36 ? 57  LYS Z CG  1 
ATOM   9417  C CD  . LYS I  3 42  ? 9.412   19.228  -24.637 1.00 143.42 ? 57  LYS Z CD  1 
ATOM   9418  C CE  . LYS I  3 42  ? 8.508   20.329  -24.140 1.00 155.61 ? 57  LYS Z CE  1 
ATOM   9419  N NZ  . LYS I  3 42  ? 7.236   19.791  -23.585 1.00 166.06 ? 57  LYS Z NZ  1 
ATOM   9420  N N   . LEU I  3 43  ? 14.225  18.202  -22.312 1.00 104.75 ? 58  LEU Z N   1 
ATOM   9421  C CA  . LEU I  3 43  ? 15.261  17.354  -21.749 1.00 103.66 ? 58  LEU Z CA  1 
ATOM   9422  C C   . LEU I  3 43  ? 14.596  16.086  -21.260 1.00 105.73 ? 58  LEU Z C   1 
ATOM   9423  O O   . LEU I  3 43  ? 13.534  16.155  -20.648 1.00 103.06 ? 58  LEU Z O   1 
ATOM   9424  C CB  . LEU I  3 43  ? 15.881  18.091  -20.550 1.00 98.65  ? 58  LEU Z CB  1 
ATOM   9425  C CG  . LEU I  3 43  ? 17.300  18.656  -20.671 1.00 104.42 ? 58  LEU Z CG  1 
ATOM   9426  C CD1 . LEU I  3 43  ? 17.471  19.535  -21.906 1.00 107.57 ? 58  LEU Z CD1 1 
ATOM   9427  C CD2 . LEU I  3 43  ? 17.662  19.446  -19.420 1.00 102.05 ? 58  LEU Z CD2 1 
ATOM   9428  N N   . ARG I  3 44  ? 15.185  14.940  -21.567 1.00 104.75 ? 59  ARG Z N   1 
ATOM   9429  C CA  . ARG I  3 44  ? 14.671  13.640  -21.151 1.00 105.21 ? 59  ARG Z CA  1 
ATOM   9430  C C   . ARG I  3 44  ? 15.667  13.013  -20.203 1.00 107.97 ? 59  ARG Z C   1 
ATOM   9431  O O   . ARG I  3 44  ? 15.302  12.207  -19.348 1.00 105.58 ? 59  ARG Z O   1 
ATOM   9432  C CB  . ARG I  3 44  ? 14.478  12.739  -22.371 1.00 111.18 ? 59  ARG Z CB  1 
ATOM   9433  C CG  . ARG I  3 44  ? 13.197  13.013  -23.141 1.00 120.55 ? 59  ARG Z CG  1 
ATOM   9434  C CD  . ARG I  3 44  ? 13.195  12.386  -24.528 1.00 136.80 ? 59  ARG Z CD  1 
ATOM   9435  N NE  . ARG I  3 44  ? 13.774  11.037  -24.561 1.00 149.92 ? 59  ARG Z NE  1 
ATOM   9436  C CZ  . ARG I  3 44  ? 13.101  9.913   -24.334 1.00 166.99 ? 59  ARG Z CZ  1 
ATOM   9437  N NH1 . ARG I  3 44  ? 11.805  9.950   -24.045 1.00 154.34 ? 59  ARG Z NH1 1 
ATOM   9438  N NH2 . ARG I  3 44  ? 13.720  8.740   -24.391 1.00 160.32 ? 59  ARG Z NH2 1 
ATOM   9439  N N   . VAL I  3 45  ? 16.941  13.375  -20.391 1.00 106.68 ? 60  VAL Z N   1 
ATOM   9440  C CA  . VAL I  3 45  ? 18.097  12.897  -19.641 1.00 106.76 ? 60  VAL Z CA  1 
ATOM   9441  C C   . VAL I  3 45  ? 18.987  14.088  -19.304 1.00 109.52 ? 60  VAL Z C   1 
ATOM   9442  O O   . VAL I  3 45  ? 18.991  15.082  -20.031 1.00 110.35 ? 60  VAL Z O   1 
ATOM   9443  C CB  . VAL I  3 45  ? 18.949  11.882  -20.465 1.00 117.13 ? 60  VAL Z CB  1 
ATOM   9444  C CG1 . VAL I  3 45  ? 19.724  10.935  -19.553 1.00 116.95 ? 60  VAL Z CG1 1 
ATOM   9445  C CG2 . VAL I  3 45  ? 18.123  11.107  -21.489 1.00 122.09 ? 60  VAL Z CG2 1 
ATOM   9446  N N   . ILE I  3 46  ? 19.781  13.959  -18.237 1.00 103.86 ? 61  ILE Z N   1 
ATOM   9447  C CA  . ILE I  3 46  ? 20.816  14.911  -17.862 1.00 101.72 ? 61  ILE Z CA  1 
ATOM   9448  C C   . ILE I  3 46  ? 22.095  14.043  -17.911 1.00 110.74 ? 61  ILE Z C   1 
ATOM   9449  O O   . ILE I  3 46  ? 22.458  13.401  -16.921 1.00 110.25 ? 61  ILE Z O   1 
ATOM   9450  C CB  . ILE I  3 46  ? 20.509  15.656  -16.529 1.00 98.33  ? 61  ILE Z CB  1 
ATOM   9451  C CG1 . ILE I  3 46  ? 19.388  16.697  -16.770 1.00 96.38  ? 61  ILE Z CG1 1 
ATOM   9452  C CG2 . ILE I  3 46  ? 21.752  16.348  -15.979 1.00 97.40  ? 61  ILE Z CG2 1 
ATOM   9453  C CD1 . ILE I  3 46  ? 18.752  17.328  -15.530 1.00 96.87  ? 61  ILE Z CD1 1 
ATOM   9454  N N   . GLN I  3 47  ? 22.679  13.925  -19.133 1.00 111.33 ? 62  GLN Z N   1 
ATOM   9455  C CA  . GLN I  3 47  ? 23.831  13.088  -19.470 1.00 115.56 ? 62  GLN Z CA  1 
ATOM   9456  C C   . GLN I  3 47  ? 24.970  13.146  -18.458 1.00 117.86 ? 62  GLN Z C   1 
ATOM   9457  O O   . GLN I  3 47  ? 25.240  14.206  -17.906 1.00 113.02 ? 62  GLN Z O   1 
ATOM   9458  C CB  . GLN I  3 47  ? 24.342  13.405  -20.879 1.00 122.04 ? 62  GLN Z CB  1 
ATOM   9459  C CG  . GLN I  3 47  ? 24.759  12.154  -21.650 1.00 142.83 ? 62  GLN Z CG  1 
ATOM   9460  C CD  . GLN I  3 47  ? 26.053  12.334  -22.411 1.00 166.07 ? 62  GLN Z CD  1 
ATOM   9461  O OE1 . GLN I  3 47  ? 26.062  12.592  -23.619 1.00 165.71 ? 62  GLN Z OE1 1 
ATOM   9462  N NE2 . GLN I  3 47  ? 27.178  12.166  -21.730 1.00 157.24 ? 62  GLN Z NE2 1 
ATOM   9463  N N   . LYS I  3 48  ? 25.617  11.983  -18.220 1.00 118.79 ? 63  LYS Z N   1 
ATOM   9464  C CA  . LYS I  3 48  ? 26.739  11.723  -17.300 1.00 118.71 ? 63  LYS Z CA  1 
ATOM   9465  C C   . LYS I  3 48  ? 27.724  12.897  -17.168 1.00 122.85 ? 63  LYS Z C   1 
ATOM   9466  O O   . LYS I  3 48  ? 28.296  13.340  -18.169 1.00 126.02 ? 63  LYS Z O   1 
ATOM   9467  C CB  . LYS I  3 48  ? 27.478  10.438  -17.729 1.00 126.86 ? 63  LYS Z CB  1 
ATOM   9468  C CG  . LYS I  3 48  ? 28.084  9.641   -16.586 1.00 135.66 ? 63  LYS Z CG  1 
ATOM   9469  C CD  . LYS I  3 48  ? 28.582  8.302   -17.092 1.00 152.13 ? 63  LYS Z CD  1 
ATOM   9470  C CE  . LYS I  3 48  ? 29.225  7.449   -16.026 1.00 161.04 ? 63  LYS Z CE  1 
ATOM   9471  N NZ  . LYS I  3 48  ? 29.746  6.170   -16.592 1.00 168.34 ? 63  LYS Z NZ  1 
ATOM   9472  N N   . GLY I  3 49  ? 27.872  13.400  -15.940 1.00 115.47 ? 64  GLY Z N   1 
ATOM   9473  C CA  . GLY I  3 49  ? 28.748  14.522  -15.611 1.00 113.97 ? 64  GLY Z CA  1 
ATOM   9474  C C   . GLY I  3 49  ? 28.485  15.779  -16.413 1.00 118.31 ? 64  GLY Z C   1 
ATOM   9475  O O   . GLY I  3 49  ? 29.427  16.394  -16.919 1.00 121.42 ? 64  GLY Z O   1 
ATOM   9476  N N   . ALA I  3 50  ? 27.201  16.145  -16.555 1.00 111.78 ? 65  ALA Z N   1 
ATOM   9477  C CA  . ALA I  3 50  ? 26.730  17.276  -17.354 1.00 111.32 ? 65  ALA Z CA  1 
ATOM   9478  C C   . ALA I  3 50  ? 27.394  18.605  -17.038 1.00 112.95 ? 65  ALA Z C   1 
ATOM   9479  O O   . ALA I  3 50  ? 27.899  19.261  -17.949 1.00 115.24 ? 65  ALA Z O   1 
ATOM   9480  C CB  . ALA I  3 50  ? 25.213  17.406  -17.242 1.00 108.90 ? 65  ALA Z CB  1 
ATOM   9481  N N   . PHE I  3 51  ? 27.386  18.996  -15.758 1.00 105.46 ? 66  PHE Z N   1 
ATOM   9482  C CA  . PHE I  3 51  ? 27.915  20.273  -15.290 1.00 103.57 ? 66  PHE Z CA  1 
ATOM   9483  C C   . PHE I  3 51  ? 29.311  20.155  -14.676 1.00 110.04 ? 66  PHE Z C   1 
ATOM   9484  O O   . PHE I  3 51  ? 29.795  21.114  -14.074 1.00 108.71 ? 66  PHE Z O   1 
ATOM   9485  C CB  . PHE I  3 51  ? 26.919  20.940  -14.316 1.00 99.88  ? 66  PHE Z CB  1 
ATOM   9486  C CG  . PHE I  3 51  ? 25.463  20.715  -14.651 1.00 99.85  ? 66  PHE Z CG  1 
ATOM   9487  C CD1 . PHE I  3 51  ? 24.866  21.379  -15.716 1.00 104.30 ? 66  PHE Z CD1 1 
ATOM   9488  C CD2 . PHE I  3 51  ? 24.695  19.825  -13.914 1.00 100.04 ? 66  PHE Z CD2 1 
ATOM   9489  C CE1 . PHE I  3 51  ? 23.528  21.148  -16.044 1.00 104.77 ? 66  PHE Z CE1 1 
ATOM   9490  C CE2 . PHE I  3 51  ? 23.351  19.600  -14.237 1.00 102.29 ? 66  PHE Z CE2 1 
ATOM   9491  C CZ  . PHE I  3 51  ? 22.774  20.270  -15.295 1.00 101.78 ? 66  PHE Z CZ  1 
ATOM   9492  N N   . SER I  3 52  ? 29.975  19.000  -14.857 1.00 110.20 ? 67  SER Z N   1 
ATOM   9493  C CA  . SER I  3 52  ? 31.322  18.768  -14.335 1.00 111.95 ? 67  SER Z CA  1 
ATOM   9494  C C   . SER I  3 52  ? 32.361  19.681  -14.967 1.00 117.50 ? 67  SER Z C   1 
ATOM   9495  O O   . SER I  3 52  ? 32.559  19.646  -16.183 1.00 121.02 ? 67  SER Z O   1 
ATOM   9496  C CB  . SER I  3 52  ? 31.720  17.303  -14.484 1.00 120.29 ? 67  SER Z CB  1 
ATOM   9497  O OG  . SER I  3 52  ? 30.813  16.480  -13.771 1.00 129.13 ? 67  SER Z OG  1 
ATOM   9498  N N   . GLY I  3 53  ? 32.974  20.511  -14.127 1.00 111.74 ? 68  GLY Z N   1 
ATOM   9499  C CA  . GLY I  3 53  ? 34.027  21.444  -14.517 1.00 114.48 ? 68  GLY Z CA  1 
ATOM   9500  C C   . GLY I  3 53  ? 33.582  22.845  -14.882 1.00 117.30 ? 68  GLY Z C   1 
ATOM   9501  O O   . GLY I  3 53  ? 34.146  23.443  -15.807 1.00 119.91 ? 68  GLY Z O   1 
ATOM   9502  N N   . PHE I  3 54  ? 32.586  23.394  -14.142 1.00 109.64 ? 69  PHE Z N   1 
ATOM   9503  C CA  . PHE I  3 54  ? 32.082  24.749  -14.383 1.00 108.23 ? 69  PHE Z CA  1 
ATOM   9504  C C   . PHE I  3 54  ? 32.556  25.782  -13.354 1.00 109.20 ? 69  PHE Z C   1 
ATOM   9505  O O   . PHE I  3 54  ? 31.908  26.820  -13.200 1.00 105.86 ? 69  PHE Z O   1 
ATOM   9506  C CB  . PHE I  3 54  ? 30.567  24.760  -14.524 1.00 107.21 ? 69  PHE Z CB  1 
ATOM   9507  C CG  . PHE I  3 54  ? 30.101  24.604  -15.949 1.00 112.59 ? 69  PHE Z CG  1 
ATOM   9508  C CD1 . PHE I  3 54  ? 30.096  25.687  -16.819 1.00 118.36 ? 69  PHE Z CD1 1 
ATOM   9509  C CD2 . PHE I  3 54  ? 29.657  23.376  -16.420 1.00 116.61 ? 69  PHE Z CD2 1 
ATOM   9510  C CE1 . PHE I  3 54  ? 29.669  25.539  -18.141 1.00 122.83 ? 69  PHE Z CE1 1 
ATOM   9511  C CE2 . PHE I  3 54  ? 29.222  23.231  -17.738 1.00 123.08 ? 69  PHE Z CE2 1 
ATOM   9512  C CZ  . PHE I  3 54  ? 29.235  24.313  -18.591 1.00 123.33 ? 69  PHE Z CZ  1 
ATOM   9513  N N   . GLY I  3 55  ? 33.713  25.480  -12.737 1.00 106.96 ? 70  GLY Z N   1 
ATOM   9514  C CA  . GLY I  3 55  ? 34.503  26.221  -11.749 1.00 105.77 ? 70  GLY Z CA  1 
ATOM   9515  C C   . GLY I  3 55  ? 33.925  27.369  -10.946 1.00 105.79 ? 70  GLY Z C   1 
ATOM   9516  O O   . GLY I  3 55  ? 34.046  27.382  -9.720  1.00 102.43 ? 70  GLY Z O   1 
ATOM   9517  N N   . ASP I  3 56  ? 33.389  28.381  -11.637 1.00 103.38 ? 71  ASP Z N   1 
ATOM   9518  C CA  . ASP I  3 56  ? 32.792  29.589  -11.073 1.00 100.63 ? 71  ASP Z CA  1 
ATOM   9519  C C   . ASP I  3 56  ? 31.361  29.359  -10.583 1.00 100.67 ? 71  ASP Z C   1 
ATOM   9520  O O   . ASP I  3 56  ? 30.952  30.015  -9.623  1.00 98.34  ? 71  ASP Z O   1 
ATOM   9521  C CB  . ASP I  3 56  ? 32.787  30.710  -12.136 1.00 105.25 ? 71  ASP Z CB  1 
ATOM   9522  C CG  . ASP I  3 56  ? 34.137  31.305  -12.534 1.00 116.88 ? 71  ASP Z CG  1 
ATOM   9523  O OD1 . ASP I  3 56  ? 35.178  30.621  -12.353 1.00 117.94 ? 71  ASP Z OD1 1 
ATOM   9524  O OD2 . ASP I  3 56  ? 34.148  32.426  -13.074 1.00 124.24 ? 71  ASP Z OD2 1 
ATOM   9525  N N   . LEU I  3 57  ? 30.605  28.449  -11.266 1.00 95.99  ? 72  LEU Z N   1 
ATOM   9526  C CA  . LEU I  3 57  ? 29.184  28.095  -11.083 1.00 91.10  ? 72  LEU Z CA  1 
ATOM   9527  C C   . LEU I  3 57  ? 28.743  27.947  -9.627  1.00 89.14  ? 72  LEU Z C   1 
ATOM   9528  O O   . LEU I  3 57  ? 29.146  27.020  -8.927  1.00 88.72  ? 72  LEU Z O   1 
ATOM   9529  C CB  . LEU I  3 57  ? 28.844  26.828  -11.900 1.00 92.17  ? 72  LEU Z CB  1 
ATOM   9530  C CG  . LEU I  3 57  ? 27.378  26.358  -12.011 1.00 94.60  ? 72  LEU Z CG  1 
ATOM   9531  C CD1 . LEU I  3 57  ? 26.453  27.446  -12.524 1.00 94.65  ? 72  LEU Z CD1 1 
ATOM   9532  C CD2 . LEU I  3 57  ? 27.262  25.198  -12.967 1.00 99.15  ? 72  LEU Z CD2 1 
ATOM   9533  N N   . GLU I  3 58  ? 27.872  28.856  -9.199  1.00 80.96  ? 73  GLU Z N   1 
ATOM   9534  C CA  . GLU I  3 58  ? 27.348  28.893  -7.842  1.00 75.80  ? 73  GLU Z CA  1 
ATOM   9535  C C   . GLU I  3 58  ? 25.943  28.289  -7.690  1.00 74.33  ? 73  GLU Z C   1 
ATOM   9536  O O   . GLU I  3 58  ? 25.680  27.675  -6.663  1.00 71.46  ? 73  GLU Z O   1 
ATOM   9537  C CB  . GLU I  3 58  ? 27.360  30.334  -7.321  1.00 76.67  ? 73  GLU Z CB  1 
ATOM   9538  C CG  . GLU I  3 58  ? 28.732  30.971  -7.217  1.00 86.46  ? 73  GLU Z CG  1 
ATOM   9539  C CD  . GLU I  3 58  ? 28.755  32.489  -7.208  1.00 106.37 ? 73  GLU Z CD  1 
ATOM   9540  O OE1 . GLU I  3 58  ? 27.684  33.106  -6.996  1.00 101.63 ? 73  GLU Z OE1 1 
ATOM   9541  O OE2 . GLU I  3 58  ? 29.852  33.065  -7.397  1.00 101.62 ? 73  GLU Z OE2 1 
ATOM   9542  N N   . LYS I  3 59  ? 25.033  28.496  -8.673  1.00 70.20  ? 74  LYS Z N   1 
ATOM   9543  C CA  . LYS I  3 59  ? 23.629  28.023  -8.617  1.00 66.96  ? 74  LYS Z CA  1 
ATOM   9544  C C   . LYS I  3 59  ? 23.169  27.263  -9.882  1.00 73.84  ? 74  LYS Z C   1 
ATOM   9545  O O   . LYS I  3 59  ? 23.413  27.731  -10.995 1.00 76.84  ? 74  LYS Z O   1 
ATOM   9546  C CB  . LYS I  3 59  ? 22.659  29.214  -8.429  1.00 66.64  ? 74  LYS Z CB  1 
ATOM   9547  C CG  . LYS I  3 59  ? 22.869  30.103  -7.219  1.00 66.15  ? 74  LYS Z CG  1 
ATOM   9548  C CD  . LYS I  3 59  ? 21.931  31.304  -7.299  1.00 73.05  ? 74  LYS Z CD  1 
ATOM   9549  C CE  . LYS I  3 59  ? 22.089  32.290  -6.155  1.00 85.81  ? 74  LYS Z CE  1 
ATOM   9550  N NZ  . LYS I  3 59  ? 21.364  31.875  -4.918  1.00 88.66  ? 74  LYS Z NZ  1 
ATOM   9551  N N   . ILE I  3 60  ? 22.426  26.149  -9.710  1.00 69.61  ? 75  ILE Z N   1 
ATOM   9552  C CA  . ILE I  3 60  ? 21.857  25.366  -10.828 1.00 71.40  ? 75  ILE Z CA  1 
ATOM   9553  C C   . ILE I  3 60  ? 20.333  25.257  -10.684 1.00 73.33  ? 75  ILE Z C   1 
ATOM   9554  O O   . ILE I  3 60  ? 19.854  24.815  -9.636  1.00 69.91  ? 75  ILE Z O   1 
ATOM   9555  C CB  . ILE I  3 60  ? 22.505  23.962  -10.991 1.00 76.10  ? 75  ILE Z CB  1 
ATOM   9556  C CG1 . ILE I  3 60  ? 23.972  24.063  -11.447 1.00 79.62  ? 75  ILE Z CG1 1 
ATOM   9557  C CG2 . ILE I  3 60  ? 21.683  23.071  -11.943 1.00 77.90  ? 75  ILE Z CG2 1 
ATOM   9558  C CD1 . ILE I  3 60  ? 24.769  22.725  -11.346 1.00 89.46  ? 75  ILE Z CD1 1 
ATOM   9559  N N   . GLU I  3 61  ? 19.585  25.625  -11.756 1.00 71.62  ? 76  GLU Z N   1 
ATOM   9560  C CA  . GLU I  3 61  ? 18.117  25.567  -11.830 1.00 69.58  ? 76  GLU Z CA  1 
ATOM   9561  C C   . GLU I  3 61  ? 17.698  24.573  -12.915 1.00 77.03  ? 76  GLU Z C   1 
ATOM   9562  O O   . GLU I  3 61  ? 18.222  24.616  -14.034 1.00 80.32  ? 76  GLU Z O   1 
ATOM   9563  C CB  . GLU I  3 61  ? 17.515  26.964  -12.125 1.00 70.13  ? 76  GLU Z CB  1 
ATOM   9564  C CG  . GLU I  3 61  ? 16.065  27.127  -11.690 1.00 73.10  ? 76  GLU Z CG  1 
ATOM   9565  C CD  . GLU I  3 61  ? 15.286  28.283  -12.300 1.00 89.95  ? 76  GLU Z CD  1 
ATOM   9566  O OE1 . GLU I  3 61  ? 15.671  29.458  -12.101 1.00 86.36  ? 76  GLU Z OE1 1 
ATOM   9567  O OE2 . GLU I  3 61  ? 14.240  28.011  -12.928 1.00 85.65  ? 76  GLU Z OE2 1 
ATOM   9568  N N   . ILE I  3 62  ? 16.785  23.657  -12.556 1.00 72.62  ? 77  ILE Z N   1 
ATOM   9569  C CA  . ILE I  3 62  ? 16.157  22.651  -13.425 1.00 75.11  ? 77  ILE Z CA  1 
ATOM   9570  C C   . ILE I  3 62  ? 14.644  22.651  -13.059 1.00 78.45  ? 77  ILE Z C   1 
ATOM   9571  O O   . ILE I  3 62  ? 14.202  21.957  -12.134 1.00 75.15  ? 77  ILE Z O   1 
ATOM   9572  C CB  . ILE I  3 62  ? 16.821  21.239  -13.350 1.00 79.35  ? 77  ILE Z CB  1 
ATOM   9573  C CG1 . ILE I  3 62  ? 18.321  21.284  -13.694 1.00 81.93  ? 77  ILE Z CG1 1 
ATOM   9574  C CG2 . ILE I  3 62  ? 16.106  20.265  -14.274 1.00 82.59  ? 77  ILE Z CG2 1 
ATOM   9575  C CD1 . ILE I  3 62  ? 19.177  20.267  -12.950 1.00 89.62  ? 77  ILE Z CD1 1 
ATOM   9576  N N   . SER I  3 63  ? 13.876  23.487  -13.756 1.00 77.32  ? 78  SER Z N   1 
ATOM   9577  C CA  . SER I  3 63  ? 12.455  23.626  -13.484 1.00 76.20  ? 78  SER Z CA  1 
ATOM   9578  C C   . SER I  3 63  ? 11.551  23.447  -14.708 1.00 83.05  ? 78  SER Z C   1 
ATOM   9579  O O   . SER I  3 63  ? 11.964  23.707  -15.839 1.00 85.77  ? 78  SER Z O   1 
ATOM   9580  C CB  . SER I  3 63  ? 12.171  24.954  -12.783 1.00 78.00  ? 78  SER Z CB  1 
ATOM   9581  O OG  . SER I  3 63  ? 12.432  26.078  -13.608 1.00 88.83  ? 78  SER Z OG  1 
ATOM   9582  N N   . GLN I  3 64  ? 10.309  22.995  -14.451 1.00 78.92  ? 79  GLN Z N   1 
ATOM   9583  C CA  . GLN I  3 64  ? 9.216   22.772  -15.403 1.00 81.52  ? 79  GLN Z CA  1 
ATOM   9584  C C   . GLN I  3 64  ? 9.652   21.985  -16.646 1.00 90.38  ? 79  GLN Z C   1 
ATOM   9585  O O   . GLN I  3 64  ? 9.679   22.511  -17.759 1.00 92.99  ? 79  GLN Z O   1 
ATOM   9586  C CB  . GLN I  3 64  ? 8.512   24.092  -15.750 1.00 82.72  ? 79  GLN Z CB  1 
ATOM   9587  C CG  . GLN I  3 64  ? 7.614   24.585  -14.616 1.00 82.40  ? 79  GLN Z CG  1 
ATOM   9588  C CD  . GLN I  3 64  ? 7.614   26.082  -14.492 1.00 90.91  ? 79  GLN Z CD  1 
ATOM   9589  O OE1 . GLN I  3 64  ? 6.736   26.763  -15.022 1.00 80.00  ? 79  GLN Z OE1 1 
ATOM   9590  N NE2 . GLN I  3 64  ? 8.592   26.628  -13.770 1.00 83.49  ? 79  GLN Z NE2 1 
ATOM   9591  N N   . ASN I  3 65  ? 10.002  20.710  -16.435 1.00 88.21  ? 80  ASN Z N   1 
ATOM   9592  C CA  . ASN I  3 65  ? 10.436  19.811  -17.502 1.00 92.77  ? 80  ASN Z CA  1 
ATOM   9593  C C   . ASN I  3 65  ? 9.575   18.553  -17.471 1.00 98.07  ? 80  ASN Z C   1 
ATOM   9594  O O   . ASN I  3 65  ? 9.849   17.581  -16.753 1.00 96.40  ? 80  ASN Z O   1 
ATOM   9595  C CB  . ASN I  3 65  ? 11.944  19.536  -17.419 1.00 94.60  ? 80  ASN Z CB  1 
ATOM   9596  C CG  . ASN I  3 65  ? 12.761  20.804  -17.280 1.00 110.23 ? 80  ASN Z CG  1 
ATOM   9597  O OD1 . ASN I  3 65  ? 12.834  21.630  -18.198 1.00 108.60 ? 80  ASN Z OD1 1 
ATOM   9598  N ND2 . ASN I  3 65  ? 13.310  21.031  -16.095 1.00 92.88  ? 80  ASN Z ND2 1 
ATOM   9599  N N   . ASP I  3 66  ? 8.485   18.624  -18.232 1.00 97.75  ? 81  ASP Z N   1 
ATOM   9600  C CA  . ASP I  3 66  ? 7.461   17.596  -18.332 1.00 100.42 ? 81  ASP Z CA  1 
ATOM   9601  C C   . ASP I  3 66  ? 7.920   16.287  -18.976 1.00 108.15 ? 81  ASP Z C   1 
ATOM   9602  O O   . ASP I  3 66  ? 7.198   15.295  -18.882 1.00 109.22 ? 81  ASP Z O   1 
ATOM   9603  C CB  . ASP I  3 66  ? 6.211   18.150  -19.052 1.00 105.09 ? 81  ASP Z CB  1 
ATOM   9604  C CG  . ASP I  3 66  ? 6.449   18.853  -20.383 1.00 122.38 ? 81  ASP Z CG  1 
ATOM   9605  O OD1 . ASP I  3 66  ? 7.587   18.788  -20.899 1.00 125.52 ? 81  ASP Z OD1 1 
ATOM   9606  O OD2 . ASP I  3 66  ? 5.492   19.466  -20.909 1.00 130.16 ? 81  ASP Z OD2 1 
ATOM   9607  N N   . VAL I  3 67  ? 9.099   16.268  -19.623 1.00 107.28 ? 82  VAL Z N   1 
ATOM   9608  C CA  . VAL I  3 67  ? 9.589   15.052  -20.286 1.00 111.60 ? 82  VAL Z CA  1 
ATOM   9609  C C   . VAL I  3 67  ? 10.934  14.543  -19.704 1.00 113.70 ? 82  VAL Z C   1 
ATOM   9610  O O   . VAL I  3 67  ? 11.494  13.591  -20.249 1.00 117.69 ? 82  VAL Z O   1 
ATOM   9611  C CB  . VAL I  3 67  ? 9.626   15.158  -21.838 1.00 120.79 ? 82  VAL Z CB  1 
ATOM   9612  C CG1 . VAL I  3 67  ? 8.222   15.318  -22.418 1.00 122.50 ? 82  VAL Z CG1 1 
ATOM   9613  C CG2 . VAL I  3 67  ? 10.543  16.279  -22.310 1.00 120.17 ? 82  VAL Z CG2 1 
ATOM   9614  N N   . LEU I  3 68  ? 11.421  15.121  -18.589 1.00 104.45 ? 83  LEU Z N   1 
ATOM   9615  C CA  . LEU I  3 68  ? 12.653  14.633  -17.960 1.00 103.36 ? 83  LEU Z CA  1 
ATOM   9616  C C   . LEU I  3 68  ? 12.354  13.412  -17.083 1.00 106.28 ? 83  LEU Z C   1 
ATOM   9617  O O   . LEU I  3 68  ? 11.405  13.455  -16.304 1.00 103.65 ? 83  LEU Z O   1 
ATOM   9618  C CB  . LEU I  3 68  ? 13.356  15.745  -17.160 1.00 98.82  ? 83  LEU Z CB  1 
ATOM   9619  C CG  . LEU I  3 68  ? 14.672  15.373  -16.447 1.00 103.14 ? 83  LEU Z CG  1 
ATOM   9620  C CD1 . LEU I  3 68  ? 15.856  15.298  -17.419 1.00 106.80 ? 83  LEU Z CD1 1 
ATOM   9621  C CD2 . LEU I  3 68  ? 14.973  16.353  -15.332 1.00 101.40 ? 83  LEU Z CD2 1 
ATOM   9622  N N   . GLU I  3 69  ? 13.160  12.334  -17.217 1.00 105.15 ? 84  GLU Z N   1 
ATOM   9623  C CA  . GLU I  3 69  ? 13.004  11.073  -16.479 1.00 105.35 ? 84  GLU Z CA  1 
ATOM   9624  C C   . GLU I  3 69  ? 14.237  10.640  -15.666 1.00 108.53 ? 84  GLU Z C   1 
ATOM   9625  O O   . GLU I  3 69  ? 14.068  9.943   -14.660 1.00 106.98 ? 84  GLU Z O   1 
ATOM   9626  C CB  . GLU I  3 69  ? 12.649  9.931   -17.440 1.00 112.69 ? 84  GLU Z CB  1 
ATOM   9627  C CG  . GLU I  3 69  ? 11.297  10.041  -18.121 1.00 119.38 ? 84  GLU Z CG  1 
ATOM   9628  C CD  . GLU I  3 69  ? 11.233  9.320   -19.455 1.00 130.56 ? 84  GLU Z CD  1 
ATOM   9629  O OE1 . GLU I  3 69  ? 11.750  8.182   -19.550 1.00 104.04 ? 84  GLU Z OE1 1 
ATOM   9630  O OE2 . GLU I  3 69  ? 10.666  9.899   -20.410 1.00 124.42 ? 84  GLU Z OE2 1 
ATOM   9631  N N   . VAL I  3 70  ? 15.467  10.980  -16.128 1.00 106.21 ? 85  VAL Z N   1 
ATOM   9632  C CA  . VAL I  3 70  ? 16.712  10.554  -15.469 1.00 105.85 ? 85  VAL Z CA  1 
ATOM   9633  C C   . VAL I  3 70  ? 17.815  11.584  -15.444 1.00 108.72 ? 85  VAL Z C   1 
ATOM   9634  O O   . VAL I  3 70  ? 18.118  12.207  -16.461 1.00 110.02 ? 85  VAL Z O   1 
ATOM   9635  C CB  . VAL I  3 70  ? 17.292  9.229   -16.027 1.00 115.44 ? 85  VAL Z CB  1 
ATOM   9636  C CG1 . VAL I  3 70  ? 16.695  8.017   -15.329 1.00 116.71 ? 85  VAL Z CG1 1 
ATOM   9637  C CG2 . VAL I  3 70  ? 17.151  9.132   -17.545 1.00 120.23 ? 85  VAL Z CG2 1 
ATOM   9638  N N   . ILE I  3 71  ? 18.474  11.685  -14.283 1.00 102.85 ? 86  ILE Z N   1 
ATOM   9639  C CA  . ILE I  3 71  ? 19.656  12.508  -14.046 1.00 101.23 ? 86  ILE Z CA  1 
ATOM   9640  C C   . ILE I  3 71  ? 20.764  11.464  -13.826 1.00 109.98 ? 86  ILE Z C   1 
ATOM   9641  O O   . ILE I  3 71  ? 20.720  10.720  -12.840 1.00 109.20 ? 86  ILE Z O   1 
ATOM   9642  C CB  . ILE I  3 71  ? 19.478  13.496  -12.846 1.00 98.04  ? 86  ILE Z CB  1 
ATOM   9643  C CG1 . ILE I  3 71  ? 18.319  14.484  -13.102 1.00 95.47  ? 86  ILE Z CG1 1 
ATOM   9644  C CG2 . ILE I  3 71  ? 20.783  14.253  -12.558 1.00 97.39  ? 86  ILE Z CG2 1 
ATOM   9645  C CD1 . ILE I  3 71  ? 17.745  15.186  -11.841 1.00 95.95  ? 86  ILE Z CD1 1 
ATOM   9646  N N   . GLU I  3 72  ? 21.701  11.357  -14.788 1.00 111.27 ? 87  GLU Z N   1 
ATOM   9647  C CA  . GLU I  3 72  ? 22.793  10.376  -14.768 1.00 115.52 ? 87  GLU Z CA  1 
ATOM   9648  C C   . GLU I  3 72  ? 23.858  10.652  -13.677 1.00 118.02 ? 87  GLU Z C   1 
ATOM   9649  O O   . GLU I  3 72  ? 23.800  11.675  -12.988 1.00 113.19 ? 87  GLU Z O   1 
ATOM   9650  C CB  . GLU I  3 72  ? 23.431  10.235  -16.167 1.00 122.38 ? 87  GLU Z CB  1 
ATOM   9651  C CG  . GLU I  3 72  ? 22.627  9.384   -17.141 1.00 136.34 ? 87  GLU Z CG  1 
ATOM   9652  C CD  . GLU I  3 72  ? 22.803  7.879   -17.023 1.00 162.39 ? 87  GLU Z CD  1 
ATOM   9653  O OE1 . GLU I  3 72  ? 23.962  7.402   -17.074 1.00 162.62 ? 87  GLU Z OE1 1 
ATOM   9654  O OE2 . GLU I  3 72  ? 21.774  7.171   -16.941 1.00 152.87 ? 87  GLU Z OE2 1 
ATOM   9655  N N   . ALA I  3 73  ? 24.807  9.702   -13.508 1.00 118.16 ? 88  ALA Z N   1 
ATOM   9656  C CA  . ALA I  3 73  ? 25.886  9.736   -12.519 1.00 116.47 ? 88  ALA Z CA  1 
ATOM   9657  C C   . ALA I  3 73  ? 26.896  10.846  -12.767 1.00 119.25 ? 88  ALA Z C   1 
ATOM   9658  O O   . ALA I  3 73  ? 27.031  11.324  -13.895 1.00 121.19 ? 88  ALA Z O   1 
ATOM   9659  C CB  . ALA I  3 73  ? 26.595  8.395   -12.492 1.00 122.28 ? 88  ALA Z CB  1 
ATOM   9660  N N   . ASP I  3 74  ? 27.607  11.252  -11.694 1.00 112.41 ? 89  ASP Z N   1 
ATOM   9661  C CA  . ASP I  3 74  ? 28.661  12.271  -11.680 1.00 111.18 ? 89  ASP Z CA  1 
ATOM   9662  C C   . ASP I  3 74  ? 28.204  13.649  -12.200 1.00 110.88 ? 89  ASP Z C   1 
ATOM   9663  O O   . ASP I  3 74  ? 29.045  14.526  -12.399 1.00 111.11 ? 89  ASP Z O   1 
ATOM   9664  C CB  . ASP I  3 74  ? 29.919  11.779  -12.435 1.00 119.04 ? 89  ASP Z CB  1 
ATOM   9665  C CG  . ASP I  3 74  ? 30.528  10.461  -11.968 1.00 135.62 ? 89  ASP Z CG  1 
ATOM   9666  O OD1 . ASP I  3 74  ? 29.770  9.485   -11.791 1.00 136.86 ? 89  ASP Z OD1 1 
ATOM   9667  O OD2 . ASP I  3 74  ? 31.777  10.377  -11.892 1.00 145.29 ? 89  ASP Z OD2 1 
ATOM   9668  N N   . VAL I  3 75  ? 26.883  13.849  -12.400 1.00 103.45 ? 90  VAL Z N   1 
ATOM   9669  C CA  . VAL I  3 75  ? 26.307  15.093  -12.924 1.00 100.35 ? 90  VAL Z CA  1 
ATOM   9670  C C   . VAL I  3 75  ? 26.586  16.284  -12.008 1.00 99.26  ? 90  VAL Z C   1 
ATOM   9671  O O   . VAL I  3 75  ? 26.956  17.359  -12.493 1.00 99.26  ? 90  VAL Z O   1 
ATOM   9672  C CB  . VAL I  3 75  ? 24.816  14.917  -13.265 1.00 102.78 ? 90  VAL Z CB  1 
ATOM   9673  C CG1 . VAL I  3 75  ? 24.039  16.220  -13.138 1.00 98.31  ? 90  VAL Z CG1 1 
ATOM   9674  C CG2 . VAL I  3 75  ? 24.672  14.338  -14.663 1.00 107.58 ? 90  VAL Z CG2 1 
ATOM   9675  N N   . PHE I  3 76  ? 26.455  16.081  -10.697 1.00 91.53  ? 91  PHE Z N   1 
ATOM   9676  C CA  . PHE I  3 76  ? 26.748  17.126  -9.731  1.00 86.98  ? 91  PHE Z CA  1 
ATOM   9677  C C   . PHE I  3 76  ? 28.127  16.862  -9.089  1.00 91.53  ? 91  PHE Z C   1 
ATOM   9678  O O   . PHE I  3 76  ? 28.228  16.539  -7.902  1.00 88.49  ? 91  PHE Z O   1 
ATOM   9679  C CB  . PHE I  3 76  ? 25.578  17.310  -8.733  1.00 83.89  ? 91  PHE Z CB  1 
ATOM   9680  C CG  . PHE I  3 76  ? 24.283  17.756  -9.386  1.00 83.33  ? 91  PHE Z CG  1 
ATOM   9681  C CD1 . PHE I  3 76  ? 24.122  19.064  -9.831  1.00 84.47  ? 91  PHE Z CD1 1 
ATOM   9682  C CD2 . PHE I  3 76  ? 23.237  16.861  -9.577  1.00 85.41  ? 91  PHE Z CD2 1 
ATOM   9683  C CE1 . PHE I  3 76  ? 22.944  19.463  -10.466 1.00 84.48  ? 91  PHE Z CE1 1 
ATOM   9684  C CE2 . PHE I  3 76  ? 22.041  17.270  -10.182 1.00 86.74  ? 91  PHE Z CE2 1 
ATOM   9685  C CZ  . PHE I  3 76  ? 21.905  18.565  -10.628 1.00 83.74  ? 91  PHE Z CZ  1 
ATOM   9686  N N   . SER I  3 77  ? 29.188  16.940  -9.934  1.00 92.59  ? 92  SER Z N   1 
ATOM   9687  C CA  . SER I  3 77  ? 30.609  16.768  -9.572  1.00 95.04  ? 92  SER Z CA  1 
ATOM   9688  C C   . SER I  3 77  ? 31.454  17.888  -10.165 1.00 100.58 ? 92  SER Z C   1 
ATOM   9689  O O   . SER I  3 77  ? 31.034  18.503  -11.143 1.00 100.64 ? 92  SER Z O   1 
ATOM   9690  C CB  . SER I  3 77  ? 31.147  15.414  -10.031 1.00 103.49 ? 92  SER Z CB  1 
ATOM   9691  O OG  . SER I  3 77  ? 31.455  15.347  -11.414 1.00 116.71 ? 92  SER Z OG  1 
ATOM   9692  N N   . ASN I  3 78  ? 32.648  18.139  -9.579  1.00 98.99  ? 93  ASN Z N   1 
ATOM   9693  C CA  . ASN I  3 78  ? 33.619  19.166  -10.002 1.00 101.06 ? 93  ASN Z CA  1 
ATOM   9694  C C   . ASN I  3 78  ? 32.979  20.560  -10.106 1.00 102.13 ? 93  ASN Z C   1 
ATOM   9695  O O   . ASN I  3 78  ? 33.091  21.240  -11.133 1.00 103.74 ? 93  ASN Z O   1 
ATOM   9696  C CB  . ASN I  3 78  ? 34.356  18.759  -11.296 1.00 107.94 ? 93  ASN Z CB  1 
ATOM   9697  C CG  . ASN I  3 78  ? 34.963  17.373  -11.265 1.00 138.05 ? 93  ASN Z CG  1 
ATOM   9698  O OD1 . ASN I  3 78  ? 35.831  17.062  -10.443 1.00 132.49 ? 93  ASN Z OD1 1 
ATOM   9699  N ND2 . ASN I  3 78  ? 34.523  16.505  -12.170 1.00 133.01 ? 93  ASN Z ND2 1 
ATOM   9700  N N   . LEU I  3 79  ? 32.272  20.957  -9.035  1.00 94.02  ? 94  LEU Z N   1 
ATOM   9701  C CA  . LEU I  3 79  ? 31.585  22.244  -8.917  1.00 90.61  ? 94  LEU Z CA  1 
ATOM   9702  C C   . LEU I  3 79  ? 31.979  22.828  -7.550  1.00 91.94  ? 94  LEU Z C   1 
ATOM   9703  O O   . LEU I  3 79  ? 31.151  22.858  -6.638  1.00 88.07  ? 94  LEU Z O   1 
ATOM   9704  C CB  . LEU I  3 79  ? 30.060  22.032  -9.010  1.00 87.52  ? 94  LEU Z CB  1 
ATOM   9705  C CG  . LEU I  3 79  ? 29.503  21.499  -10.331 1.00 94.49  ? 94  LEU Z CG  1 
ATOM   9706  C CD1 . LEU I  3 79  ? 28.308  20.601  -10.093 1.00 93.09  ? 94  LEU Z CD1 1 
ATOM   9707  C CD2 . LEU I  3 79  ? 29.093  22.625  -11.235 1.00 96.62  ? 94  LEU Z CD2 1 
ATOM   9708  N N   . PRO I  3 80  ? 33.256  23.250  -7.366  1.00 91.12  ? 95  PRO Z N   1 
ATOM   9709  C CA  . PRO I  3 80  ? 33.693  23.732  -6.042  1.00 89.16  ? 95  PRO Z CA  1 
ATOM   9710  C C   . PRO I  3 80  ? 32.975  24.958  -5.481  1.00 88.58  ? 95  PRO Z C   1 
ATOM   9711  O O   . PRO I  3 80  ? 32.948  25.122  -4.261  1.00 85.93  ? 95  PRO Z O   1 
ATOM   9712  C CB  . PRO I  3 80  ? 35.187  24.007  -6.246  1.00 95.01  ? 95  PRO Z CB  1 
ATOM   9713  C CG  . PRO I  3 80  ? 35.332  24.236  -7.712  1.00 102.18 ? 95  PRO Z CG  1 
ATOM   9714  C CD  . PRO I  3 80  ? 34.387  23.265  -8.322  1.00 97.11  ? 95  PRO Z CD  1 
ATOM   9715  N N   . LYS I  3 81  ? 32.391  25.796  -6.350  1.00 84.73  ? 96  LYS Z N   1 
ATOM   9716  C CA  . LYS I  3 81  ? 31.682  27.011  -5.934  1.00 82.08  ? 96  LYS Z CA  1 
ATOM   9717  C C   . LYS I  3 81  ? 30.139  26.850  -5.818  1.00 81.79  ? 96  LYS Z C   1 
ATOM   9718  O O   . LYS I  3 81  ? 29.455  27.804  -5.416  1.00 79.76  ? 96  LYS Z O   1 
ATOM   9719  C CB  . LYS I  3 81  ? 32.050  28.186  -6.863  1.00 87.16  ? 96  LYS Z CB  1 
ATOM   9720  C CG  . LYS I  3 81  ? 33.459  28.721  -6.651  1.00 99.27  ? 96  LYS Z CG  1 
ATOM   9721  C CD  . LYS I  3 81  ? 33.670  30.042  -7.365  1.00 111.08 ? 96  LYS Z CD  1 
ATOM   9722  C CE  . LYS I  3 81  ? 34.998  30.666  -7.003  1.00 127.05 ? 96  LYS Z CE  1 
ATOM   9723  N NZ  . LYS I  3 81  ? 35.017  31.175  -5.600  1.00 132.26 ? 96  LYS Z NZ  1 
ATOM   9724  N N   . LEU I  3 82  ? 29.601  25.651  -6.147  1.00 76.39  ? 97  LEU Z N   1 
ATOM   9725  C CA  . LEU I  3 82  ? 28.160  25.396  -6.126  1.00 72.65  ? 97  LEU Z CA  1 
ATOM   9726  C C   . LEU I  3 82  ? 27.574  25.295  -4.719  1.00 74.35  ? 97  LEU Z C   1 
ATOM   9727  O O   . LEU I  3 82  ? 27.949  24.405  -3.955  1.00 74.54  ? 97  LEU Z O   1 
ATOM   9728  C CB  . LEU I  3 82  ? 27.810  24.166  -6.959  1.00 73.22  ? 97  LEU Z CB  1 
ATOM   9729  C CG  . LEU I  3 82  ? 26.343  23.872  -7.172  1.00 74.28  ? 97  LEU Z CG  1 
ATOM   9730  C CD1 . LEU I  3 82  ? 25.798  24.679  -8.319  1.00 75.49  ? 97  LEU Z CD1 1 
ATOM   9731  C CD2 . LEU I  3 82  ? 26.138  22.408  -7.434  1.00 75.62  ? 97  LEU Z CD2 1 
ATOM   9732  N N   . HIS I  3 83  ? 26.633  26.207  -4.402  1.00 67.62  ? 98  HIS Z N   1 
ATOM   9733  C CA  . HIS I  3 83  ? 25.953  26.280  -3.111  1.00 63.74  ? 98  HIS Z CA  1 
ATOM   9734  C C   . HIS I  3 83  ? 24.435  26.054  -3.223  1.00 63.03  ? 98  HIS Z C   1 
ATOM   9735  O O   . HIS I  3 83  ? 23.762  25.839  -2.209  1.00 59.33  ? 98  HIS Z O   1 
ATOM   9736  C CB  . HIS I  3 83  ? 26.262  27.625  -2.432  1.00 64.18  ? 98  HIS Z CB  1 
ATOM   9737  C CG  . HIS I  3 83  ? 25.603  28.791  -3.088  1.00 67.70  ? 98  HIS Z CG  1 
ATOM   9738  N ND1 . HIS I  3 83  ? 26.089  29.324  -4.262  1.00 72.42  ? 98  HIS Z ND1 1 
ATOM   9739  C CD2 . HIS I  3 83  ? 24.497  29.478  -2.718  1.00 67.53  ? 98  HIS Z CD2 1 
ATOM   9740  C CE1 . HIS I  3 83  ? 25.270  30.320  -4.569  1.00 71.29  ? 98  HIS Z CE1 1 
ATOM   9741  N NE2 . HIS I  3 83  ? 24.298  30.450  -3.669  1.00 68.69  ? 98  HIS Z NE2 1 
ATOM   9742  N N   . GLU I  3 84  ? 23.899  26.106  -4.449  1.00 59.82  ? 99  GLU Z N   1 
ATOM   9743  C CA  . GLU I  3 84  ? 22.469  25.955  -4.632  1.00 58.09  ? 99  GLU Z CA  1 
ATOM   9744  C C   . GLU I  3 84  ? 22.061  25.099  -5.864  1.00 64.41  ? 99  GLU Z C   1 
ATOM   9745  O O   . GLU I  3 84  ? 22.545  25.336  -6.979  1.00 66.62  ? 99  GLU Z O   1 
ATOM   9746  C CB  . GLU I  3 84  ? 21.830  27.346  -4.665  1.00 58.40  ? 99  GLU Z CB  1 
ATOM   9747  C CG  . GLU I  3 84  ? 20.316  27.351  -4.671  1.00 68.17  ? 99  GLU Z CG  1 
ATOM   9748  C CD  . GLU I  3 84  ? 19.749  28.716  -4.992  1.00 92.02  ? 99  GLU Z CD  1 
ATOM   9749  O OE1 . GLU I  3 84  ? 19.899  29.635  -4.151  1.00 78.88  ? 99  GLU Z OE1 1 
ATOM   9750  O OE2 . GLU I  3 84  ? 19.203  28.878  -6.109  1.00 87.59  ? 99  GLU Z OE2 1 
ATOM   9751  N N   . ILE I  3 85  ? 21.178  24.091  -5.627  1.00 59.36  ? 100 ILE Z N   1 
ATOM   9752  C CA  . ILE I  3 85  ? 20.586  23.223  -6.652  1.00 61.24  ? 100 ILE Z CA  1 
ATOM   9753  C C   . ILE I  3 85  ? 19.056  23.232  -6.477  1.00 66.10  ? 100 ILE Z C   1 
ATOM   9754  O O   . ILE I  3 85  ? 18.545  22.844  -5.415  1.00 64.17  ? 100 ILE Z O   1 
ATOM   9755  C CB  . ILE I  3 85  ? 21.126  21.756  -6.738  1.00 65.64  ? 100 ILE Z CB  1 
ATOM   9756  C CG1 . ILE I  3 85  ? 22.647  21.663  -6.579  1.00 67.95  ? 100 ILE Z CG1 1 
ATOM   9757  C CG2 . ILE I  3 85  ? 20.657  21.089  -8.042  1.00 67.18  ? 100 ILE Z CG2 1 
ATOM   9758  C CD1 . ILE I  3 85  ? 23.196  20.257  -6.310  1.00 75.75  ? 100 ILE Z CD1 1 
ATOM   9759  N N   . ARG I  3 86  ? 18.337  23.652  -7.535  1.00 64.42  ? 101 ARG Z N   1 
ATOM   9760  C CA  . ARG I  3 86  ? 16.876  23.687  -7.565  1.00 63.02  ? 101 ARG Z CA  1 
ATOM   9761  C C   . ARG I  3 86  ? 16.326  22.746  -8.664  1.00 69.66  ? 101 ARG Z C   1 
ATOM   9762  O O   . ARG I  3 86  ? 16.534  22.976  -9.861  1.00 71.89  ? 101 ARG Z O   1 
ATOM   9763  C CB  . ARG I  3 86  ? 16.350  25.130  -7.675  1.00 60.12  ? 101 ARG Z CB  1 
ATOM   9764  C CG  . ARG I  3 86  ? 16.491  25.924  -6.371  1.00 61.61  ? 101 ARG Z CG  1 
ATOM   9765  C CD  . ARG I  3 86  ? 15.612  27.168  -6.331  1.00 65.23  ? 101 ARG Z CD  1 
ATOM   9766  N NE  . ARG I  3 86  ? 16.170  28.250  -7.146  1.00 72.46  ? 101 ARG Z NE  1 
ATOM   9767  C CZ  . ARG I  3 86  ? 15.616  28.743  -8.253  1.00 84.10  ? 101 ARG Z CZ  1 
ATOM   9768  N NH1 . ARG I  3 86  ? 14.440  28.289  -8.677  1.00 74.23  ? 101 ARG Z NH1 1 
ATOM   9769  N NH2 . ARG I  3 86  ? 16.208  29.725  -8.916  1.00 65.59  ? 101 ARG Z NH2 1 
ATOM   9770  N N   . ILE I  3 87  ? 15.717  21.632  -8.221  1.00 65.01  ? 102 ILE Z N   1 
ATOM   9771  C CA  . ILE I  3 87  ? 15.094  20.586  -9.044  1.00 66.89  ? 102 ILE Z CA  1 
ATOM   9772  C C   . ILE I  3 87  ? 13.585  20.660  -8.730  1.00 67.90  ? 102 ILE Z C   1 
ATOM   9773  O O   . ILE I  3 87  ? 13.062  19.929  -7.886  1.00 65.57  ? 102 ILE Z O   1 
ATOM   9774  C CB  . ILE I  3 87  ? 15.733  19.168  -8.806  1.00 71.17  ? 102 ILE Z CB  1 
ATOM   9775  C CG1 . ILE I  3 87  ? 17.239  19.152  -9.167  1.00 71.93  ? 102 ILE Z CG1 1 
ATOM   9776  C CG2 . ILE I  3 87  ? 14.959  18.057  -9.569  1.00 75.02  ? 102 ILE Z CG2 1 
ATOM   9777  C CD1 . ILE I  3 87  ? 18.036  18.107  -8.463  1.00 70.27  ? 102 ILE Z CD1 1 
ATOM   9778  N N   . GLU I  3 88  ? 12.918  21.621  -9.379  1.00 64.11  ? 103 GLU Z N   1 
ATOM   9779  C CA  . GLU I  3 88  ? 11.508  21.953  -9.194  1.00 61.41  ? 103 GLU Z CA  1 
ATOM   9780  C C   . GLU I  3 88  ? 10.680  21.561  -10.388 1.00 66.44  ? 103 GLU Z C   1 
ATOM   9781  O O   . GLU I  3 88  ? 11.108  21.748  -11.522 1.00 68.13  ? 103 GLU Z O   1 
ATOM   9782  C CB  . GLU I  3 88  ? 11.337  23.474  -8.990  1.00 61.01  ? 103 GLU Z CB  1 
ATOM   9783  C CG  . GLU I  3 88  ? 12.159  24.115  -7.879  1.00 69.27  ? 103 GLU Z CG  1 
ATOM   9784  C CD  . GLU I  3 88  ? 11.724  25.533  -7.556  1.00 98.03  ? 103 GLU Z CD  1 
ATOM   9785  O OE1 . GLU I  3 88  ? 10.539  25.723  -7.195  1.00 107.11 ? 103 GLU Z OE1 1 
ATOM   9786  O OE2 . GLU I  3 88  ? 12.564  26.455  -7.663  1.00 91.55  ? 103 GLU Z OE2 1 
ATOM   9787  N N   . LYS I  3 89  ? 9.462   21.067  -10.126 1.00 63.17  ? 104 LYS Z N   1 
ATOM   9788  C CA  . LYS I  3 89  ? 8.437   20.733  -11.118 1.00 65.41  ? 104 LYS Z CA  1 
ATOM   9789  C C   . LYS I  3 89  ? 8.984   19.867  -12.278 1.00 73.45  ? 104 LYS Z C   1 
ATOM   9790  O O   . LYS I  3 89  ? 9.191   20.327  -13.406 1.00 74.81  ? 104 LYS Z O   1 
ATOM   9791  C CB  . LYS I  3 89  ? 7.712   22.012  -11.609 1.00 66.96  ? 104 LYS Z CB  1 
ATOM   9792  C CG  . LYS I  3 89  ? 7.297   22.953  -10.468 1.00 67.46  ? 104 LYS Z CG  1 
ATOM   9793  C CD  . LYS I  3 89  ? 7.196   24.420  -10.899 1.00 73.10  ? 104 LYS Z CD  1 
ATOM   9794  C CE  . LYS I  3 89  ? 8.440   25.250  -10.651 1.00 75.74  ? 104 LYS Z CE  1 
ATOM   9795  N NZ  . LYS I  3 89  ? 8.586   25.609  -9.219  1.00 82.02  ? 104 LYS Z NZ  1 
ATOM   9796  N N   . ALA I  3 90  ? 9.244   18.606  -11.953 1.00 71.53  ? 105 ALA Z N   1 
ATOM   9797  C CA  . ALA I  3 90  ? 9.721   17.598  -12.880 1.00 75.45  ? 105 ALA Z CA  1 
ATOM   9798  C C   . ALA I  3 90  ? 8.859   16.372  -12.606 1.00 80.91  ? 105 ALA Z C   1 
ATOM   9799  O O   . ALA I  3 90  ? 9.302   15.415  -11.972 1.00 80.80  ? 105 ALA Z O   1 
ATOM   9800  C CB  . ALA I  3 90  ? 11.187  17.318  -12.611 1.00 76.26  ? 105 ALA Z CB  1 
ATOM   9801  N N   . ASN I  3 91  ? 7.584   16.453  -13.038 1.00 79.31  ? 106 ASN Z N   1 
ATOM   9802  C CA  . ASN I  3 91  ? 6.531   15.453  -12.818 1.00 81.06  ? 106 ASN Z CA  1 
ATOM   9803  C C   . ASN I  3 91  ? 6.839   14.048  -13.333 1.00 90.22  ? 106 ASN Z C   1 
ATOM   9804  O O   . ASN I  3 91  ? 6.273   13.088  -12.807 1.00 90.48  ? 106 ASN Z O   1 
ATOM   9805  C CB  . ASN I  3 91  ? 5.199   15.929  -13.389 1.00 81.47  ? 106 ASN Z CB  1 
ATOM   9806  C CG  . ASN I  3 91  ? 5.118   15.929  -14.898 1.00 100.45 ? 106 ASN Z CG  1 
ATOM   9807  O OD1 . ASN I  3 91  ? 5.855   16.643  -15.584 1.00 87.35  ? 106 ASN Z OD1 1 
ATOM   9808  N ND2 . ASN I  3 91  ? 4.188   15.151  -15.444 1.00 97.79  ? 106 ASN Z ND2 1 
ATOM   9809  N N   . ASN I  3 92  ? 7.699   13.924  -14.363 1.00 90.51  ? 107 ASN Z N   1 
ATOM   9810  C CA  . ASN I  3 92  ? 8.006   12.619  -14.930 1.00 94.98  ? 107 ASN Z CA  1 
ATOM   9811  C C   . ASN I  3 92  ? 9.361   12.108  -14.512 1.00 100.63 ? 107 ASN Z C   1 
ATOM   9812  O O   . ASN I  3 92  ? 9.693   10.966  -14.827 1.00 105.04 ? 107 ASN Z O   1 
ATOM   9813  C CB  . ASN I  3 92  ? 7.821   12.604  -16.443 1.00 97.53  ? 107 ASN Z CB  1 
ATOM   9814  C CG  . ASN I  3 92  ? 6.385   12.334  -16.845 1.00 111.60 ? 107 ASN Z CG  1 
ATOM   9815  O OD1 . ASN I  3 92  ? 5.823   11.263  -16.574 1.00 107.76 ? 107 ASN Z OD1 1 
ATOM   9816  N ND2 . ASN I  3 92  ? 5.748   13.309  -17.480 1.00 97.86  ? 107 ASN Z ND2 1 
ATOM   9817  N N   . LEU I  3 93  ? 10.135  12.926  -13.776 1.00 93.71  ? 108 LEU Z N   1 
ATOM   9818  C CA  . LEU I  3 93  ? 11.445  12.526  -13.260 1.00 93.73  ? 108 LEU Z CA  1 
ATOM   9819  C C   . LEU I  3 93  ? 11.210  11.567  -12.086 1.00 99.36  ? 108 LEU Z C   1 
ATOM   9820  O O   . LEU I  3 93  ? 10.722  11.991  -11.038 1.00 95.79  ? 108 LEU Z O   1 
ATOM   9821  C CB  . LEU I  3 93  ? 12.264  13.775  -12.850 1.00 89.62  ? 108 LEU Z CB  1 
ATOM   9822  C CG  . LEU I  3 93  ? 13.613  13.564  -12.153 1.00 92.57  ? 108 LEU Z CG  1 
ATOM   9823  C CD1 . LEU I  3 93  ? 14.708  13.214  -13.148 1.00 96.62  ? 108 LEU Z CD1 1 
ATOM   9824  C CD2 . LEU I  3 93  ? 13.997  14.783  -11.355 1.00 88.25  ? 108 LEU Z CD2 1 
ATOM   9825  N N   . LEU I  3 94  ? 11.507  10.269  -12.297 1.00 101.13 ? 109 LEU Z N   1 
ATOM   9826  C CA  . LEU I  3 94  ? 11.294  9.188   -11.328 1.00 102.20 ? 109 LEU Z CA  1 
ATOM   9827  C C   . LEU I  3 94  ? 12.590  8.675   -10.715 1.00 108.55 ? 109 LEU Z C   1 
ATOM   9828  O O   . LEU I  3 94  ? 12.611  8.312   -9.534  1.00 106.40 ? 109 LEU Z O   1 
ATOM   9829  C CB  . LEU I  3 94  ? 10.573  8.009   -12.008 1.00 107.53 ? 109 LEU Z CB  1 
ATOM   9830  C CG  . LEU I  3 94  ? 9.217   8.309   -12.642 1.00 112.70 ? 109 LEU Z CG  1 
ATOM   9831  C CD1 . LEU I  3 94  ? 9.128   7.722   -14.037 1.00 118.41 ? 109 LEU Z CD1 1 
ATOM   9832  C CD2 . LEU I  3 94  ? 8.088   7.816   -11.772 1.00 114.01 ? 109 LEU Z CD2 1 
ATOM   9833  N N   . TYR I  3 95  ? 13.658  8.604   -11.530 1.00 109.24 ? 110 TYR Z N   1 
ATOM   9834  C CA  . TYR I  3 95  ? 14.946  8.068   -11.113 1.00 110.77 ? 110 TYR Z CA  1 
ATOM   9835  C C   . TYR I  3 95  ? 16.109  9.053   -11.177 1.00 109.28 ? 110 TYR Z C   1 
ATOM   9836  O O   . TYR I  3 95  ? 16.426  9.595   -12.241 1.00 109.28 ? 110 TYR Z O   1 
ATOM   9837  C CB  . TYR I  3 95  ? 15.261  6.804   -11.943 1.00 120.00 ? 110 TYR Z CB  1 
ATOM   9838  C CG  . TYR I  3 95  ? 16.544  6.069   -11.589 1.00 126.59 ? 110 TYR Z CG  1 
ATOM   9839  C CD1 . TYR I  3 95  ? 17.745  6.370   -12.232 1.00 130.50 ? 110 TYR Z CD1 1 
ATOM   9840  C CD2 . TYR I  3 95  ? 16.534  4.995   -10.700 1.00 129.53 ? 110 TYR Z CD2 1 
ATOM   9841  C CE1 . TYR I  3 95  ? 18.913  5.654   -11.962 1.00 134.47 ? 110 TYR Z CE1 1 
ATOM   9842  C CE2 . TYR I  3 95  ? 17.697  4.269   -10.424 1.00 133.61 ? 110 TYR Z CE2 1 
ATOM   9843  C CZ  . TYR I  3 95  ? 18.886  4.607   -11.053 1.00 143.34 ? 110 TYR Z CZ  1 
ATOM   9844  O OH  . TYR I  3 95  ? 20.032  3.901   -10.783 1.00 148.54 ? 110 TYR Z OH  1 
ATOM   9845  N N   . ILE I  3 96  ? 16.776  9.224   -10.030 1.00 101.93 ? 111 ILE Z N   1 
ATOM   9846  C CA  . ILE I  3 96  ? 18.017  9.982   -9.909  1.00 100.04 ? 111 ILE Z CA  1 
ATOM   9847  C C   . ILE I  3 96  ? 19.068  8.963   -9.479  1.00 106.44 ? 111 ILE Z C   1 
ATOM   9848  O O   . ILE I  3 96  ? 18.978  8.408   -8.375  1.00 105.72 ? 111 ILE Z O   1 
ATOM   9849  C CB  . ILE I  3 96  ? 17.989  11.215  -8.964  1.00 97.42  ? 111 ILE Z CB  1 
ATOM   9850  C CG1 . ILE I  3 96  ? 16.938  12.257  -9.416  1.00 95.34  ? 111 ILE Z CG1 1 
ATOM   9851  C CG2 . ILE I  3 96  ? 19.405  11.847  -8.888  1.00 97.20  ? 111 ILE Z CG2 1 
ATOM   9852  C CD1 . ILE I  3 96  ? 16.528  13.268  -8.346  1.00 94.12  ? 111 ILE Z CD1 1 
ATOM   9853  N N   . ASN I  3 97  ? 20.043  8.708   -10.369 1.00 105.14 ? 112 ASN Z N   1 
ATOM   9854  C CA  . ASN I  3 97  ? 21.160  7.800   -10.162 1.00 107.90 ? 112 ASN Z CA  1 
ATOM   9855  C C   . ASN I  3 97  ? 21.829  8.065   -8.799  1.00 109.27 ? 112 ASN Z C   1 
ATOM   9856  O O   . ASN I  3 97  ? 22.036  9.230   -8.465  1.00 105.07 ? 112 ASN Z O   1 
ATOM   9857  C CB  . ASN I  3 97  ? 22.162  7.984   -11.300 1.00 109.76 ? 112 ASN Z CB  1 
ATOM   9858  C CG  . ASN I  3 97  ? 23.337  7.058   -11.217 1.00 132.07 ? 112 ASN Z CG  1 
ATOM   9859  O OD1 . ASN I  3 97  ? 24.300  7.311   -10.492 1.00 124.23 ? 112 ASN Z OD1 1 
ATOM   9860  N ND2 . ASN I  3 97  ? 23.262  5.941   -11.919 1.00 128.56 ? 112 ASN Z ND2 1 
ATOM   9861  N N   . PRO I  3 98  ? 22.159  7.030   -7.985  1.00 108.40 ? 113 PRO Z N   1 
ATOM   9862  C CA  . PRO I  3 98  ? 22.802  7.294   -6.678  1.00 105.65 ? 113 PRO Z CA  1 
ATOM   9863  C C   . PRO I  3 98  ? 24.118  8.078   -6.765  1.00 109.04 ? 113 PRO Z C   1 
ATOM   9864  O O   . PRO I  3 98  ? 24.328  9.006   -5.975  1.00 105.54 ? 113 PRO Z O   1 
ATOM   9865  C CB  . PRO I  3 98  ? 23.000  5.895   -6.087  1.00 111.13 ? 113 PRO Z CB  1 
ATOM   9866  C CG  . PRO I  3 98  ? 22.014  5.038   -6.806  1.00 118.81 ? 113 PRO Z CG  1 
ATOM   9867  C CD  . PRO I  3 98  ? 21.970  5.582   -8.198  1.00 115.18 ? 113 PRO Z CD  1 
ATOM   9868  N N   . GLU I  3 99  ? 24.947  7.772   -7.780  1.00 108.14 ? 114 GLU Z N   1 
ATOM   9869  C CA  . GLU I  3 99  ? 26.220  8.441   -8.031  1.00 108.50 ? 114 GLU Z CA  1 
ATOM   9870  C C   . GLU I  3 99  ? 26.084  9.840   -8.700  1.00 109.77 ? 114 GLU Z C   1 
ATOM   9871  O O   . GLU I  3 99  ? 27.097  10.407  -9.109  1.00 109.95 ? 114 GLU Z O   1 
ATOM   9872  C CB  . GLU I  3 99  ? 27.142  7.522   -8.853  1.00 116.36 ? 114 GLU Z CB  1 
ATOM   9873  C CG  . GLU I  3 99  ? 27.391  6.150   -8.240  1.00 130.54 ? 114 GLU Z CG  1 
ATOM   9874  C CD  . GLU I  3 99  ? 28.262  6.140   -7.000  1.00 146.77 ? 114 GLU Z CD  1 
ATOM   9875  O OE1 . GLU I  3 99  ? 29.465  6.467   -7.117  1.00 139.06 ? 114 GLU Z OE1 1 
ATOM   9876  O OE2 . GLU I  3 99  ? 27.747  5.792   -5.914  1.00 139.33 ? 114 GLU Z OE2 1 
ATOM   9877  N N   . ALA I  3 100 ? 24.851  10.411  -8.787  1.00 103.82 ? 115 ALA Z N   1 
ATOM   9878  C CA  . ALA I  3 100 ? 24.610  11.741  -9.380  1.00 100.63 ? 115 ALA Z CA  1 
ATOM   9879  C C   . ALA I  3 100 ? 25.120  12.844  -8.484  1.00 99.78  ? 115 ALA Z C   1 
ATOM   9880  O O   . ALA I  3 100 ? 25.677  13.816  -8.994  1.00 99.77  ? 115 ALA Z O   1 
ATOM   9881  C CB  . ALA I  3 100 ? 23.136  11.954  -9.667  1.00 99.12  ? 115 ALA Z CB  1 
ATOM   9882  N N   . PHE I  3 101 ? 24.934  12.704  -7.154  1.00 92.01  ? 116 PHE Z N   1 
ATOM   9883  C CA  . PHE I  3 101 ? 25.425  13.699  -6.210  1.00 87.91  ? 116 PHE Z CA  1 
ATOM   9884  C C   . PHE I  3 101 ? 26.773  13.324  -5.623  1.00 90.84  ? 116 PHE Z C   1 
ATOM   9885  O O   . PHE I  3 101 ? 26.848  12.547  -4.663  1.00 89.38  ? 116 PHE Z O   1 
ATOM   9886  C CB  . PHE I  3 101 ? 24.398  14.012  -5.122  1.00 85.82  ? 116 PHE Z CB  1 
ATOM   9887  C CG  . PHE I  3 101 ? 23.207  14.776  -5.631  1.00 84.97  ? 116 PHE Z CG  1 
ATOM   9888  C CD1 . PHE I  3 101 ? 23.303  16.129  -5.925  1.00 86.17  ? 116 PHE Z CD1 1 
ATOM   9889  C CD2 . PHE I  3 101 ? 21.983  14.147  -5.806  1.00 87.31  ? 116 PHE Z CD2 1 
ATOM   9890  C CE1 . PHE I  3 101 ? 22.192  16.838  -6.383  1.00 85.26  ? 116 PHE Z CE1 1 
ATOM   9891  C CE2 . PHE I  3 101 ? 20.877  14.856  -6.279  1.00 88.20  ? 116 PHE Z CE2 1 
ATOM   9892  C CZ  . PHE I  3 101 ? 20.991  16.197  -6.569  1.00 84.24  ? 116 PHE Z CZ  1 
ATOM   9893  N N   . GLN I  3 102 ? 27.840  13.880  -6.229  1.00 88.76  ? 117 GLN Z N   1 
ATOM   9894  C CA  . GLN I  3 102 ? 29.246  13.690  -5.845  1.00 90.88  ? 117 GLN Z CA  1 
ATOM   9895  C C   . GLN I  3 102 ? 29.686  14.789  -4.856  1.00 91.40  ? 117 GLN Z C   1 
ATOM   9896  O O   . GLN I  3 102 ? 28.845  15.586  -4.441  1.00 87.74  ? 117 GLN Z O   1 
ATOM   9897  C CB  . GLN I  3 102 ? 30.149  13.685  -7.095  1.00 96.20  ? 117 GLN Z CB  1 
ATOM   9898  C CG  . GLN I  3 102 ? 29.867  12.562  -8.099  1.00 106.03 ? 117 GLN Z CG  1 
ATOM   9899  C CD  . GLN I  3 102 ? 30.321  11.204  -7.637  1.00 120.81 ? 117 GLN Z CD  1 
ATOM   9900  O OE1 . GLN I  3 102 ? 31.253  11.062  -6.837  1.00 118.59 ? 117 GLN Z OE1 1 
ATOM   9901  N NE2 . GLN I  3 102 ? 29.678  10.170  -8.147  1.00 110.13 ? 117 GLN Z NE2 1 
ATOM   9902  N N   . ASN I  3 103 ? 30.984  14.840  -4.486  1.00 89.00  ? 118 ASN Z N   1 
ATOM   9903  C CA  . ASN I  3 103 ? 31.516  15.833  -3.554  1.00 86.65  ? 118 ASN Z CA  1 
ATOM   9904  C C   . ASN I  3 103 ? 31.280  17.246  -4.027  1.00 88.14  ? 118 ASN Z C   1 
ATOM   9905  O O   . ASN I  3 103 ? 31.832  17.681  -5.044  1.00 89.44  ? 118 ASN Z O   1 
ATOM   9906  C CB  . ASN I  3 103 ? 33.012  15.595  -3.237  1.00 92.58  ? 118 ASN Z CB  1 
ATOM   9907  C CG  . ASN I  3 103 ? 33.567  16.278  -1.988  1.00 102.11 ? 118 ASN Z CG  1 
ATOM   9908  O OD1 . ASN I  3 103 ? 34.421  15.721  -1.289  1.00 93.04  ? 118 ASN Z OD1 1 
ATOM   9909  N ND2 . ASN I  3 103 ? 33.159  17.509  -1.694  1.00 86.70  ? 118 ASN Z ND2 1 
ATOM   9910  N N   . LEU I  3 104 ? 30.427  17.948  -3.271  1.00 81.27  ? 119 LEU Z N   1 
ATOM   9911  C CA  . LEU I  3 104 ? 30.074  19.349  -3.455  1.00 78.82  ? 119 LEU Z CA  1 
ATOM   9912  C C   . LEU I  3 104 ? 30.367  20.031  -2.109  1.00 80.63  ? 119 LEU Z C   1 
ATOM   9913  O O   . LEU I  3 104 ? 29.532  19.992  -1.215  1.00 77.44  ? 119 LEU Z O   1 
ATOM   9914  C CB  . LEU I  3 104 ? 28.609  19.504  -3.880  1.00 76.44  ? 119 LEU Z CB  1 
ATOM   9915  C CG  . LEU I  3 104 ? 28.186  18.782  -5.166  1.00 83.59  ? 119 LEU Z CG  1 
ATOM   9916  C CD1 . LEU I  3 104 ? 26.666  18.612  -5.219  1.00 81.51  ? 119 LEU Z CD1 1 
ATOM   9917  C CD2 . LEU I  3 104 ? 28.714  19.496  -6.407  1.00 88.19  ? 119 LEU Z CD2 1 
ATOM   9918  N N   . PRO I  3 105 ? 31.606  20.545  -1.900  1.00 79.66  ? 120 PRO Z N   1 
ATOM   9919  C CA  . PRO I  3 105 ? 31.965  21.114  -0.580  1.00 78.24  ? 120 PRO Z CA  1 
ATOM   9920  C C   . PRO I  3 105 ? 31.271  22.410  -0.165  1.00 78.28  ? 120 PRO Z C   1 
ATOM   9921  O O   . PRO I  3 105 ? 31.343  22.799  1.005   1.00 76.52  ? 120 PRO Z O   1 
ATOM   9922  C CB  . PRO I  3 105 ? 33.475  21.332  -0.707  1.00 83.23  ? 120 PRO Z CB  1 
ATOM   9923  C CG  . PRO I  3 105 ? 33.686  21.548  -2.155  1.00 89.07  ? 120 PRO Z CG  1 
ATOM   9924  C CD  . PRO I  3 105 ? 32.755  20.603  -2.832  1.00 83.95  ? 120 PRO Z CD  1 
ATOM   9925  N N   . ASN I  3 106 ? 30.656  23.100  -1.123  1.00 73.60  ? 121 ASN Z N   1 
ATOM   9926  C CA  . ASN I  3 106 ? 30.029  24.380  -0.855  1.00 71.58  ? 121 ASN Z CA  1 
ATOM   9927  C C   . ASN I  3 106 ? 28.517  24.354  -0.855  1.00 72.19  ? 121 ASN Z C   1 
ATOM   9928  O O   . ASN I  3 106 ? 27.911  25.401  -0.627  1.00 71.01  ? 121 ASN Z O   1 
ATOM   9929  C CB  . ASN I  3 106 ? 30.542  25.434  -1.819  1.00 78.19  ? 121 ASN Z CB  1 
ATOM   9930  C CG  . ASN I  3 106 ? 30.688  26.779  -1.163  1.00 109.11 ? 121 ASN Z CG  1 
ATOM   9931  O OD1 . ASN I  3 106 ? 29.725  27.560  -1.066  1.00 94.05  ? 121 ASN Z OD1 1 
ATOM   9932  N ND2 . ASN I  3 106 ? 31.895  27.059  -0.669  1.00 107.18 ? 121 ASN Z ND2 1 
ATOM   9933  N N   . LEU I  3 107 ? 27.893  23.173  -1.082  1.00 66.92  ? 122 LEU Z N   1 
ATOM   9934  C CA  . LEU I  3 107 ? 26.438  23.033  -1.083  1.00 62.68  ? 122 LEU Z CA  1 
ATOM   9935  C C   . LEU I  3 107 ? 25.858  23.575  0.233   1.00 65.01  ? 122 LEU Z C   1 
ATOM   9936  O O   . LEU I  3 107 ? 26.412  23.337  1.309   1.00 64.90  ? 122 LEU Z O   1 
ATOM   9937  C CB  . LEU I  3 107 ? 25.985  21.575  -1.370  1.00 62.40  ? 122 LEU Z CB  1 
ATOM   9938  C CG  . LEU I  3 107 ? 24.470  21.384  -1.691  1.00 63.87  ? 122 LEU Z CG  1 
ATOM   9939  C CD1 . LEU I  3 107 ? 24.078  22.009  -3.024  1.00 64.32  ? 122 LEU Z CD1 1 
ATOM   9940  C CD2 . LEU I  3 107 ? 24.057  19.929  -1.659  1.00 64.19  ? 122 LEU Z CD2 1 
ATOM   9941  N N   . GLN I  3 108 ? 24.810  24.391  0.122   1.00 60.06  ? 123 GLN Z N   1 
ATOM   9942  C CA  . GLN I  3 108 ? 24.140  24.994  1.275   1.00 57.63  ? 123 GLN Z CA  1 
ATOM   9943  C C   . GLN I  3 108 ? 22.657  24.717  1.200   1.00 56.73  ? 123 GLN Z C   1 
ATOM   9944  O O   . GLN I  3 108 ? 21.981  24.696  2.225   1.00 53.80  ? 123 GLN Z O   1 
ATOM   9945  C CB  . GLN I  3 108 ? 24.369  26.523  1.317   1.00 59.30  ? 123 GLN Z CB  1 
ATOM   9946  C CG  . GLN I  3 108 ? 25.817  26.958  1.544   1.00 69.13  ? 123 GLN Z CG  1 
ATOM   9947  C CD  . GLN I  3 108 ? 26.001  28.455  1.396   1.00 81.32  ? 123 GLN Z CD  1 
ATOM   9948  O OE1 . GLN I  3 108 ? 25.159  29.265  1.813   1.00 80.09  ? 123 GLN Z OE1 1 
ATOM   9949  N NE2 . GLN I  3 108 ? 27.122  28.860  0.821   1.00 59.95  ? 123 GLN Z NE2 1 
ATOM   9950  N N   . TYR I  3 109 ? 22.154  24.536  -0.024  1.00 53.56  ? 124 TYR Z N   1 
ATOM   9951  C CA  . TYR I  3 109 ? 20.747  24.339  -0.295  1.00 51.96  ? 124 TYR Z CA  1 
ATOM   9952  C C   . TYR I  3 109 ? 20.517  23.399  -1.486  1.00 56.56  ? 124 TYR Z C   1 
ATOM   9953  O O   . TYR I  3 109 ? 20.971  23.679  -2.599  1.00 56.70  ? 124 TYR Z O   1 
ATOM   9954  C CB  . TYR I  3 109 ? 20.104  25.728  -0.521  1.00 52.98  ? 124 TYR Z CB  1 
ATOM   9955  C CG  . TYR I  3 109 ? 18.609  25.772  -0.781  1.00 55.99  ? 124 TYR Z CG  1 
ATOM   9956  C CD1 . TYR I  3 109 ? 17.703  25.246  0.137   1.00 56.54  ? 124 TYR Z CD1 1 
ATOM   9957  C CD2 . TYR I  3 109 ? 18.096  26.417  -1.904  1.00 58.24  ? 124 TYR Z CD2 1 
ATOM   9958  C CE1 . TYR I  3 109 ? 16.328  25.318  -0.079  1.00 56.26  ? 124 TYR Z CE1 1 
ATOM   9959  C CE2 . TYR I  3 109 ? 16.720  26.529  -2.111  1.00 58.71  ? 124 TYR Z CE2 1 
ATOM   9960  C CZ  . TYR I  3 109 ? 15.839  25.968  -1.200  1.00 65.37  ? 124 TYR Z CZ  1 
ATOM   9961  O OH  . TYR I  3 109 ? 14.483  26.073  -1.394  1.00 66.37  ? 124 TYR Z OH  1 
ATOM   9962  N N   . LEU I  3 110 ? 19.823  22.269  -1.227  1.00 54.08  ? 125 LEU Z N   1 
ATOM   9963  C CA  . LEU I  3 110 ? 19.381  21.282  -2.220  1.00 56.38  ? 125 LEU Z CA  1 
ATOM   9964  C C   . LEU I  3 110 ? 17.848  21.196  -2.154  1.00 61.19  ? 125 LEU Z C   1 
ATOM   9965  O O   . LEU I  3 110 ? 17.277  20.710  -1.160  1.00 60.89  ? 125 LEU Z O   1 
ATOM   9966  C CB  . LEU I  3 110 ? 20.033  19.887  -2.037  1.00 58.42  ? 125 LEU Z CB  1 
ATOM   9967  C CG  . LEU I  3 110 ? 19.580  18.758  -3.007  1.00 65.51  ? 125 LEU Z CG  1 
ATOM   9968  C CD1 . LEU I  3 110 ? 19.836  19.122  -4.456  1.00 68.50  ? 125 LEU Z CD1 1 
ATOM   9969  C CD2 . LEU I  3 110 ? 20.309  17.453  -2.729  1.00 68.87  ? 125 LEU Z CD2 1 
ATOM   9970  N N   . LEU I  3 111 ? 17.187  21.708  -3.204  1.00 57.04  ? 126 LEU Z N   1 
ATOM   9971  C CA  . LEU I  3 111 ? 15.734  21.721  -3.278  1.00 54.59  ? 126 LEU Z CA  1 
ATOM   9972  C C   . LEU I  3 111 ? 15.244  20.805  -4.395  1.00 59.79  ? 126 LEU Z C   1 
ATOM   9973  O O   . LEU I  3 111 ? 15.644  20.980  -5.549  1.00 61.60  ? 126 LEU Z O   1 
ATOM   9974  C CB  . LEU I  3 111 ? 15.215  23.166  -3.452  1.00 53.21  ? 126 LEU Z CB  1 
ATOM   9975  C CG  . LEU I  3 111 ? 13.732  23.364  -3.795  1.00 57.89  ? 126 LEU Z CG  1 
ATOM   9976  C CD1 . LEU I  3 111 ? 12.854  23.121  -2.612  1.00 56.75  ? 126 LEU Z CD1 1 
ATOM   9977  C CD2 . LEU I  3 111 ? 13.464  24.754  -4.319  1.00 60.60  ? 126 LEU Z CD2 1 
ATOM   9978  N N   . ILE I  3 112 ? 14.400  19.804  -4.025  1.00 54.33  ? 127 ILE Z N   1 
ATOM   9979  C CA  . ILE I  3 112 ? 13.702  18.870  -4.906  1.00 54.83  ? 127 ILE Z CA  1 
ATOM   9980  C C   . ILE I  3 112 ? 12.196  18.990  -4.586  1.00 56.09  ? 127 ILE Z C   1 
ATOM   9981  O O   . ILE I  3 112 ? 11.681  18.341  -3.670  1.00 52.90  ? 127 ILE Z O   1 
ATOM   9982  C CB  . ILE I  3 112 ? 14.192  17.402  -4.847  1.00 60.14  ? 127 ILE Z CB  1 
ATOM   9983  C CG1 . ILE I  3 112 ? 15.715  17.282  -4.912  1.00 61.58  ? 127 ILE Z CG1 1 
ATOM   9984  C CG2 . ILE I  3 112 ? 13.509  16.563  -5.950  1.00 64.13  ? 127 ILE Z CG2 1 
ATOM   9985  C CD1 . ILE I  3 112 ? 16.247  15.876  -4.588  1.00 68.18  ? 127 ILE Z CD1 1 
ATOM   9986  N N   . SER I  3 113 ? 11.506  19.850  -5.334  1.00 54.25  ? 128 SER Z N   1 
ATOM   9987  C CA  . SER I  3 113 ? 10.088  20.080  -5.142  1.00 54.12  ? 128 SER Z CA  1 
ATOM   9988  C C   . SER I  3 113 ? 9.281   19.606  -6.322  1.00 62.79  ? 128 SER Z C   1 
ATOM   9989  O O   . SER I  3 113 ? 9.729   19.714  -7.466  1.00 64.70  ? 128 SER Z O   1 
ATOM   9990  C CB  . SER I  3 113 ? 9.815   21.555  -4.848  1.00 56.59  ? 128 SER Z CB  1 
ATOM   9991  O OG  . SER I  3 113 ? 9.149   22.236  -5.901  1.00 67.28  ? 128 SER Z OG  1 
ATOM   9992  N N   . ASN I  3 114 ? 8.074   19.090  -6.035  1.00 60.78  ? 129 ASN Z N   1 
ATOM   9993  C CA  . ASN I  3 114 ? 7.088   18.630  -7.008  1.00 62.95  ? 129 ASN Z CA  1 
ATOM   9994  C C   . ASN I  3 114 ? 7.667   17.753  -8.123  1.00 70.30  ? 129 ASN Z C   1 
ATOM   9995  O O   . ASN I  3 114 ? 7.593   18.124  -9.293  1.00 71.73  ? 129 ASN Z O   1 
ATOM   9996  C CB  . ASN I  3 114 ? 6.323   19.832  -7.578  1.00 64.02  ? 129 ASN Z CB  1 
ATOM   9997  C CG  . ASN I  3 114 ? 4.821   19.667  -7.638  1.00 85.00  ? 129 ASN Z CG  1 
ATOM   9998  O OD1 . ASN I  3 114 ? 4.284   18.559  -7.582  1.00 75.23  ? 129 ASN Z OD1 1 
ATOM   9999  N ND2 . ASN I  3 114 ? 4.112   20.777  -7.791  1.00 76.48  ? 129 ASN Z ND2 1 
ATOM   10000 N N   . THR I  3 115 ? 8.269   16.602  -7.754  1.00 68.89  ? 130 THR Z N   1 
ATOM   10001 C CA  . THR I  3 115 ? 8.843   15.615  -8.702  1.00 72.67  ? 130 THR Z CA  1 
ATOM   10002 C C   . THR I  3 115 ? 8.205   14.220  -8.511  1.00 77.90  ? 130 THR Z C   1 
ATOM   10003 O O   . THR I  3 115 ? 7.526   13.993  -7.510  1.00 75.62  ? 130 THR Z O   1 
ATOM   10004 C CB  . THR I  3 115 ? 10.407  15.572  -8.674  1.00 81.44  ? 130 THR Z CB  1 
ATOM   10005 O OG1 . THR I  3 115 ? 10.878  14.858  -7.529  1.00 79.61  ? 130 THR Z OG1 1 
ATOM   10006 C CG2 . THR I  3 115 ? 11.056  16.955  -8.755  1.00 76.77  ? 130 THR Z CG2 1 
ATOM   10007 N N   . GLY I  3 116 ? 8.431   13.315  -9.464  1.00 78.09  ? 131 GLY Z N   1 
ATOM   10008 C CA  . GLY I  3 116 ? 7.901   11.958  -9.403  1.00 80.72  ? 131 GLY Z CA  1 
ATOM   10009 C C   . GLY I  3 116 ? 8.889   10.943  -8.873  1.00 85.53  ? 131 GLY Z C   1 
ATOM   10010 O O   . GLY I  3 116 ? 8.736   9.749   -9.145  1.00 89.79  ? 131 GLY Z O   1 
ATOM   10011 N N   . ILE I  3 117 ? 9.914   11.410  -8.118  1.00 78.11  ? 132 ILE Z N   1 
ATOM   10012 C CA  . ILE I  3 117 ? 10.982  10.556  -7.590  1.00 78.70  ? 132 ILE Z CA  1 
ATOM   10013 C C   . ILE I  3 117 ? 10.433  9.582   -6.535  1.00 83.71  ? 132 ILE Z C   1 
ATOM   10014 O O   . ILE I  3 117 ? 9.592   9.950   -5.713  1.00 79.79  ? 132 ILE Z O   1 
ATOM   10015 C CB  . ILE I  3 117 ? 12.266  11.318  -7.135  1.00 78.48  ? 132 ILE Z CB  1 
ATOM   10016 C CG1 . ILE I  3 117 ? 12.056  12.157  -5.866  1.00 73.69  ? 132 ILE Z CG1 1 
ATOM   10017 C CG2 . ILE I  3 117 ? 12.854  12.168  -8.285  1.00 79.19  ? 132 ILE Z CG2 1 
ATOM   10018 C CD1 . ILE I  3 117 ? 13.380  12.593  -5.198  1.00 78.97  ? 132 ILE Z CD1 1 
ATOM   10019 N N   . LYS I  3 118 ? 10.881  8.316   -6.620  1.00 85.35  ? 133 LYS Z N   1 
ATOM   10020 C CA  . LYS I  3 118 ? 10.406  7.214   -5.781  1.00 87.20  ? 133 LYS Z CA  1 
ATOM   10021 C C   . LYS I  3 118 ? 11.131  7.071   -4.438  1.00 90.67  ? 133 LYS Z C   1 
ATOM   10022 O O   . LYS I  3 118 ? 10.600  6.418   -3.526  1.00 90.65  ? 133 LYS Z O   1 
ATOM   10023 C CB  . LYS I  3 118 ? 10.439  5.893   -6.571  1.00 94.58  ? 133 LYS Z CB  1 
ATOM   10024 C CG  . LYS I  3 118 ? 9.457   5.858   -7.742  1.00 108.73 ? 133 LYS Z CG  1 
ATOM   10025 C CD  . LYS I  3 118 ? 8.043   5.462   -7.292  1.00 123.62 ? 133 LYS Z CD  1 
ATOM   10026 C CE  . LYS I  3 118 ? 6.986   5.628   -8.364  1.00 140.65 ? 133 LYS Z CE  1 
ATOM   10027 N NZ  . LYS I  3 118 ? 7.025   4.537   -9.377  1.00 155.78 ? 133 LYS Z NZ  1 
ATOM   10028 N N   . HIS I  3 119 ? 12.334  7.669   -4.320  1.00 86.48  ? 134 HIS Z N   1 
ATOM   10029 C CA  . HIS I  3 119 ? 13.168  7.619   -3.115  1.00 85.86  ? 134 HIS Z CA  1 
ATOM   10030 C C   . HIS I  3 119 ? 13.936  8.919   -2.938  1.00 85.08  ? 134 HIS Z C   1 
ATOM   10031 O O   . HIS I  3 119 ? 14.189  9.618   -3.919  1.00 83.87  ? 134 HIS Z O   1 
ATOM   10032 C CB  . HIS I  3 119 ? 14.188  6.468   -3.204  1.00 91.89  ? 134 HIS Z CB  1 
ATOM   10033 C CG  . HIS I  3 119 ? 13.599  5.090   -3.265  1.00 101.11 ? 134 HIS Z CG  1 
ATOM   10034 N ND1 . HIS I  3 119 ? 13.399  4.442   -4.477  1.00 107.75 ? 134 HIS Z ND1 1 
ATOM   10035 C CD2 . HIS I  3 119 ? 13.244  4.253   -2.261  1.00 105.18 ? 134 HIS Z CD2 1 
ATOM   10036 C CE1 . HIS I  3 119 ? 12.906  3.248   -4.173  1.00 111.39 ? 134 HIS Z CE1 1 
ATOM   10037 N NE2 . HIS I  3 119 ? 12.800  3.084   -2.854  1.00 110.29 ? 134 HIS Z NE2 1 
ATOM   10038 N N   . LEU I  3 120 ? 14.369  9.202   -1.690  1.00 79.17  ? 135 LEU Z N   1 
ATOM   10039 C CA  . LEU I  3 120 ? 15.173  10.380  -1.321  1.00 75.24  ? 135 LEU Z CA  1 
ATOM   10040 C C   . LEU I  3 120 ? 16.526  10.351  -2.061  1.00 80.20  ? 135 LEU Z C   1 
ATOM   10041 O O   . LEU I  3 120 ? 17.002  9.254   -2.382  1.00 83.57  ? 135 LEU Z O   1 
ATOM   10042 C CB  . LEU I  3 120 ? 15.458  10.399  0.194   1.00 73.61  ? 135 LEU Z CB  1 
ATOM   10043 C CG  . LEU I  3 120 ? 14.274  10.413  1.140   1.00 76.77  ? 135 LEU Z CG  1 
ATOM   10044 C CD1 . LEU I  3 120 ? 14.675  9.876   2.493   1.00 78.01  ? 135 LEU Z CD1 1 
ATOM   10045 C CD2 . LEU I  3 120 ? 13.661  11.803  1.258   1.00 73.92  ? 135 LEU Z CD2 1 
ATOM   10046 N N   . PRO I  3 121 ? 17.181  11.515  -2.322  1.00 73.05  ? 136 PRO Z N   1 
ATOM   10047 C CA  . PRO I  3 121 ? 18.469  11.473  -3.036  1.00 74.51  ? 136 PRO Z CA  1 
ATOM   10048 C C   . PRO I  3 121 ? 19.592  10.855  -2.204  1.00 79.60  ? 136 PRO Z C   1 
ATOM   10049 O O   . PRO I  3 121 ? 19.519  10.882  -0.967  1.00 77.32  ? 136 PRO Z O   1 
ATOM   10050 C CB  . PRO I  3 121 ? 18.730  12.943  -3.369  1.00 73.10  ? 136 PRO Z CB  1 
ATOM   10051 C CG  . PRO I  3 121 ? 18.011  13.695  -2.303  1.00 73.49  ? 136 PRO Z CG  1 
ATOM   10052 C CD  . PRO I  3 121 ? 16.775  12.907  -2.035  1.00 69.66  ? 136 PRO Z CD  1 
ATOM   10053 N N   . ASP I  3 122 ? 20.603  10.273  -2.881  1.00 79.54  ? 137 ASP Z N   1 
ATOM   10054 C CA  . ASP I  3 122 ? 21.762  9.670   -2.229  1.00 82.54  ? 137 ASP Z CA  1 
ATOM   10055 C C   . ASP I  3 122 ? 22.738  10.796  -1.894  1.00 85.82  ? 137 ASP Z C   1 
ATOM   10056 O O   . ASP I  3 122 ? 23.443  11.292  -2.782  1.00 87.42  ? 137 ASP Z O   1 
ATOM   10057 C CB  . ASP I  3 122 ? 22.408  8.627   -3.154  1.00 90.22  ? 137 ASP Z CB  1 
ATOM   10058 C CG  . ASP I  3 122 ? 23.622  7.939   -2.567  1.00 107.44 ? 137 ASP Z CG  1 
ATOM   10059 O OD1 . ASP I  3 122 ? 24.659  8.623   -2.378  1.00 107.28 ? 137 ASP Z OD1 1 
ATOM   10060 O OD2 . ASP I  3 122 ? 23.553  6.705   -2.337  1.00 118.76 ? 137 ASP Z OD2 1 
ATOM   10061 N N   . VAL I  3 123 ? 22.797  11.179  -0.611  1.00 79.85  ? 138 VAL Z N   1 
ATOM   10062 C CA  . VAL I  3 123 ? 23.590  12.334  -0.163  1.00 77.58  ? 138 VAL Z CA  1 
ATOM   10063 C C   . VAL I  3 123 ? 24.966  12.013  0.476   1.00 84.47  ? 138 VAL Z C   1 
ATOM   10064 O O   . VAL I  3 123 ? 25.706  12.955  0.781   1.00 82.46  ? 138 VAL Z O   1 
ATOM   10065 C CB  . VAL I  3 123 ? 22.756  13.243  0.791   1.00 76.62  ? 138 VAL Z CB  1 
ATOM   10066 C CG1 . VAL I  3 123 ? 21.562  13.870  0.071   1.00 73.85  ? 138 VAL Z CG1 1 
ATOM   10067 C CG2 . VAL I  3 123 ? 22.311  12.493  2.049   1.00 76.37  ? 138 VAL Z CG2 1 
ATOM   10068 N N   . HIS I  3 124 ? 25.309  10.726  0.665   1.00 85.54  ? 139 HIS Z N   1 
ATOM   10069 C CA  . HIS I  3 124 ? 26.535  10.300  1.356   1.00 88.65  ? 139 HIS Z CA  1 
ATOM   10070 C C   . HIS I  3 124 ? 27.887  10.724  0.713   1.00 92.27  ? 139 HIS Z C   1 
ATOM   10071 O O   . HIS I  3 124 ? 28.924  10.552  1.359   1.00 93.21  ? 139 HIS Z O   1 
ATOM   10072 C CB  . HIS I  3 124 ? 26.526  8.775   1.610   1.00 94.35  ? 139 HIS Z CB  1 
ATOM   10073 C CG  . HIS I  3 124 ? 26.940  7.911   0.452   1.00 102.66 ? 139 HIS Z CG  1 
ATOM   10074 N ND1 . HIS I  3 124 ? 26.004  7.292   -0.356  1.00 105.85 ? 139 HIS Z ND1 1 
ATOM   10075 C CD2 . HIS I  3 124 ? 28.177  7.520   0.062   1.00 108.57 ? 139 HIS Z CD2 1 
ATOM   10076 C CE1 . HIS I  3 124 ? 26.698  6.588   -1.237  1.00 109.98 ? 139 HIS Z CE1 1 
ATOM   10077 N NE2 . HIS I  3 124 ? 28.011  6.698   -1.028  1.00 112.04 ? 139 HIS Z NE2 1 
ATOM   10078 N N   . LYS I  3 125 ? 27.882  11.264  -0.520  1.00 87.21  ? 140 LYS Z N   1 
ATOM   10079 C CA  . LYS I  3 125 ? 29.107  11.655  -1.227  1.00 88.22  ? 140 LYS Z CA  1 
ATOM   10080 C C   . LYS I  3 125 ? 29.342  13.175  -1.325  1.00 87.04  ? 140 LYS Z C   1 
ATOM   10081 O O   . LYS I  3 125 ? 30.445  13.588  -1.676  1.00 86.99  ? 140 LYS Z O   1 
ATOM   10082 C CB  . LYS I  3 125 ? 29.145  11.005  -2.626  1.00 94.28  ? 140 LYS Z CB  1 
ATOM   10083 C CG  . LYS I  3 125 ? 29.529  9.523   -2.606  1.00 111.75 ? 140 LYS Z CG  1 
ATOM   10084 C CD  . LYS I  3 125 ? 29.561  8.906   -4.003  1.00 126.72 ? 140 LYS Z CD  1 
ATOM   10085 C CE  . LYS I  3 125 ? 30.270  7.569   -4.042  1.00 145.59 ? 140 LYS Z CE  1 
ATOM   10086 N NZ  . LYS I  3 125 ? 29.419  6.455   -3.542  1.00 156.64 ? 140 LYS Z NZ  1 
ATOM   10087 N N   . ILE I  3 126 ? 28.318  13.999  -1.002  1.00 80.42  ? 141 ILE Z N   1 
ATOM   10088 C CA  . ILE I  3 126 ? 28.376  15.470  -1.073  1.00 77.13  ? 141 ILE Z CA  1 
ATOM   10089 C C   . ILE I  3 126 ? 29.453  16.030  -0.123  1.00 80.69  ? 141 ILE Z C   1 
ATOM   10090 O O   . ILE I  3 126 ? 30.295  16.813  -0.572  1.00 81.48  ? 141 ILE Z O   1 
ATOM   10091 C CB  . ILE I  3 126 ? 26.982  16.139  -0.900  1.00 75.78  ? 141 ILE Z CB  1 
ATOM   10092 C CG1 . ILE I  3 126 ? 25.995  15.666  -2.016  1.00 76.02  ? 141 ILE Z CG1 1 
ATOM   10093 C CG2 . ILE I  3 126 ? 27.108  17.686  -0.864  1.00 74.27  ? 141 ILE Z CG2 1 
ATOM   10094 C CD1 . ILE I  3 126 ? 24.476  16.116  -1.866  1.00 77.03  ? 141 ILE Z CD1 1 
ATOM   10095 N N   . HIS I  3 127 ? 29.444  15.595  1.161   1.00 75.80  ? 142 HIS Z N   1 
ATOM   10096 C CA  . HIS I  3 127 ? 30.418  15.966  2.195   1.00 75.84  ? 142 HIS Z CA  1 
ATOM   10097 C C   . HIS I  3 127 ? 30.739  17.460  2.215   1.00 76.20  ? 142 HIS Z C   1 
ATOM   10098 O O   . HIS I  3 127 ? 31.914  17.852  2.186   1.00 78.00  ? 142 HIS Z O   1 
ATOM   10099 C CB  . HIS I  3 127 ? 31.700  15.140  2.033   1.00 81.52  ? 142 HIS Z CB  1 
ATOM   10100 C CG  . HIS I  3 127 ? 31.513  13.674  2.241   1.00 87.49  ? 142 HIS Z CG  1 
ATOM   10101 N ND1 . HIS I  3 127 ? 30.971  13.175  3.414   1.00 88.51  ? 142 HIS Z ND1 1 
ATOM   10102 C CD2 . HIS I  3 127 ? 31.854  12.641  1.437   1.00 92.80  ? 142 HIS Z CD2 1 
ATOM   10103 C CE1 . HIS I  3 127 ? 30.987  11.860  3.279   1.00 91.05  ? 142 HIS Z CE1 1 
ATOM   10104 N NE2 . HIS I  3 127 ? 31.504  11.492  2.103   1.00 94.09  ? 142 HIS Z NE2 1 
ATOM   10105 N N   . SER I  3 128 ? 29.678  18.290  2.226   1.00 67.49  ? 143 SER Z N   1 
ATOM   10106 C CA  . SER I  3 128 ? 29.769  19.745  2.239   1.00 64.82  ? 143 SER Z CA  1 
ATOM   10107 C C   . SER I  3 128 ? 30.360  20.236  3.540   1.00 69.94  ? 143 SER Z C   1 
ATOM   10108 O O   . SER I  3 128 ? 30.075  19.673  4.606   1.00 69.37  ? 143 SER Z O   1 
ATOM   10109 C CB  . SER I  3 128 ? 28.392  20.371  2.038   1.00 62.02  ? 143 SER Z CB  1 
ATOM   10110 O OG  . SER I  3 128 ? 28.386  21.753  2.358   1.00 60.44  ? 143 SER Z OG  1 
ATOM   10111 N N   . LEU I  3 129 ? 31.160  21.316  3.450   1.00 66.75  ? 144 LEU Z N   1 
ATOM   10112 C CA  . LEU I  3 129 ? 31.776  21.967  4.606   1.00 65.69  ? 144 LEU Z CA  1 
ATOM   10113 C C   . LEU I  3 129 ? 30.867  23.075  5.154   1.00 64.22  ? 144 LEU Z C   1 
ATOM   10114 O O   . LEU I  3 129 ? 31.332  23.924  5.924   1.00 64.02  ? 144 LEU Z O   1 
ATOM   10115 C CB  . LEU I  3 129 ? 33.119  22.572  4.198   1.00 68.51  ? 144 LEU Z CB  1 
ATOM   10116 C CG  . LEU I  3 129 ? 34.156  21.675  3.564   1.00 76.05  ? 144 LEU Z CG  1 
ATOM   10117 C CD1 . LEU I  3 129 ? 35.484  22.380  3.507   1.00 78.55  ? 144 LEU Z CD1 1 
ATOM   10118 C CD2 . LEU I  3 129 ? 34.315  20.398  4.330   1.00 80.72  ? 144 LEU Z CD2 1 
ATOM   10119 N N   . GLN I  3 130 ? 29.573  23.058  4.758   1.00 56.62  ? 145 GLN Z N   1 
ATOM   10120 C CA  . GLN I  3 130 ? 28.587  24.081  5.096   1.00 53.81  ? 145 GLN Z CA  1 
ATOM   10121 C C   . GLN I  3 130 ? 27.357  23.525  5.759   1.00 56.99  ? 145 GLN Z C   1 
ATOM   10122 O O   . GLN I  3 130 ? 27.032  22.357  5.566   1.00 58.48  ? 145 GLN Z O   1 
ATOM   10123 C CB  . GLN I  3 130 ? 28.110  24.783  3.807   1.00 54.17  ? 145 GLN Z CB  1 
ATOM   10124 C CG  . GLN I  3 130 ? 29.203  25.237  2.838   1.00 70.48  ? 145 GLN Z CG  1 
ATOM   10125 C CD  . GLN I  3 130 ? 29.975  26.453  3.278   1.00 90.06  ? 145 GLN Z CD  1 
ATOM   10126 O OE1 . GLN I  3 130 ? 29.664  27.118  4.276   1.00 80.09  ? 145 GLN Z OE1 1 
ATOM   10127 N NE2 . GLN I  3 130 ? 31.008  26.774  2.516   1.00 93.39  ? 145 GLN Z NE2 1 
ATOM   10128 N N   . LYS I  3 131 ? 26.613  24.372  6.476   1.00 51.12  ? 146 LYS Z N   1 
ATOM   10129 C CA  . LYS I  3 131 ? 25.323  23.952  7.018   1.00 48.82  ? 146 LYS Z CA  1 
ATOM   10130 C C   . LYS I  3 131 ? 24.417  23.771  5.783   1.00 55.66  ? 146 LYS Z C   1 
ATOM   10131 O O   . LYS I  3 131 ? 24.348  24.691  4.960   1.00 57.23  ? 146 LYS Z O   1 
ATOM   10132 C CB  . LYS I  3 131 ? 24.755  24.983  8.028   1.00 47.11  ? 146 LYS Z CB  1 
ATOM   10133 C CG  . LYS I  3 131 ? 25.471  24.901  9.379   1.00 41.99  ? 146 LYS Z CG  1 
ATOM   10134 C CD  . LYS I  3 131 ? 25.011  25.909  10.405  1.00 48.68  ? 146 LYS Z CD  1 
ATOM   10135 C CE  . LYS I  3 131 ? 25.717  25.722  11.730  1.00 66.07  ? 146 LYS Z CE  1 
ATOM   10136 N NZ  . LYS I  3 131 ? 24.794  25.966  12.878  1.00 90.34  ? 146 LYS Z NZ  1 
ATOM   10137 N N   . VAL I  3 132 ? 23.836  22.555  5.590   1.00 51.29  ? 147 VAL Z N   1 
ATOM   10138 C CA  . VAL I  3 132 ? 23.003  22.251  4.418   1.00 49.75  ? 147 VAL Z CA  1 
ATOM   10139 C C   . VAL I  3 132 ? 21.523  22.193  4.756   1.00 51.46  ? 147 VAL Z C   1 
ATOM   10140 O O   . VAL I  3 132 ? 21.123  21.486  5.679   1.00 50.74  ? 147 VAL Z O   1 
ATOM   10141 C CB  . VAL I  3 132 ? 23.471  20.954  3.691   1.00 55.26  ? 147 VAL Z CB  1 
ATOM   10142 C CG1 . VAL I  3 132 ? 22.608  20.630  2.466   1.00 54.67  ? 147 VAL Z CG1 1 
ATOM   10143 C CG2 . VAL I  3 132 ? 24.929  21.047  3.296   1.00 57.29  ? 147 VAL Z CG2 1 
ATOM   10144 N N   . LEU I  3 133 ? 20.706  22.915  3.991   1.00 47.77  ? 148 LEU Z N   1 
ATOM   10145 C CA  . LEU I  3 133 ? 19.253  22.849  4.121   1.00 46.29  ? 148 LEU Z CA  1 
ATOM   10146 C C   . LEU I  3 133 ? 18.790  21.911  2.998   1.00 55.69  ? 148 LEU Z C   1 
ATOM   10147 O O   . LEU I  3 133 ? 18.980  22.222  1.814   1.00 57.67  ? 148 LEU Z O   1 
ATOM   10148 C CB  . LEU I  3 133 ? 18.581  24.246  4.024   1.00 43.99  ? 148 LEU Z CB  1 
ATOM   10149 C CG  . LEU I  3 133 ? 17.106  24.324  3.575   1.00 46.15  ? 148 LEU Z CG  1 
ATOM   10150 C CD1 . LEU I  3 133 ? 16.173  23.589  4.519   1.00 45.87  ? 148 LEU Z CD1 1 
ATOM   10151 C CD2 . LEU I  3 133 ? 16.650  25.732  3.473   1.00 45.92  ? 148 LEU Z CD2 1 
ATOM   10152 N N   . LEU I  3 134 ? 18.245  20.742  3.377   1.00 52.98  ? 149 LEU Z N   1 
ATOM   10153 C CA  . LEU I  3 134 ? 17.757  19.769  2.418   1.00 54.48  ? 149 LEU Z CA  1 
ATOM   10154 C C   . LEU I  3 134 ? 16.226  19.848  2.422   1.00 59.90  ? 149 LEU Z C   1 
ATOM   10155 O O   . LEU I  3 134 ? 15.564  19.405  3.374   1.00 59.41  ? 149 LEU Z O   1 
ATOM   10156 C CB  . LEU I  3 134 ? 18.288  18.368  2.751   1.00 56.58  ? 149 LEU Z CB  1 
ATOM   10157 C CG  . LEU I  3 134 ? 18.011  17.278  1.714   1.00 63.96  ? 149 LEU Z CG  1 
ATOM   10158 C CD1 . LEU I  3 134 ? 18.649  17.605  0.402   1.00 65.98  ? 149 LEU Z CD1 1 
ATOM   10159 C CD2 . LEU I  3 134 ? 18.501  15.918  2.172   1.00 67.43  ? 149 LEU Z CD2 1 
ATOM   10160 N N   . ASP I  3 135 ? 15.676  20.478  1.367   1.00 56.75  ? 150 ASP Z N   1 
ATOM   10161 C CA  . ASP I  3 135 ? 14.247  20.743  1.204   1.00 55.18  ? 150 ASP Z CA  1 
ATOM   10162 C C   . ASP I  3 135 ? 13.628  19.866  0.085   1.00 61.43  ? 150 ASP Z C   1 
ATOM   10163 O O   . ASP I  3 135 ? 13.783  20.152  -1.104  1.00 62.55  ? 150 ASP Z O   1 
ATOM   10164 C CB  . ASP I  3 135 ? 14.067  22.257  0.974   1.00 54.76  ? 150 ASP Z CB  1 
ATOM   10165 C CG  . ASP I  3 135 ? 12.673  22.832  0.890   1.00 59.93  ? 150 ASP Z CG  1 
ATOM   10166 O OD1 . ASP I  3 135 ? 11.696  22.039  0.839   1.00 62.80  ? 150 ASP Z OD1 1 
ATOM   10167 O OD2 . ASP I  3 135 ? 12.557  24.071  0.759   1.00 60.89  ? 150 ASP Z OD2 1 
ATOM   10168 N N   . ILE I  3 136 ? 12.951  18.782  0.495   1.00 57.95  ? 151 ILE Z N   1 
ATOM   10169 C CA  . ILE I  3 136 ? 12.313  17.802  -0.381  1.00 60.23  ? 151 ILE Z CA  1 
ATOM   10170 C C   . ILE I  3 136 ? 10.816  17.772  -0.061  1.00 64.29  ? 151 ILE Z C   1 
ATOM   10171 O O   . ILE I  3 136 ? 10.387  17.166  0.923   1.00 64.59  ? 151 ILE Z O   1 
ATOM   10172 C CB  . ILE I  3 136 ? 13.035  16.417  -0.253  1.00 65.94  ? 151 ILE Z CB  1 
ATOM   10173 C CG1 . ILE I  3 136 ? 14.429  16.467  -0.906  1.00 66.81  ? 151 ILE Z CG1 1 
ATOM   10174 C CG2 . ILE I  3 136 ? 12.205  15.225  -0.806  1.00 69.35  ? 151 ILE Z CG2 1 
ATOM   10175 C CD1 . ILE I  3 136 ? 15.415  15.802  -0.128  1.00 73.81  ? 151 ILE Z CD1 1 
ATOM   10176 N N   . GLN I  3 137 ? 10.036  18.484  -0.872  1.00 60.17  ? 152 GLN Z N   1 
ATOM   10177 C CA  . GLN I  3 137 ? 8.599   18.629  -0.692  1.00 59.25  ? 152 GLN Z CA  1 
ATOM   10178 C C   . GLN I  3 137 ? 7.839   18.332  -1.984  1.00 65.45  ? 152 GLN Z C   1 
ATOM   10179 O O   . GLN I  3 137 ? 8.414   18.426  -3.075  1.00 66.85  ? 152 GLN Z O   1 
ATOM   10180 C CB  . GLN I  3 137 ? 8.267   20.052  -0.217  1.00 58.29  ? 152 GLN Z CB  1 
ATOM   10181 C CG  . GLN I  3 137 ? 8.735   20.397  1.198   1.00 67.40  ? 152 GLN Z CG  1 
ATOM   10182 C CD  . GLN I  3 137 ? 8.334   21.799  1.596   1.00 80.78  ? 152 GLN Z CD  1 
ATOM   10183 O OE1 . GLN I  3 137 ? 7.219   22.274  1.308   1.00 76.04  ? 152 GLN Z OE1 1 
ATOM   10184 N NE2 . GLN I  3 137 ? 9.231   22.489  2.285   1.00 67.95  ? 152 GLN Z NE2 1 
ATOM   10185 N N   . ASP I  3 138 ? 6.535   17.973  -1.841  1.00 61.12  ? 153 ASP Z N   1 
ATOM   10186 C CA  . ASP I  3 138 ? 5.576   17.662  -2.898  1.00 62.60  ? 153 ASP Z CA  1 
ATOM   10187 C C   . ASP I  3 138 ? 6.046   16.525  -3.808  1.00 68.93  ? 153 ASP Z C   1 
ATOM   10188 O O   . ASP I  3 138 ? 5.758   16.518  -5.005  1.00 70.63  ? 153 ASP Z O   1 
ATOM   10189 C CB  . ASP I  3 138 ? 5.175   18.925  -3.675  1.00 64.31  ? 153 ASP Z CB  1 
ATOM   10190 C CG  . ASP I  3 138 ? 4.422   19.923  -2.811  1.00 78.60  ? 153 ASP Z CG  1 
ATOM   10191 O OD1 . ASP I  3 138 ? 3.304   19.580  -2.342  1.00 82.49  ? 153 ASP Z OD1 1 
ATOM   10192 O OD2 . ASP I  3 138 ? 4.960   21.036  -2.576  1.00 80.41  ? 153 ASP Z OD2 1 
ATOM   10193 N N   . ASN I  3 139 ? 6.700   15.515  -3.211  1.00 66.62  ? 154 ASN Z N   1 
ATOM   10194 C CA  . ASN I  3 139 ? 7.199   14.337  -3.939  1.00 69.68  ? 154 ASN Z CA  1 
ATOM   10195 C C   . ASN I  3 139 ? 6.448   13.098  -3.465  1.00 75.11  ? 154 ASN Z C   1 
ATOM   10196 O O   . ASN I  3 139 ? 7.031   12.176  -2.884  1.00 75.45  ? 154 ASN Z O   1 
ATOM   10197 C CB  . ASN I  3 139 ? 8.728   14.190  -3.808  1.00 65.98  ? 154 ASN Z CB  1 
ATOM   10198 C CG  . ASN I  3 139 ? 9.487   15.425  -4.191  1.00 80.92  ? 154 ASN Z CG  1 
ATOM   10199 O OD1 . ASN I  3 139 ? 9.518   15.824  -5.355  1.00 75.97  ? 154 ASN Z OD1 1 
ATOM   10200 N ND2 . ASN I  3 139 ? 10.071  16.090  -3.206  1.00 71.53  ? 154 ASN Z ND2 1 
ATOM   10201 N N   . ILE I  3 140 ? 5.139   13.084  -3.757  1.00 72.21  ? 155 ILE Z N   1 
ATOM   10202 C CA  . ILE I  3 140 ? 4.174   12.058  -3.343  1.00 74.29  ? 155 ILE Z CA  1 
ATOM   10203 C C   . ILE I  3 140 ? 4.651   10.603  -3.568  1.00 82.13  ? 155 ILE Z C   1 
ATOM   10204 O O   . ILE I  3 140 ? 4.135   9.709   -2.894  1.00 84.89  ? 155 ILE Z O   1 
ATOM   10205 C CB  . ILE I  3 140 ? 2.751   12.291  -3.943  1.00 78.12  ? 155 ILE Z CB  1 
ATOM   10206 C CG1 . ILE I  3 140 ? 2.744   12.315  -5.482  1.00 80.78  ? 155 ILE Z CG1 1 
ATOM   10207 C CG2 . ILE I  3 140 ? 2.129   13.556  -3.375  1.00 74.79  ? 155 ILE Z CG2 1 
ATOM   10208 C CD1 . ILE I  3 140 ? 1.614   11.500  -6.103  1.00 90.48  ? 155 ILE Z CD1 1 
ATOM   10209 N N   . ASN I  3 141 ? 5.626   10.364  -4.465  1.00 78.62  ? 156 ASN Z N   1 
ATOM   10210 C CA  . ASN I  3 141 ? 6.095   9.003   -4.703  1.00 82.15  ? 156 ASN Z CA  1 
ATOM   10211 C C   . ASN I  3 141 ? 7.230   8.572   -3.763  1.00 85.64  ? 156 ASN Z C   1 
ATOM   10212 O O   . ASN I  3 141 ? 7.645   7.416   -3.826  1.00 89.57  ? 156 ASN Z O   1 
ATOM   10213 C CB  . ASN I  3 141 ? 6.446   8.776   -6.168  1.00 84.10  ? 156 ASN Z CB  1 
ATOM   10214 C CG  . ASN I  3 141 ? 5.243   8.795   -7.072  1.00 94.60  ? 156 ASN Z CG  1 
ATOM   10215 O OD1 . ASN I  3 141 ? 4.149   8.362   -6.704  1.00 84.86  ? 156 ASN Z OD1 1 
ATOM   10216 N ND2 . ASN I  3 141 ? 5.425   9.284   -8.284  1.00 87.62  ? 156 ASN Z ND2 1 
ATOM   10217 N N   . ILE I  3 142 ? 7.696   9.458   -2.863  1.00 77.72  ? 157 ILE Z N   1 
ATOM   10218 C CA  . ILE I  3 142 ? 8.693   9.076   -1.856  1.00 77.19  ? 157 ILE Z CA  1 
ATOM   10219 C C   . ILE I  3 142 ? 7.873   8.499   -0.701  1.00 84.40  ? 157 ILE Z C   1 
ATOM   10220 O O   . ILE I  3 142 ? 7.057   9.215   -0.132  1.00 81.03  ? 157 ILE Z O   1 
ATOM   10221 C CB  . ILE I  3 142 ? 9.589   10.257  -1.399  1.00 75.60  ? 157 ILE Z CB  1 
ATOM   10222 C CG1 . ILE I  3 142 ? 10.486  10.738  -2.540  1.00 76.01  ? 157 ILE Z CG1 1 
ATOM   10223 C CG2 . ILE I  3 142 ? 10.412  9.873   -0.160  1.00 75.23  ? 157 ILE Z CG2 1 
ATOM   10224 C CD1 . ILE I  3 142 ? 11.168  12.000  -2.270  1.00 80.72  ? 157 ILE Z CD1 1 
ATOM   10225 N N   . HIS I  3 143 ? 8.055   7.210   -0.381  1.00 87.55  ? 158 HIS Z N   1 
ATOM   10226 C CA  . HIS I  3 143 ? 7.268   6.562   0.676   1.00 89.28  ? 158 HIS Z CA  1 
ATOM   10227 C C   . HIS I  3 143 ? 8.107   6.120   1.876   1.00 93.39  ? 158 HIS Z C   1 
ATOM   10228 O O   . HIS I  3 143 ? 7.544   5.884   2.953   1.00 93.00  ? 158 HIS Z O   1 
ATOM   10229 C CB  . HIS I  3 143 ? 6.462   5.354   0.122   1.00 95.11  ? 158 HIS Z CB  1 
ATOM   10230 C CG  . HIS I  3 143 ? 5.599   5.639   -1.077  1.00 99.40  ? 158 HIS Z CG  1 
ATOM   10231 N ND1 . HIS I  3 143 ? 4.687   6.689   -1.092  1.00 98.30  ? 158 HIS Z ND1 1 
ATOM   10232 C CD2 . HIS I  3 143 ? 5.498   4.963   -2.246  1.00 104.88 ? 158 HIS Z CD2 1 
ATOM   10233 C CE1 . HIS I  3 143 ? 4.089   6.630   -2.273  1.00 99.55  ? 158 HIS Z CE1 1 
ATOM   10234 N NE2 . HIS I  3 143 ? 4.539   5.608   -3.000  1.00 103.97 ? 158 HIS Z NE2 1 
ATOM   10235 N N   . THR I  3 144 ? 9.436   5.981   1.696   1.00 89.98  ? 159 THR Z N   1 
ATOM   10236 C CA  . THR I  3 144 ? 10.268  5.485   2.787   1.00 90.95  ? 159 THR Z CA  1 
ATOM   10237 C C   . THR I  3 144 ? 11.583  6.251   3.020   1.00 91.38  ? 159 THR Z C   1 
ATOM   10238 O O   . THR I  3 144 ? 12.193  6.773   2.088   1.00 90.48  ? 159 THR Z O   1 
ATOM   10239 C CB  . THR I  3 144 ? 10.532  3.972   2.607   1.00 108.29 ? 159 THR Z CB  1 
ATOM   10240 O OG1 . THR I  3 144 ? 11.306  3.478   3.706   1.00 107.97 ? 159 THR Z OG1 1 
ATOM   10241 C CG2 . THR I  3 144 ? 11.199  3.628   1.275   1.00 112.01 ? 159 THR Z CG2 1 
ATOM   10242 N N   . ILE I  3 145 ? 12.007  6.290   4.293   1.00 86.17  ? 160 ILE Z N   1 
ATOM   10243 C CA  . ILE I  3 145 ? 13.271  6.875   4.725   1.00 84.12  ? 160 ILE Z CA  1 
ATOM   10244 C C   . ILE I  3 145 ? 14.077  5.701   5.240   1.00 90.83  ? 160 ILE Z C   1 
ATOM   10245 O O   . ILE I  3 145 ? 13.774  5.159   6.307   1.00 90.71  ? 160 ILE Z O   1 
ATOM   10246 C CB  . ILE I  3 145 ? 13.144  7.998   5.790   1.00 83.55  ? 160 ILE Z CB  1 
ATOM   10247 C CG1 . ILE I  3 145 ? 12.157  9.110   5.355   1.00 80.70  ? 160 ILE Z CG1 1 
ATOM   10248 C CG2 . ILE I  3 145 ? 14.529  8.569   6.114   1.00 83.04  ? 160 ILE Z CG2 1 
ATOM   10249 C CD1 . ILE I  3 145 ? 11.898  10.194  6.384   1.00 82.56  ? 160 ILE Z CD1 1 
ATOM   10250 N N   . GLU I  3 146 ? 15.086  5.299   4.458   1.00 90.00  ? 161 GLU Z N   1 
ATOM   10251 C CA  . GLU I  3 146 ? 15.967  4.165   4.744   1.00 94.43  ? 161 GLU Z CA  1 
ATOM   10252 C C   . GLU I  3 146 ? 16.935  4.476   5.889   1.00 97.03  ? 161 GLU Z C   1 
ATOM   10253 O O   . GLU I  3 146 ? 16.980  5.604   6.365   1.00 92.13  ? 161 GLU Z O   1 
ATOM   10254 C CB  . GLU I  3 146 ? 16.770  3.791   3.480   1.00 98.79  ? 161 GLU Z CB  1 
ATOM   10255 C CG  . GLU I  3 146 ? 15.954  3.673   2.203   1.00 108.98 ? 161 GLU Z CG  1 
ATOM   10256 C CD  . GLU I  3 146 ? 15.656  2.262   1.744   1.00 134.04 ? 161 GLU Z CD  1 
ATOM   10257 O OE1 . GLU I  3 146 ? 16.613  1.478   1.541   1.00 129.43 ? 161 GLU Z OE1 1 
ATOM   10258 O OE2 . GLU I  3 146 ? 14.460  1.962   1.527   1.00 134.18 ? 161 GLU Z OE2 1 
ATOM   10259 N N   . ARG I  3 147 ? 17.721  3.476   6.313   1.00 98.60  ? 162 ARG Z N   1 
ATOM   10260 C CA  . ARG I  3 147 ? 18.760  3.624   7.332   1.00 98.94  ? 162 ARG Z CA  1 
ATOM   10261 C C   . ARG I  3 147 ? 19.877  4.469   6.711   1.00 101.27 ? 162 ARG Z C   1 
ATOM   10262 O O   . ARG I  3 147 ? 20.048  4.435   5.487   1.00 102.08 ? 162 ARG Z O   1 
ATOM   10263 C CB  . ARG I  3 147 ? 19.314  2.238   7.712   1.00 104.83 ? 162 ARG Z CB  1 
ATOM   10264 C CG  . ARG I  3 147 ? 20.183  2.217   8.965   1.00 116.42 ? 162 ARG Z CG  1 
ATOM   10265 C CD  . ARG I  3 147 ? 20.832  0.856   9.166   1.00 138.60 ? 162 ARG Z CD  1 
ATOM   10266 N NE  . ARG I  3 147 ? 22.274  0.880   8.897   1.00 150.44 ? 162 ARG Z NE  1 
ATOM   10267 C CZ  . ARG I  3 147 ? 22.855  0.335   7.832   1.00 163.13 ? 162 ARG Z CZ  1 
ATOM   10268 N NH1 . ARG I  3 147 ? 22.127  -0.297  6.918   1.00 147.04 ? 162 ARG Z NH1 1 
ATOM   10269 N NH2 . ARG I  3 147 ? 24.170  0.413   7.675   1.00 151.24 ? 162 ARG Z NH2 1 
ATOM   10270 N N   . ASN I  3 148 ? 20.608  5.246   7.539   1.00 95.42  ? 163 ASN Z N   1 
ATOM   10271 C CA  . ASN I  3 148 ? 21.732  6.099   7.121   1.00 94.06  ? 163 ASN Z CA  1 
ATOM   10272 C C   . ASN I  3 148 ? 21.357  7.034   5.922   1.00 95.09  ? 163 ASN Z C   1 
ATOM   10273 O O   . ASN I  3 148 ? 22.218  7.372   5.100   1.00 96.38  ? 163 ASN Z O   1 
ATOM   10274 C CB  . ASN I  3 148 ? 22.983  5.231   6.780   1.00 99.07  ? 163 ASN Z CB  1 
ATOM   10275 C CG  . ASN I  3 148 ? 23.710  4.492   7.896   1.00 132.76 ? 163 ASN Z CG  1 
ATOM   10276 O OD1 . ASN I  3 148 ? 24.905  4.172   7.775   1.00 133.76 ? 163 ASN Z OD1 1 
ATOM   10277 N ND2 . ASN I  3 148 ? 23.025  4.138   8.973   1.00 124.88 ? 163 ASN Z ND2 1 
ATOM   10278 N N   . SER I  3 149 ? 20.078  7.456   5.844   1.00 86.90  ? 164 SER Z N   1 
ATOM   10279 C CA  . SER I  3 149 ? 19.534  8.277   4.752   1.00 83.24  ? 164 SER Z CA  1 
ATOM   10280 C C   . SER I  3 149 ? 20.216  9.625   4.550   1.00 82.65  ? 164 SER Z C   1 
ATOM   10281 O O   . SER I  3 149 ? 20.142  10.180  3.448   1.00 81.72  ? 164 SER Z O   1 
ATOM   10282 C CB  . SER I  3 149 ? 18.028  8.483   4.924   1.00 83.64  ? 164 SER Z CB  1 
ATOM   10283 O OG  . SER I  3 149 ? 17.252  7.448   4.338   1.00 94.54  ? 164 SER Z OG  1 
ATOM   10284 N N   . PHE I  3 150 ? 20.859  10.161  5.607   1.00 75.79  ? 165 PHE Z N   1 
ATOM   10285 C CA  . PHE I  3 150 ? 21.464  11.486  5.564   1.00 71.54  ? 165 PHE Z CA  1 
ATOM   10286 C C   . PHE I  3 150 ? 22.917  11.519  6.058   1.00 78.62  ? 165 PHE Z C   1 
ATOM   10287 O O   . PHE I  3 150 ? 23.517  12.606  6.147   1.00 77.56  ? 165 PHE Z O   1 
ATOM   10288 C CB  . PHE I  3 150 ? 20.572  12.487  6.318   1.00 68.75  ? 165 PHE Z CB  1 
ATOM   10289 C CG  . PHE I  3 150 ? 19.144  12.477  5.824   1.00 68.13  ? 165 PHE Z CG  1 
ATOM   10290 C CD1 . PHE I  3 150 ? 18.799  13.097  4.628   1.00 69.37  ? 165 PHE Z CD1 1 
ATOM   10291 C CD2 . PHE I  3 150 ? 18.154  11.794  6.523   1.00 70.06  ? 165 PHE Z CD2 1 
ATOM   10292 C CE1 . PHE I  3 150 ? 17.485  13.037  4.143   1.00 69.55  ? 165 PHE Z CE1 1 
ATOM   10293 C CE2 . PHE I  3 150 ? 16.835  11.752  6.044   1.00 71.89  ? 165 PHE Z CE2 1 
ATOM   10294 C CZ  . PHE I  3 150 ? 16.509  12.366  4.855   1.00 68.42  ? 165 PHE Z CZ  1 
ATOM   10295 N N   . VAL I  3 151 ? 23.511  10.338  6.329   1.00 77.66  ? 166 VAL Z N   1 
ATOM   10296 C CA  . VAL I  3 151 ? 24.909  10.299  6.758   1.00 78.98  ? 166 VAL Z CA  1 
ATOM   10297 C C   . VAL I  3 151 ? 25.801  10.826  5.623   1.00 80.73  ? 166 VAL Z C   1 
ATOM   10298 O O   . VAL I  3 151 ? 25.493  10.604  4.445   1.00 80.91  ? 166 VAL Z O   1 
ATOM   10299 C CB  . VAL I  3 151 ? 25.350  8.900   7.300   1.00 87.37  ? 166 VAL Z CB  1 
ATOM   10300 C CG1 . VAL I  3 151 ? 25.541  7.884   6.180   1.00 90.96  ? 166 VAL Z CG1 1 
ATOM   10301 C CG2 . VAL I  3 151 ? 26.603  8.990   8.171   1.00 88.56  ? 166 VAL Z CG2 1 
ATOM   10302 N N   . GLY I  3 152 ? 26.826  11.586  5.999   1.00 74.72  ? 167 GLY Z N   1 
ATOM   10303 C CA  . GLY I  3 152 ? 27.813  12.130  5.078   1.00 74.79  ? 167 GLY Z CA  1 
ATOM   10304 C C   . GLY I  3 152 ? 27.354  13.229  4.150   1.00 75.53  ? 167 GLY Z C   1 
ATOM   10305 O O   . GLY I  3 152 ? 28.106  13.596  3.237   1.00 76.36  ? 167 GLY Z O   1 
ATOM   10306 N N   . LEU I  3 153 ? 26.122  13.771  4.377   1.00 67.79  ? 168 LEU Z N   1 
ATOM   10307 C CA  . LEU I  3 153 ? 25.576  14.891  3.617   1.00 63.97  ? 168 LEU Z CA  1 
ATOM   10308 C C   . LEU I  3 153 ? 26.467  16.095  3.855   1.00 68.06  ? 168 LEU Z C   1 
ATOM   10309 O O   . LEU I  3 153 ? 26.784  16.807  2.904   1.00 68.58  ? 168 LEU Z O   1 
ATOM   10310 C CB  . LEU I  3 153 ? 24.145  15.215  4.072   1.00 60.57  ? 168 LEU Z CB  1 
ATOM   10311 C CG  . LEU I  3 153 ? 23.541  16.589  3.666   1.00 61.47  ? 168 LEU Z CG  1 
ATOM   10312 C CD1 . LEU I  3 153 ? 23.460  16.765  2.141   1.00 61.96  ? 168 LEU Z CD1 1 
ATOM   10313 C CD2 . LEU I  3 153 ? 22.171  16.759  4.253   1.00 60.39  ? 168 LEU Z CD2 1 
ATOM   10314 N N   . SER I  3 154 ? 26.854  16.328  5.129   1.00 63.94  ? 169 SER Z N   1 
ATOM   10315 C CA  . SER I  3 154 ? 27.702  17.451  5.534   1.00 63.57  ? 169 SER Z CA  1 
ATOM   10316 C C   . SER I  3 154 ? 28.399  17.220  6.887   1.00 72.19  ? 169 SER Z C   1 
ATOM   10317 O O   . SER I  3 154 ? 27.836  16.560  7.780   1.00 73.40  ? 169 SER Z O   1 
ATOM   10318 C CB  . SER I  3 154 ? 26.888  18.748  5.582   1.00 60.21  ? 169 SER Z CB  1 
ATOM   10319 O OG  . SER I  3 154 ? 27.523  19.788  6.305   1.00 57.00  ? 169 SER Z OG  1 
ATOM   10320 N N   . PHE I  3 155 ? 29.603  17.832  7.047   1.00 68.62  ? 170 PHE Z N   1 
ATOM   10321 C CA  . PHE I  3 155 ? 30.362  17.807  8.289   1.00 69.56  ? 170 PHE Z CA  1 
ATOM   10322 C C   . PHE I  3 155 ? 29.750  18.813  9.308   1.00 71.04  ? 170 PHE Z C   1 
ATOM   10323 O O   . PHE I  3 155 ? 30.118  18.805  10.485  1.00 71.44  ? 170 PHE Z O   1 
ATOM   10324 C CB  . PHE I  3 155 ? 31.821  18.154  8.012   1.00 74.24  ? 170 PHE Z CB  1 
ATOM   10325 C CG  . PHE I  3 155 ? 32.553  17.262  7.036   1.00 78.59  ? 170 PHE Z CG  1 
ATOM   10326 C CD1 . PHE I  3 155 ? 32.600  17.576  5.683   1.00 81.16  ? 170 PHE Z CD1 1 
ATOM   10327 C CD2 . PHE I  3 155 ? 33.246  16.143  7.478   1.00 83.39  ? 170 PHE Z CD2 1 
ATOM   10328 C CE1 . PHE I  3 155 ? 33.310  16.777  4.788   1.00 84.68  ? 170 PHE Z CE1 1 
ATOM   10329 C CE2 . PHE I  3 155 ? 33.956  15.343  6.580   1.00 89.29  ? 170 PHE Z CE2 1 
ATOM   10330 C CZ  . PHE I  3 155 ? 33.977  15.662  5.239   1.00 87.16  ? 170 PHE Z CZ  1 
ATOM   10331 N N   . GLU I  3 156 ? 28.806  19.662  8.844   1.00 65.17  ? 171 GLU Z N   1 
ATOM   10332 C CA  . GLU I  3 156 ? 28.114  20.689  9.631   1.00 63.05  ? 171 GLU Z CA  1 
ATOM   10333 C C   . GLU I  3 156 ? 26.705  20.281  10.000  1.00 67.22  ? 171 GLU Z C   1 
ATOM   10334 O O   . GLU I  3 156 ? 26.198  19.260  9.506   1.00 68.46  ? 171 GLU Z O   1 
ATOM   10335 C CB  . GLU I  3 156 ? 28.063  22.036  8.873   1.00 62.63  ? 171 GLU Z CB  1 
ATOM   10336 C CG  . GLU I  3 156 ? 29.144  23.031  9.266   1.00 68.50  ? 171 GLU Z CG  1 
ATOM   10337 C CD  . GLU I  3 156 ? 29.006  23.702  10.620  1.00 86.00  ? 171 GLU Z CD  1 
ATOM   10338 O OE1 . GLU I  3 156 ? 28.054  23.382  11.370  1.00 89.45  ? 171 GLU Z OE1 1 
ATOM   10339 O OE2 . GLU I  3 156 ? 29.863  24.558  10.932  1.00 81.23  ? 171 GLU Z OE2 1 
ATOM   10340 N N   . SER I  3 157 ? 26.051  21.108  10.855  1.00 61.55  ? 172 SER Z N   1 
ATOM   10341 C CA  . SER I  3 157 ? 24.673  20.888  11.288  1.00 58.95  ? 172 SER Z CA  1 
ATOM   10342 C C   . SER I  3 157 ? 23.776  20.924  10.061  1.00 61.19  ? 172 SER Z C   1 
ATOM   10343 O O   . SER I  3 157 ? 24.152  21.490  9.028   1.00 60.27  ? 172 SER Z O   1 
ATOM   10344 C CB  . SER I  3 157 ? 24.260  21.909  12.339  1.00 61.29  ? 172 SER Z CB  1 
ATOM   10345 O OG  . SER I  3 157 ? 23.660  23.050  11.755  1.00 67.88  ? 172 SER Z OG  1 
ATOM   10346 N N   . VAL I  3 158 ? 22.617  20.271  10.138  1.00 56.70  ? 173 VAL Z N   1 
ATOM   10347 C CA  . VAL I  3 158 ? 21.798  20.125  8.947   1.00 53.51  ? 173 VAL Z CA  1 
ATOM   10348 C C   . VAL I  3 158 ? 20.288  20.331  9.239   1.00 52.08  ? 173 VAL Z C   1 
ATOM   10349 O O   . VAL I  3 158 ? 19.831  20.012  10.337  1.00 52.87  ? 173 VAL Z O   1 
ATOM   10350 C CB  . VAL I  3 158 ? 22.221  18.729  8.355   1.00 57.84  ? 173 VAL Z CB  1 
ATOM   10351 C CG1 . VAL I  3 158 ? 21.093  17.742  8.180   1.00 57.05  ? 173 VAL Z CG1 1 
ATOM   10352 C CG2 . VAL I  3 158 ? 23.063  18.879  7.093   1.00 58.18  ? 173 VAL Z CG2 1 
ATOM   10353 N N   . ILE I  3 159 ? 19.552  20.954  8.283   1.00 43.87  ? 174 ILE Z N   1 
ATOM   10354 C CA  . ILE I  3 159 ? 18.092  21.178  8.356   1.00 41.06  ? 174 ILE Z CA  1 
ATOM   10355 C C   . ILE I  3 159 ? 17.472  20.278  7.315   1.00 47.69  ? 174 ILE Z C   1 
ATOM   10356 O O   . ILE I  3 159 ? 17.839  20.356  6.135   1.00 47.57  ? 174 ILE Z O   1 
ATOM   10357 C CB  . ILE I  3 159 ? 17.654  22.655  8.111   1.00 41.20  ? 174 ILE Z CB  1 
ATOM   10358 C CG1 . ILE I  3 159 ? 18.049  23.567  9.282   1.00 39.87  ? 174 ILE Z CG1 1 
ATOM   10359 C CG2 . ILE I  3 159 ? 16.140  22.754  7.787   1.00 39.52  ? 174 ILE Z CG2 1 
ATOM   10360 C CD1 . ILE I  3 159 ? 17.672  24.927  9.110   1.00 34.48  ? 174 ILE Z CD1 1 
ATOM   10361 N N   . LEU I  3 160 ? 16.502  19.462  7.735   1.00 46.37  ? 175 LEU Z N   1 
ATOM   10362 C CA  . LEU I  3 160 ? 15.821  18.529  6.840   1.00 47.47  ? 175 LEU Z CA  1 
ATOM   10363 C C   . LEU I  3 160 ? 14.315  18.761  6.761   1.00 52.81  ? 175 LEU Z C   1 
ATOM   10364 O O   . LEU I  3 160 ? 13.587  18.477  7.712   1.00 52.16  ? 175 LEU Z O   1 
ATOM   10365 C CB  . LEU I  3 160 ? 16.114  17.067  7.250   1.00 49.49  ? 175 LEU Z CB  1 
ATOM   10366 C CG  . LEU I  3 160 ? 17.580  16.638  7.394   1.00 53.95  ? 175 LEU Z CG  1 
ATOM   10367 C CD1 . LEU I  3 160 ? 17.677  15.214  7.898   1.00 54.81  ? 175 LEU Z CD1 1 
ATOM   10368 C CD2 . LEU I  3 160 ? 18.303  16.764  6.085   1.00 57.45  ? 175 LEU Z CD2 1 
ATOM   10369 N N   . TRP I  3 161 ? 13.853  19.271  5.614   1.00 51.12  ? 176 TRP Z N   1 
ATOM   10370 C CA  . TRP I  3 161 ? 12.433  19.466  5.359   1.00 51.11  ? 176 TRP Z CA  1 
ATOM   10371 C C   . TRP I  3 161 ? 12.004  18.375  4.383   1.00 59.97  ? 176 TRP Z C   1 
ATOM   10372 O O   . TRP I  3 161 ? 12.311  18.446  3.187   1.00 61.30  ? 176 TRP Z O   1 
ATOM   10373 C CB  . TRP I  3 161 ? 12.129  20.875  4.839   1.00 48.12  ? 176 TRP Z CB  1 
ATOM   10374 C CG  . TRP I  3 161 ? 12.451  21.966  5.819   1.00 48.27  ? 176 TRP Z CG  1 
ATOM   10375 C CD1 . TRP I  3 161 ? 12.566  21.849  7.173   1.00 51.26  ? 176 TRP Z CD1 1 
ATOM   10376 C CD2 . TRP I  3 161 ? 12.661  23.355  5.516   1.00 47.27  ? 176 TRP Z CD2 1 
ATOM   10377 N NE1 . TRP I  3 161 ? 12.837  23.074  7.733   1.00 49.96  ? 176 TRP Z NE1 1 
ATOM   10378 C CE2 . TRP I  3 161 ? 12.910  24.017  6.737   1.00 50.55  ? 176 TRP Z CE2 1 
ATOM   10379 C CE3 . TRP I  3 161 ? 12.649  24.113  4.328   1.00 47.80  ? 176 TRP Z CE3 1 
ATOM   10380 C CZ2 . TRP I  3 161 ? 13.193  25.391  6.799   1.00 48.60  ? 176 TRP Z CZ2 1 
ATOM   10381 C CZ3 . TRP I  3 161 ? 12.912  25.468  4.395   1.00 47.83  ? 176 TRP Z CZ3 1 
ATOM   10382 C CH2 . TRP I  3 161 ? 13.185  26.092  5.616   1.00 47.98  ? 176 TRP Z CH2 1 
ATOM   10383 N N   . LEU I  3 162 ? 11.396  17.309  4.931   1.00 57.46  ? 177 LEU Z N   1 
ATOM   10384 C CA  . LEU I  3 162 ? 10.932  16.142  4.178   1.00 59.11  ? 177 LEU Z CA  1 
ATOM   10385 C C   . LEU I  3 162 ? 9.414   16.115  4.254   1.00 63.94  ? 177 LEU Z C   1 
ATOM   10386 O O   . LEU I  3 162 ? 8.776   15.071  4.051   1.00 65.37  ? 177 LEU Z O   1 
ATOM   10387 C CB  . LEU I  3 162 ? 11.528  14.840  4.756   1.00 60.71  ? 177 LEU Z CB  1 
ATOM   10388 C CG  . LEU I  3 162 ? 12.956  14.911  5.246   1.00 64.32  ? 177 LEU Z CG  1 
ATOM   10389 C CD1 . LEU I  3 162 ? 13.282  13.726  6.102   1.00 65.85  ? 177 LEU Z CD1 1 
ATOM   10390 C CD2 . LEU I  3 162 ? 13.923  15.094  4.097   1.00 67.13  ? 177 LEU Z CD2 1 
ATOM   10391 N N   . ASN I  3 163 ? 8.835   17.289  4.518   1.00 58.64  ? 178 ASN Z N   1 
ATOM   10392 C CA  . ASN I  3 163 ? 7.392   17.429  4.648   1.00 58.58  ? 178 ASN Z CA  1 
ATOM   10393 C C   . ASN I  3 163 ? 6.657   17.364  3.295   1.00 61.70  ? 178 ASN Z C   1 
ATOM   10394 O O   . ASN I  3 163 ? 7.303   17.355  2.244   1.00 61.68  ? 178 ASN Z O   1 
ATOM   10395 C CB  . ASN I  3 163 ? 7.044   18.697  5.452   1.00 56.99  ? 178 ASN Z CB  1 
ATOM   10396 C CG  . ASN I  3 163 ? 7.473   19.978  4.824   1.00 76.10  ? 178 ASN Z CG  1 
ATOM   10397 O OD1 . ASN I  3 163 ? 8.622   20.393  4.934   1.00 71.17  ? 178 ASN Z OD1 1 
ATOM   10398 N ND2 . ASN I  3 163 ? 6.540   20.644  4.177   1.00 71.80  ? 178 ASN Z ND2 1 
ATOM   10399 N N   . LYS I  3 164 ? 5.312   17.261  3.338   1.00 57.86  ? 179 LYS Z N   1 
ATOM   10400 C CA  . LYS I  3 164 ? 4.414   17.218  2.179   1.00 58.63  ? 179 LYS Z CA  1 
ATOM   10401 C C   . LYS I  3 164 ? 4.809   16.163  1.116   1.00 65.01  ? 179 LYS Z C   1 
ATOM   10402 O O   . LYS I  3 164 ? 4.727   16.437  -0.076  1.00 66.57  ? 179 LYS Z O   1 
ATOM   10403 C CB  . LYS I  3 164 ? 4.275   18.633  1.553   1.00 58.84  ? 179 LYS Z CB  1 
ATOM   10404 C CG  . LYS I  3 164 ? 3.298   19.557  2.277   1.00 60.48  ? 179 LYS Z CG  1 
ATOM   10405 C CD  . LYS I  3 164 ? 3.465   21.006  1.858   1.00 63.13  ? 179 LYS Z CD  1 
ATOM   10406 C CE  . LYS I  3 164 ? 2.159   21.750  1.644   1.00 61.96  ? 179 LYS Z CE  1 
ATOM   10407 N NZ  . LYS I  3 164 ? 1.599   21.504  0.289   1.00 62.37  ? 179 LYS Z NZ  1 
ATOM   10408 N N   . ASN I  3 165 ? 5.240   14.974  1.532   1.00 61.83  ? 180 ASN Z N   1 
ATOM   10409 C CA  . ASN I  3 165 ? 5.613   13.969  0.547   1.00 64.90  ? 180 ASN Z CA  1 
ATOM   10410 C C   . ASN I  3 165 ? 4.632   12.806  0.572   1.00 74.53  ? 180 ASN Z C   1 
ATOM   10411 O O   . ASN I  3 165 ? 3.432   13.023  0.360   1.00 76.14  ? 180 ASN Z O   1 
ATOM   10412 C CB  . ASN I  3 165 ? 7.045   13.500  0.750   1.00 64.70  ? 180 ASN Z CB  1 
ATOM   10413 C CG  . ASN I  3 165 ? 8.081   14.500  0.364   1.00 71.06  ? 180 ASN Z CG  1 
ATOM   10414 O OD1 . ASN I  3 165 ? 8.076   15.026  -0.743  1.00 67.57  ? 180 ASN Z OD1 1 
ATOM   10415 N ND2 . ASN I  3 165 ? 9.029   14.739  1.255   1.00 53.50  ? 180 ASN Z ND2 1 
ATOM   10416 N N   . GLY I  3 166 ? 5.136   11.602  0.836   1.00 72.73  ? 181 GLY Z N   1 
ATOM   10417 C CA  . GLY I  3 166 ? 4.322   10.403  0.935   1.00 76.52  ? 181 GLY Z CA  1 
ATOM   10418 C C   . GLY I  3 166 ? 4.912   9.395   1.896   1.00 82.66  ? 181 GLY Z C   1 
ATOM   10419 O O   . GLY I  3 166 ? 4.548   8.212   1.854   1.00 86.59  ? 181 GLY Z O   1 
ATOM   10420 N N   . ILE I  3 167 ? 5.859   9.863   2.741   1.00 75.64  ? 182 ILE Z N   1 
ATOM   10421 C CA  . ILE I  3 167 ? 6.541   9.056   3.754   1.00 76.79  ? 182 ILE Z CA  1 
ATOM   10422 C C   . ILE I  3 167 ? 5.508   8.384   4.676   1.00 81.88  ? 182 ILE Z C   1 
ATOM   10423 O O   . ILE I  3 167 ? 4.523   9.021   5.067   1.00 81.16  ? 182 ILE Z O   1 
ATOM   10424 C CB  . ILE I  3 167 ? 7.617   9.908   4.506   1.00 77.12  ? 182 ILE Z CB  1 
ATOM   10425 C CG1 . ILE I  3 167 ? 8.750   10.323  3.552   1.00 76.81  ? 182 ILE Z CG1 1 
ATOM   10426 C CG2 . ILE I  3 167 ? 8.218   9.189   5.726   1.00 79.28  ? 182 ILE Z CG2 1 
ATOM   10427 C CD1 . ILE I  3 167 ? 8.812   11.727  3.329   1.00 80.22  ? 182 ILE Z CD1 1 
ATOM   10428 N N   . GLN I  3 168 ? 5.692   7.073   4.925   1.00 80.14  ? 183 GLN Z N   1 
ATOM   10429 C CA  . GLN I  3 168 ? 4.839   6.214   5.768   1.00 81.68  ? 183 GLN Z CA  1 
ATOM   10430 C C   . GLN I  3 168 ? 5.690   5.141   6.456   1.00 88.16  ? 183 GLN Z C   1 
ATOM   10431 O O   . GLN I  3 168 ? 5.184   4.396   7.312   1.00 89.32  ? 183 GLN Z O   1 
ATOM   10432 C CB  . GLN I  3 168 ? 3.700   5.583   4.953   1.00 85.49  ? 183 GLN Z CB  1 
ATOM   10433 C CG  . GLN I  3 168 ? 4.158   4.964   3.642   1.00 96.41  ? 183 GLN Z CG  1 
ATOM   10434 C CD  . GLN I  3 168 ? 3.004   4.615   2.753   1.00 108.73 ? 183 GLN Z CD  1 
ATOM   10435 O OE1 . GLN I  3 168 ? 2.582   5.412   1.906   1.00 97.65  ? 183 GLN Z OE1 1 
ATOM   10436 N NE2 . GLN I  3 168 ? 2.483   3.405   2.919   1.00 104.00 ? 183 GLN Z NE2 1 
ATOM   10437 N N   . GLU I  3 169 ? 7.003   5.108   6.081   1.00 84.38  ? 184 GLU Z N   1 
ATOM   10438 C CA  . GLU I  3 169 ? 8.041   4.214   6.583   1.00 87.00  ? 184 GLU Z CA  1 
ATOM   10439 C C   . GLU I  3 169 ? 9.336   4.953   6.969   1.00 86.78  ? 184 GLU Z C   1 
ATOM   10440 O O   . GLU I  3 169 ? 10.008  5.481   6.089   1.00 84.58  ? 184 GLU Z O   1 
ATOM   10441 C CB  . GLU I  3 169 ? 8.358   3.129   5.544   1.00 93.05  ? 184 GLU Z CB  1 
ATOM   10442 C CG  . GLU I  3 169 ? 7.460   1.907   5.605   1.00 109.48 ? 184 GLU Z CG  1 
ATOM   10443 C CD  . GLU I  3 169 ? 7.619   1.034   6.835   1.00 131.11 ? 184 GLU Z CD  1 
ATOM   10444 O OE1 . GLU I  3 169 ? 6.587   0.744   7.483   1.00 126.66 ? 184 GLU Z OE1 1 
ATOM   10445 O OE2 . GLU I  3 169 ? 8.767   0.639   7.149   1.00 122.42 ? 184 GLU Z OE2 1 
ATOM   10446 N N   . ILE I  3 170 ? 9.690   4.989   8.275   1.00 82.86  ? 185 ILE Z N   1 
ATOM   10447 C CA  . ILE I  3 170 ? 10.940  5.595   8.769   1.00 80.82  ? 185 ILE Z CA  1 
ATOM   10448 C C   . ILE I  3 170 ? 11.731  4.560   9.572   1.00 90.13  ? 185 ILE Z C   1 
ATOM   10449 O O   . ILE I  3 170 ? 11.384  4.267   10.711  1.00 91.51  ? 185 ILE Z O   1 
ATOM   10450 C CB  . ILE I  3 170 ? 10.789  6.959   9.517   1.00 79.30  ? 185 ILE Z CB  1 
ATOM   10451 C CG1 . ILE I  3 170 ? 10.126  8.021   8.625   1.00 75.09  ? 185 ILE Z CG1 1 
ATOM   10452 C CG2 . ILE I  3 170 ? 12.164  7.471   10.025  1.00 79.87  ? 185 ILE Z CG2 1 
ATOM   10453 C CD1 . ILE I  3 170 ? 9.668   9.183   9.332   1.00 70.72  ? 185 ILE Z CD1 1 
ATOM   10454 N N   . HIS I  3 171 ? 12.797  4.024   8.970   1.00 89.32  ? 186 HIS Z N   1 
ATOM   10455 C CA  . HIS I  3 171 ? 13.662  3.005   9.559   1.00 94.09  ? 186 HIS Z CA  1 
ATOM   10456 C C   . HIS I  3 171 ? 14.494  3.507   10.748  1.00 97.65  ? 186 HIS Z C   1 
ATOM   10457 O O   . HIS I  3 171 ? 14.710  4.705   10.887  1.00 93.62  ? 186 HIS Z O   1 
ATOM   10458 C CB  . HIS I  3 171 ? 14.607  2.446   8.473   1.00 97.86  ? 186 HIS Z CB  1 
ATOM   10459 C CG  . HIS I  3 171 ? 13.933  1.712   7.343   1.00 104.09 ? 186 HIS Z CG  1 
ATOM   10460 N ND1 . HIS I  3 171 ? 14.674  1.148   6.315   1.00 108.72 ? 186 HIS Z ND1 1 
ATOM   10461 C CD2 . HIS I  3 171 ? 12.617  1.472   7.112   1.00 106.12 ? 186 HIS Z CD2 1 
ATOM   10462 C CE1 . HIS I  3 171 ? 13.791  0.591   5.501   1.00 110.25 ? 186 HIS Z CE1 1 
ATOM   10463 N NE2 . HIS I  3 171 ? 12.542  0.758   5.940   1.00 109.13 ? 186 HIS Z NE2 1 
ATOM   10464 N N   . ASN I  3 172 ? 14.990  2.580   11.588  1.00 99.19  ? 187 ASN Z N   1 
ATOM   10465 C CA  . ASN I  3 172 ? 15.884  2.908   12.706  1.00 98.63  ? 187 ASN Z CA  1 
ATOM   10466 C C   . ASN I  3 172 ? 17.212  3.400   12.119  1.00 101.96 ? 187 ASN Z C   1 
ATOM   10467 O O   . ASN I  3 172 ? 17.639  2.918   11.066  1.00 103.75 ? 187 ASN Z O   1 
ATOM   10468 C CB  . ASN I  3 172 ? 16.124  1.692   13.613  1.00 99.51  ? 187 ASN Z CB  1 
ATOM   10469 C CG  . ASN I  3 172 ? 14.918  1.284   14.417  1.00 108.71 ? 187 ASN Z CG  1 
ATOM   10470 O OD1 . ASN I  3 172 ? 14.523  1.941   15.379  1.00 88.07  ? 187 ASN Z OD1 1 
ATOM   10471 N ND2 . ASN I  3 172 ? 14.302  0.179   14.037  1.00 109.33 ? 187 ASN Z ND2 1 
ATOM   10472 N N   . SER I  3 173 ? 17.826  4.396   12.774  1.00 95.38  ? 188 SER Z N   1 
ATOM   10473 C CA  . SER I  3 173 ? 19.092  5.028   12.390  1.00 93.54  ? 188 SER Z CA  1 
ATOM   10474 C C   . SER I  3 173 ? 19.020  5.750   11.026  1.00 95.02  ? 188 SER Z C   1 
ATOM   10475 O O   . SER I  3 173 ? 20.058  6.029   10.412  1.00 94.27  ? 188 SER Z O   1 
ATOM   10476 C CB  . SER I  3 173 ? 20.252  4.038   12.466  1.00 99.38  ? 188 SER Z CB  1 
ATOM   10477 O OG  . SER I  3 173 ? 20.503  3.725   13.824  1.00 104.64 ? 188 SER Z OG  1 
ATOM   10478 N N   . ALA I  3 174 ? 17.785  6.119   10.596  1.00 89.44  ? 189 ALA Z N   1 
ATOM   10479 C CA  . ALA I  3 174 ? 17.528  6.877   9.364   1.00 86.47  ? 189 ALA Z CA  1 
ATOM   10480 C C   . ALA I  3 174 ? 18.358  8.155   9.365   1.00 86.52  ? 189 ALA Z C   1 
ATOM   10481 O O   . ALA I  3 174 ? 18.865  8.561   8.317   1.00 85.07  ? 189 ALA Z O   1 
ATOM   10482 C CB  . ALA I  3 174 ? 16.050  7.233   9.260   1.00 85.04  ? 189 ALA Z CB  1 
ATOM   10483 N N   . PHE I  3 175 ? 18.534  8.742   10.572  1.00 81.59  ? 190 PHE Z N   1 
ATOM   10484 C CA  . PHE I  3 175 ? 19.272  9.978   10.827  1.00 78.45  ? 190 PHE Z CA  1 
ATOM   10485 C C   . PHE I  3 175 ? 20.588  9.753   11.561  1.00 84.71  ? 190 PHE Z C   1 
ATOM   10486 O O   . PHE I  3 175 ? 21.070  10.660  12.241  1.00 83.89  ? 190 PHE Z O   1 
ATOM   10487 C CB  . PHE I  3 175 ? 18.398  10.982  11.601  1.00 76.49  ? 190 PHE Z CB  1 
ATOM   10488 C CG  . PHE I  3 175 ? 17.020  11.145  11.033  1.00 75.49  ? 190 PHE Z CG  1 
ATOM   10489 C CD1 . PHE I  3 175 ? 16.819  11.834  9.845   1.00 75.97  ? 190 PHE Z CD1 1 
ATOM   10490 C CD2 . PHE I  3 175 ? 15.923  10.582  11.665  1.00 78.19  ? 190 PHE Z CD2 1 
ATOM   10491 C CE1 . PHE I  3 175 ? 15.544  11.956  9.300   1.00 75.71  ? 190 PHE Z CE1 1 
ATOM   10492 C CE2 . PHE I  3 175 ? 14.647  10.709  11.120  1.00 80.05  ? 190 PHE Z CE2 1 
ATOM   10493 C CZ  . PHE I  3 175 ? 14.466  11.389  9.937   1.00 75.86  ? 190 PHE Z CZ  1 
ATOM   10494 N N   . ASN I  3 176 ? 21.195  8.581   11.412  1.00 84.19  ? 191 ASN Z N   1 
ATOM   10495 C CA  . ASN I  3 176 ? 22.471  8.363   12.081  1.00 86.30  ? 191 ASN Z CA  1 
ATOM   10496 C C   . ASN I  3 176 ? 23.568  9.090   11.309  1.00 88.88  ? 191 ASN Z C   1 
ATOM   10497 O O   . ASN I  3 176 ? 23.364  9.406   10.129  1.00 87.03  ? 191 ASN Z O   1 
ATOM   10498 C CB  . ASN I  3 176 ? 22.727  6.872   12.361  1.00 90.70  ? 191 ASN Z CB  1 
ATOM   10499 C CG  . ASN I  3 176 ? 23.983  6.262   11.821  1.00 110.94 ? 191 ASN Z CG  1 
ATOM   10500 O OD1 . ASN I  3 176 ? 24.132  6.095   10.602  1.00 104.72 ? 191 ASN Z OD1 1 
ATOM   10501 N ND2 . ASN I  3 176 ? 24.868  5.885   12.757  1.00 106.35 ? 191 ASN Z ND2 1 
ATOM   10502 N N   . GLY I  3 177 ? 24.649  9.437   12.017  1.00 85.94  ? 192 GLY Z N   1 
ATOM   10503 C CA  . GLY I  3 177 ? 25.785  10.203  11.513  1.00 85.32  ? 192 GLY Z CA  1 
ATOM   10504 C C   . GLY I  3 177 ? 25.381  11.564  10.977  1.00 85.17  ? 192 GLY Z C   1 
ATOM   10505 O O   . GLY I  3 177 ? 25.840  11.969  9.904   1.00 84.04  ? 192 GLY Z O   1 
ATOM   10506 N N   . THR I  3 178 ? 24.477  12.259  11.699  1.00 79.37  ? 193 THR Z N   1 
ATOM   10507 C CA  . THR I  3 178 ? 23.920  13.536  11.270  1.00 75.76  ? 193 THR Z CA  1 
ATOM   10508 C C   . THR I  3 178 ? 23.680  14.498  12.430  1.00 78.99  ? 193 THR Z C   1 
ATOM   10509 O O   . THR I  3 178 ? 22.950  14.148  13.368  1.00 80.36  ? 193 THR Z O   1 
ATOM   10510 C CB  . THR I  3 178 ? 22.608  13.269  10.468  1.00 83.48  ? 193 THR Z CB  1 
ATOM   10511 O OG1 . THR I  3 178 ? 22.929  12.580  9.264   1.00 87.98  ? 193 THR Z OG1 1 
ATOM   10512 C CG2 . THR I  3 178 ? 21.847  14.540  10.097  1.00 79.35  ? 193 THR Z CG2 1 
ATOM   10513 N N   . GLN I  3 179 ? 24.219  15.736  12.326  1.00 72.43  ? 194 GLN Z N   1 
ATOM   10514 C CA  . GLN I  3 179 ? 23.920  16.784  13.303  1.00 71.09  ? 194 GLN Z CA  1 
ATOM   10515 C C   . GLN I  3 179 ? 22.517  17.364  12.911  1.00 70.22  ? 194 GLN Z C   1 
ATOM   10516 O O   . GLN I  3 179 ? 22.416  18.157  11.968  1.00 68.10  ? 194 GLN Z O   1 
ATOM   10517 C CB  . GLN I  3 179 ? 24.987  17.900  13.278  1.00 72.67  ? 194 GLN Z CB  1 
ATOM   10518 C CG  . GLN I  3 179 ? 26.339  17.548  13.875  1.00 90.12  ? 194 GLN Z CG  1 
ATOM   10519 C CD  . GLN I  3 179 ? 27.398  18.541  13.440  1.00 110.86 ? 194 GLN Z CD  1 
ATOM   10520 O OE1 . GLN I  3 179 ? 27.644  19.557  14.102  1.00 109.65 ? 194 GLN Z OE1 1 
ATOM   10521 N NE2 . GLN I  3 179 ? 28.037  18.285  12.299  1.00 97.28  ? 194 GLN Z NE2 1 
ATOM   10522 N N   . LEU I  3 180 ? 21.442  16.933  13.582  1.00 65.01  ? 195 LEU Z N   1 
ATOM   10523 C CA  . LEU I  3 180 ? 20.108  17.435  13.203  1.00 62.40  ? 195 LEU Z CA  1 
ATOM   10524 C C   . LEU I  3 180 ? 19.686  18.713  13.900  1.00 63.99  ? 195 LEU Z C   1 
ATOM   10525 O O   . LEU I  3 180 ? 19.349  18.688  15.082  1.00 64.51  ? 195 LEU Z O   1 
ATOM   10526 C CB  . LEU I  3 180 ? 18.998  16.372  13.368  1.00 62.81  ? 195 LEU Z CB  1 
ATOM   10527 C CG  . LEU I  3 180 ? 18.472  15.756  12.088  1.00 66.01  ? 195 LEU Z CG  1 
ATOM   10528 C CD1 . LEU I  3 180 ? 17.625  14.566  12.397  1.00 67.01  ? 195 LEU Z CD1 1 
ATOM   10529 C CD2 . LEU I  3 180 ? 17.696  16.769  11.274  1.00 66.68  ? 195 LEU Z CD2 1 
ATOM   10530 N N   . ASP I  3 181 ? 19.656  19.828  13.161  1.00 58.15  ? 196 ASP Z N   1 
ATOM   10531 C CA  . ASP I  3 181 ? 19.190  21.101  13.718  1.00 56.12  ? 196 ASP Z CA  1 
ATOM   10532 C C   . ASP I  3 181 ? 17.660  21.083  13.782  1.00 57.43  ? 196 ASP Z C   1 
ATOM   10533 O O   . ASP I  3 181 ? 17.085  21.176  14.870  1.00 56.55  ? 196 ASP Z O   1 
ATOM   10534 C CB  . ASP I  3 181 ? 19.717  22.286  12.903  1.00 56.65  ? 196 ASP Z CB  1 
ATOM   10535 C CG  . ASP I  3 181 ? 21.026  22.837  13.416  1.00 69.82  ? 196 ASP Z CG  1 
ATOM   10536 O OD1 . ASP I  3 181 ? 21.636  22.199  14.311  1.00 71.27  ? 196 ASP Z OD1 1 
ATOM   10537 O OD2 . ASP I  3 181 ? 21.444  23.912  12.932  1.00 79.26  ? 196 ASP Z OD2 1 
ATOM   10538 N N   . GLU I  3 182 ? 17.010  20.889  12.623  1.00 52.36  ? 197 GLU Z N   1 
ATOM   10539 C CA  . GLU I  3 182 ? 15.564  20.801  12.553  1.00 50.77  ? 197 GLU Z CA  1 
ATOM   10540 C C   . GLU I  3 182 ? 15.137  19.776  11.526  1.00 55.29  ? 197 GLU Z C   1 
ATOM   10541 O O   . GLU I  3 182 ? 15.837  19.572  10.523  1.00 54.27  ? 197 GLU Z O   1 
ATOM   10542 C CB  . GLU I  3 182 ? 14.907  22.179  12.364  1.00 50.28  ? 197 GLU Z CB  1 
ATOM   10543 C CG  . GLU I  3 182 ? 14.858  22.725  10.957  1.00 54.03  ? 197 GLU Z CG  1 
ATOM   10544 C CD  . GLU I  3 182 ? 13.899  23.881  10.810  1.00 67.08  ? 197 GLU Z CD  1 
ATOM   10545 O OE1 . GLU I  3 182 ? 14.375  25.035  10.784  1.00 64.41  ? 197 GLU Z OE1 1 
ATOM   10546 O OE2 . GLU I  3 182 ? 12.670  23.643  10.766  1.00 61.75  ? 197 GLU Z OE2 1 
ATOM   10547 N N   . LEU I  3 183 ? 14.009  19.093  11.820  1.00 53.72  ? 198 LEU Z N   1 
ATOM   10548 C CA  . LEU I  3 183 ? 13.445  18.015  11.009  1.00 54.86  ? 198 LEU Z CA  1 
ATOM   10549 C C   . LEU I  3 183 ? 11.956  18.172  10.856  1.00 58.02  ? 198 LEU Z C   1 
ATOM   10550 O O   . LEU I  3 183 ? 11.221  18.104  11.840  1.00 59.04  ? 198 LEU Z O   1 
ATOM   10551 C CB  . LEU I  3 183 ? 13.803  16.628  11.596  1.00 57.47  ? 198 LEU Z CB  1 
ATOM   10552 C CG  . LEU I  3 183 ? 13.067  15.396  11.059  1.00 63.29  ? 198 LEU Z CG  1 
ATOM   10553 C CD1 . LEU I  3 183 ? 13.555  15.011  9.669   1.00 63.78  ? 198 LEU Z CD1 1 
ATOM   10554 C CD2 . LEU I  3 183 ? 13.230  14.237  11.999  1.00 67.61  ? 198 LEU Z CD2 1 
ATOM   10555 N N   . ASN I  3 184 ? 11.517  18.386  9.610   1.00 52.93  ? 199 ASN Z N   1 
ATOM   10556 C CA  . ASN I  3 184 ? 10.117  18.552  9.276   1.00 51.71  ? 199 ASN Z CA  1 
ATOM   10557 C C   . ASN I  3 184 ? 9.599   17.321  8.543   1.00 57.72  ? 199 ASN Z C   1 
ATOM   10558 O O   . ASN I  3 184 ? 9.973   17.068  7.386   1.00 59.03  ? 199 ASN Z O   1 
ATOM   10559 C CB  . ASN I  3 184 ? 9.920   19.794  8.444   1.00 48.07  ? 199 ASN Z CB  1 
ATOM   10560 C CG  . ASN I  3 184 ? 8.490   20.234  8.288   1.00 65.90  ? 199 ASN Z CG  1 
ATOM   10561 O OD1 . ASN I  3 184 ? 7.546   19.576  8.727   1.00 61.91  ? 199 ASN Z OD1 1 
ATOM   10562 N ND2 . ASN I  3 184 ? 8.301   21.366  7.636   1.00 53.71  ? 199 ASN Z ND2 1 
ATOM   10563 N N   . LEU I  3 185 ? 8.735   16.554  9.241   1.00 52.65  ? 200 LEU Z N   1 
ATOM   10564 C CA  . LEU I  3 185 ? 8.074   15.346  8.749   1.00 52.50  ? 200 LEU Z CA  1 
ATOM   10565 C C   . LEU I  3 185 ? 6.567   15.589  8.577   1.00 56.70  ? 200 LEU Z C   1 
ATOM   10566 O O   . LEU I  3 185 ? 5.823   14.643  8.324   1.00 58.03  ? 200 LEU Z O   1 
ATOM   10567 C CB  . LEU I  3 185 ? 8.320   14.164  9.712   1.00 53.61  ? 200 LEU Z CB  1 
ATOM   10568 C CG  . LEU I  3 185 ? 9.697   13.529  9.660   1.00 57.03  ? 200 LEU Z CG  1 
ATOM   10569 C CD1 . LEU I  3 185 ? 9.949   12.671  10.869  1.00 58.04  ? 200 LEU Z CD1 1 
ATOM   10570 C CD2 . LEU I  3 185 ? 9.902   12.770  8.383   1.00 58.88  ? 200 LEU Z CD2 1 
ATOM   10571 N N   . SER I  3 186 ? 6.122   16.861  8.679   1.00 51.45  ? 201 SER Z N   1 
ATOM   10572 C CA  . SER I  3 186 ? 4.714   17.236  8.568   1.00 50.54  ? 201 SER Z CA  1 
ATOM   10573 C C   . SER I  3 186 ? 4.077   16.927  7.225   1.00 56.38  ? 201 SER Z C   1 
ATOM   10574 O O   . SER I  3 186 ? 4.757   16.737  6.229   1.00 55.57  ? 201 SER Z O   1 
ATOM   10575 C CB  . SER I  3 186 ? 4.509   18.702  8.917   1.00 50.49  ? 201 SER Z CB  1 
ATOM   10576 O OG  . SER I  3 186 ? 4.976   19.538  7.874   1.00 56.83  ? 201 SER Z OG  1 
ATOM   10577 N N   . ASP I  3 187 ? 2.753   16.841  7.228   1.00 56.20  ? 202 ASP Z N   1 
ATOM   10578 C CA  . ASP I  3 187 ? 1.875   16.603  6.092   1.00 57.90  ? 202 ASP Z CA  1 
ATOM   10579 C C   . ASP I  3 187 ? 2.183   15.319  5.295   1.00 64.61  ? 202 ASP Z C   1 
ATOM   10580 O O   . ASP I  3 187 ? 1.835   15.216  4.111   1.00 65.84  ? 202 ASP Z O   1 
ATOM   10581 C CB  . ASP I  3 187 ? 1.774   17.841  5.193   1.00 58.31  ? 202 ASP Z CB  1 
ATOM   10582 C CG  . ASP I  3 187 ? 0.584   18.701  5.600   1.00 74.93  ? 202 ASP Z CG  1 
ATOM   10583 O OD1 . ASP I  3 187 ? -0.569  18.151  5.667   1.00 77.69  ? 202 ASP Z OD1 1 
ATOM   10584 O OD2 . ASP I  3 187 ? 0.791   19.907  5.877   1.00 81.18  ? 202 ASP Z OD2 1 
ATOM   10585 N N   . ASN I  3 188 ? 2.734   14.307  5.995   1.00 62.29  ? 203 ASN Z N   1 
ATOM   10586 C CA  . ASN I  3 188 ? 2.978   12.955  5.488   1.00 64.83  ? 203 ASN Z CA  1 
ATOM   10587 C C   . ASN I  3 188 ? 1.891   12.199  6.204   1.00 72.81  ? 203 ASN Z C   1 
ATOM   10588 O O   . ASN I  3 188 ? 2.099   11.628  7.278   1.00 72.71  ? 203 ASN Z O   1 
ATOM   10589 C CB  . ASN I  3 188 ? 4.378   12.450  5.863   1.00 61.84  ? 203 ASN Z CB  1 
ATOM   10590 C CG  . ASN I  3 188 ? 5.452   13.009  4.984   1.00 65.29  ? 203 ASN Z CG  1 
ATOM   10591 O OD1 . ASN I  3 188 ? 5.502   12.743  3.783   1.00 54.47  ? 203 ASN Z OD1 1 
ATOM   10592 N ND2 . ASN I  3 188 ? 6.311   13.833  5.558   1.00 58.55  ? 203 ASN Z ND2 1 
ATOM   10593 N N   . ASN I  3 189 ? 0.680   12.339  5.655   1.00 72.71  ? 204 ASN Z N   1 
ATOM   10594 C CA  . ASN I  3 189 ? -0.578  11.855  6.208   1.00 75.90  ? 204 ASN Z CA  1 
ATOM   10595 C C   . ASN I  3 189 ? -0.611  10.355  6.450   1.00 85.07  ? 204 ASN Z C   1 
ATOM   10596 O O   . ASN I  3 189 ? -1.370  9.916   7.312   1.00 87.36  ? 204 ASN Z O   1 
ATOM   10597 C CB  . ASN I  3 189 ? -1.768  12.308  5.343   1.00 81.04  ? 204 ASN Z CB  1 
ATOM   10598 C CG  . ASN I  3 189 ? -1.600  13.662  4.668   1.00 111.86 ? 204 ASN Z CG  1 
ATOM   10599 O OD1 . ASN I  3 189 ? -1.655  13.773  3.435   1.00 106.84 ? 204 ASN Z OD1 1 
ATOM   10600 N ND2 . ASN I  3 189 ? -1.366  14.720  5.451   1.00 103.09 ? 204 ASN Z ND2 1 
ATOM   10601 N N   . ASN I  3 190 ? 0.226   9.571   5.743   1.00 82.90  ? 205 ASN Z N   1 
ATOM   10602 C CA  . ASN I  3 190 ? 0.221   8.117   5.912   1.00 86.30  ? 205 ASN Z CA  1 
ATOM   10603 C C   . ASN I  3 190 ? 1.191   7.635   6.956   1.00 89.21  ? 205 ASN Z C   1 
ATOM   10604 O O   . ASN I  3 190 ? 1.136   6.464   7.355   1.00 92.71  ? 205 ASN Z O   1 
ATOM   10605 C CB  . ASN I  3 190 ? 0.435   7.408   4.581   1.00 86.73  ? 205 ASN Z CB  1 
ATOM   10606 C CG  . ASN I  3 190 ? -0.677  7.665   3.600   1.00 101.61 ? 205 ASN Z CG  1 
ATOM   10607 O OD1 . ASN I  3 190 ? -1.870  7.760   3.960   1.00 82.84  ? 205 ASN Z OD1 1 
ATOM   10608 N ND2 . ASN I  3 190 ? -0.297  7.815   2.339   1.00 98.19  ? 205 ASN Z ND2 1 
ATOM   10609 N N   . LEU I  3 191 ? 2.069   8.532   7.416   1.00 80.74  ? 206 LEU Z N   1 
ATOM   10610 C CA  . LEU I  3 191 ? 3.078   8.190   8.411   1.00 80.19  ? 206 LEU Z CA  1 
ATOM   10611 C C   . LEU I  3 191 ? 2.459   8.074   9.791   1.00 84.26  ? 206 LEU Z C   1 
ATOM   10612 O O   . LEU I  3 191 ? 1.828   9.017   10.266  1.00 81.25  ? 206 LEU Z O   1 
ATOM   10613 C CB  . LEU I  3 191 ? 4.227   9.202   8.366   1.00 76.38  ? 206 LEU Z CB  1 
ATOM   10614 C CG  . LEU I  3 191 ? 5.345   9.055   9.371   1.00 80.94  ? 206 LEU Z CG  1 
ATOM   10615 C CD1 . LEU I  3 191 ? 6.216   7.826   9.070   1.00 84.23  ? 206 LEU Z CD1 1 
ATOM   10616 C CD2 . LEU I  3 191 ? 6.161   10.324  9.413   1.00 78.24  ? 206 LEU Z CD2 1 
ATOM   10617 N N   . GLU I  3 192 ? 2.603   6.890   10.407  1.00 84.51  ? 207 GLU Z N   1 
ATOM   10618 C CA  . GLU I  3 192 ? 2.042   6.612   11.726  1.00 85.51  ? 207 GLU Z CA  1 
ATOM   10619 C C   . GLU I  3 192 ? 2.991   5.893   12.680  1.00 91.01  ? 207 GLU Z C   1 
ATOM   10620 O O   . GLU I  3 192 ? 2.626   5.689   13.842  1.00 91.13  ? 207 GLU Z O   1 
ATOM   10621 C CB  . GLU I  3 192 ? 0.700   5.874   11.636  1.00 90.24  ? 207 GLU Z CB  1 
ATOM   10622 C CG  . GLU I  3 192 ? 0.497   4.945   10.456  1.00 101.80 ? 207 GLU Z CG  1 
ATOM   10623 C CD  . GLU I  3 192 ? -0.970  4.601   10.283  1.00 118.89 ? 207 GLU Z CD  1 
ATOM   10624 O OE1 . GLU I  3 192 ? -1.502  3.830   11.116  1.00 106.36 ? 207 GLU Z OE1 1 
ATOM   10625 O OE2 . GLU I  3 192 ? -1.606  5.162   9.362   1.00 108.42 ? 207 GLU Z OE2 1 
ATOM   10626 N N   . GLU I  3 193 ? 4.214   5.555   12.224  1.00 89.00  ? 208 GLU Z N   1 
ATOM   10627 C CA  . GLU I  3 193 ? 5.182   4.853   13.074  1.00 92.23  ? 208 GLU Z CA  1 
ATOM   10628 C C   . GLU I  3 193 ? 6.560   5.508   13.124  1.00 94.45  ? 208 GLU Z C   1 
ATOM   10629 O O   . GLU I  3 193 ? 7.295   5.468   12.132  1.00 93.89  ? 208 GLU Z O   1 
ATOM   10630 C CB  . GLU I  3 193 ? 5.301   3.353   12.712  1.00 98.99  ? 208 GLU Z CB  1 
ATOM   10631 C CG  . GLU I  3 193 ? 4.716   2.967   11.360  1.00 114.17 ? 208 GLU Z CG  1 
ATOM   10632 C CD  . GLU I  3 193 ? 4.317   1.510   11.216  1.00 140.68 ? 208 GLU Z CD  1 
ATOM   10633 O OE1 . GLU I  3 193 ? 3.348   1.086   11.886  1.00 134.99 ? 208 GLU Z OE1 1 
ATOM   10634 O OE2 . GLU I  3 193 ? 4.948   0.803   10.398  1.00 137.38 ? 208 GLU Z OE2 1 
ATOM   10635 N N   . LEU I  3 194 ? 6.908   6.099   14.297  1.00 89.52  ? 209 LEU Z N   1 
ATOM   10636 C CA  . LEU I  3 194 ? 8.217   6.709   14.575  1.00 86.87  ? 209 LEU Z CA  1 
ATOM   10637 C C   . LEU I  3 194 ? 9.027   5.759   15.484  1.00 98.71  ? 209 LEU Z C   1 
ATOM   10638 O O   . LEU I  3 194 ? 8.982   5.941   16.708  1.00 100.12 ? 209 LEU Z O   1 
ATOM   10639 C CB  . LEU I  3 194 ? 8.082   8.079   15.264  1.00 82.03  ? 209 LEU Z CB  1 
ATOM   10640 C CG  . LEU I  3 194 ? 8.180   9.341   14.413  1.00 80.43  ? 209 LEU Z CG  1 
ATOM   10641 C CD1 . LEU I  3 194 ? 8.611   10.516  15.262  1.00 77.46  ? 209 LEU Z CD1 1 
ATOM   10642 C CD2 . LEU I  3 194 ? 9.121   9.179   13.221  1.00 80.47  ? 209 LEU Z CD2 1 
ATOM   10643 N N   . PRO I  3 195 ? 9.764   4.755   14.923  1.00 99.18  ? 210 PRO Z N   1 
ATOM   10644 C CA  . PRO I  3 195 ? 10.517  3.803   15.767  1.00 103.34 ? 210 PRO Z CA  1 
ATOM   10645 C C   . PRO I  3 195 ? 11.420  4.418   16.826  1.00 106.48 ? 210 PRO Z C   1 
ATOM   10646 O O   . PRO I  3 195 ? 11.894  5.533   16.633  1.00 101.91 ? 210 PRO Z O   1 
ATOM   10647 C CB  . PRO I  3 195 ? 11.324  3.004   14.746  1.00 107.31 ? 210 PRO Z CB  1 
ATOM   10648 C CG  . PRO I  3 195 ? 10.466  3.005   13.543  1.00 110.87 ? 210 PRO Z CG  1 
ATOM   10649 C CD  . PRO I  3 195 ? 9.904   4.398   13.498  1.00 101.23 ? 210 PRO Z CD  1 
ATOM   10650 N N   . ASN I  3 196 ? 11.648  3.692   17.945  1.00 107.67 ? 211 ASN Z N   1 
ATOM   10651 C CA  . ASN I  3 196 ? 12.467  4.165   19.064  1.00 107.97 ? 211 ASN Z CA  1 
ATOM   10652 C C   . ASN I  3 196 ? 13.910  4.544   18.664  1.00 110.51 ? 211 ASN Z C   1 
ATOM   10653 O O   . ASN I  3 196 ? 14.395  5.595   19.097  1.00 108.06 ? 211 ASN Z O   1 
ATOM   10654 C CB  . ASN I  3 196 ? 12.449  3.174   20.229  1.00 117.31 ? 211 ASN Z CB  1 
ATOM   10655 C CG  . ASN I  3 196 ? 12.936  3.761   21.540  1.00 145.90 ? 211 ASN Z CG  1 
ATOM   10656 O OD1 . ASN I  3 196 ? 12.484  4.831   21.981  1.00 137.58 ? 211 ASN Z OD1 1 
ATOM   10657 N ND2 . ASN I  3 196 ? 13.856  3.059   22.204  1.00 139.39 ? 211 ASN Z ND2 1 
ATOM   10658 N N   . ASP I  3 197 ? 14.564  3.746   17.795  1.00 108.11 ? 212 ASP Z N   1 
ATOM   10659 C CA  . ASP I  3 197 ? 15.923  4.077   17.372  1.00 107.02 ? 212 ASP Z CA  1 
ATOM   10660 C C   . ASP I  3 197 ? 15.991  5.008   16.116  1.00 106.37 ? 212 ASP Z C   1 
ATOM   10661 O O   . ASP I  3 197 ? 16.974  4.917   15.375  1.00 107.80 ? 212 ASP Z O   1 
ATOM   10662 C CB  . ASP I  3 197 ? 16.790  2.804   17.182  1.00 113.80 ? 212 ASP Z CB  1 
ATOM   10663 C CG  . ASP I  3 197 ? 16.957  1.903   18.401  1.00 130.64 ? 212 ASP Z CG  1 
ATOM   10664 O OD1 . ASP I  3 197 ? 16.994  2.430   19.534  1.00 131.18 ? 212 ASP Z OD1 1 
ATOM   10665 O OD2 . ASP I  3 197 ? 17.122  0.672   18.214  1.00 140.01 ? 212 ASP Z OD2 1 
ATOM   10666 N N   . VAL I  3 198 ? 15.010  5.927   15.894  1.00 96.46  ? 213 VAL Z N   1 
ATOM   10667 C CA  . VAL I  3 198 ? 15.114  6.826   14.728  1.00 91.86  ? 213 VAL Z CA  1 
ATOM   10668 C C   . VAL I  3 198 ? 16.219  7.854   14.944  1.00 94.67  ? 213 VAL Z C   1 
ATOM   10669 O O   . VAL I  3 198 ? 17.059  8.048   14.062  1.00 94.12  ? 213 VAL Z O   1 
ATOM   10670 C CB  . VAL I  3 198 ? 13.806  7.491   14.196  1.00 91.86  ? 213 VAL Z CB  1 
ATOM   10671 C CG1 . VAL I  3 198 ? 12.921  6.476   13.497  1.00 94.46  ? 213 VAL Z CG1 1 
ATOM   10672 C CG2 . VAL I  3 198 ? 13.035  8.258   15.272  1.00 89.36  ? 213 VAL Z CG2 1 
ATOM   10673 N N   . PHE I  3 199 ? 16.251  8.455   16.147  1.00 90.56  ? 214 PHE Z N   1 
ATOM   10674 C CA  . PHE I  3 199 ? 17.207  9.485   16.530  1.00 88.02  ? 214 PHE Z CA  1 
ATOM   10675 C C   . PHE I  3 199 ? 18.511  8.893   17.107  1.00 96.59  ? 214 PHE Z C   1 
ATOM   10676 O O   . PHE I  3 199 ? 19.208  9.547   17.887  1.00 96.21  ? 214 PHE Z O   1 
ATOM   10677 C CB  . PHE I  3 199 ? 16.537  10.529  17.453  1.00 87.34  ? 214 PHE Z CB  1 
ATOM   10678 C CG  . PHE I  3 199 ? 15.319  11.195  16.828  1.00 85.74  ? 214 PHE Z CG  1 
ATOM   10679 C CD1 . PHE I  3 199 ? 15.428  11.922  15.644  1.00 85.39  ? 214 PHE Z CD1 1 
ATOM   10680 C CD2 . PHE I  3 199 ? 14.061  11.077  17.414  1.00 88.21  ? 214 PHE Z CD2 1 
ATOM   10681 C CE1 . PHE I  3 199 ? 14.298  12.500  15.050  1.00 83.47  ? 214 PHE Z CE1 1 
ATOM   10682 C CE2 . PHE I  3 199 ? 12.933  11.659  16.817  1.00 88.04  ? 214 PHE Z CE2 1 
ATOM   10683 C CZ  . PHE I  3 199 ? 13.061  12.373  15.645  1.00 82.99  ? 214 PHE Z CZ  1 
ATOM   10684 N N   . HIS I  3 200 ? 18.867  7.672   16.665  1.00 97.62  ? 215 HIS Z N   1 
ATOM   10685 C CA  . HIS I  3 200 ? 20.124  7.016   17.032  1.00 101.67 ? 215 HIS Z CA  1 
ATOM   10686 C C   . HIS I  3 200 ? 21.178  7.649   16.148  1.00 101.67 ? 215 HIS Z C   1 
ATOM   10687 O O   . HIS I  3 200 ? 20.863  7.996   15.004  1.00 99.04  ? 215 HIS Z O   1 
ATOM   10688 C CB  . HIS I  3 200 ? 20.062  5.510   16.747  1.00 107.62 ? 215 HIS Z CB  1 
ATOM   10689 C CG  . HIS I  3 200 ? 21.254  4.749   17.239  1.00 116.17 ? 215 HIS Z CG  1 
ATOM   10690 N ND1 . HIS I  3 200 ? 22.475  4.815   16.586  1.00 119.02 ? 215 HIS Z ND1 1 
ATOM   10691 C CD2 . HIS I  3 200 ? 21.362  3.893   18.283  1.00 122.87 ? 215 HIS Z CD2 1 
ATOM   10692 C CE1 . HIS I  3 200 ? 23.286  4.008   17.256  1.00 123.31 ? 215 HIS Z CE1 1 
ATOM   10693 N NE2 . HIS I  3 200 ? 22.662  3.426   18.282  1.00 126.10 ? 215 HIS Z NE2 1 
ATOM   10694 N N   . GLY I  3 201 ? 22.388  7.827   16.687  1.00 97.70  ? 216 GLY Z N   1 
ATOM   10695 C CA  . GLY I  3 201 ? 23.512  8.453   15.989  1.00 95.84  ? 216 GLY Z CA  1 
ATOM   10696 C C   . GLY I  3 201 ? 23.256  9.863   15.464  1.00 92.82  ? 216 GLY Z C   1 
ATOM   10697 O O   . GLY I  3 201 ? 23.918  10.310  14.527  1.00 90.91  ? 216 GLY Z O   1 
ATOM   10698 N N   . ALA I  3 202 ? 22.283  10.566  16.044  1.00 86.03  ? 217 ALA Z N   1 
ATOM   10699 C CA  . ALA I  3 202 ? 21.914  11.915  15.639  1.00 81.81  ? 217 ALA Z CA  1 
ATOM   10700 C C   . ALA I  3 202 ? 22.202  12.856  16.781  1.00 86.51  ? 217 ALA Z C   1 
ATOM   10701 O O   . ALA I  3 202 ? 21.988  12.488  17.939  1.00 89.23  ? 217 ALA Z O   1 
ATOM   10702 C CB  . ALA I  3 202 ? 20.433  11.971  15.286  1.00 80.16  ? 217 ALA Z CB  1 
ATOM   10703 N N   . SER I  3 203 ? 22.682  14.067  16.468  1.00 80.33  ? 218 SER Z N   1 
ATOM   10704 C CA  . SER I  3 203 ? 22.984  15.070  17.481  1.00 80.21  ? 218 SER Z CA  1 
ATOM   10705 C C   . SER I  3 203 ? 21.832  16.082  17.603  1.00 81.45  ? 218 SER Z C   1 
ATOM   10706 O O   . SER I  3 203 ? 22.048  17.241  17.990  1.00 81.02  ? 218 SER Z O   1 
ATOM   10707 C CB  . SER I  3 203 ? 24.299  15.769  17.156  1.00 85.78  ? 218 SER Z CB  1 
ATOM   10708 O OG  . SER I  3 203 ? 24.698  16.617  18.222  1.00 99.97  ? 218 SER Z OG  1 
ATOM   10709 N N   . GLY I  3 204 ? 20.621  15.627  17.290  1.00 75.16  ? 219 GLY Z N   1 
ATOM   10710 C CA  . GLY I  3 204 ? 19.426  16.451  17.349  1.00 71.96  ? 219 GLY Z CA  1 
ATOM   10711 C C   . GLY I  3 204 ? 18.168  15.623  17.363  1.00 75.81  ? 219 GLY Z C   1 
ATOM   10712 O O   . GLY I  3 204 ? 18.241  14.441  17.697  1.00 80.03  ? 219 GLY Z O   1 
ATOM   10713 N N   . PRO I  3 205 ? 16.991  16.187  17.021  1.00 67.97  ? 220 PRO Z N   1 
ATOM   10714 C CA  . PRO I  3 205 ? 16.735  17.559  16.563  1.00 64.14  ? 220 PRO Z CA  1 
ATOM   10715 C C   . PRO I  3 205 ? 16.536  18.577  17.686  1.00 65.20  ? 220 PRO Z C   1 
ATOM   10716 O O   . PRO I  3 205 ? 16.490  18.205  18.859  1.00 67.00  ? 220 PRO Z O   1 
ATOM   10717 C CB  . PRO I  3 205 ? 15.504  17.388  15.667  1.00 64.24  ? 220 PRO Z CB  1 
ATOM   10718 C CG  . PRO I  3 205 ? 14.736  16.258  16.303  1.00 70.88  ? 220 PRO Z CG  1 
ATOM   10719 C CD  . PRO I  3 205 ? 15.747  15.389  17.029  1.00 69.71  ? 220 PRO Z CD  1 
ATOM   10720 N N   . VAL I  3 206 ? 16.479  19.870  17.306  1.00 57.17  ? 221 VAL Z N   1 
ATOM   10721 C CA  . VAL I  3 206 ? 16.288  21.033  18.183  1.00 55.67  ? 221 VAL Z CA  1 
ATOM   10722 C C   . VAL I  3 206 ? 14.920  21.619  17.846  1.00 56.81  ? 221 VAL Z C   1 
ATOM   10723 O O   . VAL I  3 206 ? 14.305  22.276  18.682  1.00 56.43  ? 221 VAL Z O   1 
ATOM   10724 C CB  . VAL I  3 206 ? 17.447  22.065  18.077  1.00 58.44  ? 221 VAL Z CB  1 
ATOM   10725 C CG1 . VAL I  3 206 ? 17.320  23.151  19.132  1.00 58.91  ? 221 VAL Z CG1 1 
ATOM   10726 C CG2 . VAL I  3 206 ? 18.805  21.381  18.197  1.00 59.67  ? 221 VAL Z CG2 1 
ATOM   10727 N N   . ILE I  3 207 ? 14.440  21.336  16.619  1.00 52.23  ? 222 ILE Z N   1 
ATOM   10728 C CA  . ILE I  3 207 ? 13.101  21.648  16.111  1.00 51.19  ? 222 ILE Z CA  1 
ATOM   10729 C C   . ILE I  3 207 ? 12.565  20.376  15.438  1.00 56.61  ? 222 ILE Z C   1 
ATOM   10730 O O   . ILE I  3 207 ? 13.238  19.791  14.582  1.00 57.08  ? 222 ILE Z O   1 
ATOM   10731 C CB  . ILE I  3 207 ? 13.052  22.878  15.153  1.00 52.56  ? 222 ILE Z CB  1 
ATOM   10732 C CG1 . ILE I  3 207 ? 13.272  24.197  15.906  1.00 53.11  ? 222 ILE Z CG1 1 
ATOM   10733 C CG2 . ILE I  3 207 ? 11.741  22.925  14.328  1.00 51.55  ? 222 ILE Z CG2 1 
ATOM   10734 C CD1 . ILE I  3 207 ? 13.926  25.190  15.123  1.00 52.56  ? 222 ILE Z CD1 1 
ATOM   10735 N N   . LEU I  3 208 ? 11.376  19.931  15.848  1.00 53.35  ? 223 LEU Z N   1 
ATOM   10736 C CA  . LEU I  3 208 ? 10.727  18.785  15.228  1.00 53.06  ? 223 LEU Z CA  1 
ATOM   10737 C C   . LEU I  3 208 ? 9.334   19.199  14.846  1.00 56.32  ? 223 LEU Z C   1 
ATOM   10738 O O   . LEU I  3 208 ? 8.616   19.781  15.670  1.00 56.59  ? 223 LEU Z O   1 
ATOM   10739 C CB  . LEU I  3 208 ? 10.719  17.536  16.139  1.00 55.25  ? 223 LEU Z CB  1 
ATOM   10740 C CG  . LEU I  3 208 ? 10.054  16.205  15.652  1.00 61.10  ? 223 LEU Z CG  1 
ATOM   10741 C CD1 . LEU I  3 208 ? 10.452  15.817  14.226  1.00 60.38  ? 223 LEU Z CD1 1 
ATOM   10742 C CD2 . LEU I  3 208 ? 10.440  15.046  16.559  1.00 65.39  ? 223 LEU Z CD2 1 
ATOM   10743 N N   . ASP I  3 209 ? 8.976   18.958  13.572  1.00 51.77  ? 224 ASP Z N   1 
ATOM   10744 C CA  . ASP I  3 209 ? 7.628   19.211  13.083  1.00 51.44  ? 224 ASP Z CA  1 
ATOM   10745 C C   . ASP I  3 209 ? 7.048   17.916  12.560  1.00 55.36  ? 224 ASP Z C   1 
ATOM   10746 O O   . ASP I  3 209 ? 7.543   17.384  11.559  1.00 55.71  ? 224 ASP Z O   1 
ATOM   10747 C CB  . ASP I  3 209 ? 7.570   20.303  12.012  1.00 52.04  ? 224 ASP Z CB  1 
ATOM   10748 C CG  . ASP I  3 209 ? 6.155   20.760  11.721  1.00 66.06  ? 224 ASP Z CG  1 
ATOM   1