data_4MSL
# 
_entry.id   4MSL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4MSL         
RCSB  RCSB082313   
WWPDB D_1000082313 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3F6K 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4MSL 
_pdbx_database_status.recvd_initial_deposition_date   2013-09-18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Andersen, J.L.'    1 
'Strandbygaard, D.' 2 
'Thirup, S.'        3 
# 
_citation.id                        primary 
_citation.title                     
;Identification of the first small-molecule ligand of the neuronal receptor sortilin and structure determination of the receptor-ligand complex.
;
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            70 
_citation.page_first                451 
_citation.page_last                 460 
_citation.year                      2014 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24531479 
_citation.pdbx_database_id_DOI      10.1107/S1399004713030149 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Andersen, J.L.'    1  
primary 'Schrder, T.J.'     2  
primary 'Christensen, S.'   3  
primary 'Strandbygard, D.'  4  
primary 'Pallesen, L.T.'    5  
primary 'Garcia-Alai, M.M.' 6  
primary 'Lindberg, S.'      7  
primary 'Langgard, M.'      8  
primary 'Eskildsen, J.C.'   9  
primary 'David, L.'         10 
primary 'Tagmose, L.'       11 
primary 'Simonsen, K.B.'    12 
primary 'Maltas, P.J.'      13 
primary 'Rnn, L.C.'         14 
primary 'de Jong, I.E.'     15 
primary 'Malik, I.J.'       16 
primary 'Egebjerg, J.'      17 
primary 'Karlsson, J.J.'    18 
primary 'Uppalanchi, S.'    19 
primary 'Sakumudi, D.R.'    20 
primary 'Eradi, P.'         21 
primary 'Watson, S.P.'      22 
primary 'Thirup, S.'        23 
# 
_cell.entry_id           4MSL 
_cell.length_a           160.876 
_cell.length_b           79.165 
_cell.length_c           111.700 
_cell.angle_alpha        90.00 
_cell.angle_beta         127.27 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4MSL 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Sortilin                                                         77790.883 1  ? ? 
'Vps10p domain (UNP residues 78-756)' ? 
2 non-polymer man N-ACETYL-D-GLUCOSAMINE                                           221.208   4  ? ? ? ? 
3 non-polymer man BETA-D-MANNOSE                                                   180.156   2  ? ? ? ? 
4 non-polymer man ALPHA-D-MANNOSE                                                  180.156   1  ? ? ? ? 
5 non-polymer syn 'TETRAETHYLENE GLYCOL'                                           194.226   1  ? ? ? ? 
6 non-polymer syn 'N-[(7-hydroxy-4-methyl-2-oxo-2H-chromen-8-yl)methyl]-L-leucine' 319.352   1  ? ? ? ? 
7 water       nat water                                                            18.015    67 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        '100 kDa NT receptor, Glycoprotein 95, Gp95, Neurotensin receptor 3, NT3, NTR3' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDI
TDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTEN
GLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASV
MADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTT
TGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMA
PLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCW
QTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILG
YKEQFLRLRKSSMCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRK
IPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSGSAMIEGRGVGHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDI
TDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTEN
GLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASV
MADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTT
TGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMA
PLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCW
QTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILG
YKEQFLRLRKSSMCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRK
IPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSGSAMIEGRGVGHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ALA n 
1 3   PRO n 
1 4   GLY n 
1 5   GLU n 
1 6   ASP n 
1 7   GLU n 
1 8   GLU n 
1 9   CYS n 
1 10  GLY n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  ASP n 
1 15  PHE n 
1 16  VAL n 
1 17  ALA n 
1 18  LYS n 
1 19  LEU n 
1 20  ALA n 
1 21  ASN n 
1 22  ASN n 
1 23  THR n 
1 24  HIS n 
1 25  GLN n 
1 26  HIS n 
1 27  VAL n 
1 28  PHE n 
1 29  ASP n 
1 30  ASP n 
1 31  LEU n 
1 32  ARG n 
1 33  GLY n 
1 34  SER n 
1 35  VAL n 
1 36  SER n 
1 37  LEU n 
1 38  SER n 
1 39  TRP n 
1 40  VAL n 
1 41  GLY n 
1 42  ASP n 
1 43  SER n 
1 44  THR n 
1 45  GLY n 
1 46  VAL n 
1 47  ILE n 
1 48  LEU n 
1 49  VAL n 
1 50  LEU n 
1 51  THR n 
1 52  THR n 
1 53  PHE n 
1 54  HIS n 
1 55  VAL n 
1 56  PRO n 
1 57  LEU n 
1 58  VAL n 
1 59  ILE n 
1 60  MET n 
1 61  THR n 
1 62  PHE n 
1 63  GLY n 
1 64  GLN n 
1 65  SER n 
1 66  LYS n 
1 67  LEU n 
1 68  TYR n 
1 69  ARG n 
1 70  SER n 
1 71  GLU n 
1 72  ASP n 
1 73  TYR n 
1 74  GLY n 
1 75  LYS n 
1 76  ASN n 
1 77  PHE n 
1 78  LYS n 
1 79  ASP n 
1 80  ILE n 
1 81  THR n 
1 82  ASP n 
1 83  LEU n 
1 84  ILE n 
1 85  ASN n 
1 86  ASN n 
1 87  THR n 
1 88  PHE n 
1 89  ILE n 
1 90  ARG n 
1 91  THR n 
1 92  GLU n 
1 93  PHE n 
1 94  GLY n 
1 95  MET n 
1 96  ALA n 
1 97  ILE n 
1 98  GLY n 
1 99  PRO n 
1 100 GLU n 
1 101 ASN n 
1 102 SER n 
1 103 GLY n 
1 104 LYS n 
1 105 VAL n 
1 106 VAL n 
1 107 LEU n 
1 108 THR n 
1 109 ALA n 
1 110 GLU n 
1 111 VAL n 
1 112 SER n 
1 113 GLY n 
1 114 GLY n 
1 115 SER n 
1 116 ARG n 
1 117 GLY n 
1 118 GLY n 
1 119 ARG n 
1 120 ILE n 
1 121 PHE n 
1 122 ARG n 
1 123 SER n 
1 124 SER n 
1 125 ASP n 
1 126 PHE n 
1 127 ALA n 
1 128 LYS n 
1 129 ASN n 
1 130 PHE n 
1 131 VAL n 
1 132 GLN n 
1 133 THR n 
1 134 ASP n 
1 135 LEU n 
1 136 PRO n 
1 137 PHE n 
1 138 HIS n 
1 139 PRO n 
1 140 LEU n 
1 141 THR n 
1 142 GLN n 
1 143 MET n 
1 144 MET n 
1 145 TYR n 
1 146 SER n 
1 147 PRO n 
1 148 GLN n 
1 149 ASN n 
1 150 SER n 
1 151 ASP n 
1 152 TYR n 
1 153 LEU n 
1 154 LEU n 
1 155 ALA n 
1 156 LEU n 
1 157 SER n 
1 158 THR n 
1 159 GLU n 
1 160 ASN n 
1 161 GLY n 
1 162 LEU n 
1 163 TRP n 
1 164 VAL n 
1 165 SER n 
1 166 LYS n 
1 167 ASN n 
1 168 PHE n 
1 169 GLY n 
1 170 GLY n 
1 171 LYS n 
1 172 TRP n 
1 173 GLU n 
1 174 GLU n 
1 175 ILE n 
1 176 HIS n 
1 177 LYS n 
1 178 ALA n 
1 179 VAL n 
1 180 CYS n 
1 181 LEU n 
1 182 ALA n 
1 183 LYS n 
1 184 TRP n 
1 185 GLY n 
1 186 SER n 
1 187 ASP n 
1 188 ASN n 
1 189 THR n 
1 190 ILE n 
1 191 PHE n 
1 192 PHE n 
1 193 THR n 
1 194 THR n 
1 195 TYR n 
1 196 ALA n 
1 197 ASN n 
1 198 GLY n 
1 199 SER n 
1 200 CYS n 
1 201 LYS n 
1 202 ALA n 
1 203 ASP n 
1 204 LEU n 
1 205 GLY n 
1 206 ALA n 
1 207 LEU n 
1 208 GLU n 
1 209 LEU n 
1 210 TRP n 
1 211 ARG n 
1 212 THR n 
1 213 SER n 
1 214 ASP n 
1 215 LEU n 
1 216 GLY n 
1 217 LYS n 
1 218 SER n 
1 219 PHE n 
1 220 LYS n 
1 221 THR n 
1 222 ILE n 
1 223 GLY n 
1 224 VAL n 
1 225 LYS n 
1 226 ILE n 
1 227 TYR n 
1 228 SER n 
1 229 PHE n 
1 230 GLY n 
1 231 LEU n 
1 232 GLY n 
1 233 GLY n 
1 234 ARG n 
1 235 PHE n 
1 236 LEU n 
1 237 PHE n 
1 238 ALA n 
1 239 SER n 
1 240 VAL n 
1 241 MET n 
1 242 ALA n 
1 243 ASP n 
1 244 LYS n 
1 245 ASP n 
1 246 THR n 
1 247 THR n 
1 248 ARG n 
1 249 ARG n 
1 250 ILE n 
1 251 HIS n 
1 252 VAL n 
1 253 SER n 
1 254 THR n 
1 255 ASP n 
1 256 GLN n 
1 257 GLY n 
1 258 ASP n 
1 259 THR n 
1 260 TRP n 
1 261 SER n 
1 262 MET n 
1 263 ALA n 
1 264 GLN n 
1 265 LEU n 
1 266 PRO n 
1 267 SER n 
1 268 VAL n 
1 269 GLY n 
1 270 GLN n 
1 271 GLU n 
1 272 GLN n 
1 273 PHE n 
1 274 TYR n 
1 275 SER n 
1 276 ILE n 
1 277 LEU n 
1 278 ALA n 
1 279 ALA n 
1 280 ASN n 
1 281 ASP n 
1 282 ASP n 
1 283 MET n 
1 284 VAL n 
1 285 PHE n 
1 286 MET n 
1 287 HIS n 
1 288 VAL n 
1 289 ASP n 
1 290 GLU n 
1 291 PRO n 
1 292 GLY n 
1 293 ASP n 
1 294 THR n 
1 295 GLY n 
1 296 PHE n 
1 297 GLY n 
1 298 THR n 
1 299 ILE n 
1 300 PHE n 
1 301 THR n 
1 302 SER n 
1 303 ASP n 
1 304 ASP n 
1 305 ARG n 
1 306 GLY n 
1 307 ILE n 
1 308 VAL n 
1 309 TYR n 
1 310 SER n 
1 311 LYS n 
1 312 SER n 
1 313 LEU n 
1 314 ASP n 
1 315 ARG n 
1 316 HIS n 
1 317 LEU n 
1 318 TYR n 
1 319 THR n 
1 320 THR n 
1 321 THR n 
1 322 GLY n 
1 323 GLY n 
1 324 GLU n 
1 325 THR n 
1 326 ASP n 
1 327 PHE n 
1 328 THR n 
1 329 ASN n 
1 330 VAL n 
1 331 THR n 
1 332 SER n 
1 333 LEU n 
1 334 ARG n 
1 335 GLY n 
1 336 VAL n 
1 337 TYR n 
1 338 ILE n 
1 339 THR n 
1 340 SER n 
1 341 VAL n 
1 342 LEU n 
1 343 SER n 
1 344 GLU n 
1 345 ASP n 
1 346 ASN n 
1 347 SER n 
1 348 ILE n 
1 349 GLN n 
1 350 THR n 
1 351 MET n 
1 352 ILE n 
1 353 THR n 
1 354 PHE n 
1 355 ASP n 
1 356 GLN n 
1 357 GLY n 
1 358 GLY n 
1 359 ARG n 
1 360 TRP n 
1 361 THR n 
1 362 HIS n 
1 363 LEU n 
1 364 ARG n 
1 365 LYS n 
1 366 PRO n 
1 367 GLU n 
1 368 ASN n 
1 369 SER n 
1 370 GLU n 
1 371 CYS n 
1 372 ASP n 
1 373 ALA n 
1 374 THR n 
1 375 ALA n 
1 376 LYS n 
1 377 ASN n 
1 378 LYS n 
1 379 ASN n 
1 380 GLU n 
1 381 CYS n 
1 382 SER n 
1 383 LEU n 
1 384 HIS n 
1 385 ILE n 
1 386 HIS n 
1 387 ALA n 
1 388 SER n 
1 389 TYR n 
1 390 SER n 
1 391 ILE n 
1 392 SER n 
1 393 GLN n 
1 394 LYS n 
1 395 LEU n 
1 396 ASN n 
1 397 VAL n 
1 398 PRO n 
1 399 MET n 
1 400 ALA n 
1 401 PRO n 
1 402 LEU n 
1 403 SER n 
1 404 GLU n 
1 405 PRO n 
1 406 ASN n 
1 407 ALA n 
1 408 VAL n 
1 409 GLY n 
1 410 ILE n 
1 411 VAL n 
1 412 ILE n 
1 413 ALA n 
1 414 HIS n 
1 415 GLY n 
1 416 SER n 
1 417 VAL n 
1 418 GLY n 
1 419 ASP n 
1 420 ALA n 
1 421 ILE n 
1 422 SER n 
1 423 VAL n 
1 424 MET n 
1 425 VAL n 
1 426 PRO n 
1 427 ASP n 
1 428 VAL n 
1 429 TYR n 
1 430 ILE n 
1 431 SER n 
1 432 ASP n 
1 433 ASP n 
1 434 GLY n 
1 435 GLY n 
1 436 TYR n 
1 437 SER n 
1 438 TRP n 
1 439 THR n 
1 440 LYS n 
1 441 MET n 
1 442 LEU n 
1 443 GLU n 
1 444 GLY n 
1 445 PRO n 
1 446 HIS n 
1 447 TYR n 
1 448 TYR n 
1 449 THR n 
1 450 ILE n 
1 451 LEU n 
1 452 ASP n 
1 453 SER n 
1 454 GLY n 
1 455 GLY n 
1 456 ILE n 
1 457 ILE n 
1 458 VAL n 
1 459 ALA n 
1 460 ILE n 
1 461 GLU n 
1 462 HIS n 
1 463 SER n 
1 464 SER n 
1 465 ARG n 
1 466 PRO n 
1 467 ILE n 
1 468 ASN n 
1 469 VAL n 
1 470 ILE n 
1 471 LYS n 
1 472 PHE n 
1 473 SER n 
1 474 THR n 
1 475 ASP n 
1 476 GLU n 
1 477 GLY n 
1 478 GLN n 
1 479 CYS n 
1 480 TRP n 
1 481 GLN n 
1 482 THR n 
1 483 TYR n 
1 484 THR n 
1 485 PHE n 
1 486 THR n 
1 487 ARG n 
1 488 ASP n 
1 489 PRO n 
1 490 ILE n 
1 491 TYR n 
1 492 PHE n 
1 493 THR n 
1 494 GLY n 
1 495 LEU n 
1 496 ALA n 
1 497 SER n 
1 498 GLU n 
1 499 PRO n 
1 500 GLY n 
1 501 ALA n 
1 502 ARG n 
1 503 SER n 
1 504 MET n 
1 505 ASN n 
1 506 ILE n 
1 507 SER n 
1 508 ILE n 
1 509 TRP n 
1 510 GLY n 
1 511 PHE n 
1 512 THR n 
1 513 GLU n 
1 514 SER n 
1 515 PHE n 
1 516 LEU n 
1 517 THR n 
1 518 SER n 
1 519 GLN n 
1 520 TRP n 
1 521 VAL n 
1 522 SER n 
1 523 TYR n 
1 524 THR n 
1 525 ILE n 
1 526 ASP n 
1 527 PHE n 
1 528 LYS n 
1 529 ASP n 
1 530 ILE n 
1 531 LEU n 
1 532 GLU n 
1 533 ARG n 
1 534 ASN n 
1 535 CYS n 
1 536 GLU n 
1 537 GLU n 
1 538 LYS n 
1 539 ASP n 
1 540 TYR n 
1 541 THR n 
1 542 ILE n 
1 543 TRP n 
1 544 LEU n 
1 545 ALA n 
1 546 HIS n 
1 547 SER n 
1 548 THR n 
1 549 ASP n 
1 550 PRO n 
1 551 GLU n 
1 552 ASP n 
1 553 TYR n 
1 554 GLU n 
1 555 ASP n 
1 556 GLY n 
1 557 CYS n 
1 558 ILE n 
1 559 LEU n 
1 560 GLY n 
1 561 TYR n 
1 562 LYS n 
1 563 GLU n 
1 564 GLN n 
1 565 PHE n 
1 566 LEU n 
1 567 ARG n 
1 568 LEU n 
1 569 ARG n 
1 570 LYS n 
1 571 SER n 
1 572 SER n 
1 573 MET n 
1 574 CYS n 
1 575 GLN n 
1 576 ASN n 
1 577 GLY n 
1 578 ARG n 
1 579 ASP n 
1 580 TYR n 
1 581 VAL n 
1 582 VAL n 
1 583 THR n 
1 584 LYS n 
1 585 GLN n 
1 586 PRO n 
1 587 SER n 
1 588 ILE n 
1 589 CYS n 
1 590 LEU n 
1 591 CYS n 
1 592 SER n 
1 593 LEU n 
1 594 GLU n 
1 595 ASP n 
1 596 PHE n 
1 597 LEU n 
1 598 CYS n 
1 599 ASP n 
1 600 PHE n 
1 601 GLY n 
1 602 TYR n 
1 603 TYR n 
1 604 ARG n 
1 605 PRO n 
1 606 GLU n 
1 607 ASN n 
1 608 ASP n 
1 609 SER n 
1 610 LYS n 
1 611 CYS n 
1 612 VAL n 
1 613 GLU n 
1 614 GLN n 
1 615 PRO n 
1 616 GLU n 
1 617 LEU n 
1 618 LYS n 
1 619 GLY n 
1 620 HIS n 
1 621 ASP n 
1 622 LEU n 
1 623 GLU n 
1 624 PHE n 
1 625 CYS n 
1 626 LEU n 
1 627 TYR n 
1 628 GLY n 
1 629 ARG n 
1 630 GLU n 
1 631 GLU n 
1 632 HIS n 
1 633 LEU n 
1 634 THR n 
1 635 THR n 
1 636 ASN n 
1 637 GLY n 
1 638 TYR n 
1 639 ARG n 
1 640 LYS n 
1 641 ILE n 
1 642 PRO n 
1 643 GLY n 
1 644 ASP n 
1 645 LYS n 
1 646 CYS n 
1 647 GLN n 
1 648 GLY n 
1 649 GLY n 
1 650 VAL n 
1 651 ASN n 
1 652 PRO n 
1 653 VAL n 
1 654 ARG n 
1 655 GLU n 
1 656 VAL n 
1 657 LYS n 
1 658 ASP n 
1 659 LEU n 
1 660 LYS n 
1 661 LYS n 
1 662 LYS n 
1 663 CYS n 
1 664 THR n 
1 665 SER n 
1 666 ASN n 
1 667 PHE n 
1 668 LEU n 
1 669 SER n 
1 670 PRO n 
1 671 GLU n 
1 672 LYS n 
1 673 GLN n 
1 674 ASN n 
1 675 SER n 
1 676 LYS n 
1 677 SER n 
1 678 ASN n 
1 679 SER n 
1 680 GLY n 
1 681 SER n 
1 682 ALA n 
1 683 MET n 
1 684 ILE n 
1 685 GLU n 
1 686 GLY n 
1 687 ARG n 
1 688 GLY n 
1 689 VAL n 
1 690 GLY n 
1 691 HIS n 
1 692 HIS n 
1 693 HIS n 
1 694 HIS n 
1 695 HIS n 
1 696 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 SORT1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo Sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 'Human Embryonic Kidney 293F cells' 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pCEP-pu 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SORT_HUMAN 
_struct_ref.pdbx_db_accession          Q99523 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDI
TDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTEN
GLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASV
MADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTT
TGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMA
PLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCW
QTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILG
YKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRK
IPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNS
;
_struct_ref.pdbx_align_begin           78 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4MSL 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 679 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q99523 
_struct_ref_seq.db_align_beg                  78 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  756 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       45 
_struct_ref_seq.pdbx_auth_seq_align_end       723 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4MSL MET A 573 ? UNP Q99523 VAL 650 VARIANT          617 1  
1 4MSL GLY A 680 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 724 2  
1 4MSL SER A 681 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 725 3  
1 4MSL ALA A 682 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 726 4  
1 4MSL MET A 683 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 727 5  
1 4MSL ILE A 684 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 728 6  
1 4MSL GLU A 685 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 729 7  
1 4MSL GLY A 686 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 730 8  
1 4MSL ARG A 687 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 731 9  
1 4MSL GLY A 688 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 732 10 
1 4MSL VAL A 689 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 733 11 
1 4MSL GLY A 690 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 734 12 
1 4MSL HIS A 691 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 735 13 
1 4MSL HIS A 692 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 736 14 
1 4MSL HIS A 693 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 737 15 
1 4MSL HIS A 694 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 738 16 
1 4MSL HIS A 695 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 739 17 
1 4MSL HIS A 696 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 740 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2ET non-polymer         . 'N-[(7-hydroxy-4-methyl-2-oxo-2H-chromen-8-yl)methyl]-L-leucine' ? 'C17 H21 N O5'   319.352 
ALA 'L-peptide linking' y ALANINE                                                          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                  ? 'C4 H7 N O4'     133.103 
BMA D-saccharide        . BETA-D-MANNOSE                                                   ? 'C6 H12 O6'      180.156 
CYS 'L-peptide linking' y CYSTEINE                                                         ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                           ? 'C6 H15 N2 O2 1' 147.195 
MAN D-saccharide        . ALPHA-D-MANNOSE                                                  ? 'C6 H12 O6'      180.156 
MET 'L-peptide linking' y METHIONINE                                                       ? 'C5 H11 N O2 S'  149.211 
NAG D-saccharide        . N-ACETYL-D-GLUCOSAMINE                                           ? 'C8 H15 N O6'    221.208 
PG4 non-polymer         . 'TETRAETHYLENE GLYCOL'                                           ? 'C8 H18 O5'      194.226 
PHE 'L-peptide linking' y PHENYLALANINE                                                    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                           ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4MSL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.64 
_exptl_crystal.density_percent_sol   66.19 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.3 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;0.1 M HEPES-Tris, 0.4 M sodium malonate, 26 % (w/v) PEG 3350, 8 % (v/v) glycerol, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 292K
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 2M-F' 
_diffrn_detector.pdbx_collection_date   2012-05-14 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Bartels Monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06DA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06DA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9000 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4MSL 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   1.4 
_reflns.d_resolution_low             47.0 
_reflns.d_resolution_high            2.7 
_reflns.number_obs                   30847 
_reflns.number_all                   30847 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.039 
_reflns.pdbx_Rsym_value              0.039 
_reflns.pdbx_netI_over_sigmaI        19.0 
_reflns.B_iso_Wilson_estimate        84.4 
_reflns.pdbx_redundancy              3.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_chi_squared 
1 1  2.7 2.9  99.7  0.474 ? 1.6  ? ? ? ? ? ? ? 
1 2  2.9 3.0  99.9  0.226 ? 2.9  ? ? ? ? ? ? ? 
1 3  3.0 3.2  99.8  0.139 ? 5.5  ? ? ? ? ? ? ? 
1 4  3.2 3.5  100.0 0.077 ? 9.7  ? ? ? ? ? ? ? 
1 5  3.5 3.8  99.9  0.051 ? 10.9 ? ? ? ? ? ? ? 
1 6  3.8 4.3  99.9  0.034 ? 19.1 ? ? ? ? ? ? ? 
1 7  4.3 4.9  100.0 0.025 ? 25.9 ? ? ? ? ? ? ? 
1 8  4.9 6.0  100.0 0.026 ? 24.5 ? ? ? ? ? ? ? 
1 9  6.0 8.5  100.0 0.024 ? 25.1 ? ? ? ? ? ? ? 
1 10 8.5 47.0 99.3  0.018 ? 26.3 ? ? ? ? ? ? ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4MSL 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     30842 
_refine.ls_number_reflns_all                     30842 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.37 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             46.954 
_refine.ls_d_res_high                            2.700 
_refine.ls_percent_reflns_obs                    99.87 
_refine.ls_R_factor_obs                          0.2058 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2047 
_refine.ls_R_factor_R_free                       0.2273 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_number_reflns_R_free                  1543 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.34 
_refine.pdbx_overall_phase_error                 26.23 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5143 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         125 
_refine_hist.number_atoms_solvent             67 
_refine_hist.number_atoms_total               5335 
_refine_hist.d_res_high                       2.700 
_refine_hist.d_res_low                        46.954 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.010  ? ? 5395 'X-RAY DIFFRACTION' ? 
f_angle_d          1.260  ? ? 7291 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 14.664 ? ? 1967 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.089  ? ? 802  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 929  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.7000 2.7872  2636 0.3099 100.00 0.3434 . . 139 . . . . 
'X-RAY DIFFRACTION' . 2.7872 2.8868  2653 0.2887 100.00 0.3116 . . 140 . . . . 
'X-RAY DIFFRACTION' . 2.8868 3.0023  2626 0.2730 100.00 0.3056 . . 138 . . . . 
'X-RAY DIFFRACTION' . 3.0023 3.1389  2649 0.2671 100.00 0.2901 . . 139 . . . . 
'X-RAY DIFFRACTION' . 3.1389 3.3044  2641 0.2601 100.00 0.2472 . . 138 . . . . 
'X-RAY DIFFRACTION' . 3.3044 3.5114  2679 0.2283 100.00 0.2408 . . 142 . . . . 
'X-RAY DIFFRACTION' . 3.5114 3.7824  2646 0.2147 100.00 0.2661 . . 139 . . . . 
'X-RAY DIFFRACTION' . 3.7824 4.1628  2666 0.1984 100.00 0.2341 . . 140 . . . . 
'X-RAY DIFFRACTION' . 4.1628 4.7646  2668 0.1589 100.00 0.1728 . . 141 . . . . 
'X-RAY DIFFRACTION' . 4.7646 6.0010  2701 0.1733 100.00 0.1844 . . 143 . . . . 
'X-RAY DIFFRACTION' . 6.0010 46.9609 2734 0.1923 100.00 0.2217 . . 144 . . . . 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    4MSL 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  4MSL 
_struct.title                     'Crystal structure of the Vps10p domain of human sortilin/NTS3 in complex with AF40431' 
_struct.pdbx_descriptor           Sortilin 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4MSL 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
;proNGF, Alzheimer's disease, Beta-propeller, Asp-box repeat, Vps10p domain, 10CC domain, Receptor Sorting, Peptide binding, Protein binding, Membrane, SIGNALING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 2 ? 
G N N 2 ? 
H N N 3 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 14  ? ASN A 21  ? ASP A 58  ASN A 65  1 ? 8  
HELX_P HELX_P2  2  THR A 81  ? ASN A 85  ? THR A 125 ASN A 129 5 ? 5  
HELX_P HELX_P3  3  ARG A 90  ? PHE A 93  ? ARG A 134 PHE A 137 5 ? 4  
HELX_P HELX_P4  4  ALA A 387 ? GLN A 393 ? ALA A 431 GLN A 437 1 ? 7  
HELX_P HELX_P5  5  ASP A 452 ? GLY A 455 ? ASP A 496 GLY A 499 5 ? 4  
HELX_P HELX_P6  6  GLU A 536 ? LYS A 538 ? GLU A 580 LYS A 582 5 ? 3  
HELX_P HELX_P7  7  SER A 592 ? GLU A 594 ? SER A 636 GLU A 638 5 ? 3  
HELX_P HELX_P8  8  LYS A 618 ? GLY A 628 ? LYS A 662 GLY A 672 1 ? 11 
HELX_P HELX_P9  9  ARG A 629 ? LEU A 633 ? ARG A 673 LEU A 677 1 ? 5  
HELX_P HELX_P10 10 LEU A 659 ? SER A 665 ? LEU A 703 SER A 709 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 9   SG  ? ? ? 1_555 A CYS 479 SG ? ? A CYS 53  A CYS 523 1_555 ? ? ? ? ? ? ? 2.047 ? 
disulf2 disulf ? ? A CYS 180 SG  ? ? ? 1_555 A CYS 200 SG ? ? A CYS 224 A CYS 244 1_555 ? ? ? ? ? ? ? 2.360 ? 
disulf3 disulf ? ? A CYS 371 SG  ? ? ? 1_555 A CYS 381 SG ? ? A CYS 415 A CYS 425 1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf4 disulf ? ? A CYS 535 SG  ? ? ? 1_555 A CYS 574 SG ? ? A CYS 579 A CYS 618 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf5 disulf ? ? A CYS 557 SG  ? ? ? 1_555 A CYS 589 SG ? ? A CYS 601 A CYS 633 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf6 disulf ? ? A CYS 591 SG  ? ? ? 1_555 A CYS 646 SG ? ? A CYS 635 A CYS 690 1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf7 disulf ? ? A CYS 598 SG  ? ? ? 1_555 A CYS 611 SG ? ? A CYS 642 A CYS 655 1_555 ? ? ? ? ? ? ? 2.052 ? 
disulf8 disulf ? ? A CYS 625 SG  ? ? ? 1_555 A CYS 663 SG ? ? A CYS 669 A CYS 707 1_555 ? ? ? ? ? ? ? 2.042 ? 
covale1 covale ? ? B NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? A NAG 801 A NAG 802 1_555 ? ? ? ? ? ? ? 1.439 ? 
covale2 covale ? ? C NAG .   O4  ? ? ? 1_555 D BMA .   C1 ? ? A NAG 802 A BMA 803 1_555 ? ? ? ? ? ? ? 1.445 ? 
covale3 covale ? ? D BMA .   O6  ? ? ? 1_555 E MAN .   C1 ? ? A BMA 803 A MAN 804 1_555 ? ? ? ? ? ? ? 1.447 ? 
covale4 covale ? ? G NAG .   O4  ? ? ? 1_555 H BMA .   C1 ? ? A NAG 806 A BMA 807 1_555 ? ? ? ? ? ? ? 1.453 ? 
covale5 covale ? ? A ASN 329 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 373 A NAG 801 1_555 ? ? ? ? ? ? ? 1.453 ? 
covale6 covale ? ? F NAG .   O4  ? ? ? 1_555 G NAG .   C1 ? ? A NAG 805 A NAG 806 1_555 ? ? ? ? ? ? ? 1.458 ? 
covale7 covale ? ? A ASN 505 ND2 ? ? ? 1_555 F NAG .   C1 ? ? A ASN 549 A NAG 805 1_555 ? ? ? ? ? ? ? 1.463 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 7 ? 
F ? 4 ? 
G ? 4 ? 
H ? 4 ? 
I ? 4 ? 
J ? 3 ? 
K ? 2 ? 
L ? 2 ? 
M ? 2 ? 
N ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? anti-parallel 
E 6 7 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? parallel      
L 1 2 ? anti-parallel 
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 23  ? VAL A 27  ? THR A 67  VAL A 71  
A 2 TRP A 520 ? ASP A 526 ? TRP A 564 ASP A 570 
A 3 ASN A 505 ? PHE A 511 ? ASN A 549 PHE A 555 
A 4 TYR A 491 ? SER A 497 ? TYR A 535 SER A 541 
B 1 VAL A 35  ? VAL A 40  ? VAL A 79  VAL A 84  
B 2 VAL A 46  ? THR A 52  ? VAL A 90  THR A 96  
B 3 SER A 65  ? SER A 70  ? SER A 109 SER A 114 
B 4 LYS A 78  ? ASP A 79  ? LYS A 122 ASP A 123 
C 1 MET A 95  ? ILE A 97  ? MET A 139 ILE A 141 
C 2 VAL A 105 ? ALA A 109 ? VAL A 149 ALA A 153 
C 3 ARG A 119 ? SER A 123 ? ARG A 163 SER A 167 
C 4 VAL A 131 ? ASP A 134 ? VAL A 175 ASP A 178 
D 1 MET A 144 ? TYR A 145 ? MET A 188 TYR A 189 
D 2 LEU A 153 ? LEU A 156 ? LEU A 197 LEU A 200 
D 3 LEU A 162 ? SER A 165 ? LEU A 206 SER A 209 
D 4 GLU A 173 ? HIS A 176 ? GLU A 217 HIS A 220 
E 1 LEU A 181 ? TRP A 184 ? LEU A 225 TRP A 228 
E 2 ILE A 190 ? THR A 194 ? ILE A 234 THR A 238 
E 3 LEU A 207 ? THR A 212 ? LEU A 251 THR A 256 
E 4 LYS A 220 ? GLY A 232 ? LYS A 264 GLY A 276 
E 5 PHE A 235 ? MET A 241 ? PHE A 279 MET A 285 
E 6 ARG A 248 ? SER A 253 ? ARG A 292 SER A 297 
E 7 SER A 261 ? MET A 262 ? SER A 305 MET A 306 
F 1 TYR A 274 ? ASN A 280 ? TYR A 318 ASN A 324 
F 2 MET A 283 ? ASP A 289 ? MET A 327 ASP A 333 
F 3 PHE A 296 ? SER A 302 ? PHE A 340 SER A 346 
F 4 TYR A 309 ? LEU A 317 ? TYR A 353 LEU A 361 
G 1 THR A 328 ? ASN A 329 ? THR A 372 ASN A 373 
G 2 TYR A 337 ? LEU A 342 ? TYR A 381 LEU A 386 
G 3 ILE A 348 ? THR A 353 ? ILE A 392 THR A 397 
G 4 THR A 361 ? HIS A 362 ? THR A 405 HIS A 406 
H 1 SER A 382 ? ILE A 385 ? SER A 426 ILE A 429 
H 2 VAL A 411 ? GLY A 418 ? VAL A 455 GLY A 462 
H 3 ASP A 427 ? SER A 431 ? ASP A 471 SER A 475 
H 4 THR A 439 ? LEU A 442 ? THR A 483 LEU A 486 
I 1 HIS A 446 ? LEU A 451 ? HIS A 490 LEU A 495 
I 2 ILE A 456 ? GLU A 461 ? ILE A 500 GLU A 505 
I 3 VAL A 469 ? SER A 473 ? VAL A 513 SER A 517 
I 4 GLN A 481 ? THR A 484 ? GLN A 525 THR A 528 
J 1 TYR A 540 ? LEU A 544 ? TYR A 584 LEU A 588 
J 2 TYR A 561 ? LEU A 568 ? TYR A 605 LEU A 612 
J 3 LYS A 584 ? ILE A 588 ? LYS A 628 ILE A 632 
K 1 LEU A 590 ? CYS A 591 ? LEU A 634 CYS A 635 
K 2 GLN A 647 ? GLY A 649 ? GLN A 691 GLY A 693 
L 1 PHE A 596 ? CYS A 598 ? PHE A 640 CYS A 642 
L 2 TYR A 638 ? LYS A 640 ? TYR A 682 LYS A 684 
M 1 TYR A 602 ? TYR A 603 ? TYR A 646 TYR A 647 
M 2 VAL A 612 ? GLU A 613 ? VAL A 656 GLU A 657 
N 1 THR A 634 ? THR A 635 ? THR A 678 THR A 679 
N 2 LYS A 657 ? ASP A 658 ? LYS A 701 ASP A 702 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N HIS A 24  ? N HIS A 68  O THR A 524 ? O THR A 568 
A 2 3 O VAL A 521 ? O VAL A 565 N GLY A 510 ? N GLY A 554 
A 3 4 O TRP A 509 ? O TRP A 553 N GLY A 494 ? N GLY A 538 
B 1 2 N SER A 36  ? N SER A 80  O LEU A 50  ? O LEU A 94  
B 2 3 N THR A 51  ? N THR A 95  O LYS A 66  ? O LYS A 110 
B 3 4 N ARG A 69  ? N ARG A 113 O LYS A 78  ? O LYS A 122 
C 1 2 N ALA A 96  ? N ALA A 140 O VAL A 106 ? O VAL A 150 
C 2 3 N VAL A 105 ? N VAL A 149 O SER A 123 ? O SER A 167 
C 3 4 N ARG A 122 ? N ARG A 166 O VAL A 131 ? O VAL A 175 
D 1 2 N MET A 144 ? N MET A 188 O LEU A 154 ? O LEU A 198 
D 2 3 N ALA A 155 ? N ALA A 199 O TRP A 163 ? O TRP A 207 
D 3 4 N VAL A 164 ? N VAL A 208 O GLU A 173 ? O GLU A 217 
E 1 2 N LYS A 183 ? N LYS A 227 O PHE A 191 ? O PHE A 235 
E 2 3 N PHE A 192 ? N PHE A 236 O TRP A 210 ? O TRP A 254 
E 3 4 N LEU A 207 ? N LEU A 251 O ILE A 226 ? O ILE A 270 
E 4 5 N SER A 228 ? N SER A 272 O SER A 239 ? O SER A 283 
E 5 6 N VAL A 240 ? N VAL A 284 O ARG A 249 ? O ARG A 293 
E 6 7 N VAL A 252 ? N VAL A 296 O SER A 261 ? O SER A 305 
F 1 2 N SER A 275 ? N SER A 319 O HIS A 287 ? O HIS A 331 
F 2 3 N MET A 286 ? N MET A 330 O PHE A 300 ? O PHE A 344 
F 3 4 N GLY A 297 ? N GLY A 341 O HIS A 316 ? O HIS A 360 
G 1 2 N THR A 328 ? N THR A 372 O ILE A 338 ? O ILE A 382 
G 2 3 N THR A 339 ? N THR A 383 O MET A 351 ? O MET A 395 
G 3 4 N ILE A 352 ? N ILE A 396 O THR A 361 ? O THR A 405 
H 1 2 N HIS A 384 ? N HIS A 428 O SER A 416 ? O SER A 460 
H 2 3 N ALA A 413 ? N ALA A 457 O TYR A 429 ? O TYR A 473 
H 3 4 N ILE A 430 ? N ILE A 474 O THR A 439 ? O THR A 483 
I 1 2 N LEU A 451 ? N LEU A 495 O ILE A 456 ? O ILE A 500 
I 2 3 N ALA A 459 ? N ALA A 503 O LYS A 471 ? O LYS A 515 
I 3 4 N ILE A 470 ? N ILE A 514 O TYR A 483 ? O TYR A 527 
J 1 2 N TRP A 543 ? N TRP A 587 O PHE A 565 ? O PHE A 609 
J 2 3 N GLN A 564 ? N GLN A 608 O GLN A 585 ? O GLN A 629 
K 1 2 N CYS A 591 ? N CYS A 635 O GLY A 648 ? O GLY A 692 
L 1 2 N LEU A 597 ? N LEU A 641 O ARG A 639 ? O ARG A 683 
M 1 2 N TYR A 603 ? N TYR A 647 O VAL A 612 ? O VAL A 656 
N 1 2 N THR A 635 ? N THR A 679 O LYS A 657 ? O LYS A 701 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE PG4 A 808'                                       
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE 2ET A 809'                                       
AC3 Software ? ? ? ? 8 'BINDING SITE FOR CHAIN A OF SUGAR BOUND TO ASN A 373 RESIDUES 801 TO 804' 
AC4 Software ? ? ? ? 7 'BINDING SITE FOR CHAIN A OF SUGAR BOUND TO ASN A 549 RESIDUES 805 TO 807' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 VAL A 35  ? VAL A 79  . ? 1_555 ? 
2  AC1 5 THR A 493 ? THR A 537 . ? 1_555 ? 
3  AC1 5 LEU A 495 ? LEU A 539 . ? 1_555 ? 
4  AC1 5 TRP A 509 ? TRP A 553 . ? 1_555 ? 
5  AC1 5 TRP A 520 ? TRP A 564 . ? 1_555 ? 
6  AC2 7 TYR A 227 ? TYR A 271 . ? 1_555 ? 
7  AC2 7 PHE A 229 ? PHE A 273 . ? 1_555 ? 
8  AC2 7 SER A 239 ? SER A 283 . ? 1_555 ? 
9  AC2 7 ARG A 248 ? ARG A 292 . ? 1_555 ? 
10 AC2 7 PHE A 273 ? PHE A 317 . ? 1_555 ? 
11 AC2 7 TYR A 274 ? TYR A 318 . ? 1_555 ? 
12 AC2 7 SER A 275 ? SER A 319 . ? 1_555 ? 
13 AC3 8 ALA A 278 ? ALA A 322 . ? 1_555 ? 
14 AC3 8 ALA A 279 ? ALA A 323 . ? 1_555 ? 
15 AC3 8 ASN A 280 ? ASN A 324 . ? 1_555 ? 
16 AC3 8 ASN A 329 ? ASN A 373 . ? 1_555 ? 
17 AC3 8 THR A 331 ? THR A 375 . ? 1_555 ? 
18 AC3 8 TYR A 337 ? TYR A 381 . ? 1_555 ? 
19 AC3 8 HOH K .   ? HOH A 908 . ? 1_555 ? 
20 AC3 8 HOH K .   ? HOH A 910 . ? 1_555 ? 
21 AC4 7 ASP A 72  ? ASP A 116 . ? 1_555 ? 
22 AC4 7 LYS A 75  ? LYS A 119 . ? 1_555 ? 
23 AC4 7 SER A 503 ? SER A 547 . ? 1_555 ? 
24 AC4 7 MET A 504 ? MET A 548 . ? 1_555 ? 
25 AC4 7 ASN A 505 ? ASN A 549 . ? 1_555 ? 
26 AC4 7 ASP A 526 ? ASP A 570 . ? 1_555 ? 
27 AC4 7 ARG A 578 ? ARG A 622 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4MSL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4MSL 
_atom_sites.fract_transf_matrix[1][1]   0.006216 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004730 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012632 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011250 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . CYS A 1 9   ? -10.436 -6.887 23.952  1.00 191.36 ?  53  CYS A N   1 
ATOM   2    C CA  . CYS A 1 9   ? -9.681  -5.949 23.130  1.00 188.72 ?  53  CYS A CA  1 
ATOM   3    C C   . CYS A 1 9   ? -8.397  -5.515 23.829  1.00 185.76 ?  53  CYS A C   1 
ATOM   4    O O   . CYS A 1 9   ? -7.347  -6.135 23.661  1.00 189.06 ?  53  CYS A O   1 
ATOM   5    C CB  . CYS A 1 9   ? -10.535 -4.726 22.791  1.00 183.27 ?  53  CYS A CB  1 
ATOM   6    S SG  . CYS A 1 9   ? -11.155 -3.825 24.231  1.00 175.92 ?  53  CYS A SG  1 
ATOM   7    N N   . GLY A 1 10  ? -8.488  -4.445 24.612  1.00 140.79 ?  54  GLY A N   1 
ATOM   8    C CA  . GLY A 1 10  ? -7.340  -3.928 25.333  1.00 138.92 ?  54  GLY A CA  1 
ATOM   9    C C   . GLY A 1 10  ? -7.732  -2.958 26.430  1.00 136.60 ?  54  GLY A C   1 
ATOM   10   O O   . GLY A 1 10  ? -8.773  -2.305 26.351  1.00 135.11 ?  54  GLY A O   1 
ATOM   11   N N   . ARG A 1 11  ? -6.895  -2.865 27.458  1.00 184.34 ?  55  ARG A N   1 
ATOM   12   C CA  . ARG A 1 11  ? -7.158  -1.955 28.596  1.00 183.04 ?  55  ARG A CA  1 
ATOM   13   C C   . ARG A 1 11  ? -5.861  -1.410 29.234  1.00 183.48 ?  55  ARG A C   1 
ATOM   14   O O   . ARG A 1 11  ? -4.766  -1.674 28.740  1.00 184.69 ?  55  ARG A O   1 
ATOM   15   C CB  . ARG A 1 11  ? -8.016  -2.647 29.677  1.00 183.06 ?  55  ARG A CB  1 
ATOM   16   C CG  . ARG A 1 11  ? -9.248  -3.436 29.179  1.00 183.67 ?  55  ARG A CG  1 
ATOM   17   C CD  . ARG A 1 11  ? -10.480 -2.556 28.884  1.00 182.47 ?  55  ARG A CD  1 
ATOM   18   N NE  . ARG A 1 11  ? -11.567 -3.291 28.222  1.00 183.13 ?  55  ARG A NE  1 
ATOM   19   C CZ  . ARG A 1 11  ? -12.571 -3.904 28.851  1.00 183.82 ?  55  ARG A CZ  1 
ATOM   20   N NH1 . ARG A 1 11  ? -12.647 -3.882 30.174  1.00 183.84 ?  55  ARG A NH1 1 
ATOM   21   N NH2 . ARG A 1 11  ? -13.503 -4.543 28.156  1.00 185.96 ?  55  ARG A NH2 1 
ATOM   22   N N   . VAL A 1 12  ? -6.007  -0.660 30.331  1.00 144.89 ?  56  VAL A N   1 
ATOM   23   C CA  . VAL A 1 12  ? -4.891  -0.126 31.124  1.00 145.26 ?  56  VAL A CA  1 
ATOM   24   C C   . VAL A 1 12  ? -4.686  -1.007 32.356  1.00 146.60 ?  56  VAL A C   1 
ATOM   25   O O   . VAL A 1 12  ? -5.645  -1.508 32.936  1.00 146.91 ?  56  VAL A O   1 
ATOM   26   C CB  . VAL A 1 12  ? -5.183  1.323  31.620  1.00 143.69 ?  56  VAL A CB  1 
ATOM   27   C CG1 . VAL A 1 12  ? -3.992  1.899  32.377  1.00 144.30 ?  56  VAL A CG1 1 
ATOM   28   C CG2 . VAL A 1 12  ? -5.580  2.241  30.463  1.00 142.09 ?  56  VAL A CG2 1 
ATOM   29   N N   . ARG A 1 13  ? -3.446  -1.185 32.782  1.00 171.43 ?  57  ARG A N   1 
ATOM   30   C CA  . ARG A 1 13  ? -3.202  -2.105 33.878  1.00 172.65 ?  57  ARG A CA  1 
ATOM   31   C C   . ARG A 1 13  ? -2.938  -1.414 35.213  1.00 172.35 ?  57  ARG A C   1 
ATOM   32   O O   . ARG A 1 13  ? -2.371  -0.323 35.259  1.00 171.74 ?  57  ARG A O   1 
ATOM   33   C CB  . ARG A 1 13  ? -2.103  -3.085 33.482  1.00 174.38 ?  57  ARG A CB  1 
ATOM   34   C CG  . ARG A 1 13  ? -2.393  -3.647 32.108  1.00 174.49 ?  57  ARG A CG  1 
ATOM   35   C CD  . ARG A 1 13  ? -1.424  -4.700 31.638  1.00 175.98 ?  57  ARG A CD  1 
ATOM   36   N NE  . ARG A 1 13  ? -2.023  -5.455 30.542  1.00 176.49 ?  57  ARG A NE  1 
ATOM   37   C CZ  . ARG A 1 13  ? -2.312  -6.752 30.598  1.00 178.89 ?  57  ARG A CZ  1 
ATOM   38   N NH1 . ARG A 1 13  ? -2.033  -7.452 31.691  1.00 181.22 ?  57  ARG A NH1 1 
ATOM   39   N NH2 . ARG A 1 13  ? -2.867  -7.352 29.554  1.00 181.32 ?  57  ARG A NH2 1 
ATOM   40   N N   . ASP A 1 14  ? -3.426  -2.040 36.282  1.00 177.30 ?  58  ASP A N   1 
ATOM   41   C CA  . ASP A 1 14  ? -3.233  -1.571 37.652  1.00 177.31 ?  58  ASP A CA  1 
ATOM   42   C C   . ASP A 1 14  ? -3.773  -0.166 37.885  1.00 175.31 ?  58  ASP A C   1 
ATOM   43   O O   . ASP A 1 14  ? -3.353  0.517  38.814  1.00 175.12 ?  58  ASP A O   1 
ATOM   44   C CB  . ASP A 1 14  ? -1.751  -1.613 38.032  1.00 178.43 ?  58  ASP A CB  1 
ATOM   45   C CG  . ASP A 1 14  ? -1.166  -3.011 37.967  1.00 180.16 ?  58  ASP A CG  1 
ATOM   46   O OD1 . ASP A 1 14  ? -1.914  -3.990 38.180  1.00 181.31 ?  58  ASP A OD1 1 
ATOM   47   O OD2 . ASP A 1 14  ? 0.053   -3.126 37.711  1.00 180.45 ?  58  ASP A OD2 1 
ATOM   48   N N   . PHE A 1 15  ? -4.719  0.251  37.057  1.00 140.15 ?  59  PHE A N   1 
ATOM   49   C CA  . PHE A 1 15  ? -5.167  1.639  37.052  1.00 137.96 ?  59  PHE A CA  1 
ATOM   50   C C   . PHE A 1 15  ? -5.755  2.093  38.380  1.00 137.20 ?  59  PHE A C   1 
ATOM   51   O O   . PHE A 1 15  ? -5.668  3.271  38.735  1.00 135.61 ?  59  PHE A O   1 
ATOM   52   C CB  . PHE A 1 15  ? -6.190  1.860  35.941  1.00 136.71 ?  59  PHE A CB  1 
ATOM   53   C CG  . PHE A 1 15  ? -7.430  1.022  36.077  1.00 137.15 ?  59  PHE A CG  1 
ATOM   54   C CD1 . PHE A 1 15  ? -8.526  1.486  36.788  1.00 136.03 ?  59  PHE A CD1 1 
ATOM   55   C CD2 . PHE A 1 15  ? -7.506  -0.223 35.478  1.00 138.89 ?  59  PHE A CD2 1 
ATOM   56   C CE1 . PHE A 1 15  ? -9.671  0.720  36.907  1.00 136.86 ?  59  PHE A CE1 1 
ATOM   57   C CE2 . PHE A 1 15  ? -8.650  -0.993 35.590  1.00 139.54 ?  59  PHE A CE2 1 
ATOM   58   C CZ  . PHE A 1 15  ? -9.733  -0.520 36.306  1.00 138.61 ?  59  PHE A CZ  1 
ATOM   59   N N   . VAL A 1 16  ? -6.352  1.151  39.102  1.00 140.12 ?  60  VAL A N   1 
ATOM   60   C CA  . VAL A 1 16  ? -7.095  1.464  40.313  1.00 139.95 ?  60  VAL A CA  1 
ATOM   61   C C   . VAL A 1 16  ? -6.207  2.182  41.310  1.00 139.73 ?  60  VAL A C   1 
ATOM   62   O O   . VAL A 1 16  ? -6.590  3.204  41.879  1.00 138.31 ?  60  VAL A O   1 
ATOM   63   C CB  . VAL A 1 16  ? -7.663  0.197  40.970  1.00 142.21 ?  60  VAL A CB  1 
ATOM   64   C CG1 . VAL A 1 16  ? -8.598  0.572  42.113  1.00 142.34 ?  60  VAL A CG1 1 
ATOM   65   C CG2 . VAL A 1 16  ? -8.389  -0.654 39.938  1.00 142.61 ?  60  VAL A CG2 1 
ATOM   66   N N   . ALA A 1 17  ? -5.010  1.642  41.500  1.00 146.39 ?  61  ALA A N   1 
ATOM   67   C CA  . ALA A 1 17  ? -4.018  2.253  42.370  1.00 146.53 ?  61  ALA A CA  1 
ATOM   68   C C   . ALA A 1 17  ? -3.630  3.635  41.848  1.00 144.31 ?  61  ALA A C   1 
ATOM   69   O O   . ALA A 1 17  ? -3.356  4.548  42.628  1.00 143.36 ?  61  ALA A O   1 
ATOM   70   C CB  . ALA A 1 17  ? -2.796  1.362  42.471  1.00 148.90 ?  61  ALA A CB  1 
ATOM   71   N N   . LYS A 1 18  ? -3.624  3.787  40.525  1.00 120.46 ?  62  LYS A N   1 
ATOM   72   C CA  . LYS A 1 18  ? -3.168  5.023  39.902  1.00 118.88 ?  62  LYS A CA  1 
ATOM   73   C C   . LYS A 1 18  ? -4.175  6.142  40.108  1.00 116.12 ?  62  LYS A C   1 
ATOM   74   O O   . LYS A 1 18  ? -3.809  7.316  40.187  1.00 114.56 ?  62  LYS A O   1 
ATOM   75   C CB  . LYS A 1 18  ? -2.898  4.813  38.411  1.00 119.55 ?  62  LYS A CB  1 
ATOM   76   C CG  . LYS A 1 18  ? -2.137  3.539  38.106  1.00 122.33 ?  62  LYS A CG  1 
ATOM   77   C CD  . LYS A 1 18  ? -1.465  3.581  36.743  1.00 123.39 ?  62  LYS A CD  1 
ATOM   78   C CE  . LYS A 1 18  ? -0.730  2.275  36.464  1.00 125.63 ?  62  LYS A CE  1 
ATOM   79   N NZ  . LYS A 1 18  ? 0.141   2.343  35.258  1.00 126.99 ?  62  LYS A NZ  1 
ATOM   80   N N   . LEU A 1 19  ? -5.448  5.777  40.190  1.00 103.11 ?  63  LEU A N   1 
ATOM   81   C CA  . LEU A 1 19  ? -6.494  6.758  40.442  1.00 99.96  ?  63  LEU A CA  1 
ATOM   82   C C   . LEU A 1 19  ? -6.825  6.907  41.929  1.00 101.53 ?  63  LEU A C   1 
ATOM   83   O O   . LEU A 1 19  ? -7.531  7.839  42.339  1.00 99.43  ?  63  LEU A O   1 
ATOM   84   C CB  . LEU A 1 19  ? -7.740  6.392  39.635  1.00 99.19  ?  63  LEU A CB  1 
ATOM   85   C CG  . LEU A 1 19  ? -7.421  6.456  38.143  1.00 98.74  ?  63  LEU A CG  1 
ATOM   86   C CD1 . LEU A 1 19  ? -8.515  5.850  37.293  1.00 99.09  ?  63  LEU A CD1 1 
ATOM   87   C CD2 . LEU A 1 19  ? -7.177  7.907  37.776  1.00 96.49  ?  63  LEU A CD2 1 
ATOM   88   N N   . ALA A 1 20  ? -6.296  5.995  42.738  1.00 115.71 ?  64  ALA A N   1 
ATOM   89   C CA  . ALA A 1 20  ? -6.612  5.991  44.161  1.00 116.87 ?  64  ALA A CA  1 
ATOM   90   C C   . ALA A 1 20  ? -6.161  7.284  44.840  1.00 115.36 ?  64  ALA A C   1 
ATOM   91   O O   . ALA A 1 20  ? -6.979  8.024  45.401  1.00 114.58 ?  64  ALA A O   1 
ATOM   92   C CB  . ALA A 1 20  ? -5.990  4.777  44.845  1.00 119.87 ?  64  ALA A CB  1 
ATOM   93   N N   . ASN A 1 21  ? -4.864  7.566  44.752  1.00 141.22 ?  65  ASN A N   1 
ATOM   94   C CA  . ASN A 1 21  ? -4.295  8.739  45.399  1.00 140.00 ?  65  ASN A CA  1 
ATOM   95   C C   . ASN A 1 21  ? -4.638  10.037 44.678  1.00 137.02 ?  65  ASN A C   1 
ATOM   96   O O   . ASN A 1 21  ? -4.429  11.123 45.217  1.00 135.77 ?  65  ASN A O   1 
ATOM   97   C CB  . ASN A 1 21  ? -2.775  8.595  45.547  1.00 141.06 ?  65  ASN A CB  1 
ATOM   98   C CG  . ASN A 1 21  ? -2.329  8.543  47.006  1.00 142.69 ?  65  ASN A CG  1 
ATOM   99   O OD1 . ASN A 1 21  ? -3.005  9.064  47.897  1.00 142.58 ?  65  ASN A OD1 1 
ATOM   100  N ND2 . ASN A 1 21  ? -1.184  7.913  47.253  1.00 144.44 ?  65  ASN A ND2 1 
ATOM   101  N N   . ASN A 1 22  ? -5.158  9.917  43.460  1.00 113.03 ?  66  ASN A N   1 
ATOM   102  C CA  . ASN A 1 22  ? -5.499  11.077 42.651  1.00 110.36 ?  66  ASN A CA  1 
ATOM   103  C C   . ASN A 1 22  ? -6.959  11.490 42.694  1.00 109.35 ?  66  ASN A C   1 
ATOM   104  O O   . ASN A 1 22  ? -7.341  12.509 42.124  1.00 107.14 ?  66  ASN A O   1 
ATOM   105  C CB  . ASN A 1 22  ? -5.092  10.816 41.211  1.00 110.27 ?  66  ASN A CB  1 
ATOM   106  C CG  . ASN A 1 22  ? -3.605  10.892 41.021  1.00 111.27 ?  66  ASN A CG  1 
ATOM   107  O OD1 . ASN A 1 22  ? -2.965  11.835 41.482  1.00 110.37 ?  66  ASN A OD1 1 
ATOM   108  N ND2 . ASN A 1 22  ? -3.036  9.895  40.354  1.00 113.54 ?  66  ASN A ND2 1 
ATOM   109  N N   . THR A 1 23  ? -7.785  10.703 43.362  1.00 98.26  ?  67  THR A N   1 
ATOM   110  C CA  . THR A 1 23  ? -9.183  11.069 43.493  1.00 98.10  ?  67  THR A CA  1 
ATOM   111  C C   . THR A 1 23  ? -9.255  11.998 44.687  1.00 97.99  ?  67  THR A C   1 
ATOM   112  O O   . THR A 1 23  ? -8.822  11.637 45.784  1.00 99.82  ?  67  THR A O   1 
ATOM   113  C CB  . THR A 1 23  ? -10.047 9.830  43.733  1.00 100.68 ?  67  THR A CB  1 
ATOM   114  O OG1 . THR A 1 23  ? -9.727  8.831  42.756  1.00 101.18 ?  67  THR A OG1 1 
ATOM   115  C CG2 . THR A 1 23  ? -11.519 10.173 43.655  1.00 100.78 ?  67  THR A CG2 1 
ATOM   116  N N   . HIS A 1 24  ? -9.755  13.209 44.483  1.00 103.56 ?  68  HIS A N   1 
ATOM   117  C CA  . HIS A 1 24  ? -9.790  14.179 45.570  1.00 103.53 ?  68  HIS A CA  1 
ATOM   118  C C   . HIS A 1 24  ? -11.193 14.676 45.884  1.00 104.28 ?  68  HIS A C   1 
ATOM   119  O O   . HIS A 1 24  ? -11.772 15.445 45.123  1.00 102.60 ?  68  HIS A O   1 
ATOM   120  C CB  . HIS A 1 24  ? -8.876  15.359 45.246  1.00 100.72 ?  68  HIS A CB  1 
ATOM   121  C CG  . HIS A 1 24  ? -7.472  14.955 44.927  1.00 100.42 ?  68  HIS A CG  1 
ATOM   122  N ND1 . HIS A 1 24  ? -6.973  14.946 43.641  1.00 98.78  ?  68  HIS A ND1 1 
ATOM   123  C CD2 . HIS A 1 24  ? -6.466  14.523 45.725  1.00 102.08 ?  68  HIS A CD2 1 
ATOM   124  C CE1 . HIS A 1 24  ? -5.715  14.540 43.662  1.00 99.68  ?  68  HIS A CE1 1 
ATOM   125  N NE2 . HIS A 1 24  ? -5.384  14.276 44.914  1.00 101.57 ?  68  HIS A NE2 1 
ATOM   126  N N   . GLN A 1 25  ? -11.718 14.270 47.034  1.00 103.37 ?  69  GLN A N   1 
ATOM   127  C CA  . GLN A 1 25  ? -13.050 14.689 47.442  1.00 104.50 ?  69  GLN A CA  1 
ATOM   128  C C   . GLN A 1 25  ? -13.036 16.044 48.137  1.00 104.05 ?  69  GLN A C   1 
ATOM   129  O O   . GLN A 1 25  ? -12.143 16.333 48.935  1.00 104.36 ?  69  GLN A O   1 
ATOM   130  C CB  . GLN A 1 25  ? -13.675 13.649 48.362  1.00 107.52 ?  69  GLN A CB  1 
ATOM   131  C CG  . GLN A 1 25  ? -14.989 14.091 48.956  1.00 108.78 ?  69  GLN A CG  1 
ATOM   132  C CD  . GLN A 1 25  ? -15.426 13.214 50.107  1.00 111.78 ?  69  GLN A CD  1 
ATOM   133  O OE1 . GLN A 1 25  ? -14.593 12.643 50.830  1.00 113.66 ?  69  GLN A OE1 1 
ATOM   134  N NE2 . GLN A 1 25  ? -16.740 13.094 50.286  1.00 112.14 ?  69  GLN A NE2 1 
ATOM   135  N N   . HIS A 1 26  ? -14.015 16.881 47.809  1.00 100.37 ?  70  HIS A N   1 
ATOM   136  C CA  . HIS A 1 26  ? -14.259 18.094 48.569  1.00 100.64 ?  70  HIS A CA  1 
ATOM   137  C C   . HIS A 1 26  ? -15.733 18.223 48.843  1.00 102.25 ?  70  HIS A C   1 
ATOM   138  O O   . HIS A 1 26  ? -16.535 18.254 47.913  1.00 101.26 ?  70  HIS A O   1 
ATOM   139  C CB  . HIS A 1 26  ? -13.804 19.351 47.839  1.00 97.56  ?  70  HIS A CB  1 
ATOM   140  C CG  . HIS A 1 26  ? -13.971 20.595 48.654  1.00 97.95  ?  70  HIS A CG  1 
ATOM   141  N ND1 . HIS A 1 26  ? -12.931 21.170 49.355  1.00 97.62  ?  70  HIS A ND1 1 
ATOM   142  C CD2 . HIS A 1 26  ? -15.065 21.350 48.920  1.00 98.96  ?  70  HIS A CD2 1 
ATOM   143  C CE1 . HIS A 1 26  ? -13.371 22.240 49.996  1.00 98.45  ?  70  HIS A CE1 1 
ATOM   144  N NE2 . HIS A 1 26  ? -14.664 22.367 49.753  1.00 99.26  ?  70  HIS A NE2 1 
ATOM   145  N N   . VAL A 1 27  ? -16.085 18.313 50.123  1.00 113.31 ?  71  VAL A N   1 
ATOM   146  C CA  . VAL A 1 27  ? -17.471 18.490 50.531  1.00 114.68 ?  71  VAL A CA  1 
ATOM   147  C C   . VAL A 1 27  ? -17.794 19.966 50.679  1.00 114.16 ?  71  VAL A C   1 
ATOM   148  O O   . VAL A 1 27  ? -17.003 20.732 51.222  1.00 114.18 ?  71  VAL A O   1 
ATOM   149  C CB  . VAL A 1 27  ? -17.765 17.780 51.841  1.00 117.64 ?  71  VAL A CB  1 
ATOM   150  C CG1 . VAL A 1 27  ? -19.263 17.700 52.044  1.00 118.42 ?  71  VAL A CG1 1 
ATOM   151  C CG2 . VAL A 1 27  ? -17.148 16.395 51.815  1.00 118.24 ?  71  VAL A CG2 1 
ATOM   152  N N   . PHE A 1 28  ? -18.957 20.361 50.179  1.00 118.61 ?  72  PHE A N   1 
ATOM   153  C CA  . PHE A 1 28  ? -19.304 21.771 50.115  1.00 117.99 ?  72  PHE A CA  1 
ATOM   154  C C   . PHE A 1 28  ? -20.196 22.334 51.227  1.00 120.28 ?  72  PHE A C   1 
ATOM   155  O O   . PHE A 1 28  ? -20.602 23.496 51.149  1.00 119.94 ?  72  PHE A O   1 
ATOM   156  C CB  . PHE A 1 28  ? -19.825 22.127 48.729  1.00 115.49 ?  72  PHE A CB  1 
ATOM   157  C CG  . PHE A 1 28  ? -18.739 22.288 47.719  1.00 113.25 ?  72  PHE A CG  1 
ATOM   158  C CD1 . PHE A 1 28  ? -18.199 21.182 47.080  1.00 112.53 ?  72  PHE A CD1 1 
ATOM   159  C CD2 . PHE A 1 28  ? -18.243 23.547 47.422  1.00 111.79 ?  72  PHE A CD2 1 
ATOM   160  C CE1 . PHE A 1 28  ? -17.199 21.333 46.158  1.00 110.34 ?  72  PHE A CE1 1 
ATOM   161  C CE2 . PHE A 1 28  ? -17.246 23.705 46.501  1.00 109.22 ?  72  PHE A CE2 1 
ATOM   162  C CZ  . PHE A 1 28  ? -16.721 22.598 45.868  1.00 108.39 ?  72  PHE A CZ  1 
ATOM   163  N N   . ASP A 1 29  ? -20.508 21.520 52.234  1.00 164.55 ?  73  ASP A N   1 
ATOM   164  C CA  . ASP A 1 29  ? -21.258 21.996 53.398  1.00 166.88 ?  73  ASP A CA  1 
ATOM   165  C C   . ASP A 1 29  ? -22.453 22.840 52.952  1.00 166.06 ?  73  ASP A C   1 
ATOM   166  O O   . ASP A 1 29  ? -23.242 22.406 52.105  1.00 164.48 ?  73  ASP A O   1 
ATOM   167  C CB  . ASP A 1 29  ? -20.359 22.802 54.347  1.00 168.33 ?  73  ASP A CB  1 
ATOM   168  C CG  . ASP A 1 29  ? -19.727 21.948 55.439  1.00 170.44 ?  73  ASP A CG  1 
ATOM   169  O OD1 . ASP A 1 29  ? -19.686 20.708 55.297  1.00 170.68 ?  73  ASP A OD1 1 
ATOM   170  O OD2 . ASP A 1 29  ? -19.264 22.526 56.447  1.00 171.87 ?  73  ASP A OD2 1 
ATOM   171  N N   . ASP A 1 30  ? -22.543 24.067 53.467  1.00 175.02 ?  74  ASP A N   1 
ATOM   172  C CA  . ASP A 1 30  ? -23.671 24.926 53.137  1.00 174.51 ?  74  ASP A CA  1 
ATOM   173  C C   . ASP A 1 30  ? -23.669 25.243 51.649  1.00 171.48 ?  74  ASP A C   1 
ATOM   174  O O   . ASP A 1 30  ? -22.730 25.839 51.117  1.00 170.29 ?  74  ASP A O   1 
ATOM   175  C CB  . ASP A 1 30  ? -23.625 26.228 53.952  1.00 176.45 ?  74  ASP A CB  1 
ATOM   176  C CG  . ASP A 1 30  ? -23.549 25.980 55.452  1.00 179.06 ?  74  ASP A CG  1 
ATOM   177  O OD1 . ASP A 1 30  ? -24.572 25.566 56.039  1.00 180.52 ?  74  ASP A OD1 1 
ATOM   178  O OD2 . ASP A 1 30  ? -22.471 26.209 56.041  1.00 179.46 ?  74  ASP A OD2 1 
ATOM   179  N N   . LEU A 1 31  ? -24.745 24.838 50.989  1.00 228.69 ?  75  LEU A N   1 
ATOM   180  C CA  . LEU A 1 31  ? -24.955 25.149 49.592  1.00 225.68 ?  75  LEU A CA  1 
ATOM   181  C C   . LEU A 1 31  ? -26.453 25.043 49.299  1.00 224.79 ?  75  LEU A C   1 
ATOM   182  O O   . LEU A 1 31  ? -27.140 24.207 49.886  1.00 225.76 ?  75  LEU A O   1 
ATOM   183  C CB  . LEU A 1 31  ? -24.146 24.185 48.725  1.00 223.72 ?  75  LEU A CB  1 
ATOM   184  C CG  . LEU A 1 31  ? -23.612 24.689 47.387  1.00 220.76 ?  75  LEU A CG  1 
ATOM   185  C CD1 . LEU A 1 31  ? -22.458 23.833 46.907  1.00 220.06 ?  75  LEU A CD1 1 
ATOM   186  C CD2 . LEU A 1 31  ? -24.707 24.710 46.352  1.00 218.09 ?  75  LEU A CD2 1 
ATOM   187  N N   . ARG A 1 32  ? -26.968 25.965 48.489  1.00 151.04 ?  76  ARG A N   1 
ATOM   188  C CA  . ARG A 1 32  ? -28.377 25.956 48.099  1.00 149.79 ?  76  ARG A CA  1 
ATOM   189  C C   . ARG A 1 32  ? -28.637 26.842 46.881  1.00 147.31 ?  76  ARG A C   1 
ATOM   190  O O   . ARG A 1 32  ? -27.815 27.693 46.543  1.00 146.49 ?  76  ARG A O   1 
ATOM   191  C CB  . ARG A 1 32  ? -29.259 26.399 49.268  1.00 152.68 ?  76  ARG A CB  1 
ATOM   192  C CG  . ARG A 1 32  ? -30.708 25.953 49.156  1.00 152.23 ?  76  ARG A CG  1 
ATOM   193  C CD  . ARG A 1 32  ? -30.810 24.449 48.966  1.00 151.31 ?  76  ARG A CD  1 
ATOM   194  N NE  . ARG A 1 32  ? -30.260 23.715 50.102  1.00 152.65 ?  76  ARG A NE  1 
ATOM   195  C CZ  . ARG A 1 32  ? -30.731 23.796 51.342  1.00 154.15 ?  76  ARG A CZ  1 
ATOM   196  N NH1 . ARG A 1 32  ? -31.765 24.581 51.611  1.00 154.55 ?  76  ARG A NH1 1 
ATOM   197  N NH2 . ARG A 1 32  ? -30.168 23.092 52.314  1.00 155.34 ?  76  ARG A NH2 1 
ATOM   198  N N   . GLY A 1 33  ? -29.788 26.660 46.237  1.00 128.17 ?  77  GLY A N   1 
ATOM   199  C CA  . GLY A 1 33  ? -30.254 27.621 45.266  1.00 126.48 ?  77  GLY A CA  1 
ATOM   200  C C   . GLY A 1 33  ? -29.406 27.632 44.030  1.00 123.24 ?  77  GLY A C   1 
ATOM   201  O O   . GLY A 1 33  ? -28.945 26.592 43.571  1.00 121.34 ?  77  GLY A O   1 
ATOM   202  N N   . SER A 1 34  ? -29.178 28.822 43.504  1.00 154.46 ?  78  SER A N   1 
ATOM   203  C CA  . SER A 1 34  ? -28.366 28.942 42.316  1.00 150.88 ?  78  SER A CA  1 
ATOM   204  C C   . SER A 1 34  ? -26.908 28.630 42.627  1.00 151.32 ?  78  SER A C   1 
ATOM   205  O O   . SER A 1 34  ? -26.320 29.201 43.542  1.00 154.46 ?  78  SER A O   1 
ATOM   206  C CB  . SER A 1 34  ? -28.503 30.335 41.715  1.00 150.50 ?  78  SER A CB  1 
ATOM   207  O OG  . SER A 1 34  ? -28.085 30.332 40.361  1.00 146.01 ?  78  SER A OG  1 
ATOM   208  N N   . VAL A 1 35  ? -26.343 27.703 41.860  1.00 115.83 ?  79  VAL A N   1 
ATOM   209  C CA  . VAL A 1 35  ? -24.936 27.353 41.963  1.00 116.30 ?  79  VAL A CA  1 
ATOM   210  C C   . VAL A 1 35  ? -24.245 27.676 40.648  1.00 111.98 ?  79  VAL A C   1 
ATOM   211  O O   . VAL A 1 35  ? -24.481 27.018 39.630  1.00 107.93 ?  79  VAL A O   1 
ATOM   212  C CB  . VAL A 1 35  ? -24.772 25.857 42.238  1.00 116.94 ?  79  VAL A CB  1 
ATOM   213  C CG1 . VAL A 1 35  ? -23.399 25.574 42.830  1.00 119.69 ?  79  VAL A CG1 1 
ATOM   214  C CG2 . VAL A 1 35  ? -25.875 25.374 43.157  1.00 119.29 ?  79  VAL A CG2 1 
ATOM   215  N N   . SER A 1 36  ? -23.393 28.693 40.676  1.00 89.21  ?  80  SER A N   1 
ATOM   216  C CA  . SER A 1 36  ? -22.620 29.073 39.508  1.00 84.26  ?  80  SER A CA  1 
ATOM   217  C C   . SER A 1 36  ? -21.207 28.549 39.677  1.00 84.92  ?  80  SER A C   1 
ATOM   218  O O   . SER A 1 36  ? -20.668 28.531 40.791  1.00 91.13  ?  80  SER A O   1 
ATOM   219  C CB  . SER A 1 36  ? -22.566 30.594 39.360  1.00 84.00  ?  80  SER A CB  1 
ATOM   220  O OG  . SER A 1 36  ? -23.781 31.121 38.868  1.00 83.03  ?  80  SER A OG  1 
ATOM   221  N N   . LEU A 1 37  ? -20.611 28.127 38.569  1.00 74.68  ?  81  LEU A N   1 
ATOM   222  C CA  . LEU A 1 37  ? -19.221 27.713 38.555  1.00 73.65  ?  81  LEU A CA  1 
ATOM   223  C C   . LEU A 1 37  ? -18.520 28.509 37.461  1.00 67.28  ?  81  LEU A C   1 
ATOM   224  O O   . LEU A 1 37  ? -19.013 28.567 36.332  1.00 63.80  ?  81  LEU A O   1 
ATOM   225  C CB  . LEU A 1 37  ? -19.127 26.213 38.277  1.00 74.31  ?  81  LEU A CB  1 
ATOM   226  C CG  . LEU A 1 37  ? -17.791 25.511 38.517  1.00 75.18  ?  81  LEU A CG  1 
ATOM   227  C CD1 . LEU A 1 37  ? -18.010 24.039 38.809  1.00 79.80  ?  81  LEU A CD1 1 
ATOM   228  C CD2 . LEU A 1 37  ? -16.899 25.660 37.315  1.00 69.40  ?  81  LEU A CD2 1 
ATOM   229  N N   . SER A 1 38  ? -17.387 29.128 37.788  1.00 80.18  ?  82  SER A N   1 
ATOM   230  C CA  . SER A 1 38  ? -16.597 29.846 36.789  1.00 75.61  ?  82  SER A CA  1 
ATOM   231  C C   . SER A 1 38  ? -15.119 29.482 36.812  1.00 75.10  ?  82  SER A C   1 
ATOM   232  O O   . SER A 1 38  ? -14.479 29.516 37.859  1.00 77.13  ?  82  SER A O   1 
ATOM   233  C CB  . SER A 1 38  ? -16.731 31.363 36.950  1.00 75.22  ?  82  SER A CB  1 
ATOM   234  O OG  . SER A 1 38  ? -18.026 31.806 36.611  1.00 75.62  ?  82  SER A OG  1 
ATOM   235  N N   . TRP A 1 39  ? -14.573 29.137 35.655  1.00 70.35  ?  83  TRP A N   1 
ATOM   236  C CA  . TRP A 1 39  ? -13.139 28.969 35.535  1.00 70.87  ?  83  TRP A CA  1 
ATOM   237  C C   . TRP A 1 39  ? -12.549 30.355 35.382  1.00 69.76  ?  83  TRP A C   1 
ATOM   238  O O   . TRP A 1 39  ? -13.140 31.200 34.704  1.00 68.31  ?  83  TRP A O   1 
ATOM   239  C CB  . TRP A 1 39  ? -12.802 28.105 34.330  1.00 71.53  ?  83  TRP A CB  1 
ATOM   240  C CG  . TRP A 1 39  ? -13.033 26.654 34.565  1.00 73.47  ?  83  TRP A CG  1 
ATOM   241  C CD1 . TRP A 1 39  ? -14.184 25.974 34.370  1.00 73.60  ?  83  TRP A CD1 1 
ATOM   242  C CD2 . TRP A 1 39  ? -12.080 25.702 35.048  1.00 76.20  ?  83  TRP A CD2 1 
ATOM   243  N NE1 . TRP A 1 39  ? -14.014 24.649 34.698  1.00 76.50  ?  83  TRP A NE1 1 
ATOM   244  C CE2 . TRP A 1 39  ? -12.729 24.456 35.111  1.00 78.06  ?  83  TRP A CE2 1 
ATOM   245  C CE3 . TRP A 1 39  ? -10.737 25.783 35.418  1.00 77.65  ?  83  TRP A CE3 1 
ATOM   246  C CZ2 . TRP A 1 39  ? -12.089 23.302 35.533  1.00 81.28  ?  83  TRP A CZ2 1 
ATOM   247  C CZ3 . TRP A 1 39  ? -10.097 24.633 35.839  1.00 80.57  ?  83  TRP A CZ3 1 
ATOM   248  C CH2 . TRP A 1 39  ? -10.771 23.409 35.892  1.00 82.30  ?  83  TRP A CH2 1 
ATOM   249  N N   . VAL A 1 40  ? -11.422 30.622 36.039  1.00 69.88  ?  84  VAL A N   1 
ATOM   250  C CA  . VAL A 1 40  ? -10.777 31.906 35.858  1.00 69.52  ?  84  VAL A CA  1 
ATOM   251  C C   . VAL A 1 40  ? -9.355  31.741 35.349  1.00 71.38  ?  84  VAL A C   1 
ATOM   252  O O   . VAL A 1 40  ? -8.440  31.394 36.122  1.00 73.02  ?  84  VAL A O   1 
ATOM   253  C CB  . VAL A 1 40  ? -10.737 32.693 37.171  1.00 70.18  ?  84  VAL A CB  1 
ATOM   254  C CG1 . VAL A 1 40  ? -10.246 34.096 36.920  1.00 69.99  ?  84  VAL A CG1 1 
ATOM   255  C CG2 . VAL A 1 40  ? -12.108 32.734 37.792  1.00 70.42  ?  84  VAL A CG2 1 
ATOM   256  N N   . GLY A 1 41  ? -9.157  32.073 34.069  1.00 72.99  ?  85  GLY A N   1 
ATOM   257  C CA  . GLY A 1 41  ? -7.855  32.017 33.419  1.00 76.38  ?  85  GLY A CA  1 
ATOM   258  C C   . GLY A 1 41  ? -7.537  30.637 32.887  1.00 79.34  ?  85  GLY A C   1 
ATOM   259  O O   . GLY A 1 41  ? -8.069  29.648 33.366  1.00 78.50  ?  85  GLY A O   1 
ATOM   260  N N   . ASP A 1 42  ? -6.679  30.569 31.878  1.00 66.74  ?  86  ASP A N   1 
ATOM   261  C CA  . ASP A 1 42  ? -6.175  29.285 31.388  1.00 67.46  ?  86  ASP A CA  1 
ATOM   262  C C   . ASP A 1 42  ? -4.894  28.907 32.120  1.00 70.63  ?  86  ASP A C   1 
ATOM   263  O O   . ASP A 1 42  ? -4.067  29.773 32.398  1.00 73.08  ?  86  ASP A O   1 
ATOM   264  C CB  . ASP A 1 42  ? -5.910  29.333 29.887  1.00 69.49  ?  86  ASP A CB  1 
ATOM   265  C CG  . ASP A 1 42  ? -5.489  27.983 29.339  1.00 75.56  ?  86  ASP A CG  1 
ATOM   266  O OD1 . ASP A 1 42  ? -6.193  26.985 29.622  1.00 74.37  ?  86  ASP A OD1 1 
ATOM   267  O OD2 . ASP A 1 42  ? -4.440  27.914 28.652  1.00 81.62  ?  86  ASP A OD2 1 
ATOM   268  N N   . SER A 1 43  ? -4.766  27.660 32.541  1.00 90.34  ?  87  SER A N   1 
ATOM   269  C CA  . SER A 1 43  ? -3.510  27.207 33.118  1.00 92.79  ?  87  SER A CA  1 
ATOM   270  C C   . SER A 1 43  ? -3.288  27.916 34.451  1.00 89.25  ?  87  SER A C   1 
ATOM   271  O O   . SER A 1 43  ? -2.161  27.994 34.941  1.00 91.18  ?  87  SER A O   1 
ATOM   272  C CB  . SER A 1 43  ? -2.337  27.580 32.209  1.00 98.18  ?  87  SER A CB  1 
ATOM   273  O OG  . SER A 1 43  ? -2.304  26.757 31.056  1.00 103.48 ?  87  SER A OG  1 
ATOM   274  N N   . THR A 1 44  ? -4.368  28.418 35.042  1.00 89.68  ?  88  THR A N   1 
ATOM   275  C CA  . THR A 1 44  ? -4.311  28.967 36.391  1.00 87.62  ?  88  THR A CA  1 
ATOM   276  C C   . THR A 1 44  ? -4.822  27.908 37.370  1.00 87.32  ?  88  THR A C   1 
ATOM   277  O O   . THR A 1 44  ? -4.217  27.663 38.403  1.00 88.61  ?  88  THR A O   1 
ATOM   278  C CB  . THR A 1 44  ? -5.138  30.245 36.560  1.00 84.34  ?  88  THR A CB  1 
ATOM   279  O OG1 . THR A 1 44  ? -6.536  29.936 36.476  1.00 81.86  ?  88  THR A OG1 1 
ATOM   280  C CG2 . THR A 1 44  ? -4.759  31.270 35.496  1.00 84.97  ?  88  THR A CG2 1 
ATOM   281  N N   . GLY A 1 45  ? -5.925  27.258 37.045  1.00 89.50  ?  89  GLY A N   1 
ATOM   282  C CA  . GLY A 1 45  ? -6.466  26.259 37.943  1.00 89.91  ?  89  GLY A CA  1 
ATOM   283  C C   . GLY A 1 45  ? -7.549  26.827 38.822  1.00 87.87  ?  89  GLY A C   1 
ATOM   284  O O   . GLY A 1 45  ? -8.230  26.095 39.536  1.00 88.82  ?  89  GLY A O   1 
ATOM   285  N N   . VAL A 1 46  ? -7.722  28.142 38.743  1.00 80.16  ?  90  VAL A N   1 
ATOM   286  C CA  . VAL A 1 46  ? -8.720  28.852 39.533  1.00 79.23  ?  90  VAL A CA  1 
ATOM   287  C C   . VAL A 1 46  ? -10.164 28.563 39.134  1.00 78.13  ?  90  VAL A C   1 
ATOM   288  O O   . VAL A 1 46  ? -10.561 28.749 37.976  1.00 76.02  ?  90  VAL A O   1 
ATOM   289  C CB  . VAL A 1 46  ? -8.482  30.360 39.473  1.00 77.93  ?  90  VAL A CB  1 
ATOM   290  C CG1 . VAL A 1 46  ? -9.543  31.090 40.270  1.00 78.03  ?  90  VAL A CG1 1 
ATOM   291  C CG2 . VAL A 1 46  ? -7.070  30.694 39.991  1.00 79.76  ?  90  VAL A CG2 1 
ATOM   292  N N   . ILE A 1 47  ? -10.956 28.114 40.108  1.00 71.97  ?  91  ILE A N   1 
ATOM   293  C CA  . ILE A 1 47  ? -12.393 27.930 39.903  1.00 72.25  ?  91  ILE A CA  1 
ATOM   294  C C   . ILE A 1 47  ? -13.169 28.687 40.971  1.00 74.86  ?  91  ILE A C   1 
ATOM   295  O O   . ILE A 1 47  ? -12.799 28.660 42.138  1.00 77.79  ?  91  ILE A O   1 
ATOM   296  C CB  . ILE A 1 47  ? -12.785 26.447 39.956  1.00 74.84  ?  91  ILE A CB  1 
ATOM   297  C CG1 . ILE A 1 47  ? -11.894 25.636 39.014  1.00 73.60  ?  91  ILE A CG1 1 
ATOM   298  C CG2 . ILE A 1 47  ? -14.270 26.270 39.618  1.00 75.79  ?  91  ILE A CG2 1 
ATOM   299  C CD1 . ILE A 1 47  ? -12.236 24.167 38.964  1.00 76.42  ?  91  ILE A CD1 1 
ATOM   300  N N   . LEU A 1 48  ? -14.235 29.377 40.577  1.00 79.41  ?  92  LEU A N   1 
ATOM   301  C CA  . LEU A 1 48  ? -15.096 30.019 41.560  1.00 83.42  ?  92  LEU A CA  1 
ATOM   302  C C   . LEU A 1 48  ? -16.438 29.323 41.604  1.00 87.48  ?  92  LEU A C   1 
ATOM   303  O O   . LEU A 1 48  ? -17.026 29.036 40.557  1.00 85.20  ?  92  LEU A O   1 
ATOM   304  C CB  . LEU A 1 48  ? -15.289 31.499 41.240  1.00 81.32  ?  92  LEU A CB  1 
ATOM   305  C CG  . LEU A 1 48  ? -14.104 32.421 41.531  1.00 79.68  ?  92  LEU A CG  1 
ATOM   306  C CD1 . LEU A 1 48  ? -14.533 33.869 41.422  1.00 79.22  ?  92  LEU A CD1 1 
ATOM   307  C CD2 . LEU A 1 48  ? -13.505 32.147 42.906  1.00 83.39  ?  92  LEU A CD2 1 
ATOM   308  N N   . VAL A 1 49  ? -16.914 29.035 42.816  1.00 78.13  ?  93  VAL A N   1 
ATOM   309  C CA  . VAL A 1 49  ? -18.273 28.505 43.002  1.00 83.55  ?  93  VAL A CA  1 
ATOM   310  C C   . VAL A 1 49  ? -19.137 29.484 43.804  1.00 86.63  ?  93  VAL A C   1 
ATOM   311  O O   . VAL A 1 49  ? -18.862 29.757 44.965  1.00 87.74  ?  93  VAL A O   1 
ATOM   312  C CB  . VAL A 1 49  ? -18.279 27.122 43.685  1.00 86.59  ?  93  VAL A CB  1 
ATOM   313  C CG1 . VAL A 1 49  ? -19.670 26.792 44.161  1.00 89.49  ?  93  VAL A CG1 1 
ATOM   314  C CG2 . VAL A 1 49  ? -17.774 26.054 42.733  1.00 84.44  ?  93  VAL A CG2 1 
ATOM   315  N N   . LEU A 1 50  ? -20.167 30.028 43.169  1.00 81.37  ?  94  LEU A N   1 
ATOM   316  C CA  . LEU A 1 50  ? -21.054 30.985 43.826  1.00 82.82  ?  94  LEU A CA  1 
ATOM   317  C C   . LEU A 1 50  ? -22.422 30.369 44.081  1.00 83.49  ?  94  LEU A C   1 
ATOM   318  O O   . LEU A 1 50  ? -23.059 29.847 43.155  1.00 81.02  ?  94  LEU A O   1 
ATOM   319  C CB  . LEU A 1 50  ? -21.215 32.235 42.964  1.00 81.54  ?  94  LEU A CB  1 
ATOM   320  C CG  . LEU A 1 50  ? -22.139 33.333 43.494  1.00 83.11  ?  94  LEU A CG  1 
ATOM   321  C CD1 . LEU A 1 50  ? -21.667 33.860 44.859  1.00 84.70  ?  94  LEU A CD1 1 
ATOM   322  C CD2 . LEU A 1 50  ? -22.250 34.470 42.490  1.00 81.74  ?  94  LEU A CD2 1 
ATOM   323  N N   . THR A 1 51  ? -22.868 30.427 45.334  1.00 100.39 ?  95  THR A N   1 
ATOM   324  C CA  . THR A 1 51  ? -24.178 29.905 45.713  1.00 101.19 ?  95  THR A CA  1 
ATOM   325  C C   . THR A 1 51  ? -25.009 30.963 46.409  1.00 103.42 ?  95  THR A C   1 
ATOM   326  O O   . THR A 1 51  ? -24.473 31.804 47.119  1.00 105.11 ?  95  THR A O   1 
ATOM   327  C CB  . THR A 1 51  ? -24.055 28.724 46.675  1.00 102.87 ?  95  THR A CB  1 
ATOM   328  O OG1 . THR A 1 51  ? -23.939 29.209 48.017  1.00 105.70 ?  95  THR A OG1 1 
ATOM   329  C CG2 . THR A 1 51  ? -22.842 27.892 46.330  1.00 101.93 ?  95  THR A CG2 1 
ATOM   330  N N   . THR A 1 52  ? -26.322 30.915 46.214  1.00 131.81 ?  96  THR A N   1 
ATOM   331  C CA  . THR A 1 52  ? -27.227 31.851 46.881  1.00 134.36 ?  96  THR A CA  1 
ATOM   332  C C   . THR A 1 52  ? -28.391 31.126 47.564  1.00 135.75 ?  96  THR A C   1 
ATOM   333  O O   . THR A 1 52  ? -28.870 30.105 47.075  1.00 133.89 ?  96  THR A O   1 
ATOM   334  C CB  . THR A 1 52  ? -27.777 32.906 45.900  1.00 133.32 ?  96  THR A CB  1 
ATOM   335  O OG1 . THR A 1 52  ? -28.724 32.294 45.017  1.00 131.43 ?  96  THR A OG1 1 
ATOM   336  C CG2 . THR A 1 52  ? -26.644 33.532 45.087  1.00 131.39 ?  96  THR A CG2 1 
ATOM   337  N N   . PHE A 1 53  ? -28.835 31.667 48.696  1.00 145.48 ?  97  PHE A N   1 
ATOM   338  C CA  . PHE A 1 53  ? -29.909 31.082 49.494  1.00 146.78 ?  97  PHE A CA  1 
ATOM   339  C C   . PHE A 1 53  ? -31.047 32.090 49.539  1.00 147.85 ?  97  PHE A C   1 
ATOM   340  O O   . PHE A 1 53  ? -30.832 33.275 49.317  1.00 148.62 ?  97  PHE A O   1 
ATOM   341  C CB  . PHE A 1 53  ? -29.443 30.846 50.932  1.00 149.25 ?  97  PHE A CB  1 
ATOM   342  C CG  . PHE A 1 53  ? -28.401 29.762 51.095  1.00 148.80 ?  97  PHE A CG  1 
ATOM   343  C CD1 . PHE A 1 53  ? -27.180 29.829 50.430  1.00 147.19 ?  97  PHE A CD1 1 
ATOM   344  C CD2 . PHE A 1 53  ? -28.624 28.706 51.973  1.00 150.05 ?  97  PHE A CD2 1 
ATOM   345  C CE1 . PHE A 1 53  ? -26.220 28.845 50.604  1.00 146.91 ?  97  PHE A CE1 1 
ATOM   346  C CE2 . PHE A 1 53  ? -27.670 27.719 52.156  1.00 149.99 ?  97  PHE A CE2 1 
ATOM   347  C CZ  . PHE A 1 53  ? -26.463 27.790 51.470  1.00 148.49 ?  97  PHE A CZ  1 
ATOM   348  N N   . HIS A 1 54  ? -32.258 31.637 49.837  1.00 166.36 ?  98  HIS A N   1 
ATOM   349  C CA  . HIS A 1 54  ? -33.378 32.564 49.975  1.00 167.55 ?  98  HIS A CA  1 
ATOM   350  C C   . HIS A 1 54  ? -34.376 32.125 51.051  1.00 168.85 ?  98  HIS A C   1 
ATOM   351  O O   . HIS A 1 54  ? -34.586 30.931 51.265  1.00 168.20 ?  98  HIS A O   1 
ATOM   352  C CB  . HIS A 1 54  ? -34.067 32.774 48.624  1.00 165.83 ?  98  HIS A CB  1 
ATOM   353  C CG  . HIS A 1 54  ? -33.211 33.469 47.609  1.00 160.82 ?  98  HIS A CG  1 
ATOM   354  N ND1 . HIS A 1 54  ? -32.283 32.802 46.838  1.00 164.30 ?  98  HIS A ND1 1 
ATOM   355  C CD2 . HIS A 1 54  ? -33.139 34.772 47.239  1.00 152.52 ?  98  HIS A CD2 1 
ATOM   356  C CE1 . HIS A 1 54  ? -31.676 33.663 46.040  1.00 158.28 ?  98  HIS A CE1 1 
ATOM   357  N NE2 . HIS A 1 54  ? -32.177 34.864 46.262  1.00 151.10 ?  98  HIS A NE2 1 
ATOM   358  N N   . VAL A 1 55  ? -34.969 33.102 51.736  1.00 157.86 ?  99  VAL A N   1 
ATOM   359  C CA  . VAL A 1 55  ? -35.954 32.838 52.788  1.00 159.17 ?  99  VAL A CA  1 
ATOM   360  C C   . VAL A 1 55  ? -37.189 32.132 52.234  1.00 158.94 ?  99  VAL A C   1 
ATOM   361  O O   . VAL A 1 55  ? -37.197 30.914 52.058  1.00 159.15 ?  99  VAL A O   1 
ATOM   362  C CB  . VAL A 1 55  ? -36.410 34.143 53.489  1.00 160.84 ?  99  VAL A CB  1 
ATOM   363  C CG1 . VAL A 1 55  ? -37.475 33.851 54.546  1.00 168.03 ?  99  VAL A CG1 1 
ATOM   364  C CG2 . VAL A 1 55  ? -35.222 34.867 54.102  1.00 160.63 ?  99  VAL A CG2 1 
ATOM   365  N N   . GLY A 1 63  ? -31.326 35.958 50.925  1.00 165.36 ?  107 GLY A N   1 
ATOM   366  C CA  . GLY A 1 63  ? -30.702 35.106 51.922  1.00 165.97 ?  107 GLY A CA  1 
ATOM   367  C C   . GLY A 1 63  ? -29.205 35.326 52.050  1.00 166.07 ?  107 GLY A C   1 
ATOM   368  O O   . GLY A 1 63  ? -28.755 36.443 52.306  1.00 166.93 ?  107 GLY A O   1 
ATOM   369  N N   . GLN A 1 64  ? -28.433 34.255 51.872  1.00 158.77 ?  108 GLN A N   1 
ATOM   370  C CA  . GLN A 1 64  ? -26.976 34.309 52.008  1.00 158.64 ?  108 GLN A CA  1 
ATOM   371  C C   . GLN A 1 64  ? -26.270 33.809 50.747  1.00 155.72 ?  108 GLN A C   1 
ATOM   372  O O   . GLN A 1 64  ? -26.778 32.938 50.040  1.00 154.06 ?  108 GLN A O   1 
ATOM   373  C CB  . GLN A 1 64  ? -26.508 33.510 53.240  1.00 160.09 ?  108 GLN A CB  1 
ATOM   374  C CG  . GLN A 1 64  ? -26.595 31.983 53.103  1.00 159.09 ?  108 GLN A CG  1 
ATOM   375  C CD  . GLN A 1 64  ? -26.506 31.237 54.439  1.00 161.02 ?  108 GLN A CD  1 
ATOM   376  O OE1 . GLN A 1 64  ? -26.613 31.836 55.510  1.00 162.86 ?  108 GLN A OE1 1 
ATOM   377  N NE2 . GLN A 1 64  ? -26.314 29.920 54.372  1.00 160.39 ?  108 GLN A NE2 1 
ATOM   378  N N   . SER A 1 65  ? -25.103 34.378 50.461  1.00 107.89 ?  109 SER A N   1 
ATOM   379  C CA  . SER A 1 65  ? -24.287 33.943 49.330  1.00 104.46 ?  109 SER A CA  1 
ATOM   380  C C   . SER A 1 65  ? -22.989 33.359 49.844  1.00 104.17 ?  109 SER A C   1 
ATOM   381  O O   . SER A 1 65  ? -22.349 33.943 50.713  1.00 105.50 ?  109 SER A O   1 
ATOM   382  C CB  . SER A 1 65  ? -23.978 35.110 48.397  1.00 102.46 ?  109 SER A CB  1 
ATOM   383  O OG  . SER A 1 65  ? -25.124 35.503 47.668  1.00 102.38 ?  109 SER A OG  1 
ATOM   384  N N   . LYS A 1 66  ? -22.613 32.197 49.328  1.00 106.35 ?  110 LYS A N   1 
ATOM   385  C CA  . LYS A 1 66  ? -21.343 31.589 49.685  1.00 105.84 ?  110 LYS A CA  1 
ATOM   386  C C   . LYS A 1 66  ? -20.450 31.587 48.455  1.00 102.30 ?  110 LYS A C   1 
ATOM   387  O O   . LYS A 1 66  ? -20.929 31.381 47.337  1.00 100.75 ?  110 LYS A O   1 
ATOM   388  C CB  . LYS A 1 66  ? -21.555 30.162 50.171  1.00 107.08 ?  110 LYS A CB  1 
ATOM   389  C CG  . LYS A 1 66  ? -22.632 30.024 51.226  1.00 110.18 ?  110 LYS A CG  1 
ATOM   390  C CD  . LYS A 1 66  ? -22.326 30.845 52.475  1.00 112.84 ?  110 LYS A CD  1 
ATOM   391  C CE  . LYS A 1 66  ? -21.030 30.399 53.140  1.00 113.22 ?  110 LYS A CE  1 
ATOM   392  N NZ  . LYS A 1 66  ? -20.749 31.166 54.403  1.00 116.04 ?  110 LYS A NZ  1 
ATOM   393  N N   . LEU A 1 67  ? -19.158 31.818 48.653  1.00 101.55 ?  111 LEU A N   1 
ATOM   394  C CA  . LEU A 1 67  ? -18.227 31.858 47.530  1.00 97.57  ?  111 LEU A CA  1 
ATOM   395  C C   . LEU A 1 67  ? -16.978 31.030 47.815  1.00 96.32  ?  111 LEU A C   1 
ATOM   396  O O   . LEU A 1 67  ? -16.306 31.234 48.829  1.00 97.41  ?  111 LEU A O   1 
ATOM   397  C CB  . LEU A 1 67  ? -17.850 33.302 47.224  1.00 95.49  ?  111 LEU A CB  1 
ATOM   398  C CG  . LEU A 1 67  ? -16.883 33.512 46.061  1.00 90.45  ?  111 LEU A CG  1 
ATOM   399  C CD1 . LEU A 1 67  ? -17.488 33.004 44.763  1.00 88.83  ?  111 LEU A CD1 1 
ATOM   400  C CD2 . LEU A 1 67  ? -16.493 34.987 45.945  1.00 88.67  ?  111 LEU A CD2 1 
ATOM   401  N N   . TYR A 1 68  ? -16.673 30.087 46.930  1.00 98.45  ?  112 TYR A N   1 
ATOM   402  C CA  . TYR A 1 68  ? -15.550 29.182 47.149  1.00 97.43  ?  112 TYR A CA  1 
ATOM   403  C C   . TYR A 1 68  ? -14.522 29.335 46.024  1.00 92.42  ?  112 TYR A C   1 
ATOM   404  O O   . TYR A 1 68  ? -14.885 29.656 44.899  1.00 89.81  ?  112 TYR A O   1 
ATOM   405  C CB  . TYR A 1 68  ? -16.036 27.730 47.219  1.00 99.59  ?  112 TYR A CB  1 
ATOM   406  C CG  . TYR A 1 68  ? -17.153 27.461 48.212  1.00 103.72 ?  112 TYR A CG  1 
ATOM   407  C CD1 . TYR A 1 68  ? -18.483 27.747 47.899  1.00 104.83 ?  112 TYR A CD1 1 
ATOM   408  C CD2 . TYR A 1 68  ? -16.888 26.887 49.445  1.00 106.24 ?  112 TYR A CD2 1 
ATOM   409  C CE1 . TYR A 1 68  ? -19.502 27.491 48.802  1.00 107.75 ?  112 TYR A CE1 1 
ATOM   410  C CE2 . TYR A 1 68  ? -17.896 26.624 50.342  1.00 109.48 ?  112 TYR A CE2 1 
ATOM   411  C CZ  . TYR A 1 68  ? -19.198 26.928 50.023  1.00 110.04 ?  112 TYR A CZ  1 
ATOM   412  O OH  . TYR A 1 68  ? -20.200 26.662 50.933  1.00 112.82 ?  112 TYR A OH  1 
ATOM   413  N N   . ARG A 1 69  ? -13.249 29.086 46.322  1.00 107.44 ?  113 ARG A N   1 
ATOM   414  C CA  . ARG A 1 69  ? -12.194 29.187 45.317  1.00 102.93 ?  113 ARG A CA  1 
ATOM   415  C C   . ARG A 1 69  ? -11.218 28.016 45.392  1.00 103.03 ?  113 ARG A C   1 
ATOM   416  O O   . ARG A 1 69  ? -10.871 27.569 46.482  1.00 106.11 ?  113 ARG A O   1 
ATOM   417  C CB  . ARG A 1 69  ? -11.438 30.500 45.494  1.00 101.46 ?  113 ARG A CB  1 
ATOM   418  C CG  . ARG A 1 69  ? -10.330 30.738 44.496  1.00 97.88  ?  113 ARG A CG  1 
ATOM   419  C CD  . ARG A 1 69  ? -9.698  32.075 44.781  1.00 98.30  ?  113 ARG A CD  1 
ATOM   420  N NE  . ARG A 1 69  ? -8.608  32.399 43.863  1.00 97.50  ?  113 ARG A NE  1 
ATOM   421  C CZ  . ARG A 1 69  ? -7.352  32.009 44.048  1.00 95.13  ?  113 ARG A CZ  1 
ATOM   422  N NH1 . ARG A 1 69  ? -7.045  31.285 45.118  1.00 92.90  ?  113 ARG A NH1 1 
ATOM   423  N NH2 . ARG A 1 69  ? -6.405  32.335 43.175  1.00 95.56  ?  113 ARG A NH2 1 
ATOM   424  N N   . SER A 1 70  ? -10.777 27.535 44.229  1.00 94.70  ?  114 SER A N   1 
ATOM   425  C CA  . SER A 1 70  ? -9.802  26.446 44.125  1.00 94.98  ?  114 SER A CA  1 
ATOM   426  C C   . SER A 1 70  ? -8.683  26.797 43.149  1.00 91.87  ?  114 SER A C   1 
ATOM   427  O O   . SER A 1 70  ? -8.965  27.206 42.034  1.00 89.00  ?  114 SER A O   1 
ATOM   428  C CB  . SER A 1 70  ? -10.485 25.179 43.616  1.00 95.92  ?  114 SER A CB  1 
ATOM   429  O OG  . SER A 1 70  ? -9.525  24.178 43.299  1.00 96.00  ?  114 SER A OG  1 
ATOM   430  N N   . GLU A 1 71  ? -7.424  26.629 43.554  1.00 106.28 ?  115 GLU A N   1 
ATOM   431  C CA  . GLU A 1 71  ? -6.281  26.798 42.648  1.00 104.91 ?  115 GLU A CA  1 
ATOM   432  C C   . GLU A 1 71  ? -5.788  25.466 42.086  1.00 106.01 ?  115 GLU A C   1 
ATOM   433  O O   . GLU A 1 71  ? -4.837  25.434 41.317  1.00 106.13 ?  115 GLU A O   1 
ATOM   434  C CB  . GLU A 1 71  ? -5.095  27.465 43.363  1.00 106.37 ?  115 GLU A CB  1 
ATOM   435  C CG  . GLU A 1 71  ? -5.283  28.915 43.796  1.00 106.30 ?  115 GLU A CG  1 
ATOM   436  C CD  . GLU A 1 71  ? -4.076  29.475 44.566  1.00 108.33 ?  115 GLU A CD  1 
ATOM   437  O OE1 . GLU A 1 71  ? -3.152  28.710 44.945  1.00 110.70 ?  115 GLU A OE1 1 
ATOM   438  O OE2 . GLU A 1 71  ? -4.053  30.701 44.798  1.00 107.87 ?  115 GLU A OE2 1 
ATOM   439  N N   . ASP A 1 72  ? -6.392  24.369 42.528  1.00 103.75 ?  116 ASP A N   1 
ATOM   440  C CA  . ASP A 1 72  ? -6.007  23.009 42.120  1.00 105.34 ?  116 ASP A CA  1 
ATOM   441  C C   . ASP A 1 72  ? -6.822  22.335 41.012  1.00 104.67 ?  116 ASP A C   1 
ATOM   442  O O   . ASP A 1 72  ? -6.729  21.120 40.860  1.00 106.69 ?  116 ASP A O   1 
ATOM   443  C CB  . ASP A 1 72  ? -5.876  22.058 43.311  1.00 108.19 ?  116 ASP A CB  1 
ATOM   444  C CG  . ASP A 1 72  ? -7.181  21.826 44.009  1.00 110.14 ?  116 ASP A CG  1 
ATOM   445  O OD1 . ASP A 1 72  ? -8.228  22.266 43.471  1.00 109.63 ?  116 ASP A OD1 1 
ATOM   446  O OD2 . ASP A 1 72  ? -7.152  21.209 45.101  1.00 112.63 ?  116 ASP A OD2 1 
ATOM   447  N N   . TYR A 1 73  ? -7.656  23.094 40.306  1.00 92.06  ?  117 TYR A N   1 
ATOM   448  C CA  . TYR A 1 73  ? -8.654  22.543 39.370  1.00 91.54  ?  117 TYR A CA  1 
ATOM   449  C C   . TYR A 1 73  ? -9.814  21.826 40.062  1.00 93.65  ?  117 TYR A C   1 
ATOM   450  O O   . TYR A 1 73  ? -10.342 20.868 39.522  1.00 94.93  ?  117 TYR A O   1 
ATOM   451  C CB  . TYR A 1 73  ? -8.006  21.557 38.369  1.00 93.05  ?  117 TYR A CB  1 
ATOM   452  C CG  . TYR A 1 73  ? -7.194  22.195 37.261  1.00 92.38  ?  117 TYR A CG  1 
ATOM   453  C CD1 . TYR A 1 73  ? -6.084  22.993 37.535  1.00 95.98  ?  117 TYR A CD1 1 
ATOM   454  C CD2 . TYR A 1 73  ? -7.545  22.003 35.933  1.00 89.09  ?  117 TYR A CD2 1 
ATOM   455  C CE1 . TYR A 1 73  ? -5.345  23.587 36.497  1.00 97.04  ?  117 TYR A CE1 1 
ATOM   456  C CE2 . TYR A 1 73  ? -6.827  22.589 34.899  1.00 89.71  ?  117 TYR A CE2 1 
ATOM   457  C CZ  . TYR A 1 73  ? -5.731  23.382 35.177  1.00 94.03  ?  117 TYR A CZ  1 
ATOM   458  O OH  . TYR A 1 73  ? -5.058  23.945 34.103  1.00 96.16  ?  117 TYR A OH  1 
ATOM   459  N N   . GLY A 1 74  ? -10.232 22.294 41.235  1.00 79.60  ?  118 GLY A N   1 
ATOM   460  C CA  . GLY A 1 74  ? -11.312 21.640 41.952  1.00 83.04  ?  118 GLY A CA  1 
ATOM   461  C C   . GLY A 1 74  ? -10.951 20.524 42.934  1.00 86.49  ?  118 GLY A C   1 
ATOM   462  O O   . GLY A 1 74  ? -11.843 19.888 43.502  1.00 89.57  ?  118 GLY A O   1 
ATOM   463  N N   . LYS A 1 75  ? -9.667  20.267 43.155  1.00 92.36  ?  119 LYS A N   1 
ATOM   464  C CA  . LYS A 1 75  ? -9.316  19.240 44.121  1.00 95.44  ?  119 LYS A CA  1 
ATOM   465  C C   . LYS A 1 75  ? -9.579  19.724 45.536  1.00 97.45  ?  119 LYS A C   1 
ATOM   466  O O   . LYS A 1 75  ? -9.967  18.939 46.398  1.00 100.56 ?  119 LYS A O   1 
ATOM   467  C CB  . LYS A 1 75  ? -7.861  18.812 43.978  1.00 95.25  ?  119 LYS A CB  1 
ATOM   468  C CG  . LYS A 1 75  ? -7.537  18.154 42.655  1.00 94.50  ?  119 LYS A CG  1 
ATOM   469  C CD  . LYS A 1 75  ? -6.045  17.900 42.569  1.00 95.15  ?  119 LYS A CD  1 
ATOM   470  C CE  . LYS A 1 75  ? -5.696  17.114 41.337  1.00 95.72  ?  119 LYS A CE  1 
ATOM   471  N NZ  . LYS A 1 75  ? -4.248  17.173 41.068  1.00 96.69  ?  119 LYS A NZ  1 
ATOM   472  N N   . ASN A 1 76  ? -9.363  21.013 45.777  1.00 100.23 ?  120 ASN A N   1 
ATOM   473  C CA  . ASN A 1 76  ? -9.674  21.610 47.078  1.00 102.40 ?  120 ASN A CA  1 
ATOM   474  C C   . ASN A 1 76  ? -10.221 23.007 46.905  1.00 100.74 ?  120 ASN A C   1 
ATOM   475  O O   . ASN A 1 76  ? -9.742  23.749 46.054  1.00 97.38  ?  120 ASN A O   1 
ATOM   476  C CB  . ASN A 1 76  ? -8.436  21.683 47.972  1.00 103.45 ?  120 ASN A CB  1 
ATOM   477  C CG  . ASN A 1 76  ? -7.792  20.338 48.170  1.00 105.19 ?  120 ASN A CG  1 
ATOM   478  O OD1 . ASN A 1 76  ? -8.273  19.522 48.960  1.00 108.11 ?  120 ASN A OD1 1 
ATOM   479  N ND2 . ASN A 1 76  ? -6.706  20.086 47.443  1.00 103.65 ?  120 ASN A ND2 1 
ATOM   480  N N   . PHE A 1 77  ? -11.225 23.370 47.701  1.00 97.18  ?  121 PHE A N   1 
ATOM   481  C CA  . PHE A 1 77  ? -11.690 24.753 47.701  1.00 96.24  ?  121 PHE A CA  1 
ATOM   482  C C   . PHE A 1 77  ? -11.450 25.389 49.061  1.00 98.74  ?  121 PHE A C   1 
ATOM   483  O O   . PHE A 1 77  ? -11.110 24.705 50.012  1.00 101.38 ?  121 PHE A O   1 
ATOM   484  C CB  . PHE A 1 77  ? -13.184 24.830 47.362  1.00 97.40  ?  121 PHE A CB  1 
ATOM   485  C CG  . PHE A 1 77  ? -13.501 24.608 45.913  1.00 94.79  ?  121 PHE A CG  1 
ATOM   486  C CD1 . PHE A 1 77  ? -13.429 23.341 45.358  1.00 94.96  ?  121 PHE A CD1 1 
ATOM   487  C CD2 . PHE A 1 77  ? -13.903 25.664 45.115  1.00 92.38  ?  121 PHE A CD2 1 
ATOM   488  C CE1 . PHE A 1 77  ? -13.736 23.129 44.027  1.00 92.86  ?  121 PHE A CE1 1 
ATOM   489  C CE2 . PHE A 1 77  ? -14.213 25.469 43.782  1.00 89.90  ?  121 PHE A CE2 1 
ATOM   490  C CZ  . PHE A 1 77  ? -14.129 24.195 43.235  1.00 90.17  ?  121 PHE A CZ  1 
ATOM   491  N N   . LYS A 1 78  ? -11.685 26.691 49.152  1.00 110.91 ?  122 LYS A N   1 
ATOM   492  C CA  . LYS A 1 78  ? -11.574 27.420 50.402  1.00 113.60 ?  122 LYS A CA  1 
ATOM   493  C C   . LYS A 1 78  ? -12.666 28.477 50.424  1.00 114.26 ?  122 LYS A C   1 
ATOM   494  O O   . LYS A 1 78  ? -12.867 29.175 49.435  1.00 111.39 ?  122 LYS A O   1 
ATOM   495  C CB  . LYS A 1 78  ? -10.191 28.067 50.537  1.00 112.26 ?  122 LYS A CB  1 
ATOM   496  C CG  . LYS A 1 78  ? -9.199  27.274 51.398  1.00 114.48 ?  122 LYS A CG  1 
ATOM   497  C CD  . LYS A 1 78  ? -8.513  26.130 50.622  1.00 112.51 ?  122 LYS A CD  1 
ATOM   498  C CE  . LYS A 1 78  ? -7.866  25.095 51.572  1.00 115.59 ?  122 LYS A CE  1 
ATOM   499  N NZ  . LYS A 1 78  ? -7.303  23.901 50.857  1.00 114.16 ?  122 LYS A NZ  1 
ATOM   500  N N   . ASP A 1 79  ? -13.370 28.608 51.548  1.00 108.61 ?  123 ASP A N   1 
ATOM   501  C CA  . ASP A 1 79  ? -14.497 29.532 51.595  1.00 109.74 ?  123 ASP A CA  1 
ATOM   502  C C   . ASP A 1 79  ? -13.989 30.956 51.780  1.00 109.08 ?  123 ASP A C   1 
ATOM   503  O O   . ASP A 1 79  ? -13.526 31.335 52.858  1.00 111.58 ?  123 ASP A O   1 
ATOM   504  C CB  . ASP A 1 79  ? -15.429 29.143 52.746  1.00 114.16 ?  123 ASP A CB  1 
ATOM   505  C CG  . ASP A 1 79  ? -16.526 30.163 53.000  1.00 115.83 ?  123 ASP A CG  1 
ATOM   506  O OD1 . ASP A 1 79  ? -16.739 31.069 52.174  1.00 113.70 ?  123 ASP A OD1 1 
ATOM   507  O OD2 . ASP A 1 79  ? -17.201 30.042 54.040  1.00 119.34 ?  123 ASP A OD2 1 
ATOM   508  N N   . ILE A 1 80  ? -14.155 31.737 50.716  1.00 99.16  ?  124 ILE A N   1 
ATOM   509  C CA  . ILE A 1 80  ? -13.793 33.151 50.634  1.00 98.02  ?  124 ILE A CA  1 
ATOM   510  C C   . ILE A 1 80  ? -14.962 34.137 50.809  1.00 99.85  ?  124 ILE A C   1 
ATOM   511  O O   . ILE A 1 80  ? -14.842 35.310 50.468  1.00 98.46  ?  124 ILE A O   1 
ATOM   512  C CB  . ILE A 1 80  ? -12.950 33.463 49.382  1.00 93.06  ?  124 ILE A CB  1 
ATOM   513  C CG1 . ILE A 1 80  ? -13.750 33.209 48.105  1.00 90.37  ?  124 ILE A CG1 1 
ATOM   514  C CG2 . ILE A 1 80  ? -11.671 32.642 49.396  1.00 92.56  ?  124 ILE A CG2 1 
ATOM   515  C CD1 . ILE A 1 80  ? -12.985 33.545 46.872  1.00 85.37  ?  124 ILE A CD1 1 
ATOM   516  N N   . THR A 1 81  ? -16.112 33.637 51.251  1.00 114.67 ?  125 THR A N   1 
ATOM   517  C CA  . THR A 1 81  ? -17.275 34.484 51.531  1.00 116.99 ?  125 THR A CA  1 
ATOM   518  C C   . THR A 1 81  ? -16.930 35.691 52.411  1.00 118.93 ?  125 THR A C   1 
ATOM   519  O O   . THR A 1 81  ? -17.596 36.727 52.346  1.00 119.64 ?  125 THR A O   1 
ATOM   520  C CB  . THR A 1 81  ? -18.380 33.694 52.257  1.00 120.61 ?  125 THR A CB  1 
ATOM   521  O OG1 . THR A 1 81  ? -18.516 32.397 51.666  1.00 119.44 ?  125 THR A OG1 1 
ATOM   522  C CG2 . THR A 1 81  ? -19.702 34.425 52.175  1.00 122.10 ?  125 THR A CG2 1 
ATOM   523  N N   . ASP A 1 82  ? -15.893 35.555 53.235  1.00 141.39 ?  126 ASP A N   1 
ATOM   524  C CA  . ASP A 1 82  ? -15.487 36.637 54.125  1.00 143.76 ?  126 ASP A CA  1 
ATOM   525  C C   . ASP A 1 82  ? -14.911 37.820 53.350  1.00 140.75 ?  126 ASP A C   1 
ATOM   526  O O   . ASP A 1 82  ? -14.838 38.934 53.866  1.00 142.46 ?  126 ASP A O   1 
ATOM   527  C CB  . ASP A 1 82  ? -14.494 36.142 55.179  1.00 145.98 ?  126 ASP A CB  1 
ATOM   528  C CG  . ASP A 1 82  ? -14.777 36.723 56.557  1.00 149.50 ?  126 ASP A CG  1 
ATOM   529  O OD1 . ASP A 1 82  ? -15.932 37.143 56.778  1.00 150.83 ?  126 ASP A OD1 1 
ATOM   530  O OD2 . ASP A 1 82  ? -13.864 36.760 57.418  1.00 150.49 ?  126 ASP A OD2 1 
ATOM   531  N N   . LEU A 1 83  ? -14.515 37.568 52.106  1.00 126.98 ?  127 LEU A N   1 
ATOM   532  C CA  . LEU A 1 83  ? -13.971 38.605 51.238  1.00 123.79 ?  127 LEU A CA  1 
ATOM   533  C C   . LEU A 1 83  ? -15.058 39.502 50.656  1.00 123.53 ?  127 LEU A C   1 
ATOM   534  O O   . LEU A 1 83  ? -14.795 40.646 50.294  1.00 122.49 ?  127 LEU A O   1 
ATOM   535  C CB  . LEU A 1 83  ? -13.172 37.983 50.090  1.00 119.06 ?  127 LEU A CB  1 
ATOM   536  C CG  . LEU A 1 83  ? -11.986 37.086 50.449  1.00 118.96 ?  127 LEU A CG  1 
ATOM   537  C CD1 . LEU A 1 83  ? -11.204 36.715 49.197  1.00 114.23 ?  127 LEU A CD1 1 
ATOM   538  C CD2 . LEU A 1 83  ? -11.083 37.762 51.453  1.00 121.66 ?  127 LEU A CD2 1 
ATOM   539  N N   . ILE A 1 84  ? -16.270 38.975 50.531  1.00 128.32 ?  128 ILE A N   1 
ATOM   540  C CA  . ILE A 1 84  ? -17.389 39.775 50.037  1.00 128.67 ?  128 ILE A CA  1 
ATOM   541  C C   . ILE A 1 84  ? -18.203 40.387 51.158  1.00 133.16 ?  128 ILE A C   1 
ATOM   542  O O   . ILE A 1 84  ? -19.301 40.890 50.922  1.00 134.22 ?  128 ILE A O   1 
ATOM   543  C CB  . ILE A 1 84  ? -18.310 39.017 49.085  1.00 127.46 ?  128 ILE A CB  1 
ATOM   544  C CG1 . ILE A 1 84  ? -18.816 37.735 49.742  1.00 130.08 ?  128 ILE A CG1 1 
ATOM   545  C CG2 . ILE A 1 84  ? -17.600 38.749 47.762  1.00 122.59 ?  128 ILE A CG2 1 
ATOM   546  C CD1 . ILE A 1 84  ? -19.642 36.863 48.812  1.00 129.22 ?  128 ILE A CD1 1 
ATOM   547  N N   . ASN A 1 85  ? -17.684 40.276 52.378  1.00 136.82 ?  129 ASN A N   1 
ATOM   548  C CA  . ASN A 1 85  ? -18.353 40.786 53.569  1.00 141.08 ?  129 ASN A CA  1 
ATOM   549  C C   . ASN A 1 85  ? -19.677 40.068 53.798  1.00 143.24 ?  129 ASN A C   1 
ATOM   550  O O   . ASN A 1 85  ? -20.645 40.668 54.264  1.00 145.14 ?  129 ASN A O   1 
ATOM   551  C CB  . ASN A 1 85  ? -18.542 42.313 53.512  1.00 141.28 ?  129 ASN A CB  1 
ATOM   552  C CG  . ASN A 1 85  ? -17.310 43.082 53.997  1.00 141.18 ?  129 ASN A CG  1 
ATOM   553  O OD1 . ASN A 1 85  ? -16.174 42.674 53.754  1.00 139.19 ?  129 ASN A OD1 1 
ATOM   554  N ND2 . ASN A 1 85  ? -17.536 44.193 54.696  1.00 143.35 ?  129 ASN A ND2 1 
ATOM   555  N N   . ASN A 1 86  ? -19.699 38.781 53.445  1.00 134.71 ?  130 ASN A N   1 
ATOM   556  C CA  . ASN A 1 86  ? -20.877 37.929 53.598  1.00 136.74 ?  130 ASN A CA  1 
ATOM   557  C C   . ASN A 1 86  ? -22.162 38.617 53.120  1.00 137.17 ?  130 ASN A C   1 
ATOM   558  O O   . ASN A 1 86  ? -23.205 38.508 53.762  1.00 139.39 ?  130 ASN A O   1 
ATOM   559  C CB  . ASN A 1 86  ? -21.033 37.447 55.055  1.00 139.66 ?  130 ASN A CB  1 
ATOM   560  C CG  . ASN A 1 86  ? -20.034 36.348 55.439  1.00 139.49 ?  130 ASN A CG  1 
ATOM   561  O OD1 . ASN A 1 86  ? -20.307 35.155 55.286  1.00 139.42 ?  130 ASN A OD1 1 
ATOM   562  N ND2 . ASN A 1 86  ? -18.885 36.752 55.967  1.00 139.31 ?  130 ASN A ND2 1 
ATOM   563  N N   . THR A 1 87  ? -22.084 39.347 52.011  1.00 128.27 ?  131 THR A N   1 
ATOM   564  C CA  . THR A 1 87  ? -23.263 40.045 51.511  1.00 128.78 ?  131 THR A CA  1 
ATOM   565  C C   . THR A 1 87  ? -23.927 39.208 50.443  1.00 127.11 ?  131 THR A C   1 
ATOM   566  O O   . THR A 1 87  ? -23.436 38.140 50.089  1.00 125.35 ?  131 THR A O   1 
ATOM   567  C CB  . THR A 1 87  ? -22.939 41.437 50.941  1.00 126.94 ?  131 THR A CB  1 
ATOM   568  O OG1 . THR A 1 87  ? -22.190 41.301 49.729  1.00 122.86 ?  131 THR A OG1 1 
ATOM   569  C CG2 . THR A 1 87  ? -22.157 42.270 51.959  1.00 128.25 ?  131 THR A CG2 1 
ATOM   570  N N   . PHE A 1 88  ? -25.041 39.700 49.921  1.00 122.52 ?  132 PHE A N   1 
ATOM   571  C CA  . PHE A 1 88  ? -25.855 38.894 49.029  1.00 121.56 ?  132 PHE A CA  1 
ATOM   572  C C   . PHE A 1 88  ? -25.618 39.222 47.556  1.00 118.23 ?  132 PHE A C   1 
ATOM   573  O O   . PHE A 1 88  ? -25.860 40.342 47.110  1.00 118.09 ?  132 PHE A O   1 
ATOM   574  C CB  . PHE A 1 88  ? -27.332 39.034 49.389  1.00 124.67 ?  132 PHE A CB  1 
ATOM   575  C CG  . PHE A 1 88  ? -28.205 37.991 48.762  1.00 123.74 ?  132 PHE A CG  1 
ATOM   576  C CD1 . PHE A 1 88  ? -28.068 36.661 49.112  1.00 123.13 ?  132 PHE A CD1 1 
ATOM   577  C CD2 . PHE A 1 88  ? -29.162 38.337 47.820  1.00 123.26 ?  132 PHE A CD2 1 
ATOM   578  C CE1 . PHE A 1 88  ? -28.867 35.694 48.535  1.00 121.71 ?  132 PHE A CE1 1 
ATOM   579  C CE2 . PHE A 1 88  ? -29.969 37.374 47.242  1.00 121.91 ?  132 PHE A CE2 1 
ATOM   580  C CZ  . PHE A 1 88  ? -29.821 36.051 47.600  1.00 120.94 ?  132 PHE A CZ  1 
ATOM   581  N N   . ILE A 1 89  ? -25.141 38.230 46.811  1.00 113.93 ?  133 ILE A N   1 
ATOM   582  C CA  . ILE A 1 89  ? -24.854 38.397 45.392  1.00 111.03 ?  133 ILE A CA  1 
ATOM   583  C C   . ILE A 1 89  ? -26.054 38.028 44.531  1.00 111.00 ?  133 ILE A C   1 
ATOM   584  O O   . ILE A 1 89  ? -26.673 36.982 44.728  1.00 111.38 ?  133 ILE A O   1 
ATOM   585  C CB  . ILE A 1 89  ? -23.660 37.538 44.958  1.00 108.46 ?  133 ILE A CB  1 
ATOM   586  C CG1 . ILE A 1 89  ? -22.452 37.860 45.820  1.00 108.01 ?  133 ILE A CG1 1 
ATOM   587  C CG2 . ILE A 1 89  ? -23.323 37.803 43.505  1.00 105.80 ?  133 ILE A CG2 1 
ATOM   588  C CD1 . ILE A 1 89  ? -22.065 39.310 45.749  1.00 107.03 ?  133 ILE A CD1 1 
ATOM   589  N N   . ARG A 1 90  ? -26.375 38.901 43.582  1.00 117.59 ?  134 ARG A N   1 
ATOM   590  C CA  . ARG A 1 90  ? -27.477 38.675 42.664  1.00 117.37 ?  134 ARG A CA  1 
ATOM   591  C C   . ARG A 1 90  ? -27.024 37.751 41.549  1.00 113.82 ?  134 ARG A C   1 
ATOM   592  O O   . ARG A 1 90  ? -26.079 38.057 40.838  1.00 111.89 ?  134 ARG A O   1 
ATOM   593  C CB  . ARG A 1 90  ? -27.970 40.007 42.093  1.00 118.51 ?  134 ARG A CB  1 
ATOM   594  C CG  . ARG A 1 90  ? -28.780 40.843 43.089  1.00 121.98 ?  134 ARG A CG  1 
ATOM   595  C CD  . ARG A 1 90  ? -29.157 42.226 42.546  1.00 122.99 ?  134 ARG A CD  1 
ATOM   596  N NE  . ARG A 1 90  ? -29.976 42.155 41.335  1.00 123.24 ?  134 ARG A NE  1 
ATOM   597  C CZ  . ARG A 1 90  ? -31.287 41.923 41.328  1.00 125.88 ?  134 ARG A CZ  1 
ATOM   598  N NH1 . ARG A 1 90  ? -31.938 41.729 42.469  1.00 128.36 ?  134 ARG A NH1 1 
ATOM   599  N NH2 . ARG A 1 90  ? -31.945 41.875 40.175  1.00 126.35 ?  134 ARG A NH2 1 
ATOM   600  N N   . THR A 1 91  ? -27.705 36.623 41.394  1.00 119.01 ?  135 THR A N   1 
ATOM   601  C CA  . THR A 1 91  ? -27.269 35.600 40.453  1.00 114.64 ?  135 THR A CA  1 
ATOM   602  C C   . THR A 1 91  ? -27.589 35.919 39.000  1.00 111.67 ?  135 THR A C   1 
ATOM   603  O O   . THR A 1 91  ? -26.969 35.366 38.090  1.00 106.97 ?  135 THR A O   1 
ATOM   604  C CB  . THR A 1 91  ? -27.897 34.250 40.772  1.00 113.87 ?  135 THR A CB  1 
ATOM   605  O OG1 . THR A 1 91  ? -28.049 34.120 42.188  1.00 117.51 ?  135 THR A OG1 1 
ATOM   606  C CG2 . THR A 1 91  ? -27.005 33.145 40.252  1.00 109.61 ?  135 THR A CG2 1 
ATOM   607  N N   . GLU A 1 92  ? -28.565 36.796 38.792  1.00 119.11 ?  136 GLU A N   1 
ATOM   608  C CA  . GLU A 1 92  ? -28.976 37.216 37.461  1.00 117.79 ?  136 GLU A CA  1 
ATOM   609  C C   . GLU A 1 92  ? -27.749 37.627 36.672  1.00 114.26 ?  136 GLU A C   1 
ATOM   610  O O   . GLU A 1 92  ? -27.634 37.347 35.482  1.00 110.18 ?  136 GLU A O   1 
ATOM   611  C CB  . GLU A 1 92  ? -29.927 38.414 37.553  1.00 123.07 ?  136 GLU A CB  1 
ATOM   612  C CG  . GLU A 1 92  ? -31.195 38.208 38.395  1.00 126.81 ?  136 GLU A CG  1 
ATOM   613  C CD  . GLU A 1 92  ? -30.965 38.375 39.894  1.00 129.05 ?  136 GLU A CD  1 
ATOM   614  O OE1 . GLU A 1 92  ? -29.868 38.005 40.372  1.00 127.06 ?  136 GLU A OE1 1 
ATOM   615  O OE2 . GLU A 1 92  ? -31.879 38.872 40.595  1.00 132.91 ?  136 GLU A OE2 1 
ATOM   616  N N   . PHE A 1 93  ? -26.834 38.299 37.363  1.00 90.93  ?  137 PHE A N   1 
ATOM   617  C CA  . PHE A 1 93  ? -25.611 38.790 36.769  1.00 87.64  ?  137 PHE A CA  1 
ATOM   618  C C   . PHE A 1 93  ? -24.448 37.812 36.919  1.00 82.74  ?  137 PHE A C   1 
ATOM   619  O O   . PHE A 1 93  ? -23.375 38.016 36.333  1.00 77.55  ?  137 PHE A O   1 
ATOM   620  C CB  . PHE A 1 93  ? -25.245 40.137 37.386  1.00 91.30  ?  137 PHE A CB  1 
ATOM   621  C CG  . PHE A 1 93  ? -26.335 41.171 37.280  1.00 95.76  ?  137 PHE A CG  1 
ATOM   622  C CD1 . PHE A 1 93  ? -26.524 41.890 36.107  1.00 94.75  ?  137 PHE A CD1 1 
ATOM   623  C CD2 . PHE A 1 93  ? -27.165 41.434 38.364  1.00 99.87  ?  137 PHE A CD2 1 
ATOM   624  C CE1 . PHE A 1 93  ? -27.528 42.847 36.019  1.00 99.46  ?  137 PHE A CE1 1 
ATOM   625  C CE2 . PHE A 1 93  ? -28.167 42.388 38.284  1.00 103.00 ?  137 PHE A CE2 1 
ATOM   626  C CZ  . PHE A 1 93  ? -28.347 43.098 37.114  1.00 103.32 ?  137 PHE A CZ  1 
ATOM   627  N N   . GLY A 1 94  ? -24.647 36.767 37.713  1.00 91.34  ?  138 GLY A N   1 
ATOM   628  C CA  . GLY A 1 94  ? -23.623 35.754 37.881  1.00 87.96  ?  138 GLY A CA  1 
ATOM   629  C C   . GLY A 1 94  ? -22.259 36.345 38.207  1.00 86.75  ?  138 GLY A C   1 
ATOM   630  O O   . GLY A 1 94  ? -22.141 37.389 38.867  1.00 90.51  ?  138 GLY A O   1 
ATOM   631  N N   . MET A 1 95  ? -21.223 35.683 37.703  1.00 89.65  ?  139 MET A N   1 
ATOM   632  C CA  . MET A 1 95  ? -19.844 36.098 37.914  1.00 87.12  ?  139 MET A CA  1 
ATOM   633  C C   . MET A 1 95  ? -19.295 36.566 36.582  1.00 81.64  ?  139 MET A C   1 
ATOM   634  O O   . MET A 1 95  ? -19.192 35.788 35.638  1.00 78.31  ?  139 MET A O   1 
ATOM   635  C CB  . MET A 1 95  ? -19.034 34.919 38.432  1.00 86.65  ?  139 MET A CB  1 
ATOM   636  C CG  . MET A 1 95  ? -19.581 34.365 39.732  1.00 93.58  ?  139 MET A CG  1 
ATOM   637  S SD  . MET A 1 95  ? -18.526 33.133 40.516  1.00 94.29  ?  139 MET A SD  1 
ATOM   638  C CE  . MET A 1 95  ? -18.961 31.650 39.610  1.00 92.23  ?  139 MET A CE  1 
ATOM   639  N N   . ALA A 1 96  ? -18.965 37.841 36.472  1.00 81.24  ?  140 ALA A N   1 
ATOM   640  C CA  . ALA A 1 96  ? -18.539 38.329 35.174  1.00 78.02  ?  140 ALA A CA  1 
ATOM   641  C C   . ALA A 1 96  ? -17.017 38.250 35.069  1.00 75.80  ?  140 ALA A C   1 
ATOM   642  O O   . ALA A 1 96  ? -16.299 39.011 35.715  1.00 76.76  ?  140 ALA A O   1 
ATOM   643  C CB  . ALA A 1 96  ? -19.040 39.742 34.955  1.00 80.06  ?  140 ALA A CB  1 
ATOM   644  N N   . ILE A 1 97  ? -16.537 37.331 34.237  1.00 78.16  ?  141 ILE A N   1 
ATOM   645  C CA  . ILE A 1 97  ? -15.109 37.024 34.174  1.00 77.39  ?  141 ILE A CA  1 
ATOM   646  C C   . ILE A 1 97  ? -14.373 37.754 33.044  1.00 77.73  ?  141 ILE A C   1 
ATOM   647  O O   . ILE A 1 97  ? -14.818 37.750 31.896  1.00 78.16  ?  141 ILE A O   1 
ATOM   648  C CB  . ILE A 1 97  ? -14.857 35.498 34.052  1.00 76.63  ?  141 ILE A CB  1 
ATOM   649  C CG1 . ILE A 1 97  ? -15.716 34.720 35.056  1.00 77.34  ?  141 ILE A CG1 1 
ATOM   650  C CG2 . ILE A 1 97  ? -13.362 35.178 34.228  1.00 77.12  ?  141 ILE A CG2 1 
ATOM   651  C CD1 . ILE A 1 97  ? -15.595 35.183 36.488  1.00 79.60  ?  141 ILE A CD1 1 
ATOM   652  N N   . GLY A 1 98  ? -13.246 38.376 33.381  1.00 67.97  ?  142 GLY A N   1 
ATOM   653  C CA  . GLY A 1 98  ? -12.430 39.078 32.403  1.00 69.46  ?  142 GLY A CA  1 
ATOM   654  C C   . GLY A 1 98  ? -11.900 38.121 31.360  1.00 70.67  ?  142 GLY A C   1 
ATOM   655  O O   . GLY A 1 98  ? -11.779 36.922 31.614  1.00 70.10  ?  142 GLY A O   1 
ATOM   656  N N   . PRO A 1 99  ? -11.585 38.641 30.170  1.00 76.33  ?  143 PRO A N   1 
ATOM   657  C CA  . PRO A 1 99  ? -11.117 37.801 29.064  1.00 79.50  ?  143 PRO A CA  1 
ATOM   658  C C   . PRO A 1 99  ? -9.786  37.146 29.389  1.00 80.88  ?  143 PRO A C   1 
ATOM   659  O O   . PRO A 1 99  ? -8.975  37.753 30.093  1.00 80.41  ?  143 PRO A O   1 
ATOM   660  C CB  . PRO A 1 99  ? -10.914 38.811 27.930  1.00 83.04  ?  143 PRO A CB  1 
ATOM   661  C CG  . PRO A 1 99  ? -10.664 40.118 28.625  1.00 81.50  ?  143 PRO A CG  1 
ATOM   662  C CD  . PRO A 1 99  ? -11.557 40.074 29.832  1.00 77.64  ?  143 PRO A CD  1 
ATOM   663  N N   . GLU A 1 100 ? -9.568  35.935 28.888  1.00 98.85  ?  144 GLU A N   1 
ATOM   664  C CA  . GLU A 1 100 ? -8.246  35.312 28.935  1.00 101.87 ?  144 GLU A CA  1 
ATOM   665  C C   . GLU A 1 100 ? -7.665  35.202 30.343  1.00 99.03  ?  144 GLU A C   1 
ATOM   666  O O   . GLU A 1 100 ? -8.350  34.802 31.289  1.00 95.50  ?  144 GLU A O   1 
ATOM   667  C CB  . GLU A 1 100 ? -7.277  36.081 28.031  1.00 106.38 ?  144 GLU A CB  1 
ATOM   668  C CG  . GLU A 1 100 ? -7.585  35.959 26.549  1.00 111.38 ?  144 GLU A CG  1 
ATOM   669  C CD  . GLU A 1 100 ? -6.850  36.978 25.700  1.00 114.64 ?  144 GLU A CD  1 
ATOM   670  O OE1 . GLU A 1 100 ? -7.116  38.188 25.868  1.00 112.29 ?  144 GLU A OE1 1 
ATOM   671  O OE2 . GLU A 1 100 ? -6.013  36.570 24.863  1.00 119.69 ?  144 GLU A OE2 1 
ATOM   672  N N   . ASN A 1 101 ? -6.392  35.563 30.461  1.00 101.23 ?  145 ASN A N   1 
ATOM   673  C CA  . ASN A 1 101 ? -5.661  35.515 31.725  1.00 100.03 ?  145 ASN A CA  1 
ATOM   674  C C   . ASN A 1 101 ? -5.644  36.819 32.534  1.00 98.15  ?  145 ASN A C   1 
ATOM   675  O O   . ASN A 1 101 ? -4.843  36.963 33.457  1.00 98.68  ?  145 ASN A O   1 
ATOM   676  C CB  . ASN A 1 101 ? -4.260  34.925 31.550  1.00 104.24 ?  145 ASN A CB  1 
ATOM   677  C CG  . ASN A 1 101 ? -4.268  33.402 31.563  1.00 105.39 ?  145 ASN A CG  1 
ATOM   678  O OD1 . ASN A 1 101 ? -5.288  32.774 31.287  1.00 103.95 ?  145 ASN A OD1 1 
ATOM   679  N ND2 . ASN A 1 101 ? -3.127  32.805 31.890  1.00 108.29 ?  145 ASN A ND2 1 
ATOM   680  N N   . SER A 1 102 ? -6.469  37.785 32.130  1.00 94.90  ?  146 SER A N   1 
ATOM   681  C CA  . SER A 1 102 ? -6.624  39.061 32.848  1.00 93.76  ?  146 SER A CA  1 
ATOM   682  C C   . SER A 1 102 ? -6.878  38.908 34.343  1.00 91.97  ?  146 SER A C   1 
ATOM   683  O O   . SER A 1 102 ? -6.478  39.750 35.139  1.00 92.77  ?  146 SER A O   1 
ATOM   684  C CB  . SER A 1 102 ? -7.766  39.870 32.243  1.00 92.59  ?  146 SER A CB  1 
ATOM   685  O OG  . SER A 1 102 ? -8.895  39.040 32.019  1.00 90.55  ?  146 SER A OG  1 
ATOM   686  N N   . GLY A 1 103 ? -7.563  37.837 34.712  1.00 94.19  ?  147 GLY A N   1 
ATOM   687  C CA  . GLY A 1 103 ? -7.865  37.578 36.102  1.00 93.51  ?  147 GLY A CA  1 
ATOM   688  C C   . GLY A 1 103 ? -8.997  38.420 36.650  1.00 92.64  ?  147 GLY A C   1 
ATOM   689  O O   . GLY A 1 103 ? -9.255  38.394 37.847  1.00 93.36  ?  147 GLY A O   1 
ATOM   690  N N   . LYS A 1 104 ? -9.679  39.168 35.793  1.00 95.06  ?  148 LYS A N   1 
ATOM   691  C CA  . LYS A 1 104 ? -10.728 40.060 36.271  1.00 95.13  ?  148 LYS A CA  1 
ATOM   692  C C   . LYS A 1 104 ? -12.000 39.284 36.647  1.00 94.32  ?  148 LYS A C   1 
ATOM   693  O O   . LYS A 1 104 ? -12.459 38.410 35.912  1.00 92.86  ?  148 LYS A O   1 
ATOM   694  C CB  . LYS A 1 104 ? -11.017 41.160 35.245  1.00 95.28  ?  148 LYS A CB  1 
ATOM   695  C CG  . LYS A 1 104 ? -9.774  41.885 34.704  1.00 96.87  ?  148 LYS A CG  1 
ATOM   696  C CD  . LYS A 1 104 ? -9.243  42.913 35.686  1.00 98.64  ?  148 LYS A CD  1 
ATOM   697  C CE  . LYS A 1 104 ? -7.865  43.415 35.277  1.00 100.74 ?  148 LYS A CE  1 
ATOM   698  N NZ  . LYS A 1 104 ? -7.908  44.089 33.956  1.00 101.44 ?  148 LYS A NZ  1 
ATOM   699  N N   . VAL A 1 105 ? -12.550 39.594 37.817  1.00 84.64  ?  149 VAL A N   1 
ATOM   700  C CA  . VAL A 1 105 ? -13.754 38.929 38.319  1.00 85.47  ?  149 VAL A CA  1 
ATOM   701  C C   . VAL A 1 105 ? -14.694 39.960 38.943  1.00 88.30  ?  149 VAL A C   1 
ATOM   702  O O   . VAL A 1 105 ? -14.277 40.725 39.806  1.00 90.46  ?  149 VAL A O   1 
ATOM   703  C CB  . VAL A 1 105 ? -13.387 37.877 39.380  1.00 86.87  ?  149 VAL A CB  1 
ATOM   704  C CG1 . VAL A 1 105 ? -14.626 37.362 40.073  1.00 89.61  ?  149 VAL A CG1 1 
ATOM   705  C CG2 . VAL A 1 105 ? -12.585 36.737 38.746  1.00 84.68  ?  149 VAL A CG2 1 
ATOM   706  N N   . VAL A 1 106 ? -15.951 39.998 38.504  1.00 76.60  ?  150 VAL A N   1 
ATOM   707  C CA  . VAL A 1 106 ? -16.896 40.995 39.016  1.00 80.20  ?  150 VAL A CA  1 
ATOM   708  C C   . VAL A 1 106 ? -18.207 40.375 39.453  1.00 83.73  ?  150 VAL A C   1 
ATOM   709  O O   . VAL A 1 106 ? -18.877 39.714 38.661  1.00 82.70  ?  150 VAL A O   1 
ATOM   710  C CB  . VAL A 1 106 ? -17.215 42.087 37.971  1.00 79.26  ?  150 VAL A CB  1 
ATOM   711  C CG1 . VAL A 1 106 ? -18.261 43.050 38.521  1.00 83.51  ?  150 VAL A CG1 1 
ATOM   712  C CG2 . VAL A 1 106 ? -15.956 42.844 37.578  1.00 77.42  ?  150 VAL A CG2 1 
ATOM   713  N N   . LEU A 1 107 ? -18.577 40.597 40.713  1.00 89.32  ?  151 LEU A N   1 
ATOM   714  C CA  . LEU A 1 107 ? -19.855 40.101 41.237  1.00 94.39  ?  151 LEU A CA  1 
ATOM   715  C C   . LEU A 1 107 ? -20.790 41.242 41.597  1.00 98.28  ?  151 LEU A C   1 
ATOM   716  O O   . LEU A 1 107 ? -20.360 42.296 42.059  1.00 98.21  ?  151 LEU A O   1 
ATOM   717  C CB  . LEU A 1 107 ? -19.653 39.202 42.461  1.00 97.17  ?  151 LEU A CB  1 
ATOM   718  C CG  . LEU A 1 107 ? -18.873 37.901 42.270  1.00 94.45  ?  151 LEU A CG  1 
ATOM   719  C CD1 . LEU A 1 107 ? -17.405 38.158 42.443  1.00 90.96  ?  151 LEU A CD1 1 
ATOM   720  C CD2 . LEU A 1 107 ? -19.335 36.828 43.236  1.00 98.94  ?  151 LEU A CD2 1 
ATOM   721  N N   . THR A 1 108 ? -22.078 41.022 41.402  1.00 92.22  ?  152 THR A N   1 
ATOM   722  C CA  . THR A 1 108 ? -23.046 42.073 41.641  1.00 95.32  ?  152 THR A CA  1 
ATOM   723  C C   . THR A 1 108 ? -23.883 41.812 42.901  1.00 99.39  ?  152 THR A C   1 
ATOM   724  O O   . THR A 1 108 ? -24.665 40.862 42.967  1.00 101.11 ?  152 THR A O   1 
ATOM   725  C CB  . THR A 1 108 ? -23.942 42.266 40.412  1.00 95.96  ?  152 THR A CB  1 
ATOM   726  O OG1 . THR A 1 108 ? -23.119 42.446 39.252  1.00 91.06  ?  152 THR A OG1 1 
ATOM   727  C CG2 . THR A 1 108 ? -24.823 43.481 40.588  1.00 98.35  ?  152 THR A CG2 1 
ATOM   728  N N   . ALA A 1 109 ? -23.694 42.657 43.908  1.00 94.74  ?  153 ALA A N   1 
ATOM   729  C CA  . ALA A 1 109 ? -24.431 42.541 45.162  1.00 98.33  ?  153 ALA A CA  1 
ATOM   730  C C   . ALA A 1 109 ? -25.830 43.137 45.068  1.00 100.91 ?  153 ALA A C   1 
ATOM   731  O O   . ALA A 1 109 ? -26.076 44.042 44.274  1.00 100.19 ?  153 ALA A O   1 
ATOM   732  C CB  . ALA A 1 109 ? -23.655 43.206 46.294  1.00 98.95  ?  153 ALA A CB  1 
ATOM   733  N N   . GLU A 1 110 ? -26.742 42.625 45.889  1.00 117.94 ?  154 GLU A N   1 
ATOM   734  C CA  . GLU A 1 110 ? -28.068 43.214 46.001  1.00 120.72 ?  154 GLU A CA  1 
ATOM   735  C C   . GLU A 1 110 ? -28.020 44.357 47.000  1.00 122.36 ?  154 GLU A C   1 
ATOM   736  O O   . GLU A 1 110 ? -27.434 44.234 48.074  1.00 123.11 ?  154 GLU A O   1 
ATOM   737  C CB  . GLU A 1 110 ? -29.119 42.185 46.432  1.00 123.15 ?  154 GLU A CB  1 
ATOM   738  C CG  . GLU A 1 110 ? -30.550 42.667 46.174  1.00 125.24 ?  154 GLU A CG  1 
ATOM   739  C CD  . GLU A 1 110 ? -31.620 41.877 46.916  1.00 127.05 ?  154 GLU A CD  1 
ATOM   740  O OE1 . GLU A 1 110 ? -31.291 40.894 47.617  1.00 127.07 ?  154 GLU A OE1 1 
ATOM   741  O OE2 . GLU A 1 110 ? -32.806 42.256 46.800  1.00 128.12 ?  154 GLU A OE2 1 
ATOM   742  N N   . VAL A 1 111 ? -28.650 45.467 46.641  1.00 98.66  ?  155 VAL A N   1 
ATOM   743  C CA  . VAL A 1 111 ? -28.611 46.672 47.453  1.00 99.61  ?  155 VAL A CA  1 
ATOM   744  C C   . VAL A 1 111 ? -29.999 46.970 48.029  1.00 102.46 ?  155 VAL A C   1 
ATOM   745  O O   . VAL A 1 111 ? -31.014 46.556 47.466  1.00 103.10 ?  155 VAL A O   1 
ATOM   746  C CB  . VAL A 1 111 ? -28.100 47.873 46.616  1.00 97.39  ?  155 VAL A CB  1 
ATOM   747  C CG1 . VAL A 1 111 ? -26.740 47.562 46.036  1.00 94.08  ?  155 VAL A CG1 1 
ATOM   748  C CG2 . VAL A 1 111 ? -29.066 48.202 45.495  1.00 97.41  ?  155 VAL A CG2 1 
ATOM   749  N N   . SER A 1 112 ? -30.033 47.684 49.151  1.00 120.84 ?  156 SER A N   1 
ATOM   750  C CA  . SER A 1 112 ? -31.278 48.122 49.766  1.00 122.74 ?  156 SER A CA  1 
ATOM   751  C C   . SER A 1 112 ? -32.108 48.858 48.726  1.00 122.74 ?  156 SER A C   1 
ATOM   752  O O   . SER A 1 112 ? -31.551 49.444 47.803  1.00 121.22 ?  156 SER A O   1 
ATOM   753  C CB  . SER A 1 112 ? -30.958 49.072 50.906  1.00 123.42 ?  156 SER A CB  1 
ATOM   754  O OG  . SER A 1 112 ? -32.111 49.788 51.290  1.00 124.83 ?  156 SER A OG  1 
ATOM   755  N N   . GLY A 1 113 ? -33.430 48.782 48.843  1.00 132.66 ?  157 GLY A N   1 
ATOM   756  C CA  . GLY A 1 113 ? -34.328 49.392 47.878  1.00 133.25 ?  157 GLY A CA  1 
ATOM   757  C C   . GLY A 1 113 ? -34.018 50.839 47.537  1.00 132.39 ?  157 GLY A C   1 
ATOM   758  O O   . GLY A 1 113 ? -33.968 51.219 46.370  1.00 131.36 ?  157 GLY A O   1 
ATOM   759  N N   . GLY A 1 114 ? -33.781 51.650 48.556  1.00 145.48 ?  158 GLY A N   1 
ATOM   760  C CA  . GLY A 1 114 ? -33.641 53.080 48.352  1.00 144.90 ?  158 GLY A CA  1 
ATOM   761  C C   . GLY A 1 114 ? -32.294 53.586 47.866  1.00 142.53 ?  158 GLY A C   1 
ATOM   762  O O   . GLY A 1 114 ? -32.145 54.779 47.601  1.00 141.77 ?  158 GLY A O   1 
ATOM   763  N N   . SER A 1 115 ? -31.320 52.690 47.741  1.00 124.81 ?  159 SER A N   1 
ATOM   764  C CA  . SER A 1 115 ? -29.954 53.072 47.385  1.00 122.50 ?  159 SER A CA  1 
ATOM   765  C C   . SER A 1 115 ? -29.918 53.873 46.093  1.00 120.73 ?  159 SER A C   1 
ATOM   766  O O   . SER A 1 115 ? -30.741 53.662 45.207  1.00 120.99 ?  159 SER A O   1 
ATOM   767  C CB  . SER A 1 115 ? -29.076 51.829 47.238  1.00 121.27 ?  159 SER A CB  1 
ATOM   768  O OG  . SER A 1 115 ? -29.215 50.982 48.365  1.00 122.86 ?  159 SER A OG  1 
ATOM   769  N N   . ARG A 1 116 ? -28.980 54.810 46.006  1.00 156.17 ?  160 ARG A N   1 
ATOM   770  C CA  . ARG A 1 116 ? -28.842 55.664 44.832  1.00 154.34 ?  160 ARG A CA  1 
ATOM   771  C C   . ARG A 1 116 ? -28.298 54.873 43.650  1.00 152.13 ?  160 ARG A C   1 
ATOM   772  O O   . ARG A 1 116 ? -28.636 55.140 42.499  1.00 151.10 ?  160 ARG A O   1 
ATOM   773  C CB  . ARG A 1 116 ? -27.902 56.833 45.132  1.00 153.69 ?  160 ARG A CB  1 
ATOM   774  C CG  . ARG A 1 116 ? -26.491 56.396 45.519  1.00 152.63 ?  160 ARG A CG  1 
ATOM   775  C CD  . ARG A 1 116 ? -25.535 57.571 45.727  1.00 152.51 ?  160 ARG A CD  1 
ATOM   776  N NE  . ARG A 1 116 ? -25.173 58.244 44.479  1.00 150.16 ?  160 ARG A NE  1 
ATOM   777  C CZ  . ARG A 1 116 ? -24.196 57.853 43.662  1.00 147.76 ?  160 ARG A CZ  1 
ATOM   778  N NH1 . ARG A 1 116 ? -23.471 56.777 43.945  1.00 147.18 ?  160 ARG A NH1 1 
ATOM   779  N NH2 . ARG A 1 116 ? -23.946 58.540 42.554  1.00 145.94 ?  160 ARG A NH2 1 
ATOM   780  N N   . GLY A 1 117 ? -27.449 53.896 43.944  1.00 110.73 ?  161 GLY A N   1 
ATOM   781  C CA  . GLY A 1 117 ? -26.798 53.122 42.911  1.00 108.45 ?  161 GLY A CA  1 
ATOM   782  C C   . GLY A 1 117 ? -26.515 51.702 43.344  1.00 108.23 ?  161 GLY A C   1 
ATOM   783  O O   . GLY A 1 117 ? -26.626 51.362 44.526  1.00 109.85 ?  161 GLY A O   1 
ATOM   784  N N   . GLY A 1 118 ? -26.153 50.866 42.376  1.00 103.65 ?  162 GLY A N   1 
ATOM   785  C CA  . GLY A 1 118 ? -25.930 49.458 42.633  1.00 103.22 ?  162 GLY A CA  1 
ATOM   786  C C   . GLY A 1 118 ? -24.612 49.275 43.345  1.00 101.53 ?  162 GLY A C   1 
ATOM   787  O O   . GLY A 1 118 ? -23.981 50.245 43.759  1.00 101.29 ?  162 GLY A O   1 
ATOM   788  N N   . ARG A 1 119 ? -24.178 48.036 43.495  1.00 112.54 ?  163 ARG A N   1 
ATOM   789  C CA  . ARG A 1 119 ? -22.865 47.819 44.073  1.00 110.89 ?  163 ARG A CA  1 
ATOM   790  C C   . ARG A 1 119 ? -22.214 46.572 43.506  1.00 108.17 ?  163 ARG A C   1 
ATOM   791  O O   . ARG A 1 119 ? -22.894 45.582 43.246  1.00 108.98 ?  163 ARG A O   1 
ATOM   792  C CB  . ARG A 1 119 ? -22.960 47.739 45.594  1.00 114.12 ?  163 ARG A CB  1 
ATOM   793  C CG  . ARG A 1 119 ? -21.634 47.486 46.276  1.00 113.20 ?  163 ARG A CG  1 
ATOM   794  C CD  . ARG A 1 119 ? -21.805 47.438 47.775  1.00 116.89 ?  163 ARG A CD  1 
ATOM   795  N NE  . ARG A 1 119 ? -22.202 48.731 48.319  1.00 119.04 ?  163 ARG A NE  1 
ATOM   796  C CZ  . ARG A 1 119 ? -22.757 48.885 49.513  1.00 122.22 ?  163 ARG A CZ  1 
ATOM   797  N NH1 . ARG A 1 119 ? -22.977 47.819 50.266  1.00 123.73 ?  163 ARG A NH1 1 
ATOM   798  N NH2 . ARG A 1 119 ? -23.093 50.094 49.951  1.00 123.77 ?  163 ARG A NH2 1 
ATOM   799  N N   . ILE A 1 120 ? -20.899 46.628 43.306  1.00 98.02  ?  164 ILE A N   1 
ATOM   800  C CA  . ILE A 1 120 ? -20.149 45.472 42.827  1.00 95.03  ?  164 ILE A CA  1 
ATOM   801  C C   . ILE A 1 120 ? -18.952 45.094 43.704  1.00 94.44  ?  164 ILE A C   1 
ATOM   802  O O   . ILE A 1 120 ? -18.408 45.917 44.445  1.00 95.65  ?  164 ILE A O   1 
ATOM   803  C CB  . ILE A 1 120 ? -19.658 45.684 41.395  1.00 90.86  ?  164 ILE A CB  1 
ATOM   804  C CG1 . ILE A 1 120 ? -18.869 46.994 41.299  1.00 89.92  ?  164 ILE A CG1 1 
ATOM   805  C CG2 . ILE A 1 120 ? -20.837 45.660 40.427  1.00 91.51  ?  164 ILE A CG2 1 
ATOM   806  C CD1 . ILE A 1 120 ? -18.361 47.325 39.897  1.00 86.33  ?  164 ILE A CD1 1 
ATOM   807  N N   . PHE A 1 121 ? -18.567 43.826 43.625  1.00 101.79 ?  165 PHE A N   1 
ATOM   808  C CA  . PHE A 1 121 ? -17.369 43.336 44.289  1.00 100.93 ?  165 PHE A CA  1 
ATOM   809  C C   . PHE A 1 121 ? -16.434 42.868 43.199  1.00 96.11  ?  165 PHE A C   1 
ATOM   810  O O   . PHE A 1 121 ? -16.753 41.936 42.462  1.00 94.20  ?  165 PHE A O   1 
ATOM   811  C CB  . PHE A 1 121 ? -17.698 42.184 45.242  1.00 103.62 ?  165 PHE A CB  1 
ATOM   812  C CG  . PHE A 1 121 ? -18.317 42.628 46.540  1.00 108.34 ?  165 PHE A CG  1 
ATOM   813  C CD1 . PHE A 1 121 ? -19.605 43.132 46.568  1.00 110.93 ?  165 PHE A CD1 1 
ATOM   814  C CD2 . PHE A 1 121 ? -17.611 42.533 47.729  1.00 110.29 ?  165 PHE A CD2 1 
ATOM   815  C CE1 . PHE A 1 121 ? -20.174 43.543 47.755  1.00 114.98 ?  165 PHE A CE1 1 
ATOM   816  C CE2 . PHE A 1 121 ? -18.172 42.942 48.927  1.00 114.58 ?  165 PHE A CE2 1 
ATOM   817  C CZ  . PHE A 1 121 ? -19.454 43.446 48.946  1.00 116.79 ?  165 PHE A CZ  1 
ATOM   818  N N   . ARG A 1 122 ? -15.292 43.532 43.079  1.00 102.48 ?  166 ARG A N   1 
ATOM   819  C CA  . ARG A 1 122 ? -14.387 43.283 41.963  1.00 98.32  ?  166 ARG A CA  1 
ATOM   820  C C   . ARG A 1 122 ? -12.987 42.859 42.395  1.00 97.69  ?  166 ARG A C   1 
ATOM   821  O O   . ARG A 1 122 ? -12.456 43.325 43.407  1.00 100.24 ?  166 ARG A O   1 
ATOM   822  C CB  . ARG A 1 122 ? -14.318 44.511 41.048  1.00 97.33  ?  166 ARG A CB  1 
ATOM   823  C CG  . ARG A 1 122 ? -13.948 45.797 41.755  1.00 99.99  ?  166 ARG A CG  1 
ATOM   824  C CD  . ARG A 1 122 ? -14.339 47.034 40.960  1.00 100.00 ?  166 ARG A CD  1 
ATOM   825  N NE  . ARG A 1 122 ? -13.744 48.218 41.564  1.00 102.44 ?  166 ARG A NE  1 
ATOM   826  C CZ  . ARG A 1 122 ? -12.579 48.732 41.183  1.00 101.87 ?  166 ARG A CZ  1 
ATOM   827  N NH1 . ARG A 1 122 ? -11.906 48.175 40.180  1.00 98.98  ?  166 ARG A NH1 1 
ATOM   828  N NH2 . ARG A 1 122 ? -12.088 49.806 41.792  1.00 104.65 ?  166 ARG A NH2 1 
ATOM   829  N N   . SER A 1 123 ? -12.405 41.965 41.606  1.00 105.84 ?  167 SER A N   1 
ATOM   830  C CA  . SER A 1 123 ? -11.054 41.480 41.830  1.00 105.44 ?  167 SER A CA  1 
ATOM   831  C C   . SER A 1 123 ? -10.315 41.376 40.503  1.00 102.43 ?  167 SER A C   1 
ATOM   832  O O   . SER A 1 123 ? -10.843 40.811 39.549  1.00 100.02 ?  167 SER A O   1 
ATOM   833  C CB  . SER A 1 123 ? -11.099 40.109 42.491  1.00 106.05 ?  167 SER A CB  1 
ATOM   834  O OG  . SER A 1 123 ? -11.703 39.169 41.624  1.00 105.50 ?  167 SER A OG  1 
ATOM   835  N N   . SER A 1 124 ? -9.122  41.960 40.430  1.00 99.70  ?  168 SER A N   1 
ATOM   836  C CA  . SER A 1 124 ? -8.254  41.826 39.261  1.00 98.53  ?  168 SER A CA  1 
ATOM   837  C C   . SER A 1 124 ? -7.166  40.776 39.482  1.00 99.42  ?  168 SER A C   1 
ATOM   838  O O   . SER A 1 124 ? -6.342  40.521 38.609  1.00 99.36  ?  168 SER A O   1 
ATOM   839  C CB  . SER A 1 124 ? -7.625  43.176 38.909  1.00 100.92 ?  168 SER A CB  1 
ATOM   840  O OG  . SER A 1 124 ? -6.829  43.691 39.974  1.00 105.04 ?  168 SER A OG  1 
ATOM   841  N N   . ASP A 1 125 ? -7.159  40.209 40.680  1.00 117.56 ?  169 ASP A N   1 
ATOM   842  C CA  . ASP A 1 125 ? -6.103  39.319 41.157  1.00 119.37 ?  169 ASP A CA  1 
ATOM   843  C C   . ASP A 1 125 ? -6.387  37.824 41.043  1.00 117.18 ?  169 ASP A C   1 
ATOM   844  O O   . ASP A 1 125 ? -5.692  37.019 41.653  1.00 118.93 ?  169 ASP A O   1 
ATOM   845  C CB  . ASP A 1 125 ? -5.651  39.699 42.569  1.00 123.73 ?  169 ASP A CB  1 
ATOM   846  C CG  . ASP A 1 125 ? -6.766  39.606 43.590  1.00 124.26 ?  169 ASP A CG  1 
ATOM   847  O OD1 . ASP A 1 125 ? -7.925  39.320 43.214  1.00 123.24 ?  169 ASP A OD1 1 
ATOM   848  O OD2 . ASP A 1 125 ? -6.478  39.834 44.780  1.00 126.43 ?  169 ASP A OD2 1 
ATOM   849  N N   . PHE A 1 126 ? -7.437  37.483 40.301  1.00 89.84  ?  170 PHE A N   1 
ATOM   850  C CA  . PHE A 1 126 ? -8.056  36.141 40.276  1.00 88.85  ?  170 PHE A CA  1 
ATOM   851  C C   . PHE A 1 126 ? -8.818  35.793 41.557  1.00 90.72  ?  170 PHE A C   1 
ATOM   852  O O   . PHE A 1 126 ? -8.861  34.631 41.958  1.00 91.45  ?  170 PHE A O   1 
ATOM   853  C CB  . PHE A 1 126 ? -7.022  35.033 40.009  1.00 89.39  ?  170 PHE A CB  1 
ATOM   854  C CG  . PHE A 1 126 ? -6.344  35.126 38.675  1.00 88.73  ?  170 PHE A CG  1 
ATOM   855  C CD1 . PHE A 1 126 ? -6.884  34.490 37.563  1.00 83.28  ?  170 PHE A CD1 1 
ATOM   856  C CD2 . PHE A 1 126 ? -5.166  35.830 38.533  1.00 94.44  ?  170 PHE A CD2 1 
ATOM   857  C CE1 . PHE A 1 126 ? -6.256  34.569 36.334  1.00 83.86  ?  170 PHE A CE1 1 
ATOM   858  C CE2 . PHE A 1 126 ? -4.533  35.918 37.317  1.00 95.30  ?  170 PHE A CE2 1 
ATOM   859  C CZ  . PHE A 1 126 ? -5.064  35.290 36.219  1.00 90.17  ?  170 PHE A CZ  1 
ATOM   860  N N   . ALA A 1 127 ? -9.444  36.796 42.166  1.00 123.19 ?  171 ALA A N   1 
ATOM   861  C CA  . ALA A 1 127 ? -10.226 36.624 43.393  1.00 126.31 ?  171 ALA A CA  1 
ATOM   862  C C   . ALA A 1 127 ? -9.403  36.234 44.612  1.00 129.34 ?  171 ALA A C   1 
ATOM   863  O O   . ALA A 1 127 ? -9.868  35.467 45.455  1.00 131.77 ?  171 ALA A O   1 
ATOM   864  C CB  . ALA A 1 127 ? -11.368 35.638 43.187  1.00 126.13 ?  171 ALA A CB  1 
ATOM   865  N N   . LYS A 1 128 ? -8.179  36.747 44.701  1.00 119.69 ?  172 LYS A N   1 
ATOM   866  C CA  . LYS A 1 128 ? -7.428  36.670 45.949  1.00 123.11 ?  172 LYS A CA  1 
ATOM   867  C C   . LYS A 1 128 ? -7.860  37.797 46.882  1.00 125.97 ?  172 LYS A C   1 
ATOM   868  O O   . LYS A 1 128 ? -7.926  37.620 48.095  1.00 129.47 ?  172 LYS A O   1 
ATOM   869  C CB  . LYS A 1 128 ? -5.924  36.703 45.686  1.00 124.29 ?  172 LYS A CB  1 
ATOM   870  C CG  . LYS A 1 128 ? -5.355  35.365 45.237  1.00 123.04 ?  172 LYS A CG  1 
ATOM   871  C CD  . LYS A 1 128 ? -3.916  35.509 44.751  1.00 124.83 ?  172 LYS A CD  1 
ATOM   872  C CE  . LYS A 1 128 ? -3.251  34.154 44.505  1.00 124.53 ?  172 LYS A CE  1 
ATOM   873  N NZ  . LYS A 1 128 ? -3.097  33.339 45.754  1.00 127.50 ?  172 LYS A NZ  1 
ATOM   874  N N   . ASN A 1 129 ? -8.151  38.957 46.303  1.00 107.92 ?  173 ASN A N   1 
ATOM   875  C CA  . ASN A 1 129 ? -8.698  40.092 47.044  1.00 110.69 ?  173 ASN A CA  1 
ATOM   876  C C   . ASN A 1 129 ? -9.743  40.766 46.198  1.00 108.70 ?  173 ASN A C   1 
ATOM   877  O O   . ASN A 1 129 ? -9.621  40.827 44.977  1.00 105.26 ?  173 ASN A O   1 
ATOM   878  C CB  . ASN A 1 129 ? -7.629  41.125 47.369  1.00 114.44 ?  173 ASN A CB  1 
ATOM   879  C CG  . ASN A 1 129 ? -6.417  40.518 47.990  1.00 118.02 ?  173 ASN A CG  1 
ATOM   880  O OD1 . ASN A 1 129 ? -6.273  40.511 49.213  1.00 122.58 ?  173 ASN A OD1 1 
ATOM   881  N ND2 . ASN A 1 129 ? -5.526  39.997 47.156  1.00 116.42 ?  173 ASN A ND2 1 
ATOM   882  N N   . PHE A 1 130 ? -10.766 41.284 46.862  1.00 100.21 ?  174 PHE A N   1 
ATOM   883  C CA  . PHE A 1 130 ? -11.862 41.954 46.194  1.00 99.27  ?  174 PHE A CA  1 
ATOM   884  C C   . PHE A 1 130 ? -11.935 43.364 46.711  1.00 101.86 ?  174 PHE A C   1 
ATOM   885  O O   . PHE A 1 130 ? -11.418 43.671 47.785  1.00 105.05 ?  174 PHE A O   1 
ATOM   886  C CB  . PHE A 1 130 ? -13.169 41.253 46.509  1.00 100.89 ?  174 PHE A CB  1 
ATOM   887  C CG  . PHE A 1 130 ? -13.425 40.064 45.657  1.00 98.08  ?  174 PHE A CG  1 
ATOM   888  C CD1 . PHE A 1 130 ? -14.056 40.208 44.423  1.00 95.31  ?  174 PHE A CD1 1 
ATOM   889  C CD2 . PHE A 1 130 ? -13.047 38.802 46.076  1.00 98.44  ?  174 PHE A CD2 1 
ATOM   890  C CE1 . PHE A 1 130 ? -14.303 39.116 43.621  1.00 92.88  ?  174 PHE A CE1 1 
ATOM   891  C CE2 . PHE A 1 130 ? -13.294 37.700 45.284  1.00 96.11  ?  174 PHE A CE2 1 
ATOM   892  C CZ  . PHE A 1 130 ? -13.928 37.857 44.049  1.00 93.29  ?  174 PHE A CZ  1 
ATOM   893  N N   . VAL A 1 131 ? -12.576 44.227 45.941  1.00 131.50 ?  175 VAL A N   1 
ATOM   894  C CA  . VAL A 1 131 ? -12.854 45.568 46.414  1.00 134.26 ?  175 VAL A CA  1 
ATOM   895  C C   . VAL A 1 131 ? -14.311 45.909 46.117  1.00 134.91 ?  175 VAL A C   1 
ATOM   896  O O   . VAL A 1 131 ? -14.809 45.674 45.017  1.00 132.23 ?  175 VAL A O   1 
ATOM   897  C CB  . VAL A 1 131 ? -11.869 46.612 45.825  1.00 133.26 ?  175 VAL A CB  1 
ATOM   898  C CG1 . VAL A 1 131 ? -12.254 48.024 46.237  1.00 129.12 ?  175 VAL A CG1 1 
ATOM   899  C CG2 . VAL A 1 131 ? -10.440 46.294 46.226  1.00 135.44 ?  175 VAL A CG2 1 
ATOM   900  N N   . GLN A 1 132 ? -14.997 46.419 47.131  1.00 113.98 ?  176 GLN A N   1 
ATOM   901  C CA  . GLN A 1 132 ? -16.374 46.862 47.006  1.00 115.51 ?  176 GLN A CA  1 
ATOM   902  C C   . GLN A 1 132 ? -16.387 48.218 46.317  1.00 114.80 ?  176 GLN A C   1 
ATOM   903  O O   . GLN A 1 132 ? -15.540 49.061 46.585  1.00 115.46 ?  176 GLN A O   1 
ATOM   904  C CB  . GLN A 1 132 ? -16.978 46.964 48.406  1.00 120.16 ?  176 GLN A CB  1 
ATOM   905  C CG  . GLN A 1 132 ? -18.384 47.503 48.492  1.00 122.31 ?  176 GLN A CG  1 
ATOM   906  C CD  . GLN A 1 132 ? -18.866 47.566 49.930  1.00 126.51 ?  176 GLN A CD  1 
ATOM   907  O OE1 . GLN A 1 132 ? -19.815 48.284 50.252  1.00 128.72 ?  176 GLN A OE1 1 
ATOM   908  N NE2 . GLN A 1 132 ? -18.202 46.815 50.809  1.00 127.58 ?  176 GLN A NE2 1 
ATOM   909  N N   . THR A 1 133 ? -17.320 48.422 45.402  1.00 115.43 ?  177 THR A N   1 
ATOM   910  C CA  . THR A 1 133 ? -17.436 49.715 44.752  1.00 115.17 ?  177 THR A CA  1 
ATOM   911  C C   . THR A 1 133 ? -18.893 50.068 44.547  1.00 116.85 ?  177 THR A C   1 
ATOM   912  O O   . THR A 1 133 ? -19.628 49.326 43.901  1.00 115.95 ?  177 THR A O   1 
ATOM   913  C CB  . THR A 1 133 ? -16.728 49.705 43.385  1.00 111.18 ?  177 THR A CB  1 
ATOM   914  O OG1 . THR A 1 133 ? -15.324 49.504 43.579  1.00 110.14 ?  177 THR A OG1 1 
ATOM   915  C CG2 . THR A 1 133 ? -16.950 51.014 42.646  1.00 111.07 ?  177 THR A CG2 1 
ATOM   916  N N   . ASP A 1 134 ? -19.304 51.220 45.058  1.00 123.82 ?  178 ASP A N   1 
ATOM   917  C CA  . ASP A 1 134 ? -20.675 51.666 44.887  1.00 125.46 ?  178 ASP A CA  1 
ATOM   918  C C   . ASP A 1 134 ? -20.824 52.350 43.535  1.00 123.31 ?  178 ASP A C   1 
ATOM   919  O O   . ASP A 1 134 ? -20.075 53.266 43.211  1.00 122.43 ?  178 ASP A O   1 
ATOM   920  C CB  . ASP A 1 134 ? -21.075 52.616 46.015  1.00 128.92 ?  178 ASP A CB  1 
ATOM   921  C CG  . ASP A 1 134 ? -21.092 51.936 47.371  1.00 131.52 ?  178 ASP A CG  1 
ATOM   922  O OD1 . ASP A 1 134 ? -21.932 51.033 47.552  1.00 132.45 ?  178 ASP A OD1 1 
ATOM   923  O OD2 . ASP A 1 134 ? -20.281 52.308 48.254  1.00 132.92 ?  178 ASP A OD2 1 
ATOM   924  N N   . LEU A 1 135 ? -21.788 51.900 42.743  1.00 98.68  ?  179 LEU A N   1 
ATOM   925  C CA  . LEU A 1 135 ? -21.992 52.455 41.412  1.00 96.95  ?  179 LEU A CA  1 
ATOM   926  C C   . LEU A 1 135 ? -22.902 53.667 41.471  1.00 99.18  ?  179 LEU A C   1 
ATOM   927  O O   . LEU A 1 135 ? -23.759 53.757 42.344  1.00 102.02 ?  179 LEU A O   1 
ATOM   928  C CB  . LEU A 1 135 ? -22.612 51.407 40.496  1.00 95.84  ?  179 LEU A CB  1 
ATOM   929  C CG  . LEU A 1 135 ? -21.855 50.084 40.479  1.00 93.60  ?  179 LEU A CG  1 
ATOM   930  C CD1 . LEU A 1 135 ? -22.725 48.990 39.912  1.00 93.92  ?  179 LEU A CD1 1 
ATOM   931  C CD2 . LEU A 1 135 ? -20.582 50.225 39.673  1.00 89.97  ?  179 LEU A CD2 1 
ATOM   932  N N   . PRO A 1 136 ? -22.700 54.615 40.545  1.00 105.84 ?  180 PRO A N   1 
ATOM   933  C CA  . PRO A 1 136 ? -23.587 55.760 40.313  1.00 107.40 ?  180 PRO A CA  1 
ATOM   934  C C   . PRO A 1 136 ? -24.959 55.338 39.785  1.00 108.40 ?  180 PRO A C   1 
ATOM   935  O O   . PRO A 1 136 ? -25.854 56.175 39.705  1.00 109.97 ?  180 PRO A O   1 
ATOM   936  C CB  . PRO A 1 136 ? -22.828 56.595 39.277  1.00 105.47 ?  180 PRO A CB  1 
ATOM   937  C CG  . PRO A 1 136 ? -21.867 55.655 38.657  1.00 102.72 ?  180 PRO A CG  1 
ATOM   938  C CD  . PRO A 1 136 ? -21.482 54.695 39.724  1.00 103.01 ?  180 PRO A CD  1 
ATOM   939  N N   . PHE A 1 137 ? -25.102 54.074 39.391  1.00 98.93  ?  181 PHE A N   1 
ATOM   940  C CA  . PHE A 1 137 ? -26.343 53.586 38.784  1.00 100.35 ?  181 PHE A CA  1 
ATOM   941  C C   . PHE A 1 137 ? -26.749 52.181 39.239  1.00 101.68 ?  181 PHE A C   1 
ATOM   942  O O   . PHE A 1 137 ? -26.068 51.556 40.057  1.00 101.19 ?  181 PHE A O   1 
ATOM   943  C CB  . PHE A 1 137 ? -26.196 53.575 37.264  1.00 98.25  ?  181 PHE A CB  1 
ATOM   944  C CG  . PHE A 1 137 ? -25.053 52.734 36.779  1.00 95.12  ?  181 PHE A CG  1 
ATOM   945  C CD1 . PHE A 1 137 ? -23.771 53.260 36.715  1.00 92.73  ?  181 PHE A CD1 1 
ATOM   946  C CD2 . PHE A 1 137 ? -25.256 51.421 36.399  1.00 94.84  ?  181 PHE A CD2 1 
ATOM   947  C CE1 . PHE A 1 137 ? -22.709 52.496 36.277  1.00 89.79  ?  181 PHE A CE1 1 
ATOM   948  C CE2 . PHE A 1 137 ? -24.201 50.651 35.960  1.00 91.57  ?  181 PHE A CE2 1 
ATOM   949  C CZ  . PHE A 1 137 ? -22.921 51.191 35.900  1.00 88.90  ?  181 PHE A CZ  1 
ATOM   950  N N   . HIS A 1 138 ? -27.860 51.688 38.691  1.00 105.61 ?  182 HIS A N   1 
ATOM   951  C CA  . HIS A 1 138 ? -28.278 50.303 38.905  1.00 107.23 ?  182 HIS A CA  1 
ATOM   952  C C   . HIS A 1 138 ? -28.192 49.513 37.616  1.00 106.13 ?  182 HIS A C   1 
ATOM   953  O O   . HIS A 1 138 ? -28.867 49.819 36.637  1.00 107.29 ?  182 HIS A O   1 
ATOM   954  C CB  . HIS A 1 138 ? -29.694 50.230 39.465  1.00 111.54 ?  182 HIS A CB  1 
ATOM   955  C CG  . HIS A 1 138 ? -29.832 50.840 40.821  1.00 113.02 ?  182 HIS A CG  1 
ATOM   956  N ND1 . HIS A 1 138 ? -28.989 50.526 41.864  1.00 114.93 ?  182 HIS A ND1 1 
ATOM   957  C CD2 . HIS A 1 138 ? -30.715 51.741 41.311  1.00 112.93 ?  182 HIS A CD2 1 
ATOM   958  C CE1 . HIS A 1 138 ? -29.345 51.207 42.938  1.00 116.05 ?  182 HIS A CE1 1 
ATOM   959  N NE2 . HIS A 1 138 ? -30.395 51.948 42.632  1.00 114.93 ?  182 HIS A NE2 1 
ATOM   960  N N   . PRO A 1 139 ? -27.348 48.484 37.613  1.00 90.87  ?  183 PRO A N   1 
ATOM   961  C CA  . PRO A 1 139 ? -27.121 47.709 36.395  1.00 89.38  ?  183 PRO A CA  1 
ATOM   962  C C   . PRO A 1 139 ? -28.370 46.992 35.937  1.00 93.76  ?  183 PRO A C   1 
ATOM   963  O O   . PRO A 1 139 ? -29.053 46.369 36.745  1.00 96.62  ?  183 PRO A O   1 
ATOM   964  C CB  . PRO A 1 139 ? -26.048 46.703 36.811  1.00 86.60  ?  183 PRO A CB  1 
ATOM   965  C CG  . PRO A 1 139 ? -26.157 46.608 38.270  1.00 88.61  ?  183 PRO A CG  1 
ATOM   966  C CD  . PRO A 1 139 ? -26.623 47.936 38.768  1.00 90.04  ?  183 PRO A CD  1 
ATOM   967  N N   . LEU A 1 140 ? -28.687 47.149 34.655  1.00 83.20  ?  184 LEU A N   1 
ATOM   968  C CA  . LEU A 1 140 ? -29.689 46.337 33.973  1.00 87.82  ?  184 LEU A CA  1 
ATOM   969  C C   . LEU A 1 140 ? -29.067 45.032 33.494  1.00 84.02  ?  184 LEU A C   1 
ATOM   970  O O   . LEU A 1 140 ? -29.740 44.014 33.391  1.00 85.43  ?  184 LEU A O   1 
ATOM   971  C CB  . LEU A 1 140 ? -30.301 47.108 32.793  1.00 89.59  ?  184 LEU A CB  1 
ATOM   972  C CG  . LEU A 1 140 ? -31.431 46.429 32.018  1.00 95.10  ?  184 LEU A CG  1 
ATOM   973  C CD1 . LEU A 1 140 ? -32.453 45.820 32.962  1.00 99.38  ?  184 LEU A CD1 1 
ATOM   974  C CD2 . LEU A 1 140 ? -32.084 47.436 31.109  1.00 97.24  ?  184 LEU A CD2 1 
ATOM   975  N N   . THR A 1 141 ? -27.770 45.072 33.213  1.00 84.78  ?  185 THR A N   1 
ATOM   976  C CA  . THR A 1 141 ? -27.093 43.961 32.546  1.00 79.38  ?  185 THR A CA  1 
ATOM   977  C C   . THR A 1 141 ? -25.829 43.554 33.267  1.00 74.57  ?  185 THR A C   1 
ATOM   978  O O   . THR A 1 141 ? -25.393 44.230 34.200  1.00 75.29  ?  185 THR A O   1 
ATOM   979  C CB  . THR A 1 141 ? -26.681 44.311 31.099  1.00 76.23  ?  185 THR A CB  1 
ATOM   980  O OG1 . THR A 1 141 ? -25.724 45.386 31.113  1.00 73.56  ?  185 THR A OG1 1 
ATOM   981  C CG2 . THR A 1 141 ? -27.894 44.714 30.277  1.00 81.30  ?  185 THR A CG2 1 
ATOM   982  N N   . GLN A 1 142 ? -25.257 42.429 32.853  1.00 95.43  ?  186 GLN A N   1 
ATOM   983  C CA  . GLN A 1 142 ? -23.964 42.028 33.363  1.00 90.77  ?  186 GLN A CA  1 
ATOM   984  C C   . GLN A 1 142 ? -22.975 43.006 32.773  1.00 88.13  ?  186 GLN A C   1 
ATOM   985  O O   . GLN A 1 142 ? -23.212 43.569 31.708  1.00 88.67  ?  186 GLN A O   1 
ATOM   986  C CB  . GLN A 1 142 ? -23.644 40.599 32.933  1.00 86.46  ?  186 GLN A CB  1 
ATOM   987  C CG  . GLN A 1 142 ? -22.361 40.009 33.526  1.00 82.61  ?  186 GLN A CG  1 
ATOM   988  C CD  . GLN A 1 142 ? -22.116 38.572 33.069  1.00 78.93  ?  186 GLN A CD  1 
ATOM   989  O OE1 . GLN A 1 142 ? -21.951 38.312 31.872  1.00 77.09  ?  186 GLN A OE1 1 
ATOM   990  N NE2 . GLN A 1 142 ? -22.108 37.634 34.014  1.00 78.96  ?  186 GLN A NE2 1 
ATOM   991  N N   . MET A 1 143 ? -21.874 43.240 33.463  1.00 96.49  ?  187 MET A N   1 
ATOM   992  C CA  . MET A 1 143 ? -20.874 44.144 32.920  1.00 94.68  ?  187 MET A CA  1 
ATOM   993  C C   . MET A 1 143 ? -19.996 43.437 31.907  1.00 91.35  ?  187 MET A C   1 
ATOM   994  O O   . MET A 1 143 ? -19.508 42.337 32.150  1.00 88.93  ?  187 MET A O   1 
ATOM   995  C CB  . MET A 1 143 ? -20.063 44.756 34.039  1.00 94.84  ?  187 MET A CB  1 
ATOM   996  C CG  . MET A 1 143 ? -20.965 45.452 35.012  1.00 99.16  ?  187 MET A CG  1 
ATOM   997  S SD  . MET A 1 143 ? -20.079 46.244 36.340  1.00 100.00 ?  187 MET A SD  1 
ATOM   998  C CE  . MET A 1 143 ? -21.439 47.076 37.138  1.00 105.47 ?  187 MET A CE  1 
ATOM   999  N N   . MET A 1 144 ? -19.831 44.074 30.753  1.00 92.61  ?  188 MET A N   1 
ATOM   1000 C CA  . MET A 1 144 ? -19.121 43.480 29.631  1.00 91.59  ?  188 MET A CA  1 
ATOM   1001 C C   . MET A 1 144 ? -17.735 44.094 29.484  1.00 91.23  ?  188 MET A C   1 
ATOM   1002 O O   . MET A 1 144 ? -17.592 45.312 29.384  1.00 92.81  ?  188 MET A O   1 
ATOM   1003 C CB  . MET A 1 144 ? -19.913 43.694 28.347  1.00 94.45  ?  188 MET A CB  1 
ATOM   1004 C CG  . MET A 1 144 ? -21.348 43.207 28.386  1.00 95.85  ?  188 MET A CG  1 
ATOM   1005 S SD  . MET A 1 144 ? -21.519 41.443 28.738  1.00 93.20  ?  188 MET A SD  1 
ATOM   1006 C CE  . MET A 1 144 ? -20.687 40.669 27.353  1.00 93.28  ?  188 MET A CE  1 
ATOM   1007 N N   . TYR A 1 145 ? -16.719 43.238 29.479  1.00 80.07  ?  189 TYR A N   1 
ATOM   1008 C CA  . TYR A 1 145 ? -15.332 43.666 29.295  1.00 80.53  ?  189 TYR A CA  1 
ATOM   1009 C C   . TYR A 1 145 ? -15.047 43.951 27.824  1.00 83.51  ?  189 TYR A C   1 
ATOM   1010 O O   . TYR A 1 145 ? -15.549 43.257 26.942  1.00 84.99  ?  189 TYR A O   1 
ATOM   1011 C CB  . TYR A 1 145 ? -14.362 42.568 29.753  1.00 78.81  ?  189 TYR A CB  1 
ATOM   1012 C CG  . TYR A 1 145 ? -14.475 42.140 31.200  1.00 76.50  ?  189 TYR A CG  1 
ATOM   1013 C CD1 . TYR A 1 145 ? -15.441 41.229 31.603  1.00 75.12  ?  189 TYR A CD1 1 
ATOM   1014 C CD2 . TYR A 1 145 ? -13.580 42.620 32.154  1.00 76.51  ?  189 TYR A CD2 1 
ATOM   1015 C CE1 . TYR A 1 145 ? -15.539 40.828 32.911  1.00 74.21  ?  189 TYR A CE1 1 
ATOM   1016 C CE2 . TYR A 1 145 ? -13.673 42.238 33.477  1.00 75.67  ?  189 TYR A CE2 1 
ATOM   1017 C CZ  . TYR A 1 145 ? -14.648 41.330 33.852  1.00 74.71  ?  189 TYR A CZ  1 
ATOM   1018 O OH  . TYR A 1 145 ? -14.732 40.934 35.171  1.00 75.07  ?  189 TYR A OH  1 
ATOM   1019 N N   . SER A 1 146 ? -14.229 44.955 27.551  1.00 75.94  ?  190 SER A N   1 
ATOM   1020 C CA  . SER A 1 146 ? -13.716 45.125 26.202  1.00 79.08  ?  190 SER A CA  1 
ATOM   1021 C C   . SER A 1 146 ? -12.683 44.043 25.911  1.00 79.72  ?  190 SER A C   1 
ATOM   1022 O O   . SER A 1 146 ? -11.697 43.922 26.630  1.00 78.52  ?  190 SER A O   1 
ATOM   1023 C CB  . SER A 1 146 ? -13.079 46.498 26.027  1.00 80.37  ?  190 SER A CB  1 
ATOM   1024 O OG  . SER A 1 146 ? -12.244 46.511 24.884  1.00 83.13  ?  190 SER A OG  1 
ATOM   1025 N N   . PRO A 1 147 ? -12.904 43.253 24.853  1.00 85.87  ?  191 PRO A N   1 
ATOM   1026 C CA  . PRO A 1 147 ? -11.998 42.165 24.459  1.00 87.71  ?  191 PRO A CA  1 
ATOM   1027 C C   . PRO A 1 147 ? -10.548 42.637 24.291  1.00 89.07  ?  191 PRO A C   1 
ATOM   1028 O O   . PRO A 1 147 ? -9.614  41.863 24.511  1.00 89.71  ?  191 PRO A O   1 
ATOM   1029 C CB  . PRO A 1 147 ? -12.565 41.719 23.111  1.00 91.71  ?  191 PRO A CB  1 
ATOM   1030 C CG  . PRO A 1 147 ? -14.003 42.088 23.175  1.00 90.84  ?  191 PRO A CG  1 
ATOM   1031 C CD  . PRO A 1 147 ? -14.066 43.358 23.955  1.00 88.07  ?  191 PRO A CD  1 
ATOM   1032 N N   . GLN A 1 148 ? -10.376 43.895 23.901  1.00 120.58 ?  192 GLN A N   1 
ATOM   1033 C CA  . GLN A 1 148 ? -9.057  44.487 23.753  1.00 121.91 ?  192 GLN A CA  1 
ATOM   1034 C C   . GLN A 1 148 ? -8.408  44.762 25.104  1.00 119.48 ?  192 GLN A C   1 
ATOM   1035 O O   . GLN A 1 148 ? -7.293  44.321 25.365  1.00 120.34 ?  192 GLN A O   1 
ATOM   1036 C CB  . GLN A 1 148 ? -9.158  45.787 22.955  1.00 123.26 ?  192 GLN A CB  1 
ATOM   1037 C CG  . GLN A 1 148 ? -7.824  46.382 22.539  1.00 125.13 ?  192 GLN A CG  1 
ATOM   1038 C CD  . GLN A 1 148 ? -7.183  45.613 21.403  1.00 128.08 ?  192 GLN A CD  1 
ATOM   1039 O OE1 . GLN A 1 148 ? -7.768  44.663 20.877  1.00 129.05 ?  192 GLN A OE1 1 
ATOM   1040 N NE2 . GLN A 1 148 ? -5.977  46.020 21.014  1.00 129.82 ?  192 GLN A NE2 1 
ATOM   1041 N N   . ASN A 1 149 ? -9.120  45.484 25.965  1.00 99.57  ?  193 ASN A N   1 
ATOM   1042 C CA  . ASN A 1 149 ? -8.584  45.895 27.260  1.00 97.85  ?  193 ASN A CA  1 
ATOM   1043 C C   . ASN A 1 149 ? -9.504  45.492 28.399  1.00 94.64  ?  193 ASN A C   1 
ATOM   1044 O O   . ASN A 1 149 ? -10.595 46.036 28.546  1.00 93.73  ?  193 ASN A O   1 
ATOM   1045 C CB  . ASN A 1 149 ? -8.370  47.413 27.281  1.00 99.01  ?  193 ASN A CB  1 
ATOM   1046 C CG  . ASN A 1 149 ? -7.558  47.887 28.487  1.00 98.69  ?  193 ASN A CG  1 
ATOM   1047 O OD1 . ASN A 1 149 ? -7.746  47.427 29.618  1.00 96.71  ?  193 ASN A OD1 1 
ATOM   1048 N ND2 . ASN A 1 149 ? -6.652  48.826 28.242  1.00 101.01 ?  193 ASN A ND2 1 
ATOM   1049 N N   . SER A 1 150 ? -9.033  44.577 29.236  1.00 98.78  ?  194 SER A N   1 
ATOM   1050 C CA  . SER A 1 150 ? -9.850  44.015 30.307  1.00 95.85  ?  194 SER A CA  1 
ATOM   1051 C C   . SER A 1 150 ? -10.123 44.994 31.454  1.00 95.23  ?  194 SER A C   1 
ATOM   1052 O O   . SER A 1 150 ? -10.813 44.654 32.409  1.00 93.60  ?  194 SER A O   1 
ATOM   1053 C CB  . SER A 1 150 ? -9.222  42.731 30.846  1.00 94.99  ?  194 SER A CB  1 
ATOM   1054 O OG  . SER A 1 150 ? -8.293  43.003 31.877  1.00 95.29  ?  194 SER A OG  1 
ATOM   1055 N N   . ASP A 1 151 ? -9.548  46.189 31.381  1.00 109.02 ?  195 ASP A N   1 
ATOM   1056 C CA  . ASP A 1 151 ? -9.841  47.230 32.356  1.00 109.48 ?  195 ASP A CA  1 
ATOM   1057 C C   . ASP A 1 151 ? -11.000 48.110 31.885  1.00 109.98 ?  195 ASP A C   1 
ATOM   1058 O O   . ASP A 1 151 ? -11.448 48.995 32.610  1.00 110.87 ?  195 ASP A O   1 
ATOM   1059 C CB  . ASP A 1 151 ? -8.602  48.096 32.613  1.00 111.79 ?  195 ASP A CB  1 
ATOM   1060 C CG  . ASP A 1 151 ? -7.546  47.391 33.460  1.00 111.92 ?  195 ASP A CG  1 
ATOM   1061 O OD1 . ASP A 1 151 ? -7.869  46.371 34.105  1.00 110.18 ?  195 ASP A OD1 1 
ATOM   1062 O OD2 . ASP A 1 151 ? -6.390  47.875 33.495  1.00 115.00 ?  195 ASP A OD2 1 
ATOM   1063 N N   . TYR A 1 152 ? -11.475 47.866 30.666  1.00 87.37  ?  196 TYR A N   1 
ATOM   1064 C CA  . TYR A 1 152 ? -12.573 48.644 30.087  1.00 88.33  ?  196 TYR A CA  1 
ATOM   1065 C C   . TYR A 1 152 ? -13.883 47.871 30.182  1.00 87.08  ?  196 TYR A C   1 
ATOM   1066 O O   . TYR A 1 152 ? -13.970 46.743 29.712  1.00 86.21  ?  196 TYR A O   1 
ATOM   1067 C CB  . TYR A 1 152 ? -12.288 48.980 28.619  1.00 90.24  ?  196 TYR A CB  1 
ATOM   1068 C CG  . TYR A 1 152 ? -11.131 49.932 28.390  1.00 92.08  ?  196 TYR A CG  1 
ATOM   1069 C CD1 . TYR A 1 152 ? -10.567 50.646 29.443  1.00 92.34  ?  196 TYR A CD1 1 
ATOM   1070 C CD2 . TYR A 1 152 ? -10.604 50.121 27.117  1.00 94.03  ?  196 TYR A CD2 1 
ATOM   1071 C CE1 . TYR A 1 152 ? -9.516  51.511 29.235  1.00 94.38  ?  196 TYR A CE1 1 
ATOM   1072 C CE2 . TYR A 1 152 ? -9.546  50.982 26.904  1.00 95.87  ?  196 TYR A CE2 1 
ATOM   1073 C CZ  . TYR A 1 152 ? -9.009  51.675 27.965  1.00 96.00  ?  196 TYR A CZ  1 
ATOM   1074 O OH  . TYR A 1 152 ? -7.959  52.541 27.749  1.00 98.19  ?  196 TYR A OH  1 
ATOM   1075 N N   . LEU A 1 153 ? -14.898 48.473 30.794  1.00 90.16  ?  197 LEU A N   1 
ATOM   1076 C CA  . LEU A 1 153 ? -16.182 47.803 30.974  1.00 89.68  ?  197 LEU A CA  1 
ATOM   1077 C C   . LEU A 1 153 ? -17.295 48.728 30.530  1.00 92.01  ?  197 LEU A C   1 
ATOM   1078 O O   . LEU A 1 153 ? -17.172 49.950 30.620  1.00 93.60  ?  197 LEU A O   1 
ATOM   1079 C CB  . LEU A 1 153 ? -16.417 47.439 32.447  1.00 89.01  ?  197 LEU A CB  1 
ATOM   1080 C CG  . LEU A 1 153 ? -15.301 46.926 33.365  1.00 87.71  ?  197 LEU A CG  1 
ATOM   1081 C CD1 . LEU A 1 153 ? -15.850 46.612 34.746  1.00 88.23  ?  197 LEU A CD1 1 
ATOM   1082 C CD2 . LEU A 1 153 ? -14.645 45.697 32.789  1.00 85.71  ?  197 LEU A CD2 1 
ATOM   1083 N N   . LEU A 1 154 ? -18.388 48.150 30.053  1.00 82.57  ?  198 LEU A N   1 
ATOM   1084 C CA  . LEU A 1 154 ? -19.593 48.935 29.847  1.00 85.13  ?  198 LEU A CA  1 
ATOM   1085 C C   . LEU A 1 154 ? -20.777 48.214 30.444  1.00 85.81  ?  198 LEU A C   1 
ATOM   1086 O O   . LEU A 1 154 ? -20.773 46.988 30.538  1.00 84.28  ?  198 LEU A O   1 
ATOM   1087 C CB  . LEU A 1 154 ? -19.832 49.237 28.369  1.00 86.78  ?  198 LEU A CB  1 
ATOM   1088 C CG  . LEU A 1 154 ? -19.996 48.104 27.357  1.00 86.88  ?  198 LEU A CG  1 
ATOM   1089 C CD1 . LEU A 1 154 ? -21.379 47.504 27.384  1.00 88.10  ?  198 LEU A CD1 1 
ATOM   1090 C CD2 . LEU A 1 154 ? -19.698 48.639 25.975  1.00 88.94  ?  198 LEU A CD2 1 
ATOM   1091 N N   . ALA A 1 155 ? -21.791 48.978 30.838  1.00 77.49  ?  199 ALA A N   1 
ATOM   1092 C CA  . ALA A 1 155 ? -22.996 48.411 31.418  1.00 79.58  ?  199 ALA A CA  1 
ATOM   1093 C C   . ALA A 1 155 ? -24.209 49.232 31.015  1.00 83.07  ?  199 ALA A C   1 
ATOM   1094 O O   . ALA A 1 155 ? -24.083 50.419 30.712  1.00 83.46  ?  199 ALA A O   1 
ATOM   1095 C CB  . ALA A 1 155 ? -22.874 48.375 32.928  1.00 80.08  ?  199 ALA A CB  1 
ATOM   1096 N N   . LEU A 1 156 ? -25.382 48.605 31.010  1.00 90.10  ?  200 LEU A N   1 
ATOM   1097 C CA  . LEU A 1 156 ? -26.633 49.354 30.896  1.00 94.19  ?  200 LEU A CA  1 
ATOM   1098 C C   . LEU A 1 156 ? -27.305 49.547 32.256  1.00 97.51  ?  200 LEU A C   1 
ATOM   1099 O O   . LEU A 1 156 ? -27.493 48.589 33.011  1.00 99.09  ?  200 LEU A O   1 
ATOM   1100 C CB  . LEU A 1 156 ? -27.619 48.659 29.966  1.00 96.85  ?  200 LEU A CB  1 
ATOM   1101 C CG  . LEU A 1 156 ? -27.186 48.507 28.519  1.00 95.80  ?  200 LEU A CG  1 
ATOM   1102 C CD1 . LEU A 1 156 ? -28.313 47.905 27.688  1.00 91.95  ?  200 LEU A CD1 1 
ATOM   1103 C CD2 . LEU A 1 156 ? -26.736 49.836 27.959  1.00 101.43 ?  200 LEU A CD2 1 
ATOM   1104 N N   . SER A 1 157 ? -27.674 50.789 32.555  1.00 83.63  ?  201 SER A N   1 
ATOM   1105 C CA  . SER A 1 157 ? -28.460 51.079 33.740  1.00 86.89  ?  201 SER A CA  1 
ATOM   1106 C C   . SER A 1 157 ? -29.932 50.722 33.532  1.00 92.02  ?  201 SER A C   1 
ATOM   1107 O O   . SER A 1 157 ? -30.415 50.619 32.407  1.00 93.39  ?  201 SER A O   1 
ATOM   1108 C CB  . SER A 1 157 ? -28.319 52.548 34.140  1.00 86.07  ?  201 SER A CB  1 
ATOM   1109 O OG  . SER A 1 157 ? -29.309 53.346 33.514  1.00 88.00  ?  201 SER A OG  1 
ATOM   1110 N N   . THR A 1 158 ? -30.624 50.518 34.644  1.00 81.88  ?  202 THR A N   1 
ATOM   1111 C CA  . THR A 1 158 ? -32.068 50.358 34.690  1.00 87.41  ?  202 THR A CA  1 
ATOM   1112 C C   . THR A 1 158 ? -32.782 51.582 34.136  1.00 88.42  ?  202 THR A C   1 
ATOM   1113 O O   . THR A 1 158 ? -33.960 51.523 33.806  1.00 92.90  ?  202 THR A O   1 
ATOM   1114 C CB  . THR A 1 158 ? -32.502 50.225 36.136  1.00 89.15  ?  202 THR A CB  1 
ATOM   1115 O OG1 . THR A 1 158 ? -31.923 51.307 36.879  1.00 86.28  ?  202 THR A OG1 1 
ATOM   1116 C CG2 . THR A 1 158 ? -32.005 48.916 36.717  1.00 88.54  ?  202 THR A CG2 1 
ATOM   1117 N N   . GLU A 1 159 ? -32.066 52.694 34.052  1.00 118.19 ?  203 GLU A N   1 
ATOM   1118 C CA  . GLU A 1 159 ? -32.605 53.916 33.479  1.00 118.29 ?  203 GLU A CA  1 
ATOM   1119 C C   . GLU A 1 159 ? -32.354 53.940 31.979  1.00 116.75 ?  203 GLU A C   1 
ATOM   1120 O O   . GLU A 1 159 ? -32.625 54.935 31.310  1.00 116.12 ?  203 GLU A O   1 
ATOM   1121 C CB  . GLU A 1 159 ? -31.962 55.133 34.137  1.00 115.30 ?  203 GLU A CB  1 
ATOM   1122 C CG  . GLU A 1 159 ? -32.274 55.259 35.619  1.00 116.85 ?  203 GLU A CG  1 
ATOM   1123 C CD  . GLU A 1 159 ? -33.758 55.439 35.884  1.00 120.95 ?  203 GLU A CD  1 
ATOM   1124 O OE1 . GLU A 1 159 ? -34.410 56.172 35.105  1.00 121.79 ?  203 GLU A OE1 1 
ATOM   1125 O OE2 . GLU A 1 159 ? -34.271 54.844 36.866  1.00 123.25 ?  203 GLU A OE2 1 
ATOM   1126 N N   . ASN A 1 160 ? -31.818 52.835 31.470  1.00 99.40  ?  204 ASN A N   1 
ATOM   1127 C CA  . ASN A 1 160 ? -31.427 52.704 30.073  1.00 97.31  ?  204 ASN A CA  1 
ATOM   1128 C C   . ASN A 1 160 ? -30.328 53.682 29.699  1.00 92.39  ?  204 ASN A C   1 
ATOM   1129 O O   . ASN A 1 160 ? -30.293 54.207 28.584  1.00 91.28  ?  204 ASN A O   1 
ATOM   1130 C CB  . ASN A 1 160 ? -32.626 52.836 29.130  1.00 101.05 ?  204 ASN A CB  1 
ATOM   1131 C CG  . ASN A 1 160 ? -33.641 51.734 29.328  1.00 107.20 ?  204 ASN A CG  1 
ATOM   1132 O OD1 . ASN A 1 160 ? -33.289 50.566 29.496  1.00 108.12 ?  204 ASN A OD1 1 
ATOM   1133 N ND2 . ASN A 1 160 ? -34.914 52.102 29.317  1.00 111.65 ?  204 ASN A ND2 1 
ATOM   1134 N N   . GLY A 1 161 ? -29.432 53.930 30.645  1.00 101.28 ?  205 GLY A N   1 
ATOM   1135 C CA  . GLY A 1 161 ? -28.240 54.703 30.359  1.00 97.77  ?  205 GLY A CA  1 
ATOM   1136 C C   . GLY A 1 161 ? -27.088 53.789 29.994  1.00 95.08  ?  205 GLY A C   1 
ATOM   1137 O O   . GLY A 1 161 ? -27.054 52.637 30.423  1.00 95.20  ?  205 GLY A O   1 
ATOM   1138 N N   . LEU A 1 162 ? -26.143 54.295 29.209  1.00 87.35  ?  206 LEU A N   1 
ATOM   1139 C CA  . LEU A 1 162 ? -24.960 53.521 28.848  1.00 85.04  ?  206 LEU A CA  1 
ATOM   1140 C C   . LEU A 1 162 ? -23.762 54.020 29.641  1.00 83.52  ?  206 LEU A C   1 
ATOM   1141 O O   . LEU A 1 162 ? -23.287 55.145 29.445  1.00 83.58  ?  206 LEU A O   1 
ATOM   1142 C CB  . LEU A 1 162 ? -24.684 53.609 27.344  1.00 84.77  ?  206 LEU A CB  1 
ATOM   1143 C CG  . LEU A 1 162 ? -23.421 52.921 26.805  1.00 83.06  ?  206 LEU A CG  1 
ATOM   1144 C CD1 . LEU A 1 162 ? -23.385 51.447 27.189  1.00 82.13  ?  206 LEU A CD1 1 
ATOM   1145 C CD2 . LEU A 1 162 ? -23.326 53.067 25.301  1.00 83.74  ?  206 LEU A CD2 1 
ATOM   1146 N N   . TRP A 1 163 ? -23.279 53.183 30.548  1.00 97.61  ?  207 TRP A N   1 
ATOM   1147 C CA  . TRP A 1 163 ? -22.184 53.583 31.413  1.00 96.51  ?  207 TRP A CA  1 
ATOM   1148 C C   . TRP A 1 163 ? -20.908 52.864 31.039  1.00 94.00  ?  207 TRP A C   1 
ATOM   1149 O O   . TRP A 1 163 ? -20.927 51.689 30.668  1.00 92.75  ?  207 TRP A O   1 
ATOM   1150 C CB  . TRP A 1 163 ? -22.519 53.302 32.871  1.00 97.41  ?  207 TRP A CB  1 
ATOM   1151 C CG  . TRP A 1 163 ? -23.660 54.104 33.401  1.00 100.19 ?  207 TRP A CG  1 
ATOM   1152 C CD1 . TRP A 1 163 ? -24.993 53.842 33.247  1.00 102.30 ?  207 TRP A CD1 1 
ATOM   1153 C CD2 . TRP A 1 163 ? -23.572 55.296 34.186  1.00 101.41 ?  207 TRP A CD2 1 
ATOM   1154 N NE1 . TRP A 1 163 ? -25.742 54.804 33.887  1.00 104.53 ?  207 TRP A NE1 1 
ATOM   1155 C CE2 . TRP A 1 163 ? -24.892 55.707 34.473  1.00 103.89 ?  207 TRP A CE2 1 
ATOM   1156 C CE3 . TRP A 1 163 ? -22.506 56.054 34.681  1.00 100.96 ?  207 TRP A CE3 1 
ATOM   1157 C CZ2 . TRP A 1 163 ? -25.173 56.846 35.230  1.00 105.54 ?  207 TRP A CZ2 1 
ATOM   1158 C CZ3 . TRP A 1 163 ? -22.787 57.186 35.434  1.00 102.90 ?  207 TRP A CZ3 1 
ATOM   1159 C CH2 . TRP A 1 163 ? -24.110 57.569 35.702  1.00 104.97 ?  207 TRP A CH2 1 
ATOM   1160 N N   . VAL A 1 164 ? -19.797 53.584 31.144  1.00 95.53  ?  208 VAL A N   1 
ATOM   1161 C CA  . VAL A 1 164 ? -18.490 53.050 30.789  1.00 93.65  ?  208 VAL A CA  1 
ATOM   1162 C C   . VAL A 1 164 ? -17.481 53.281 31.909  1.00 93.20  ?  208 VAL A C   1 
ATOM   1163 O O   . VAL A 1 164 ? -17.466 54.341 32.541  1.00 94.79  ?  208 VAL A O   1 
ATOM   1164 C CB  . VAL A 1 164 ? -17.960 53.709 29.500  1.00 94.31  ?  208 VAL A CB  1 
ATOM   1165 C CG1 . VAL A 1 164 ? -16.669 53.059 29.067  1.00 92.90  ?  208 VAL A CG1 1 
ATOM   1166 C CG2 . VAL A 1 164 ? -18.984 53.603 28.392  1.00 95.41  ?  208 VAL A CG2 1 
ATOM   1167 N N   . SER A 1 165 ? -16.639 52.285 32.156  1.00 102.29 ?  209 SER A N   1 
ATOM   1168 C CA  . SER A 1 165 ? -15.549 52.451 33.101  1.00 102.20 ?  209 SER A CA  1 
ATOM   1169 C C   . SER A 1 165 ? -14.214 52.229 32.408  1.00 101.35 ?  209 SER A C   1 
ATOM   1170 O O   . SER A 1 165 ? -14.026 51.221 31.725  1.00 99.79  ?  209 SER A O   1 
ATOM   1171 C CB  . SER A 1 165 ? -15.694 51.483 34.271  1.00 101.36 ?  209 SER A CB  1 
ATOM   1172 O OG  . SER A 1 165 ? -14.576 51.586 35.138  1.00 101.64 ?  209 SER A OG  1 
ATOM   1173 N N   . LYS A 1 166 ? -13.307 53.191 32.560  1.00 105.37 ?  210 LYS A N   1 
ATOM   1174 C CA  . LYS A 1 166 ? -11.949 53.047 32.054  1.00 105.39 ?  210 LYS A CA  1 
ATOM   1175 C C   . LYS A 1 166 ? -11.036 52.312 33.016  1.00 104.71 ?  210 LYS A C   1 
ATOM   1176 O O   . LYS A 1 166 ? -10.004 51.791 32.605  1.00 104.39 ?  210 LYS A O   1 
ATOM   1177 C CB  . LYS A 1 166 ? -11.339 54.405 31.737  1.00 107.80 ?  210 LYS A CB  1 
ATOM   1178 C CG  . LYS A 1 166 ? -11.967 55.120 30.555  1.00 108.58 ?  210 LYS A CG  1 
ATOM   1179 C CD  . LYS A 1 166 ? -11.010 56.182 30.019  1.00 110.58 ?  210 LYS A CD  1 
ATOM   1180 C CE  . LYS A 1 166 ? -11.659 57.140 29.023  1.00 111.88 ?  210 LYS A CE  1 
ATOM   1181 N NZ  . LYS A 1 166 ? -10.652 58.151 28.555  1.00 115.75 ?  210 LYS A NZ  1 
ATOM   1182 N N   . ASN A 1 167 ? -11.377 52.309 34.303  1.00 118.04 ?  211 ASN A N   1 
ATOM   1183 C CA  . ASN A 1 167 ? -10.602 51.521 35.249  1.00 117.60 ?  211 ASN A CA  1 
ATOM   1184 C C   . ASN A 1 167 ? -11.403 50.427 35.932  1.00 115.86 ?  211 ASN A C   1 
ATOM   1185 O O   . ASN A 1 167 ? -11.902 50.632 37.037  1.00 117.20 ?  211 ASN A O   1 
ATOM   1186 C CB  . ASN A 1 167 ? -10.116 52.466 36.347  1.00 121.61 ?  211 ASN A CB  1 
ATOM   1187 C CG  . ASN A 1 167 ? -11.216 53.413 36.838  1.00 122.86 ?  211 ASN A CG  1 
ATOM   1188 O OD1 . ASN A 1 167 ? -12.410 53.157 36.657  1.00 120.80 ?  211 ASN A OD1 1 
ATOM   1189 N ND2 . ASN A 1 167 ? -10.811 54.514 37.453  1.00 127.35 ?  211 ASN A ND2 1 
ATOM   1190 N N   . PHE A 1 168 ? -11.600 49.296 35.274  1.00 96.04  ?  212 PHE A N   1 
ATOM   1191 C CA  . PHE A 1 168 ? -11.962 48.082 35.982  1.00 94.37  ?  212 PHE A CA  1 
ATOM   1192 C C   . PHE A 1 168 ? -13.151 48.342 36.898  1.00 95.58  ?  212 PHE A C   1 
ATOM   1193 O O   . PHE A 1 168 ? -13.231 47.791 37.996  1.00 95.93  ?  212 PHE A O   1 
ATOM   1194 C CB  . PHE A 1 168 ? -10.775 47.560 36.795  1.00 94.13  ?  212 PHE A CB  1 
ATOM   1195 C CG  . PHE A 1 168 ? -10.945 46.148 37.277  1.00 92.44  ?  212 PHE A CG  1 
ATOM   1196 C CD1 . PHE A 1 168 ? -11.836 45.291 36.653  1.00 90.41  ?  212 PHE A CD1 1 
ATOM   1197 C CD2 . PHE A 1 168 ? -10.213 45.677 38.354  1.00 93.40  ?  212 PHE A CD2 1 
ATOM   1198 C CE1 . PHE A 1 168 ? -11.995 43.991 37.093  1.00 89.24  ?  212 PHE A CE1 1 
ATOM   1199 C CE2 . PHE A 1 168 ? -10.367 44.378 38.800  1.00 92.34  ?  212 PHE A CE2 1 
ATOM   1200 C CZ  . PHE A 1 168 ? -11.259 43.533 38.169  1.00 90.21  ?  212 PHE A CZ  1 
ATOM   1201 N N   . GLY A 1 169 ? -14.075 49.175 36.442  1.00 105.09 ?  213 GLY A N   1 
ATOM   1202 C CA  . GLY A 1 169 ? -15.295 49.448 37.185  1.00 107.03 ?  213 GLY A CA  1 
ATOM   1203 C C   . GLY A 1 169 ? -15.182 50.394 38.372  1.00 109.97 ?  213 GLY A C   1 
ATOM   1204 O O   . GLY A 1 169 ? -16.161 50.611 39.092  1.00 112.12 ?  213 GLY A O   1 
ATOM   1205 N N   . GLY A 1 170 ? -13.997 50.959 38.583  1.00 106.44 ?  214 GLY A N   1 
ATOM   1206 C CA  . GLY A 1 170 ? -13.776 51.890 39.679  1.00 109.53 ?  214 GLY A CA  1 
ATOM   1207 C C   . GLY A 1 170 ? -14.551 53.188 39.526  1.00 111.61 ?  214 GLY A C   1 
ATOM   1208 O O   . GLY A 1 170 ? -15.251 53.621 40.444  1.00 114.06 ?  214 GLY A O   1 
ATOM   1209 N N   . LYS A 1 171 ? -14.423 53.811 38.357  1.00 128.70 ?  215 LYS A N   1 
ATOM   1210 C CA  . LYS A 1 171 ? -15.163 55.030 38.040  1.00 130.38 ?  215 LYS A CA  1 
ATOM   1211 C C   . LYS A 1 171 ? -16.000 54.827 36.781  1.00 128.79 ?  215 LYS A C   1 
ATOM   1212 O O   . LYS A 1 171 ? -15.535 54.228 35.814  1.00 126.65 ?  215 LYS A O   1 
ATOM   1213 C CB  . LYS A 1 171 ? -14.212 56.214 37.844  1.00 131.91 ?  215 LYS A CB  1 
ATOM   1214 C CG  . LYS A 1 171 ? -13.680 56.838 39.134  1.00 135.67 ?  215 LYS A CG  1 
ATOM   1215 C CD  . LYS A 1 171 ? -12.607 55.978 39.778  1.00 136.42 ?  215 LYS A CD  1 
ATOM   1216 C CE  . LYS A 1 171 ? -12.049 56.616 41.030  1.00 142.30 ?  215 LYS A CE  1 
ATOM   1217 N NZ  . LYS A 1 171 ? -10.987 55.755 41.610  1.00 143.59 ?  215 LYS A NZ  1 
ATOM   1218 N N   . TRP A 1 172 ? -17.231 55.333 36.797  1.00 102.59 ?  216 TRP A N   1 
ATOM   1219 C CA  . TRP A 1 172 ? -18.160 55.149 35.683  1.00 101.81 ?  216 TRP A CA  1 
ATOM   1220 C C   . TRP A 1 172 ? -18.677 56.466 35.121  1.00 103.42 ?  216 TRP A C   1 
ATOM   1221 O O   . TRP A 1 172 ? -18.990 57.393 35.868  1.00 105.48 ?  216 TRP A O   1 
ATOM   1222 C CB  . TRP A 1 172 ? -19.346 54.288 36.113  1.00 102.23 ?  216 TRP A CB  1 
ATOM   1223 C CG  . TRP A 1 172 ? -18.961 52.901 36.487  1.00 100.53 ?  216 TRP A CG  1 
ATOM   1224 C CD1 . TRP A 1 172 ? -18.410 52.496 37.667  1.00 100.85 ?  216 TRP A CD1 1 
ATOM   1225 C CD2 . TRP A 1 172 ? -19.097 51.725 35.681  1.00 98.38  ?  216 TRP A CD2 1 
ATOM   1226 N NE1 . TRP A 1 172 ? -18.191 51.140 37.646  1.00 98.85  ?  216 TRP A NE1 1 
ATOM   1227 C CE2 . TRP A 1 172 ? -18.605 50.642 36.438  1.00 97.20  ?  216 TRP A CE2 1 
ATOM   1228 C CE3 . TRP A 1 172 ? -19.588 51.482 34.397  1.00 97.58  ?  216 TRP A CE3 1 
ATOM   1229 C CZ2 . TRP A 1 172 ? -18.588 49.339 35.954  1.00 94.94  ?  216 TRP A CZ2 1 
ATOM   1230 C CZ3 . TRP A 1 172 ? -19.574 50.179 33.916  1.00 95.60  ?  216 TRP A CZ3 1 
ATOM   1231 C CH2 . TRP A 1 172 ? -19.076 49.127 34.693  1.00 94.10  ?  216 TRP A CH2 1 
ATOM   1232 N N   . GLU A 1 173 ? -18.779 56.534 33.800  1.00 133.16 ?  217 GLU A N   1 
ATOM   1233 C CA  . GLU A 1 173 ? -19.299 57.715 33.136  1.00 134.64 ?  217 GLU A CA  1 
ATOM   1234 C C   . GLU A 1 173 ? -20.461 57.322 32.246  1.00 134.61 ?  217 GLU A C   1 
ATOM   1235 O O   . GLU A 1 173 ? -20.414 56.296 31.574  1.00 133.24 ?  217 GLU A O   1 
ATOM   1236 C CB  . GLU A 1 173 ? -18.202 58.384 32.313  1.00 134.60 ?  217 GLU A CB  1 
ATOM   1237 C CG  . GLU A 1 173 ? -18.643 59.640 31.599  1.00 135.66 ?  217 GLU A CG  1 
ATOM   1238 C CD  . GLU A 1 173 ? -17.595 60.732 31.658  1.00 138.11 ?  217 GLU A CD  1 
ATOM   1239 O OE1 . GLU A 1 173 ? -16.860 60.806 32.672  1.00 137.96 ?  217 GLU A OE1 1 
ATOM   1240 O OE2 . GLU A 1 173 ? -17.507 61.518 30.687  1.00 140.45 ?  217 GLU A OE2 1 
ATOM   1241 N N   . GLU A 1 174 ? -21.507 58.137 32.241  1.00 107.17 ?  218 GLU A N   1 
ATOM   1242 C CA  . GLU A 1 174 ? -22.671 57.837 31.427  1.00 107.56 ?  218 GLU A CA  1 
ATOM   1243 C C   . GLU A 1 174 ? -22.494 58.542 30.089  1.00 107.51 ?  218 GLU A C   1 
ATOM   1244 O O   . GLU A 1 174 ? -22.574 59.770 30.009  1.00 108.48 ?  218 GLU A O   1 
ATOM   1245 C CB  . GLU A 1 174 ? -23.929 58.332 32.138  1.00 109.47 ?  218 GLU A CB  1 
ATOM   1246 C CG  . GLU A 1 174 ? -25.242 57.927 31.496  1.00 110.38 ?  218 GLU A CG  1 
ATOM   1247 C CD  . GLU A 1 174 ? -26.442 58.502 32.235  1.00 112.65 ?  218 GLU A CD  1 
ATOM   1248 O OE1 . GLU A 1 174 ? -26.272 59.516 32.948  1.00 113.38 ?  218 GLU A OE1 1 
ATOM   1249 O OE2 . GLU A 1 174 ? -27.554 57.941 32.112  1.00 114.06 ?  218 GLU A OE2 1 
ATOM   1250 N N   . ILE A 1 175 ? -22.225 57.760 29.045  1.00 107.05 ?  219 ILE A N   1 
ATOM   1251 C CA  . ILE A 1 175 ? -21.929 58.326 27.727  1.00 107.31 ?  219 ILE A CA  1 
ATOM   1252 C C   . ILE A 1 175 ? -23.128 58.626 26.810  1.00 108.36 ?  219 ILE A C   1 
ATOM   1253 O O   . ILE A 1 175 ? -23.022 59.455 25.905  1.00 108.85 ?  219 ILE A O   1 
ATOM   1254 C CB  . ILE A 1 175 ? -20.884 57.485 26.967  1.00 106.26 ?  219 ILE A CB  1 
ATOM   1255 C CG1 . ILE A 1 175 ? -21.458 56.124 26.587  1.00 105.82 ?  219 ILE A CG1 1 
ATOM   1256 C CG2 . ILE A 1 175 ? -19.615 57.323 27.798  1.00 105.29 ?  219 ILE A CG2 1 
ATOM   1257 C CD1 . ILE A 1 175 ? -20.542 55.342 25.697  1.00 105.17 ?  219 ILE A CD1 1 
ATOM   1258 N N   . HIS A 1 176 ? -24.252 57.949 27.033  1.00 108.75 ?  220 HIS A N   1 
ATOM   1259 C CA  . HIS A 1 176 ? -25.487 58.248 26.306  1.00 109.89 ?  220 HIS A CA  1 
ATOM   1260 C C   . HIS A 1 176 ? -26.675 57.882 27.183  1.00 111.06 ?  220 HIS A C   1 
ATOM   1261 O O   . HIS A 1 176 ? -26.619 56.889 27.902  1.00 110.98 ?  220 HIS A O   1 
ATOM   1262 C CB  . HIS A 1 176 ? -25.543 57.471 24.991  1.00 109.83 ?  220 HIS A CB  1 
ATOM   1263 C CG  . HIS A 1 176 ? -26.504 58.039 23.987  1.00 110.79 ?  220 HIS A CG  1 
ATOM   1264 N ND1 . HIS A 1 176 ? -27.871 57.867 24.081  1.00 112.04 ?  220 HIS A ND1 1 
ATOM   1265 C CD2 . HIS A 1 176 ? -26.291 58.763 22.861  1.00 110.82 ?  220 HIS A CD2 1 
ATOM   1266 C CE1 . HIS A 1 176 ? -28.458 58.469 23.061  1.00 112.53 ?  220 HIS A CE1 1 
ATOM   1267 N NE2 . HIS A 1 176 ? -27.522 59.018 22.305  1.00 111.66 ?  220 HIS A NE2 1 
ATOM   1268 N N   . LYS A 1 177 ? -27.745 58.669 27.137  1.00 122.74 ?  221 LYS A N   1 
ATOM   1269 C CA  . LYS A 1 177 ? -28.830 58.472 28.105  1.00 124.58 ?  221 LYS A CA  1 
ATOM   1270 C C   . LYS A 1 177 ? -29.988 57.555 27.676  1.00 126.67 ?  221 LYS A C   1 
ATOM   1271 O O   . LYS A 1 177 ? -30.803 57.150 28.514  1.00 129.03 ?  221 LYS A O   1 
ATOM   1272 C CB  . LYS A 1 177 ? -29.358 59.817 28.642  1.00 125.50 ?  221 LYS A CB  1 
ATOM   1273 C CG  . LYS A 1 177 ? -28.455 60.484 29.689  1.00 124.79 ?  221 LYS A CG  1 
ATOM   1274 C CD  . LYS A 1 177 ? -29.202 61.552 30.487  1.00 126.28 ?  221 LYS A CD  1 
ATOM   1275 C CE  . LYS A 1 177 ? -28.316 62.188 31.556  1.00 126.05 ?  221 LYS A CE  1 
ATOM   1276 N NZ  . LYS A 1 177 ? -29.018 63.256 32.338  1.00 127.58 ?  221 LYS A NZ  1 
ATOM   1277 N N   . ALA A 1 178 ? -30.061 57.206 26.396  1.00 111.48 ?  222 ALA A N   1 
ATOM   1278 C CA  . ALA A 1 178 ? -31.067 56.243 25.963  1.00 114.01 ?  222 ALA A CA  1 
ATOM   1279 C C   . ALA A 1 178 ? -30.444 55.181 25.073  1.00 112.86 ?  222 ALA A C   1 
ATOM   1280 O O   . ALA A 1 178 ? -30.055 55.470 23.946  1.00 111.48 ?  222 ALA A O   1 
ATOM   1281 C CB  . ALA A 1 178 ? -32.184 56.951 25.231  1.00 115.76 ?  222 ALA A CB  1 
ATOM   1282 N N   . VAL A 1 179 ? -30.387 53.947 25.564  1.00 98.52  ?  223 VAL A N   1 
ATOM   1283 C CA  . VAL A 1 179 ? -29.770 52.857 24.822  1.00 97.35  ?  223 VAL A CA  1 
ATOM   1284 C C   . VAL A 1 179 ? -30.568 51.589 25.010  1.00 100.71 ?  223 VAL A C   1 
ATOM   1285 O O   . VAL A 1 179 ? -30.946 51.240 26.125  1.00 102.94 ?  223 VAL A O   1 
ATOM   1286 C CB  . VAL A 1 179 ? -28.340 52.584 25.285  1.00 94.02  ?  223 VAL A CB  1 
ATOM   1287 C CG1 . VAL A 1 179 ? -27.397 53.600 24.722  1.00 92.33  ?  223 VAL A CG1 1 
ATOM   1288 C CG2 . VAL A 1 179 ? -28.277 52.640 26.777  1.00 93.88  ?  223 VAL A CG2 1 
ATOM   1289 N N   . CYS A 1 180 ? -30.883 50.940 23.899  1.00 106.08 ?  224 CYS A N   1 
ATOM   1290 C CA  . CYS A 1 180 ? -31.524 49.635 23.915  1.00 109.57 ?  224 CYS A CA  1 
ATOM   1291 C C   . CYS A 1 180 ? -30.547 48.468 24.022  1.00 107.00 ?  224 CYS A C   1 
ATOM   1292 O O   . CYS A 1 180 ? -30.787 47.505 24.742  1.00 109.08 ?  224 CYS A O   1 
ATOM   1293 C CB  . CYS A 1 180 ? -32.395 49.504 22.680  1.00 111.74 ?  224 CYS A CB  1 
ATOM   1294 S SG  . CYS A 1 180 ? -33.727 50.691 22.749  1.00 114.66 ?  224 CYS A SG  1 
ATOM   1295 N N   . LEU A 1 181 ? -29.452 48.559 23.279  1.00 90.91  ?  225 LEU A N   1 
ATOM   1296 C CA  . LEU A 1 181 ? -28.492 47.473 23.185  1.00 88.32  ?  225 LEU A CA  1 
ATOM   1297 C C   . LEU A 1 181 ? -27.098 48.036 22.921  1.00 84.73  ?  225 LEU A C   1 
ATOM   1298 O O   . LEU A 1 181 ? -26.955 48.990 22.162  1.00 84.65  ?  225 LEU A O   1 
ATOM   1299 C CB  . LEU A 1 181 ? -28.909 46.546 22.053  1.00 89.58  ?  225 LEU A CB  1 
ATOM   1300 C CG  . LEU A 1 181 ? -28.036 45.325 21.794  1.00 87.06  ?  225 LEU A CG  1 
ATOM   1301 C CD1 . LEU A 1 181 ? -28.071 44.397 22.978  1.00 86.55  ?  225 LEU A CD1 1 
ATOM   1302 C CD2 . LEU A 1 181 ? -28.487 44.599 20.531  1.00 88.24  ?  225 LEU A CD2 1 
ATOM   1303 N N   . ALA A 1 182 ? -26.074 47.452 23.538  1.00 79.52  ?  226 ALA A N   1 
ATOM   1304 C CA  . ALA A 1 182 ? -24.703 47.955 23.394  1.00 77.55  ?  226 ALA A CA  1 
ATOM   1305 C C   . ALA A 1 182 ? -23.647 46.843 23.372  1.00 75.93  ?  226 ALA A C   1 
ATOM   1306 O O   . ALA A 1 182 ? -23.710 45.906 24.161  1.00 74.48  ?  226 ALA A O   1 
ATOM   1307 C CB  . ALA A 1 182 ? -24.389 48.957 24.477  1.00 76.57  ?  226 ALA A CB  1 
ATOM   1308 N N   . LYS A 1 183 ? -22.673 46.955 22.470  1.00 81.02  ?  227 LYS A N   1 
ATOM   1309 C CA  . LYS A 1 183 ? -21.681 45.894 22.292  1.00 80.47  ?  227 LYS A CA  1 
ATOM   1310 C C   . LYS A 1 183 ? -20.253 46.395 22.038  1.00 80.59  ?  227 LYS A C   1 
ATOM   1311 O O   . LYS A 1 183 ? -20.044 47.422 21.394  1.00 81.79  ?  227 LYS A O   1 
ATOM   1312 C CB  . LYS A 1 183 ? -22.110 44.956 21.160  1.00 81.82  ?  227 LYS A CB  1 
ATOM   1313 C CG  . LYS A 1 183 ? -23.238 44.017 21.520  1.00 80.85  ?  227 LYS A CG  1 
ATOM   1314 C CD  . LYS A 1 183 ? -23.741 43.270 20.307  1.00 82.03  ?  227 LYS A CD  1 
ATOM   1315 C CE  . LYS A 1 183 ? -24.927 42.371 20.636  1.00 81.85  ?  227 LYS A CE  1 
ATOM   1316 N NZ  . LYS A 1 183 ? -25.276 41.524 19.440  1.00 82.48  ?  227 LYS A NZ  1 
ATOM   1317 N N   . TRP A 1 184 ? -19.271 45.654 22.542  1.00 88.11  ?  228 TRP A N   1 
ATOM   1318 C CA  . TRP A 1 184 ? -17.875 45.936 22.242  1.00 88.07  ?  228 TRP A CA  1 
ATOM   1319 C C   . TRP A 1 184 ? -17.492 45.366 20.887  1.00 90.99  ?  228 TRP A C   1 
ATOM   1320 O O   . TRP A 1 184 ? -17.732 44.193 20.610  1.00 92.22  ?  228 TRP A O   1 
ATOM   1321 C CB  . TRP A 1 184 ? -16.953 45.290 23.269  1.00 85.10  ?  228 TRP A CB  1 
ATOM   1322 C CG  . TRP A 1 184 ? -16.913 45.924 24.607  1.00 81.89  ?  228 TRP A CG  1 
ATOM   1323 C CD1 . TRP A 1 184 ? -17.392 45.402 25.765  1.00 79.08  ?  228 TRP A CD1 1 
ATOM   1324 C CD2 . TRP A 1 184 ? -16.321 47.184 24.945  1.00 81.48  ?  228 TRP A CD2 1 
ATOM   1325 N NE1 . TRP A 1 184 ? -17.146 46.263 26.810  1.00 77.41  ?  228 TRP A NE1 1 
ATOM   1326 C CE2 . TRP A 1 184 ? -16.491 47.366 26.332  1.00 78.92  ?  228 TRP A CE2 1 
ATOM   1327 C CE3 . TRP A 1 184 ? -15.663 48.175 24.212  1.00 83.18  ?  228 TRP A CE3 1 
ATOM   1328 C CZ2 . TRP A 1 184 ? -16.035 48.500 26.999  1.00 78.59  ?  228 TRP A CZ2 1 
ATOM   1329 C CZ3 . TRP A 1 184 ? -15.207 49.300 24.877  1.00 82.42  ?  228 TRP A CZ3 1 
ATOM   1330 C CH2 . TRP A 1 184 ? -15.400 49.455 26.256  1.00 80.36  ?  228 TRP A CH2 1 
ATOM   1331 N N   . GLY A 1 185 ? -16.878 46.193 20.051  1.00 84.65  ?  229 GLY A N   1 
ATOM   1332 C CA  . GLY A 1 185 ? -16.266 45.704 18.834  1.00 86.52  ?  229 GLY A CA  1 
ATOM   1333 C C   . GLY A 1 185 ? -14.778 45.487 19.037  1.00 85.87  ?  229 GLY A C   1 
ATOM   1334 O O   . GLY A 1 185 ? -14.304 45.366 20.166  1.00 83.98  ?  229 GLY A O   1 
ATOM   1335 N N   . SER A 1 186 ? -14.040 45.427 17.940  1.00 105.46 ?  230 SER A N   1 
ATOM   1336 C CA  . SER A 1 186 ? -12.594 45.383 18.016  1.00 105.46 ?  230 SER A CA  1 
ATOM   1337 C C   . SER A 1 186 ? -12.087 46.774 18.378  1.00 104.41 ?  230 SER A C   1 
ATOM   1338 O O   . SER A 1 186 ? -12.793 47.764 18.184  1.00 104.24 ?  230 SER A O   1 
ATOM   1339 C CB  . SER A 1 186 ? -12.026 44.952 16.673  1.00 107.31 ?  230 SER A CB  1 
ATOM   1340 O OG  . SER A 1 186 ? -12.479 45.832 15.659  1.00 112.62 ?  230 SER A OG  1 
ATOM   1341 N N   . ASP A 1 187 ? -10.874 46.841 18.916  1.00 102.15 ?  231 ASP A N   1 
ATOM   1342 C CA  . ASP A 1 187 ? -10.229 48.113 19.234  1.00 101.48 ?  231 ASP A CA  1 
ATOM   1343 C C   . ASP A 1 187 ? -11.067 49.040 20.132  1.00 99.64  ?  231 ASP A C   1 
ATOM   1344 O O   . ASP A 1 187 ? -11.189 50.234 19.857  1.00 99.96  ?  231 ASP A O   1 
ATOM   1345 C CB  . ASP A 1 187 ? -9.827  48.833 17.944  1.00 103.24 ?  231 ASP A CB  1 
ATOM   1346 C CG  . ASP A 1 187 ? -8.986  47.959 17.024  1.00 105.21 ?  231 ASP A CG  1 
ATOM   1347 O OD1 . ASP A 1 187 ? -8.236  47.106 17.548  1.00 105.39 ?  231 ASP A OD1 1 
ATOM   1348 O OD2 . ASP A 1 187 ? -9.068  48.126 15.781  1.00 106.57 ?  231 ASP A OD2 1 
ATOM   1349 N N   . ASN A 1 188 ? -11.662 48.477 21.181  1.00 102.19 ?  232 ASN A N   1 
ATOM   1350 C CA  . ASN A 1 188 ? -12.381 49.253 22.194  1.00 100.43 ?  232 ASN A CA  1 
ATOM   1351 C C   . ASN A 1 188 ? -13.517 50.113 21.622  1.00 101.42 ?  232 ASN A C   1 
ATOM   1352 O O   . ASN A 1 188 ? -13.942 51.096 22.230  1.00 100.79 ?  232 ASN A O   1 
ATOM   1353 C CB  . ASN A 1 188 ? -11.401 50.113 23.007  1.00 99.64  ?  232 ASN A CB  1 
ATOM   1354 C CG  . ASN A 1 188 ? -10.262 49.295 23.623  1.00 98.91  ?  232 ASN A CG  1 
ATOM   1355 O OD1 . ASN A 1 188 ? -10.492 48.289 24.293  1.00 97.34  ?  232 ASN A OD1 1 
ATOM   1356 N ND2 . ASN A 1 188 ? -9.025  49.738 23.399  1.00 100.22 ?  232 ASN A ND2 1 
ATOM   1357 N N   . THR A 1 189 ? -14.013 49.728 20.450  1.00 90.94  ?  233 THR A N   1 
ATOM   1358 C CA  . THR A 1 189 ? -15.125 50.430 19.825  1.00 92.03  ?  233 THR A CA  1 
ATOM   1359 C C   . THR A 1 189 ? -16.391 50.037 20.551  1.00 91.45  ?  233 THR A C   1 
ATOM   1360 O O   . THR A 1 189 ? -16.505 48.914 21.035  1.00 90.82  ?  233 THR A O   1 
ATOM   1361 C CB  . THR A 1 189 ? -15.294 50.028 18.351  1.00 93.97  ?  233 THR A CB  1 
ATOM   1362 O OG1 . THR A 1 189 ? -14.009 49.870 17.736  1.00 94.50  ?  233 THR A OG1 1 
ATOM   1363 C CG2 . THR A 1 189 ? -16.097 51.077 17.605  1.00 94.88  ?  233 THR A CG2 1 
ATOM   1364 N N   . ILE A 1 190 ? -17.345 50.952 20.628  1.00 99.13  ?  234 ILE A N   1 
ATOM   1365 C CA  . ILE A 1 190 ? -18.638 50.607 21.197  1.00 99.06  ?  234 ILE A CA  1 
ATOM   1366 C C   . ILE A 1 190 ? -19.772 50.874 20.216  1.00 101.02 ?  234 ILE A C   1 
ATOM   1367 O O   . ILE A 1 190 ? -19.978 52.003 19.774  1.00 101.50 ?  234 ILE A O   1 
ATOM   1368 C CB  . ILE A 1 190 ? -18.892 51.360 22.498  1.00 97.51  ?  234 ILE A CB  1 
ATOM   1369 C CG1 . ILE A 1 190 ? -17.931 50.870 23.573  1.00 95.14  ?  234 ILE A CG1 1 
ATOM   1370 C CG2 . ILE A 1 190 ? -20.319 51.155 22.960  1.00 97.83  ?  234 ILE A CG2 1 
ATOM   1371 C CD1 . ILE A 1 190 ? -17.992 51.669 24.860  1.00 93.71  ?  234 ILE A CD1 1 
ATOM   1372 N N   . PHE A 1 191 ? -20.493 49.822 19.855  1.00 78.22  ?  235 PHE A N   1 
ATOM   1373 C CA  . PHE A 1 191 ? -21.705 49.992 19.067  1.00 79.54  ?  235 PHE A CA  1 
ATOM   1374 C C   . PHE A 1 191 ? -22.927 49.975 19.992  1.00 78.72  ?  235 PHE A C   1 
ATOM   1375 O O   . PHE A 1 191 ? -23.001 49.165 20.914  1.00 77.63  ?  235 PHE A O   1 
ATOM   1376 C CB  . PHE A 1 191 ? -21.817 48.887 18.012  1.00 80.83  ?  235 PHE A CB  1 
ATOM   1377 C CG  . PHE A 1 191 ? -20.697 48.883 17.009  1.00 81.42  ?  235 PHE A CG  1 
ATOM   1378 C CD1 . PHE A 1 191 ? -20.638 49.839 16.010  1.00 81.75  ?  235 PHE A CD1 1 
ATOM   1379 C CD2 . PHE A 1 191 ? -19.714 47.908 17.053  1.00 81.20  ?  235 PHE A CD2 1 
ATOM   1380 C CE1 . PHE A 1 191 ? -19.613 49.829 15.083  1.00 81.76  ?  235 PHE A CE1 1 
ATOM   1381 C CE2 . PHE A 1 191 ? -18.689 47.888 16.131  1.00 81.23  ?  235 PHE A CE2 1 
ATOM   1382 C CZ  . PHE A 1 191 ? -18.639 48.849 15.144  1.00 81.52  ?  235 PHE A CZ  1 
ATOM   1383 N N   . PHE A 1 192 ? -23.880 50.867 19.757  1.00 94.07  ?  236 PHE A N   1 
ATOM   1384 C CA  . PHE A 1 192 ? -25.121 50.820 20.522  1.00 94.01  ?  236 PHE A CA  1 
ATOM   1385 C C   . PHE A 1 192 ? -26.316 51.400 19.775  1.00 95.27  ?  236 PHE A C   1 
ATOM   1386 O O   . PHE A 1 192 ? -26.166 52.240 18.897  1.00 95.43  ?  236 PHE A O   1 
ATOM   1387 C CB  . PHE A 1 192 ? -24.959 51.497 21.889  1.00 93.13  ?  236 PHE A CB  1 
ATOM   1388 C CG  . PHE A 1 192 ? -24.575 52.939 21.808  1.00 93.06  ?  236 PHE A CG  1 
ATOM   1389 C CD1 . PHE A 1 192 ? -23.244 53.303 21.723  1.00 92.52  ?  236 PHE A CD1 1 
ATOM   1390 C CD2 . PHE A 1 192 ? -25.543 53.931 21.815  1.00 93.72  ?  236 PHE A CD2 1 
ATOM   1391 C CE1 . PHE A 1 192 ? -22.882 54.628 21.645  1.00 92.57  ?  236 PHE A CE1 1 
ATOM   1392 C CE2 . PHE A 1 192 ? -25.188 55.264 21.740  1.00 93.59  ?  236 PHE A CE2 1 
ATOM   1393 C CZ  . PHE A 1 192 ? -23.858 55.616 21.653  1.00 93.06  ?  236 PHE A CZ  1 
ATOM   1394 N N   . THR A 1 193 ? -27.503 50.941 20.140  1.00 79.40  ?  237 THR A N   1 
ATOM   1395 C CA  . THR A 1 193 ? -28.732 51.467 19.577  1.00 81.08  ?  237 THR A CA  1 
ATOM   1396 C C   . THR A 1 193 ? -29.313 52.442 20.584  1.00 81.76  ?  237 THR A C   1 
ATOM   1397 O O   . THR A 1 193 ? -29.063 52.314 21.782  1.00 81.54  ?  237 THR A O   1 
ATOM   1398 C CB  . THR A 1 193 ? -29.746 50.361 19.237  1.00 83.31  ?  237 THR A CB  1 
ATOM   1399 O OG1 . THR A 1 193 ? -29.778 49.391 20.292  1.00 84.22  ?  237 THR A OG1 1 
ATOM   1400 C CG2 . THR A 1 193 ? -29.341 49.669 17.968  1.00 82.70  ?  237 THR A CG2 1 
ATOM   1401 N N   . THR A 1 194 ? -30.021 53.453 20.082  1.00 98.25  ?  238 THR A N   1 
ATOM   1402 C CA  . THR A 1 194 ? -30.607 54.497 20.912  1.00 98.96  ?  238 THR A CA  1 
ATOM   1403 C C   . THR A 1 194 ? -32.051 54.735 20.526  1.00 101.59 ?  238 THR A C   1 
ATOM   1404 O O   . THR A 1 194 ? -32.470 54.388 19.427  1.00 102.30 ?  238 THR A O   1 
ATOM   1405 C CB  . THR A 1 194 ? -29.866 55.824 20.720  1.00 96.97  ?  238 THR A CB  1 
ATOM   1406 O OG1 . THR A 1 194 ? -29.774 56.117 19.320  1.00 96.51  ?  238 THR A OG1 1 
ATOM   1407 C CG2 . THR A 1 194 ? -28.472 55.726 21.267  1.00 95.14  ?  238 THR A CG2 1 
ATOM   1408 N N   . TYR A 1 195 ? -32.818 55.336 21.426  1.00 113.21 ?  239 TYR A N   1 
ATOM   1409 C CA  . TYR A 1 195 ? -34.167 55.744 21.072  1.00 116.52 ?  239 TYR A CA  1 
ATOM   1410 C C   . TYR A 1 195 ? -34.370 57.215 21.373  1.00 122.63 ?  239 TYR A C   1 
ATOM   1411 O O   . TYR A 1 195 ? -33.482 57.879 21.910  1.00 124.11 ?  239 TYR A O   1 
ATOM   1412 C CB  . TYR A 1 195 ? -35.220 54.883 21.776  1.00 115.86 ?  239 TYR A CB  1 
ATOM   1413 C CG  . TYR A 1 195 ? -35.171 54.934 23.283  1.00 117.31 ?  239 TYR A CG  1 
ATOM   1414 C CD1 . TYR A 1 195 ? -35.826 55.937 23.984  1.00 122.91 ?  239 TYR A CD1 1 
ATOM   1415 C CD2 . TYR A 1 195 ? -34.474 53.979 24.010  1.00 113.55 ?  239 TYR A CD2 1 
ATOM   1416 C CE1 . TYR A 1 195 ? -35.790 55.989 25.355  1.00 124.58 ?  239 TYR A CE1 1 
ATOM   1417 C CE2 . TYR A 1 195 ? -34.436 54.027 25.393  1.00 115.22 ?  239 TYR A CE2 1 
ATOM   1418 C CZ  . TYR A 1 195 ? -35.095 55.032 26.054  1.00 120.66 ?  239 TYR A CZ  1 
ATOM   1419 O OH  . TYR A 1 195 ? -35.059 55.089 27.426  1.00 122.67 ?  239 TYR A OH  1 
ATOM   1420 N N   . ALA A 1 196 ? -35.550 57.718 21.035  1.00 119.66 ?  240 ALA A N   1 
ATOM   1421 C CA  . ALA A 1 196 ? -35.815 59.144 21.127  1.00 126.30 ?  240 ALA A CA  1 
ATOM   1422 C C   . ALA A 1 196 ? -37.070 59.432 21.949  1.00 130.90 ?  240 ALA A C   1 
ATOM   1423 O O   . ALA A 1 196 ? -36.981 59.922 23.075  1.00 133.81 ?  240 ALA A O   1 
ATOM   1424 C CB  . ALA A 1 196 ? -35.931 59.742 19.729  1.00 128.28 ?  240 ALA A CB  1 
ATOM   1425 N N   . ASN A 1 197 ? -38.233 59.103 21.398  1.00 185.21 ?  241 ASN A N   1 
ATOM   1426 C CA  . ASN A 1 197 ? -39.503 59.403 22.051  1.00 190.20 ?  241 ASN A CA  1 
ATOM   1427 C C   . ASN A 1 197 ? -39.737 58.645 23.344  1.00 188.64 ?  241 ASN A C   1 
ATOM   1428 O O   . ASN A 1 197 ? -39.990 59.234 24.390  1.00 192.86 ?  241 ASN A O   1 
ATOM   1429 C CB  . ASN A 1 197 ? -40.668 59.109 21.113  1.00 191.43 ?  241 ASN A CB  1 
ATOM   1430 C CG  . ASN A 1 197 ? -40.797 60.127 20.016  1.00 195.63 ?  241 ASN A CG  1 
ATOM   1431 O OD1 . ASN A 1 197 ? -40.615 61.322 20.239  1.00 200.62 ?  241 ASN A OD1 1 
ATOM   1432 N ND2 . ASN A 1 197 ? -41.109 59.662 18.816  1.00 193.97 ?  241 ASN A ND2 1 
ATOM   1433 N N   . GLY A 1 198 ? -39.636 57.328 23.269  1.00 170.20 ?  242 GLY A N   1 
ATOM   1434 C CA  . GLY A 1 198 ? -40.126 56.483 24.336  1.00 169.13 ?  242 GLY A CA  1 
ATOM   1435 C C   . GLY A 1 198 ? -39.499 55.118 24.224  1.00 162.07 ?  242 GLY A C   1 
ATOM   1436 O O   . GLY A 1 198 ? -38.541 54.947 23.475  1.00 158.27 ?  242 GLY A O   1 
ATOM   1437 N N   . SER A 1 199 ? -40.074 54.142 24.916  1.00 143.21 ?  243 SER A N   1 
ATOM   1438 C CA  . SER A 1 199 ? -39.392 52.893 25.213  1.00 137.47 ?  243 SER A CA  1 
ATOM   1439 C C   . SER A 1 199 ? -38.788 52.230 23.995  1.00 132.53 ?  243 SER A C   1 
ATOM   1440 O O   . SER A 1 199 ? -39.240 52.402 22.863  1.00 133.10 ?  243 SER A O   1 
ATOM   1441 C CB  . SER A 1 199 ? -40.348 51.911 25.875  1.00 137.16 ?  243 SER A CB  1 
ATOM   1442 O OG  . SER A 1 199 ? -41.334 51.507 24.951  1.00 137.62 ?  243 SER A OG  1 
ATOM   1443 N N   . CYS A 1 200 ? -37.706 51.520 24.261  1.00 139.32 ?  244 CYS A N   1 
ATOM   1444 C CA  . CYS A 1 200 ? -37.053 50.690 23.284  1.00 135.74 ?  244 CYS A CA  1 
ATOM   1445 C C   . CYS A 1 200 ? -38.103 49.863 22.552  1.00 134.88 ?  244 CYS A C   1 
ATOM   1446 O O   . CYS A 1 200 ? -38.140 49.831 21.324  1.00 134.19 ?  244 CYS A O   1 
ATOM   1447 C CB  . CYS A 1 200 ? -36.109 49.771 24.036  1.00 133.70 ?  244 CYS A CB  1 
ATOM   1448 S SG  . CYS A 1 200 ? -34.771 50.608 24.864  1.00 130.21 ?  244 CYS A SG  1 
ATOM   1449 N N   . LYS A 1 201 ? -38.968 49.216 23.323  1.00 138.33 ?  245 LYS A N   1 
ATOM   1450 C CA  . LYS A 1 201 ? -40.084 48.437 22.794  1.00 138.06 ?  245 LYS A CA  1 
ATOM   1451 C C   . LYS A 1 201 ? -40.919 49.221 21.771  1.00 141.07 ?  245 LYS A C   1 
ATOM   1452 O O   . LYS A 1 201 ? -41.202 48.728 20.681  1.00 139.68 ?  245 LYS A O   1 
ATOM   1453 C CB  . LYS A 1 201 ? -40.978 47.971 23.952  1.00 139.70 ?  245 LYS A CB  1 
ATOM   1454 C CG  . LYS A 1 201 ? -41.571 46.563 23.807  1.00 137.75 ?  245 LYS A CG  1 
ATOM   1455 C CD  . LYS A 1 201 ? -40.485 45.483 23.812  1.00 134.25 ?  245 LYS A CD  1 
ATOM   1456 C CE  . LYS A 1 201 ? -41.064 44.077 23.649  1.00 132.69 ?  245 LYS A CE  1 
ATOM   1457 N NZ  . LYS A 1 201 ? -39.996 43.057 23.450  1.00 129.69 ?  245 LYS A NZ  1 
ATOM   1458 N N   . ALA A 1 202 ? -41.307 50.439 22.130  1.00 126.15 ?  246 ALA A N   1 
ATOM   1459 C CA  . ALA A 1 202 ? -42.165 51.263 21.278  1.00 130.48 ?  246 ALA A CA  1 
ATOM   1460 C C   . ALA A 1 202 ? -41.482 51.697 19.983  1.00 129.17 ?  246 ALA A C   1 
ATOM   1461 O O   . ALA A 1 202 ? -42.074 51.668 18.905  1.00 130.26 ?  246 ALA A O   1 
ATOM   1462 C CB  . ALA A 1 202 ? -42.644 52.486 22.043  1.00 136.48 ?  246 ALA A CB  1 
ATOM   1463 N N   . ASP A 1 203 ? -40.221 52.080 20.095  1.00 124.35 ?  247 ASP A N   1 
ATOM   1464 C CA  . ASP A 1 203 ? -39.508 52.681 18.982  1.00 123.97 ?  247 ASP A CA  1 
ATOM   1465 C C   . ASP A 1 203 ? -38.858 51.617 18.112  1.00 118.59 ?  247 ASP A C   1 
ATOM   1466 O O   . ASP A 1 203 ? -37.996 51.917 17.286  1.00 117.28 ?  247 ASP A O   1 
ATOM   1467 C CB  . ASP A 1 203 ? -38.495 53.709 19.472  1.00 125.23 ?  247 ASP A CB  1 
ATOM   1468 C CG  . ASP A 1 203 ? -39.136 55.036 19.815  1.00 131.71 ?  247 ASP A CG  1 
ATOM   1469 O OD1 . ASP A 1 203 ? -40.352 55.069 20.132  1.00 135.25 ?  247 ASP A OD1 1 
ATOM   1470 O OD2 . ASP A 1 203 ? -38.416 56.055 19.766  1.00 133.78 ?  247 ASP A OD2 1 
ATOM   1471 N N   . LEU A 1 204 ? -39.227 50.364 18.353  1.00 132.32 ?  248 LEU A N   1 
ATOM   1472 C CA  . LEU A 1 204 ? -38.651 49.252 17.614  1.00 128.70 ?  248 LEU A CA  1 
ATOM   1473 C C   . LEU A 1 204 ? -38.779 49.495 16.116  1.00 128.71 ?  248 LEU A C   1 
ATOM   1474 O O   . LEU A 1 204 ? -39.868 49.720 15.602  1.00 131.37 ?  248 LEU A O   1 
ATOM   1475 C CB  . LEU A 1 204 ? -39.360 47.954 17.992  1.00 127.19 ?  248 LEU A CB  1 
ATOM   1476 C CG  . LEU A 1 204 ? -38.579 46.682 17.664  1.00 123.60 ?  248 LEU A CG  1 
ATOM   1477 C CD1 . LEU A 1 204 ? -37.269 46.629 18.455  1.00 123.35 ?  248 LEU A CD1 1 
ATOM   1478 C CD2 . LEU A 1 204 ? -39.442 45.452 17.925  1.00 122.53 ?  248 LEU A CD2 1 
ATOM   1479 N N   . GLY A 1 205 ? -37.649 49.453 15.424  1.00 101.23 ?  249 GLY A N   1 
ATOM   1480 C CA  . GLY A 1 205 ? -37.593 49.809 14.019  1.00 101.53 ?  249 GLY A CA  1 
ATOM   1481 C C   . GLY A 1 205 ? -37.237 51.264 13.783  1.00 104.00 ?  249 GLY A C   1 
ATOM   1482 O O   . GLY A 1 205 ? -36.764 51.621 12.719  1.00 104.26 ?  249 GLY A O   1 
ATOM   1483 N N   . ALA A 1 206 ? -37.486 52.108 14.774  1.00 100.22 ?  250 ALA A N   1 
ATOM   1484 C CA  . ALA A 1 206 ? -37.178 53.536 14.679  1.00 104.50 ?  250 ALA A CA  1 
ATOM   1485 C C   . ALA A 1 206 ? -35.868 53.897 15.384  1.00 102.78 ?  250 ALA A C   1 
ATOM   1486 O O   . ALA A 1 206 ? -35.489 55.068 15.459  1.00 106.32 ?  250 ALA A O   1 
ATOM   1487 C CB  . ALA A 1 206 ? -38.328 54.359 15.229  1.00 110.31 ?  250 ALA A CB  1 
ATOM   1488 N N   . LEU A 1 207 ? -35.194 52.880 15.916  1.00 97.07  ?  251 LEU A N   1 
ATOM   1489 C CA  . LEU A 1 207 ? -33.957 53.071 16.667  1.00 96.37  ?  251 LEU A CA  1 
ATOM   1490 C C   . LEU A 1 207 ? -32.822 53.609 15.811  1.00 96.28  ?  251 LEU A C   1 
ATOM   1491 O O   . LEU A 1 207 ? -32.758 53.342 14.612  1.00 95.27  ?  251 LEU A O   1 
ATOM   1492 C CB  . LEU A 1 207 ? -33.533 51.750 17.295  1.00 93.04  ?  251 LEU A CB  1 
ATOM   1493 C CG  . LEU A 1 207 ? -34.652 51.086 18.089  1.00 92.98  ?  251 LEU A CG  1 
ATOM   1494 C CD1 . LEU A 1 207 ? -34.183 49.761 18.641  1.00 89.96  ?  251 LEU A CD1 1 
ATOM   1495 C CD2 . LEU A 1 207 ? -35.113 52.019 19.195  1.00 96.16  ?  251 LEU A CD2 1 
ATOM   1496 N N   . GLU A 1 208 ? -31.927 54.367 16.436  1.00 101.44 ?  252 GLU A N   1 
ATOM   1497 C CA  . GLU A 1 208 ? -30.740 54.882 15.760  1.00 101.44 ?  252 GLU A CA  1 
ATOM   1498 C C   . GLU A 1 208 ? -29.495 54.107 16.207  1.00 98.78  ?  252 GLU A C   1 
ATOM   1499 O O   . GLU A 1 208 ? -29.317 53.846 17.394  1.00 99.19  ?  252 GLU A O   1 
ATOM   1500 C CB  . GLU A 1 208 ? -30.587 56.377 16.041  1.00 105.20 ?  252 GLU A CB  1 
ATOM   1501 C CG  . GLU A 1 208 ? -30.621 57.228 14.790  1.00 108.57 ?  252 GLU A CG  1 
ATOM   1502 C CD  . GLU A 1 208 ? -30.726 58.713 15.085  1.00 114.92 ?  252 GLU A CD  1 
ATOM   1503 O OE1 . GLU A 1 208 ? -31.569 59.088 15.920  1.00 117.89 ?  252 GLU A OE1 1 
ATOM   1504 O OE2 . GLU A 1 208 ? -29.971 59.505 14.478  1.00 117.26 ?  252 GLU A OE2 1 
ATOM   1505 N N   . LEU A 1 209 ? -28.646 53.715 15.263  1.00 95.25  ?  253 LEU A N   1 
ATOM   1506 C CA  . LEU A 1 209 ? -27.444 52.957 15.609  1.00 94.62  ?  253 LEU A CA  1 
ATOM   1507 C C   . LEU A 1 209 ? -26.242 53.877 15.642  1.00 94.82  ?  253 LEU A C   1 
ATOM   1508 O O   . LEU A 1 209 ? -25.947 54.546 14.654  1.00 94.62  ?  253 LEU A O   1 
ATOM   1509 C CB  . LEU A 1 209 ? -27.200 51.818 14.619  1.00 93.27  ?  253 LEU A CB  1 
ATOM   1510 C CG  . LEU A 1 209 ? -25.931 50.987 14.859  1.00 92.51  ?  253 LEU A CG  1 
ATOM   1511 C CD1 . LEU A 1 209 ? -25.953 50.306 16.221  1.00 93.02  ?  253 LEU A CD1 1 
ATOM   1512 C CD2 . LEU A 1 209 ? -25.724 49.951 13.772  1.00 91.13  ?  253 LEU A CD2 1 
ATOM   1513 N N   . TRP A 1 210 ? -25.540 53.897 16.771  1.00 97.62  ?  254 TRP A N   1 
ATOM   1514 C CA  . TRP A 1 210 ? -24.404 54.791 16.950  1.00 97.67  ?  254 TRP A CA  1 
ATOM   1515 C C   . TRP A 1 210 ? -23.117 54.019 17.198  1.00 96.36  ?  254 TRP A C   1 
ATOM   1516 O O   . TRP A 1 210 ? -23.143 52.834 17.538  1.00 95.78  ?  254 TRP A O   1 
ATOM   1517 C CB  . TRP A 1 210 ? -24.630 55.747 18.117  1.00 99.68  ?  254 TRP A CB  1 
ATOM   1518 C CG  . TRP A 1 210 ? -25.760 56.714 17.947  1.00 102.29 ?  254 TRP A CG  1 
ATOM   1519 C CD1 . TRP A 1 210 ? -26.916 56.520 17.248  1.00 102.31 ?  254 TRP A CD1 1 
ATOM   1520 C CD2 . TRP A 1 210 ? -25.840 58.040 18.492  1.00 106.36 ?  254 TRP A CD2 1 
ATOM   1521 N NE1 . TRP A 1 210 ? -27.713 57.644 17.328  1.00 105.88 ?  254 TRP A NE1 1 
ATOM   1522 C CE2 . TRP A 1 210 ? -27.073 58.588 18.085  1.00 109.47 ?  254 TRP A CE2 1 
ATOM   1523 C CE3 . TRP A 1 210 ? -24.989 58.813 19.288  1.00 109.51 ?  254 TRP A CE3 1 
ATOM   1524 C CZ2 . TRP A 1 210 ? -27.473 59.869 18.444  1.00 115.56 ?  254 TRP A CZ2 1 
ATOM   1525 C CZ3 . TRP A 1 210 ? -25.391 60.088 19.644  1.00 115.54 ?  254 TRP A CZ3 1 
ATOM   1526 C CH2 . TRP A 1 210 ? -26.620 60.602 19.222  1.00 118.49 ?  254 TRP A CH2 1 
ATOM   1527 N N   . ARG A 1 211 ? -21.994 54.706 17.007  1.00 97.48  ?  255 ARG A N   1 
ATOM   1528 C CA  . ARG A 1 211 ? -20.674 54.132 17.236  1.00 95.87  ?  255 ARG A CA  1 
ATOM   1529 C C   . ARG A 1 211 ? -19.759 55.156 17.887  1.00 96.60  ?  255 ARG A C   1 
ATOM   1530 O O   . ARG A 1 211 ? -19.824 56.343 17.569  1.00 99.02  ?  255 ARG A O   1 
ATOM   1531 C CB  . ARG A 1 211 ? -20.056 53.671 15.917  1.00 94.01  ?  255 ARG A CB  1 
ATOM   1532 C CG  . ARG A 1 211 ? -18.640 53.125 16.049  1.00 91.46  ?  255 ARG A CG  1 
ATOM   1533 C CD  . ARG A 1 211 ? -17.944 53.035 14.689  1.00 89.99  ?  255 ARG A CD  1 
ATOM   1534 N NE  . ARG A 1 211 ? -17.477 54.337 14.208  1.00 91.77  ?  255 ARG A NE  1 
ATOM   1535 C CZ  . ARG A 1 211 ? -17.121 54.595 12.950  1.00 91.67  ?  255 ARG A CZ  1 
ATOM   1536 N NH1 . ARG A 1 211 ? -17.190 53.648 12.025  1.00 89.03  ?  255 ARG A NH1 1 
ATOM   1537 N NH2 . ARG A 1 211 ? -16.709 55.810 12.613  1.00 96.15  ?  255 ARG A NH2 1 
ATOM   1538 N N   . THR A 1 212 ? -18.954 54.682 18.833  1.00 102.77 ?  256 THR A N   1 
ATOM   1539 C CA  . THR A 1 212 ? -17.909 55.478 19.456  1.00 104.37 ?  256 THR A CA  1 
ATOM   1540 C C   . THR A 1 212 ? -16.589 54.712 19.422  1.00 102.15 ?  256 THR A C   1 
ATOM   1541 O O   . THR A 1 212 ? -16.539 53.532 19.770  1.00 99.74  ?  256 THR A O   1 
ATOM   1542 C CB  . THR A 1 212 ? -18.255 55.827 20.915  1.00 107.32 ?  256 THR A CB  1 
ATOM   1543 O OG1 . THR A 1 212 ? -17.330 56.804 21.408  1.00 112.81 ?  256 THR A OG1 1 
ATOM   1544 C CG2 . THR A 1 212 ? -18.189 54.585 21.790  1.00 106.76 ?  256 THR A CG2 1 
ATOM   1545 N N   . SER A 1 213 ? -15.521 55.386 19.009  1.00 114.46 ?  257 SER A N   1 
ATOM   1546 C CA  . SER A 1 213 ? -14.182 54.789 19.017  1.00 113.28 ?  257 SER A CA  1 
ATOM   1547 C C   . SER A 1 213 ? -13.251 55.400 20.066  1.00 117.17 ?  257 SER A C   1 
ATOM   1548 O O   . SER A 1 213 ? -12.114 54.961 20.236  1.00 116.47 ?  257 SER A O   1 
ATOM   1549 C CB  . SER A 1 213 ? -13.545 54.893 17.629  1.00 113.82 ?  257 SER A CB  1 
ATOM   1550 O OG  . SER A 1 213 ? -14.212 54.059 16.698  1.00 112.49 ?  257 SER A OG  1 
ATOM   1551 N N   . ASP A 1 214 ? -13.750 56.414 20.762  1.00 129.78 ?  258 ASP A N   1 
ATOM   1552 C CA  . ASP A 1 214 ? -13.006 57.106 21.824  1.00 134.66 ?  258 ASP A CA  1 
ATOM   1553 C C   . ASP A 1 214 ? -13.462 56.778 23.253  1.00 134.84 ?  258 ASP A C   1 
ATOM   1554 O O   . ASP A 1 214 ? -12.950 57.339 24.222  1.00 139.43 ?  258 ASP A O   1 
ATOM   1555 C CB  . ASP A 1 214 ? -13.050 58.620 21.601  1.00 140.47 ?  258 ASP A CB  1 
ATOM   1556 C CG  . ASP A 1 214 ? -14.450 59.188 21.724  1.00 140.52 ?  258 ASP A CG  1 
ATOM   1557 O OD1 . ASP A 1 214 ? -15.359 58.443 22.148  1.00 139.48 ?  258 ASP A OD1 1 
ATOM   1558 O OD2 . ASP A 1 214 ? -14.642 60.377 21.395  1.00 141.80 ?  258 ASP A OD2 1 
ATOM   1559 N N   . LEU A 1 215 ? -14.363 55.810 23.388  1.00 112.12 ?  259 LEU A N   1 
ATOM   1560 C CA  . LEU A 1 215 ? -15.066 55.589 24.651  1.00 112.01 ?  259 LEU A CA  1 
ATOM   1561 C C   . LEU A 1 215 ? -15.957 56.755 25.117  1.00 116.43 ?  259 LEU A C   1 
ATOM   1562 O O   . LEU A 1 215 ? -15.947 57.124 26.292  1.00 119.40 ?  259 LEU A O   1 
ATOM   1563 C CB  . LEU A 1 215 ? -14.068 55.226 25.755  1.00 112.84 ?  259 LEU A CB  1 
ATOM   1564 C CG  . LEU A 1 215 ? -13.216 53.978 25.515  1.00 108.34 ?  259 LEU A CG  1 
ATOM   1565 C CD1 . LEU A 1 215 ? -12.277 53.735 26.687  1.00 110.11 ?  259 LEU A CD1 1 
ATOM   1566 C CD2 . LEU A 1 215 ? -14.099 52.764 25.270  1.00 103.21 ?  259 LEU A CD2 1 
ATOM   1567 N N   . GLY A 1 216 ? -16.730 57.316 24.187  1.00 108.38 ?  260 GLY A N   1 
ATOM   1568 C CA  . GLY A 1 216 ? -17.747 58.314 24.500  1.00 112.47 ?  260 GLY A CA  1 
ATOM   1569 C C   . GLY A 1 216 ? -17.421 59.795 24.387  1.00 118.34 ?  260 GLY A C   1 
ATOM   1570 O O   . GLY A 1 216 ? -18.242 60.646 24.727  1.00 122.14 ?  260 GLY A O   1 
ATOM   1571 N N   . LYS A 1 217 ? -16.227 60.099 23.898  1.00 117.71 ?  261 LYS A N   1 
ATOM   1572 C CA  . LYS A 1 217 ? -15.822 61.461 23.559  1.00 123.72 ?  261 LYS A CA  1 
ATOM   1573 C C   . LYS A 1 217 ? -16.575 61.991 22.340  1.00 124.18 ?  261 LYS A C   1 
ATOM   1574 O O   . LYS A 1 217 ? -17.014 63.140 22.329  1.00 129.36 ?  261 LYS A O   1 
ATOM   1575 C CB  . LYS A 1 217 ? -14.306 61.569 23.364  1.00 125.28 ?  261 LYS A CB  1 
ATOM   1576 C CG  . LYS A 1 217 ? -13.538 61.952 24.631  1.00 129.58 ?  261 LYS A CG  1 
ATOM   1577 C CD  . LYS A 1 217 ? -12.069 62.274 24.339  1.00 132.43 ?  261 LYS A CD  1 
ATOM   1578 C CE  . LYS A 1 217 ? -11.899 63.541 23.486  1.00 137.54 ?  261 LYS A CE  1 
ATOM   1579 N NZ  . LYS A 1 217 ? -12.124 64.813 24.244  1.00 144.58 ?  261 LYS A NZ  1 
ATOM   1580 N N   . SER A 1 218 ? -16.739 61.145 21.329  1.00 138.86 ?  262 SER A N   1 
ATOM   1581 C CA  . SER A 1 218 ? -17.456 61.522 20.116  1.00 139.08 ?  262 SER A CA  1 
ATOM   1582 C C   . SER A 1 218 ? -18.251 60.343 19.566  1.00 132.96 ?  262 SER A C   1 
ATOM   1583 O O   . SER A 1 218 ? -17.854 59.187 19.711  1.00 128.14 ?  262 SER A O   1 
ATOM   1584 C CB  . SER A 1 218 ? -16.480 62.015 19.049  1.00 141.06 ?  262 SER A CB  1 
ATOM   1585 O OG  . SER A 1 218 ? -15.730 60.933 18.522  1.00 136.20 ?  262 SER A OG  1 
ATOM   1586 N N   . PHE A 1 219 ? -19.373 60.637 18.923  1.00 122.00 ?  263 PHE A N   1 
ATOM   1587 C CA  . PHE A 1 219 ? -20.199 59.580 18.363  1.00 116.85 ?  263 PHE A CA  1 
ATOM   1588 C C   . PHE A 1 219 ? -20.501 59.831 16.899  1.00 117.21 ?  263 PHE A C   1 
ATOM   1589 O O   . PHE A 1 219 ? -20.458 60.968 16.426  1.00 122.13 ?  263 PHE A O   1 
ATOM   1590 C CB  . PHE A 1 219 ? -21.509 59.464 19.132  1.00 116.87 ?  263 PHE A CB  1 
ATOM   1591 C CG  . PHE A 1 219 ? -21.329 59.326 20.608  1.00 117.44 ?  263 PHE A CG  1 
ATOM   1592 C CD1 . PHE A 1 219 ? -21.277 60.447 21.418  1.00 123.03 ?  263 PHE A CD1 1 
ATOM   1593 C CD2 . PHE A 1 219 ? -21.220 58.073 21.190  1.00 112.89 ?  263 PHE A CD2 1 
ATOM   1594 C CE1 . PHE A 1 219 ? -21.114 60.323 22.778  1.00 123.87 ?  263 PHE A CE1 1 
ATOM   1595 C CE2 . PHE A 1 219 ? -21.057 57.941 22.556  1.00 113.75 ?  263 PHE A CE2 1 
ATOM   1596 C CZ  . PHE A 1 219 ? -21.006 59.071 23.351  1.00 119.18 ?  263 PHE A CZ  1 
ATOM   1597 N N   . LYS A 1 220 ? -20.806 58.753 16.190  1.00 115.84 ?  264 LYS A N   1 
ATOM   1598 C CA  . LYS A 1 220 ? -21.260 58.836 14.817  1.00 115.88 ?  264 LYS A CA  1 
ATOM   1599 C C   . LYS A 1 220 ? -22.464 57.927 14.690  1.00 112.56 ?  264 LYS A C   1 
ATOM   1600 O O   . LYS A 1 220 ? -22.402 56.761 15.085  1.00 108.47 ?  264 LYS A O   1 
ATOM   1601 C CB  . LYS A 1 220 ? -20.158 58.365 13.873  1.00 113.72 ?  264 LYS A CB  1 
ATOM   1602 C CG  . LYS A 1 220 ? -20.557 58.343 12.402  1.00 113.71 ?  264 LYS A CG  1 
ATOM   1603 C CD  . LYS A 1 220 ? -19.437 57.790 11.518  1.00 111.56 ?  264 LYS A CD  1 
ATOM   1604 C CE  . LYS A 1 220 ? -19.711 58.053 10.039  1.00 113.13 ?  264 LYS A CE  1 
ATOM   1605 N NZ  . LYS A 1 220 ? -18.577 57.638 9.165   1.00 111.90 ?  264 LYS A NZ  1 
ATOM   1606 N N   . THR A 1 221 ? -23.557 58.432 14.129  1.00 103.72 ?  265 THR A N   1 
ATOM   1607 C CA  . THR A 1 221 ? -24.743 57.597 14.028  1.00 100.89 ?  265 THR A CA  1 
ATOM   1608 C C   . THR A 1 221 ? -24.611 56.869 12.710  1.00 97.94  ?  265 THR A C   1 
ATOM   1609 O O   . THR A 1 221 ? -24.707 57.463 11.645  1.00 100.66 ?  265 THR A O   1 
ATOM   1610 C CB  . THR A 1 221 ? -26.040 58.421 14.037  1.00 105.28 ?  265 THR A CB  1 
ATOM   1611 O OG1 . THR A 1 221 ? -26.247 58.995 12.747  1.00 108.04 ?  265 THR A OG1 1 
ATOM   1612 C CG2 . THR A 1 221 ? -25.966 59.531 15.075  1.00 110.04 ?  265 THR A CG2 1 
ATOM   1613 N N   . ILE A 1 222 ? -24.366 55.572 12.792  1.00 111.99 ?  266 ILE A N   1 
ATOM   1614 C CA  . ILE A 1 222 ? -24.035 54.798 11.613  1.00 109.81 ?  266 ILE A CA  1 
ATOM   1615 C C   . ILE A 1 222 ? -25.235 54.054 11.056  1.00 109.67 ?  266 ILE A C   1 
ATOM   1616 O O   . ILE A 1 222 ? -25.117 53.315 10.089  1.00 108.51 ?  266 ILE A O   1 
ATOM   1617 C CB  . ILE A 1 222 ? -22.896 53.811 11.904  1.00 108.15 ?  266 ILE A CB  1 
ATOM   1618 C CG1 . ILE A 1 222 ? -23.340 52.771 12.922  1.00 108.39 ?  266 ILE A CG1 1 
ATOM   1619 C CG2 . ILE A 1 222 ? -21.677 54.552 12.427  1.00 107.93 ?  266 ILE A CG2 1 
ATOM   1620 C CD1 . ILE A 1 222 ? -22.218 51.877 13.372  1.00 107.00 ?  266 ILE A CD1 1 
ATOM   1621 N N   . GLY A 1 223 ? -26.390 54.224 11.676  1.00 101.81 ?  267 GLY A N   1 
ATOM   1622 C CA  . GLY A 1 223 ? -27.589 53.625 11.136  1.00 101.67 ?  267 GLY A CA  1 
ATOM   1623 C C   . GLY A 1 223 ? -28.817 54.319 11.660  1.00 103.34 ?  267 GLY A C   1 
ATOM   1624 O O   . GLY A 1 223 ? -28.792 54.894 12.745  1.00 104.59 ?  267 GLY A O   1 
ATOM   1625 N N   . VAL A 1 224 ? -29.895 54.262 10.888  1.00 95.70  ?  268 VAL A N   1 
ATOM   1626 C CA  . VAL A 1 224 ? -31.173 54.844 11.282  1.00 97.95  ?  268 VAL A CA  1 
ATOM   1627 C C   . VAL A 1 224 ? -32.264 53.875 10.872  1.00 96.74  ?  268 VAL A C   1 
ATOM   1628 O O   . VAL A 1 224 ? -32.004 52.943 10.114  1.00 94.52  ?  268 VAL A O   1 
ATOM   1629 C CB  . VAL A 1 224 ? -31.421 56.190 10.607  1.00 103.26 ?  268 VAL A CB  1 
ATOM   1630 C CG1 . VAL A 1 224 ? -30.435 57.226 11.116  1.00 105.54 ?  268 VAL A CG1 1 
ATOM   1631 C CG2 . VAL A 1 224 ? -31.325 56.045 9.103   1.00 103.33 ?  268 VAL A CG2 1 
ATOM   1632 N N   . LYS A 1 225 ? -33.478 54.094 11.369  1.00 109.50 ?  269 LYS A N   1 
ATOM   1633 C CA  . LYS A 1 225 ? -34.559 53.130 11.199  1.00 108.26 ?  269 LYS A CA  1 
ATOM   1634 C C   . LYS A 1 225 ? -34.107 51.730 11.616  1.00 104.66 ?  269 LYS A C   1 
ATOM   1635 O O   . LYS A 1 225 ? -34.410 50.748 10.938  1.00 102.91 ?  269 LYS A O   1 
ATOM   1636 C CB  . LYS A 1 225 ? -35.057 53.109 9.751   1.00 109.86 ?  269 LYS A CB  1 
ATOM   1637 C CG  . LYS A 1 225 ? -35.936 54.282 9.351   1.00 116.08 ?  269 LYS A CG  1 
ATOM   1638 C CD  . LYS A 1 225 ? -37.290 54.222 10.051  1.00 118.60 ?  269 LYS A CD  1 
ATOM   1639 C CE  . LYS A 1 225 ? -38.408 54.724 9.146   1.00 123.99 ?  269 LYS A CE  1 
ATOM   1640 N NZ  . LYS A 1 225 ? -38.394 56.207 8.925   1.00 129.86 ?  269 LYS A NZ  1 
ATOM   1641 N N   . ILE A 1 226 ? -33.383 51.643 12.730  1.00 88.98  ?  270 ILE A N   1 
ATOM   1642 C CA  . ILE A 1 226 ? -32.822 50.365 13.163  1.00 83.63  ?  270 ILE A CA  1 
ATOM   1643 C C   . ILE A 1 226 ? -33.796 49.509 13.966  1.00 82.61  ?  270 ILE A C   1 
ATOM   1644 O O   . ILE A 1 226 ? -34.514 49.995 14.839  1.00 85.47  ?  270 ILE A O   1 
ATOM   1645 C CB  . ILE A 1 226 ? -31.527 50.553 13.971  1.00 81.92  ?  270 ILE A CB  1 
ATOM   1646 C CG1 . ILE A 1 226 ? -30.539 51.400 13.175  1.00 83.29  ?  270 ILE A CG1 1 
ATOM   1647 C CG2 . ILE A 1 226 ? -30.913 49.210 14.321  1.00 76.96  ?  270 ILE A CG2 1 
ATOM   1648 C CD1 . ILE A 1 226 ? -30.067 50.724 11.913  1.00 80.69  ?  270 ILE A CD1 1 
ATOM   1649 N N   . TYR A 1 227 ? -33.825 48.216 13.631  1.00 105.11 ?  271 TYR A N   1 
ATOM   1650 C CA  . TYR A 1 227 ? -34.593 47.217 14.377  1.00 104.16 ?  271 TYR A CA  1 
ATOM   1651 C C   . TYR A 1 227 ? -33.734 46.448 15.389  1.00 104.05 ?  271 TYR A C   1 
ATOM   1652 O O   . TYR A 1 227 ? -34.122 46.291 16.546  1.00 104.66 ?  271 TYR A O   1 
ATOM   1653 C CB  . TYR A 1 227 ? -35.274 46.240 13.416  1.00 102.49 ?  271 TYR A CB  1 
ATOM   1654 C CG  . TYR A 1 227 ? -36.185 45.245 14.099  1.00 101.41 ?  271 TYR A CG  1 
ATOM   1655 C CD1 . TYR A 1 227 ? -35.671 44.114 14.718  1.00 100.20 ?  271 TYR A CD1 1 
ATOM   1656 C CD2 . TYR A 1 227 ? -37.560 45.437 14.123  1.00 101.69 ?  271 TYR A CD2 1 
ATOM   1657 C CE1 . TYR A 1 227 ? -36.500 43.202 15.343  1.00 99.23  ?  271 TYR A CE1 1 
ATOM   1658 C CE2 . TYR A 1 227 ? -38.397 44.530 14.745  1.00 100.90 ?  271 TYR A CE2 1 
ATOM   1659 C CZ  . TYR A 1 227 ? -37.862 43.415 15.354  1.00 99.63  ?  271 TYR A CZ  1 
ATOM   1660 O OH  . TYR A 1 227 ? -38.692 42.510 15.974  1.00 98.94  ?  271 TYR A OH  1 
ATOM   1661 N N   . SER A 1 228 ? -32.610 45.912 14.913  1.00 87.54  ?  272 SER A N   1 
ATOM   1662 C CA  . SER A 1 228 ? -31.642 45.198 15.748  1.00 87.73  ?  272 SER A CA  1 
ATOM   1663 C C   . SER A 1 228 ? -30.275 45.139 15.057  1.00 88.02  ?  272 SER A C   1 
ATOM   1664 O O   . SER A 1 228 ? -30.188 45.348 13.847  1.00 88.04  ?  272 SER A O   1 
ATOM   1665 C CB  . SER A 1 228 ? -32.138 43.786 16.061  1.00 85.88  ?  272 SER A CB  1 
ATOM   1666 O OG  . SER A 1 228 ? -31.506 43.268 17.218  1.00 86.21  ?  272 SER A OG  1 
ATOM   1667 N N   . PHE A 1 229 ? -29.213 44.845 15.807  1.00 78.65  ?  273 PHE A N   1 
ATOM   1668 C CA  . PHE A 1 229 ? -27.903 44.644 15.184  1.00 79.11  ?  273 PHE A CA  1 
ATOM   1669 C C   . PHE A 1 229 ? -27.135 43.527 15.860  1.00 78.89  ?  273 PHE A C   1 
ATOM   1670 O O   . PHE A 1 229 ? -27.504 43.082 16.949  1.00 78.43  ?  273 PHE A O   1 
ATOM   1671 C CB  . PHE A 1 229 ? -27.063 45.923 15.187  1.00 80.72  ?  273 PHE A CB  1 
ATOM   1672 C CG  . PHE A 1 229 ? -26.450 46.247 16.513  1.00 81.80  ?  273 PHE A CG  1 
ATOM   1673 C CD1 . PHE A 1 229 ? -27.222 46.784 17.539  1.00 82.44  ?  273 PHE A CD1 1 
ATOM   1674 C CD2 . PHE A 1 229 ? -25.102 46.031 16.732  1.00 81.61  ?  273 PHE A CD2 1 
ATOM   1675 C CE1 . PHE A 1 229 ? -26.661 47.096 18.773  1.00 83.31  ?  273 PHE A CE1 1 
ATOM   1676 C CE2 . PHE A 1 229 ? -24.529 46.337 17.957  1.00 82.04  ?  273 PHE A CE2 1 
ATOM   1677 C CZ  . PHE A 1 229 ? -25.311 46.871 18.984  1.00 83.23  ?  273 PHE A CZ  1 
ATOM   1678 N N   . GLY A 1 230 ? -26.077 43.065 15.201  1.00 71.75  ?  274 GLY A N   1 
ATOM   1679 C CA  . GLY A 1 230 ? -25.272 41.991 15.742  1.00 71.29  ?  274 GLY A CA  1 
ATOM   1680 C C   . GLY A 1 230 ? -23.936 41.824 15.051  1.00 69.66  ?  274 GLY A C   1 
ATOM   1681 O O   . GLY A 1 230 ? -23.767 42.227 13.898  1.00 68.88  ?  274 GLY A O   1 
ATOM   1682 N N   . LEU A 1 231 ? -22.972 41.225 15.739  1.00 73.82  ?  275 LEU A N   1 
ATOM   1683 C CA  . LEU A 1 231 ? -21.651 41.062 15.140  1.00 69.72  ?  275 LEU A CA  1 
ATOM   1684 C C   . LEU A 1 231 ? -21.288 39.620 14.957  1.00 66.54  ?  275 LEU A C   1 
ATOM   1685 O O   . LEU A 1 231 ? -21.489 38.825 15.864  1.00 66.13  ?  275 LEU A O   1 
ATOM   1686 C CB  . LEU A 1 231 ? -20.577 41.723 15.996  1.00 68.63  ?  275 LEU A CB  1 
ATOM   1687 C CG  . LEU A 1 231 ? -20.727 43.235 16.044  1.00 70.78  ?  275 LEU A CG  1 
ATOM   1688 C CD1 . LEU A 1 231 ? -21.295 43.673 17.381  1.00 73.69  ?  275 LEU A CD1 1 
ATOM   1689 C CD2 . LEU A 1 231 ? -19.408 43.909 15.774  1.00 68.67  ?  275 LEU A CD2 1 
ATOM   1690 N N   . GLY A 1 232 ? -20.745 39.283 13.792  1.00 71.44  ?  276 GLY A N   1 
ATOM   1691 C CA  . GLY A 1 232 ? -19.997 38.046 13.671  1.00 68.29  ?  276 GLY A CA  1 
ATOM   1692 C C   . GLY A 1 232 ? -18.945 38.106 12.582  1.00 66.38  ?  276 GLY A C   1 
ATOM   1693 O O   . GLY A 1 232 ? -19.145 38.737 11.530  1.00 67.33  ?  276 GLY A O   1 
ATOM   1694 N N   . GLY A 1 233 ? -17.849 37.387 12.797  1.00 65.60  ?  277 GLY A N   1 
ATOM   1695 C CA  . GLY A 1 233 ? -16.687 37.537 11.942  1.00 64.28  ?  277 GLY A CA  1 
ATOM   1696 C C   . GLY A 1 233 ? -16.317 39.005 11.740  1.00 65.49  ?  277 GLY A C   1 
ATOM   1697 O O   . GLY A 1 233 ? -16.378 39.801 12.673  1.00 66.63  ?  277 GLY A O   1 
ATOM   1698 N N   . ARG A 1 234 ? -15.970 39.379 10.513  1.00 83.94  ?  278 ARG A N   1 
ATOM   1699 C CA  . ARG A 1 234 ? -15.653 40.771 10.237  1.00 85.06  ?  278 ARG A CA  1 
ATOM   1700 C C   . ARG A 1 234 ? -16.911 41.587 10.039  1.00 87.25  ?  278 ARG A C   1 
ATOM   1701 O O   . ARG A 1 234 ? -16.857 42.802 9.840   1.00 88.38  ?  278 ARG A O   1 
ATOM   1702 C CB  . ARG A 1 234 ? -14.820 40.898 8.968   1.00 84.42  ?  278 ARG A CB  1 
ATOM   1703 C CG  . ARG A 1 234 ? -13.457 40.266 9.034   1.00 82.92  ?  278 ARG A CG  1 
ATOM   1704 C CD  . ARG A 1 234 ? -12.805 40.256 7.665   1.00 82.69  ?  278 ARG A CD  1 
ATOM   1705 N NE  . ARG A 1 234 ? -13.555 39.430 6.735   1.00 82.40  ?  278 ARG A NE  1 
ATOM   1706 C CZ  . ARG A 1 234 ? -14.140 39.900 5.641   1.00 83.33  ?  278 ARG A CZ  1 
ATOM   1707 N NH1 . ARG A 1 234 ? -14.049 41.194 5.338   1.00 84.38  ?  278 ARG A NH1 1 
ATOM   1708 N NH2 . ARG A 1 234 ? -14.799 39.073 4.837   1.00 83.28  ?  278 ARG A NH2 1 
ATOM   1709 N N   . PHE A 1 235 ? -18.053 40.921 10.063  1.00 72.34  ?  279 PHE A N   1 
ATOM   1710 C CA  . PHE A 1 235 ? -19.285 41.587 9.675   1.00 74.86  ?  279 PHE A CA  1 
ATOM   1711 C C   . PHE A 1 235 ? -20.002 42.301 10.826  1.00 77.29  ?  279 PHE A C   1 
ATOM   1712 O O   . PHE A 1 235 ? -19.992 41.849 11.971  1.00 77.43  ?  279 PHE A O   1 
ATOM   1713 C CB  . PHE A 1 235 ? -20.200 40.591 8.974   1.00 75.14  ?  279 PHE A CB  1 
ATOM   1714 C CG  . PHE A 1 235 ? -19.523 39.840 7.876   1.00 73.12  ?  279 PHE A CG  1 
ATOM   1715 C CD1 . PHE A 1 235 ? -19.009 40.518 6.777   1.00 72.88  ?  279 PHE A CD1 1 
ATOM   1716 C CD2 . PHE A 1 235 ? -19.376 38.465 7.946   1.00 71.63  ?  279 PHE A CD2 1 
ATOM   1717 C CE1 . PHE A 1 235 ? -18.368 39.839 5.748   1.00 71.50  ?  279 PHE A CE1 1 
ATOM   1718 C CE2 . PHE A 1 235 ? -18.732 37.767 6.934   1.00 70.15  ?  279 PHE A CE2 1 
ATOM   1719 C CZ  . PHE A 1 235 ? -18.231 38.459 5.826   1.00 70.23  ?  279 PHE A CZ  1 
ATOM   1720 N N   . LEU A 1 236 ? -20.577 43.452 10.506  1.00 65.61  ?  280 LEU A N   1 
ATOM   1721 C CA  . LEU A 1 236 ? -21.492 44.136 11.401  1.00 68.46  ?  280 LEU A CA  1 
ATOM   1722 C C   . LEU A 1 236 ? -22.849 44.106 10.704  1.00 70.26  ?  280 LEU A C   1 
ATOM   1723 O O   . LEU A 1 236 ? -23.003 44.689 9.634   1.00 70.06  ?  280 LEU A O   1 
ATOM   1724 C CB  . LEU A 1 236 ? -21.048 45.582 11.638  1.00 69.12  ?  280 LEU A CB  1 
ATOM   1725 C CG  . LEU A 1 236 ? -22.135 46.503 12.215  1.00 72.07  ?  280 LEU A CG  1 
ATOM   1726 C CD1 . LEU A 1 236 ? -22.521 46.034 13.601  1.00 73.31  ?  280 LEU A CD1 1 
ATOM   1727 C CD2 . LEU A 1 236 ? -21.726 47.969 12.251  1.00 72.49  ?  280 LEU A CD2 1 
ATOM   1728 N N   . PHE A 1 237 ? -23.821 43.403 11.287  1.00 71.92  ?  281 PHE A N   1 
ATOM   1729 C CA  . PHE A 1 237 ? -25.135 43.280 10.660  1.00 72.82  ?  281 PHE A CA  1 
ATOM   1730 C C   . PHE A 1 237 ? -26.127 44.228 11.324  1.00 74.32  ?  281 PHE A C   1 
ATOM   1731 O O   . PHE A 1 237 ? -26.072 44.434 12.536  1.00 75.52  ?  281 PHE A O   1 
ATOM   1732 C CB  . PHE A 1 237 ? -25.650 41.843 10.748  1.00 72.42  ?  281 PHE A CB  1 
ATOM   1733 C CG  . PHE A 1 237 ? -24.794 40.839 10.032  1.00 70.75  ?  281 PHE A CG  1 
ATOM   1734 C CD1 . PHE A 1 237 ? -24.867 40.700 8.646   1.00 69.54  ?  281 PHE A CD1 1 
ATOM   1735 C CD2 . PHE A 1 237 ? -23.914 40.023 10.738  1.00 69.34  ?  281 PHE A CD2 1 
ATOM   1736 C CE1 . PHE A 1 237 ? -24.075 39.766 7.978   1.00 67.41  ?  281 PHE A CE1 1 
ATOM   1737 C CE2 . PHE A 1 237 ? -23.116 39.086 10.081  1.00 66.01  ?  281 PHE A CE2 1 
ATOM   1738 C CZ  . PHE A 1 237 ? -23.199 38.956 8.703   1.00 65.47  ?  281 PHE A CZ  1 
ATOM   1739 N N   . ALA A 1 238 ? -27.027 44.812 10.542  1.00 85.96  ?  282 ALA A N   1 
ATOM   1740 C CA  . ALA A 1 238 ? -28.119 45.591 11.116  1.00 86.76  ?  282 ALA A CA  1 
ATOM   1741 C C   . ALA A 1 238 ? -29.424 45.246 10.414  1.00 85.65  ?  282 ALA A C   1 
ATOM   1742 O O   . ALA A 1 238 ? -29.458 45.145 9.182   1.00 84.94  ?  282 ALA A O   1 
ATOM   1743 C CB  . ALA A 1 238 ? -27.838 47.086 11.008  1.00 87.79  ?  282 ALA A CB  1 
ATOM   1744 N N   . SER A 1 239 ? -30.496 45.049 11.179  1.00 73.03  ?  283 SER A N   1 
ATOM   1745 C CA  . SER A 1 239 ? -31.805 44.874 10.558  1.00 72.07  ?  283 SER A CA  1 
ATOM   1746 C C   . SER A 1 239 ? -32.471 46.239 10.431  1.00 73.38  ?  283 SER A C   1 
ATOM   1747 O O   . SER A 1 239 ? -32.498 46.998 11.385  1.00 74.57  ?  283 SER A O   1 
ATOM   1748 C CB  . SER A 1 239 ? -32.676 43.848 11.303  1.00 70.76  ?  283 SER A CB  1 
ATOM   1749 O OG  . SER A 1 239 ? -32.766 44.100 12.700  1.00 71.56  ?  283 SER A OG  1 
ATOM   1750 N N   . VAL A 1 240 ? -32.956 46.574 9.240   1.00 89.49  ?  284 VAL A N   1 
ATOM   1751 C CA  . VAL A 1 240 ? -33.521 47.901 8.988   1.00 90.73  ?  284 VAL A CA  1 
ATOM   1752 C C   . VAL A 1 240 ? -34.961 47.797 8.458   1.00 90.40  ?  284 VAL A C   1 
ATOM   1753 O O   . VAL A 1 240 ? -35.251 46.945 7.624   1.00 89.27  ?  284 VAL A O   1 
ATOM   1754 C CB  . VAL A 1 240 ? -32.657 48.702 7.970   1.00 91.33  ?  284 VAL A CB  1 
ATOM   1755 C CG1 . VAL A 1 240 ? -33.145 50.148 7.869   1.00 92.95  ?  284 VAL A CG1 1 
ATOM   1756 C CG2 . VAL A 1 240 ? -31.182 48.657 8.337   1.00 91.38  ?  284 VAL A CG2 1 
ATOM   1757 N N   . MET A 1 241 ? -35.855 48.659 8.935   1.00 131.74 ?  285 MET A N   1 
ATOM   1758 C CA  . MET A 1 241 ? -37.258 48.605 8.525   1.00 133.18 ?  285 MET A CA  1 
ATOM   1759 C C   . MET A 1 241 ? -37.459 49.339 7.207   1.00 136.70 ?  285 MET A C   1 
ATOM   1760 O O   . MET A 1 241 ? -36.843 50.373 6.979   1.00 138.59 ?  285 MET A O   1 
ATOM   1761 C CB  . MET A 1 241 ? -38.150 49.230 9.602   1.00 136.17 ?  285 MET A CB  1 
ATOM   1762 C CG  . MET A 1 241 ? -39.629 48.800 9.591   1.00 138.89 ?  285 MET A CG  1 
ATOM   1763 S SD  . MET A 1 241 ? -39.989 47.249 10.460  1.00 134.43 ?  285 MET A SD  1 
ATOM   1764 C CE  . MET A 1 241 ? -38.907 47.411 11.860  1.00 131.30 ?  285 MET A CE  1 
ATOM   1765 N N   . ALA A 1 242 ? -38.321 48.799 6.345   1.00 145.14 ?  286 ALA A N   1 
ATOM   1766 C CA  . ALA A 1 242 ? -38.693 49.459 5.090   1.00 149.57 ?  286 ALA A CA  1 
ATOM   1767 C C   . ALA A 1 242 ? -39.588 50.662 5.363   1.00 155.55 ?  286 ALA A C   1 
ATOM   1768 O O   . ALA A 1 242 ? -40.470 50.600 6.216   1.00 156.90 ?  286 ALA A O   1 
ATOM   1769 C CB  . ALA A 1 242 ? -39.396 48.479 4.158   1.00 149.81 ?  286 ALA A CB  1 
ATOM   1770 N N   . ASP A 1 243 ? -39.356 51.750 4.631   1.00 166.70 ?  287 ASP A N   1 
ATOM   1771 C CA  . ASP A 1 243 ? -40.111 52.997 4.804   1.00 172.99 ?  287 ASP A CA  1 
ATOM   1772 C C   . ASP A 1 243 ? -41.613 52.804 4.589   1.00 177.18 ?  287 ASP A C   1 
ATOM   1773 O O   . ASP A 1 243 ? -42.032 52.240 3.580   1.00 178.02 ?  287 ASP A O   1 
ATOM   1774 C CB  . ASP A 1 243 ? -39.583 54.083 3.857   1.00 176.70 ?  287 ASP A CB  1 
ATOM   1775 C CG  . ASP A 1 243 ? -38.180 54.550 4.219   1.00 174.02 ?  287 ASP A CG  1 
ATOM   1776 O OD1 . ASP A 1 243 ? -37.896 54.709 5.426   1.00 172.28 ?  287 ASP A OD1 1 
ATOM   1777 O OD2 . ASP A 1 243 ? -37.364 54.762 3.295   1.00 174.00 ?  287 ASP A OD2 1 
ATOM   1778 N N   . LYS A 1 244 ? -42.409 53.281 5.545   1.00 167.80 ?  288 LYS A N   1 
ATOM   1779 C CA  . LYS A 1 244 ? -43.862 53.086 5.546   1.00 171.99 ?  288 LYS A CA  1 
ATOM   1780 C C   . LYS A 1 244 ? -44.254 51.616 5.387   1.00 168.47 ?  288 LYS A C   1 
ATOM   1781 O O   . LYS A 1 244 ? -45.137 51.281 4.598   1.00 171.60 ?  288 LYS A O   1 
ATOM   1782 C CB  . LYS A 1 244 ? -44.539 53.939 4.465   1.00 178.95 ?  288 LYS A CB  1 
ATOM   1783 C CG  . LYS A 1 244 ? -44.569 55.429 4.767   1.00 184.23 ?  288 LYS A CG  1 
ATOM   1784 C CD  . LYS A 1 244 ? -45.198 56.206 3.627   1.00 191.25 ?  288 LYS A CD  1 
ATOM   1785 C CE  . LYS A 1 244 ? -45.214 57.695 3.922   1.00 196.88 ?  288 LYS A CE  1 
ATOM   1786 N NZ  . LYS A 1 244 ? -45.953 57.999 5.175   1.00 199.08 ?  288 LYS A NZ  1 
ATOM   1787 N N   . ASP A 1 245 ? -43.596 50.743 6.141   1.00 156.89 ?  289 ASP A N   1 
ATOM   1788 C CA  . ASP A 1 245 ? -43.835 49.311 6.028   1.00 153.32 ?  289 ASP A CA  1 
ATOM   1789 C C   . ASP A 1 245 ? -43.572 48.624 7.358   1.00 148.78 ?  289 ASP A C   1 
ATOM   1790 O O   . ASP A 1 245 ? -42.940 49.181 8.252   1.00 147.43 ?  289 ASP A O   1 
ATOM   1791 C CB  . ASP A 1 245 ? -42.951 48.703 4.930   1.00 149.87 ?  289 ASP A CB  1 
ATOM   1792 C CG  . ASP A 1 245 ? -43.551 47.444 4.315   1.00 149.10 ?  289 ASP A CG  1 
ATOM   1793 O OD1 . ASP A 1 245 ? -44.243 46.684 5.029   1.00 148.38 ?  289 ASP A OD1 1 
ATOM   1794 O OD2 . ASP A 1 245 ? -43.324 47.219 3.107   1.00 149.51 ?  289 ASP A OD2 1 
ATOM   1795 N N   . THR A 1 246 ? -44.094 47.416 7.483   1.00 133.29 ?  290 THR A N   1 
ATOM   1796 C CA  . THR A 1 246 ? -43.922 46.616 8.680   1.00 129.27 ?  290 THR A CA  1 
ATOM   1797 C C   . THR A 1 246 ? -42.800 45.564 8.540   1.00 122.84 ?  290 THR A C   1 
ATOM   1798 O O   . THR A 1 246 ? -42.595 44.743 9.438   1.00 119.47 ?  290 THR A O   1 
ATOM   1799 C CB  . THR A 1 246 ? -45.251 45.949 9.043   1.00 131.84 ?  290 THR A CB  1 
ATOM   1800 O OG1 . THR A 1 246 ? -45.218 45.503 10.403  1.00 129.45 ?  290 THR A OG1 1 
ATOM   1801 C CG2 . THR A 1 246 ? -45.529 44.784 8.099   1.00 130.74 ?  290 THR A CG2 1 
ATOM   1802 N N   . THR A 1 247 ? -42.099 45.571 7.404   1.00 99.00  ?  291 THR A N   1 
ATOM   1803 C CA  . THR A 1 247 ? -41.025 44.595 7.163   1.00 93.65  ?  291 THR A CA  1 
ATOM   1804 C C   . THR A 1 247 ? -39.619 45.162 7.291   1.00 91.00  ?  291 THR A C   1 
ATOM   1805 O O   . THR A 1 247 ? -39.419 46.362 7.414   1.00 93.40  ?  291 THR A O   1 
ATOM   1806 C CB  . THR A 1 247 ? -41.111 43.993 5.754   1.00 93.97  ?  291 THR A CB  1 
ATOM   1807 O OG1 . THR A 1 247 ? -40.765 44.997 4.788   1.00 96.49  ?  291 THR A OG1 1 
ATOM   1808 C CG2 . THR A 1 247 ? -42.520 43.484 5.477   1.00 97.44  ?  291 THR A CG2 1 
ATOM   1809 N N   . ARG A 1 248 ? -38.637 44.283 7.187   1.00 83.22  ?  292 ARG A N   1 
ATOM   1810 C CA  . ARG A 1 248 ? -37.265 44.664 7.472   1.00 80.48  ?  292 ARG A CA  1 
ATOM   1811 C C   . ARG A 1 248 ? -36.249 43.759 6.772   1.00 77.73  ?  292 ARG A C   1 
ATOM   1812 O O   . ARG A 1 248 ? -36.581 42.676 6.280   1.00 76.54  ?  292 ARG A O   1 
ATOM   1813 C CB  . ARG A 1 248 ? -37.028 44.719 8.992   1.00 79.64  ?  292 ARG A CB  1 
ATOM   1814 C CG  . ARG A 1 248 ? -36.803 43.365 9.677   1.00 77.09  ?  292 ARG A CG  1 
ATOM   1815 C CD  . ARG A 1 248 ? -36.789 43.489 11.226  1.00 77.77  ?  292 ARG A CD  1 
ATOM   1816 N NE  . ARG A 1 248 ? -36.494 42.209 11.873  1.00 76.23  ?  292 ARG A NE  1 
ATOM   1817 C CZ  . ARG A 1 248 ? -37.426 41.326 12.214  1.00 75.25  ?  292 ARG A CZ  1 
ATOM   1818 N NH1 . ARG A 1 248 ? -38.701 41.598 11.969  1.00 75.83  ?  292 ARG A NH1 1 
ATOM   1819 N NH2 . ARG A 1 248 ? -37.098 40.177 12.783  1.00 73.86  ?  292 ARG A NH2 1 
ATOM   1820 N N   . ARG A 1 249 ? -35.009 44.210 6.699   1.00 87.97  ?  293 ARG A N   1 
ATOM   1821 C CA  . ARG A 1 249 ? -34.026 43.432 5.978   1.00 87.17  ?  293 ARG A CA  1 
ATOM   1822 C C   . ARG A 1 249 ? -32.614 43.709 6.467   1.00 87.74  ?  293 ARG A C   1 
ATOM   1823 O O   . ARG A 1 249 ? -32.357 44.712 7.119   1.00 89.04  ?  293 ARG A O   1 
ATOM   1824 C CB  . ARG A 1 249 ? -34.138 43.716 4.489   1.00 87.52  ?  293 ARG A CB  1 
ATOM   1825 C CG  . ARG A 1 249 ? -33.829 45.130 4.133   1.00 88.90  ?  293 ARG A CG  1 
ATOM   1826 C CD  . ARG A 1 249 ? -33.679 45.261 2.641   1.00 89.02  ?  293 ARG A CD  1 
ATOM   1827 N NE  . ARG A 1 249 ? -34.856 44.777 1.926   1.00 89.27  ?  293 ARG A NE  1 
ATOM   1828 C CZ  . ARG A 1 249 ? -34.921 43.618 1.271   1.00 88.15  ?  293 ARG A CZ  1 
ATOM   1829 N NH1 . ARG A 1 249 ? -33.872 42.793 1.220   1.00 87.13  ?  293 ARG A NH1 1 
ATOM   1830 N NH2 . ARG A 1 249 ? -36.049 43.286 0.661   1.00 89.35  ?  293 ARG A NH2 1 
ATOM   1831 N N   . ILE A 1 250 ? -31.698 42.813 6.140   1.00 82.58  ?  294 ILE A N   1 
ATOM   1832 C CA  . ILE A 1 250 ? -30.328 42.907 6.629   1.00 83.11  ?  294 ILE A CA  1 
ATOM   1833 C C   . ILE A 1 250 ? -29.426 43.847 5.810   1.00 83.86  ?  294 ILE A C   1 
ATOM   1834 O O   . ILE A 1 250 ? -29.467 43.847 4.575   1.00 83.45  ?  294 ILE A O   1 
ATOM   1835 C CB  . ILE A 1 250 ? -29.710 41.510 6.643   1.00 81.91  ?  294 ILE A CB  1 
ATOM   1836 C CG1 . ILE A 1 250 ? -30.518 40.593 7.567   1.00 80.60  ?  294 ILE A CG1 1 
ATOM   1837 C CG2 . ILE A 1 250 ? -28.250 41.571 7.038   1.00 82.66  ?  294 ILE A CG2 1 
ATOM   1838 C CD1 . ILE A 1 250 ? -30.435 40.973 9.002   1.00 81.33  ?  294 ILE A CD1 1 
ATOM   1839 N N   . HIS A 1 251 ? -28.628 44.656 6.500   1.00 90.86  ?  295 HIS A N   1 
ATOM   1840 C CA  . HIS A 1 251 ? -27.555 45.403 5.849   1.00 90.92  ?  295 HIS A CA  1 
ATOM   1841 C C   . HIS A 1 251 ? -26.205 45.023 6.472   1.00 90.55  ?  295 HIS A C   1 
ATOM   1842 O O   . HIS A 1 251 ? -26.132 44.727 7.663   1.00 91.12  ?  295 HIS A O   1 
ATOM   1843 C CB  . HIS A 1 251 ? -27.794 46.906 5.947   1.00 92.06  ?  295 HIS A CB  1 
ATOM   1844 C CG  . HIS A 1 251 ? -29.005 47.380 5.204   1.00 92.38  ?  295 HIS A CG  1 
ATOM   1845 N ND1 . HIS A 1 251 ? -28.927 48.203 4.099   1.00 92.96  ?  295 HIS A ND1 1 
ATOM   1846 C CD2 . HIS A 1 251 ? -30.325 47.162 5.416   1.00 92.21  ?  295 HIS A CD2 1 
ATOM   1847 C CE1 . HIS A 1 251 ? -30.145 48.470 3.661   1.00 93.30  ?  295 HIS A CE1 1 
ATOM   1848 N NE2 . HIS A 1 251 ? -31.013 47.851 4.443   1.00 92.82  ?  295 HIS A NE2 1 
ATOM   1849 N N   . VAL A 1 252 ? -25.141 45.014 5.673   1.00 85.54  ?  296 VAL A N   1 
ATOM   1850 C CA  . VAL A 1 252 ? -23.836 44.557 6.159   1.00 84.33  ?  296 VAL A CA  1 
ATOM   1851 C C   . VAL A 1 252 ? -22.776 45.633 6.091   1.00 83.79  ?  296 VAL A C   1 
ATOM   1852 O O   . VAL A 1 252 ? -22.712 46.386 5.120   1.00 83.75  ?  296 VAL A O   1 
ATOM   1853 C CB  . VAL A 1 252 ? -23.297 43.365 5.345   1.00 82.52  ?  296 VAL A CB  1 
ATOM   1854 C CG1 . VAL A 1 252 ? -22.221 42.631 6.127   1.00 81.01  ?  296 VAL A CG1 1 
ATOM   1855 C CG2 . VAL A 1 252 ? -24.409 42.426 5.006   1.00 83.01  ?  296 VAL A CG2 1 
ATOM   1856 N N   . SER A 1 253 ? -21.927 45.688 7.111   1.00 84.66  ?  297 SER A N   1 
ATOM   1857 C CA  . SER A 1 253 ? -20.772 46.574 7.088   1.00 83.86  ?  297 SER A CA  1 
ATOM   1858 C C   . SER A 1 253 ? -19.496 45.886 7.568   1.00 81.85  ?  297 SER A C   1 
ATOM   1859 O O   . SER A 1 253 ? -19.462 45.272 8.645   1.00 81.64  ?  297 SER A O   1 
ATOM   1860 C CB  . SER A 1 253 ? -21.024 47.826 7.917   1.00 85.63  ?  297 SER A CB  1 
ATOM   1861 O OG  . SER A 1 253 ? -19.878 48.661 7.911   1.00 85.02  ?  297 SER A OG  1 
ATOM   1862 N N   . THR A 1 254 ? -18.457 45.963 6.744   1.00 94.98  ?  298 THR A N   1 
ATOM   1863 C CA  . THR A 1 254 ? -17.135 45.514 7.146   1.00 93.25  ?  298 THR A CA  1 
ATOM   1864 C C   . THR A 1 254 ? -16.241 46.662 7.622   1.00 93.66  ?  298 THR A C   1 
ATOM   1865 O O   . THR A 1 254 ? -15.142 46.434 8.120   1.00 92.65  ?  298 THR A O   1 
ATOM   1866 C CB  . THR A 1 254 ? -16.462 44.764 6.005   1.00 91.76  ?  298 THR A CB  1 
ATOM   1867 O OG1 . THR A 1 254 ? -16.412 45.603 4.840   1.00 92.43  ?  298 THR A OG1 1 
ATOM   1868 C CG2 . THR A 1 254 ? -17.260 43.525 5.680   1.00 91.35  ?  298 THR A CG2 1 
ATOM   1869 N N   . ASP A 1 255 ? -16.708 47.894 7.459   1.00 101.70 ?  299 ASP A N   1 
ATOM   1870 C CA  . ASP A 1 255 ? -15.947 49.070 7.882   1.00 102.37 ?  299 ASP A CA  1 
ATOM   1871 C C   . ASP A 1 255 ? -16.340 49.668 9.232   1.00 103.71 ?  299 ASP A C   1 
ATOM   1872 O O   . ASP A 1 255 ? -16.001 50.818 9.510   1.00 104.80 ?  299 ASP A O   1 
ATOM   1873 C CB  . ASP A 1 255 ? -15.865 50.132 6.789   1.00 103.34 ?  299 ASP A CB  1 
ATOM   1874 C CG  . ASP A 1 255 ? -17.208 50.644 6.392   1.00 104.58 ?  299 ASP A CG  1 
ATOM   1875 O OD1 . ASP A 1 255 ? -18.220 50.122 6.910   1.00 105.98 ?  299 ASP A OD1 1 
ATOM   1876 O OD2 . ASP A 1 255 ? -17.251 51.551 5.540   1.00 104.41 ?  299 ASP A OD2 1 
ATOM   1877 N N   . GLN A 1 256 ? -17.138 48.932 10.006  1.00 111.46 ?  300 GLN A N   1 
ATOM   1878 C CA  . GLN A 1 256 ? -17.649 49.391 11.304  1.00 113.08 ?  300 GLN A CA  1 
ATOM   1879 C C   . GLN A 1 256 ? -18.643 50.532 11.179  1.00 115.42 ?  300 GLN A C   1 
ATOM   1880 O O   . GLN A 1 256 ? -18.642 51.463 11.983  1.00 116.87 ?  300 GLN A O   1 
ATOM   1881 C CB  . GLN A 1 256 ? -16.520 49.817 12.240  1.00 112.74 ?  300 GLN A CB  1 
ATOM   1882 C CG  . GLN A 1 256 ? -15.581 48.710 12.638  1.00 110.88 ?  300 GLN A CG  1 
ATOM   1883 C CD  . GLN A 1 256 ? -14.651 49.150 13.748  1.00 111.93 ?  300 GLN A CD  1 
ATOM   1884 O OE1 . GLN A 1 256 ? -14.103 50.257 13.701  1.00 113.35 ?  300 GLN A OE1 1 
ATOM   1885 N NE2 . GLN A 1 256 ? -14.476 48.297 14.765  1.00 111.49 ?  300 GLN A NE2 1 
ATOM   1886 N N   . GLY A 1 257 ? -19.479 50.459 10.152  1.00 92.07  ?  301 GLY A N   1 
ATOM   1887 C CA  . GLY A 1 257 ? -20.585 51.383 10.009  1.00 94.13  ?  301 GLY A CA  1 
ATOM   1888 C C   . GLY A 1 257 ? -20.335 52.514 9.035   1.00 94.42  ?  301 GLY A C   1 
ATOM   1889 O O   . GLY A 1 257 ? -21.271 53.211 8.634   1.00 95.79  ?  301 GLY A O   1 
ATOM   1890 N N   . ASP A 1 258 ? -19.076 52.706 8.652   1.00 115.50 ?  302 ASP A N   1 
ATOM   1891 C CA  . ASP A 1 258 ? -18.727 53.789 7.736   1.00 117.62 ?  302 ASP A CA  1 
ATOM   1892 C C   . ASP A 1 258 ? -19.492 53.653 6.419   1.00 117.89 ?  302 ASP A C   1 
ATOM   1893 O O   . ASP A 1 258 ? -20.094 54.616 5.943   1.00 121.66 ?  302 ASP A O   1 
ATOM   1894 C CB  . ASP A 1 258 ? -17.215 53.841 7.507   1.00 117.87 ?  302 ASP A CB  1 
ATOM   1895 C CG  . ASP A 1 258 ? -16.462 54.362 8.718   1.00 119.28 ?  302 ASP A CG  1 
ATOM   1896 O OD1 . ASP A 1 258 ? -16.872 55.406 9.271   1.00 122.77 ?  302 ASP A OD1 1 
ATOM   1897 O OD2 . ASP A 1 258 ? -15.466 53.723 9.118   1.00 117.30 ?  302 ASP A OD2 1 
ATOM   1898 N N   . THR A 1 259 ? -19.485 52.452 5.846   1.00 92.26  ?  303 THR A N   1 
ATOM   1899 C CA  . THR A 1 259 ? -20.312 52.160 4.672   1.00 92.41  ?  303 THR A CA  1 
ATOM   1900 C C   . THR A 1 259 ? -21.147 50.888 4.842   1.00 91.08  ?  303 THR A C   1 
ATOM   1901 O O   . THR A 1 259 ? -20.767 49.961 5.549   1.00 90.12  ?  303 THR A O   1 
ATOM   1902 C CB  . THR A 1 259 ? -19.490 52.096 3.344   1.00 92.46  ?  303 THR A CB  1 
ATOM   1903 O OG1 . THR A 1 259 ? -18.302 51.321 3.537   1.00 90.23  ?  303 THR A OG1 1 
ATOM   1904 C CG2 . THR A 1 259 ? -19.105 53.493 2.875   1.00 97.63  ?  303 THR A CG2 1 
ATOM   1905 N N   . TRP A 1 260 ? -22.296 50.863 4.181   1.00 97.79  ?  304 TRP A N   1 
ATOM   1906 C CA  . TRP A 1 260 ? -23.241 49.767 4.322   1.00 97.76  ?  304 TRP A CA  1 
ATOM   1907 C C   . TRP A 1 260 ? -23.639 49.247 2.961   1.00 97.37  ?  304 TRP A C   1 
ATOM   1908 O O   . TRP A 1 260 ? -23.558 49.962 1.974   1.00 97.68  ?  304 TRP A O   1 
ATOM   1909 C CB  . TRP A 1 260 ? -24.504 50.257 5.031   1.00 99.47  ?  304 TRP A CB  1 
ATOM   1910 C CG  . TRP A 1 260 ? -24.337 50.474 6.483   1.00 100.20 ?  304 TRP A CG  1 
ATOM   1911 C CD1 . TRP A 1 260 ? -24.088 51.658 7.115   1.00 101.27 ?  304 TRP A CD1 1 
ATOM   1912 C CD2 . TRP A 1 260 ? -24.415 49.477 7.503   1.00 100.11 ?  304 TRP A CD2 1 
ATOM   1913 N NE1 . TRP A 1 260 ? -24.000 51.455 8.471   1.00 101.80 ?  304 TRP A NE1 1 
ATOM   1914 C CE2 . TRP A 1 260 ? -24.200 50.124 8.736   1.00 101.17 ?  304 TRP A CE2 1 
ATOM   1915 C CE3 . TRP A 1 260 ? -24.649 48.100 7.495   1.00 99.40  ?  304 TRP A CE3 1 
ATOM   1916 C CZ2 . TRP A 1 260 ? -24.206 49.441 9.945   1.00 101.57 ?  304 TRP A CZ2 1 
ATOM   1917 C CZ3 . TRP A 1 260 ? -24.657 47.428 8.693   1.00 99.85  ?  304 TRP A CZ3 1 
ATOM   1918 C CH2 . TRP A 1 260 ? -24.436 48.097 9.902   1.00 100.96 ?  304 TRP A CH2 1 
ATOM   1919 N N   . SER A 1 261 ? -24.080 48.003 2.906   1.00 92.95  ?  305 SER A N   1 
ATOM   1920 C CA  . SER A 1 261 ? -24.666 47.492 1.680   1.00 92.96  ?  305 SER A CA  1 
ATOM   1921 C C   . SER A 1 261 ? -25.765 46.500 2.026   1.00 92.89  ?  305 SER A C   1 
ATOM   1922 O O   . SER A 1 261 ? -25.639 45.724 2.969   1.00 92.57  ?  305 SER A O   1 
ATOM   1923 C CB  . SER A 1 261 ? -23.602 46.876 0.766   1.00 92.23  ?  305 SER A CB  1 
ATOM   1924 O OG  . SER A 1 261 ? -22.693 47.872 0.322   1.00 86.68  ?  305 SER A OG  1 
ATOM   1925 N N   . MET A 1 262 ? -26.855 46.557 1.268   1.00 97.67  ?  306 MET A N   1 
ATOM   1926 C CA  . MET A 1 262 ? -27.989 45.682 1.490   1.00 97.57  ?  306 MET A CA  1 
ATOM   1927 C C   . MET A 1 262 ? -27.635 44.248 1.143   1.00 96.42  ?  306 MET A C   1 
ATOM   1928 O O   . MET A 1 262 ? -26.990 43.984 0.126   1.00 95.87  ?  306 MET A O   1 
ATOM   1929 C CB  . MET A 1 262 ? -29.183 46.130 0.658   1.00 98.26  ?  306 MET A CB  1 
ATOM   1930 C CG  . MET A 1 262 ? -30.326 45.146 0.703   1.00 97.92  ?  306 MET A CG  1 
ATOM   1931 S SD  . MET A 1 262 ? -31.458 45.393 -0.657  1.00 98.65  ?  306 MET A SD  1 
ATOM   1932 C CE  . MET A 1 262 ? -32.136 46.995 -0.238  1.00 101.32 ?  306 MET A CE  1 
ATOM   1933 N N   . ALA A 1 263 ? -28.039 43.326 2.010   1.00 78.50  ?  307 ALA A N   1 
ATOM   1934 C CA  . ALA A 1 263 ? -27.754 41.910 1.817   1.00 77.50  ?  307 ALA A CA  1 
ATOM   1935 C C   . ALA A 1 263 ? -28.656 41.292 0.756   1.00 77.28  ?  307 ALA A C   1 
ATOM   1936 O O   . ALA A 1 263 ? -29.709 41.833 0.447   1.00 77.82  ?  307 ALA A O   1 
ATOM   1937 C CB  . ALA A 1 263 ? -27.872 41.164 3.139   1.00 77.28  ?  307 ALA A CB  1 
ATOM   1938 N N   . GLN A 1 264 ? -28.244 40.145 0.230   1.00 108.12 ?  308 GLN A N   1 
ATOM   1939 C CA  . GLN A 1 264 ? -28.944 39.466 -0.854  1.00 108.25 ?  308 GLN A CA  1 
ATOM   1940 C C   . GLN A 1 264 ? -30.100 38.629 -0.314  1.00 107.98 ?  308 GLN A C   1 
ATOM   1941 O O   . GLN A 1 264 ? -30.664 37.805 -1.013  1.00 108.71 ?  308 GLN A O   1 
ATOM   1942 C CB  . GLN A 1 264 ? -27.984 38.592 -1.660  1.00 107.74 ?  308 GLN A CB  1 
ATOM   1943 C CG  . GLN A 1 264 ? -28.334 38.459 -3.150  1.00 108.31 ?  308 GLN A CG  1 
ATOM   1944 C CD  . GLN A 1 264 ? -28.865 37.070 -3.530  1.00 108.30 ?  308 GLN A CD  1 
ATOM   1945 O OE1 . GLN A 1 264 ? -28.424 36.053 -2.990  1.00 107.68 ?  308 GLN A OE1 1 
ATOM   1946 N NE2 . GLN A 1 264 ? -29.822 37.032 -4.462  1.00 109.07 ?  308 GLN A NE2 1 
ATOM   1947 N N   . LEU A 1 265 ? -30.403 38.790 0.963   1.00 73.92  ?  309 LEU A N   1 
ATOM   1948 C CA  . LEU A 1 265 ? -31.446 38.002 1.619   1.00 73.27  ?  309 LEU A CA  1 
ATOM   1949 C C   . LEU A 1 265 ? -32.841 38.551 1.437   1.00 73.76  ?  309 LEU A C   1 
ATOM   1950 O O   . LEU A 1 265 ? -33.017 39.733 1.128   1.00 74.92  ?  309 LEU A O   1 
ATOM   1951 C CB  . LEU A 1 265 ? -31.142 37.922 3.105   1.00 72.78  ?  309 LEU A CB  1 
ATOM   1952 C CG  . LEU A 1 265 ? -29.855 37.172 3.383   1.00 72.34  ?  309 LEU A CG  1 
ATOM   1953 C CD1 . LEU A 1 265 ? -29.398 37.500 4.770   1.00 72.33  ?  309 LEU A CD1 1 
ATOM   1954 C CD2 . LEU A 1 265 ? -30.099 35.688 3.201   1.00 70.87  ?  309 LEU A CD2 1 
ATOM   1955 N N   . PRO A 1 266 ? -33.858 37.693 1.629   1.00 80.08  ?  310 PRO A N   1 
ATOM   1956 C CA  . PRO A 1 266 ? -35.247 38.185 1.604   1.00 80.57  ?  310 PRO A CA  1 
ATOM   1957 C C   . PRO A 1 266 ? -35.524 39.097 2.785   1.00 80.90  ?  310 PRO A C   1 
ATOM   1958 O O   . PRO A 1 266 ? -34.864 38.995 3.820   1.00 80.34  ?  310 PRO A O   1 
ATOM   1959 C CB  . PRO A 1 266 ? -36.087 36.913 1.759   1.00 79.51  ?  310 PRO A CB  1 
ATOM   1960 C CG  . PRO A 1 266 ? -35.158 35.766 1.434   1.00 78.78  ?  310 PRO A CG  1 
ATOM   1961 C CD  . PRO A 1 266 ? -33.769 36.226 1.737   1.00 78.85  ?  310 PRO A CD  1 
ATOM   1962 N N   . SER A 1 267 ? -36.480 39.997 2.614   1.00 83.50  ?  311 SER A N   1 
ATOM   1963 C CA  . SER A 1 267 ? -37.025 40.745 3.732   1.00 83.90  ?  311 SER A CA  1 
ATOM   1964 C C   . SER A 1 267 ? -37.938 39.833 4.554   1.00 82.76  ?  311 SER A C   1 
ATOM   1965 O O   . SER A 1 267 ? -38.339 38.760 4.095   1.00 82.04  ?  311 SER A O   1 
ATOM   1966 C CB  . SER A 1 267 ? -37.781 41.973 3.238   1.00 86.42  ?  311 SER A CB  1 
ATOM   1967 O OG  . SER A 1 267 ? -38.445 41.659 2.042   1.00 88.04  ?  311 SER A OG  1 
ATOM   1968 N N   . VAL A 1 268 ? -38.229 40.241 5.785   1.00 83.11  ?  312 VAL A N   1 
ATOM   1969 C CA  . VAL A 1 268 ? -39.097 39.462 6.665   1.00 82.51  ?  312 VAL A CA  1 
ATOM   1970 C C   . VAL A 1 268 ? -40.095 40.366 7.368   1.00 84.81  ?  312 VAL A C   1 
ATOM   1971 O O   . VAL A 1 268 ? -39.876 41.571 7.466   1.00 86.31  ?  312 VAL A O   1 
ATOM   1972 C CB  . VAL A 1 268 ? -38.284 38.698 7.736   1.00 80.90  ?  312 VAL A CB  1 
ATOM   1973 C CG1 . VAL A 1 268 ? -37.309 37.714 7.083   1.00 79.67  ?  312 VAL A CG1 1 
ATOM   1974 C CG2 . VAL A 1 268 ? -37.572 39.665 8.683   1.00 81.82  ?  312 VAL A CG2 1 
ATOM   1975 N N   . GLY A 1 269 ? -41.195 39.793 7.851   1.00 82.64  ?  313 GLY A N   1 
ATOM   1976 C CA  . GLY A 1 269 ? -42.169 40.547 8.626   1.00 85.95  ?  313 GLY A CA  1 
ATOM   1977 C C   . GLY A 1 269 ? -41.806 40.469 10.095  1.00 83.96  ?  313 GLY A C   1 
ATOM   1978 O O   . GLY A 1 269 ? -40.743 39.933 10.448  1.00 81.47  ?  313 GLY A O   1 
ATOM   1979 N N   . GLN A 1 270 ? -42.690 40.967 10.958  1.00 106.29 ?  314 GLN A N   1 
ATOM   1980 C CA  . GLN A 1 270 ? -42.382 41.065 12.381  1.00 105.34 ?  314 GLN A CA  1 
ATOM   1981 C C   . GLN A 1 270 ? -42.413 39.734 13.120  1.00 103.42 ?  314 GLN A C   1 
ATOM   1982 O O   . GLN A 1 270 ? -41.718 39.563 14.118  1.00 102.24 ?  314 GLN A O   1 
ATOM   1983 C CB  . GLN A 1 270 ? -43.299 42.074 13.062  1.00 109.52 ?  314 GLN A CB  1 
ATOM   1984 C CG  . GLN A 1 270 ? -42.944 43.513 12.773  1.00 111.64 ?  314 GLN A CG  1 
ATOM   1985 C CD  . GLN A 1 270 ? -44.039 44.475 13.199  1.00 117.15 ?  314 GLN A CD  1 
ATOM   1986 O OE1 . GLN A 1 270 ? -45.174 44.072 13.487  1.00 119.87 ?  314 GLN A OE1 1 
ATOM   1987 N NE2 . GLN A 1 270 ? -43.706 45.761 13.236  1.00 119.22 ?  314 GLN A NE2 1 
ATOM   1988 N N   . GLU A 1 271 ? -43.208 38.794 12.631  1.00 98.29  ?  315 GLU A N   1 
ATOM   1989 C CA  . GLU A 1 271 ? -43.249 37.465 13.228  1.00 96.53  ?  315 GLU A CA  1 
ATOM   1990 C C   . GLU A 1 271 ? -42.032 36.653 12.814  1.00 93.33  ?  315 GLU A C   1 
ATOM   1991 O O   . GLU A 1 271 ? -41.730 35.612 13.396  1.00 91.51  ?  315 GLU A O   1 
ATOM   1992 C CB  . GLU A 1 271 ? -44.503 36.720 12.788  1.00 98.90  ?  315 GLU A CB  1 
ATOM   1993 C CG  . GLU A 1 271 ? -45.820 37.257 13.348  1.00 103.94 ?  315 GLU A CG  1 
ATOM   1994 C CD  . GLU A 1 271 ? -47.015 36.481 12.815  1.00 107.22 ?  315 GLU A CD  1 
ATOM   1995 O OE1 . GLU A 1 271 ? -46.790 35.465 12.114  1.00 105.31 ?  315 GLU A OE1 1 
ATOM   1996 O OE2 . GLU A 1 271 ? -48.175 36.878 13.091  1.00 112.20 ?  315 GLU A OE2 1 
ATOM   1997 N N   . GLN A 1 272 ? -41.388 37.105 11.748  1.00 78.94  ?  316 GLN A N   1 
ATOM   1998 C CA  . GLN A 1 272 ? -40.168 36.506 11.232  1.00 76.79  ?  316 GLN A CA  1 
ATOM   1999 C C   . GLN A 1 272 ? -38.876 37.000 11.914  1.00 77.00  ?  316 GLN A C   1 
ATOM   2000 O O   . GLN A 1 272 ? -38.840 38.100 12.458  1.00 78.57  ?  316 GLN A O   1 
ATOM   2001 C CB  . GLN A 1 272 ? -40.123 36.708 9.725   1.00 77.06  ?  316 GLN A CB  1 
ATOM   2002 C CG  . GLN A 1 272 ? -40.826 35.628 8.928   1.00 76.66  ?  316 GLN A CG  1 
ATOM   2003 C CD  . GLN A 1 272 ? -40.916 35.986 7.468   1.00 77.95  ?  316 GLN A CD  1 
ATOM   2004 O OE1 . GLN A 1 272 ? -41.591 36.943 7.101   1.00 80.45  ?  316 GLN A OE1 1 
ATOM   2005 N NE2 . GLN A 1 272 ? -40.224 35.233 6.624   1.00 76.48  ?  316 GLN A NE2 1 
ATOM   2006 N N   . PHE A 1 273 ? -37.817 36.203 11.889  1.00 66.90  ?  317 PHE A N   1 
ATOM   2007 C CA  . PHE A 1 273 ? -36.522 36.701 12.388  1.00 67.39  ?  317 PHE A CA  1 
ATOM   2008 C C   . PHE A 1 273 ? -35.311 36.283 11.530  1.00 66.47  ?  317 PHE A C   1 
ATOM   2009 O O   . PHE A 1 273 ? -35.412 35.383 10.694  1.00 65.15  ?  317 PHE A O   1 
ATOM   2010 C CB  . PHE A 1 273 ? -36.291 36.254 13.836  1.00 67.25  ?  317 PHE A CB  1 
ATOM   2011 C CG  . PHE A 1 273 ? -36.113 34.781 13.981  1.00 65.22  ?  317 PHE A CG  1 
ATOM   2012 C CD1 . PHE A 1 273 ? -37.223 33.951 14.128  1.00 64.40  ?  317 PHE A CD1 1 
ATOM   2013 C CD2 . PHE A 1 273 ? -34.842 34.223 13.941  1.00 64.21  ?  317 PHE A CD2 1 
ATOM   2014 C CE1 . PHE A 1 273 ? -37.082 32.590 14.236  1.00 62.55  ?  317 PHE A CE1 1 
ATOM   2015 C CE2 . PHE A 1 273 ? -34.668 32.862 14.052  1.00 62.23  ?  317 PHE A CE2 1 
ATOM   2016 C CZ  . PHE A 1 273 ? -35.796 32.034 14.200  1.00 61.35  ?  317 PHE A CZ  1 
ATOM   2017 N N   . TYR A 1 274 ? -34.170 36.942 11.743  1.00 66.52  ?  318 TYR A N   1 
ATOM   2018 C CA  . TYR A 1 274 ? -32.887 36.466 11.210  1.00 65.82  ?  318 TYR A CA  1 
ATOM   2019 C C   . TYR A 1 274 ? -32.041 35.961 12.369  1.00 65.44  ?  318 TYR A C   1 
ATOM   2020 O O   . TYR A 1 274 ? -32.141 36.472 13.480  1.00 66.62  ?  318 TYR A O   1 
ATOM   2021 C CB  . TYR A 1 274 ? -32.098 37.583 10.549  1.00 67.60  ?  318 TYR A CB  1 
ATOM   2022 C CG  . TYR A 1 274 ? -32.779 38.266 9.408   1.00 68.36  ?  318 TYR A CG  1 
ATOM   2023 C CD1 . TYR A 1 274 ? -32.779 37.712 8.137   1.00 67.63  ?  318 TYR A CD1 1 
ATOM   2024 C CD2 . TYR A 1 274 ? -33.402 39.480 9.592   1.00 69.97  ?  318 TYR A CD2 1 
ATOM   2025 C CE1 . TYR A 1 274 ? -33.394 38.338 7.091   1.00 68.53  ?  318 TYR A CE1 1 
ATOM   2026 C CE2 . TYR A 1 274 ? -34.014 40.120 8.547   1.00 70.66  ?  318 TYR A CE2 1 
ATOM   2027 C CZ  . TYR A 1 274 ? -34.012 39.545 7.302   1.00 69.96  ?  318 TYR A CZ  1 
ATOM   2028 O OH  . TYR A 1 274 ? -34.645 40.200 6.266   1.00 70.83  ?  318 TYR A OH  1 
ATOM   2029 N N   . SER A 1 275 ? -31.181 34.985 12.106  1.00 68.52  ?  319 SER A N   1 
ATOM   2030 C CA  . SER A 1 275 ? -30.210 34.556 13.100  1.00 68.33  ?  319 SER A CA  1 
ATOM   2031 C C   . SER A 1 275 ? -28.857 34.216 12.465  1.00 67.90  ?  319 SER A C   1 
ATOM   2032 O O   . SER A 1 275 ? -28.802 33.596 11.400  1.00 66.63  ?  319 SER A O   1 
ATOM   2033 C CB  . SER A 1 275 ? -30.762 33.359 13.869  1.00 66.56  ?  319 SER A CB  1 
ATOM   2034 O OG  . SER A 1 275 ? -29.955 33.038 14.975  1.00 66.74  ?  319 SER A OG  1 
ATOM   2035 N N   . ILE A 1 276 ? -27.767 34.615 13.127  1.00 51.65  ?  320 ILE A N   1 
ATOM   2036 C CA  . ILE A 1 276 ? -26.440 34.306 12.633  1.00 51.16  ?  320 ILE A CA  1 
ATOM   2037 C C   . ILE A 1 276 ? -26.177 32.948 13.235  1.00 48.72  ?  320 ILE A C   1 
ATOM   2038 O O   . ILE A 1 276 ? -26.025 32.815 14.450  1.00 48.98  ?  320 ILE A O   1 
ATOM   2039 C CB  . ILE A 1 276 ? -25.323 35.223 13.220  1.00 53.15  ?  320 ILE A CB  1 
ATOM   2040 C CG1 . ILE A 1 276 ? -25.581 36.706 12.982  1.00 56.26  ?  320 ILE A CG1 1 
ATOM   2041 C CG2 . ILE A 1 276 ? -23.888 34.776 12.717  1.00 51.60  ?  320 ILE A CG2 1 
ATOM   2042 C CD1 . ILE A 1 276 ? -26.050 37.000 11.637  1.00 56.83  ?  320 ILE A CD1 1 
ATOM   2043 N N   . LEU A 1 277 ? -26.095 31.923 12.409  1.00 55.43  ?  321 LEU A N   1 
ATOM   2044 C CA  . LEU A 1 277 ? -25.856 30.628 12.988  1.00 53.01  ?  321 LEU A CA  1 
ATOM   2045 C C   . LEU A 1 277 ? -24.379 30.475 13.306  1.00 52.34  ?  321 LEU A C   1 
ATOM   2046 O O   . LEU A 1 277 ? -24.019 29.853 14.271  1.00 50.86  ?  321 LEU A O   1 
ATOM   2047 C CB  . LEU A 1 277 ? -26.344 29.531 12.051  1.00 51.04  ?  321 LEU A CB  1 
ATOM   2048 C CG  . LEU A 1 277 ? -27.824 29.572 11.684  1.00 51.23  ?  321 LEU A CG  1 
ATOM   2049 C CD1 . LEU A 1 277 ? -28.109 28.649 10.507  1.00 50.12  ?  321 LEU A CD1 1 
ATOM   2050 C CD2 . LEU A 1 277 ? -28.696 29.198 12.907  1.00 50.78  ?  321 LEU A CD2 1 
ATOM   2051 N N   . ALA A 1 278 ? -23.517 30.959 12.430  1.00 55.75  ?  322 ALA A N   1 
ATOM   2052 C CA  . ALA A 1 278 ? -22.089 30.901 12.689  1.00 54.56  ?  322 ALA A CA  1 
ATOM   2053 C C   . ALA A 1 278 ? -21.425 31.940 11.836  1.00 55.84  ?  322 ALA A C   1 
ATOM   2054 O O   . ALA A 1 278 ? -21.876 32.203 10.714  1.00 56.91  ?  322 ALA A O   1 
ATOM   2055 C CB  . ALA A 1 278 ? -21.534 29.516 12.393  1.00 51.59  ?  322 ALA A CB  1 
ATOM   2056 N N   . ALA A 1 279 ? -20.353 32.528 12.340  1.00 57.74  ?  323 ALA A N   1 
ATOM   2057 C CA  . ALA A 1 279 ? -19.651 33.514 11.560  1.00 58.52  ?  323 ALA A CA  1 
ATOM   2058 C C   . ALA A 1 279 ? -18.181 33.410 11.886  1.00 56.39  ?  323 ALA A C   1 
ATOM   2059 O O   . ALA A 1 279 ? -17.789 33.087 13.032  1.00 55.22  ?  323 ALA A O   1 
ATOM   2060 C CB  . ALA A 1 279 ? -20.155 34.897 11.859  1.00 61.20  ?  323 ALA A CB  1 
ATOM   2061 N N   . ASN A 1 280 ? -17.392 33.595 10.828  1.00 52.38  ?  324 ASN A N   1 
ATOM   2062 C CA  . ASN A 1 280 ? -15.950 33.390 10.795  1.00 50.69  ?  324 ASN A CA  1 
ATOM   2063 C C   . ASN A 1 280 ? -15.339 34.369 9.795   1.00 51.66  ?  324 ASN A C   1 
ATOM   2064 O O   . ASN A 1 280 ? -16.053 34.950 8.978   1.00 53.57  ?  324 ASN A O   1 
ATOM   2065 C CB  . ASN A 1 280 ? -15.617 31.951 10.403  1.00 48.33  ?  324 ASN A CB  1 
ATOM   2066 C CG  . ASN A 1 280 ? -15.999 31.633 8.971   1.00 48.56  ?  324 ASN A CG  1 
ATOM   2067 O OD1 . ASN A 1 280 ? -16.587 32.461 8.275   1.00 50.10  ?  324 ASN A OD1 1 
ATOM   2068 N ND2 . ASN A 1 280 ? -15.664 30.429 8.522   1.00 47.12  ?  324 ASN A ND2 1 
ATOM   2069 N N   . ASP A 1 281 ? -14.028 34.567 9.870   1.00 86.36  ?  325 ASP A N   1 
ATOM   2070 C CA  . ASP A 1 281 ? -13.383 35.645 9.148   1.00 87.42  ?  325 ASP A CA  1 
ATOM   2071 C C   . ASP A 1 281 ? -13.755 35.650 7.661   1.00 88.19  ?  325 ASP A C   1 
ATOM   2072 O O   . ASP A 1 281 ? -13.681 36.674 6.979   1.00 89.30  ?  325 ASP A O   1 
ATOM   2073 C CB  . ASP A 1 281 ? -11.878 35.559 9.374   1.00 86.44  ?  325 ASP A CB  1 
ATOM   2074 C CG  . ASP A 1 281 ? -11.130 36.648 8.682   1.00 87.97  ?  325 ASP A CG  1 
ATOM   2075 O OD1 . ASP A 1 281 ? -11.196 37.786 9.190   1.00 89.94  ?  325 ASP A OD1 1 
ATOM   2076 O OD2 . ASP A 1 281 ? -10.471 36.362 7.642   1.00 87.39  ?  325 ASP A OD2 1 
ATOM   2077 N N   . ASP A 1 282 ? -14.123 34.480 7.166   1.00 73.06  ?  326 ASP A N   1 
ATOM   2078 C CA  . ASP A 1 282 ? -14.550 34.311 5.781   1.00 73.97  ?  326 ASP A CA  1 
ATOM   2079 C C   . ASP A 1 282 ? -16.025 34.570 5.462   1.00 75.57  ?  326 ASP A C   1 
ATOM   2080 O O   . ASP A 1 282 ? -16.328 35.136 4.417   1.00 76.81  ?  326 ASP A O   1 
ATOM   2081 C CB  . ASP A 1 282 ? -14.137 32.937 5.286   1.00 72.97  ?  326 ASP A CB  1 
ATOM   2082 C CG  . ASP A 1 282 ? -12.686 32.669 5.541   1.00 71.67  ?  326 ASP A CG  1 
ATOM   2083 O OD1 . ASP A 1 282 ? -11.869 33.549 5.204   1.00 72.15  ?  326 ASP A OD1 1 
ATOM   2084 O OD2 . ASP A 1 282 ? -12.342 31.611 6.106   1.00 70.28  ?  326 ASP A OD2 1 
ATOM   2085 N N   . MET A 1 283 ? -16.939 34.125 6.330   1.00 65.11  ?  327 MET A N   1 
ATOM   2086 C CA  . MET A 1 283 ? -18.365 34.130 5.987   1.00 66.83  ?  327 MET A CA  1 
ATOM   2087 C C   . MET A 1 283 ? -19.331 33.982 7.166   1.00 67.29  ?  327 MET A C   1 
ATOM   2088 O O   . MET A 1 283 ? -18.903 33.807 8.318   1.00 66.10  ?  327 MET A O   1 
ATOM   2089 C CB  . MET A 1 283 ? -18.649 33.019 4.980   1.00 66.83  ?  327 MET A CB  1 
ATOM   2090 C CG  . MET A 1 283 ? -18.132 31.659 5.404   1.00 64.91  ?  327 MET A CG  1 
ATOM   2091 S SD  . MET A 1 283 ? -19.241 30.690 6.468   1.00 64.26  ?  327 MET A SD  1 
ATOM   2092 C CE  . MET A 1 283 ? -20.530 30.179 5.342   1.00 65.57  ?  327 MET A CE  1 
ATOM   2093 N N   . VAL A 1 284 ? -20.634 34.040 6.862   1.00 59.15  ?  328 VAL A N   1 
ATOM   2094 C CA  . VAL A 1 284 ? -21.669 33.659 7.829   1.00 59.56  ?  328 VAL A CA  1 
ATOM   2095 C C   . VAL A 1 284 ? -22.694 32.694 7.262   1.00 59.37  ?  328 VAL A C   1 
ATOM   2096 O O   . VAL A 1 284 ? -22.988 32.694 6.054   1.00 60.44  ?  328 VAL A O   1 
ATOM   2097 C CB  . VAL A 1 284 ? -22.471 34.863 8.374   1.00 62.13  ?  328 VAL A CB  1 
ATOM   2098 C CG1 . VAL A 1 284 ? -21.556 35.890 8.919   1.00 62.14  ?  328 VAL A CG1 1 
ATOM   2099 C CG2 . VAL A 1 284 ? -23.283 35.490 7.278   1.00 64.60  ?  328 VAL A CG2 1 
ATOM   2100 N N   . PHE A 1 285 ? -23.234 31.872 8.160   1.00 57.86  ?  329 PHE A N   1 
ATOM   2101 C CA  . PHE A 1 285 ? -24.449 31.106 7.898   1.00 57.07  ?  329 PHE A CA  1 
ATOM   2102 C C   . PHE A 1 285 ? -25.595 31.891 8.484   1.00 58.22  ?  329 PHE A C   1 
ATOM   2103 O O   . PHE A 1 285 ? -25.690 32.038 9.703   1.00 58.12  ?  329 PHE A O   1 
ATOM   2104 C CB  . PHE A 1 285 ? -24.438 29.775 8.633   1.00 54.47  ?  329 PHE A CB  1 
ATOM   2105 C CG  . PHE A 1 285 ? -23.418 28.802 8.143   1.00 53.15  ?  329 PHE A CG  1 
ATOM   2106 C CD1 . PHE A 1 285 ? -22.098 28.916 8.525   1.00 52.54  ?  329 PHE A CD1 1 
ATOM   2107 C CD2 . PHE A 1 285 ? -23.788 27.731 7.350   1.00 52.69  ?  329 PHE A CD2 1 
ATOM   2108 C CE1 . PHE A 1 285 ? -21.185 27.998 8.114   1.00 51.26  ?  329 PHE A CE1 1 
ATOM   2109 C CE2 . PHE A 1 285 ? -22.860 26.814 6.929   1.00 51.99  ?  329 PHE A CE2 1 
ATOM   2110 C CZ  . PHE A 1 285 ? -21.571 26.947 7.318   1.00 51.16  ?  329 PHE A CZ  1 
ATOM   2111 N N   . MET A 1 286 ? -26.477 32.381 7.630   1.00 58.80  ?  330 MET A N   1 
ATOM   2112 C CA  . MET A 1 286 ? -27.614 33.147 8.080   1.00 59.72  ?  330 MET A CA  1 
ATOM   2113 C C   . MET A 1 286 ? -28.853 32.245 8.026   1.00 58.10  ?  330 MET A C   1 
ATOM   2114 O O   . MET A 1 286 ? -29.103 31.597 7.011   1.00 57.81  ?  330 MET A O   1 
ATOM   2115 C CB  . MET A 1 286 ? -27.775 34.362 7.182   1.00 62.22  ?  330 MET A CB  1 
ATOM   2116 C CG  . MET A 1 286 ? -28.827 35.312 7.641   1.00 63.15  ?  330 MET A CG  1 
ATOM   2117 S SD  . MET A 1 286 ? -28.381 36.185 9.139   1.00 64.53  ?  330 MET A SD  1 
ATOM   2118 C CE  . MET A 1 286 ? -27.477 37.572 8.456   1.00 67.68  ?  330 MET A CE  1 
ATOM   2119 N N   . HIS A 1 287 ? -29.593 32.159 9.129   1.00 62.20  ?  331 HIS A N   1 
ATOM   2120 C CA  . HIS A 1 287 ? -30.899 31.487 9.155   1.00 61.21  ?  331 HIS A CA  1 
ATOM   2121 C C   . HIS A 1 287 ? -31.995 32.519 8.943   1.00 62.76  ?  331 HIS A C   1 
ATOM   2122 O O   . HIS A 1 287 ? -32.068 33.499 9.672   1.00 63.97  ?  331 HIS A O   1 
ATOM   2123 C CB  . HIS A 1 287 ? -31.140 30.807 10.513  1.00 59.92  ?  331 HIS A CB  1 
ATOM   2124 C CG  . HIS A 1 287 ? -32.486 30.159 10.638  1.00 59.23  ?  331 HIS A CG  1 
ATOM   2125 N ND1 . HIS A 1 287 ? -32.692 28.820 10.380  1.00 57.76  ?  331 HIS A ND1 1 
ATOM   2126 C CD2 . HIS A 1 287 ? -33.691 30.657 11.001  1.00 60.03  ?  331 HIS A CD2 1 
ATOM   2127 C CE1 . HIS A 1 287 ? -33.964 28.519 10.568  1.00 57.76  ?  331 HIS A CE1 1 
ATOM   2128 N NE2 . HIS A 1 287 ? -34.590 29.615 10.951  1.00 59.06  ?  331 HIS A NE2 1 
ATOM   2129 N N   . VAL A 1 288 ? -32.851 32.319 7.955   1.00 60.22  ?  332 VAL A N   1 
ATOM   2130 C CA  . VAL A 1 288 ? -34.022 33.204 7.803   1.00 61.44  ?  332 VAL A CA  1 
ATOM   2131 C C   . VAL A 1 288 ? -35.312 32.460 8.128   1.00 60.67  ?  332 VAL A C   1 
ATOM   2132 O O   . VAL A 1 288 ? -35.629 31.472 7.456   1.00 60.08  ?  332 VAL A O   1 
ATOM   2133 C CB  . VAL A 1 288 ? -34.159 33.758 6.375   1.00 62.87  ?  332 VAL A CB  1 
ATOM   2134 C CG1 . VAL A 1 288 ? -35.483 34.519 6.249   1.00 63.99  ?  332 VAL A CG1 1 
ATOM   2135 C CG2 . VAL A 1 288 ? -32.966 34.641 5.999   1.00 64.15  ?  332 VAL A CG2 1 
ATOM   2136 N N   . ASP A 1 289 ? -36.045 32.927 9.144   1.00 73.31  ?  333 ASP A N   1 
ATOM   2137 C CA  . ASP A 1 289 ? -37.361 32.367 9.501   1.00 73.02  ?  333 ASP A CA  1 
ATOM   2138 C C   . ASP A 1 289 ? -38.353 32.386 8.345   1.00 73.84  ?  333 ASP A C   1 
ATOM   2139 O O   . ASP A 1 289 ? -38.482 33.383 7.649   1.00 75.26  ?  333 ASP A O   1 
ATOM   2140 C CB  . ASP A 1 289 ? -38.001 33.129 10.659  1.00 73.97  ?  333 ASP A CB  1 
ATOM   2141 C CG  . ASP A 1 289 ? -39.278 32.471 11.129  1.00 73.85  ?  333 ASP A CG  1 
ATOM   2142 O OD1 . ASP A 1 289 ? -39.292 31.218 11.147  1.00 72.62  ?  333 ASP A OD1 1 
ATOM   2143 O OD2 . ASP A 1 289 ? -40.270 33.170 11.450  1.00 75.09  ?  333 ASP A OD2 1 
ATOM   2144 N N   . GLU A 1 290 ? -39.064 31.285 8.154   1.00 76.55  ?  334 GLU A N   1 
ATOM   2145 C CA  . GLU A 1 290 ? -40.138 31.236 7.164   1.00 77.96  ?  334 GLU A CA  1 
ATOM   2146 C C   . GLU A 1 290 ? -41.370 32.008 7.679   1.00 80.11  ?  334 GLU A C   1 
ATOM   2147 O O   . GLU A 1 290 ? -41.633 32.034 8.892   1.00 79.90  ?  334 GLU A O   1 
ATOM   2148 C CB  . GLU A 1 290 ? -40.492 29.774 6.870   1.00 77.48  ?  334 GLU A CB  1 
ATOM   2149 C CG  . GLU A 1 290 ? -40.739 29.446 5.411   1.00 78.94  ?  334 GLU A CG  1 
ATOM   2150 C CD  . GLU A 1 290 ? -39.751 30.115 4.481   1.00 78.97  ?  334 GLU A CD  1 
ATOM   2151 O OE1 . GLU A 1 290 ? -38.514 30.032 4.741   1.00 77.68  ?  334 GLU A OE1 1 
ATOM   2152 O OE2 . GLU A 1 290 ? -40.219 30.726 3.481   1.00 81.00  ?  334 GLU A OE2 1 
ATOM   2153 N N   . PRO A 1 291 ? -42.115 32.662 6.765   1.00 83.21  ?  335 PRO A N   1 
ATOM   2154 C CA  . PRO A 1 291 ? -43.309 33.392 7.211   1.00 87.04  ?  335 PRO A CA  1 
ATOM   2155 C C   . PRO A 1 291 ? -44.304 32.433 7.805   1.00 88.75  ?  335 PRO A C   1 
ATOM   2156 O O   . PRO A 1 291 ? -44.375 31.289 7.362   1.00 88.43  ?  335 PRO A O   1 
ATOM   2157 C CB  . PRO A 1 291 ? -43.868 33.982 5.913   1.00 90.91  ?  335 PRO A CB  1 
ATOM   2158 C CG  . PRO A 1 291 ? -43.354 33.120 4.849   1.00 89.66  ?  335 PRO A CG  1 
ATOM   2159 C CD  . PRO A 1 291 ? -41.966 32.731 5.300   1.00 84.48  ?  335 PRO A CD  1 
ATOM   2160 N N   . GLY A 1 292 ? -45.058 32.887 8.791   1.00 107.02 ?  336 GLY A N   1 
ATOM   2161 C CA  . GLY A 1 292 ? -46.151 32.085 9.292   1.00 109.66 ?  336 GLY A CA  1 
ATOM   2162 C C   . GLY A 1 292 ? -45.853 30.871 10.149  1.00 106.98 ?  336 GLY A C   1 
ATOM   2163 O O   . GLY A 1 292 ? -46.221 29.762 9.781   1.00 107.78 ?  336 GLY A O   1 
ATOM   2164 N N   . ASP A 1 293 ? -45.149 31.071 11.257  1.00 144.34 ?  337 ASP A N   1 
ATOM   2165 C CA  . ASP A 1 293 ? -45.167 30.109 12.360  1.00 143.16 ?  337 ASP A CA  1 
ATOM   2166 C C   . ASP A 1 293 ? -44.903 28.676 11.916  1.00 141.65 ?  337 ASP A C   1 
ATOM   2167 O O   . ASP A 1 293 ? -45.665 27.758 12.211  1.00 143.69 ?  337 ASP A O   1 
ATOM   2168 C CB  . ASP A 1 293 ? -46.497 30.192 13.120  1.00 147.52 ?  337 ASP A CB  1 
ATOM   2169 C CG  . ASP A 1 293 ? -46.459 29.458 14.454  1.00 146.55 ?  337 ASP A CG  1 
ATOM   2170 O OD1 . ASP A 1 293 ? -45.964 30.038 15.446  1.00 145.03 ?  337 ASP A OD1 1 
ATOM   2171 O OD2 . ASP A 1 293 ? -46.930 28.303 14.512  1.00 147.66 ?  337 ASP A OD2 1 
ATOM   2172 N N   . THR A 1 294 ? -43.840 28.511 11.151  1.00 98.37  ?  338 THR A N   1 
ATOM   2173 C CA  . THR A 1 294 ? -43.456 27.216 10.646  1.00 96.94  ?  338 THR A CA  1 
ATOM   2174 C C   . THR A 1 294 ? -42.641 26.433 11.684  1.00 93.67  ?  338 THR A C   1 
ATOM   2175 O O   . THR A 1 294 ? -42.783 25.216 11.813  1.00 93.82  ?  338 THR A O   1 
ATOM   2176 C CB  . THR A 1 294 ? -42.672 27.407 9.360   1.00 95.52  ?  338 THR A CB  1 
ATOM   2177 O OG1 . THR A 1 294 ? -41.455 28.109 9.654   1.00 93.00  ?  338 THR A OG1 1 
ATOM   2178 C CG2 . THR A 1 294 ? -43.487 28.233 8.378   1.00 99.15  ?  338 THR A CG2 1 
ATOM   2179 N N   . GLY A 1 295 ? -41.799 27.140 12.433  1.00 79.06  ?  339 GLY A N   1 
ATOM   2180 C CA  . GLY A 1 295 ? -40.869 26.497 13.352  1.00 76.97  ?  339 GLY A CA  1 
ATOM   2181 C C   . GLY A 1 295 ? -39.627 26.061 12.599  1.00 75.05  ?  339 GLY A C   1 
ATOM   2182 O O   . GLY A 1 295 ? -38.831 25.245 13.070  1.00 73.65  ?  339 GLY A O   1 
ATOM   2183 N N   . PHE A 1 296 ? -39.478 26.604 11.393  1.00 71.80  ?  340 PHE A N   1 
ATOM   2184 C CA  . PHE A 1 296 ? -38.357 26.290 10.537  1.00 71.12  ?  340 PHE A CA  1 
ATOM   2185 C C   . PHE A 1 296 ? -38.098 27.412 9.550   1.00 72.27  ?  340 PHE A C   1 
ATOM   2186 O O   . PHE A 1 296 ? -38.937 28.305 9.352   1.00 73.65  ?  340 PHE A O   1 
ATOM   2187 C CB  . PHE A 1 296 ? -38.545 24.962 9.793   1.00 70.77  ?  340 PHE A CB  1 
ATOM   2188 C CG  . PHE A 1 296 ? -39.591 24.997 8.701   1.00 72.56  ?  340 PHE A CG  1 
ATOM   2189 C CD1 . PHE A 1 296 ? -39.303 25.519 7.443   1.00 73.39  ?  340 PHE A CD1 1 
ATOM   2190 C CD2 . PHE A 1 296 ? -40.859 24.449 8.928   1.00 74.12  ?  340 PHE A CD2 1 
ATOM   2191 C CE1 . PHE A 1 296 ? -40.246 25.527 6.451   1.00 75.49  ?  340 PHE A CE1 1 
ATOM   2192 C CE2 . PHE A 1 296 ? -41.834 24.437 7.914   1.00 77.10  ?  340 PHE A CE2 1 
ATOM   2193 C CZ  . PHE A 1 296 ? -41.525 24.977 6.680   1.00 77.50  ?  340 PHE A CZ  1 
ATOM   2194 N N   . GLY A 1 297 ? -36.938 27.320 8.906   1.00 62.00  ?  341 GLY A N   1 
ATOM   2195 C CA  . GLY A 1 297 ? -36.404 28.389 8.091   1.00 63.04  ?  341 GLY A CA  1 
ATOM   2196 C C   . GLY A 1 297 ? -35.459 27.824 7.054   1.00 63.11  ?  341 GLY A C   1 
ATOM   2197 O O   . GLY A 1 297 ? -35.414 26.615 6.802   1.00 62.63  ?  341 GLY A O   1 
ATOM   2198 N N   . THR A 1 298 ? -34.735 28.726 6.414   1.00 60.95  ?  342 THR A N   1 
ATOM   2199 C CA  . THR A 1 298 ? -33.806 28.371 5.367   1.00 61.57  ?  342 THR A CA  1 
ATOM   2200 C C   . THR A 1 298 ? -32.485 28.929 5.817   1.00 61.26  ?  342 THR A C   1 
ATOM   2201 O O   . THR A 1 298 ? -32.433 30.019 6.388   1.00 61.64  ?  342 THR A O   1 
ATOM   2202 C CB  . THR A 1 298 ? -34.257 28.998 4.036   1.00 63.62  ?  342 THR A CB  1 
ATOM   2203 O OG1 . THR A 1 298 ? -35.658 28.725 3.851   1.00 64.03  ?  342 THR A OG1 1 
ATOM   2204 C CG2 . THR A 1 298 ? -33.487 28.432 2.869   1.00 64.92  ?  342 THR A CG2 1 
ATOM   2205 N N   . ILE A 1 299 ? -31.423 28.156 5.622   1.00 53.96  ?  343 ILE A N   1 
ATOM   2206 C CA  . ILE A 1 299 ? -30.070 28.613 5.931   1.00 53.78  ?  343 ILE A CA  1 
ATOM   2207 C C   . ILE A 1 299 ? -29.418 29.101 4.644   1.00 55.92  ?  343 ILE A C   1 
ATOM   2208 O O   . ILE A 1 299 ? -29.447 28.391 3.655   1.00 57.12  ?  343 ILE A O   1 
ATOM   2209 C CB  . ILE A 1 299 ? -29.226 27.444 6.422   1.00 52.12  ?  343 ILE A CB  1 
ATOM   2210 C CG1 . ILE A 1 299 ? -29.724 26.941 7.766   1.00 50.32  ?  343 ILE A CG1 1 
ATOM   2211 C CG2 . ILE A 1 299 ? -27.736 27.809 6.461   1.00 52.11  ?  343 ILE A CG2 1 
ATOM   2212 C CD1 . ILE A 1 299 ? -28.913 25.732 8.259   1.00 48.66  ?  343 ILE A CD1 1 
ATOM   2213 N N   . PHE A 1 300 ? -28.825 30.295 4.662   1.00 57.91  ?  344 PHE A N   1 
ATOM   2214 C CA  . PHE A 1 300 ? -28.044 30.789 3.522   1.00 60.27  ?  344 PHE A CA  1 
ATOM   2215 C C   . PHE A 1 300 ? -26.575 30.950 3.927   1.00 59.95  ?  344 PHE A C   1 
ATOM   2216 O O   . PHE A 1 300 ? -26.285 31.345 5.055   1.00 58.79  ?  344 PHE A O   1 
ATOM   2217 C CB  . PHE A 1 300 ? -28.562 32.148 3.044   1.00 62.15  ?  344 PHE A CB  1 
ATOM   2218 C CG  . PHE A 1 300 ? -30.010 32.151 2.577   1.00 62.28  ?  344 PHE A CG  1 
ATOM   2219 C CD1 . PHE A 1 300 ? -31.065 32.083 3.490   1.00 60.87  ?  344 PHE A CD1 1 
ATOM   2220 C CD2 . PHE A 1 300 ? -30.318 32.291 1.234   1.00 63.93  ?  344 PHE A CD2 1 
ATOM   2221 C CE1 . PHE A 1 300 ? -32.388 32.115 3.060   1.00 61.20  ?  344 PHE A CE1 1 
ATOM   2222 C CE2 . PHE A 1 300 ? -31.658 32.335 0.803   1.00 64.07  ?  344 PHE A CE2 1 
ATOM   2223 C CZ  . PHE A 1 300 ? -32.676 32.241 1.715   1.00 62.79  ?  344 PHE A CZ  1 
ATOM   2224 N N   . THR A 1 301 ? -25.639 30.649 3.031   1.00 54.00  ?  345 THR A N   1 
ATOM   2225 C CA  . THR A 1 301 ? -24.231 30.957 3.325   1.00 53.18  ?  345 THR A CA  1 
ATOM   2226 C C   . THR A 1 301 ? -23.834 32.195 2.525   1.00 55.54  ?  345 THR A C   1 
ATOM   2227 O O   . THR A 1 301 ? -24.331 32.391 1.413   1.00 57.27  ?  345 THR A O   1 
ATOM   2228 C CB  . THR A 1 301 ? -23.303 29.776 3.009   1.00 51.47  ?  345 THR A CB  1 
ATOM   2229 O OG1 . THR A 1 301 ? -23.527 29.354 1.668   1.00 53.40  ?  345 THR A OG1 1 
ATOM   2230 C CG2 . THR A 1 301 ? -23.607 28.610 3.940   1.00 49.08  ?  345 THR A CG2 1 
ATOM   2231 N N   . SER A 1 302 ? -22.992 33.057 3.089   1.00 59.49  ?  346 SER A N   1 
ATOM   2232 C CA  . SER A 1 302 ? -22.676 34.282 2.384   1.00 60.25  ?  346 SER A CA  1 
ATOM   2233 C C   . SER A 1 302 ? -21.377 34.136 1.629   1.00 58.76  ?  346 SER A C   1 
ATOM   2234 O O   . SER A 1 302 ? -20.608 33.200 1.862   1.00 57.21  ?  346 SER A O   1 
ATOM   2235 C CB  . SER A 1 302 ? -22.471 35.405 3.373   1.00 60.28  ?  346 SER A CB  1 
ATOM   2236 O OG  . SER A 1 302 ? -21.312 35.142 4.131   1.00 58.16  ?  346 SER A OG  1 
ATOM   2237 N N   . ASP A 1 303 ? -21.097 35.139 0.799   1.00 64.12  ?  347 ASP A N   1 
ATOM   2238 C CA  . ASP A 1 303 ? -19.801 35.306 0.219   1.00 62.99  ?  347 ASP A CA  1 
ATOM   2239 C C   . ASP A 1 303 ? -18.949 36.043 1.234   1.00 61.89  ?  347 ASP A C   1 
ATOM   2240 O O   . ASP A 1 303 ? -19.409 36.354 2.337   1.00 62.04  ?  347 ASP A O   1 
ATOM   2241 C CB  . ASP A 1 303 ? -19.894 36.049 -1.119  1.00 64.07  ?  347 ASP A CB  1 
ATOM   2242 C CG  . ASP A 1 303 ? -20.197 37.542 -0.981  1.00 64.82  ?  347 ASP A CG  1 
ATOM   2243 O OD1 . ASP A 1 303 ? -20.535 38.031 0.115   1.00 64.96  ?  347 ASP A OD1 1 
ATOM   2244 O OD2 . ASP A 1 303 ? -20.101 38.229 -2.020  1.00 65.42  ?  347 ASP A OD2 1 
ATOM   2245 N N   . ASP A 1 304 ? -17.706 36.331 0.872   1.00 82.53  ?  348 ASP A N   1 
ATOM   2246 C CA  . ASP A 1 304 ? -16.761 36.864 1.841   1.00 81.45  ?  348 ASP A CA  1 
ATOM   2247 C C   . ASP A 1 304 ? -16.989 38.338 2.133   1.00 82.35  ?  348 ASP A C   1 
ATOM   2248 O O   . ASP A 1 304 ? -16.321 38.921 2.981   1.00 81.85  ?  348 ASP A O   1 
ATOM   2249 C CB  . ASP A 1 304 ? -15.325 36.591 1.412   1.00 80.39  ?  348 ASP A CB  1 
ATOM   2250 C CG  . ASP A 1 304 ? -14.911 37.391 0.184   1.00 81.30  ?  348 ASP A CG  1 
ATOM   2251 O OD1 . ASP A 1 304 ? -15.745 37.584 -0.739  1.00 82.58  ?  348 ASP A OD1 1 
ATOM   2252 O OD2 . ASP A 1 304 ? -13.734 37.822 0.152   1.00 80.87  ?  348 ASP A OD2 1 
ATOM   2253 N N   . ARG A 1 305 ? -17.923 38.946 1.417   1.00 77.80  ?  349 ARG A N   1 
ATOM   2254 C CA  . ARG A 1 305 ? -18.353 40.299 1.759   1.00 78.88  ?  349 ARG A CA  1 
ATOM   2255 C C   . ARG A 1 305 ? -19.557 40.309 2.726   1.00 79.93  ?  349 ARG A C   1 
ATOM   2256 O O   . ARG A 1 305 ? -19.925 41.351 3.268   1.00 80.97  ?  349 ARG A O   1 
ATOM   2257 C CB  . ARG A 1 305 ? -18.656 41.096 0.496   1.00 79.95  ?  349 ARG A CB  1 
ATOM   2258 C CG  . ARG A 1 305 ? -17.408 41.411 -0.305  1.00 79.37  ?  349 ARG A CG  1 
ATOM   2259 C CD  . ARG A 1 305 ? -17.738 41.786 -1.737  1.00 80.42  ?  349 ARG A CD  1 
ATOM   2260 N NE  . ARG A 1 305 ? -18.627 40.801 -2.333  1.00 80.83  ?  349 ARG A NE  1 
ATOM   2261 C CZ  . ARG A 1 305 ? -19.247 40.956 -3.492  1.00 81.91  ?  349 ARG A CZ  1 
ATOM   2262 N NH1 . ARG A 1 305 ? -19.073 42.061 -4.215  1.00 82.67  ?  349 ARG A NH1 1 
ATOM   2263 N NH2 . ARG A 1 305 ? -20.036 39.991 -3.931  1.00 82.32  ?  349 ARG A NH2 1 
ATOM   2264 N N   . GLY A 1 306 ? -20.139 39.134 2.951   1.00 69.24  ?  350 GLY A N   1 
ATOM   2265 C CA  . GLY A 1 306 ? -21.377 39.017 3.688   1.00 70.69  ?  350 GLY A CA  1 
ATOM   2266 C C   . GLY A 1 306 ? -22.542 39.626 2.928   1.00 72.51  ?  350 GLY A C   1 
ATOM   2267 O O   . GLY A 1 306 ? -23.612 39.828 3.484   1.00 73.99  ?  350 GLY A O   1 
ATOM   2268 N N   . ILE A 1 307 ? -22.304 39.995 1.677   1.00 77.53  ?  351 ILE A N   1 
ATOM   2269 C CA  . ILE A 1 307 ? -23.337 40.555 0.823   1.00 78.81  ?  351 ILE A CA  1 
ATOM   2270 C C   . ILE A 1 307 ? -24.197 39.567 0.021   1.00 79.08  ?  351 ILE A C   1 
ATOM   2271 O O   . ILE A 1 307 ? -25.425 39.686 0.007   1.00 79.98  ?  351 ILE A O   1 
ATOM   2272 C CB  . ILE A 1 307 ? -22.722 41.604 -0.103  1.00 78.73  ?  351 ILE A CB  1 
ATOM   2273 C CG1 . ILE A 1 307 ? -22.160 42.741 0.758   1.00 78.85  ?  351 ILE A CG1 1 
ATOM   2274 C CG2 . ILE A 1 307 ? -23.748 42.106 -1.099  1.00 79.91  ?  351 ILE A CG2 1 
ATOM   2275 C CD1 . ILE A 1 307 ? -21.192 43.663 0.044   1.00 78.47  ?  351 ILE A CD1 1 
ATOM   2276 N N   . VAL A 1 308 ? -23.554 38.589 -0.622  1.00 81.63  ?  352 VAL A N   1 
ATOM   2277 C CA  . VAL A 1 308 ? -24.237 37.692 -1.562  1.00 82.11  ?  352 VAL A CA  1 
ATOM   2278 C C   . VAL A 1 308 ? -24.505 36.357 -0.906  1.00 81.87  ?  352 VAL A C   1 
ATOM   2279 O O   . VAL A 1 308 ? -23.595 35.763 -0.320  1.00 80.76  ?  352 VAL A O   1 
ATOM   2280 C CB  . VAL A 1 308 ? -23.395 37.434 -2.828  1.00 81.67  ?  352 VAL A CB  1 
ATOM   2281 C CG1 . VAL A 1 308 ? -24.158 36.556 -3.797  1.00 82.51  ?  352 VAL A CG1 1 
ATOM   2282 C CG2 . VAL A 1 308 ? -23.016 38.735 -3.493  1.00 81.90  ?  352 VAL A CG2 1 
ATOM   2283 N N   . TYR A 1 309 ? -25.749 35.879 -0.997  1.00 67.36  ?  353 TYR A N   1 
ATOM   2284 C CA  . TYR A 1 309 ? -26.123 34.667 -0.247  1.00 67.17  ?  353 TYR A CA  1 
ATOM   2285 C C   . TYR A 1 309 ? -26.587 33.514 -1.109  1.00 67.44  ?  353 TYR A C   1 
ATOM   2286 O O   . TYR A 1 309 ? -27.559 33.630 -1.833  1.00 67.96  ?  353 TYR A O   1 
ATOM   2287 C CB  . TYR A 1 309 ? -27.164 34.982 0.814   1.00 67.14  ?  353 TYR A CB  1 
ATOM   2288 C CG  . TYR A 1 309 ? -26.582 35.801 1.925   1.00 67.19  ?  353 TYR A CG  1 
ATOM   2289 C CD1 . TYR A 1 309 ? -26.345 37.152 1.765   1.00 67.70  ?  353 TYR A CD1 1 
ATOM   2290 C CD2 . TYR A 1 309 ? -26.249 35.218 3.118   1.00 66.69  ?  353 TYR A CD2 1 
ATOM   2291 C CE1 . TYR A 1 309 ? -25.806 37.886 2.768   1.00 67.92  ?  353 TYR A CE1 1 
ATOM   2292 C CE2 . TYR A 1 309 ? -25.712 35.940 4.116   1.00 67.16  ?  353 TYR A CE2 1 
ATOM   2293 C CZ  . TYR A 1 309 ? -25.485 37.267 3.939   1.00 67.79  ?  353 TYR A CZ  1 
ATOM   2294 O OH  . TYR A 1 309 ? -24.931 37.973 4.969   1.00 68.18  ?  353 TYR A OH  1 
ATOM   2295 N N   . SER A 1 310 ? -25.848 32.414 -1.060  1.00 76.14  ?  354 SER A N   1 
ATOM   2296 C CA  . SER A 1 310 ? -26.295 31.181 -1.673  1.00 76.64  ?  354 SER A CA  1 
ATOM   2297 C C   . SER A 1 310 ? -27.274 30.499 -0.717  1.00 76.36  ?  354 SER A C   1 
ATOM   2298 O O   . SER A 1 310 ? -27.211 30.714 0.480   1.00 75.27  ?  354 SER A O   1 
ATOM   2299 C CB  . SER A 1 310 ? -25.098 30.291 -1.970  1.00 76.03  ?  354 SER A CB  1 
ATOM   2300 O OG  . SER A 1 310 ? -25.517 29.084 -2.571  1.00 76.97  ?  354 SER A OG  1 
ATOM   2301 N N   . LYS A 1 311 ? -28.185 29.693 -1.237  1.00 77.06  ?  355 LYS A N   1 
ATOM   2302 C CA  . LYS A 1 311 ? -29.147 29.013 -0.389  1.00 75.69  ?  355 LYS A CA  1 
ATOM   2303 C C   . LYS A 1 311 ? -28.648 27.622 -0.083  1.00 75.52  ?  355 LYS A C   1 
ATOM   2304 O O   . LYS A 1 311 ? -28.547 26.763 -0.948  1.00 77.11  ?  355 LYS A O   1 
ATOM   2305 C CB  . LYS A 1 311 ? -30.511 28.939 -1.059  1.00 75.91  ?  355 LYS A CB  1 
ATOM   2306 C CG  . LYS A 1 311 ? -31.447 28.014 -0.338  1.00 74.48  ?  355 LYS A CG  1 
ATOM   2307 C CD  . LYS A 1 311 ? -32.860 28.101 -0.896  1.00 75.15  ?  355 LYS A CD  1 
ATOM   2308 C CE  . LYS A 1 311 ? -33.327 26.735 -1.404  1.00 75.72  ?  355 LYS A CE  1 
ATOM   2309 N NZ  . LYS A 1 311 ? -34.628 26.771 -2.168  1.00 76.80  ?  355 LYS A NZ  1 
ATOM   2310 N N   . SER A 1 312 ? -28.281 27.430 1.164   1.00 54.25  ?  356 SER A N   1 
ATOM   2311 C CA  . SER A 1 312 ? -27.725 26.166 1.632   1.00 53.09  ?  356 SER A CA  1 
ATOM   2312 C C   . SER A 1 312 ? -28.705 25.067 2.082   1.00 51.90  ?  356 SER A C   1 
ATOM   2313 O O   . SER A 1 312 ? -28.502 23.892 1.768   1.00 53.04  ?  356 SER A O   1 
ATOM   2314 C CB  . SER A 1 312 ? -26.703 26.450 2.738   1.00 50.11  ?  356 SER A CB  1 
ATOM   2315 O OG  . SER A 1 312 ? -26.050 25.255 3.133   1.00 48.76  ?  356 SER A OG  1 
ATOM   2316 N N   . LEU A 1 313 ? -29.721 25.432 2.873   1.00 61.59  ?  357 LEU A N   1 
ATOM   2317 C CA  . LEU A 1 313 ? -30.580 24.404 3.443   1.00 60.29  ?  357 LEU A CA  1 
ATOM   2318 C C   . LEU A 1 313 ? -32.056 24.756 3.693   1.00 59.67  ?  357 LEU A C   1 
ATOM   2319 O O   . LEU A 1 313 ? -32.390 25.756 4.350   1.00 58.69  ?  357 LEU A O   1 
ATOM   2320 C CB  . LEU A 1 313 ? -29.940 23.877 4.716   1.00 57.75  ?  357 LEU A CB  1 
ATOM   2321 C CG  . LEU A 1 313 ? -30.492 22.587 5.310   1.00 56.79  ?  357 LEU A CG  1 
ATOM   2322 C CD1 . LEU A 1 313 ? -30.365 21.449 4.338   1.00 59.18  ?  357 LEU A CD1 1 
ATOM   2323 C CD2 . LEU A 1 313 ? -29.773 22.254 6.592   1.00 54.42  ?  357 LEU A CD2 1 
ATOM   2324 N N   . ASP A 1 314 ? -32.933 23.865 3.259   1.00 77.16  ?  358 ASP A N   1 
ATOM   2325 C CA  . ASP A 1 314 ? -34.363 24.059 3.418   1.00 76.81  ?  358 ASP A CA  1 
ATOM   2326 C C   . ASP A 1 314 ? -34.877 23.431 4.687   1.00 74.84  ?  358 ASP A C   1 
ATOM   2327 O O   . ASP A 1 314 ? -34.302 22.464 5.186   1.00 74.00  ?  358 ASP A O   1 
ATOM   2328 C CB  . ASP A 1 314 ? -35.137 23.497 2.229   1.00 78.67  ?  358 ASP A CB  1 
ATOM   2329 C CG  . ASP A 1 314 ? -35.111 24.420 1.045   1.00 80.55  ?  358 ASP A CG  1 
ATOM   2330 O OD1 . ASP A 1 314 ? -34.922 25.641 1.270   1.00 80.18  ?  358 ASP A OD1 1 
ATOM   2331 O OD2 . ASP A 1 314 ? -35.288 23.928 -0.094  1.00 82.46  ?  358 ASP A OD2 1 
ATOM   2332 N N   . ARG A 1 315 ? -35.931 24.044 5.225   1.00 68.28  ?  359 ARG A N   1 
ATOM   2333 C CA  . ARG A 1 315 ? -36.686 23.503 6.342   1.00 67.06  ?  359 ARG A CA  1 
ATOM   2334 C C   . ARG A 1 315 ? -35.786 23.190 7.506   1.00 65.32  ?  359 ARG A C   1 
ATOM   2335 O O   . ARG A 1 315 ? -35.898 22.137 8.139   1.00 64.52  ?  359 ARG A O   1 
ATOM   2336 C CB  . ARG A 1 315 ? -37.502 22.288 5.910   1.00 67.74  ?  359 ARG A CB  1 
ATOM   2337 C CG  . ARG A 1 315 ? -38.484 22.642 4.822   1.00 69.66  ?  359 ARG A CG  1 
ATOM   2338 C CD  . ARG A 1 315 ? -39.184 21.427 4.235   1.00 71.26  ?  359 ARG A CD  1 
ATOM   2339 N NE  . ARG A 1 315 ? -40.033 20.772 5.207   1.00 71.22  ?  359 ARG A NE  1 
ATOM   2340 C CZ  . ARG A 1 315 ? -41.260 21.183 5.491   1.00 73.70  ?  359 ARG A CZ  1 
ATOM   2341 N NH1 . ARG A 1 315 ? -41.759 22.243 4.863   1.00 75.51  ?  359 ARG A NH1 1 
ATOM   2342 N NH2 . ARG A 1 315 ? -41.976 20.533 6.394   1.00 74.96  ?  359 ARG A NH2 1 
ATOM   2343 N N   . HIS A 1 316 ? -34.870 24.119 7.755   1.00 54.41  ?  360 HIS A N   1 
ATOM   2344 C CA  . HIS A 1 316 ? -33.981 24.035 8.883   1.00 52.94  ?  360 HIS A CA  1 
ATOM   2345 C C   . HIS A 1 316 ? -34.781 24.319 10.159  1.00 52.40  ?  360 HIS A C   1 
ATOM   2346 O O   . HIS A 1 316 ? -35.422 25.355 10.276  1.00 53.22  ?  360 HIS A O   1 
ATOM   2347 C CB  . HIS A 1 316 ? -32.889 25.076 8.749   1.00 53.14  ?  360 HIS A CB  1 
ATOM   2348 C CG  . HIS A 1 316 ? -31.909 25.054 9.883   1.00 51.83  ?  360 HIS A CG  1 
ATOM   2349 N ND1 . HIS A 1 316 ? -31.456 26.202 10.502  1.00 52.14  ?  360 HIS A ND1 1 
ATOM   2350 C CD2 . HIS A 1 316 ? -31.302 24.022 10.518  1.00 50.57  ?  360 HIS A CD2 1 
ATOM   2351 C CE1 . HIS A 1 316 ? -30.613 25.879 11.466  1.00 51.16  ?  360 HIS A CE1 1 
ATOM   2352 N NE2 . HIS A 1 316 ? -30.500 24.562 11.496  1.00 50.02  ?  360 HIS A NE2 1 
ATOM   2353 N N   . LEU A 1 317 ? -34.701 23.434 11.136  1.00 74.77  ?  361 LEU A N   1 
ATOM   2354 C CA  . LEU A 1 317 ? -35.519 23.573 12.311  1.00 74.74  ?  361 LEU A CA  1 
ATOM   2355 C C   . LEU A 1 317 ? -34.961 24.651 13.246  1.00 74.93  ?  361 LEU A C   1 
ATOM   2356 O O   . LEU A 1 317 ? -33.824 24.553 13.705  1.00 74.22  ?  361 LEU A O   1 
ATOM   2357 C CB  . LEU A 1 317 ? -35.548 22.226 12.998  1.00 73.86  ?  361 LEU A CB  1 
ATOM   2358 C CG  . LEU A 1 317 ? -36.401 22.110 14.240  1.00 74.01  ?  361 LEU A CG  1 
ATOM   2359 C CD1 . LEU A 1 317 ? -37.018 20.741 14.252  1.00 73.91  ?  361 LEU A CD1 1 
ATOM   2360 C CD2 . LEU A 1 317 ? -35.549 22.310 15.486  1.00 73.48  ?  361 LEU A CD2 1 
ATOM   2361 N N   . TYR A 1 318 ? -35.742 25.705 13.484  1.00 64.92  ?  362 TYR A N   1 
ATOM   2362 C CA  . TYR A 1 318 ? -35.400 26.697 14.497  1.00 65.76  ?  362 TYR A CA  1 
ATOM   2363 C C   . TYR A 1 318 ? -36.682 27.158 15.179  1.00 67.03  ?  362 TYR A C   1 
ATOM   2364 O O   . TYR A 1 318 ? -37.478 27.845 14.538  1.00 68.12  ?  362 TYR A O   1 
ATOM   2365 C CB  . TYR A 1 318 ? -34.741 27.871 13.784  1.00 66.69  ?  362 TYR A CB  1 
ATOM   2366 C CG  . TYR A 1 318 ? -33.778 28.718 14.586  1.00 67.54  ?  362 TYR A CG  1 
ATOM   2367 C CD1 . TYR A 1 318 ? -34.038 29.062 15.893  1.00 68.55  ?  362 TYR A CD1 1 
ATOM   2368 C CD2 . TYR A 1 318 ? -32.622 29.204 14.011  1.00 67.76  ?  362 TYR A CD2 1 
ATOM   2369 C CE1 . TYR A 1 318 ? -33.149 29.854 16.613  1.00 69.85  ?  362 TYR A CE1 1 
ATOM   2370 C CE2 . TYR A 1 318 ? -31.744 29.999 14.716  1.00 69.02  ?  362 TYR A CE2 1 
ATOM   2371 C CZ  . TYR A 1 318 ? -32.010 30.317 16.010  1.00 70.13  ?  362 TYR A CZ  1 
ATOM   2372 O OH  . TYR A 1 318 ? -31.148 31.109 16.710  1.00 71.83  ?  362 TYR A OH  1 
ATOM   2373 N N   . THR A 1 319 ? -36.895 26.875 16.462  1.00 70.60  ?  363 THR A N   1 
ATOM   2374 C CA  . THR A 1 319 ? -38.190 27.283 17.060  1.00 72.01  ?  363 THR A CA  1 
ATOM   2375 C C   . THR A 1 319 ? -38.241 28.776 17.348  1.00 73.94  ?  363 THR A C   1 
ATOM   2376 O O   . THR A 1 319 ? -37.239 29.372 17.711  1.00 74.26  ?  363 THR A O   1 
ATOM   2377 C CB  . THR A 1 319 ? -38.497 26.580 18.368  1.00 71.98  ?  363 THR A CB  1 
ATOM   2378 O OG1 . THR A 1 319 ? -37.508 26.937 19.346  1.00 72.32  ?  363 THR A OG1 1 
ATOM   2379 C CG2 . THR A 1 319 ? -38.512 25.095 18.169  1.00 70.41  ?  363 THR A CG2 1 
ATOM   2380 N N   . THR A 1 320 ? -39.406 29.381 17.192  1.00 119.15 ?  364 THR A N   1 
ATOM   2381 C CA  . THR A 1 320 ? -39.548 30.826 17.345  1.00 120.98 ?  364 THR A CA  1 
ATOM   2382 C C   . THR A 1 320 ? -39.540 31.274 18.818  1.00 121.83 ?  364 THR A C   1 
ATOM   2383 O O   . THR A 1 320 ? -38.944 32.299 19.170  1.00 122.85 ?  364 THR A O   1 
ATOM   2384 C CB  . THR A 1 320 ? -40.848 31.277 16.687  1.00 122.04 ?  364 THR A CB  1 
ATOM   2385 O OG1 . THR A 1 320 ? -40.781 30.951 15.291  1.00 121.74 ?  364 THR A OG1 1 
ATOM   2386 C CG2 . THR A 1 320 ? -41.062 32.790 16.841  1.00 121.94 ?  364 THR A CG2 1 
ATOM   2387 N N   . THR A 1 321 ? -40.203 30.508 19.677  1.00 119.14 ?  365 THR A N   1 
ATOM   2388 C CA  . THR A 1 321 ? -40.192 30.817 21.098  1.00 119.57 ?  365 THR A CA  1 
ATOM   2389 C C   . THR A 1 321 ? -39.318 29.849 21.864  1.00 118.92 ?  365 THR A C   1 
ATOM   2390 O O   . THR A 1 321 ? -39.446 28.630 21.740  1.00 117.83 ?  365 THR A O   1 
ATOM   2391 C CB  . THR A 1 321 ? -41.601 30.873 21.691  1.00 121.36 ?  365 THR A CB  1 
ATOM   2392 O OG1 . THR A 1 321 ? -42.212 32.106 21.302  1.00 123.71 ?  365 THR A OG1 1 
ATOM   2393 C CG2 . THR A 1 321 ? -41.548 30.827 23.204  1.00 121.03 ?  365 THR A CG2 1 
ATOM   2394 N N   . GLY A 1 322 ? -38.427 30.426 22.657  1.00 104.13 ?  366 GLY A N   1 
ATOM   2395 C CA  . GLY A 1 322 ? -37.377 29.681 23.317  1.00 103.26 ?  366 GLY A CA  1 
ATOM   2396 C C   . GLY A 1 322 ? -36.588 29.059 22.199  1.00 102.67 ?  366 GLY A C   1 
ATOM   2397 O O   . GLY A 1 322 ? -36.497 27.833 22.132  1.00 103.43 ?  366 GLY A O   1 
ATOM   2398 N N   . GLY A 1 323 ? -36.070 29.897 21.295  1.00 66.56  ?  367 GLY A N   1 
ATOM   2399 C CA  . GLY A 1 323 ? -35.655 29.404 19.997  1.00 66.81  ?  367 GLY A CA  1 
ATOM   2400 C C   . GLY A 1 323 ? -34.489 28.458 20.027  1.00 64.49  ?  367 GLY A C   1 
ATOM   2401 O O   . GLY A 1 323 ? -33.349 28.849 20.229  1.00 64.71  ?  367 GLY A O   1 
ATOM   2402 N N   . GLU A 1 324 ? -34.769 27.183 19.775  1.00 86.30  ?  368 GLU A N   1 
ATOM   2403 C CA  . GLU A 1 324 ? -33.720 26.169 19.766  1.00 84.41  ?  368 GLU A CA  1 
ATOM   2404 C C   . GLU A 1 324 ? -33.497 25.566 18.379  1.00 82.92  ?  368 GLU A C   1 
ATOM   2405 O O   . GLU A 1 324 ? -34.436 25.114 17.725  1.00 82.73  ?  368 GLU A O   1 
ATOM   2406 C CB  . GLU A 1 324 ? -34.041 25.062 20.772  1.00 84.02  ?  368 GLU A CB  1 
ATOM   2407 C CG  . GLU A 1 324 ? -34.642 25.562 22.076  1.00 84.35  ?  368 GLU A CG  1 
ATOM   2408 C CD  . GLU A 1 324 ? -36.035 25.016 22.322  1.00 86.21  ?  368 GLU A CD  1 
ATOM   2409 O OE1 . GLU A 1 324 ? -36.823 24.938 21.357  1.00 83.69  ?  368 GLU A OE1 1 
ATOM   2410 O OE2 . GLU A 1 324 ? -36.341 24.666 23.481  1.00 90.34  ?  368 GLU A OE2 1 
ATOM   2411 N N   . THR A 1 325 ? -32.239 25.564 17.943  1.00 54.59  ?  369 THR A N   1 
ATOM   2412 C CA  . THR A 1 325 ? -31.840 24.947 16.681  1.00 53.24  ?  369 THR A CA  1 
ATOM   2413 C C   . THR A 1 325 ? -30.678 23.991 16.938  1.00 51.75  ?  369 THR A C   1 
ATOM   2414 O O   . THR A 1 325 ? -29.806 24.283 17.756  1.00 51.82  ?  369 THR A O   1 
ATOM   2415 C CB  . THR A 1 325 ? -31.413 26.000 15.643  1.00 54.04  ?  369 THR A CB  1 
ATOM   2416 O OG1 . THR A 1 325 ? -31.234 25.373 14.368  1.00 53.01  ?  369 THR A OG1 1 
ATOM   2417 C CG2 . THR A 1 325 ? -30.112 26.666 16.064  1.00 54.75  ?  369 THR A CG2 1 
ATOM   2418 N N   . ASP A 1 326 ? -30.664 22.848 16.256  1.00 58.15  ?  370 ASP A N   1 
ATOM   2419 C CA  . ASP A 1 326 ? -29.652 21.845 16.534  1.00 57.08  ?  370 ASP A CA  1 
ATOM   2420 C C   . ASP A 1 326 ? -28.372 22.199 15.799  1.00 56.78  ?  370 ASP A C   1 
ATOM   2421 O O   . ASP A 1 326 ? -27.440 21.403 15.752  1.00 56.16  ?  370 ASP A O   1 
ATOM   2422 C CB  . ASP A 1 326 ? -30.127 20.448 16.159  1.00 56.76  ?  370 ASP A CB  1 
ATOM   2423 C CG  . ASP A 1 326 ? -31.248 19.947 17.072  1.00 57.10  ?  370 ASP A CG  1 
ATOM   2424 O OD1 . ASP A 1 326 ? -31.387 20.454 18.199  1.00 57.50  ?  370 ASP A OD1 1 
ATOM   2425 O OD2 . ASP A 1 326 ? -32.005 19.038 16.674  1.00 57.30  ?  370 ASP A OD2 1 
ATOM   2426 N N   . PHE A 1 327 ? -28.346 23.385 15.198  1.00 54.32  ?  371 PHE A N   1 
ATOM   2427 C CA  . PHE A 1 327 ? -27.229 23.771 14.358  1.00 54.33  ?  371 PHE A CA  1 
ATOM   2428 C C   . PHE A 1 327 ? -25.904 23.718 15.117  1.00 53.67  ?  371 PHE A C   1 
ATOM   2429 O O   . PHE A 1 327 ? -25.747 24.335 16.171  1.00 54.07  ?  371 PHE A O   1 
ATOM   2430 C CB  . PHE A 1 327 ? -27.416 25.158 13.748  1.00 55.78  ?  371 PHE A CB  1 
ATOM   2431 C CG  . PHE A 1 327 ? -26.308 25.537 12.820  1.00 56.07  ?  371 PHE A CG  1 
ATOM   2432 C CD1 . PHE A 1 327 ? -26.382 25.224 11.463  1.00 56.32  ?  371 PHE A CD1 1 
ATOM   2433 C CD2 . PHE A 1 327 ? -25.157 26.143 13.297  1.00 56.29  ?  371 PHE A CD2 1 
ATOM   2434 C CE1 . PHE A 1 327 ? -25.338 25.544 10.595  1.00 56.83  ?  371 PHE A CE1 1 
ATOM   2435 C CE2 . PHE A 1 327 ? -24.115 26.461 12.437  1.00 56.55  ?  371 PHE A CE2 1 
ATOM   2436 C CZ  . PHE A 1 327 ? -24.215 26.166 11.078  1.00 56.83  ?  371 PHE A CZ  1 
ATOM   2437 N N   . THR A 1 328 ? -24.959 22.980 14.560  1.00 51.48  ?  372 THR A N   1 
ATOM   2438 C CA  . THR A 1 328 ? -23.745 22.685 15.267  1.00 50.73  ?  372 THR A CA  1 
ATOM   2439 C C   . THR A 1 328 ? -22.492 22.773 14.392  1.00 50.65  ?  372 THR A C   1 
ATOM   2440 O O   . THR A 1 328 ? -22.371 22.102 13.364  1.00 51.25  ?  372 THR A O   1 
ATOM   2441 C CB  . THR A 1 328 ? -23.840 21.311 15.924  1.00 50.46  ?  372 THR A CB  1 
ATOM   2442 O OG1 . THR A 1 328 ? -24.925 21.305 16.877  1.00 50.54  ?  372 THR A OG1 1 
ATOM   2443 C CG2 . THR A 1 328 ? -22.520 20.980 16.624  1.00 50.07  ?  372 THR A CG2 1 
ATOM   2444 N N   . ASN A 1 329 ? -21.555 23.614 14.810  1.00 51.32  ?  373 ASN A N   1 
ATOM   2445 C CA  . ASN A 1 329 ? -20.235 23.559 14.242  1.00 50.95  ?  373 ASN A CA  1 
ATOM   2446 C C   . ASN A 1 329 ? -19.513 22.355 14.804  1.00 50.50  ?  373 ASN A C   1 
ATOM   2447 O O   . ASN A 1 329 ? -19.302 22.254 16.003  1.00 50.10  ?  373 ASN A O   1 
ATOM   2448 C CB  . ASN A 1 329 ? -19.455 24.814 14.569  1.00 50.81  ?  373 ASN A CB  1 
ATOM   2449 C CG  . ASN A 1 329 ? -18.205 24.955 13.723  1.00 50.62  ?  373 ASN A CG  1 
ATOM   2450 O OD1 . ASN A 1 329 ? -17.582 23.957 13.298  1.00 50.37  ?  373 ASN A OD1 1 
ATOM   2451 N ND2 . ASN A 1 329 ? -17.824 26.213 13.470  1.00 51.26  ?  373 ASN A ND2 1 
ATOM   2452 N N   . VAL A 1 330 ? -19.087 21.457 13.933  1.00 47.28  ?  374 VAL A N   1 
ATOM   2453 C CA  . VAL A 1 330 ? -18.322 20.340 14.411  1.00 47.90  ?  374 VAL A CA  1 
ATOM   2454 C C   . VAL A 1 330 ? -16.879 20.866 14.367  1.00 47.42  ?  374 VAL A C   1 
ATOM   2455 O O   . VAL A 1 330 ? -16.225 20.954 13.304  1.00 47.85  ?  374 VAL A O   1 
ATOM   2456 C CB  . VAL A 1 330 ? -18.492 19.159 13.466  1.00 49.97  ?  374 VAL A CB  1 
ATOM   2457 C CG1 . VAL A 1 330 ? -17.614 17.994 13.861  1.00 51.76  ?  374 VAL A CG1 1 
ATOM   2458 C CG2 . VAL A 1 330 ? -19.925 18.744 13.444  1.00 50.65  ?  374 VAL A CG2 1 
ATOM   2459 N N   . THR A 1 331 ? -16.385 21.169 15.555  1.00 53.19  ?  375 THR A N   1 
ATOM   2460 C CA  . THR A 1 331 ? -15.213 21.987 15.674  1.00 52.75  ?  375 THR A CA  1 
ATOM   2461 C C   . THR A 1 331 ? -13.948 21.158 15.521  1.00 54.19  ?  375 THR A C   1 
ATOM   2462 O O   . THR A 1 331 ? -12.883 21.708 15.296  1.00 54.05  ?  375 THR A O   1 
ATOM   2463 C CB  . THR A 1 331 ? -15.231 22.839 16.960  1.00 52.31  ?  375 THR A CB  1 
ATOM   2464 O OG1 . THR A 1 331 ? -15.485 22.019 18.120  1.00 53.35  ?  375 THR A OG1 1 
ATOM   2465 C CG2 . THR A 1 331 ? -16.314 23.891 16.824  1.00 51.63  ?  375 THR A CG2 1 
ATOM   2466 N N   . SER A 1 332 ? -14.089 19.834 15.550  1.00 54.22  ?  376 SER A N   1 
ATOM   2467 C CA  . SER A 1 332 ? -12.934 18.963 15.425  1.00 56.73  ?  376 SER A CA  1 
ATOM   2468 C C   . SER A 1 332 ? -12.566 18.584 13.975  1.00 57.48  ?  376 SER A C   1 
ATOM   2469 O O   . SER A 1 332 ? -11.645 17.774 13.760  1.00 59.87  ?  376 SER A O   1 
ATOM   2470 C CB  . SER A 1 332 ? -13.125 17.707 16.272  1.00 59.89  ?  376 SER A CB  1 
ATOM   2471 O OG  . SER A 1 332 ? -14.227 16.975 15.809  1.00 60.51  ?  376 SER A OG  1 
ATOM   2472 N N   . LEU A 1 333 ? -13.294 19.105 12.987  1.00 45.05  ?  377 LEU A N   1 
ATOM   2473 C CA  . LEU A 1 333 ? -12.842 18.998 11.600  1.00 45.84  ?  377 LEU A CA  1 
ATOM   2474 C C   . LEU A 1 333 ? -13.321 20.159 10.730  1.00 44.15  ?  377 LEU A C   1 
ATOM   2475 O O   . LEU A 1 333 ? -14.522 20.480 10.742  1.00 43.53  ?  377 LEU A O   1 
ATOM   2476 C CB  . LEU A 1 333 ? -13.262 17.665 10.983  1.00 48.83  ?  377 LEU A CB  1 
ATOM   2477 C CG  . LEU A 1 333 ? -12.632 17.457 9.604   1.00 50.06  ?  377 LEU A CG  1 
ATOM   2478 C CD1 . LEU A 1 333 ? -11.114 17.493 9.721   1.00 50.07  ?  377 LEU A CD1 1 
ATOM   2479 C CD2 . LEU A 1 333 ? -13.089 16.148 8.970   1.00 53.62  ?  377 LEU A CD2 1 
ATOM   2480 N N   . ARG A 1 334 ? -12.434 20.714 9.912   1.00 51.63  ?  378 ARG A N   1 
ATOM   2481 C CA  . ARG A 1 334 ? -12.721 21.904 9.119   1.00 50.90  ?  378 ARG A CA  1 
ATOM   2482 C C   . ARG A 1 334 ? -13.824 21.646 8.095   1.00 52.21  ?  378 ARG A C   1 
ATOM   2483 O O   . ARG A 1 334 ? -13.836 20.596 7.442   1.00 54.05  ?  378 ARG A O   1 
ATOM   2484 C CB  . ARG A 1 334 ? -11.435 22.371 8.435   1.00 51.07  ?  378 ARG A CB  1 
ATOM   2485 C CG  . ARG A 1 334 ? -11.555 23.391 7.320   1.00 51.40  ?  378 ARG A CG  1 
ATOM   2486 C CD  . ARG A 1 334 ? -10.155 23.709 6.777   1.00 51.75  ?  378 ARG A CD  1 
ATOM   2487 N NE  . ARG A 1 334 ? -9.711  22.661 5.860   1.00 53.22  ?  378 ARG A NE  1 
ATOM   2488 C CZ  . ARG A 1 334 ? -9.954  22.707 4.549   1.00 54.58  ?  378 ARG A CZ  1 
ATOM   2489 N NH1 . ARG A 1 334 ? -10.626 23.748 4.049   1.00 54.73  ?  378 ARG A NH1 1 
ATOM   2490 N NH2 . ARG A 1 334 ? -9.543  21.730 3.737   1.00 56.09  ?  378 ARG A NH2 1 
ATOM   2491 N N   . GLY A 1 335 ? -14.751 22.606 7.987   1.00 52.36  ?  379 GLY A N   1 
ATOM   2492 C CA  . GLY A 1 335 ? -15.864 22.562 7.053   1.00 53.95  ?  379 GLY A CA  1 
ATOM   2493 C C   . GLY A 1 335 ? -17.117 21.812 7.499   1.00 54.55  ?  379 GLY A C   1 
ATOM   2494 O O   . GLY A 1 335 ? -18.125 21.851 6.796   1.00 56.01  ?  379 GLY A O   1 
ATOM   2495 N N   . VAL A 1 336 ? -17.069 21.128 8.641   1.00 50.01  ?  380 VAL A N   1 
ATOM   2496 C CA  . VAL A 1 336 ? -18.148 20.202 9.003   1.00 51.11  ?  380 VAL A CA  1 
ATOM   2497 C C   . VAL A 1 336 ? -19.182 20.787 9.970   1.00 49.55  ?  380 VAL A C   1 
ATOM   2498 O O   . VAL A 1 336 ? -18.844 21.303 11.050  1.00 47.65  ?  380 VAL A O   1 
ATOM   2499 C CB  . VAL A 1 336 ? -17.606 18.902 9.631   1.00 51.99  ?  380 VAL A CB  1 
ATOM   2500 C CG1 . VAL A 1 336 ? -18.735 17.986 10.042  1.00 53.34  ?  380 VAL A CG1 1 
ATOM   2501 C CG2 . VAL A 1 336 ? -16.675 18.199 8.671   1.00 54.21  ?  380 VAL A CG2 1 
ATOM   2502 N N   . TYR A 1 337 ? -20.445 20.718 9.576   1.00 49.70  ?  381 TYR A N   1 
ATOM   2503 C CA  . TYR A 1 337 ? -21.517 21.214 10.416  1.00 48.36  ?  381 TYR A CA  1 
ATOM   2504 C C   . TYR A 1 337 ? -22.656 20.188 10.369  1.00 49.20  ?  381 TYR A C   1 
ATOM   2505 O O   . TYR A 1 337 ? -22.872 19.547 9.322   1.00 51.11  ?  381 TYR A O   1 
ATOM   2506 C CB  . TYR A 1 337 ? -21.978 22.575 9.896   1.00 48.32  ?  381 TYR A CB  1 
ATOM   2507 C CG  . TYR A 1 337 ? -20.892 23.624 9.872   1.00 47.88  ?  381 TYR A CG  1 
ATOM   2508 C CD1 . TYR A 1 337 ? -19.925 23.656 8.856   1.00 48.63  ?  381 TYR A CD1 1 
ATOM   2509 C CD2 . TYR A 1 337 ? -20.824 24.591 10.857  1.00 47.11  ?  381 TYR A CD2 1 
ATOM   2510 C CE1 . TYR A 1 337 ? -18.928 24.620 8.836   1.00 48.19  ?  381 TYR A CE1 1 
ATOM   2511 C CE2 . TYR A 1 337 ? -19.842 25.543 10.846  1.00 47.10  ?  381 TYR A CE2 1 
ATOM   2512 C CZ  . TYR A 1 337 ? -18.893 25.561 9.832   1.00 47.48  ?  381 TYR A CZ  1 
ATOM   2513 O OH  . TYR A 1 337 ? -17.896 26.545 9.852   1.00 47.48  ?  381 TYR A OH  1 
ATOM   2514 N N   . ILE A 1 338 ? -23.359 19.997 11.489  1.00 54.48  ?  382 ILE A N   1 
ATOM   2515 C CA  . ILE A 1 338 ? -24.545 19.143 11.487  1.00 54.99  ?  382 ILE A CA  1 
ATOM   2516 C C   . ILE A 1 338 ? -25.758 19.965 11.905  1.00 53.91  ?  382 ILE A C   1 
ATOM   2517 O O   . ILE A 1 338 ? -25.605 20.959 12.614  1.00 52.97  ?  382 ILE A O   1 
ATOM   2518 C CB  . ILE A 1 338 ? -24.394 17.902 12.371  1.00 55.34  ?  382 ILE A CB  1 
ATOM   2519 C CG1 . ILE A 1 338 ? -24.315 18.316 13.817  1.00 53.84  ?  382 ILE A CG1 1 
ATOM   2520 C CG2 . ILE A 1 338 ? -23.151 17.132 12.024  1.00 57.11  ?  382 ILE A CG2 1 
ATOM   2521 C CD1 . ILE A 1 338 ? -24.818 17.226 14.798  1.00 54.29  ?  382 ILE A CD1 1 
ATOM   2522 N N   . THR A 1 339 ? -26.953 19.593 11.438  1.00 49.88  ?  383 THR A N   1 
ATOM   2523 C CA  . THR A 1 339 ? -28.162 20.247 11.947  1.00 49.28  ?  383 THR A CA  1 
ATOM   2524 C C   . THR A 1 339 ? -29.433 19.424 11.743  1.00 49.91  ?  383 THR A C   1 
ATOM   2525 O O   . THR A 1 339 ? -29.387 18.320 11.204  1.00 50.94  ?  383 THR A O   1 
ATOM   2526 C CB  . THR A 1 339 ? -28.332 21.675 11.357  1.00 49.67  ?  383 THR A CB  1 
ATOM   2527 O OG1 . THR A 1 339 ? -29.314 22.414 12.093  1.00 49.50  ?  383 THR A OG1 1 
ATOM   2528 C CG2 . THR A 1 339 ? -28.711 21.645 9.905   1.00 51.15  ?  383 THR A CG2 1 
ATOM   2529 N N   . SER A 1 340 ? -30.563 19.984 12.161  1.00 59.94  ?  384 SER A N   1 
ATOM   2530 C CA  . SER A 1 340 ? -31.847 19.301 12.034  1.00 60.53  ?  384 SER A CA  1 
ATOM   2531 C C   . SER A 1 340 ? -32.678 19.950 10.957  1.00 61.59  ?  384 SER A C   1 
ATOM   2532 O O   . SER A 1 340 ? -32.652 21.173 10.791  1.00 61.68  ?  384 SER A O   1 
ATOM   2533 C CB  . SER A 1 340 ? -32.618 19.309 13.352  1.00 59.93  ?  384 SER A CB  1 
ATOM   2534 O OG  . SER A 1 340 ? -31.988 18.451 14.280  1.00 59.28  ?  384 SER A OG  1 
ATOM   2535 N N   . VAL A 1 341 ? -33.379 19.121 10.197  1.00 47.48  ?  385 VAL A N   1 
ATOM   2536 C CA  . VAL A 1 341 ? -34.339 19.627 9.243   1.00 49.55  ?  385 VAL A CA  1 
ATOM   2537 C C   . VAL A 1 341 ? -35.699 18.993 9.492   1.00 52.79  ?  385 VAL A C   1 
ATOM   2538 O O   . VAL A 1 341 ? -35.831 17.885 10.048  1.00 53.67  ?  385 VAL A O   1 
ATOM   2539 C CB  . VAL A 1 341 ? -33.943 19.303 7.827   1.00 50.23  ?  385 VAL A CB  1 
ATOM   2540 C CG1 . VAL A 1 341 ? -32.645 20.037 7.456   1.00 48.79  ?  385 VAL A CG1 1 
ATOM   2541 C CG2 . VAL A 1 341 ? -33.809 17.806 7.673   1.00 51.18  ?  385 VAL A CG2 1 
ATOM   2542 N N   . LEU A 1 342 ? -36.729 19.708 9.078   1.00 71.32  ?  386 LEU A N   1 
ATOM   2543 C CA  . LEU A 1 342 ? -38.061 19.220 9.305   1.00 72.21  ?  386 LEU A CA  1 
ATOM   2544 C C   . LEU A 1 342 ? -38.594 18.644 7.992   1.00 74.28  ?  386 LEU A C   1 
ATOM   2545 O O   . LEU A 1 342 ? -38.572 19.291 6.944   1.00 75.10  ?  386 LEU A O   1 
ATOM   2546 C CB  . LEU A 1 342 ? -38.926 20.326 9.902   1.00 72.50  ?  386 LEU A CB  1 
ATOM   2547 C CG  . LEU A 1 342 ? -40.413 20.005 10.135  1.00 74.94  ?  386 LEU A CG  1 
ATOM   2548 C CD1 . LEU A 1 342 ? -40.609 18.743 10.977  1.00 75.69  ?  386 LEU A CD1 1 
ATOM   2549 C CD2 . LEU A 1 342 ? -41.134 21.196 10.774  1.00 75.88  ?  386 LEU A CD2 1 
ATOM   2550 N N   . SER A 1 343 ? -39.022 17.395 8.041   1.00 82.33  ?  387 SER A N   1 
ATOM   2551 C CA  . SER A 1 343 ? -39.461 16.748 6.834   1.00 84.80  ?  387 SER A CA  1 
ATOM   2552 C C   . SER A 1 343 ? -40.931 17.030 6.580   1.00 88.63  ?  387 SER A C   1 
ATOM   2553 O O   . SER A 1 343 ? -41.592 17.678 7.390   1.00 89.07  ?  387 SER A O   1 
ATOM   2554 C CB  . SER A 1 343 ? -39.219 15.248 6.916   1.00 85.68  ?  387 SER A CB  1 
ATOM   2555 O OG  . SER A 1 343 ? -39.302 14.668 5.616   1.00 87.70  ?  387 SER A OG  1 
ATOM   2556 N N   . GLU A 1 344 ? -41.433 16.528 5.453   1.00 102.22 ?  388 GLU A N   1 
ATOM   2557 C CA  . GLU A 1 344 ? -42.822 16.714 5.059   1.00 106.75 ?  388 GLU A CA  1 
ATOM   2558 C C   . GLU A 1 344 ? -43.757 15.898 5.933   1.00 109.49 ?  388 GLU A C   1 
ATOM   2559 O O   . GLU A 1 344 ? -44.815 16.371 6.312   1.00 112.22 ?  388 GLU A O   1 
ATOM   2560 C CB  . GLU A 1 344 ? -43.004 16.320 3.606   1.00 109.76 ?  388 GLU A CB  1 
ATOM   2561 C CG  . GLU A 1 344 ? -42.188 17.154 2.639   1.00 107.88 ?  388 GLU A CG  1 
ATOM   2562 C CD  . GLU A 1 344 ? -42.583 18.621 2.638   1.00 107.82 ?  388 GLU A CD  1 
ATOM   2563 O OE1 . GLU A 1 344 ? -43.773 18.929 2.872   1.00 111.02 ?  388 GLU A OE1 1 
ATOM   2564 O OE2 . GLU A 1 344 ? -41.689 19.465 2.395   1.00 104.87 ?  388 GLU A OE2 1 
ATOM   2565 N N   . ASP A 1 345 ? -43.332 14.686 6.279   1.00 116.92 ?  389 ASP A N   1 
ATOM   2566 C CA  . ASP A 1 345 ? -44.056 13.794 7.196   1.00 119.61 ?  389 ASP A CA  1 
ATOM   2567 C C   . ASP A 1 345 ? -44.047 14.331 8.623   1.00 117.44 ?  389 ASP A C   1 
ATOM   2568 O O   . ASP A 1 345 ? -44.453 13.652 9.563   1.00 119.02 ?  389 ASP A O   1 
ATOM   2569 C CB  . ASP A 1 345 ? -43.529 12.352 7.150   1.00 120.03 ?  389 ASP A CB  1 
ATOM   2570 C CG  . ASP A 1 345 ? -42.010 12.269 7.207   1.00 115.12 ?  389 ASP A CG  1 
ATOM   2571 O OD1 . ASP A 1 345 ? -41.381 13.003 8.011   1.00 111.23 ?  389 ASP A OD1 1 
ATOM   2572 O OD2 . ASP A 1 345 ? -41.442 11.461 6.435   1.00 115.71 ?  389 ASP A OD2 1 
ATOM   2573 N N   . ASN A 1 346 ? -43.469 15.515 8.770   1.00 104.05 ?  390 ASN A N   1 
ATOM   2574 C CA  . ASN A 1 346 ? -43.396 16.228 10.033  1.00 101.99 ?  390 ASN A CA  1 
ATOM   2575 C C   . ASN A 1 346 ? -42.518 15.552 11.087  1.00 99.30  ?  390 ASN A C   1 
ATOM   2576 O O   . ASN A 1 346 ? -42.832 15.533 12.278  1.00 99.68  ?  390 ASN A O   1 
ATOM   2577 C CB  . ASN A 1 346 ? -44.783 16.526 10.577  1.00 106.05 ?  390 ASN A CB  1 
ATOM   2578 C CG  . ASN A 1 346 ? -44.903 17.945 11.058  1.00 104.77 ?  390 ASN A CG  1 
ATOM   2579 O OD1 . ASN A 1 346 ? -44.338 18.864 10.450  1.00 102.42 ?  390 ASN A OD1 1 
ATOM   2580 N ND2 . ASN A 1 346 ? -45.618 18.141 12.167  1.00 106.57 ?  390 ASN A ND2 1 
ATOM   2581 N N   . SER A 1 347 ? -41.395 15.025 10.624  1.00 76.08  ?  391 SER A N   1 
ATOM   2582 C CA  . SER A 1 347 ? -40.447 14.323 11.463  1.00 73.82  ?  391 SER A CA  1 
ATOM   2583 C C   . SER A 1 347 ? -39.121 15.060 11.344  1.00 69.45  ?  391 SER A C   1 
ATOM   2584 O O   . SER A 1 347 ? -38.968 15.953 10.512  1.00 68.60  ?  391 SER A O   1 
ATOM   2585 C CB  . SER A 1 347 ? -40.294 12.893 10.989  1.00 75.65  ?  391 SER A CB  1 
ATOM   2586 O OG  . SER A 1 347 ? -39.741 12.914 9.692   1.00 75.55  ?  391 SER A OG  1 
ATOM   2587 N N   . ILE A 1 348 ? -38.190 14.739 12.224  1.00 67.65  ?  392 ILE A N   1 
ATOM   2588 C CA  . ILE A 1 348 ? -36.932 15.450 12.225  1.00 65.29  ?  392 ILE A CA  1 
ATOM   2589 C C   . ILE A 1 348 ? -35.758 14.578 11.799  1.00 65.20  ?  392 ILE A C   1 
ATOM   2590 O O   . ILE A 1 348 ? -35.602 13.437 12.253  1.00 65.78  ?  392 ILE A O   1 
ATOM   2591 C CB  . ILE A 1 348 ? -36.695 16.109 13.583  1.00 63.85  ?  392 ILE A CB  1 
ATOM   2592 C CG1 . ILE A 1 348 ? -37.909 16.972 13.917  1.00 64.85  ?  392 ILE A CG1 1 
ATOM   2593 C CG2 . ILE A 1 348 ? -35.458 16.961 13.541  1.00 62.53  ?  392 ILE A CG2 1 
ATOM   2594 C CD1 . ILE A 1 348 ? -38.274 17.011 15.374  1.00 64.95  ?  392 ILE A CD1 1 
ATOM   2595 N N   . GLN A 1 349 ? -34.953 15.119 10.893  1.00 72.24  ?  393 GLN A N   1 
ATOM   2596 C CA  . GLN A 1 349 ? -33.754 14.421 10.413  1.00 73.12  ?  393 GLN A CA  1 
ATOM   2597 C C   . GLN A 1 349 ? -32.516 15.252 10.541  1.00 72.27  ?  393 GLN A C   1 
ATOM   2598 O O   . GLN A 1 349 ? -32.529 16.454 10.290  1.00 71.68  ?  393 GLN A O   1 
ATOM   2599 C CB  . GLN A 1 349 ? -33.948 14.003 8.976   1.00 75.52  ?  393 GLN A CB  1 
ATOM   2600 C CG  . GLN A 1 349 ? -35.215 13.215 8.907   1.00 76.81  ?  393 GLN A CG  1 
ATOM   2601 C CD  . GLN A 1 349 ? -35.875 13.310 7.619   1.00 77.80  ?  393 GLN A CD  1 
ATOM   2602 O OE1 . GLN A 1 349 ? -35.460 14.059 6.718   1.00 75.43  ?  393 GLN A OE1 1 
ATOM   2603 N NE2 . GLN A 1 349 ? -36.923 12.533 7.477   1.00 82.17  ?  393 GLN A NE2 1 
ATOM   2604 N N   . THR A 1 350 ? -31.446 14.604 10.970  1.00 55.95  ?  394 THR A N   1 
ATOM   2605 C CA  . THR A 1 350 ? -30.173 15.287 11.045  1.00 55.41  ?  394 THR A CA  1 
ATOM   2606 C C   . THR A 1 350 ? -29.504 15.244 9.699   1.00 57.62  ?  394 THR A C   1 
ATOM   2607 O O   . THR A 1 350 ? -29.562 14.221 9.026   1.00 60.09  ?  394 THR A O   1 
ATOM   2608 C CB  . THR A 1 350 ? -29.229 14.687 12.087  1.00 54.98  ?  394 THR A CB  1 
ATOM   2609 O OG1 . THR A 1 350 ? -29.862 14.716 13.367  1.00 53.51  ?  394 THR A OG1 1 
ATOM   2610 C CG2 . THR A 1 350 ? -27.957 15.526 12.172  1.00 54.27  ?  394 THR A CG2 1 
ATOM   2611 N N   . MET A 1 351 ? -28.897 16.370 9.317   1.00 61.23  ?  395 MET A N   1 
ATOM   2612 C CA  . MET A 1 351 ? -28.082 16.474 8.114   1.00 63.52  ?  395 MET A CA  1 
ATOM   2613 C C   . MET A 1 351 ? -26.690 16.954 8.487   1.00 62.68  ?  395 MET A C   1 
ATOM   2614 O O   . MET A 1 351 ? -26.485 17.670 9.477   1.00 60.11  ?  395 MET A O   1 
ATOM   2615 C CB  . MET A 1 351 ? -28.683 17.489 7.149   1.00 64.02  ?  395 MET A CB  1 
ATOM   2616 C CG  . MET A 1 351 ? -30.138 17.212 6.725   1.00 64.81  ?  395 MET A CG  1 
ATOM   2617 S SD  . MET A 1 351 ? -30.177 16.096 5.315   1.00 69.05  ?  395 MET A SD  1 
ATOM   2618 C CE  . MET A 1 351 ? -30.492 14.619 6.244   1.00 68.44  ?  395 MET A CE  1 
ATOM   2619 N N   . ILE A 1 352 ? -25.731 16.598 7.650   1.00 51.29  ?  396 ILE A N   1 
ATOM   2620 C CA  . ILE A 1 352 ? -24.358 17.001 7.844   1.00 50.65  ?  396 ILE A CA  1 
ATOM   2621 C C   . ILE A 1 352 ? -23.811 17.569 6.541   1.00 52.53  ?  396 ILE A C   1 
ATOM   2622 O O   . ILE A 1 352 ? -24.161 17.088 5.469   1.00 55.94  ?  396 ILE A O   1 
ATOM   2623 C CB  . ILE A 1 352 ? -23.540 15.771 8.322   1.00 52.29  ?  396 ILE A CB  1 
ATOM   2624 C CG1 . ILE A 1 352 ? -22.055 16.097 8.525   1.00 51.82  ?  396 ILE A CG1 1 
ATOM   2625 C CG2 . ILE A 1 352 ? -23.772 14.561 7.404   1.00 56.79  ?  396 ILE A CG2 1 
ATOM   2626 C CD1 . ILE A 1 352 ? -21.348 15.036 9.352   1.00 52.89  ?  396 ILE A CD1 1 
ATOM   2627 N N   . THR A 1 353 ? -22.980 18.611 6.644   1.00 52.81  ?  397 THR A N   1 
ATOM   2628 C CA  . THR A 1 353 ? -22.267 19.170 5.503   1.00 54.05  ?  397 THR A CA  1 
ATOM   2629 C C   . THR A 1 353 ? -20.811 19.071 5.835   1.00 53.32  ?  397 THR A C   1 
ATOM   2630 O O   . THR A 1 353 ? -20.435 19.337 6.979   1.00 51.02  ?  397 THR A O   1 
ATOM   2631 C CB  . THR A 1 353 ? -22.632 20.645 5.224   1.00 52.70  ?  397 THR A CB  1 
ATOM   2632 O OG1 . THR A 1 353 ? -21.894 21.116 4.084   1.00 53.94  ?  397 THR A OG1 1 
ATOM   2633 C CG2 . THR A 1 353 ? -22.354 21.523 6.409   1.00 49.65  ?  397 THR A CG2 1 
ATOM   2634 N N   . PHE A 1 354 ? -19.999 18.587 4.887   1.00 54.15  ?  398 PHE A N   1 
ATOM   2635 C CA  . PHE A 1 354 ? -18.546 18.549 5.080   1.00 53.40  ?  398 PHE A CA  1 
ATOM   2636 C C   . PHE A 1 354 ? -17.844 19.703 4.419   1.00 52.26  ?  398 PHE A C   1 
ATOM   2637 O O   . PHE A 1 354 ? -16.667 19.920 4.635   1.00 50.87  ?  398 PHE A O   1 
ATOM   2638 C CB  . PHE A 1 354 ? -17.986 17.267 4.513   1.00 56.29  ?  398 PHE A CB  1 
ATOM   2639 C CG  . PHE A 1 354 ? -18.567 16.057 5.121   1.00 58.35  ?  398 PHE A CG  1 
ATOM   2640 C CD1 . PHE A 1 354 ? -18.213 15.680 6.410   1.00 57.29  ?  398 PHE A CD1 1 
ATOM   2641 C CD2 . PHE A 1 354 ? -19.510 15.300 4.424   1.00 61.80  ?  398 PHE A CD2 1 
ATOM   2642 C CE1 . PHE A 1 354 ? -18.767 14.541 7.001   1.00 59.76  ?  398 PHE A CE1 1 
ATOM   2643 C CE2 . PHE A 1 354 ? -20.078 14.166 4.995   1.00 64.53  ?  398 PHE A CE2 1 
ATOM   2644 C CZ  . PHE A 1 354 ? -19.705 13.782 6.291   1.00 63.45  ?  398 PHE A CZ  1 
ATOM   2645 N N   . ASP A 1 355 ? -18.556 20.418 3.552   1.00 57.08  ?  399 ASP A N   1 
ATOM   2646 C CA  . ASP A 1 355 ? -17.947 21.477 2.741   1.00 56.61  ?  399 ASP A CA  1 
ATOM   2647 C C   . ASP A 1 355 ? -18.216 22.920 3.186   1.00 55.03  ?  399 ASP A C   1 
ATOM   2648 O O   . ASP A 1 355 ? -17.847 23.861 2.483   1.00 55.92  ?  399 ASP A O   1 
ATOM   2649 C CB  . ASP A 1 355 ? -18.345 21.309 1.271   1.00 59.12  ?  399 ASP A CB  1 
ATOM   2650 C CG  . ASP A 1 355 ? -19.821 21.010 1.098   1.00 61.07  ?  399 ASP A CG  1 
ATOM   2651 O OD1 . ASP A 1 355 ? -20.541 20.956 2.116   1.00 60.61  ?  399 ASP A OD1 1 
ATOM   2652 O OD2 . ASP A 1 355 ? -20.260 20.830 -0.058  1.00 63.13  ?  399 ASP A OD2 1 
ATOM   2653 N N   . GLN A 1 356 ? -18.865 23.100 4.331   1.00 55.48  ?  400 GLN A N   1 
ATOM   2654 C CA  . GLN A 1 356 ? -19.315 24.426 4.745   1.00 54.63  ?  400 GLN A CA  1 
ATOM   2655 C C   . GLN A 1 356 ? -20.633 24.790 4.044   1.00 56.32  ?  400 GLN A C   1 
ATOM   2656 O O   . GLN A 1 356 ? -20.839 25.922 3.610   1.00 57.18  ?  400 GLN A O   1 
ATOM   2657 C CB  . GLN A 1 356 ? -18.234 25.475 4.457   1.00 54.38  ?  400 GLN A CB  1 
ATOM   2658 C CG  . GLN A 1 356 ? -18.423 26.800 5.183   1.00 53.96  ?  400 GLN A CG  1 
ATOM   2659 C CD  . GLN A 1 356 ? -17.296 27.797 4.883   1.00 54.16  ?  400 GLN A CD  1 
ATOM   2660 O OE1 . GLN A 1 356 ? -16.428 28.076 5.740   1.00 55.67  ?  400 GLN A OE1 1 
ATOM   2661 N NE2 . GLN A 1 356 ? -17.295 28.328 3.662   1.00 52.62  ?  400 GLN A NE2 1 
ATOM   2662 N N   . GLY A 1 357 ? -21.506 23.807 3.902   1.00 50.89  ?  401 GLY A N   1 
ATOM   2663 C CA  . GLY A 1 357 ? -22.858 24.087 3.468   1.00 52.41  ?  401 GLY A CA  1 
ATOM   2664 C C   . GLY A 1 357 ? -23.085 24.138 1.982   1.00 55.45  ?  401 GLY A C   1 
ATOM   2665 O O   . GLY A 1 357 ? -24.104 24.636 1.526   1.00 57.31  ?  401 GLY A O   1 
ATOM   2666 N N   . GLY A 1 358 ? -22.125 23.639 1.209   1.00 48.37  ?  402 GLY A N   1 
ATOM   2667 C CA  . GLY A 1 358 ? -22.342 23.485 -0.205  1.00 51.14  ?  402 GLY A CA  1 
ATOM   2668 C C   . GLY A 1 358 ? -23.173 22.251 -0.452  1.00 53.47  ?  402 GLY A C   1 
ATOM   2669 O O   . GLY A 1 358 ? -23.899 22.201 -1.417  1.00 55.97  ?  402 GLY A O   1 
ATOM   2670 N N   . ARG A 1 359 ? -23.060 21.245 0.391   1.00 71.07  ?  403 ARG A N   1 
ATOM   2671 C CA  . ARG A 1 359 ? -23.819 20.037 0.192   1.00 73.97  ?  403 ARG A CA  1 
ATOM   2672 C C   . ARG A 1 359 ? -24.202 19.463 1.540   1.00 72.71  ?  403 ARG A C   1 
ATOM   2673 O O   . ARG A 1 359 ? -23.387 19.360 2.445   1.00 70.04  ?  403 ARG A O   1 
ATOM   2674 C CB  . ARG A 1 359 ? -22.962 19.066 -0.577  1.00 75.33  ?  403 ARG A CB  1 
ATOM   2675 C CG  . ARG A 1 359 ? -23.564 17.743 -0.934  1.00 78.43  ?  403 ARG A CG  1 
ATOM   2676 C CD  . ARG A 1 359 ? -22.514 16.958 -1.773  1.00 79.24  ?  403 ARG A CD  1 
ATOM   2677 N NE  . ARG A 1 359 ? -23.071 15.742 -2.366  1.00 82.06  ?  403 ARG A NE  1 
ATOM   2678 C CZ  . ARG A 1 359 ? -23.243 14.602 -1.693  1.00 83.27  ?  403 ARG A CZ  1 
ATOM   2679 N NH1 . ARG A 1 359 ? -22.877 14.528 -0.400  1.00 82.24  ?  403 ARG A NH1 1 
ATOM   2680 N NH2 . ARG A 1 359 ? -23.774 13.540 -2.311  1.00 85.33  ?  403 ARG A NH2 1 
ATOM   2681 N N   . TRP A 1 360 ? -25.465 19.088 1.674   1.00 58.22  ?  404 TRP A N   1 
ATOM   2682 C CA  . TRP A 1 360 ? -25.907 18.418 2.886   1.00 56.02  ?  404 TRP A CA  1 
ATOM   2683 C C   . TRP A 1 360 ? -26.367 17.013 2.538   1.00 59.39  ?  404 TRP A C   1 
ATOM   2684 O O   . TRP A 1 360 ? -26.781 16.753 1.424   1.00 62.40  ?  404 TRP A O   1 
ATOM   2685 C CB  . TRP A 1 360 ? -27.002 19.213 3.566   1.00 52.79  ?  404 TRP A CB  1 
ATOM   2686 C CG  . TRP A 1 360 ? -26.596 20.574 4.055   1.00 49.83  ?  404 TRP A CG  1 
ATOM   2687 C CD1 . TRP A 1 360 ? -26.518 21.718 3.320   1.00 50.66  ?  404 TRP A CD1 1 
ATOM   2688 C CD2 . TRP A 1 360 ? -26.268 20.939 5.407   1.00 46.11  ?  404 TRP A CD2 1 
ATOM   2689 N NE1 . TRP A 1 360 ? -26.144 22.775 4.130   1.00 47.76  ?  404 TRP A NE1 1 
ATOM   2690 C CE2 . TRP A 1 360 ? -26.002 22.323 5.417   1.00 45.10  ?  404 TRP A CE2 1 
ATOM   2691 C CE3 . TRP A 1 360 ? -26.214 20.232 6.614   1.00 44.13  ?  404 TRP A CE3 1 
ATOM   2692 C CZ2 . TRP A 1 360 ? -25.661 23.018 6.587   1.00 42.53  ?  404 TRP A CZ2 1 
ATOM   2693 C CZ3 . TRP A 1 360 ? -25.877 20.919 7.797   1.00 41.40  ?  404 TRP A CZ3 1 
ATOM   2694 C CH2 . TRP A 1 360 ? -25.600 22.300 7.774   1.00 40.77  ?  404 TRP A CH2 1 
ATOM   2695 N N   . THR A 1 361 ? -26.260 16.105 3.493   1.00 49.93  ?  405 THR A N   1 
ATOM   2696 C CA  . THR A 1 361 ? -26.487 14.682 3.234   1.00 52.77  ?  405 THR A CA  1 
ATOM   2697 C C   . THR A 1 361 ? -26.860 14.014 4.558   1.00 49.69  ?  405 THR A C   1 
ATOM   2698 O O   . THR A 1 361 ? -26.656 14.623 5.602   1.00 46.49  ?  405 THR A O   1 
ATOM   2699 C CB  . THR A 1 361 ? -25.232 13.992 2.628   1.00 57.02  ?  405 THR A CB  1 
ATOM   2700 O OG1 . THR A 1 361 ? -25.463 12.588 2.567   1.00 58.40  ?  405 THR A OG1 1 
ATOM   2701 C CG2 . THR A 1 361 ? -23.972 14.230 3.474   1.00 55.34  ?  405 THR A CG2 1 
ATOM   2702 N N   . HIS A 1 362 ? -27.419 12.806 4.541   1.00 85.44  ?  406 HIS A N   1 
ATOM   2703 C CA  . HIS A 1 362 ? -27.688 12.104 5.792   1.00 83.16  ?  406 HIS A CA  1 
ATOM   2704 C C   . HIS A 1 362 ? -26.375 11.546 6.342   1.00 84.48  ?  406 HIS A C   1 
ATOM   2705 O O   . HIS A 1 362 ? -25.457 11.244 5.587   1.00 88.05  ?  406 HIS A O   1 
ATOM   2706 C CB  . HIS A 1 362 ? -28.720 10.979 5.617   1.00 83.80  ?  406 HIS A CB  1 
ATOM   2707 C CG  . HIS A 1 362 ? -30.126 11.461 5.373   1.00 82.13  ?  406 HIS A CG  1 
ATOM   2708 N ND1 . HIS A 1 362 ? -30.539 11.995 4.167   1.00 83.47  ?  406 HIS A ND1 1 
ATOM   2709 C CD2 . HIS A 1 362 ? -31.222 11.474 6.176   1.00 79.60  ?  406 HIS A CD2 1 
ATOM   2710 C CE1 . HIS A 1 362 ? -31.817 12.328 4.244   1.00 81.80  ?  406 HIS A CE1 1 
ATOM   2711 N NE2 . HIS A 1 362 ? -32.255 12.026 5.452   1.00 79.54  ?  406 HIS A NE2 1 
ATOM   2712 N N   . LEU A 1 363 ? -26.290 11.447 7.665   1.00 59.93  ?  407 LEU A N   1 
ATOM   2713 C CA  . LEU A 1 363 ? -25.141 10.866 8.360   1.00 60.80  ?  407 LEU A CA  1 
ATOM   2714 C C   . LEU A 1 363 ? -25.124 9.363  8.207   1.00 63.76  ?  407 LEU A C   1 
ATOM   2715 O O   . LEU A 1 363 ? -26.124 8.698  8.509   1.00 62.89  ?  407 LEU A O   1 
ATOM   2716 C CB  . LEU A 1 363 ? -25.183 11.181 9.857   1.00 57.07  ?  407 LEU A CB  1 
ATOM   2717 C CG  . LEU A 1 363 ? -24.818 12.605 10.281  1.00 53.87  ?  407 LEU A CG  1 
ATOM   2718 C CD1 . LEU A 1 363 ? -25.961 13.552 9.929   1.00 51.86  ?  407 LEU A CD1 1 
ATOM   2719 C CD2 . LEU A 1 363 ? -24.480 12.676 11.767  1.00 51.64  ?  407 LEU A CD2 1 
ATOM   2720 N N   . ARG A 1 364 ? -23.995 8.829  7.752   1.00 73.96  ?  408 ARG A N   1 
ATOM   2721 C CA  . ARG A 1 364 ? -23.840 7.399  7.571   1.00 76.63  ?  408 ARG A CA  1 
ATOM   2722 C C   . ARG A 1 364 ? -24.115 6.729  8.904   1.00 74.68  ?  408 ARG A C   1 
ATOM   2723 O O   . ARG A 1 364 ? -23.805 7.278  9.949   1.00 72.48  ?  408 ARG A O   1 
ATOM   2724 C CB  . ARG A 1 364 ? -22.442 7.075  7.056   1.00 80.16  ?  408 ARG A CB  1 
ATOM   2725 C CG  . ARG A 1 364 ? -22.256 5.629  6.755   1.00 82.50  ?  408 ARG A CG  1 
ATOM   2726 C CD  . ARG A 1 364 ? -20.979 5.320  5.995   1.00 85.40  ?  408 ARG A CD  1 
ATOM   2727 N NE  . ARG A 1 364 ? -21.015 3.930  5.520   1.00 87.06  ?  408 ARG A NE  1 
ATOM   2728 C CZ  . ARG A 1 364 ? -19.959 3.239  5.088   1.00 88.80  ?  408 ARG A CZ  1 
ATOM   2729 N NH1 . ARG A 1 364 ? -18.750 3.806  5.062   1.00 88.91  ?  408 ARG A NH1 1 
ATOM   2730 N NH2 . ARG A 1 364 ? -20.109 1.978  4.680   1.00 90.11  ?  408 ARG A NH2 1 
ATOM   2731 N N   . LYS A 1 365 ? -24.772 5.584  8.879   1.00 75.57  ?  409 LYS A N   1 
ATOM   2732 C CA  . LYS A 1 365 ? -25.055 4.873  10.111  1.00 74.34  ?  409 LYS A CA  1 
ATOM   2733 C C   . LYS A 1 365 ? -23.912 3.911  10.410  1.00 76.87  ?  409 LYS A C   1 
ATOM   2734 O O   . LYS A 1 365 ? -23.191 3.507  9.501   1.00 79.56  ?  409 LYS A O   1 
ATOM   2735 C CB  . LYS A 1 365 ? -26.377 4.108  9.984   1.00 73.94  ?  409 LYS A CB  1 
ATOM   2736 C CG  . LYS A 1 365 ? -26.259 2.822  9.218   1.00 77.11  ?  409 LYS A CG  1 
ATOM   2737 C CD  . LYS A 1 365 ? -27.513 2.016  9.363   1.00 76.68  ?  409 LYS A CD  1 
ATOM   2738 C CE  . LYS A 1 365 ? -27.302 0.568  8.936   1.00 79.47  ?  409 LYS A CE  1 
ATOM   2739 N NZ  . LYS A 1 365 ? -26.705 -0.261 10.030  1.00 79.94  ?  409 LYS A NZ  1 
ATOM   2740 N N   . PRO A 1 366 ? -23.741 3.549  11.688  1.00 85.39  ?  410 PRO A N   1 
ATOM   2741 C CA  . PRO A 1 366 ? -22.758 2.552  12.111  1.00 87.73  ?  410 PRO A CA  1 
ATOM   2742 C C   . PRO A 1 366 ? -22.941 1.255  11.357  1.00 90.16  ?  410 PRO A C   1 
ATOM   2743 O O   . PRO A 1 366 ? -24.075 0.909  11.051  1.00 89.53  ?  410 PRO A O   1 
ATOM   2744 C CB  . PRO A 1 366 ? -23.110 2.328  13.577  1.00 86.20  ?  410 PRO A CB  1 
ATOM   2745 C CG  . PRO A 1 366 ? -23.654 3.626  14.020  1.00 82.99  ?  410 PRO A CG  1 
ATOM   2746 C CD  . PRO A 1 366 ? -24.430 4.154  12.840  1.00 82.22  ?  410 PRO A CD  1 
ATOM   2747 N N   . GLU A 1 367 ? -21.847 0.557  11.067  1.00 121.26 ?  411 GLU A N   1 
ATOM   2748 C CA  . GLU A 1 367 ? -21.901 -0.681 10.299  1.00 123.64 ?  411 GLU A CA  1 
ATOM   2749 C C   . GLU A 1 367 ? -22.784 -1.709 10.971  1.00 123.40 ?  411 GLU A C   1 
ATOM   2750 O O   . GLU A 1 367 ? -23.618 -2.343 10.330  1.00 123.98 ?  411 GLU A O   1 
ATOM   2751 C CB  . GLU A 1 367 ? -20.499 -1.262 10.125  1.00 125.95 ?  411 GLU A CB  1 
ATOM   2752 C CG  . GLU A 1 367 ? -19.636 -0.492 9.150   1.00 126.40 ?  411 GLU A CG  1 
ATOM   2753 C CD  . GLU A 1 367 ? -20.251 -0.429 7.767   1.00 127.29 ?  411 GLU A CD  1 
ATOM   2754 O OE1 . GLU A 1 367 ? -20.618 -1.501 7.235   1.00 128.94 ?  411 GLU A OE1 1 
ATOM   2755 O OE2 . GLU A 1 367 ? -20.378 0.690  7.219   1.00 126.35 ?  411 GLU A OE2 1 
ATOM   2756 N N   . ASN A 1 368 ? -22.592 -1.861 12.273  1.00 119.85 ?  412 ASN A N   1 
ATOM   2757 C CA  . ASN A 1 368 ? -23.269 -2.905 13.022  1.00 120.06 ?  412 ASN A CA  1 
ATOM   2758 C C   . ASN A 1 368 ? -24.579 -2.454 13.667  1.00 117.57 ?  412 ASN A C   1 
ATOM   2759 O O   . ASN A 1 368 ? -25.281 -3.258 14.286  1.00 117.91 ?  412 ASN A O   1 
ATOM   2760 C CB  . ASN A 1 368 ? -22.332 -3.497 14.078  1.00 121.17 ?  412 ASN A CB  1 
ATOM   2761 C CG  . ASN A 1 368 ? -21.025 -4.000 13.488  1.00 123.66 ?  412 ASN A CG  1 
ATOM   2762 O OD1 . ASN A 1 368 ? -20.956 -4.375 12.314  1.00 125.01 ?  412 ASN A OD1 1 
ATOM   2763 N ND2 . ASN A 1 368 ? -19.976 -4.011 14.306  1.00 124.28 ?  412 ASN A ND2 1 
ATOM   2764 N N   . SER A 1 369 ? -24.923 -1.178 13.525  1.00 99.45  ?  413 SER A N   1 
ATOM   2765 C CA  . SER A 1 369 ? -26.176 -0.707 14.101  1.00 96.94  ?  413 SER A CA  1 
ATOM   2766 C C   . SER A 1 369 ? -27.380 -1.271 13.345  1.00 97.22  ?  413 SER A C   1 
ATOM   2767 O O   . SER A 1 369 ? -27.287 -1.625 12.165  1.00 98.94  ?  413 SER A O   1 
ATOM   2768 C CB  . SER A 1 369 ? -26.241 0.824  14.170  1.00 94.39  ?  413 SER A CB  1 
ATOM   2769 O OG  . SER A 1 369 ? -25.257 1.350  15.063  1.00 92.05  ?  413 SER A OG  1 
ATOM   2770 N N   . GLU A 1 370 ? -28.503 -1.364 14.049  1.00 120.30 ?  414 GLU A N   1 
ATOM   2771 C CA  . GLU A 1 370 ? -29.739 -1.853 13.474  1.00 121.57 ?  414 GLU A CA  1 
ATOM   2772 C C   . GLU A 1 370 ? -30.707 -0.691 13.380  1.00 118.89 ?  414 GLU A C   1 
ATOM   2773 O O   . GLU A 1 370 ? -30.702 0.210  14.228  1.00 116.34 ?  414 GLU A O   1 
ATOM   2774 C CB  . GLU A 1 370 ? -30.321 -2.958 14.355  1.00 125.74 ?  414 GLU A CB  1 
ATOM   2775 C CG  . GLU A 1 370 ? -29.457 -4.230 14.373  1.00 124.79 ?  414 GLU A CG  1 
ATOM   2776 C CD  . GLU A 1 370 ? -29.982 -5.323 15.306  1.00 128.21 ?  414 GLU A CD  1 
ATOM   2777 O OE1 . GLU A 1 370 ? -30.917 -5.045 16.095  1.00 131.55 ?  414 GLU A OE1 1 
ATOM   2778 O OE2 . GLU A 1 370 ? -29.450 -6.458 15.247  1.00 127.91 ?  414 GLU A OE2 1 
ATOM   2779 N N   . CYS A 1 371 ? -31.524 -0.702 12.338  1.00 89.54  ?  415 CYS A N   1 
ATOM   2780 C CA  . CYS A 1 371 ? -32.542 0.321  12.170  1.00 88.00  ?  415 CYS A CA  1 
ATOM   2781 C C   . CYS A 1 371 ? -33.689 0.061  13.151  1.00 90.43  ?  415 CYS A C   1 
ATOM   2782 O O   . CYS A 1 371 ? -33.895 -1.062 13.579  1.00 94.21  ?  415 CYS A O   1 
ATOM   2783 C CB  . CYS A 1 371 ? -33.064 0.306  10.738  1.00 89.52  ?  415 CYS A CB  1 
ATOM   2784 S SG  . CYS A 1 371 ? -31.830 0.791  9.528   1.00 88.06  ?  415 CYS A SG  1 
ATOM   2785 N N   . ASP A 1 372 ? -34.300 1.166  13.569  1.00 89.46  ?  416 ASP A N   1 
ATOM   2786 C CA  . ASP A 1 372 ? -35.391 1.220  14.533  1.00 91.57  ?  416 ASP A CA  1 
ATOM   2787 C C   . ASP A 1 372 ? -36.744 1.315  13.844  1.00 93.71  ?  416 ASP A C   1 
ATOM   2788 O O   . ASP A 1 372 ? -36.838 1.243  12.618  1.00 93.36  ?  416 ASP A O   1 
ATOM   2789 C CB  . ASP A 1 372 ? -35.204 2.402  15.487  1.00 88.40  ?  416 ASP A CB  1 
ATOM   2790 C CG  . ASP A 1 372 ? -35.003 3.714  14.755  1.00 84.12  ?  416 ASP A CG  1 
ATOM   2791 O OD1 . ASP A 1 372 ? -35.397 3.804  13.574  1.00 83.99  ?  416 ASP A OD1 1 
ATOM   2792 O OD2 . ASP A 1 372 ? -34.451 4.656  15.362  1.00 81.09  ?  416 ASP A OD2 1 
ATOM   2793 N N   . ALA A 1 373 ? -37.791 1.478  14.645  1.00 94.23  ?  417 ALA A N   1 
ATOM   2794 C CA  . ALA A 1 373 ? -39.145 1.589  14.122  1.00 97.28  ?  417 ALA A CA  1 
ATOM   2795 C C   . ALA A 1 373 ? -39.312 2.802  13.205  1.00 94.54  ?  417 ALA A C   1 
ATOM   2796 O O   . ALA A 1 373 ? -39.979 2.706  12.174  1.00 97.34  ?  417 ALA A O   1 
ATOM   2797 C CB  . ALA A 1 373 ? -40.150 1.642  15.263  1.00 100.19 ?  417 ALA A CB  1 
ATOM   2798 N N   . THR A 1 374 ? -38.717 3.938  13.564  1.00 99.55  ?  418 THR A N   1 
ATOM   2799 C CA  . THR A 1 374 ? -38.836 5.119  12.707  1.00 96.99  ?  418 THR A CA  1 
ATOM   2800 C C   . THR A 1 374 ? -38.441 4.842  11.234  1.00 97.24  ?  418 THR A C   1 
ATOM   2801 O O   . THR A 1 374 ? -38.792 5.587  10.312  1.00 96.83  ?  418 THR A O   1 
ATOM   2802 C CB  . THR A 1 374 ? -37.979 6.302  13.256  1.00 91.83  ?  418 THR A CB  1 
ATOM   2803 O OG1 . THR A 1 374 ? -38.201 7.442  12.428  1.00 90.23  ?  418 THR A OG1 1 
ATOM   2804 C CG2 . THR A 1 374 ? -36.548 6.057  13.118  1.00 88.87  ?  418 THR A CG2 1 
ATOM   2805 N N   . ALA A 1 375 ? -37.716 3.752  11.014  1.00 83.18  ?  419 ALA A N   1 
ATOM   2806 C CA  . ALA A 1 375 ? -37.133 3.480  9.706   1.00 83.20  ?  419 ALA A CA  1 
ATOM   2807 C C   . ALA A 1 375 ? -37.988 2.538  8.901   1.00 88.55  ?  419 ALA A C   1 
ATOM   2808 O O   . ALA A 1 375 ? -38.403 1.500  9.395   1.00 92.31  ?  419 ALA A O   1 
ATOM   2809 C CB  . ALA A 1 375 ? -35.762 2.894  9.869   1.00 81.48  ?  419 ALA A CB  1 
ATOM   2810 N N   . LYS A 1 376 ? -38.240 2.895  7.651   1.00 110.11 ?  420 LYS A N   1 
ATOM   2811 C CA  . LYS A 1 376 ? -39.124 2.095  6.824   1.00 115.56 ?  420 LYS A CA  1 
ATOM   2812 C C   . LYS A 1 376 ? -38.469 0.801  6.327   1.00 118.15 ?  420 LYS A C   1 
ATOM   2813 O O   . LYS A 1 376 ? -39.158 -0.184 6.064   1.00 123.40 ?  420 LYS A O   1 
ATOM   2814 C CB  . LYS A 1 376 ? -39.678 2.933  5.674   1.00 115.98 ?  420 LYS A CB  1 
ATOM   2815 C CG  . LYS A 1 376 ? -38.644 3.423  4.696   1.00 117.22 ?  420 LYS A CG  1 
ATOM   2816 C CD  . LYS A 1 376 ? -39.314 4.214  3.598   1.00 117.56 ?  420 LYS A CD  1 
ATOM   2817 C CE  . LYS A 1 376 ? -38.307 4.722  2.598   1.00 118.17 ?  420 LYS A CE  1 
ATOM   2818 N NZ  . LYS A 1 376 ? -38.972 5.505  1.512   1.00 121.00 ?  420 LYS A NZ  1 
ATOM   2819 N N   . ASN A 1 377 ? -37.142 0.810  6.216   1.00 108.19 ?  421 ASN A N   1 
ATOM   2820 C CA  . ASN A 1 377 ? -36.369 -0.381 5.882   1.00 110.42 ?  421 ASN A CA  1 
ATOM   2821 C C   . ASN A 1 377 ? -35.420 -0.730 7.022   1.00 108.28 ?  421 ASN A C   1 
ATOM   2822 O O   . ASN A 1 377 ? -34.646 0.114  7.476   1.00 103.70 ?  421 ASN A O   1 
ATOM   2823 C CB  . ASN A 1 377 ? -35.576 -0.148 4.599   1.00 109.52 ?  421 ASN A CB  1 
ATOM   2824 C CG  . ASN A 1 377 ? -34.862 -1.400 4.108   1.00 112.59 ?  421 ASN A CG  1 
ATOM   2825 O OD1 . ASN A 1 377 ? -34.388 -2.221 4.893   1.00 113.34 ?  421 ASN A OD1 1 
ATOM   2826 N ND2 . ASN A 1 377 ? -34.781 -1.545 2.793   1.00 114.72 ?  421 ASN A ND2 1 
ATOM   2827 N N   . LYS A 1 378 ? -35.478 -1.978 7.476   1.00 117.02 ?  422 LYS A N   1 
ATOM   2828 C CA  . LYS A 1 378 ? -34.619 -2.445 8.563   1.00 115.92 ?  422 LYS A CA  1 
ATOM   2829 C C   . LYS A 1 378 ? -33.146 -2.443 8.183   1.00 113.53 ?  422 LYS A C   1 
ATOM   2830 O O   . LYS A 1 378 ? -32.273 -2.268 9.033   1.00 110.85 ?  422 LYS A O   1 
ATOM   2831 C CB  . LYS A 1 378 ? -35.025 -3.849 9.007   1.00 121.46 ?  422 LYS A CB  1 
ATOM   2832 C CG  . LYS A 1 378 ? -36.214 -3.872 9.936   1.00 123.64 ?  422 LYS A CG  1 
ATOM   2833 C CD  . LYS A 1 378 ? -36.732 -5.289 10.144  1.00 130.08 ?  422 LYS A CD  1 
ATOM   2834 C CE  . LYS A 1 378 ? -37.985 -5.282 11.011  1.00 132.70 ?  422 LYS A CE  1 
ATOM   2835 N NZ  . LYS A 1 378 ? -38.430 -6.657 11.360  1.00 139.10 ?  422 LYS A NZ  1 
ATOM   2836 N N   . ASN A 1 379 ? -32.875 -2.656 6.903   1.00 126.22 ?  423 ASN A N   1 
ATOM   2837 C CA  . ASN A 1 379 ? -31.504 -2.672 6.413   1.00 124.54 ?  423 ASN A CA  1 
ATOM   2838 C C   . ASN A 1 379 ? -30.924 -1.284 6.185   1.00 120.64 ?  423 ASN A C   1 
ATOM   2839 O O   . ASN A 1 379 ? -29.747 -1.057 6.441   1.00 120.14 ?  423 ASN A O   1 
ATOM   2840 C CB  . ASN A 1 379 ? -31.404 -3.495 5.130   1.00 128.52 ?  423 ASN A CB  1 
ATOM   2841 C CG  . ASN A 1 379 ? -31.724 -4.954 5.354   1.00 133.94 ?  423 ASN A CG  1 
ATOM   2842 O OD1 . ASN A 1 379 ? -32.547 -5.532 4.648   1.00 138.22 ?  423 ASN A OD1 1 
ATOM   2843 N ND2 . ASN A 1 379 ? -31.078 -5.559 6.345   1.00 134.15 ?  423 ASN A ND2 1 
ATOM   2844 N N   . GLU A 1 380 ? -31.749 -0.359 5.703   1.00 128.07 ?  424 GLU A N   1 
ATOM   2845 C CA  . GLU A 1 380 ? -31.252 0.949  5.287   1.00 126.19 ?  424 GLU A CA  1 
ATOM   2846 C C   . GLU A 1 380 ? -31.868 2.153  5.990   1.00 123.13 ?  424 GLU A C   1 
ATOM   2847 O O   . GLU A 1 380 ? -33.038 2.460  5.804   1.00 122.65 ?  424 GLU A O   1 
ATOM   2848 C CB  . GLU A 1 380 ? -31.398 1.106  3.774   1.00 127.73 ?  424 GLU A CB  1 
ATOM   2849 C CG  . GLU A 1 380 ? -30.546 0.131  2.978   1.00 129.86 ?  424 GLU A CG  1 
ATOM   2850 C CD  . GLU A 1 380 ? -30.564 0.424  1.489   1.00 133.04 ?  424 GLU A CD  1 
ATOM   2851 O OE1 . GLU A 1 380 ? -31.349 1.308  1.072   1.00 135.24 ?  424 GLU A OE1 1 
ATOM   2852 O OE2 . GLU A 1 380 ? -29.796 -0.227 0.740   1.00 133.71 ?  424 GLU A OE2 1 
ATOM   2853 N N   . CYS A 1 381 ? -31.046 2.847  6.768   1.00 81.37  ?  425 CYS A N   1 
ATOM   2854 C CA  . CYS A 1 381 ? -31.441 4.061  7.463   1.00 78.26  ?  425 CYS A CA  1 
ATOM   2855 C C   . CYS A 1 381 ? -30.166 4.827  7.784   1.00 77.91  ?  425 CYS A C   1 
ATOM   2856 O O   . CYS A 1 381 ? -29.096 4.426  7.355   1.00 80.46  ?  425 CYS A O   1 
ATOM   2857 C CB  . CYS A 1 381 ? -32.140 3.722  8.764   1.00 76.48  ?  425 CYS A CB  1 
ATOM   2858 S SG  . CYS A 1 381 ? -31.126 2.686  9.831   1.00 77.52  ?  425 CYS A SG  1 
ATOM   2859 N N   . SER A 1 382 ? -30.279 5.893  8.571   1.00 75.18  ?  426 SER A N   1 
ATOM   2860 C CA  . SER A 1 382 ? -29.138 6.710  8.933   1.00 74.62  ?  426 SER A CA  1 
ATOM   2861 C C   . SER A 1 382 ? -29.062 7.078  10.418  1.00 72.00  ?  426 SER A C   1 
ATOM   2862 O O   . SER A 1 382 ? -29.921 6.714  11.227  1.00 70.73  ?  426 SER A O   1 
ATOM   2863 C CB  . SER A 1 382 ? -29.129 7.986  8.095   1.00 74.06  ?  426 SER A CB  1 
ATOM   2864 O OG  . SER A 1 382 ? -30.421 8.528  7.991   1.00 72.12  ?  426 SER A OG  1 
ATOM   2865 N N   . LEU A 1 383 ? -28.012 7.820  10.768  1.00 68.81  ?  427 LEU A N   1 
ATOM   2866 C CA  . LEU A 1 383 ? -27.824 8.263  12.143  1.00 66.41  ?  427 LEU A CA  1 
ATOM   2867 C C   . LEU A 1 383 ? -28.339 9.668  12.297  1.00 63.47  ?  427 LEU A C   1 
ATOM   2868 O O   . LEU A 1 383 ? -28.091 10.521 11.458  1.00 63.40  ?  427 LEU A O   1 
ATOM   2869 C CB  . LEU A 1 383 ? -26.351 8.215  12.543  1.00 67.52  ?  427 LEU A CB  1 
ATOM   2870 C CG  . LEU A 1 383 ? -26.065 8.808  13.926  1.00 65.28  ?  427 LEU A CG  1 
ATOM   2871 C CD1 . LEU A 1 383 ? -26.648 7.940  15.063  1.00 65.17  ?  427 LEU A CD1 1 
ATOM   2872 C CD2 . LEU A 1 383 ? -24.572 9.069  14.124  1.00 66.28  ?  427 LEU A CD2 1 
ATOM   2873 N N   . HIS A 1 384 ? -29.063 9.900  13.381  1.00 63.42  ?  428 HIS A N   1 
ATOM   2874 C CA  . HIS A 1 384 ? -29.624 11.210 13.664  1.00 60.88  ?  428 HIS A CA  1 
ATOM   2875 C C   . HIS A 1 384 ? -29.153 11.646 15.051  1.00 59.34  ?  428 HIS A C   1 
ATOM   2876 O O   . HIS A 1 384 ? -28.928 10.807 15.909  1.00 60.04  ?  428 HIS A O   1 
ATOM   2877 C CB  . HIS A 1 384 ? -31.154 11.142 13.563  1.00 60.43  ?  428 HIS A CB  1 
ATOM   2878 C CG  . HIS A 1 384 ? -31.650 10.719 12.209  1.00 62.12  ?  428 HIS A CG  1 
ATOM   2879 N ND1 . HIS A 1 384 ? -31.936 11.622 11.204  1.00 61.87  ?  428 HIS A ND1 1 
ATOM   2880 C CD2 . HIS A 1 384 ? -31.904 9.491  11.694  1.00 64.32  ?  428 HIS A CD2 1 
ATOM   2881 C CE1 . HIS A 1 384 ? -32.351 10.969 10.133  1.00 63.89  ?  428 HIS A CE1 1 
ATOM   2882 N NE2 . HIS A 1 384 ? -32.345 9.674  10.404  1.00 65.36  ?  428 HIS A NE2 1 
ATOM   2883 N N   . ILE A 1 385 ? -28.999 12.949 15.258  1.00 59.23  ?  429 ILE A N   1 
ATOM   2884 C CA  . ILE A 1 385 ? -28.341 13.475 16.444  1.00 58.19  ?  429 ILE A CA  1 
ATOM   2885 C C   . ILE A 1 385 ? -29.299 14.224 17.374  1.00 56.78  ?  429 ILE A C   1 
ATOM   2886 O O   . ILE A 1 385 ? -30.103 15.039 16.918  1.00 55.98  ?  429 ILE A O   1 
ATOM   2887 C CB  . ILE A 1 385 ? -27.183 14.416 16.021  1.00 57.70  ?  429 ILE A CB  1 
ATOM   2888 C CG1 . ILE A 1 385 ? -26.123 13.634 15.267  1.00 59.76  ?  429 ILE A CG1 1 
ATOM   2889 C CG2 . ILE A 1 385 ? -26.530 15.054 17.210  1.00 56.84  ?  429 ILE A CG2 1 
ATOM   2890 C CD1 . ILE A 1 385 ? -25.597 12.458 16.039  1.00 61.55  ?  429 ILE A CD1 1 
ATOM   2891 N N   . HIS A 1 386 ? -29.208 13.937 18.675  1.00 63.68  ?  430 HIS A N   1 
ATOM   2892 C CA  . HIS A 1 386 ? -29.976 14.641 19.704  1.00 63.08  ?  430 HIS A CA  1 
ATOM   2893 C C   . HIS A 1 386 ? -29.164 15.868 20.102  1.00 62.27  ?  430 HIS A C   1 
ATOM   2894 O O   . HIS A 1 386 ? -27.976 15.759 20.429  1.00 62.49  ?  430 HIS A O   1 
ATOM   2895 C CB  . HIS A 1 386 ? -30.165 13.764 20.941  1.00 64.08  ?  430 HIS A CB  1 
ATOM   2896 C CG  . HIS A 1 386 ? -31.092 12.612 20.748  1.00 64.92  ?  430 HIS A CG  1 
ATOM   2897 N ND1 . HIS A 1 386 ? -32.456 12.765 20.628  1.00 64.90  ?  430 HIS A ND1 1 
ATOM   2898 C CD2 . HIS A 1 386 ? -30.855 11.279 20.694  1.00 66.16  ?  430 HIS A CD2 1 
ATOM   2899 C CE1 . HIS A 1 386 ? -33.020 11.575 20.494  1.00 66.03  ?  430 HIS A CE1 1 
ATOM   2900 N NE2 . HIS A 1 386 ? -32.069 10.656 20.533  1.00 66.65  ?  430 HIS A NE2 1 
ATOM   2901 N N   . ALA A 1 387 ? -29.796 17.032 20.094  1.00 56.16  ?  431 ALA A N   1 
ATOM   2902 C CA  . ALA A 1 387 ? -29.099 18.291 20.353  1.00 55.76  ?  431 ALA A CA  1 
ATOM   2903 C C   . ALA A 1 387 ? -30.129 19.181 21.027  1.00 56.37  ?  431 ALA A C   1 
ATOM   2904 O O   . ALA A 1 387 ? -31.146 18.657 21.505  1.00 56.96  ?  431 ALA A O   1 
ATOM   2905 C CB  . ALA A 1 387 ? -28.578 18.902 19.079  1.00 55.16  ?  431 ALA A CB  1 
ATOM   2906 N N   . SER A 1 388 ? -29.895 20.495 21.079  1.00 65.22  ?  432 SER A N   1 
ATOM   2907 C CA  . SER A 1 388 ? -30.751 21.410 21.840  1.00 66.55  ?  432 SER A CA  1 
ATOM   2908 C C   . SER A 1 388 ? -32.230 21.135 21.692  1.00 67.09  ?  432 SER A C   1 
ATOM   2909 O O   . SER A 1 388 ? -32.978 21.177 22.685  1.00 68.22  ?  432 SER A O   1 
ATOM   2910 C CB  . SER A 1 388 ? -30.554 22.841 21.383  1.00 67.32  ?  432 SER A CB  1 
ATOM   2911 O OG  . SER A 1 388 ? -29.224 23.247 21.570  1.00 67.01  ?  432 SER A OG  1 
ATOM   2912 N N   . TYR A 1 389 ? -32.651 20.834 20.471  1.00 76.91  ?  433 TYR A N   1 
ATOM   2913 C CA  . TYR A 1 389 ? -34.060 20.644 20.237  1.00 77.51  ?  433 TYR A CA  1 
ATOM   2914 C C   . TYR A 1 389 ? -34.593 19.437 21.006  1.00 77.66  ?  433 TYR A C   1 
ATOM   2915 O O   . TYR A 1 389 ? -35.546 19.573 21.792  1.00 78.71  ?  433 TYR A O   1 
ATOM   2916 C CB  . TYR A 1 389 ? -34.411 20.565 18.756  1.00 77.07  ?  433 TYR A CB  1 
ATOM   2917 C CG  . TYR A 1 389 ? -35.886 20.520 18.637  1.00 77.94  ?  433 TYR A CG  1 
ATOM   2918 C CD1 . TYR A 1 389 ? -36.641 21.670 18.802  1.00 79.13  ?  433 TYR A CD1 1 
ATOM   2919 C CD2 . TYR A 1 389 ? -36.547 19.313 18.470  1.00 77.89  ?  433 TYR A CD2 1 
ATOM   2920 C CE1 . TYR A 1 389 ? -38.007 21.619 18.765  1.00 80.09  ?  433 TYR A CE1 1 
ATOM   2921 C CE2 . TYR A 1 389 ? -37.898 19.255 18.427  1.00 79.30  ?  433 TYR A CE2 1 
ATOM   2922 C CZ  . TYR A 1 389 ? -38.628 20.407 18.575  1.00 80.45  ?  433 TYR A CZ  1 
ATOM   2923 O OH  . TYR A 1 389 ? -40.008 20.339 18.538  1.00 82.70  ?  433 TYR A OH  1 
ATOM   2924 N N   . SER A 1 390 ? -33.975 18.273 20.808  1.00 65.68  ?  434 SER A N   1 
ATOM   2925 C CA  . SER A 1 390 ? -34.341 17.088 21.584  1.00 66.14  ?  434 SER A CA  1 
ATOM   2926 C C   . SER A 1 390 ? -34.384 17.423 23.066  1.00 66.99  ?  434 SER A C   1 
ATOM   2927 O O   . SER A 1 390 ? -35.391 17.159 23.745  1.00 68.25  ?  434 SER A O   1 
ATOM   2928 C CB  . SER A 1 390 ? -33.338 15.961 21.383  1.00 65.65  ?  434 SER A CB  1 
ATOM   2929 O OG  . SER A 1 390 ? -33.475 15.366 20.114  1.00 65.37  ?  434 SER A OG  1 
ATOM   2930 N N   . ILE A 1 391 ? -33.290 18.014 23.560  1.00 61.27  ?  435 ILE A N   1 
ATOM   2931 C CA  . ILE A 1 391 ? -33.203 18.382 24.975  1.00 62.35  ?  435 ILE A CA  1 
ATOM   2932 C C   . ILE A 1 391 ? -34.417 19.196 25.425  1.00 63.68  ?  435 ILE A C   1 
ATOM   2933 O O   . ILE A 1 391 ? -35.032 18.878 26.432  1.00 64.85  ?  435 ILE A O   1 
ATOM   2934 C CB  . ILE A 1 391 ? -31.914 19.148 25.296  1.00 62.19  ?  435 ILE A CB  1 
ATOM   2935 C CG1 . ILE A 1 391 ? -30.737 18.178 25.360  1.00 61.60  ?  435 ILE A CG1 1 
ATOM   2936 C CG2 . ILE A 1 391 ? -32.042 19.837 26.633  1.00 63.71  ?  435 ILE A CG2 1 
ATOM   2937 C CD1 . ILE A 1 391 ? -29.380 18.820 25.072  1.00 60.99  ?  435 ILE A CD1 1 
ATOM   2938 N N   . SER A 1 392 ? -34.768 20.213 24.642  1.00 71.99  ?  436 SER A N   1 
ATOM   2939 C CA  . SER A 1 392 ? -35.822 21.141 25.008  1.00 73.52  ?  436 SER A CA  1 
ATOM   2940 C C   . SER A 1 392 ? -37.173 20.446 25.072  1.00 74.28  ?  436 SER A C   1 
ATOM   2941 O O   . SER A 1 392 ? -38.073 20.873 25.803  1.00 76.40  ?  436 SER A O   1 
ATOM   2942 C CB  . SER A 1 392 ? -35.886 22.287 24.007  1.00 73.58  ?  436 SER A CB  1 
ATOM   2943 O OG  . SER A 1 392 ? -36.609 21.910 22.852  1.00 72.86  ?  436 SER A OG  1 
ATOM   2944 N N   . GLN A 1 393 ? -37.316 19.378 24.297  1.00 88.05  ?  437 GLN A N   1 
ATOM   2945 C CA  . GLN A 1 393 ? -38.540 18.603 24.295  1.00 90.03  ?  437 GLN A CA  1 
ATOM   2946 C C   . GLN A 1 393 ? -38.452 17.533 25.365  1.00 91.41  ?  437 GLN A C   1 
ATOM   2947 O O   . GLN A 1 393 ? -39.351 16.711 25.508  1.00 94.47  ?  437 GLN A O   1 
ATOM   2948 C CB  . GLN A 1 393 ? -38.779 17.964 22.936  1.00 89.35  ?  437 GLN A CB  1 
ATOM   2949 C CG  . GLN A 1 393 ? -38.921 18.959 21.814  1.00 88.47  ?  437 GLN A CG  1 
ATOM   2950 C CD  . GLN A 1 393 ? -40.034 19.963 22.051  1.00 90.62  ?  437 GLN A CD  1 
ATOM   2951 O OE1 . GLN A 1 393 ? -41.217 19.608 22.073  1.00 93.65  ?  437 GLN A OE1 1 
ATOM   2952 N NE2 . GLN A 1 393 ? -39.660 21.232 22.223  1.00 90.23  ?  437 GLN A NE2 1 
ATOM   2953 N N   . LYS A 1 394 ? -37.364 17.548 26.120  1.00 89.58  ?  438 LYS A N   1 
ATOM   2954 C CA  . LYS A 1 394 ? -37.311 16.782 27.359  1.00 91.62  ?  438 LYS A CA  1 
ATOM   2955 C C   . LYS A 1 394 ? -37.274 15.259 27.105  1.00 92.81  ?  438 LYS A C   1 
ATOM   2956 O O   . LYS A 1 394 ? -37.718 14.447 27.899  1.00 95.97  ?  438 LYS A O   1 
ATOM   2957 C CB  . LYS A 1 394 ? -38.459 17.267 28.267  1.00 95.06  ?  438 LYS A CB  1 
ATOM   2958 C CG  . LYS A 1 394 ? -38.393 18.679 28.813  1.00 98.53  ?  438 LYS A CG  1 
ATOM   2959 C CD  . LYS A 1 394 ? -39.582 19.098 29.689  1.00 97.64  ?  438 LYS A CD  1 
ATOM   2960 C CE  . LYS A 1 394 ? -39.393 20.573 30.220  1.00 103.06 ?  438 LYS A CE  1 
ATOM   2961 N NZ  . LYS A 1 394 ? -40.462 21.214 31.094  1.00 104.52 ?  438 LYS A NZ  1 
ATOM   2962 N N   . LEU A 1 395 ? -36.687 14.896 25.971  1.00 84.58  ?  439 LEU A N   1 
ATOM   2963 C CA  . LEU A 1 395 ? -36.166 13.554 25.733  1.00 84.97  ?  439 LEU A CA  1 
ATOM   2964 C C   . LEU A 1 395 ? -34.988 13.301 26.684  1.00 84.35  ?  439 LEU A C   1 
ATOM   2965 O O   . LEU A 1 395 ? -34.352 14.252 27.162  1.00 83.01  ?  439 LEU A O   1 
ATOM   2966 C CB  . LEU A 1 395 ? -35.684 13.452 24.289  1.00 82.45  ?  439 LEU A CB  1 
ATOM   2967 C CG  . LEU A 1 395 ? -36.739 13.511 23.196  1.00 83.41  ?  439 LEU A CG  1 
ATOM   2968 C CD1 . LEU A 1 395 ? -36.082 13.082 21.908  1.00 81.56  ?  439 LEU A CD1 1 
ATOM   2969 C CD2 . LEU A 1 395 ? -37.901 12.606 23.522  1.00 87.57  ?  439 LEU A CD2 1 
ATOM   2970 N N   . ASN A 1 396 ? -34.637 12.041 26.921  1.00 91.36  ?  440 ASN A N   1 
ATOM   2971 C CA  . ASN A 1 396 ? -33.672 11.799 27.966  1.00 91.71  ?  440 ASN A CA  1 
ATOM   2972 C C   . ASN A 1 396 ? -32.315 11.950 27.334  1.00 88.88  ?  440 ASN A C   1 
ATOM   2973 O O   . ASN A 1 396 ? -31.695 10.981 26.906  1.00 89.11  ?  440 ASN A O   1 
ATOM   2974 C CB  . ASN A 1 396 ? -33.819 10.340 28.367  1.00 95.10  ?  440 ASN A CB  1 
ATOM   2975 C CG  . ASN A 1 396 ? -33.392 10.063 29.793  1.00 97.43  ?  440 ASN A CG  1 
ATOM   2976 O OD1 . ASN A 1 396 ? -33.768 10.781 30.730  1.00 98.50  ?  440 ASN A OD1 1 
ATOM   2977 N ND2 . ASN A 1 396 ? -32.627 8.989  29.972  1.00 98.71  ?  440 ASN A ND2 1 
ATOM   2978 N N   . VAL A 1 397 ? -31.798 13.168 27.433  1.00 78.05  ?  441 VAL A N   1 
ATOM   2979 C CA  . VAL A 1 397 ? -30.586 13.598 26.742  1.00 76.55  ?  441 VAL A CA  1 
ATOM   2980 C C   . VAL A 1 397 ? -29.726 14.430 27.686  1.00 76.94  ?  441 VAL A C   1 
ATOM   2981 O O   . VAL A 1 397 ? -30.009 15.606 27.885  1.00 76.67  ?  441 VAL A O   1 
ATOM   2982 C CB  . VAL A 1 397 ? -30.902 14.391 25.451  1.00 74.98  ?  441 VAL A CB  1 
ATOM   2983 C CG1 . VAL A 1 397 ? -29.621 14.790 24.752  1.00 74.16  ?  441 VAL A CG1 1 
ATOM   2984 C CG2 . VAL A 1 397 ? -31.774 13.557 24.508  1.00 74.89  ?  441 VAL A CG2 1 
ATOM   2985 N N   . PRO A 1 398 ? -28.743 13.806 28.349  1.00 79.30  ?  442 PRO A N   1 
ATOM   2986 C CA  . PRO A 1 398 ? -27.869 14.519 29.291  1.00 79.98  ?  442 PRO A CA  1 
ATOM   2987 C C   . PRO A 1 398 ? -27.051 15.647 28.646  1.00 78.76  ?  442 PRO A C   1 
ATOM   2988 O O   . PRO A 1 398 ? -26.946 16.710 29.248  1.00 79.05  ?  442 PRO A O   1 
ATOM   2989 C CB  . PRO A 1 398 ? -26.919 13.427 29.802  1.00 81.59  ?  442 PRO A CB  1 
ATOM   2990 C CG  . PRO A 1 398 ? -27.507 12.138 29.380  1.00 81.99  ?  442 PRO A CG  1 
ATOM   2991 C CD  . PRO A 1 398 ? -28.372 12.393 28.196  1.00 80.29  ?  442 PRO A CD  1 
ATOM   2992 N N   . MET A 1 399 ? -26.471 15.417 27.466  1.00 67.12  ?  443 MET A N   1 
ATOM   2993 C CA  . MET A 1 399 ? -25.635 16.436 26.806  1.00 66.04  ?  443 MET A CA  1 
ATOM   2994 C C   . MET A 1 399 ? -25.846 16.549 25.314  1.00 64.50  ?  443 MET A C   1 
ATOM   2995 O O   . MET A 1 399 ? -26.126 15.566 24.644  1.00 64.55  ?  443 MET A O   1 
ATOM   2996 C CB  . MET A 1 399 ? -24.149 16.140 26.977  1.00 66.92  ?  443 MET A CB  1 
ATOM   2997 C CG  . MET A 1 399 ? -23.604 16.437 28.308  1.00 68.42  ?  443 MET A CG  1 
ATOM   2998 S SD  . MET A 1 399 ? -21.851 16.072 28.293  1.00 69.89  ?  443 MET A SD  1 
ATOM   2999 C CE  . MET A 1 399 ? -21.339 17.165 26.967  1.00 67.74  ?  443 MET A CE  1 
ATOM   3000 N N   . ALA A 1 400 ? -25.616 17.750 24.797  1.00 55.48  ?  444 ALA A N   1 
ATOM   3001 C CA  . ALA A 1 400 ? -25.621 18.007 23.361  1.00 54.22  ?  444 ALA A CA  1 
ATOM   3002 C C   . ALA A 1 400 ? -24.352 17.422 22.729  1.00 54.28  ?  444 ALA A C   1 
ATOM   3003 O O   . ALA A 1 400 ? -23.516 16.860 23.438  1.00 55.44  ?  444 ALA A O   1 
ATOM   3004 C CB  . ALA A 1 400 ? -25.710 19.492 23.120  1.00 53.61  ?  444 ALA A CB  1 
ATOM   3005 N N   . PRO A 1 401 ? -24.183 17.550 21.420  1.00 57.01  ?  445 PRO A N   1 
ATOM   3006 C CA  . PRO A 1 401 ? -22.982 16.989 20.788  1.00 57.78  ?  445 PRO A CA  1 
ATOM   3007 C C   . PRO A 1 401 ? -21.705 17.670 21.286  1.00 57.50  ?  445 PRO A C   1 
ATOM   3008 O O   . PRO A 1 401 ? -21.687 18.893 21.425  1.00 56.39  ?  445 PRO A O   1 
ATOM   3009 C CB  . PRO A 1 401 ? -23.197 17.293 19.305  1.00 57.41  ?  445 PRO A CB  1 
ATOM   3010 C CG  . PRO A 1 401 ? -24.679 17.341 19.149  1.00 56.87  ?  445 PRO A CG  1 
ATOM   3011 C CD  . PRO A 1 401 ? -25.208 17.922 20.429  1.00 56.20  ?  445 PRO A CD  1 
ATOM   3012 N N   . LEU A 1 402 ? -20.653 16.893 21.540  1.00 48.94  ?  446 LEU A N   1 
ATOM   3013 C CA  . LEU A 1 402 ? -19.362 17.464 21.918  1.00 49.34  ?  446 LEU A CA  1 
ATOM   3014 C C   . LEU A 1 402 ? -18.258 17.247 20.877  1.00 49.92  ?  446 LEU A C   1 
ATOM   3015 O O   . LEU A 1 402 ? -18.090 16.140 20.346  1.00 51.61  ?  446 LEU A O   1 
ATOM   3016 C CB  . LEU A 1 402 ? -18.896 16.872 23.248  1.00 51.68  ?  446 LEU A CB  1 
ATOM   3017 C CG  . LEU A 1 402 ? -17.542 17.375 23.771  1.00 53.27  ?  446 LEU A CG  1 
ATOM   3018 C CD1 . LEU A 1 402 ? -17.669 18.733 24.439  1.00 52.42  ?  446 LEU A CD1 1 
ATOM   3019 C CD2 . LEU A 1 402 ? -16.921 16.347 24.692  1.00 56.55  ?  446 LEU A CD2 1 
ATOM   3020 N N   . SER A 1 403 ? -17.506 18.308 20.610  1.00 61.57  ?  447 SER A N   1 
ATOM   3021 C CA  . SER A 1 403 ? -16.242 18.195 19.891  1.00 62.59  ?  447 SER A CA  1 
ATOM   3022 C C   . SER A 1 403 ? -15.280 19.301 20.331  1.00 62.28  ?  447 SER A C   1 
ATOM   3023 O O   . SER A 1 403 ? -15.712 20.364 20.794  1.00 60.68  ?  447 SER A O   1 
ATOM   3024 C CB  . SER A 1 403 ? -16.449 18.258 18.377  1.00 61.31  ?  447 SER A CB  1 
ATOM   3025 O OG  . SER A 1 403 ? -16.985 19.513 17.986  1.00 58.71  ?  447 SER A OG  1 
ATOM   3026 N N   . GLU A 1 404 ? -13.980 19.047 20.196  1.00 65.62  ?  448 GLU A N   1 
ATOM   3027 C CA  . GLU A 1 404 ? -12.976 20.041 20.538  1.00 65.51  ?  448 GLU A CA  1 
ATOM   3028 C C   . GLU A 1 404 ? -11.963 20.172 19.388  1.00 64.91  ?  448 GLU A C   1 
ATOM   3029 O O   . GLU A 1 404 ? -11.610 19.179 18.755  1.00 66.68  ?  448 GLU A O   1 
ATOM   3030 C CB  . GLU A 1 404 ? -12.296 19.645 21.847  1.00 69.44  ?  448 GLU A CB  1 
ATOM   3031 C CG  . GLU A 1 404 ? -13.265 19.390 23.006  1.00 70.61  ?  448 GLU A CG  1 
ATOM   3032 C CD  . GLU A 1 404 ? -13.429 20.595 23.937  1.00 70.10  ?  448 GLU A CD  1 
ATOM   3033 O OE1 . GLU A 1 404 ? -13.188 21.739 23.463  1.00 67.67  ?  448 GLU A OE1 1 
ATOM   3034 O OE2 . GLU A 1 404 ? -13.783 20.388 25.141  1.00 72.33  ?  448 GLU A OE2 1 
ATOM   3035 N N   . PRO A 1 405 ? -11.501 21.400 19.093  1.00 69.19  ?  449 PRO A N   1 
ATOM   3036 C CA  . PRO A 1 405 ? -10.590 21.591 17.949  1.00 68.45  ?  449 PRO A CA  1 
ATOM   3037 C C   . PRO A 1 405 ? -9.224  20.930 18.130  1.00 70.90  ?  449 PRO A C   1 
ATOM   3038 O O   . PRO A 1 405 ? -8.551  20.681 17.123  1.00 70.83  ?  449 PRO A O   1 
ATOM   3039 C CB  . PRO A 1 405 ? -10.399 23.110 17.873  1.00 66.56  ?  449 PRO A CB  1 
ATOM   3040 C CG  . PRO A 1 405 ? -11.422 23.694 18.702  1.00 65.99  ?  449 PRO A CG  1 
ATOM   3041 C CD  . PRO A 1 405 ? -11.897 22.672 19.712  1.00 67.78  ?  449 PRO A CD  1 
ATOM   3042 N N   . ASN A 1 406 ? -8.805  20.680 19.372  1.00 61.95  ?  450 ASN A N   1 
ATOM   3043 C CA  . ASN A 1 406 ? -7.485  20.088 19.608  1.00 64.35  ?  450 ASN A CA  1 
ATOM   3044 C C   . ASN A 1 406 ? -7.562  18.576 19.632  1.00 67.57  ?  450 ASN A C   1 
ATOM   3045 O O   . ASN A 1 406 ? -6.544  17.892 19.749  1.00 69.54  ?  450 ASN A O   1 
ATOM   3046 C CB  . ASN A 1 406 ? -6.819  20.630 20.887  1.00 65.59  ?  450 ASN A CB  1 
ATOM   3047 C CG  . ASN A 1 406 ? -7.799  20.802 22.039  1.00 66.60  ?  450 ASN A CG  1 
ATOM   3048 O OD1 . ASN A 1 406 ? -8.962  21.167 21.835  1.00 64.76  ?  450 ASN A OD1 1 
ATOM   3049 N ND2 . ASN A 1 406 ? -7.333  20.549 23.258  1.00 69.48  ?  450 ASN A ND2 1 
ATOM   3050 N N   . ALA A 1 407 ? -8.789  18.062 19.539  1.00 67.75  ?  451 ALA A N   1 
ATOM   3051 C CA  . ALA A 1 407 ? -8.970  16.632 19.372  1.00 71.28  ?  451 ALA A CA  1 
ATOM   3052 C C   . ALA A 1 407 ? -9.490  16.405 17.969  1.00 69.79  ?  451 ALA A C   1 
ATOM   3053 O O   . ALA A 1 407 ? -10.684 16.431 17.735  1.00 68.79  ?  451 ALA A O   1 
ATOM   3054 C CB  . ALA A 1 407 ? -9.965  16.119 20.399  1.00 74.22  ?  451 ALA A CB  1 
ATOM   3055 N N   . VAL A 1 408 ? -8.592  16.037 17.070  1.00 63.80  ?  452 VAL A N   1 
ATOM   3056 C CA  . VAL A 1 408 ? -8.866  16.057 15.642  1.00 62.20  ?  452 VAL A CA  1 
ATOM   3057 C C   . VAL A 1 408 ? -9.827  14.951 15.238  1.00 65.02  ?  452 VAL A C   1 
ATOM   3058 O O   . VAL A 1 408 ? -9.661  13.805 15.640  1.00 68.92  ?  452 VAL A O   1 
ATOM   3059 C CB  . VAL A 1 408 ? -7.551  15.949 14.844  1.00 61.76  ?  452 VAL A CB  1 
ATOM   3060 C CG1 . VAL A 1 408 ? -7.833  15.667 13.374  1.00 60.38  ?  452 VAL A CG1 1 
ATOM   3061 C CG2 . VAL A 1 408 ? -6.750  17.224 15.001  1.00 62.30  ?  452 VAL A CG2 1 
ATOM   3062 N N   . GLY A 1 409 ? -10.850 15.315 14.463  1.00 58.26  ?  453 GLY A N   1 
ATOM   3063 C CA  . GLY A 1 409 ? -11.849 14.369 13.986  1.00 60.85  ?  453 GLY A CA  1 
ATOM   3064 C C   . GLY A 1 409 ? -12.883 13.846 14.987  1.00 62.24  ?  453 GLY A C   1 
ATOM   3065 O O   . GLY A 1 409 ? -13.809 13.123 14.619  1.00 63.29  ?  453 GLY A O   1 
ATOM   3066 N N   . ILE A 1 410 ? -12.762 14.196 16.257  1.00 61.66  ?  454 ILE A N   1 
ATOM   3067 C CA  . ILE A 1 410 ? -13.598 13.509 17.230  1.00 62.15  ?  454 ILE A CA  1 
ATOM   3068 C C   . ILE A 1 410 ? -14.970 14.144 17.444  1.00 57.58  ?  454 ILE A C   1 
ATOM   3069 O O   . ILE A 1 410 ? -15.097 15.350 17.665  1.00 54.24  ?  454 ILE A O   1 
ATOM   3070 C CB  . ILE A 1 410 ? -12.851 13.290 18.563  1.00 64.40  ?  454 ILE A CB  1 
ATOM   3071 C CG1 . ILE A 1 410 ? -11.895 12.104 18.426  1.00 68.35  ?  454 ILE A CG1 1 
ATOM   3072 C CG2 . ILE A 1 410 ? -13.836 13.021 19.682  1.00 62.67  ?  454 ILE A CG2 1 
ATOM   3073 C CD1 . ILE A 1 410 ? -11.088 11.842 19.653  1.00 69.25  ?  454 ILE A CD1 1 
ATOM   3074 N N   . VAL A 1 411 ? -16.015 13.339 17.340  1.00 56.20  ?  455 VAL A N   1 
ATOM   3075 C CA  . VAL A 1 411 ? -17.360 13.841 17.675  1.00 52.95  ?  455 VAL A CA  1 
ATOM   3076 C C   . VAL A 1 411 ? -18.136 12.844 18.530  1.00 54.06  ?  455 VAL A C   1 
ATOM   3077 O O   . VAL A 1 411 ? -18.180 11.645 18.217  1.00 56.73  ?  455 VAL A O   1 
ATOM   3078 C CB  . VAL A 1 411 ? -18.204 14.254 16.423  1.00 51.45  ?  455 VAL A CB  1 
ATOM   3079 C CG1 . VAL A 1 411 ? -19.176 15.346 16.809  1.00 48.15  ?  455 VAL A CG1 1 
ATOM   3080 C CG2 . VAL A 1 411 ? -17.315 14.756 15.290  1.00 51.56  ?  455 VAL A CG2 1 
ATOM   3081 N N   . ILE A 1 412 ? -18.724 13.336 19.620  1.00 59.93  ?  456 ILE A N   1 
ATOM   3082 C CA  . ILE A 1 412 ? -19.501 12.487 20.544  1.00 60.87  ?  456 ILE A CA  1 
ATOM   3083 C C   . ILE A 1 412 ? -20.907 13.026 20.713  1.00 58.59  ?  456 ILE A C   1 
ATOM   3084 O O   . ILE A 1 412 ? -21.091 14.205 21.010  1.00 56.36  ?  456 ILE A O   1 
ATOM   3085 C CB  . ILE A 1 412 ? -18.833 12.417 21.921  1.00 62.01  ?  456 ILE A CB  1 
ATOM   3086 C CG1 . ILE A 1 412 ? -17.415 11.861 21.782  1.00 64.89  ?  456 ILE A CG1 1 
ATOM   3087 C CG2 . ILE A 1 412 ? -19.637 11.548 22.864  1.00 62.92  ?  456 ILE A CG2 1 
ATOM   3088 C CD1 . ILE A 1 412 ? -16.611 11.901 23.060  1.00 66.45  ?  456 ILE A CD1 1 
ATOM   3089 N N   . ALA A 1 413 ? -21.907 12.178 20.494  1.00 59.75  ?  457 ALA A N   1 
ATOM   3090 C CA  . ALA A 1 413 ? -23.313 12.631 20.529  1.00 57.98  ?  457 ALA A CA  1 
ATOM   3091 C C   . ALA A 1 413 ? -24.291 11.533 20.903  1.00 59.16  ?  457 ALA A C   1 
ATOM   3092 O O   . ALA A 1 413 ? -24.098 10.369 20.526  1.00 61.55  ?  457 ALA A O   1 
ATOM   3093 C CB  . ALA A 1 413 ? -23.718 13.230 19.181  1.00 56.90  ?  457 ALA A CB  1 
ATOM   3094 N N   . HIS A 1 414 ? -25.350 11.903 21.620  1.00 68.28  ?  458 HIS A N   1 
ATOM   3095 C CA  . HIS A 1 414 ? -26.495 11.012 21.731  1.00 68.74  ?  458 HIS A CA  1 
ATOM   3096 C C   . HIS A 1 414 ? -27.151 11.024 20.356  1.00 68.02  ?  458 HIS A C   1 
ATOM   3097 O O   . HIS A 1 414 ? -27.122 12.038 19.635  1.00 66.40  ?  458 HIS A O   1 
ATOM   3098 C CB  . HIS A 1 414 ? -27.490 11.485 22.797  1.00 67.68  ?  458 HIS A CB  1 
ATOM   3099 C CG  . HIS A 1 414 ? -26.951 11.429 24.193  1.00 68.62  ?  458 HIS A CG  1 
ATOM   3100 N ND1 . HIS A 1 414 ? -26.186 12.440 24.734  1.00 68.00  ?  458 HIS A ND1 1 
ATOM   3101 C CD2 . HIS A 1 414 ? -27.043 10.473 25.148  1.00 70.32  ?  458 HIS A CD2 1 
ATOM   3102 C CE1 . HIS A 1 414 ? -25.835 12.113 25.967  1.00 69.35  ?  458 HIS A CE1 1 
ATOM   3103 N NE2 . HIS A 1 414 ? -26.338 10.922 26.240  1.00 70.77  ?  458 HIS A NE2 1 
ATOM   3104 N N   . GLY A 1 415 ? -27.725 9.897  19.971  1.00 67.02  ?  459 GLY A N   1 
ATOM   3105 C CA  . GLY A 1 415 ? -28.374 9.831  18.684  1.00 66.73  ?  459 GLY A CA  1 
ATOM   3106 C C   . GLY A 1 415 ? -29.340 8.686  18.582  1.00 67.70  ?  459 GLY A C   1 
ATOM   3107 O O   . GLY A 1 415 ? -29.564 7.972  19.555  1.00 68.43  ?  459 GLY A O   1 
ATOM   3108 N N   . SER A 1 416 ? -29.934 8.527  17.407  1.00 69.95  ?  460 SER A N   1 
ATOM   3109 C CA  . SER A 1 416 ? -30.691 7.317  17.100  1.00 71.52  ?  460 SER A CA  1 
ATOM   3110 C C   . SER A 1 416 ? -30.481 6.922  15.644  1.00 73.01  ?  460 SER A C   1 
ATOM   3111 O O   . SER A 1 416 ? -30.198 7.758  14.786  1.00 72.36  ?  460 SER A O   1 
ATOM   3112 C CB  . SER A 1 416 ? -32.178 7.470  17.429  1.00 70.66  ?  460 SER A CB  1 
ATOM   3113 O OG  . SER A 1 416 ? -32.733 8.561  16.722  1.00 69.17  ?  460 SER A OG  1 
ATOM   3114 N N   . VAL A 1 417 ? -30.593 5.630  15.391  1.00 66.74  ?  461 VAL A N   1 
ATOM   3115 C CA  . VAL A 1 417 ? -30.409 5.071  14.067  1.00 68.74  ?  461 VAL A CA  1 
ATOM   3116 C C   . VAL A 1 417 ? -31.801 4.684  13.509  1.00 68.96  ?  461 VAL A C   1 
ATOM   3117 O O   . VAL A 1 417 ? -32.470 3.800  14.053  1.00 71.07  ?  461 VAL A O   1 
ATOM   3118 C CB  . VAL A 1 417 ? -29.465 3.833  14.139  1.00 71.46  ?  461 VAL A CB  1 
ATOM   3119 C CG1 . VAL A 1 417 ? -29.180 3.263  12.766  1.00 73.75  ?  461 VAL A CG1 1 
ATOM   3120 C CG2 . VAL A 1 417 ? -28.171 4.188  14.850  1.00 71.58  ?  461 VAL A CG2 1 
ATOM   3121 N N   . GLY A 1 418 ? -32.205 5.364  12.428  1.00 70.77  ?  462 GLY A N   1 
ATOM   3122 C CA  . GLY A 1 418 ? -33.476 5.171  11.738  1.00 71.65  ?  462 GLY A CA  1 
ATOM   3123 C C   . GLY A 1 418 ? -33.705 6.281  10.712  1.00 70.83  ?  462 GLY A C   1 
ATOM   3124 O O   . GLY A 1 418 ? -32.758 6.912  10.270  1.00 70.64  ?  462 GLY A O   1 
ATOM   3125 N N   . ASP A 1 419 ? -34.956 6.535  10.329  1.00 82.90  ?  463 ASP A N   1 
ATOM   3126 C CA  . ASP A 1 419 ? -35.260 7.598  9.362   1.00 82.27  ?  463 ASP A CA  1 
ATOM   3127 C C   . ASP A 1 419 ? -35.548 8.960  9.998   1.00 79.67  ?  463 ASP A C   1 
ATOM   3128 O O   . ASP A 1 419 ? -35.694 9.969  9.305   1.00 78.98  ?  463 ASP A O   1 
ATOM   3129 C CB  . ASP A 1 419 ? -36.386 7.177  8.414   1.00 85.27  ?  463 ASP A CB  1 
ATOM   3130 C CG  . ASP A 1 419 ? -36.010 5.964  7.577   1.00 87.98  ?  463 ASP A CG  1 
ATOM   3131 O OD1 . ASP A 1 419 ? -35.046 5.287  7.980   1.00 87.44  ?  463 ASP A OD1 1 
ATOM   3132 O OD2 . ASP A 1 419 ? -36.654 5.679  6.530   1.00 91.07  ?  463 ASP A OD2 1 
ATOM   3133 N N   . ALA A 1 420 ? -35.623 8.992  11.321  1.00 72.94  ?  464 ALA A N   1 
ATOM   3134 C CA  . ALA A 1 420 ? -35.864 10.245 12.012  1.00 70.72  ?  464 ALA A CA  1 
ATOM   3135 C C   . ALA A 1 420 ? -35.341 10.162 13.432  1.00 69.37  ?  464 ALA A C   1 
ATOM   3136 O O   . ALA A 1 420 ? -35.073 9.064  13.943  1.00 70.40  ?  464 ALA A O   1 
ATOM   3137 C CB  . ALA A 1 420 ? -37.339 10.566 12.011  1.00 72.67  ?  464 ALA A CB  1 
ATOM   3138 N N   . ILE A 1 421 ? -35.174 11.330 14.047  1.00 67.40  ?  465 ILE A N   1 
ATOM   3139 C CA  . ILE A 1 421 ? -34.898 11.408 15.472  1.00 66.49  ?  465 ILE A CA  1 
ATOM   3140 C C   . ILE A 1 421 ? -36.023 10.694 16.218  1.00 68.94  ?  465 ILE A C   1 
ATOM   3141 O O   . ILE A 1 421 ? -37.197 11.020 16.048  1.00 70.87  ?  465 ILE A O   1 
ATOM   3142 C CB  . ILE A 1 421 ? -34.802 12.876 15.942  1.00 64.62  ?  465 ILE A CB  1 
ATOM   3143 C CG1 . ILE A 1 421 ? -33.665 13.588 15.214  1.00 63.81  ?  465 ILE A CG1 1 
ATOM   3144 C CG2 . ILE A 1 421 ? -34.566 12.961 17.441  1.00 64.15  ?  465 ILE A CG2 1 
ATOM   3145 C CD1 . ILE A 1 421 ? -33.424 14.980 15.690  1.00 62.56  ?  465 ILE A CD1 1 
ATOM   3146 N N   . SER A 1 422 ? -35.667 9.733  17.058  1.00 91.55  ?  466 SER A N   1 
ATOM   3147 C CA  . SER A 1 422 ? -36.672 8.963  17.769  1.00 95.29  ?  466 SER A CA  1 
ATOM   3148 C C   . SER A 1 422 ? -36.698 9.362  19.227  1.00 95.10  ?  466 SER A C   1 
ATOM   3149 O O   . SER A 1 422 ? -35.706 9.834  19.786  1.00 92.45  ?  466 SER A O   1 
ATOM   3150 C CB  . SER A 1 422 ? -36.381 7.475  17.685  1.00 97.75  ?  466 SER A CB  1 
ATOM   3151 O OG  . SER A 1 422 ? -35.364 7.130  18.608  1.00 96.75  ?  466 SER A OG  1 
ATOM   3152 N N   . VAL A 1 423 ? -37.863 9.185  19.826  1.00 71.11  ?  467 VAL A N   1 
ATOM   3153 C CA  . VAL A 1 423 ? -38.122 9.607  21.191  1.00 71.79  ?  467 VAL A CA  1 
ATOM   3154 C C   . VAL A 1 423 ? -37.531 8.660  22.219  1.00 73.14  ?  467 VAL A C   1 
ATOM   3155 O O   . VAL A 1 423 ? -37.595 8.951  23.405  1.00 73.81  ?  467 VAL A O   1 
ATOM   3156 C CB  . VAL A 1 423 ? -39.643 9.698  21.473  1.00 75.69  ?  467 VAL A CB  1 
ATOM   3157 C CG1 . VAL A 1 423 ? -40.294 10.731 20.573  1.00 74.86  ?  467 VAL A CG1 1 
ATOM   3158 C CG2 . VAL A 1 423 ? -40.285 8.340  21.311  1.00 80.07  ?  467 VAL A CG2 1 
ATOM   3159 N N   . MET A 1 424 ? -36.975 7.531  21.789  1.00 110.37 ?  468 MET A N   1 
ATOM   3160 C CA  . MET A 1 424 ? -36.500 6.534  22.742  1.00 112.47 ?  468 MET A CA  1 
ATOM   3161 C C   . MET A 1 424 ? -35.234 6.967  23.490  1.00 109.57 ?  468 MET A C   1 
ATOM   3162 O O   . MET A 1 424 ? -34.629 8.003  23.189  1.00 105.78 ?  468 MET A O   1 
ATOM   3163 C CB  . MET A 1 424 ? -36.228 5.216  22.022  1.00 114.45 ?  468 MET A CB  1 
ATOM   3164 C CG  . MET A 1 424 ? -37.473 4.466  21.526  1.00 118.76 ?  468 MET A CG  1 
ATOM   3165 S SD  . MET A 1 424 ? -37.236 3.802  19.845  1.00 118.82 ?  468 MET A SD  1 
ATOM   3166 C CE  . MET A 1 424 ? -35.858 2.639  20.046  1.00 119.11 ?  468 MET A CE  1 
ATOM   3167 N N   . VAL A 1 425 ? -34.811 6.143  24.445  1.00 85.75  ?  469 VAL A N   1 
ATOM   3168 C CA  . VAL A 1 425 ? -33.665 6.480  25.290  1.00 83.90  ?  469 VAL A CA  1 
ATOM   3169 C C   . VAL A 1 425 ? -32.361 6.173  24.545  1.00 81.67  ?  469 VAL A C   1 
ATOM   3170 O O   . VAL A 1 425 ? -32.010 5.011  24.337  1.00 83.73  ?  469 VAL A O   1 
ATOM   3171 C CB  . VAL A 1 425 ? -33.722 5.719  26.645  1.00 87.73  ?  469 VAL A CB  1 
ATOM   3172 C CG1 . VAL A 1 425 ? -32.451 5.932  27.424  1.00 86.32  ?  469 VAL A CG1 1 
ATOM   3173 C CG2 . VAL A 1 425 ? -34.901 6.184  27.467  1.00 89.97  ?  469 VAL A CG2 1 
ATOM   3174 N N   . PRO A 1 426 ? -31.636 7.227  24.155  1.00 79.88  ?  470 PRO A N   1 
ATOM   3175 C CA  . PRO A 1 426 ? -30.537 7.180  23.180  1.00 78.50  ?  470 PRO A CA  1 
ATOM   3176 C C   . PRO A 1 426 ? -29.251 6.606  23.727  1.00 79.80  ?  470 PRO A C   1 
ATOM   3177 O O   . PRO A 1 426 ? -28.899 6.906  24.863  1.00 79.97  ?  470 PRO A O   1 
ATOM   3178 C CB  . PRO A 1 426 ? -30.312 8.653  22.863  1.00 75.97  ?  470 PRO A CB  1 
ATOM   3179 C CG  . PRO A 1 426 ? -30.606 9.340  24.157  1.00 75.59  ?  470 PRO A CG  1 
ATOM   3180 C CD  . PRO A 1 426 ? -31.734 8.548  24.799  1.00 78.01  ?  470 PRO A CD  1 
ATOM   3181 N N   . ASP A 1 427 ? -28.551 5.804  22.933  1.00 76.54  ?  471 ASP A N   1 
ATOM   3182 C CA  . ASP A 1 427 ? -27.192 5.450  23.296  1.00 78.46  ?  471 ASP A CA  1 
ATOM   3183 C C   . ASP A 1 427 ? -26.290 6.596  22.877  1.00 77.42  ?  471 ASP A C   1 
ATOM   3184 O O   . ASP A 1 427 ? -26.746 7.569  22.264  1.00 75.18  ?  471 ASP A O   1 
ATOM   3185 C CB  . ASP A 1 427 ? -26.747 4.201  22.564  1.00 80.95  ?  471 ASP A CB  1 
ATOM   3186 C CG  . ASP A 1 427 ? -27.796 3.163  22.540  1.00 81.59  ?  471 ASP A CG  1 
ATOM   3187 O OD1 . ASP A 1 427 ? -28.303 2.855  23.640  1.00 82.52  ?  471 ASP A OD1 1 
ATOM   3188 O OD2 . ASP A 1 427 ? -28.121 2.677  21.429  1.00 81.95  ?  471 ASP A OD2 1 
ATOM   3189 N N   . VAL A 1 428 ? -25.003 6.461  23.191  1.00 73.21  ?  472 VAL A N   1 
ATOM   3190 C CA  . VAL A 1 428 ? -24.013 7.454  22.797  1.00 72.61  ?  472 VAL A CA  1 
ATOM   3191 C C   . VAL A 1 428 ? -23.200 6.940  21.620  1.00 74.76  ?  472 VAL A C   1 
ATOM   3192 O O   . VAL A 1 428 ? -22.758 5.789  21.604  1.00 77.50  ?  472 VAL A O   1 
ATOM   3193 C CB  . VAL A 1 428 ? -23.100 7.846  23.977  1.00 72.80  ?  472 VAL A CB  1 
ATOM   3194 C CG1 . VAL A 1 428 ? -21.953 8.742  23.504  1.00 72.07  ?  472 VAL A CG1 1 
ATOM   3195 C CG2 . VAL A 1 428 ? -23.910 8.542  25.065  1.00 70.98  ?  472 VAL A CG2 1 
ATOM   3196 N N   . TYR A 1 429 ? -23.031 7.801  20.624  1.00 65.24  ?  473 TYR A N   1 
ATOM   3197 C CA  . TYR A 1 429 ? -22.254 7.467  19.441  1.00 66.48  ?  473 TYR A CA  1 
ATOM   3198 C C   . TYR A 1 429 ? -21.039 8.359  19.286  1.00 65.78  ?  473 TYR A C   1 
ATOM   3199 O O   . TYR A 1 429 ? -21.062 9.528  19.663  1.00 63.33  ?  473 TYR A O   1 
ATOM   3200 C CB  . TYR A 1 429 ? -23.127 7.592  18.199  1.00 65.37  ?  473 TYR A CB  1 
ATOM   3201 C CG  . TYR A 1 429 ? -24.240 6.597  18.172  1.00 65.72  ?  473 TYR A CG  1 
ATOM   3202 C CD1 . TYR A 1 429 ? -25.457 6.867  18.777  1.00 63.74  ?  473 TYR A CD1 1 
ATOM   3203 C CD2 . TYR A 1 429 ? -24.072 5.385  17.534  1.00 68.06  ?  473 TYR A CD2 1 
ATOM   3204 C CE1 . TYR A 1 429 ? -26.473 5.946  18.749  1.00 64.06  ?  473 TYR A CE1 1 
ATOM   3205 C CE2 . TYR A 1 429 ? -25.062 4.465  17.499  1.00 68.40  ?  473 TYR A CE2 1 
ATOM   3206 C CZ  . TYR A 1 429 ? -26.263 4.743  18.108  1.00 66.39  ?  473 TYR A CZ  1 
ATOM   3207 O OH  . TYR A 1 429 ? -27.251 3.794  18.057  1.00 66.93  ?  473 TYR A OH  1 
ATOM   3208 N N   . ILE A 1 430 ? -19.984 7.803  18.702  1.00 59.52  ?  474 ILE A N   1 
ATOM   3209 C CA  . ILE A 1 430 ? -18.753 8.548  18.483  1.00 59.42  ?  474 ILE A CA  1 
ATOM   3210 C C   . ILE A 1 430 ? -18.270 8.464  17.029  1.00 61.00  ?  474 ILE A C   1 
ATOM   3211 O O   . ILE A 1 430 ? -18.633 7.546  16.283  1.00 62.92  ?  474 ILE A O   1 
ATOM   3212 C CB  . ILE A 1 430 ? -17.643 8.058  19.458  1.00 61.34  ?  474 ILE A CB  1 
ATOM   3213 C CG1 . ILE A 1 430 ? -16.513 9.088  19.538  1.00 60.77  ?  474 ILE A CG1 1 
ATOM   3214 C CG2 . ILE A 1 430 ? -17.165 6.663  19.089  1.00 64.81  ?  474 ILE A CG2 1 
ATOM   3215 C CD1 . ILE A 1 430 ? -15.292 8.600  20.238  1.00 63.10  ?  474 ILE A CD1 1 
ATOM   3216 N N   . SER A 1 431 ? -17.460 9.442  16.625  1.00 65.12  ?  475 SER A N   1 
ATOM   3217 C CA  . SER A 1 431 ? -16.798 9.439  15.319  1.00 67.30  ?  475 SER A CA  1 
ATOM   3218 C C   . SER A 1 431 ? -15.388 9.971  15.509  1.00 68.26  ?  475 SER A C   1 
ATOM   3219 O O   . SER A 1 431 ? -15.202 11.000 16.165  1.00 65.80  ?  475 SER A O   1 
ATOM   3220 C CB  . SER A 1 431 ? -17.558 10.334 14.332  1.00 65.29  ?  475 SER A CB  1 
ATOM   3221 O OG  . SER A 1 431 ? -16.825 10.515 13.130  1.00 67.59  ?  475 SER A OG  1 
ATOM   3222 N N   . ASP A 1 432 ? -14.388 9.263  14.986  1.00 69.82  ?  476 ASP A N   1 
ATOM   3223 C CA  . ASP A 1 432 ? -13.020 9.781  15.036  1.00 70.67  ?  476 ASP A CA  1 
ATOM   3224 C C   . ASP A 1 432 ? -12.609 10.507 13.763  1.00 71.20  ?  476 ASP A C   1 
ATOM   3225 O O   . ASP A 1 432 ? -11.555 11.127 13.719  1.00 69.78  ?  476 ASP A O   1 
ATOM   3226 C CB  . ASP A 1 432 ? -12.009 8.699  15.406  1.00 72.36  ?  476 ASP A CB  1 
ATOM   3227 C CG  . ASP A 1 432 ? -11.877 7.618  14.353  1.00 74.37  ?  476 ASP A CG  1 
ATOM   3228 O OD1 . ASP A 1 432 ? -12.297 7.835  13.193  1.00 74.83  ?  476 ASP A OD1 1 
ATOM   3229 O OD2 . ASP A 1 432 ? -11.335 6.537  14.694  1.00 75.56  ?  476 ASP A OD2 1 
ATOM   3230 N N   . ASP A 1 433 ? -13.432 10.389 12.725  1.00 65.58  ?  477 ASP A N   1 
ATOM   3231 C CA  . ASP A 1 433 ? -13.184 11.059 11.443  1.00 64.03  ?  477 ASP A CA  1 
ATOM   3232 C C   . ASP A 1 433 ? -13.939 12.366 11.145  1.00 58.82  ?  477 ASP A C   1 
ATOM   3233 O O   . ASP A 1 433 ? -13.925 12.822 10.012  1.00 57.22  ?  477 ASP A O   1 
ATOM   3234 C CB  . ASP A 1 433 ? -13.247 10.095 10.257  1.00 66.36  ?  477 ASP A CB  1 
ATOM   3235 C CG  . ASP A 1 433 ? -14.603 9.463  10.088  1.00 69.22  ?  477 ASP A CG  1 
ATOM   3236 O OD1 . ASP A 1 433 ? -15.619 10.082 10.471  1.00 67.26  ?  477 ASP A OD1 1 
ATOM   3237 O OD2 . ASP A 1 433 ? -14.643 8.336  9.558   1.00 70.81  ?  477 ASP A OD2 1 
ATOM   3238 N N   . GLY A 1 434 ? -14.656 12.932 12.102  1.00 58.55  ?  478 GLY A N   1 
ATOM   3239 C CA  . GLY A 1 434 ? -15.294 14.209 11.847  1.00 53.60  ?  478 GLY A CA  1 
ATOM   3240 C C   . GLY A 1 434 ? -16.701 14.048 11.275  1.00 53.61  ?  478 GLY A C   1 
ATOM   3241 O O   . GLY A 1 434 ? -17.284 14.996 10.749  1.00 50.97  ?  478 GLY A O   1 
ATOM   3242 N N   . GLY A 1 435 ? -17.265 12.850 11.397  1.00 54.18  ?  479 GLY A N   1 
ATOM   3243 C CA  . GLY A 1 435 ? -18.657 12.635 11.073  1.00 53.99  ?  479 GLY A CA  1 
ATOM   3244 C C   . GLY A 1 435 ? -18.943 11.842 9.813   1.00 58.30  ?  479 GLY A C   1 
ATOM   3245 O O   . GLY A 1 435 ? -20.098 11.640 9.489   1.00 58.35  ?  479 GLY A O   1 
ATOM   3246 N N   . TYR A 1 436 ? -17.917 11.379 9.112   1.00 56.41  ?  480 TYR A N   1 
ATOM   3247 C CA  . TYR A 1 436 ? -18.120 10.521 7.954   1.00 61.77  ?  480 TYR A CA  1 
ATOM   3248 C C   . TYR A 1 436 ? -18.557 9.131  8.371   1.00 63.71  ?  480 TYR A C   1 
ATOM   3249 O O   . TYR A 1 436 ? -19.290 8.452  7.645   1.00 65.26  ?  480 TYR A O   1 
ATOM   3250 C CB  . TYR A 1 436 ? -16.846 10.403 7.140   1.00 62.86  ?  480 TYR A CB  1 
ATOM   3251 C CG  . TYR A 1 436 ? -16.528 11.626 6.313   1.00 58.30  ?  480 TYR A CG  1 
ATOM   3252 C CD1 . TYR A 1 436 ? -15.862 12.721 6.865   1.00 53.74  ?  480 TYR A CD1 1 
ATOM   3253 C CD2 . TYR A 1 436 ? -16.888 11.683 4.977   1.00 58.89  ?  480 TYR A CD2 1 
ATOM   3254 C CE1 . TYR A 1 436 ? -15.568 13.831 6.101   1.00 50.52  ?  480 TYR A CE1 1 
ATOM   3255 C CE2 . TYR A 1 436 ? -16.609 12.784 4.213   1.00 55.71  ?  480 TYR A CE2 1 
ATOM   3256 C CZ  . TYR A 1 436 ? -15.947 13.856 4.774   1.00 51.74  ?  480 TYR A CZ  1 
ATOM   3257 O OH  . TYR A 1 436 ? -15.674 14.949 3.977   1.00 49.45  ?  480 TYR A OH  1 
ATOM   3258 N N   . SER A 1 437 ? -18.106 8.691  9.536   1.00 60.30  ?  481 SER A N   1 
ATOM   3259 C CA  . SER A 1 437 ? -18.400 7.335  9.966   1.00 61.02  ?  481 SER A CA  1 
ATOM   3260 C C   . SER A 1 437 ? -18.571 7.303  11.468  1.00 58.14  ?  481 SER A C   1 
ATOM   3261 O O   . SER A 1 437 ? -17.911 8.065  12.188  1.00 56.53  ?  481 SER A O   1 
ATOM   3262 C CB  . SER A 1 437 ? -17.280 6.391  9.556   1.00 63.96  ?  481 SER A CB  1 
ATOM   3263 O OG  . SER A 1 437 ? -16.238 6.449  10.504  1.00 63.27  ?  481 SER A OG  1 
ATOM   3264 N N   . TRP A 1 438 ? -19.446 6.422  11.943  1.00 64.46  ?  482 TRP A N   1 
ATOM   3265 C CA  . TRP A 1 438 ? -19.776 6.395  13.356  1.00 62.09  ?  482 TRP A CA  1 
ATOM   3266 C C   . TRP A 1 438 ? -19.814 5.016  13.956  1.00 63.70  ?  482 TRP A C   1 
ATOM   3267 O O   . TRP A 1 438 ? -19.880 4.000  13.261  1.00 66.02  ?  482 TRP A O   1 
ATOM   3268 C CB  . TRP A 1 438 ? -21.132 7.024  13.591  1.00 58.87  ?  482 TRP A CB  1 
ATOM   3269 C CG  . TRP A 1 438 ? -21.243 8.423  13.148  1.00 56.58  ?  482 TRP A CG  1 
ATOM   3270 C CD1 . TRP A 1 438 ? -21.435 8.879  11.870  1.00 57.27  ?  482 TRP A CD1 1 
ATOM   3271 C CD2 . TRP A 1 438 ? -21.198 9.574  13.988  1.00 53.29  ?  482 TRP A CD2 1 
ATOM   3272 N NE1 . TRP A 1 438 ? -21.508 10.255 11.870  1.00 54.28  ?  482 TRP A NE1 1 
ATOM   3273 C CE2 . TRP A 1 438 ? -21.365 10.706 13.155  1.00 51.66  ?  482 TRP A CE2 1 
ATOM   3274 C CE3 . TRP A 1 438 ? -21.040 9.760  15.371  1.00 51.76  ?  482 TRP A CE3 1 
ATOM   3275 C CZ2 . TRP A 1 438 ? -21.377 12.004 13.657  1.00 48.27  ?  482 TRP A CZ2 1 
ATOM   3276 C CZ3 . TRP A 1 438 ? -21.050 11.056 15.877  1.00 48.68  ?  482 TRP A CZ3 1 
ATOM   3277 C CH2 . TRP A 1 438 ? -21.207 12.163 15.017  1.00 46.85  ?  482 TRP A CH2 1 
ATOM   3278 N N   . THR A 1 439 ? -19.807 5.005  15.280  1.00 79.65  ?  483 THR A N   1 
ATOM   3279 C CA  . THR A 1 439 ? -19.840 3.777  16.044  1.00 81.15  ?  483 THR A CA  1 
ATOM   3280 C C   . THR A 1 439 ? -20.576 4.076  17.336  1.00 79.04  ?  483 THR A C   1 
ATOM   3281 O O   . THR A 1 439 ? -20.501 5.200  17.840  1.00 76.88  ?  483 THR A O   1 
ATOM   3282 C CB  . THR A 1 439 ? -18.412 3.310  16.341  1.00 83.30  ?  483 THR A CB  1 
ATOM   3283 O OG1 . THR A 1 439 ? -17.768 2.974  15.109  1.00 85.48  ?  483 THR A OG1 1 
ATOM   3284 C CG2 . THR A 1 439 ? -18.414 2.091  17.218  1.00 84.80  ?  483 THR A CG2 1 
ATOM   3285 N N   . LYS A 1 440 ? -21.286 3.089  17.879  1.00 79.55  ?  484 LYS A N   1 
ATOM   3286 C CA  . LYS A 1 440 ? -21.918 3.282  19.173  1.00 78.20  ?  484 LYS A CA  1 
ATOM   3287 C C   . LYS A 1 440 ? -20.809 3.271  20.212  1.00 79.38  ?  484 LYS A C   1 
ATOM   3288 O O   . LYS A 1 440 ? -20.078 2.292  20.342  1.00 81.83  ?  484 LYS A O   1 
ATOM   3289 C CB  . LYS A 1 440 ? -22.925 2.165  19.464  1.00 78.82  ?  484 LYS A CB  1 
ATOM   3290 C CG  . LYS A 1 440 ? -23.681 2.343  20.785  1.00 77.57  ?  484 LYS A CG  1 
ATOM   3291 C CD  . LYS A 1 440 ? -24.649 1.206  21.076  1.00 78.21  ?  484 LYS A CD  1 
ATOM   3292 C CE  . LYS A 1 440 ? -25.751 1.087  20.036  1.00 77.09  ?  484 LYS A CE  1 
ATOM   3293 N NZ  . LYS A 1 440 ? -26.501 -0.207 20.210  1.00 78.83  ?  484 LYS A NZ  1 
ATOM   3294 N N   . MET A 1 441 ? -20.673 4.372  20.939  1.00 85.89  ?  485 MET A N   1 
ATOM   3295 C CA  . MET A 1 441 ? -19.631 4.477  21.949  1.00 86.56  ?  485 MET A CA  1 
ATOM   3296 C C   . MET A 1 441 ? -20.032 3.734  23.225  1.00 87.80  ?  485 MET A C   1 
ATOM   3297 O O   . MET A 1 441 ? -19.258 2.935  23.761  1.00 89.98  ?  485 MET A O   1 
ATOM   3298 C CB  . MET A 1 441 ? -19.353 5.943  22.266  1.00 83.94  ?  485 MET A CB  1 
ATOM   3299 C CG  . MET A 1 441 ? -18.067 6.188  23.007  1.00 84.74  ?  485 MET A CG  1 
ATOM   3300 S SD  . MET A 1 441 ? -17.778 7.956  23.256  1.00 81.72  ?  485 MET A SD  1 
ATOM   3301 C CE  . MET A 1 441 ? -18.596 8.200  24.838  1.00 80.68  ?  485 MET A CE  1 
ATOM   3302 N N   . LEU A 1 442 ? -21.248 3.991  23.694  1.00 82.03  ?  486 LEU A N   1 
ATOM   3303 C CA  . LEU A 1 442 ? -21.729 3.415  24.941  1.00 82.87  ?  486 LEU A CA  1 
ATOM   3304 C C   . LEU A 1 442 ? -23.232 3.205  24.827  1.00 81.29  ?  486 LEU A C   1 
ATOM   3305 O O   . LEU A 1 442 ? -23.920 3.914  24.082  1.00 78.90  ?  486 LEU A O   1 
ATOM   3306 C CB  . LEU A 1 442 ? -21.445 4.349  26.125  1.00 81.30  ?  486 LEU A CB  1 
ATOM   3307 C CG  . LEU A 1 442 ? -20.008 4.744  26.491  1.00 81.93  ?  486 LEU A CG  1 
ATOM   3308 C CD1 . LEU A 1 442 ? -20.006 5.844  27.544  1.00 80.24  ?  486 LEU A CD1 1 
ATOM   3309 C CD2 . LEU A 1 442 ? -19.212 3.540  26.973  1.00 85.17  ?  486 LEU A CD2 1 
ATOM   3310 N N   . GLU A 1 443 ? -23.759 2.239  25.558  1.00 104.99 ?  487 GLU A N   1 
ATOM   3311 C CA  . GLU A 1 443 ? -25.190 2.062  25.539  1.00 103.30 ?  487 GLU A CA  1 
ATOM   3312 C C   . GLU A 1 443 ? -25.767 2.887  26.651  1.00 101.60 ?  487 GLU A C   1 
ATOM   3313 O O   . GLU A 1 443 ? -25.251 2.889  27.760  1.00 102.89 ?  487 GLU A O   1 
ATOM   3314 C CB  . GLU A 1 443 ? -25.542 0.602  25.705  1.00 106.11 ?  487 GLU A CB  1 
ATOM   3315 C CG  . GLU A 1 443 ? -24.890 -0.246 24.659  1.00 107.22 ?  487 GLU A CG  1 
ATOM   3316 C CD  . GLU A 1 443 ? -25.325 -1.681 24.725  1.00 110.63 ?  487 GLU A CD  1 
ATOM   3317 O OE1 . GLU A 1 443 ? -25.751 -2.139 25.817  1.00 114.00 ?  487 GLU A OE1 1 
ATOM   3318 O OE2 . GLU A 1 443 ? -25.241 -2.343 23.665  1.00 111.37 ?  487 GLU A OE2 1 
ATOM   3319 N N   . GLY A 1 444 ? -26.827 3.617  26.343  1.00 79.45  ?  488 GLY A N   1 
ATOM   3320 C CA  . GLY A 1 444 ? -27.495 4.425  27.340  1.00 78.66  ?  488 GLY A CA  1 
ATOM   3321 C C   . GLY A 1 444 ? -26.944 5.827  27.413  1.00 75.95  ?  488 GLY A C   1 
ATOM   3322 O O   . GLY A 1 444 ? -25.813 6.089  27.016  1.00 76.33  ?  488 GLY A O   1 
ATOM   3323 N N   . PRO A 1 445 ? -27.747 6.755  27.926  1.00 72.15  ?  489 PRO A N   1 
ATOM   3324 C CA  . PRO A 1 445 ? -27.321 8.160  27.933  1.00 69.96  ?  489 PRO A CA  1 
ATOM   3325 C C   . PRO A 1 445 ? -26.171 8.385  28.916  1.00 71.14  ?  489 PRO A C   1 
ATOM   3326 O O   . PRO A 1 445 ? -26.180 7.786  29.993  1.00 72.96  ?  489 PRO A O   1 
ATOM   3327 C CB  . PRO A 1 445 ? -28.591 8.887  28.400  1.00 69.06  ?  489 PRO A CB  1 
ATOM   3328 C CG  . PRO A 1 445 ? -29.315 7.864  29.227  1.00 72.02  ?  489 PRO A CG  1 
ATOM   3329 C CD  . PRO A 1 445 ? -29.082 6.568  28.516  1.00 73.46  ?  489 PRO A CD  1 
ATOM   3330 N N   . HIS A 1 446 ? -25.195 9.211  28.556  1.00 71.94  ?  490 HIS A N   1 
ATOM   3331 C CA  . HIS A 1 446 ? -24.070 9.502  29.456  1.00 73.13  ?  490 HIS A CA  1 
ATOM   3332 C C   . HIS A 1 446 ? -23.701 10.966 29.384  1.00 71.40  ?  490 HIS A C   1 
ATOM   3333 O O   . HIS A 1 446 ? -23.973 11.611 28.378  1.00 69.42  ?  490 HIS A O   1 
ATOM   3334 C CB  . HIS A 1 446 ? -22.820 8.720  29.059  1.00 75.07  ?  490 HIS A CB  1 
ATOM   3335 C CG  . HIS A 1 446 ? -22.887 7.255  29.347  1.00 77.57  ?  490 HIS A CG  1 
ATOM   3336 N ND1 . HIS A 1 446 ? -23.738 6.404  28.680  1.00 77.74  ?  490 HIS A ND1 1 
ATOM   3337 C CD2 . HIS A 1 446 ? -22.175 6.483  30.202  1.00 80.15  ?  490 HIS A CD2 1 
ATOM   3338 C CE1 . HIS A 1 446 ? -23.549 5.171  29.110  1.00 80.32  ?  490 HIS A CE1 1 
ATOM   3339 N NE2 . HIS A 1 446 ? -22.608 5.191  30.035  1.00 81.83  ?  490 HIS A NE2 1 
ATOM   3340 N N   . TYR A 1 447 ? -23.086 11.491 30.444  1.00 75.76  ?  491 TYR A N   1 
ATOM   3341 C CA  . TYR A 1 447 ? -22.369 12.757 30.336  1.00 74.85  ?  491 TYR A CA  1 
ATOM   3342 C C   . TYR A 1 447 ? -20.950 12.421 29.880  1.00 76.02  ?  491 TYR A C   1 
ATOM   3343 O O   . TYR A 1 447 ? -20.363 11.448 30.341  1.00 78.25  ?  491 TYR A O   1 
ATOM   3344 C CB  . TYR A 1 447 ? -22.335 13.516 31.660  1.00 75.73  ?  491 TYR A CB  1 
ATOM   3345 C CG  . TYR A 1 447 ? -23.684 13.838 32.249  1.00 75.17  ?  491 TYR A CG  1 
ATOM   3346 C CD1 . TYR A 1 447 ? -24.458 12.840 32.837  1.00 76.24  ?  491 TYR A CD1 1 
ATOM   3347 C CD2 . TYR A 1 447 ? -24.169 15.139 32.258  1.00 73.98  ?  491 TYR A CD2 1 
ATOM   3348 C CE1 . TYR A 1 447 ? -25.687 13.119 33.399  1.00 76.04  ?  491 TYR A CE1 1 
ATOM   3349 C CE2 . TYR A 1 447 ? -25.396 15.439 32.822  1.00 73.96  ?  491 TYR A CE2 1 
ATOM   3350 C CZ  . TYR A 1 447 ? -26.154 14.422 33.389  1.00 74.94  ?  491 TYR A CZ  1 
ATOM   3351 O OH  . TYR A 1 447 ? -27.393 14.684 33.949  1.00 75.40  ?  491 TYR A OH  1 
ATOM   3352 N N   . TYR A 1 448 ? -20.405 13.206 28.964  1.00 73.26  ?  492 TYR A N   1 
ATOM   3353 C CA  . TYR A 1 448 ? -19.082 12.911 28.428  1.00 74.54  ?  492 TYR A CA  1 
ATOM   3354 C C   . TYR A 1 448 ? -18.200 14.155 28.345  1.00 74.24  ?  492 TYR A C   1 
ATOM   3355 O O   . TYR A 1 448 ? -18.692 15.268 28.183  1.00 72.30  ?  492 TYR A O   1 
ATOM   3356 C CB  . TYR A 1 448 ? -19.184 12.218 27.059  1.00 74.02  ?  492 TYR A CB  1 
ATOM   3357 C CG  . TYR A 1 448 ? -20.311 12.739 26.190  1.00 71.33  ?  492 TYR A CG  1 
ATOM   3358 C CD1 . TYR A 1 448 ? -20.191 13.941 25.516  1.00 69.25  ?  492 TYR A CD1 1 
ATOM   3359 C CD2 . TYR A 1 448 ? -21.491 12.030 26.059  1.00 71.10  ?  492 TYR A CD2 1 
ATOM   3360 C CE1 . TYR A 1 448 ? -21.208 14.427 24.742  1.00 67.01  ?  492 TYR A CE1 1 
ATOM   3361 C CE2 . TYR A 1 448 ? -22.527 12.503 25.271  1.00 68.99  ?  492 TYR A CE2 1 
ATOM   3362 C CZ  . TYR A 1 448 ? -22.379 13.705 24.616  1.00 66.99  ?  492 TYR A CZ  1 
ATOM   3363 O OH  . TYR A 1 448 ? -23.398 14.183 23.833  1.00 65.21  ?  492 TYR A OH  1 
ATOM   3364 N N   . THR A 1 449 ? -16.895 13.950 28.481  1.00 75.57  ?  493 THR A N   1 
ATOM   3365 C CA  . THR A 1 449 ? -15.915 15.028 28.400  1.00 76.02  ?  493 THR A CA  1 
ATOM   3366 C C   . THR A 1 449 ? -14.635 14.520 27.722  1.00 77.91  ?  493 THR A C   1 
ATOM   3367 O O   . THR A 1 449 ? -14.339 13.323 27.761  1.00 79.45  ?  493 THR A O   1 
ATOM   3368 C CB  . THR A 1 449 ? -15.577 15.543 29.802  1.00 77.73  ?  493 THR A CB  1 
ATOM   3369 O OG1 . THR A 1 449 ? -14.494 16.489 29.740  1.00 78.60  ?  493 THR A OG1 1 
ATOM   3370 C CG2 . THR A 1 449 ? -15.159 14.380 30.671  1.00 80.25  ?  493 THR A CG2 1 
ATOM   3371 N N   . ILE A 1 450 ? -13.886 15.431 27.097  1.00 63.76  ?  494 ILE A N   1 
ATOM   3372 C CA  . ILE A 1 450 ? -12.584 15.108 26.497  1.00 65.89  ?  494 ILE A CA  1 
ATOM   3373 C C   . ILE A 1 450 ? -11.425 15.764 27.245  1.00 67.86  ?  494 ILE A C   1 
ATOM   3374 O O   . ILE A 1 450 ? -11.426 16.973 27.478  1.00 67.46  ?  494 ILE A O   1 
ATOM   3375 C CB  . ILE A 1 450 ? -12.523 15.549 25.033  1.00 64.67  ?  494 ILE A CB  1 
ATOM   3376 C CG1 . ILE A 1 450 ? -13.518 14.744 24.186  1.00 62.72  ?  494 ILE A CG1 1 
ATOM   3377 C CG2 . ILE A 1 450 ? -11.100 15.413 24.484  1.00 67.02  ?  494 ILE A CG2 1 
ATOM   3378 C CD1 . ILE A 1 450 ? -13.833 15.375 22.826  1.00 60.11  ?  494 ILE A CD1 1 
ATOM   3379 N N   . LEU A 1 451 ? -10.429 14.961 27.606  1.00 75.60  ?  495 LEU A N   1 
ATOM   3380 C CA  . LEU A 1 451 ? -9.228  15.458 28.278  1.00 76.71  ?  495 LEU A CA  1 
ATOM   3381 C C   . LEU A 1 451 ? -8.003  15.284 27.394  1.00 76.83  ?  495 LEU A C   1 
ATOM   3382 O O   . LEU A 1 451 ? -8.011  14.437 26.502  1.00 76.95  ?  495 LEU A O   1 
ATOM   3383 C CB  . LEU A 1 451 ? -9.011  14.706 29.586  1.00 78.21  ?  495 LEU A CB  1 
ATOM   3384 C CG  . LEU A 1 451 ? -10.162 14.889 30.568  1.00 77.89  ?  495 LEU A CG  1 
ATOM   3385 C CD1 . LEU A 1 451 ? -10.110 13.842 31.637  1.00 79.29  ?  495 LEU A CD1 1 
ATOM   3386 C CD2 . LEU A 1 451 ? -10.102 16.270 31.174  1.00 77.91  ?  495 LEU A CD2 1 
ATOM   3387 N N   . ASP A 1 452 ? -6.969  16.097 27.638  1.00 88.10  ?  496 ASP A N   1 
ATOM   3388 C CA  . ASP A 1 452 ? -5.672  15.947 26.979  1.00 87.81  ?  496 ASP A CA  1 
ATOM   3389 C C   . ASP A 1 452 ? -5.804  15.802 25.467  1.00 86.50  ?  496 ASP A C   1 
ATOM   3390 O O   . ASP A 1 452 ? -5.256  14.869 24.880  1.00 87.01  ?  496 ASP A O   1 
ATOM   3391 C CB  . ASP A 1 452 ? -4.934  14.736 27.556  1.00 89.74  ?  496 ASP A CB  1 
ATOM   3392 C CG  . ASP A 1 452 ? -3.515  14.583 27.015  1.00 89.61  ?  496 ASP A CG  1 
ATOM   3393 O OD1 . ASP A 1 452 ? -2.749  15.581 26.960  1.00 88.59  ?  496 ASP A OD1 1 
ATOM   3394 O OD2 . ASP A 1 452 ? -3.175  13.439 26.638  1.00 90.58  ?  496 ASP A OD2 1 
ATOM   3395 N N   . SER A 1 453 ? -6.573  16.699 24.855  1.00 70.80  ?  497 SER A N   1 
ATOM   3396 C CA  . SER A 1 453 ? -6.702  16.747 23.404  1.00 69.13  ?  497 SER A CA  1 
ATOM   3397 C C   . SER A 1 453 ? -7.044  15.384 22.823  1.00 70.72  ?  497 SER A C   1 
ATOM   3398 O O   . SER A 1 453 ? -6.527  15.001 21.775  1.00 70.18  ?  497 SER A O   1 
ATOM   3399 C CB  . SER A 1 453 ? -5.407  17.253 22.759  1.00 67.32  ?  497 SER A CB  1 
ATOM   3400 O OG  . SER A 1 453 ? -5.059  18.551 23.216  1.00 65.53  ?  497 SER A OG  1 
ATOM   3401 N N   . GLY A 1 454 ? -7.896  14.641 23.518  1.00 75.89  ?  498 GLY A N   1 
ATOM   3402 C CA  . GLY A 1 454 ? -8.337  13.352 23.026  1.00 76.91  ?  498 GLY A CA  1 
ATOM   3403 C C   . GLY A 1 454 ? -7.539  12.185 23.567  1.00 78.51  ?  498 GLY A C   1 
ATOM   3404 O O   . GLY A 1 454 ? -7.792  11.037 23.209  1.00 79.52  ?  498 GLY A O   1 
ATOM   3405 N N   . GLY A 1 455 ? -6.571  12.469 24.431  1.00 90.48  ?  499 GLY A N   1 
ATOM   3406 C CA  . GLY A 1 455 ? -5.780  11.412 25.027  1.00 92.18  ?  499 GLY A CA  1 
ATOM   3407 C C   . GLY A 1 455 ? -6.635  10.609 25.981  1.00 93.25  ?  499 GLY A C   1 
ATOM   3408 O O   . GLY A 1 455 ? -6.399  9.418  26.214  1.00 94.77  ?  499 GLY A O   1 
ATOM   3409 N N   . ILE A 1 456 ? -7.635  11.277 26.547  1.00 86.55  ?  500 ILE A N   1 
ATOM   3410 C CA  . ILE A 1 456 ? -8.553  10.635 27.477  1.00 87.12  ?  500 ILE A CA  1 
ATOM   3411 C C   . ILE A 1 456 ? -9.960  11.060 27.168  1.00 85.43  ?  500 ILE A C   1 
ATOM   3412 O O   . ILE A 1 456 ? -10.235 12.246 26.996  1.00 84.12  ?  500 ILE A O   1 
ATOM   3413 C CB  . ILE A 1 456 ? -8.282  11.037 28.942  1.00 87.85  ?  500 ILE A CB  1 
ATOM   3414 C CG1 . ILE A 1 456 ? -6.846  10.723 29.335  1.00 89.39  ?  500 ILE A CG1 1 
ATOM   3415 C CG2 . ILE A 1 456 ? -9.223  10.284 29.876  1.00 88.45  ?  500 ILE A CG2 1 
ATOM   3416 C CD1 . ILE A 1 456 ? -6.629  9.250  29.583  1.00 91.30  ?  500 ILE A CD1 1 
ATOM   3417 N N   . ILE A 1 457 ? -10.855 10.086 27.097  1.00 78.64  ?  501 ILE A N   1 
ATOM   3418 C CA  . ILE A 1 457 ? -12.277 10.384 27.056  1.00 76.73  ?  501 ILE A CA  1 
ATOM   3419 C C   . ILE A 1 457 ? -12.912 9.835  28.318  1.00 77.24  ?  501 ILE A C   1 
ATOM   3420 O O   . ILE A 1 457 ? -12.629 8.706  28.730  1.00 79.09  ?  501 ILE A O   1 
ATOM   3421 C CB  . ILE A 1 457 ? -12.956 9.796  25.821  1.00 76.00  ?  501 ILE A CB  1 
ATOM   3422 C CG1 . ILE A 1 457 ? -12.328 10.386 24.556  1.00 75.72  ?  501 ILE A CG1 1 
ATOM   3423 C CG2 . ILE A 1 457 ? -14.433 10.101 25.859  1.00 73.64  ?  501 ILE A CG2 1 
ATOM   3424 C CD1 . ILE A 1 457 ? -12.940 9.888  23.255  1.00 75.22  ?  501 ILE A CD1 1 
ATOM   3425 N N   . VAL A 1 458 ? -13.759 10.644 28.945  1.00 80.56  ?  502 VAL A N   1 
ATOM   3426 C CA  . VAL A 1 458 ? -14.383 10.262 30.201  1.00 81.10  ?  502 VAL A CA  1 
ATOM   3427 C C   . VAL A 1 458 ? -15.912 10.306 30.082  1.00 78.99  ?  502 VAL A C   1 
ATOM   3428 O O   . VAL A 1 458 ? -16.452 11.207 29.451  1.00 76.71  ?  502 VAL A O   1 
ATOM   3429 C CB  . VAL A 1 458 ? -13.889 11.190 31.330  1.00 81.70  ?  502 VAL A CB  1 
ATOM   3430 C CG1 . VAL A 1 458 ? -14.590 10.881 32.603  1.00 82.39  ?  502 VAL A CG1 1 
ATOM   3431 C CG2 . VAL A 1 458 ? -12.398 11.039 31.522  1.00 83.62  ?  502 VAL A CG2 1 
ATOM   3432 N N   . ALA A 1 459 ? -16.598 9.335  30.686  1.00 75.30  ?  503 ALA A N   1 
ATOM   3433 C CA  . ALA A 1 459 ? -18.059 9.269  30.658  1.00 73.61  ?  503 ALA A CA  1 
ATOM   3434 C C   . ALA A 1 459 ? -18.719 8.868  31.997  1.00 74.65  ?  503 ALA A C   1 
ATOM   3435 O O   . ALA A 1 459 ? -18.262 7.958  32.704  1.00 77.08  ?  503 ALA A O   1 
ATOM   3436 C CB  . ALA A 1 459 ? -18.510 8.332  29.565  1.00 73.55  ?  503 ALA A CB  1 
ATOM   3437 N N   . ILE A 1 460 ? -19.822 9.540  32.316  1.00 86.53  ?  504 ILE A N   1 
ATOM   3438 C CA  . ILE A 1 460 ? -20.604 9.239  33.504  1.00 87.37  ?  504 ILE A CA  1 
ATOM   3439 C C   . ILE A 1 460 ? -22.001 8.789  33.093  1.00 86.22  ?  504 ILE A C   1 
ATOM   3440 O O   . ILE A 1 460 ? -22.676 9.475  32.342  1.00 83.91  ?  504 ILE A O   1 
ATOM   3441 C CB  . ILE A 1 460 ? -20.723 10.479 34.395  1.00 86.87  ?  504 ILE A CB  1 
ATOM   3442 C CG1 . ILE A 1 460 ? -19.374 10.798 35.021  1.00 88.71  ?  504 ILE A CG1 1 
ATOM   3443 C CG2 . ILE A 1 460 ? -21.718 10.238 35.508  1.00 88.06  ?  504 ILE A CG2 1 
ATOM   3444 C CD1 . ILE A 1 460 ? -19.118 9.991  36.286  1.00 91.76  ?  504 ILE A CD1 1 
ATOM   3445 N N   . GLU A 1 461 ? -22.437 7.638  33.584  1.00 107.15 ?  505 GLU A N   1 
ATOM   3446 C CA  . GLU A 1 461 ? -23.778 7.151  33.285  1.00 107.01 ?  505 GLU A CA  1 
ATOM   3447 C C   . GLU A 1 461 ? -24.863 8.107  33.751  1.00 105.80 ?  505 GLU A C   1 
ATOM   3448 O O   . GLU A 1 461 ? -24.771 8.675  34.824  1.00 106.83 ?  505 GLU A O   1 
ATOM   3449 C CB  . GLU A 1 461 ? -23.994 5.783  33.922  1.00 110.88 ?  505 GLU A CB  1 
ATOM   3450 C CG  . GLU A 1 461 ? -25.446 5.438  34.153  1.00 112.64 ?  505 GLU A CG  1 
ATOM   3451 C CD  . GLU A 1 461 ? -25.652 3.982  34.490  1.00 117.25 ?  505 GLU A CD  1 
ATOM   3452 O OE1 . GLU A 1 461 ? -24.655 3.228  34.532  1.00 119.05 ?  505 GLU A OE1 1 
ATOM   3453 O OE2 . GLU A 1 461 ? -26.817 3.591  34.704  1.00 119.53 ?  505 GLU A OE2 1 
ATOM   3454 N N   . HIS A 1 462 ? -25.896 8.281  32.941  1.00 108.46 ?  506 HIS A N   1 
ATOM   3455 C CA  . HIS A 1 462 ? -27.019 9.107  33.338  1.00 107.82 ?  506 HIS A CA  1 
ATOM   3456 C C   . HIS A 1 462 ? -28.094 8.238  33.939  1.00 111.71 ?  506 HIS A C   1 
ATOM   3457 O O   . HIS A 1 462 ? -28.683 7.421  33.247  1.00 112.32 ?  506 HIS A O   1 
ATOM   3458 C CB  . HIS A 1 462 ? -27.582 9.844  32.136  1.00 104.71 ?  506 HIS A CB  1 
ATOM   3459 C CG  . HIS A 1 462 ? -28.827 10.612 32.436  1.00 104.39 ?  506 HIS A CG  1 
ATOM   3460 N ND1 . HIS A 1 462 ? -28.875 11.602 33.392  1.00 104.81 ?  506 HIS A ND1 1 
ATOM   3461 C CD2 . HIS A 1 462 ? -30.070 10.538 31.906  1.00 104.50 ?  506 HIS A CD2 1 
ATOM   3462 C CE1 . HIS A 1 462 ? -30.098 12.100 33.446  1.00 105.21 ?  506 HIS A CE1 1 
ATOM   3463 N NE2 . HIS A 1 462 ? -30.842 11.472 32.554  1.00 105.09 ?  506 HIS A NE2 1 
ATOM   3464 N N   . SER A 1 463 ? -28.351 8.422  35.230  1.00 81.61  ?  507 SER A N   1 
ATOM   3465 C CA  . SER A 1 463 ? -29.279 7.556  35.955  1.00 86.27  ?  507 SER A CA  1 
ATOM   3466 C C   . SER A 1 463 ? -30.290 8.307  36.814  1.00 87.98  ?  507 SER A C   1 
ATOM   3467 O O   . SER A 1 463 ? -30.020 9.403  37.312  1.00 86.79  ?  507 SER A O   1 
ATOM   3468 C CB  . SER A 1 463 ? -28.525 6.558  36.831  1.00 90.28  ?  507 SER A CB  1 
ATOM   3469 O OG  . SER A 1 463 ? -29.430 5.625  37.407  1.00 95.00  ?  507 SER A OG  1 
ATOM   3470 N N   . SER A 1 464 ? -31.463 7.705  36.975  1.00 93.05  ?  508 SER A N   1 
ATOM   3471 C CA  . SER A 1 464 ? -32.445 8.214  37.916  1.00 95.87  ?  508 SER A CA  1 
ATOM   3472 C C   . SER A 1 464 ? -31.960 8.000  39.357  1.00 99.95  ?  508 SER A C   1 
ATOM   3473 O O   . SER A 1 464 ? -32.368 8.717  40.262  1.00 101.75 ?  508 SER A O   1 
ATOM   3474 C CB  . SER A 1 464 ? -33.797 7.537  37.692  1.00 98.75  ?  508 SER A CB  1 
ATOM   3475 O OG  . SER A 1 464 ? -33.671 6.123  37.695  1.00 101.88 ?  508 SER A OG  1 
ATOM   3476 N N   . ARG A 1 465 ? -31.059 7.038  39.544  1.00 125.53 ?  509 ARG A N   1 
ATOM   3477 C CA  . ARG A 1 465 ? -30.530 6.697  40.864  1.00 129.92 ?  509 ARG A CA  1 
ATOM   3478 C C   . ARG A 1 465 ? -29.020 6.974  40.980  1.00 128.18 ?  509 ARG A C   1 
ATOM   3479 O O   . ARG A 1 465 ? -28.320 7.038  39.965  1.00 124.19 ?  509 ARG A O   1 
ATOM   3480 C CB  . ARG A 1 465 ? -30.834 5.230  41.182  1.00 134.90 ?  509 ARG A CB  1 
ATOM   3481 C CG  . ARG A 1 465 ? -32.316 4.914  41.302  1.00 137.92 ?  509 ARG A CG  1 
ATOM   3482 C CD  . ARG A 1 465 ? -32.515 3.499  41.800  1.00 143.63 ?  509 ARG A CD  1 
ATOM   3483 N NE  . ARG A 1 465 ? -31.920 3.310  43.120  1.00 147.93 ?  509 ARG A NE  1 
ATOM   3484 C CZ  . ARG A 1 465 ? -31.784 2.129  43.716  1.00 153.28 ?  509 ARG A CZ  1 
ATOM   3485 N NH1 . ARG A 1 465 ? -32.198 1.027  43.105  1.00 154.96 ?  509 ARG A NH1 1 
ATOM   3486 N NH2 . ARG A 1 465 ? -31.231 2.049  44.920  1.00 157.29 ?  509 ARG A NH2 1 
ATOM   3487 N N   . PRO A 1 466 ? -28.515 7.147  42.221  1.00 118.27 ?  510 PRO A N   1 
ATOM   3488 C CA  . PRO A 1 466 ? -27.103 7.492  42.460  1.00 117.37 ?  510 PRO A CA  1 
ATOM   3489 C C   . PRO A 1 466 ? -26.046 6.584  41.792  1.00 116.65 ?  510 PRO A C   1 
ATOM   3490 O O   . PRO A 1 466 ? -26.301 5.414  41.514  1.00 118.69 ?  510 PRO A O   1 
ATOM   3491 C CB  . PRO A 1 466 ? -26.989 7.417  43.988  1.00 122.96 ?  510 PRO A CB  1 
ATOM   3492 C CG  . PRO A 1 466 ? -28.350 7.781  44.474  1.00 124.79 ?  510 PRO A CG  1 
ATOM   3493 C CD  . PRO A 1 466 ? -29.304 7.193  43.472  1.00 123.21 ?  510 PRO A CD  1 
ATOM   3494 N N   . ILE A 1 467 ? -24.870 7.152  41.525  1.00 113.42 ?  511 ILE A N   1 
ATOM   3495 C CA  . ILE A 1 467 ? -23.766 6.425  40.894  1.00 112.78 ?  511 ILE A CA  1 
ATOM   3496 C C   . ILE A 1 467 ? -22.465 6.639  41.671  1.00 114.90 ?  511 ILE A C   1 
ATOM   3497 O O   . ILE A 1 467 ? -22.205 7.741  42.158  1.00 114.08 ?  511 ILE A O   1 
ATOM   3498 C CB  . ILE A 1 467 ? -23.562 6.846  39.400  1.00 106.89 ?  511 ILE A CB  1 
ATOM   3499 C CG1 . ILE A 1 467 ? -23.471 8.368  39.251  1.00 102.99 ?  511 ILE A CG1 1 
ATOM   3500 C CG2 . ILE A 1 467 ? -24.691 6.321  38.523  1.00 105.63 ?  511 ILE A CG2 1 
ATOM   3501 C CD1 . ILE A 1 467 ? -22.065 8.887  39.120  1.00 101.63 ?  511 ILE A CD1 1 
ATOM   3502 N N   . ASN A 1 468 ? -21.691 5.572  41.853  1.00 119.49 ?  512 ASN A N   1 
ATOM   3503 C CA  . ASN A 1 468 ? -20.324 5.675  42.379  1.00 121.49 ?  512 ASN A CA  1 
ATOM   3504 C C   . ASN A 1 468 ? -19.193 5.582  41.333  1.00 118.56 ?  512 ASN A C   1 
ATOM   3505 O O   . ASN A 1 468 ? -18.014 5.541  41.693  1.00 120.66 ?  512 ASN A O   1 
ATOM   3506 C CB  . ASN A 1 468 ? -20.087 4.686  43.525  1.00 128.32 ?  512 ASN A CB  1 
ATOM   3507 C CG  . ASN A 1 468 ? -20.180 3.250  43.077  1.00 130.51 ?  512 ASN A CG  1 
ATOM   3508 O OD1 . ASN A 1 468 ? -20.877 2.936  42.114  1.00 127.68 ?  512 ASN A OD1 1 
ATOM   3509 N ND2 . ASN A 1 468 ? -19.475 2.366  43.769  1.00 135.95 ?  512 ASN A ND2 1 
ATOM   3510 N N   . VAL A 1 469 ? -19.545 5.517  40.052  1.00 115.70 ?  513 VAL A N   1 
ATOM   3511 C CA  . VAL A 1 469 ? -18.577 5.093  39.037  1.00 114.07 ?  513 VAL A CA  1 
ATOM   3512 C C   . VAL A 1 469 ? -18.318 6.071  37.882  1.00 108.36 ?  513 VAL A C   1 
ATOM   3513 O O   . VAL A 1 469 ? -19.229 6.757  37.421  1.00 104.89 ?  513 VAL A O   1 
ATOM   3514 C CB  . VAL A 1 469 ? -18.972 3.704  38.476  1.00 115.72 ?  513 VAL A CB  1 
ATOM   3515 C CG1 . VAL A 1 469 ? -18.040 3.304  37.328  1.00 117.01 ?  513 VAL A CG1 1 
ATOM   3516 C CG2 . VAL A 1 469 ? -18.972 2.652  39.563  1.00 111.58 ?  513 VAL A CG2 1 
ATOM   3517 N N   . ILE A 1 470 ? -17.064 6.136  37.431  1.00 107.13 ?  514 ILE A N   1 
ATOM   3518 C CA  . ILE A 1 470 ? -16.709 6.871  36.214  1.00 102.95 ?  514 ILE A CA  1 
ATOM   3519 C C   . ILE A 1 470 ? -16.077 5.917  35.190  1.00 103.40 ?  514 ILE A C   1 
ATOM   3520 O O   . ILE A 1 470 ? -15.582 4.849  35.551  1.00 106.67 ?  514 ILE A O   1 
ATOM   3521 C CB  . ILE A 1 470 ? -15.752 8.041  36.524  1.00 102.45 ?  514 ILE A CB  1 
ATOM   3522 C CG1 . ILE A 1 470 ? -15.793 9.089  35.423  1.00 99.14  ?  514 ILE A CG1 1 
ATOM   3523 C CG2 . ILE A 1 470 ? -14.328 7.545  36.740  1.00 105.16 ?  514 ILE A CG2 1 
ATOM   3524 C CD1 . ILE A 1 470 ? -15.284 10.426 35.876  1.00 98.81  ?  514 ILE A CD1 1 
ATOM   3525 N N   . LYS A 1 471 ? -16.113 6.289  33.916  1.00 94.92  ?  515 LYS A N   1 
ATOM   3526 C CA  . LYS A 1 471 ? -15.587 5.437  32.856  1.00 95.79  ?  515 LYS A CA  1 
ATOM   3527 C C   . LYS A 1 471 ? -14.613 6.221  31.985  1.00 94.89  ?  515 LYS A C   1 
ATOM   3528 O O   . LYS A 1 471 ? -14.847 7.399  31.702  1.00 92.73  ?  515 LYS A O   1 
ATOM   3529 C CB  . LYS A 1 471 ? -16.721 4.947  31.962  1.00 94.65  ?  515 LYS A CB  1 
ATOM   3530 C CG  . LYS A 1 471 ? -17.943 4.425  32.678  1.00 94.93  ?  515 LYS A CG  1 
ATOM   3531 C CD  . LYS A 1 471 ? -19.016 4.076  31.654  1.00 93.67  ?  515 LYS A CD  1 
ATOM   3532 C CE  . LYS A 1 471 ? -20.214 3.385  32.284  1.00 94.69  ?  515 LYS A CE  1 
ATOM   3533 N NZ  . LYS A 1 471 ? -21.090 2.778  31.235  1.00 94.03  ?  515 LYS A NZ  1 
ATOM   3534 N N   . PHE A 1 472 ? -13.540 5.575  31.530  1.00 100.98 ?  516 PHE A N   1 
ATOM   3535 C CA  . PHE A 1 472 ? -12.550 6.264  30.690  1.00 100.38 ?  516 PHE A CA  1 
ATOM   3536 C C   . PHE A 1 472 ? -12.003 5.412  29.553  1.00 101.32 ?  516 PHE A C   1 
ATOM   3537 O O   . PHE A 1 472 ? -12.017 4.181  29.621  1.00 103.18 ?  516 PHE A O   1 
ATOM   3538 C CB  . PHE A 1 472 ? -11.382 6.770  31.535  1.00 101.54 ?  516 PHE A CB  1 
ATOM   3539 C CG  . PHE A 1 472 ? -10.621 5.674  32.221  1.00 104.32 ?  516 PHE A CG  1 
ATOM   3540 C CD1 . PHE A 1 472 ? -11.014 5.219  33.466  1.00 105.87 ?  516 PHE A CD1 1 
ATOM   3541 C CD2 . PHE A 1 472 ? -9.533  5.087  31.614  1.00 105.64 ?  516 PHE A CD2 1 
ATOM   3542 C CE1 . PHE A 1 472 ? -10.333 4.203  34.093  1.00 109.59 ?  516 PHE A CE1 1 
ATOM   3543 C CE2 . PHE A 1 472 ? -8.848  4.080  32.232  1.00 108.66 ?  516 PHE A CE2 1 
ATOM   3544 C CZ  . PHE A 1 472 ? -9.247  3.634  33.476  1.00 111.17 ?  516 PHE A CZ  1 
ATOM   3545 N N   . SER A 1 473 ? -11.511 6.091  28.520  1.00 89.21  ?  517 SER A N   1 
ATOM   3546 C CA  . SER A 1 473 ? -10.869 5.449  27.370  1.00 90.08  ?  517 SER A CA  1 
ATOM   3547 C C   . SER A 1 473 ? -9.649  6.229  26.900  1.00 89.87  ?  517 SER A C   1 
ATOM   3548 O O   . SER A 1 473 ? -9.717  7.444  26.738  1.00 88.21  ?  517 SER A O   1 
ATOM   3549 C CB  . SER A 1 473 ? -11.841 5.348  26.201  1.00 88.85  ?  517 SER A CB  1 
ATOM   3550 O OG  . SER A 1 473 ? -11.149 4.939  25.034  1.00 89.68  ?  517 SER A OG  1 
ATOM   3551 N N   . THR A 1 474 ? -8.531  5.540  26.693  1.00 109.39 ?  518 THR A N   1 
ATOM   3552 C CA  . THR A 1 474 ? -7.345  6.192  26.144  1.00 109.14 ?  518 THR A CA  1 
ATOM   3553 C C   . THR A 1 474 ? -7.190  5.963  24.637  1.00 108.82 ?  518 THR A C   1 
ATOM   3554 O O   . THR A 1 474 ? -6.290  6.516  24.016  1.00 108.24 ?  518 THR A O   1 
ATOM   3555 C CB  . THR A 1 474 ? -6.065  5.697  26.825  1.00 111.02 ?  518 THR A CB  1 
ATOM   3556 O OG1 . THR A 1 474 ? -5.621  4.487  26.196  1.00 112.58 ?  518 THR A OG1 1 
ATOM   3557 C CG2 . THR A 1 474 ? -6.305  5.437  28.302  1.00 112.21 ?  518 THR A CG2 1 
ATOM   3558 N N   . ASP A 1 475 ? -8.050  5.120  24.074  1.00 86.43  ?  519 ASP A N   1 
ATOM   3559 C CA  . ASP A 1 475 ? -8.063  4.775  22.646  1.00 86.45  ?  519 ASP A CA  1 
ATOM   3560 C C   . ASP A 1 475 ? -9.115  5.505  21.803  1.00 84.75  ?  519 ASP A C   1 
ATOM   3561 O O   . ASP A 1 475 ? -9.565  4.972  20.783  1.00 85.17  ?  519 ASP A O   1 
ATOM   3562 C CB  . ASP A 1 475 ? -8.096  3.271  22.392  1.00 88.46  ?  519 ASP A CB  1 
ATOM   3563 C CG  . ASP A 1 475 ? -9.366  2.622  22.875  1.00 88.93  ?  519 ASP A CG  1 
ATOM   3564 O OD1 . ASP A 1 475 ? -10.313 3.356  23.247  1.00 87.43  ?  519 ASP A OD1 1 
ATOM   3565 O OD2 . ASP A 1 475 ? -9.412  1.363  22.863  1.00 90.80  ?  519 ASP A OD2 1 
ATOM   3566 N N   . GLU A 1 476 ? -9.648  6.606  22.330  1.00 88.37  ?  520 GLU A N   1 
ATOM   3567 C CA  . GLU A 1 476 ? -10.686 7.398  21.646  1.00 86.63  ?  520 GLU A CA  1 
ATOM   3568 C C   . GLU A 1 476 ? -12.021 6.662  21.546  1.00 86.50  ?  520 GLU A C   1 
ATOM   3569 O O   . GLU A 1 476 ? -12.715 6.758  20.534  1.00 85.88  ?  520 GLU A O   1 
ATOM   3570 C CB  . GLU A 1 476 ? -10.222 7.848  20.254  1.00 86.47  ?  520 GLU A CB  1 
ATOM   3571 C CG  . GLU A 1 476 ? -8.985  8.723  20.244  1.00 86.22  ?  520 GLU A CG  1 
ATOM   3572 C CD  . GLU A 1 476 ? -8.680  9.287  18.868  1.00 85.45  ?  520 GLU A CD  1 
ATOM   3573 O OE1 . GLU A 1 476 ? -9.151  8.708  17.867  1.00 86.26  ?  520 GLU A OE1 1 
ATOM   3574 O OE2 . GLU A 1 476 ? -7.962  10.310 18.790  1.00 83.88  ?  520 GLU A OE2 1 
ATOM   3575 N N   . GLY A 1 477 ? -12.372 5.936  22.604  1.00 100.91 ?  521 GLY A N   1 
ATOM   3576 C CA  . GLY A 1 477 ? -13.697 5.366  22.732  1.00 100.50 ?  521 GLY A CA  1 
ATOM   3577 C C   . GLY A 1 477 ? -13.854 3.932  22.258  1.00 102.65 ?  521 GLY A C   1 
ATOM   3578 O O   . GLY A 1 477 ? -14.956 3.389  22.329  1.00 102.55 ?  521 GLY A O   1 
ATOM   3579 N N   . GLN A 1 478 ? -12.783 3.311  21.769  1.00 102.13 ?  522 GLN A N   1 
ATOM   3580 C CA  . GLN A 1 478 ? -12.874 1.946  21.257  1.00 104.29 ?  522 GLN A CA  1 
ATOM   3581 C C   . GLN A 1 478 ? -13.055 0.952  22.394  1.00 105.79 ?  522 GLN A C   1 
ATOM   3582 O O   . GLN A 1 478 ? -13.963 0.138  22.361  1.00 106.38 ?  522 GLN A O   1 
ATOM   3583 C CB  . GLN A 1 478 ? -11.654 1.615  20.392  1.00 105.59 ?  522 GLN A CB  1 
ATOM   3584 C CG  . GLN A 1 478 ? -11.628 2.344  19.061  1.00 103.17 ?  522 GLN A CG  1 
ATOM   3585 C CD  . GLN A 1 478 ? -10.389 2.080  18.239  1.00 105.72 ?  522 GLN A CD  1 
ATOM   3586 O OE1 . GLN A 1 478 ? -9.434  1.463  18.717  1.00 110.84 ?  522 GLN A OE1 1 
ATOM   3587 N NE2 . GLN A 1 478 ? -10.396 2.549  16.986  1.00 102.12 ?  522 GLN A NE2 1 
ATOM   3588 N N   . CYS A 1 479 ? -12.225 1.019  23.439  1.00 112.70 ?  523 CYS A N   1 
ATOM   3589 C CA  . CYS A 1 479 ? -12.568 0.313  24.676  1.00 113.73 ?  523 CYS A CA  1 
ATOM   3590 C C   . CYS A 1 479 ? -12.496 1.161  25.914  1.00 112.60 ?  523 CYS A C   1 
ATOM   3591 O O   . CYS A 1 479 ? -11.792 2.182  25.986  1.00 111.38 ?  523 CYS A O   1 
ATOM   3592 C CB  . CYS A 1 479 ? -11.807 -0.989 24.863  1.00 116.94 ?  523 CYS A CB  1 
ATOM   3593 S SG  . CYS A 1 479 ? -12.230 -2.198 23.610  1.00 117.14 ?  523 CYS A SG  1 
ATOM   3594 N N   . TRP A 1 480 ? -13.203 0.668  26.874  1.00 100.40 ?  524 TRP A N   1 
ATOM   3595 C CA  . TRP A 1 480 ? -13.425 1.428  28.083  1.00 99.40  ?  524 TRP A CA  1 
ATOM   3596 C C   . TRP A 1 480 ? -13.013 0.651  29.303  1.00 101.82 ?  524 TRP A C   1 
ATOM   3597 O O   . TRP A 1 480 ? -12.869 -0.567 29.277  1.00 104.16 ?  524 TRP A O   1 
ATOM   3598 C CB  . TRP A 1 480 ? -14.899 1.824  28.185  1.00 97.57  ?  524 TRP A CB  1 
ATOM   3599 C CG  . TRP A 1 480 ? -15.253 2.874  27.219  1.00 94.93  ?  524 TRP A CG  1 
ATOM   3600 C CD1 . TRP A 1 480 ? -15.540 2.707  25.906  1.00 94.52  ?  524 TRP A CD1 1 
ATOM   3601 C CD2 . TRP A 1 480 ? -15.340 4.277  27.478  1.00 92.47  ?  524 TRP A CD2 1 
ATOM   3602 N NE1 . TRP A 1 480 ? -15.806 3.920  25.322  1.00 91.94  ?  524 TRP A NE1 1 
ATOM   3603 C CE2 . TRP A 1 480 ? -15.690 4.902  26.268  1.00 90.60  ?  524 TRP A CE2 1 
ATOM   3604 C CE3 . TRP A 1 480 ? -15.165 5.063  28.619  1.00 91.87  ?  524 TRP A CE3 1 
ATOM   3605 C CZ2 . TRP A 1 480 ? -15.862 6.277  26.163  1.00 88.06  ?  524 TRP A CZ2 1 
ATOM   3606 C CZ3 . TRP A 1 480 ? -15.333 6.430  28.515  1.00 89.43  ?  524 TRP A CZ3 1 
ATOM   3607 C CH2 . TRP A 1 480 ? -15.679 7.024  27.298  1.00 87.51  ?  524 TRP A CH2 1 
ATOM   3608 N N   . GLN A 1 481 ? -12.835 1.390  30.381  1.00 132.16 ?  525 GLN A N   1 
ATOM   3609 C CA  . GLN A 1 481 ? -12.584 0.813  31.681  1.00 135.13 ?  525 GLN A CA  1 
ATOM   3610 C C   . GLN A 1 481 ? -13.432 1.522  32.710  1.00 134.19 ?  525 GLN A C   1 
ATOM   3611 O O   . GLN A 1 481 ? -14.025 2.557  32.434  1.00 130.81 ?  525 GLN A O   1 
ATOM   3612 C CB  . GLN A 1 481 ? -11.119 0.927  32.042  1.00 137.03 ?  525 GLN A CB  1 
ATOM   3613 C CG  . GLN A 1 481 ? -10.257 -0.024 31.278  1.00 139.39 ?  525 GLN A CG  1 
ATOM   3614 C CD  . GLN A 1 481 ? -8.828  0.153  31.648  1.00 142.34 ?  525 GLN A CD  1 
ATOM   3615 O OE1 . GLN A 1 481 ? -8.257  1.208  31.415  1.00 139.80 ?  525 GLN A OE1 1 
ATOM   3616 N NE2 . GLN A 1 481 ? -8.244  -0.856 32.270  1.00 148.24 ?  525 GLN A NE2 1 
ATOM   3617 N N   . THR A 1 482 ? -13.489 0.954  33.901  1.00 111.71 ?  526 THR A N   1 
ATOM   3618 C CA  . THR A 1 482 ? -14.403 1.422  34.920  1.00 111.91 ?  526 THR A CA  1 
ATOM   3619 C C   . THR A 1 482 ? -13.681 1.645  36.240  1.00 115.71 ?  526 THR A C   1 
ATOM   3620 O O   . THR A 1 482 ? -12.879 0.817  36.682  1.00 120.45 ?  526 THR A O   1 
ATOM   3621 C CB  . THR A 1 482 ? -15.515 0.406  35.118  1.00 114.36 ?  526 THR A CB  1 
ATOM   3622 O OG1 . THR A 1 482 ? -16.234 0.255  33.889  1.00 113.03 ?  526 THR A OG1 1 
ATOM   3623 C CG2 . THR A 1 482 ? -16.456 0.880  36.178  1.00 112.28 ?  526 THR A CG2 1 
ATOM   3624 N N   . TYR A 1 483 ? -13.974 2.783  36.858  1.00 117.51 ?  527 TYR A N   1 
ATOM   3625 C CA  . TYR A 1 483 ? -13.348 3.167  38.110  1.00 120.95 ?  527 TYR A CA  1 
ATOM   3626 C C   . TYR A 1 483 ? -14.402 3.601  39.112  1.00 121.58 ?  527 TYR A C   1 
ATOM   3627 O O   . TYR A 1 483 ? -15.243 4.445  38.813  1.00 117.49 ?  527 TYR A O   1 
ATOM   3628 C CB  . TYR A 1 483 ? -12.358 4.308  37.880  1.00 118.56 ?  527 TYR A CB  1 
ATOM   3629 C CG  . TYR A 1 483 ? -11.735 4.830  39.154  1.00 122.13 ?  527 TYR A CG  1 
ATOM   3630 C CD1 . TYR A 1 483 ? -10.900 4.025  39.922  1.00 128.09 ?  527 TYR A CD1 1 
ATOM   3631 C CD2 . TYR A 1 483 ? -11.974 6.126  39.589  1.00 120.00 ?  527 TYR A CD2 1 
ATOM   3632 C CE1 . TYR A 1 483 ? -10.328 4.494  41.081  1.00 131.89 ?  527 TYR A CE1 1 
ATOM   3633 C CE2 . TYR A 1 483 ? -11.404 6.606  40.747  1.00 123.61 ?  527 TYR A CE2 1 
ATOM   3634 C CZ  . TYR A 1 483 ? -10.584 5.784  41.492  1.00 129.61 ?  527 TYR A CZ  1 
ATOM   3635 O OH  . TYR A 1 483 ? -10.009 6.254  42.651  1.00 133.77 ?  527 TYR A OH  1 
ATOM   3636 N N   . THR A 1 484 ? -14.351 3.021  40.302  1.00 117.65 ?  528 THR A N   1 
ATOM   3637 C CA  . THR A 1 484 ? -15.229 3.424  41.380  1.00 119.26 ?  528 THR A CA  1 
ATOM   3638 C C   . THR A 1 484 ? -14.502 4.510  42.145  1.00 119.90 ?  528 THR A C   1 
ATOM   3639 O O   . THR A 1 484 ? -13.485 4.247  42.778  1.00 124.25 ?  528 THR A O   1 
ATOM   3640 C CB  . THR A 1 484 ? -15.470 2.257  42.342  1.00 125.80 ?  528 THR A CB  1 
ATOM   3641 O OG1 . THR A 1 484 ? -16.129 1.189  41.648  1.00 125.82 ?  528 THR A OG1 1 
ATOM   3642 C CG2 . THR A 1 484 ? -16.315 2.700  43.529  1.00 128.06 ?  528 THR A CG2 1 
ATOM   3643 N N   . PHE A 1 485 ? -15.013 5.733  42.086  1.00 122.03 ?  529 PHE A N   1 
ATOM   3644 C CA  . PHE A 1 485 ? -14.295 6.860  42.671  1.00 122.30 ?  529 PHE A CA  1 
ATOM   3645 C C   . PHE A 1 485 ? -14.672 7.181  44.102  1.00 126.52 ?  529 PHE A C   1 
ATOM   3646 O O   . PHE A 1 485 ? -14.027 8.016  44.737  1.00 127.93 ?  529 PHE A O   1 
ATOM   3647 C CB  . PHE A 1 485 ? -14.450 8.112  41.815  1.00 116.20 ?  529 PHE A CB  1 
ATOM   3648 C CG  . PHE A 1 485 ? -15.874 8.486  41.524  1.00 112.82 ?  529 PHE A CG  1 
ATOM   3649 C CD1 . PHE A 1 485 ? -16.603 9.252  42.419  1.00 113.67 ?  529 PHE A CD1 1 
ATOM   3650 C CD2 . PHE A 1 485 ? -16.469 8.099  40.333  1.00 109.07 ?  529 PHE A CD2 1 
ATOM   3651 C CE1 . PHE A 1 485 ? -17.902 9.611  42.136  1.00 110.88 ?  529 PHE A CE1 1 
ATOM   3652 C CE2 . PHE A 1 485 ? -17.764 8.452  40.044  1.00 106.31 ?  529 PHE A CE2 1 
ATOM   3653 C CZ  . PHE A 1 485 ? -18.484 9.207  40.944  1.00 107.20 ?  529 PHE A CZ  1 
ATOM   3654 N N   . THR A 1 486 ? -15.720 6.533  44.602  1.00 130.61 ?  530 THR A N   1 
ATOM   3655 C CA  . THR A 1 486 ? -16.196 6.770  45.956  1.00 134.96 ?  530 THR A CA  1 
ATOM   3656 C C   . THR A 1 486 ? -16.899 5.534  46.473  1.00 139.41 ?  530 THR A C   1 
ATOM   3657 O O   . THR A 1 486 ? -17.443 4.756  45.689  1.00 137.72 ?  530 THR A O   1 
ATOM   3658 C CB  . THR A 1 486 ? -17.198 7.935  45.993  1.00 131.48 ?  530 THR A CB  1 
ATOM   3659 O OG1 . THR A 1 486 ? -17.760 8.052  47.305  1.00 136.19 ?  530 THR A OG1 1 
ATOM   3660 C CG2 . THR A 1 486 ? -18.315 7.694  45.001  1.00 127.17 ?  530 THR A CG2 1 
ATOM   3661 N N   . ARG A 1 487 ? -16.884 5.356  47.792  1.00 142.91 ?  531 ARG A N   1 
ATOM   3662 C CA  . ARG A 1 487 ? -17.749 4.375  48.432  1.00 147.45 ?  531 ARG A CA  1 
ATOM   3663 C C   . ARG A 1 487 ? -19.175 4.908  48.531  1.00 145.42 ?  531 ARG A C   1 
ATOM   3664 O O   . ARG A 1 487 ? -20.124 4.228  48.145  1.00 145.01 ?  531 ARG A O   1 
ATOM   3665 C CB  . ARG A 1 487 ? -17.236 4.053  49.826  1.00 154.98 ?  531 ARG A CB  1 
ATOM   3666 C CG  . ARG A 1 487 ? -15.911 3.307  49.843  1.00 158.50 ?  531 ARG A CG  1 
ATOM   3667 C CD  . ARG A 1 487 ? -15.347 3.201  51.263  1.00 166.07 ?  531 ARG A CD  1 
ATOM   3668 N NE  . ARG A 1 487 ? -16.195 2.403  52.151  1.00 171.63 ?  531 ARG A NE  1 
ATOM   3669 C CZ  . ARG A 1 487 ? -17.042 2.908  53.043  1.00 173.64 ?  531 ARG A CZ  1 
ATOM   3670 N NH1 . ARG A 1 487 ? -17.165 4.222  53.180  1.00 170.54 ?  531 ARG A NH1 1 
ATOM   3671 N NH2 . ARG A 1 487 ? -17.769 2.097  53.801  1.00 179.07 ?  531 ARG A NH2 1 
ATOM   3672 N N   . ASP A 1 488 ? -19.320 6.127  49.046  1.00 144.38 ?  532 ASP A N   1 
ATOM   3673 C CA  . ASP A 1 488 ? -20.635 6.738  49.197  1.00 142.87 ?  532 ASP A CA  1 
ATOM   3674 C C   . ASP A 1 488 ? -21.061 7.267  47.849  1.00 135.62 ?  532 ASP A C   1 
ATOM   3675 O O   . ASP A 1 488 ? -20.501 8.251  47.384  1.00 131.68 ?  532 ASP A O   1 
ATOM   3676 C CB  . ASP A 1 488 ? -20.573 7.922  50.166  1.00 144.51 ?  532 ASP A CB  1 
ATOM   3677 C CG  . ASP A 1 488 ? -19.746 7.631  51.408  1.00 151.33 ?  532 ASP A CG  1 
ATOM   3678 O OD1 . ASP A 1 488 ? -19.905 6.542  52.009  1.00 156.62 ?  532 ASP A OD1 1 
ATOM   3679 O OD2 . ASP A 1 488 ? -18.932 8.506  51.781  1.00 151.71 ?  532 ASP A OD2 1 
ATOM   3680 N N   . PRO A 1 489 ? -22.083 6.652  47.234  1.00 131.57 ?  533 PRO A N   1 
ATOM   3681 C CA  . PRO A 1 489 ? -22.531 7.071  45.903  1.00 125.09 ?  533 PRO A CA  1 
ATOM   3682 C C   . PRO A 1 489 ? -23.296 8.381  45.975  1.00 122.38 ?  533 PRO A C   1 
ATOM   3683 O O   . PRO A 1 489 ? -23.828 8.729  47.033  1.00 125.92 ?  533 PRO A O   1 
ATOM   3684 C CB  . PRO A 1 489 ? -23.473 5.938  45.475  1.00 126.07 ?  533 PRO A CB  1 
ATOM   3685 C CG  . PRO A 1 489 ? -23.187 4.816  46.417  1.00 132.67 ?  533 PRO A CG  1 
ATOM   3686 C CD  . PRO A 1 489 ? -22.829 5.479  47.699  1.00 136.27 ?  533 PRO A CD  1 
ATOM   3687 N N   . ILE A 1 490 ? -23.342 9.101  44.860  1.00 110.96 ?  534 ILE A N   1 
ATOM   3688 C CA  . ILE A 1 490 ? -23.960 10.420 44.830  1.00 108.25 ?  534 ILE A CA  1 
ATOM   3689 C C   . ILE A 1 490 ? -24.986 10.525 43.707  1.00 104.01 ?  534 ILE A C   1 
ATOM   3690 O O   . ILE A 1 490 ? -25.011 9.699  42.796  1.00 102.33 ?  534 ILE A O   1 
ATOM   3691 C CB  . ILE A 1 490 ? -22.906 11.528 44.595  1.00 105.31 ?  534 ILE A CB  1 
ATOM   3692 C CG1 . ILE A 1 490 ? -22.454 11.525 43.136  1.00 99.92  ?  534 ILE A CG1 1 
ATOM   3693 C CG2 . ILE A 1 490 ? -21.720 11.340 45.506  1.00 109.36 ?  534 ILE A CG2 1 
ATOM   3694 C CD1 . ILE A 1 490 ? -21.398 12.526 42.849  1.00 97.37  ?  534 ILE A CD1 1 
ATOM   3695 N N   . TYR A 1 491 ? -25.809 11.569 43.768  1.00 107.92 ?  535 TYR A N   1 
ATOM   3696 C CA  . TYR A 1 491 ? -26.685 11.931 42.665  1.00 105.23 ?  535 TYR A CA  1 
ATOM   3697 C C   . TYR A 1 491 ? -25.891 12.849 41.760  1.00 104.44 ?  535 TYR A C   1 
ATOM   3698 O O   . TYR A 1 491 ? -25.565 13.957 42.169  1.00 105.77 ?  535 TYR A O   1 
ATOM   3699 C CB  . TYR A 1 491 ? -27.883 12.724 43.187  1.00 105.21 ?  535 TYR A CB  1 
ATOM   3700 C CG  . TYR A 1 491 ? -29.015 11.910 43.773  1.00 106.28 ?  535 TYR A CG  1 
ATOM   3701 C CD1 . TYR A 1 491 ? -30.055 11.463 42.970  1.00 106.24 ?  535 TYR A CD1 1 
ATOM   3702 C CD2 . TYR A 1 491 ? -29.063 11.620 45.135  1.00 111.21 ?  535 TYR A CD2 1 
ATOM   3703 C CE1 . TYR A 1 491 ? -31.098 10.736 43.496  1.00 111.03 ?  535 TYR A CE1 1 
ATOM   3704 C CE2 . TYR A 1 491 ? -30.099 10.891 45.670  1.00 115.90 ?  535 TYR A CE2 1 
ATOM   3705 C CZ  . TYR A 1 491 ? -31.117 10.452 44.850  1.00 115.84 ?  535 TYR A CZ  1 
ATOM   3706 O OH  . TYR A 1 491 ? -32.160 9.728  45.392  1.00 121.04 ?  535 TYR A OH  1 
ATOM   3707 N N   . PHE A 1 492 ? -25.610 12.425 40.529  1.00 91.54  ?  536 PHE A N   1 
ATOM   3708 C CA  . PHE A 1 492 ? -24.754 13.207 39.632  1.00 87.37  ?  536 PHE A CA  1 
ATOM   3709 C C   . PHE A 1 492 ? -25.440 14.482 39.147  1.00 85.58  ?  536 PHE A C   1 
ATOM   3710 O O   . PHE A 1 492 ? -26.506 14.410 38.589  1.00 84.39  ?  536 PHE A O   1 
ATOM   3711 C CB  . PHE A 1 492 ? -24.385 12.350 38.431  1.00 85.30  ?  536 PHE A CB  1 
ATOM   3712 C CG  . PHE A 1 492 ? -23.577 13.079 37.405  1.00 82.53  ?  536 PHE A CG  1 
ATOM   3713 C CD1 . PHE A 1 492 ? -24.194 13.791 36.385  1.00 80.44  ?  536 PHE A CD1 1 
ATOM   3714 C CD2 . PHE A 1 492 ? -22.189 13.058 37.471  1.00 82.27  ?  536 PHE A CD2 1 
ATOM   3715 C CE1 . PHE A 1 492 ? -23.444 14.463 35.470  1.00 78.17  ?  536 PHE A CE1 1 
ATOM   3716 C CE2 . PHE A 1 492 ? -21.432 13.710 36.554  1.00 80.05  ?  536 PHE A CE2 1 
ATOM   3717 C CZ  . PHE A 1 492 ? -22.049 14.413 35.542  1.00 77.98  ?  536 PHE A CZ  1 
ATOM   3718 N N   . THR A 1 493 ? -24.782 15.621 39.369  1.00 118.19 ?  537 THR A N   1 
ATOM   3719 C CA  . THR A 1 493 ? -25.257 16.916 38.884  1.00 117.05 ?  537 THR A CA  1 
ATOM   3720 C C   . THR A 1 493 ? -24.409 17.612 37.799  1.00 115.56 ?  537 THR A C   1 
ATOM   3721 O O   . THR A 1 493 ? -24.789 18.686 37.334  1.00 112.72 ?  537 THR A O   1 
ATOM   3722 C CB  . THR A 1 493 ? -25.457 17.904 40.051  1.00 120.26 ?  537 THR A CB  1 
ATOM   3723 O OG1 . THR A 1 493 ? -26.442 17.387 40.955  1.00 117.54 ?  537 THR A OG1 1 
ATOM   3724 C CG2 . THR A 1 493 ? -25.915 19.258 39.530  1.00 120.06 ?  537 THR A CG2 1 
ATOM   3725 N N   . GLY A 1 494 ? -23.279 17.032 37.387  1.00 91.12  ?  538 GLY A N   1 
ATOM   3726 C CA  . GLY A 1 494 ? -22.472 17.679 36.370  1.00 90.33  ?  538 GLY A CA  1 
ATOM   3727 C C   . GLY A 1 494 ? -20.996 17.333 36.325  1.00 91.67  ?  538 GLY A C   1 
ATOM   3728 O O   . GLY A 1 494 ? -20.453 16.736 37.245  1.00 93.37  ?  538 GLY A O   1 
ATOM   3729 N N   . LEU A 1 495 ? -20.359 17.699 35.214  1.00 70.87  ?  539 LEU A N   1 
ATOM   3730 C CA  . LEU A 1 495 ? -18.920 17.599 35.043  1.00 71.67  ?  539 LEU A CA  1 
ATOM   3731 C C   . LEU A 1 495 ? -18.388 18.985 34.880  1.00 72.87  ?  539 LEU A C   1 
ATOM   3732 O O   . LEU A 1 495 ? -19.011 19.812 34.231  1.00 71.07  ?  539 LEU A O   1 
ATOM   3733 C CB  . LEU A 1 495 ? -18.578 16.832 33.781  1.00 69.16  ?  539 LEU A CB  1 
ATOM   3734 C CG  . LEU A 1 495 ? -18.892 15.348 33.829  1.00 68.95  ?  539 LEU A CG  1 
ATOM   3735 C CD1 . LEU A 1 495 ? -18.529 14.685 32.495  1.00 66.64  ?  539 LEU A CD1 1 
ATOM   3736 C CD2 . LEU A 1 495 ? -18.144 14.727 34.969  1.00 71.96  ?  539 LEU A CD2 1 
ATOM   3737 N N   . ALA A 1 496 ? -17.231 19.231 35.476  1.00 68.88  ?  540 ALA A N   1 
ATOM   3738 C CA  . ALA A 1 496 ? -16.474 20.444 35.220  1.00 68.63  ?  540 ALA A CA  1 
ATOM   3739 C C   . ALA A 1 496 ? -15.046 20.050 34.863  1.00 68.11  ?  540 ALA A C   1 
ATOM   3740 O O   . ALA A 1 496 ? -14.470 19.164 35.479  1.00 70.34  ?  540 ALA A O   1 
ATOM   3741 C CB  . ALA A 1 496 ? -16.488 21.344 36.429  1.00 71.09  ?  540 ALA A CB  1 
ATOM   3742 N N   . SER A 1 497 ? -14.500 20.673 33.831  1.00 65.92  ?  541 SER A N   1 
ATOM   3743 C CA  . SER A 1 497 ? -13.108 20.456 33.465  1.00 66.31  ?  541 SER A CA  1 
ATOM   3744 C C   . SER A 1 497 ? -12.631 21.683 32.726  1.00 65.07  ?  541 SER A C   1 
ATOM   3745 O O   . SER A 1 497 ? -13.432 22.384 32.122  1.00 63.02  ?  541 SER A O   1 
ATOM   3746 C CB  . SER A 1 497 ? -12.946 19.225 32.589  1.00 64.72  ?  541 SER A CB  1 
ATOM   3747 O OG  . SER A 1 497 ? -13.248 19.527 31.249  1.00 61.38  ?  541 SER A OG  1 
ATOM   3748 N N   . GLU A 1 498 ? -11.330 21.942 32.774  1.00 80.53  ?  542 GLU A N   1 
ATOM   3749 C CA  . GLU A 1 498 ? -10.770 23.158 32.196  1.00 77.54  ?  542 GLU A CA  1 
ATOM   3750 C C   . GLU A 1 498 ? -11.114 23.293 30.724  1.00 73.30  ?  542 GLU A C   1 
ATOM   3751 O O   . GLU A 1 498 ? -10.872 22.374 29.932  1.00 71.28  ?  542 GLU A O   1 
ATOM   3752 C CB  . GLU A 1 498 ? -9.257  23.218 32.399  1.00 77.14  ?  542 GLU A CB  1 
ATOM   3753 C CG  . GLU A 1 498 ? -8.639  24.513 31.940  1.00 75.20  ?  542 GLU A CG  1 
ATOM   3754 C CD  . GLU A 1 498 ? -7.117  24.438 31.863  1.00 74.97  ?  542 GLU A CD  1 
ATOM   3755 O OE1 . GLU A 1 498 ? -6.437  25.332 32.422  1.00 77.45  ?  542 GLU A OE1 1 
ATOM   3756 O OE2 . GLU A 1 498 ? -6.608  23.483 31.236  1.00 73.54  ?  542 GLU A OE2 1 
ATOM   3757 N N   . PRO A 1 499 ? -11.731 24.428 30.370  1.00 65.59  ?  543 PRO A N   1 
ATOM   3758 C CA  . PRO A 1 499 ? -12.044 24.776 28.981  1.00 62.20  ?  543 PRO A CA  1 
ATOM   3759 C C   . PRO A 1 499 ? -10.800 24.654 28.105  1.00 60.38  ?  543 PRO A C   1 
ATOM   3760 O O   . PRO A 1 499 ? -9.686  25.049 28.522  1.00 62.16  ?  543 PRO A O   1 
ATOM   3761 C CB  . PRO A 1 499 ? -12.475 26.238 29.075  1.00 63.69  ?  543 PRO A CB  1 
ATOM   3762 C CG  . PRO A 1 499 ? -13.017 26.385 30.440  1.00 67.29  ?  543 PRO A CG  1 
ATOM   3763 C CD  . PRO A 1 499 ? -12.351 25.360 31.327  1.00 68.67  ?  543 PRO A CD  1 
ATOM   3764 N N   . GLY A 1 500 ? -10.995 24.100 26.914  1.00 66.81  ?  544 GLY A N   1 
ATOM   3765 C CA  . GLY A 1 500 ? -9.910  23.858 26.001  1.00 64.02  ?  544 GLY A CA  1 
ATOM   3766 C C   . GLY A 1 500 ? -9.471  22.405 25.955  1.00 64.21  ?  544 GLY A C   1 
ATOM   3767 O O   . GLY A 1 500 ? -8.579  22.070 25.177  1.00 62.34  ?  544 GLY A O   1 
ATOM   3768 N N   . ALA A 1 501 ? -10.060 21.554 26.793  1.00 63.58  ?  545 ALA A N   1 
ATOM   3769 C CA  . ALA A 1 501 ? -9.811  20.109 26.747  1.00 65.41  ?  545 ALA A CA  1 
ATOM   3770 C C   . ALA A 1 501 ? -8.334  19.726 26.804  1.00 66.02  ?  545 ALA A C   1 
ATOM   3771 O O   . ALA A 1 501 ? -7.921  18.760 26.152  1.00 65.92  ?  545 ALA A O   1 
ATOM   3772 C CB  . ALA A 1 501 ? -10.435 19.512 25.519  1.00 62.81  ?  545 ALA A CB  1 
ATOM   3773 N N   . ARG A 1 502 ? -7.531  20.522 27.501  1.00 75.06  ?  546 ARG A N   1 
ATOM   3774 C CA  . ARG A 1 502 ? -6.118  20.216 27.650  1.00 75.82  ?  546 ARG A CA  1 
ATOM   3775 C C   . ARG A 1 502 ? -5.650  19.624 28.983  1.00 79.99  ?  546 ARG A C   1 
ATOM   3776 O O   . ARG A 1 502 ? -4.479  19.278 29.121  1.00 80.70  ?  546 ARG A O   1 
ATOM   3777 C CB  . ARG A 1 502 ? -5.291  21.454 27.321  1.00 73.77  ?  546 ARG A CB  1 
ATOM   3778 C CG  . ARG A 1 502 ? -5.426  21.869 25.882  1.00 69.90  ?  546 ARG A CG  1 
ATOM   3779 C CD  . ARG A 1 502 ? -4.547  23.036 25.476  1.00 68.77  ?  546 ARG A CD  1 
ATOM   3780 N NE  . ARG A 1 502 ? -4.664  23.154 24.029  1.00 65.31  ?  546 ARG A NE  1 
ATOM   3781 C CZ  . ARG A 1 502 ? -3.735  22.765 23.155  1.00 64.39  ?  546 ARG A CZ  1 
ATOM   3782 N NH1 . ARG A 1 502 ? -2.562  22.273 23.586  1.00 66.73  ?  546 ARG A NH1 1 
ATOM   3783 N NH2 . ARG A 1 502 ? -3.976  22.886 21.846  1.00 61.60  ?  546 ARG A NH2 1 
ATOM   3784 N N   . SER A 1 503 ? -6.525  19.501 29.973  1.00 74.84  ?  547 SER A N   1 
ATOM   3785 C CA  . SER A 1 503 ? -6.037  19.060 31.275  1.00 78.50  ?  547 SER A CA  1 
ATOM   3786 C C   . SER A 1 503 ? -6.138  17.547 31.417  1.00 80.97  ?  547 SER A C   1 
ATOM   3787 O O   . SER A 1 503 ? -6.637  16.870 30.516  1.00 80.26  ?  547 SER A O   1 
ATOM   3788 C CB  . SER A 1 503 ? -6.780  19.771 32.419  1.00 80.76  ?  547 SER A CB  1 
ATOM   3789 O OG  . SER A 1 503 ? -7.909  19.037 32.872  1.00 83.35  ?  547 SER A OG  1 
ATOM   3790 N N   . MET A 1 504 ? -5.610  17.020 32.520  1.00 99.39  ?  548 MET A N   1 
ATOM   3791 C CA  . MET A 1 504 ? -5.863  15.650 32.940  1.00 102.28 ?  548 MET A CA  1 
ATOM   3792 C C   . MET A 1 504 ? -6.906  15.641 34.058  1.00 104.94 ?  548 MET A C   1 
ATOM   3793 O O   . MET A 1 504 ? -7.266  14.590 34.582  1.00 107.32 ?  548 MET A O   1 
ATOM   3794 C CB  . MET A 1 504 ? -4.571  14.980 33.413  1.00 103.65 ?  548 MET A CB  1 
ATOM   3795 C CG  . MET A 1 504 ? -3.440  14.987 32.395  1.00 101.40 ?  548 MET A CG  1 
ATOM   3796 S SD  . MET A 1 504 ? -3.546  13.724 31.115  1.00 100.77 ?  548 MET A SD  1 
ATOM   3797 C CE  . MET A 1 504 ? -2.291  12.589 31.703  1.00 103.17 ?  548 MET A CE  1 
ATOM   3798 N N   . ASN A 1 505 ? -7.371  16.827 34.438  1.00 86.41  ?  549 ASN A N   1 
ATOM   3799 C CA  . ASN A 1 505 ? -8.210  16.978 35.625  1.00 88.97  ?  549 ASN A CA  1 
ATOM   3800 C C   . ASN A 1 505 ? -9.714  17.122 35.318  1.00 89.23  ?  549 ASN A C   1 
ATOM   3801 O O   . ASN A 1 505 ? -10.126 18.004 34.565  1.00 87.32  ?  549 ASN A O   1 
ATOM   3802 C CB  . ASN A 1 505 ? -7.709  18.150 36.482  1.00 89.26  ?  549 ASN A CB  1 
ATOM   3803 C CG  . ASN A 1 505 ? -6.285  17.958 36.961  1.00 89.76  ?  549 ASN A CG  1 
ATOM   3804 O OD1 . ASN A 1 505 ? -6.029  17.109 37.811  1.00 92.53  ?  549 ASN A OD1 1 
ATOM   3805 N ND2 . ASN A 1 505 ? -5.347  18.766 36.428  1.00 88.81  ?  549 ASN A ND2 1 
ATOM   3806 N N   . ILE A 1 506 ? -10.514 16.238 35.915  1.00 79.05  ?  550 ILE A N   1 
ATOM   3807 C CA  . ILE A 1 506 ? -11.979 16.238 35.772  1.00 79.73  ?  550 ILE A CA  1 
ATOM   3808 C C   . ILE A 1 506 ? -12.716 16.242 37.130  1.00 82.03  ?  550 ILE A C   1 
ATOM   3809 O O   . ILE A 1 506 ? -12.379 15.491 38.047  1.00 83.62  ?  550 ILE A O   1 
ATOM   3810 C CB  . ILE A 1 506 ? -12.481 15.039 34.913  1.00 79.57  ?  550 ILE A CB  1 
ATOM   3811 C CG1 . ILE A 1 506 ? -13.993 15.091 34.736  1.00 79.75  ?  550 ILE A CG1 1 
ATOM   3812 C CG2 . ILE A 1 506 ? -12.112 13.705 35.536  1.00 81.06  ?  550 ILE A CG2 1 
ATOM   3813 C CD1 . ILE A 1 506 ? -14.464 16.236 33.903  1.00 78.60  ?  550 ILE A CD1 1 
ATOM   3814 N N   . SER A 1 507 ? -13.717 17.107 37.245  1.00 76.79  ?  551 SER A N   1 
ATOM   3815 C CA  . SER A 1 507 ? -14.518 17.234 38.455  1.00 79.38  ?  551 SER A CA  1 
ATOM   3816 C C   . SER A 1 507 ? -15.896 16.597 38.246  1.00 78.26  ?  551 SER A C   1 
ATOM   3817 O O   . SER A 1 507 ? -16.598 16.941 37.290  1.00 75.05  ?  551 SER A O   1 
ATOM   3818 C CB  . SER A 1 507 ? -14.683 18.711 38.805  1.00 79.40  ?  551 SER A CB  1 
ATOM   3819 O OG  . SER A 1 507 ? -13.483 19.251 39.315  1.00 81.83  ?  551 SER A OG  1 
ATOM   3820 N N   . ILE A 1 508 ? -16.264 15.661 39.123  1.00 86.13  ?  552 ILE A N   1 
ATOM   3821 C CA  . ILE A 1 508 ? -17.598 15.055 39.114  1.00 85.55  ?  552 ILE A CA  1 
ATOM   3822 C C   . ILE A 1 508 ? -18.428 15.704 40.193  1.00 86.58  ?  552 ILE A C   1 
ATOM   3823 O O   . ILE A 1 508 ? -18.092 15.628 41.372  1.00 89.00  ?  552 ILE A O   1 
ATOM   3824 C CB  . ILE A 1 508 ? -17.567 13.557 39.427  1.00 86.07  ?  552 ILE A CB  1 
ATOM   3825 C CG1 . ILE A 1 508 ? -16.790 12.800 38.360  1.00 85.17  ?  552 ILE A CG1 1 
ATOM   3826 C CG2 . ILE A 1 508 ? -18.970 13.009 39.539  1.00 86.09  ?  552 ILE A CG2 1 
ATOM   3827 C CD1 . ILE A 1 508 ? -15.396 12.401 38.834  1.00 86.95  ?  552 ILE A CD1 1 
ATOM   3828 N N   . TRP A 1 509 ? -19.516 16.343 39.798  1.00 89.60  ?  553 TRP A N   1 
ATOM   3829 C CA  . TRP A 1 509 ? -20.324 17.071 40.754  1.00 90.75  ?  553 TRP A CA  1 
ATOM   3830 C C   . TRP A 1 509 ? -21.607 16.329 41.104  1.00 90.07  ?  553 TRP A C   1 
ATOM   3831 O O   . TRP A 1 509 ? -22.259 15.733 40.235  1.00 88.15  ?  553 TRP A O   1 
ATOM   3832 C CB  . TRP A 1 509 ? -20.636 18.459 40.222  1.00 90.72  ?  553 TRP A CB  1 
ATOM   3833 C CG  . TRP A 1 509 ? -19.507 19.391 40.385  1.00 92.02  ?  553 TRP A CG  1 
ATOM   3834 C CD1 . TRP A 1 509 ? -18.359 19.431 39.648  1.00 91.45  ?  553 TRP A CD1 1 
ATOM   3835 C CD2 . TRP A 1 509 ? -19.401 20.429 41.352  1.00 93.76  ?  553 TRP A CD2 1 
ATOM   3836 N NE1 . TRP A 1 509 ? -17.544 20.438 40.103  1.00 92.35  ?  553 TRP A NE1 1 
ATOM   3837 C CE2 . TRP A 1 509 ? -18.163 21.065 41.151  1.00 93.91  ?  553 TRP A CE2 1 
ATOM   3838 C CE3 . TRP A 1 509 ? -20.235 20.888 42.364  1.00 95.04  ?  553 TRP A CE3 1 
ATOM   3839 C CZ2 . TRP A 1 509 ? -17.747 22.134 41.922  1.00 95.21  ?  553 TRP A CZ2 1 
ATOM   3840 C CZ3 . TRP A 1 509 ? -19.817 21.940 43.133  1.00 96.67  ?  553 TRP A CZ3 1 
ATOM   3841 C CH2 . TRP A 1 509 ? -18.589 22.556 42.908  1.00 96.74  ?  553 TRP A CH2 1 
ATOM   3842 N N   . GLY A 1 510 ? -21.970 16.377 42.380  1.00 106.89 ?  554 GLY A N   1 
ATOM   3843 C CA  . GLY A 1 510 ? -23.157 15.696 42.838  1.00 106.47 ?  554 GLY A CA  1 
ATOM   3844 C C   . GLY A 1 510 ? -23.507 15.975 44.286  1.00 108.54 ?  554 GLY A C   1 
ATOM   3845 O O   . GLY A 1 510 ? -22.897 16.816 44.955  1.00 110.34 ?  554 GLY A O   1 
ATOM   3846 N N   . PHE A 1 511 ? -24.510 15.259 44.776  1.00 125.93 ?  555 PHE A N   1 
ATOM   3847 C CA  . PHE A 1 511 ? -24.911 15.387 46.162  1.00 127.93 ?  555 PHE A CA  1 
ATOM   3848 C C   . PHE A 1 511 ? -25.333 14.029 46.698  1.00 128.11 ?  555 PHE A C   1 
ATOM   3849 O O   . PHE A 1 511 ? -25.873 13.209 45.965  1.00 126.28 ?  555 PHE A O   1 
ATOM   3850 C CB  . PHE A 1 511 ? -26.009 16.442 46.322  1.00 127.85 ?  555 PHE A CB  1 
ATOM   3851 C CG  . PHE A 1 511 ? -27.205 16.231 45.437  1.00 125.57 ?  555 PHE A CG  1 
ATOM   3852 C CD1 . PHE A 1 511 ? -28.250 15.410 45.841  1.00 125.16 ?  555 PHE A CD1 1 
ATOM   3853 C CD2 . PHE A 1 511 ? -27.305 16.881 44.214  1.00 123.85 ?  555 PHE A CD2 1 
ATOM   3854 C CE1 . PHE A 1 511 ? -29.366 15.225 45.033  1.00 122.95 ?  555 PHE A CE1 1 
ATOM   3855 C CE2 . PHE A 1 511 ? -28.420 16.701 43.398  1.00 121.57 ?  555 PHE A CE2 1 
ATOM   3856 C CZ  . PHE A 1 511 ? -29.451 15.871 43.809  1.00 121.06 ?  555 PHE A CZ  1 
ATOM   3857 N N   . THR A 1 512 ? -25.030 13.786 47.967  1.00 118.21 ?  556 THR A N   1 
ATOM   3858 C CA  . THR A 1 512 ? -25.347 12.529 48.639  1.00 121.10 ?  556 THR A CA  1 
ATOM   3859 C C   . THR A 1 512 ? -26.825 12.426 49.021  1.00 123.24 ?  556 THR A C   1 
ATOM   3860 O O   . THR A 1 512 ? -27.515 13.441 49.089  1.00 122.66 ?  556 THR A O   1 
ATOM   3861 C CB  . THR A 1 512 ? -24.481 12.384 49.897  1.00 124.78 ?  556 THR A CB  1 
ATOM   3862 O OG1 . THR A 1 512 ? -24.880 13.363 50.868  1.00 127.30 ?  556 THR A OG1 1 
ATOM   3863 C CG2 . THR A 1 512 ? -23.011 12.595 49.530  1.00 123.54 ?  556 THR A CG2 1 
ATOM   3864 N N   . GLU A 1 513 ? -27.309 11.205 49.266  1.00 163.26 ?  557 GLU A N   1 
ATOM   3865 C CA  . GLU A 1 513 ? -28.685 10.994 49.733  1.00 166.60 ?  557 GLU A CA  1 
ATOM   3866 C C   . GLU A 1 513 ? -28.862 11.499 51.159  1.00 171.13 ?  557 GLU A C   1 
ATOM   3867 O O   . GLU A 1 513 ? -28.023 11.245 52.025  1.00 174.03 ?  557 GLU A O   1 
ATOM   3868 C CB  . GLU A 1 513 ? -29.086 9.511  49.708  1.00 169.75 ?  557 GLU A CB  1 
ATOM   3869 C CG  . GLU A 1 513 ? -28.600 8.691  48.530  1.00 166.55 ?  557 GLU A CG  1 
ATOM   3870 C CD  . GLU A 1 513 ? -27.236 8.072  48.772  1.00 167.22 ?  557 GLU A CD  1 
ATOM   3871 O OE1 . GLU A 1 513 ? -26.294 8.825  49.095  1.00 165.74 ?  557 GLU A OE1 1 
ATOM   3872 O OE2 . GLU A 1 513 ? -27.105 6.836  48.636  1.00 169.74 ?  557 GLU A OE2 1 
ATOM   3873 N N   . SER A 1 514 ? -29.973 12.186 51.401  1.00 172.45 ?  558 SER A N   1 
ATOM   3874 C CA  . SER A 1 514 ? -30.317 12.667 52.732  1.00 177.44 ?  558 SER A CA  1 
ATOM   3875 C C   . SER A 1 514 ? -31.333 11.733 53.356  1.00 183.16 ?  558 SER A C   1 
ATOM   3876 O O   . SER A 1 514 ? -32.499 11.753 52.972  1.00 183.63 ?  558 SER A O   1 
ATOM   3877 C CB  . SER A 1 514 ? -30.916 14.067 52.640  1.00 175.91 ?  558 SER A CB  1 
ATOM   3878 O OG  . SER A 1 514 ? -32.033 14.073 51.768  1.00 174.35 ?  558 SER A OG  1 
ATOM   3879 N N   . THR A 1 517 ? -31.431 16.816 54.612  1.00 206.93 ?  561 THR A N   1 
ATOM   3880 C CA  . THR A 1 517 ? -30.056 16.776 55.096  1.00 205.11 ?  561 THR A CA  1 
ATOM   3881 C C   . THR A 1 517 ? -29.068 16.652 53.941  1.00 199.57 ?  561 THR A C   1 
ATOM   3882 O O   . THR A 1 517 ? -27.927 16.232 54.130  1.00 195.48 ?  561 THR A O   1 
ATOM   3883 C CB  . THR A 1 517 ? -29.836 15.608 56.075  1.00 209.32 ?  561 THR A CB  1 
ATOM   3884 O OG1 . THR A 1 517 ? -29.660 14.391 55.340  1.00 211.95 ?  561 THR A OG1 1 
ATOM   3885 C CG2 . THR A 1 517 ? -31.029 15.464 57.008  1.00 214.43 ?  561 THR A CG2 1 
ATOM   3886 N N   . SER A 1 518 ? -29.515 17.019 52.744  1.00 198.53 ?  562 SER A N   1 
ATOM   3887 C CA  . SER A 1 518 ? -28.667 16.949 51.550  1.00 194.38 ?  562 SER A CA  1 
ATOM   3888 C C   . SER A 1 518 ? -27.600 18.025 51.401  1.00 193.23 ?  562 SER A C   1 
ATOM   3889 O O   . SER A 1 518 ? -27.817 19.177 51.748  1.00 190.93 ?  562 SER A O   1 
ATOM   3890 C CB  . SER A 1 518 ? -29.534 16.934 50.299  1.00 191.85 ?  562 SER A CB  1 
ATOM   3891 O OG  . SER A 1 518 ? -28.753 17.111 49.137  1.00 191.85 ?  562 SER A OG  1 
ATOM   3892 N N   . GLN A 1 519 ? -26.467 17.625 50.832  1.00 160.22 ?  563 GLN A N   1 
ATOM   3893 C CA  . GLN A 1 519 ? -25.329 18.504 50.610  1.00 160.51 ?  563 GLN A CA  1 
ATOM   3894 C C   . GLN A 1 519 ? -24.583 18.151 49.328  1.00 159.04 ?  563 GLN A C   1 
ATOM   3895 O O   . GLN A 1 519 ? -24.716 17.052 48.821  1.00 158.91 ?  563 GLN A O   1 
ATOM   3896 C CB  . GLN A 1 519 ? -24.373 18.433 51.792  1.00 162.80 ?  563 GLN A CB  1 
ATOM   3897 C CG  . GLN A 1 519 ? -24.943 19.002 53.079  1.00 166.47 ?  563 GLN A CG  1 
ATOM   3898 C CD  . GLN A 1 519 ? -23.995 18.849 54.246  1.00 169.72 ?  563 GLN A CD  1 
ATOM   3899 O OE1 . GLN A 1 519 ? -23.145 17.962 54.257  1.00 171.31 ?  563 GLN A OE1 1 
ATOM   3900 N NE2 . GLN A 1 519 ? -24.138 19.712 55.238  1.00 171.82 ?  563 GLN A NE2 1 
ATOM   3901 N N   . TRP A 1 520 ? -23.794 19.086 48.811  1.00 126.87 ?  564 TRP A N   1 
ATOM   3902 C CA  . TRP A 1 520 ? -23.045 18.878 47.581  1.00 125.41 ?  564 TRP A CA  1 
ATOM   3903 C C   . TRP A 1 520 ? -21.637 18.390 47.805  1.00 126.45 ?  564 TRP A C   1 
ATOM   3904 O O   . TRP A 1 520 ? -20.973 18.831 48.717  1.00 128.04 ?  564 TRP A O   1 
ATOM   3905 C CB  . TRP A 1 520 ? -22.911 20.195 46.880  1.00 124.71 ?  564 TRP A CB  1 
ATOM   3906 C CG  . TRP A 1 520 ? -24.166 20.856 46.598  1.00 124.78 ?  564 TRP A CG  1 
ATOM   3907 C CD1 . TRP A 1 520 ? -24.738 21.851 47.306  1.00 126.41 ?  564 TRP A CD1 1 
ATOM   3908 C CD2 . TRP A 1 520 ? -25.014 20.609 45.489  1.00 123.20 ?  564 TRP A CD2 1 
ATOM   3909 N NE1 . TRP A 1 520 ? -25.905 22.241 46.714  1.00 126.00 ?  564 TRP A NE1 1 
ATOM   3910 C CE2 . TRP A 1 520 ? -26.095 21.487 45.590  1.00 123.96 ?  564 TRP A CE2 1 
ATOM   3911 C CE3 . TRP A 1 520 ? -24.961 19.729 44.412  1.00 121.22 ?  564 TRP A CE3 1 
ATOM   3912 C CZ2 . TRP A 1 520 ? -27.113 21.512 44.660  1.00 122.69 ?  564 TRP A CZ2 1 
ATOM   3913 C CZ3 . TRP A 1 520 ? -25.967 19.757 43.496  1.00 119.87 ?  564 TRP A CZ3 1 
ATOM   3914 C CH2 . TRP A 1 520 ? -27.029 20.641 43.619  1.00 120.56 ?  564 TRP A CH2 1 
ATOM   3915 N N   . VAL A 1 521 ? -21.148 17.526 46.934  1.00 107.40 ?  565 VAL A N   1 
ATOM   3916 C CA  . VAL A 1 521 ? -19.769 17.092 47.041  1.00 108.16 ?  565 VAL A CA  1 
ATOM   3917 C C   . VAL A 1 521 ? -19.187 17.074 45.621  1.00 104.65 ?  565 VAL A C   1 
ATOM   3918 O O   . VAL A 1 521 ? -19.938 17.017 44.645  1.00 102.91 ?  565 VAL A O   1 
ATOM   3919 C CB  . VAL A 1 521 ? -19.695 15.711 47.734  1.00 110.57 ?  565 VAL A CB  1 
ATOM   3920 C CG1 . VAL A 1 521 ? -20.122 14.615 46.775  1.00 108.50 ?  565 VAL A CG1 1 
ATOM   3921 C CG2 . VAL A 1 521 ? -18.308 15.454 48.295  1.00 112.73 ?  565 VAL A CG2 1 
ATOM   3922 N N   . SER A 1 522 ? -17.868 17.179 45.494  1.00 114.19 ?  566 SER A N   1 
ATOM   3923 C CA  . SER A 1 522 ? -17.233 17.075 44.178  1.00 112.55 ?  566 SER A CA  1 
ATOM   3924 C C   . SER A 1 522 ? -15.970 16.229 44.269  1.00 112.96 ?  566 SER A C   1 
ATOM   3925 O O   . SER A 1 522 ? -15.110 16.479 45.112  1.00 114.21 ?  566 SER A O   1 
ATOM   3926 C CB  . SER A 1 522 ? -16.930 18.457 43.576  1.00 112.00 ?  566 SER A CB  1 
ATOM   3927 O OG  . SER A 1 522 ? -15.838 19.090 44.225  1.00 113.00 ?  566 SER A OG  1 
ATOM   3928 N N   . TYR A 1 523 ? -15.870 15.219 43.411  1.00 102.21 ?  567 TYR A N   1 
ATOM   3929 C CA  . TYR A 1 523 ? -14.694 14.357 43.387  1.00 102.73 ?  567 TYR A CA  1 
ATOM   3930 C C   . TYR A 1 523 ? -13.817 14.695 42.164  1.00 101.16 ?  567 TYR A C   1 
ATOM   3931 O O   . TYR A 1 523 ? -14.167 14.373 41.026  1.00 99.75  ?  567 TYR A O   1 
ATOM   3932 C CB  . TYR A 1 523 ? -15.120 12.879 43.368  1.00 103.01 ?  567 TYR A CB  1 
ATOM   3933 C CG  . TYR A 1 523 ? -15.825 12.389 44.624  1.00 104.75 ?  567 TYR A CG  1 
ATOM   3934 C CD1 . TYR A 1 523 ? -17.122 12.790 44.924  1.00 104.24 ?  567 TYR A CD1 1 
ATOM   3935 C CD2 . TYR A 1 523 ? -15.194 11.516 45.506  1.00 108.52 ?  567 TYR A CD2 1 
ATOM   3936 C CE1 . TYR A 1 523 ? -17.766 12.344 46.066  1.00 107.48 ?  567 TYR A CE1 1 
ATOM   3937 C CE2 . TYR A 1 523 ? -15.837 11.063 46.655  1.00 112.99 ?  567 TYR A CE2 1 
ATOM   3938 C CZ  . TYR A 1 523 ? -17.125 11.481 46.927  1.00 112.39 ?  567 TYR A CZ  1 
ATOM   3939 O OH  . TYR A 1 523 ? -17.785 11.046 48.059  1.00 117.08 ?  567 TYR A OH  1 
ATOM   3940 N N   . THR A 1 524 ? -12.670 15.331 42.379  1.00 95.10  ?  568 THR A N   1 
ATOM   3941 C CA  . THR A 1 524 ? -11.841 15.687 41.232  1.00 92.26  ?  568 THR A CA  1 
ATOM   3942 C C   . THR A 1 524 ? -10.719 14.676 40.988  1.00 93.95  ?  568 THR A C   1 
ATOM   3943 O O   . THR A 1 524 ? -9.932  14.371 41.886  1.00 98.51  ?  568 THR A O   1 
ATOM   3944 C CB  . THR A 1 524 ? -11.308 17.120 41.318  1.00 92.02  ?  568 THR A CB  1 
ATOM   3945 O OG1 . THR A 1 524 ? -12.412 18.023 41.465  1.00 91.30  ?  568 THR A OG1 1 
ATOM   3946 C CG2 . THR A 1 524 ? -10.557 17.466 40.049  1.00 89.28  ?  568 THR A CG2 1 
ATOM   3947 N N   . ILE A 1 525 ? -10.668 14.145 39.771  1.00 104.48 ?  569 ILE A N   1 
ATOM   3948 C CA  . ILE A 1 525 ? -9.736  13.072 39.447  1.00 104.72 ?  569 ILE A CA  1 
ATOM   3949 C C   . ILE A 1 525 ? -8.603  13.538 38.535  1.00 102.92 ?  569 ILE A C   1 
ATOM   3950 O O   . ILE A 1 525 ? -8.838  14.182 37.505  1.00 100.85 ?  569 ILE A O   1 
ATOM   3951 C CB  . ILE A 1 525 ? -10.454 11.881 38.788  1.00 104.68 ?  569 ILE A CB  1 
ATOM   3952 C CG1 . ILE A 1 525 ? -11.575 11.361 39.695  1.00 106.28 ?  569 ILE A CG1 1 
ATOM   3953 C CG2 . ILE A 1 525 ? -9.468  10.776 38.493  1.00 105.29 ?  569 ILE A CG2 1 
ATOM   3954 C CD1 . ILE A 1 525 ? -12.348 10.189 39.124  1.00 106.08 ?  569 ILE A CD1 1 
ATOM   3955 N N   . ASP A 1 526 ? -7.374  13.208 38.929  1.00 108.65 ?  570 ASP A N   1 
ATOM   3956 C CA  . ASP A 1 526 ? -6.188  13.530 38.144  1.00 106.87 ?  570 ASP A CA  1 
ATOM   3957 C C   . ASP A 1 526 ? -5.648  12.271 37.458  1.00 106.98 ?  570 ASP A C   1 
ATOM   3958 O O   . ASP A 1 526 ? -5.235  11.315 38.115  1.00 109.16 ?  570 ASP A O   1 
ATOM   3959 C CB  . ASP A 1 526 ? -5.114  14.153 39.045  1.00 107.77 ?  570 ASP A CB  1 
ATOM   3960 C CG  . ASP A 1 526 ? -4.086  14.964 38.268  1.00 105.35 ?  570 ASP A CG  1 
ATOM   3961 O OD1 . ASP A 1 526 ? -3.944  14.746 37.038  1.00 103.15 ?  570 ASP A OD1 1 
ATOM   3962 O OD2 . ASP A 1 526 ? -3.424  15.826 38.893  1.00 105.72 ?  570 ASP A OD2 1 
ATOM   3963 N N   . PHE A 1 527 ? -5.635  12.288 36.133  1.00 104.19 ?  571 PHE A N   1 
ATOM   3964 C CA  . PHE A 1 527 ? -5.201  11.138 35.343  1.00 104.25 ?  571 PHE A CA  1 
ATOM   3965 C C   . PHE A 1 527 ? -3.697  11.138 35.078  1.00 103.65 ?  571 PHE A C   1 
ATOM   3966 O O   . PHE A 1 527 ? -3.204  10.326 34.292  1.00 103.51 ?  571 PHE A O   1 
ATOM   3967 C CB  . PHE A 1 527 ? -5.979  11.055 34.021  1.00 102.34 ?  571 PHE A CB  1 
ATOM   3968 C CG  . PHE A 1 527 ? -7.373  10.524 34.180  1.00 103.61 ?  571 PHE A CG  1 
ATOM   3969 C CD1 . PHE A 1 527 ? -8.418  11.371 34.501  1.00 103.18 ?  571 PHE A CD1 1 
ATOM   3970 C CD2 . PHE A 1 527 ? -7.634  9.173  34.028  1.00 105.33 ?  571 PHE A CD2 1 
ATOM   3971 C CE1 . PHE A 1 527 ? -9.695  10.881 34.663  1.00 104.18 ?  571 PHE A CE1 1 
ATOM   3972 C CE2 . PHE A 1 527 ? -8.914  8.677  34.186  1.00 106.25 ?  571 PHE A CE2 1 
ATOM   3973 C CZ  . PHE A 1 527 ? -9.942  9.532  34.504  1.00 105.52 ?  571 PHE A CZ  1 
ATOM   3974 N N   . LYS A 1 528 ? -2.982  12.065 35.716  1.00 118.84 ?  572 LYS A N   1 
ATOM   3975 C CA  . LYS A 1 528 ? -1.545  12.241 35.489  1.00 118.20 ?  572 LYS A CA  1 
ATOM   3976 C C   . LYS A 1 528 ? -0.764  10.936 35.577  1.00 120.31 ?  572 LYS A C   1 
ATOM   3977 O O   . LYS A 1 528 ? 0.205   10.738 34.852  1.00 119.99 ?  572 LYS A O   1 
ATOM   3978 C CB  . LYS A 1 528 ? -0.950  13.273 36.454  1.00 118.89 ?  572 LYS A CB  1 
ATOM   3979 C CG  . LYS A 1 528 ? -0.974  12.864 37.923  1.00 122.60 ?  572 LYS A CG  1 
ATOM   3980 C CD  . LYS A 1 528 ? -0.308  13.899 38.812  1.00 124.48 ?  572 LYS A CD  1 
ATOM   3981 C CE  . LYS A 1 528 ? -0.551  13.606 40.284  1.00 128.50 ?  572 LYS A CE  1 
ATOM   3982 N NZ  . LYS A 1 528 ? 0.234   12.449 40.823  1.00 133.85 ?  572 LYS A NZ  1 
ATOM   3983 N N   . ASP A 1 529 ? -1.192  10.047 36.462  1.00 132.80 ?  573 ASP A N   1 
ATOM   3984 C CA  . ASP A 1 529 ? -0.546  8.750  36.589  1.00 135.60 ?  573 ASP A CA  1 
ATOM   3985 C C   . ASP A 1 529 ? -1.046  7.737  35.553  1.00 134.89 ?  573 ASP A C   1 
ATOM   3986 O O   . ASP A 1 529 ? -0.270  6.924  35.048  1.00 135.93 ?  573 ASP A O   1 
ATOM   3987 C CB  . ASP A 1 529 ? -0.675  8.223  38.020  1.00 139.75 ?  573 ASP A CB  1 
ATOM   3988 C CG  . ASP A 1 529 ? 0.029   9.114  39.029  1.00 142.59 ?  573 ASP A CG  1 
ATOM   3989 O OD1 . ASP A 1 529 ? 1.063   9.713  38.671  1.00 143.42 ?  573 ASP A OD1 1 
ATOM   3990 O OD2 . ASP A 1 529 ? -0.457  9.223  40.175  1.00 144.60 ?  573 ASP A OD2 1 
ATOM   3991 N N   . ILE A 1 530 ? -2.336  7.791  35.240  1.00 112.71 ?  574 ILE A N   1 
ATOM   3992 C CA  . ILE A 1 530 ? -2.905  6.914  34.215  1.00 112.48 ?  574 ILE A CA  1 
ATOM   3993 C C   . ILE A 1 530 ? -2.124  6.948  32.901  1.00 110.44 ?  574 ILE A C   1 
ATOM   3994 O O   . ILE A 1 530 ? -1.732  5.902  32.387  1.00 111.68 ?  574 ILE A O   1 
ATOM   3995 C CB  . ILE A 1 530 ? -4.386  7.217  33.942  1.00 111.49 ?  574 ILE A CB  1 
ATOM   3996 C CG1 . ILE A 1 530 ? -5.231  6.789  35.136  1.00 113.91 ?  574 ILE A CG1 1 
ATOM   3997 C CG2 . ILE A 1 530 ? -4.864  6.467  32.717  1.00 111.03 ?  574 ILE A CG2 1 
ATOM   3998 C CD1 . ILE A 1 530 ? -5.105  5.324  35.477  1.00 117.17 ?  574 ILE A CD1 1 
ATOM   3999 N N   . LEU A 1 531 ? -1.896  8.134  32.350  1.00 109.16 ?  575 LEU A N   1 
ATOM   4000 C CA  . LEU A 1 531 ? -0.886  8.236  31.313  1.00 107.39 ?  575 LEU A CA  1 
ATOM   4001 C C   . LEU A 1 531 ? 0.335   8.871  31.945  1.00 107.34 ?  575 LEU A C   1 
ATOM   4002 O O   . LEU A 1 531 ? 0.418   10.098 32.029  1.00 105.41 ?  575 LEU A O   1 
ATOM   4003 C CB  . LEU A 1 531 ? -1.365  9.155  30.199  1.00 103.96 ?  575 LEU A CB  1 
ATOM   4004 C CG  . LEU A 1 531 ? -2.808  8.995  29.729  1.00 103.68 ?  575 LEU A CG  1 
ATOM   4005 C CD1 . LEU A 1 531 ? -3.276  10.265 29.068  1.00 100.39 ?  575 LEU A CD1 1 
ATOM   4006 C CD2 . LEU A 1 531 ? -2.890  7.839  28.763  1.00 104.43 ?  575 LEU A CD2 1 
ATOM   4007 N N   . GLU A 1 532 ? 1.315   8.040  32.302  1.00 141.93 ?  576 GLU A N   1 
ATOM   4008 C CA  . GLU A 1 532 ? 2.562   8.506  32.896  1.00 145.67 ?  576 GLU A CA  1 
ATOM   4009 C C   . GLU A 1 532 ? 3.519   8.940  31.806  1.00 145.10 ?  576 GLU A C   1 
ATOM   4010 O O   . GLU A 1 532 ? 4.345   9.833  32.003  1.00 146.65 ?  576 GLU A O   1 
ATOM   4011 C CB  . GLU A 1 532 ? 3.214   7.407  33.742  1.00 152.18 ?  576 GLU A CB  1 
ATOM   4012 C CG  . GLU A 1 532 ? 3.685   6.185  32.951  1.00 154.41 ?  576 GLU A CG  1 
ATOM   4013 C CD  . GLU A 1 532 ? 4.920   5.515  33.545  1.00 161.92 ?  576 GLU A CD  1 
ATOM   4014 O OE1 . GLU A 1 532 ? 5.741   6.209  34.183  1.00 165.22 ?  576 GLU A OE1 1 
ATOM   4015 O OE2 . GLU A 1 532 ? 5.072   4.287  33.372  1.00 165.36 ?  576 GLU A OE2 1 
ATOM   4016 N N   . ARG A 1 533 ? 3.392   8.281  30.657  1.00 111.41 ?  577 ARG A N   1 
ATOM   4017 C CA  . ARG A 1 533 ? 4.306   8.447  29.541  1.00 111.74 ?  577 ARG A CA  1 
ATOM   4018 C C   . ARG A 1 533 ? 3.884   9.672  28.753  1.00 105.90 ?  577 ARG A C   1 
ATOM   4019 O O   . ARG A 1 533 ? 2.708   9.853  28.480  1.00 100.75 ?  577 ARG A O   1 
ATOM   4020 C CB  . ARG A 1 533 ? 4.278   7.189  28.654  1.00 112.36 ?  577 ARG A CB  1 
ATOM   4021 C CG  . ARG A 1 533 ? 5.469   7.031  27.711  1.00 115.16 ?  577 ARG A CG  1 
ATOM   4022 C CD  . ARG A 1 533 ? 5.417   5.720  26.918  1.00 116.46 ?  577 ARG A CD  1 
ATOM   4023 N NE  . ARG A 1 533 ? 4.253   5.636  26.051  1.00 110.52 ?  577 ARG A NE  1 
ATOM   4024 C CZ  . ARG A 1 533 ? 4.236   6.094  24.802  1.00 106.89 ?  577 ARG A CZ  1 
ATOM   4025 N NH1 . ARG A 1 533 ? 5.327   6.650  24.296  1.00 108.64 ?  577 ARG A NH1 1 
ATOM   4026 N NH2 . ARG A 1 533 ? 3.137   6.005  24.055  1.00 101.88 ?  577 ARG A NH2 1 
ATOM   4027 N N   . ASN A 1 534 ? 4.838   10.538 28.432  1.00 110.08 ?  578 ASN A N   1 
ATOM   4028 C CA  . ASN A 1 534 ? 4.577   11.651 27.530  1.00 105.51 ?  578 ASN A CA  1 
ATOM   4029 C C   . ASN A 1 534 ? 4.626   11.142 26.103  1.00 103.55 ?  578 ASN A C   1 
ATOM   4030 O O   . ASN A 1 534 ? 5.516   10.375 25.748  1.00 107.12 ?  578 ASN A O   1 
ATOM   4031 C CB  . ASN A 1 534 ? 5.609   12.767 27.709  1.00 107.85 ?  578 ASN A CB  1 
ATOM   4032 C CG  . ASN A 1 534 ? 5.421   13.542 29.002  1.00 109.05 ?  578 ASN A CG  1 
ATOM   4033 O OD1 . ASN A 1 534 ? 4.542   13.231 29.804  1.00 108.22 ?  578 ASN A OD1 1 
ATOM   4034 N ND2 . ASN A 1 534 ? 6.260   14.554 29.214  1.00 111.44 ?  578 ASN A ND2 1 
ATOM   4035 N N   . CYS A 1 535 ? 3.656   11.553 25.292  1.00 98.38  ?  579 CYS A N   1 
ATOM   4036 C CA  . CYS A 1 535 ? 3.644   11.184 23.887  1.00 96.47  ?  579 CYS A CA  1 
ATOM   4037 C C   . CYS A 1 535 ? 4.958   11.570 23.201  1.00 98.65  ?  579 CYS A C   1 
ATOM   4038 O O   . CYS A 1 535 ? 5.508   12.637 23.458  1.00 99.40  ?  579 CYS A O   1 
ATOM   4039 C CB  . CYS A 1 535 ? 2.460   11.854 23.178  1.00 91.42  ?  579 CYS A CB  1 
ATOM   4040 S SG  . CYS A 1 535 ? 0.851   11.047 23.480  1.00 92.24  ?  579 CYS A SG  1 
ATOM   4041 N N   . GLU A 1 536 ? 5.443   10.711 22.314  1.00 115.10 ?  580 GLU A N   1 
ATOM   4042 C CA  . GLU A 1 536 ? 6.582   11.068 21.487  1.00 117.12 ?  580 GLU A CA  1 
ATOM   4043 C C   . GLU A 1 536 ? 6.287   10.802 20.020  1.00 114.35 ?  580 GLU A C   1 
ATOM   4044 O O   . GLU A 1 536 ? 5.278   10.198 19.679  1.00 111.53 ?  580 GLU A O   1 
ATOM   4045 C CB  . GLU A 1 536 ? 7.848   10.345 21.926  1.00 123.84 ?  580 GLU A CB  1 
ATOM   4046 C CG  . GLU A 1 536 ? 7.892   8.882  21.564  1.00 126.19 ?  580 GLU A CG  1 
ATOM   4047 C CD  . GLU A 1 536 ? 8.971   8.136  22.339  1.00 133.56 ?  580 GLU A CD  1 
ATOM   4048 O OE1 . GLU A 1 536 ? 9.552   8.736  23.274  1.00 136.55 ?  580 GLU A OE1 1 
ATOM   4049 O OE2 . GLU A 1 536 ? 9.259   6.958  22.040  1.00 136.93 ?  580 GLU A OE2 1 
ATOM   4050 N N   . GLU A 1 537 ? 7.182   11.277 19.164  1.00 116.80 ?  581 GLU A N   1 
ATOM   4051 C CA  . GLU A 1 537 ? 6.968   11.345 17.722  1.00 114.10 ?  581 GLU A CA  1 
ATOM   4052 C C   . GLU A 1 537 ? 6.369   10.067 17.104  1.00 113.45 ?  581 GLU A C   1 
ATOM   4053 O O   . GLU A 1 537 ? 5.393   10.131 16.342  1.00 109.25 ?  581 GLU A O   1 
ATOM   4054 C CB  . GLU A 1 537 ? 8.289   11.724 17.056  1.00 117.87 ?  581 GLU A CB  1 
ATOM   4055 C CG  . GLU A 1 537 ? 8.206   12.042 15.585  1.00 115.54 ?  581 GLU A CG  1 
ATOM   4056 C CD  . GLU A 1 537 ? 9.577   12.154 14.931  1.00 120.55 ?  581 GLU A CD  1 
ATOM   4057 O OE1 . GLU A 1 537 ? 10.539  12.658 15.573  1.00 124.77 ?  581 GLU A OE1 1 
ATOM   4058 O OE2 . GLU A 1 537 ? 9.692   11.719 13.763  1.00 120.68 ?  581 GLU A OE2 1 
ATOM   4059 N N   . LYS A 1 538 ? 6.938   8.919  17.466  1.00 99.73  ?  582 LYS A N   1 
ATOM   4060 C CA  . LYS A 1 538 ? 6.422   7.603  17.069  1.00 100.04 ?  582 LYS A CA  1 
ATOM   4061 C C   . LYS A 1 538 ? 4.943   7.373  17.422  1.00 95.46  ?  582 LYS A C   1 
ATOM   4062 O O   . LYS A 1 538 ? 4.252   6.624  16.734  1.00 94.03  ?  582 LYS A O   1 
ATOM   4063 C CB  . LYS A 1 538 ? 7.307   6.453  17.614  1.00 106.77 ?  582 LYS A CB  1 
ATOM   4064 C CG  . LYS A 1 538 ? 7.274   6.157  19.133  1.00 109.26 ?  582 LYS A CG  1 
ATOM   4065 C CD  . LYS A 1 538 ? 7.701   4.712  19.419  1.00 115.11 ?  582 LYS A CD  1 
ATOM   4066 C CE  . LYS A 1 538 ? 7.746   4.372  20.916  1.00 118.40 ?  582 LYS A CE  1 
ATOM   4067 N NZ  . LYS A 1 538 ? 9.070   3.699  21.279  1.00 126.47 ?  582 LYS A NZ  1 
ATOM   4068 N N   . ASP A 1 539 ? 4.454   8.017  18.478  1.00 111.28 ?  583 ASP A N   1 
ATOM   4069 C CA  . ASP A 1 539 ? 3.071   7.798  18.919  1.00 109.58 ?  583 ASP A CA  1 
ATOM   4070 C C   . ASP A 1 539 ? 2.039   8.370  17.951  1.00 106.60 ?  583 ASP A C   1 
ATOM   4071 O O   . ASP A 1 539 ? 0.846   8.080  18.053  1.00 107.43 ?  583 ASP A O   1 
ATOM   4072 C CB  . ASP A 1 539 ? 2.841   8.357  20.327  1.00 109.51 ?  583 ASP A CB  1 
ATOM   4073 C CG  . ASP A 1 539 ? 3.555   7.560  21.390  1.00 113.65 ?  583 ASP A CG  1 
ATOM   4074 O OD1 . ASP A 1 539 ? 3.394   6.322  21.410  1.00 116.20 ?  583 ASP A OD1 1 
ATOM   4075 O OD2 . ASP A 1 539 ? 4.294   8.164  22.198  1.00 115.47 ?  583 ASP A OD2 1 
ATOM   4076 N N   . TYR A 1 540 ? 2.498   9.183  17.012  1.00 96.80  ?  584 TYR A N   1 
ATOM   4077 C CA  . TYR A 1 540 ? 1.588   9.779  16.047  1.00 94.08  ?  584 TYR A CA  1 
ATOM   4078 C C   . TYR A 1 540 ? 1.700   9.125  14.696  1.00 95.04  ?  584 TYR A C   1 
ATOM   4079 O O   . TYR A 1 540 ? 2.769   8.690  14.280  1.00 96.33  ?  584 TYR A O   1 
ATOM   4080 C CB  . TYR A 1 540 ? 1.841   11.267 15.917  1.00 90.01  ?  584 TYR A CB  1 
ATOM   4081 C CG  . TYR A 1 540 ? 1.677   11.962 17.223  1.00 89.53  ?  584 TYR A CG  1 
ATOM   4082 C CD1 . TYR A 1 540 ? 2.737   12.077 18.105  1.00 91.61  ?  584 TYR A CD1 1 
ATOM   4083 C CD2 . TYR A 1 540 ? 0.449   12.476 17.594  1.00 87.93  ?  584 TYR A CD2 1 
ATOM   4084 C CE1 . TYR A 1 540 ? 2.580   12.703 19.315  1.00 91.62  ?  584 TYR A CE1 1 
ATOM   4085 C CE2 . TYR A 1 540 ? 0.279   13.102 18.792  1.00 87.74  ?  584 TYR A CE2 1 
ATOM   4086 C CZ  . TYR A 1 540 ? 1.346   13.218 19.650  1.00 89.49  ?  584 TYR A CZ  1 
ATOM   4087 O OH  . TYR A 1 540 ? 1.164   13.852 20.854  1.00 89.78  ?  584 TYR A OH  1 
ATOM   4088 N N   . THR A 1 541 ? 0.576   9.050  14.013  1.00 88.45  ?  585 THR A N   1 
ATOM   4089 C CA  . THR A 1 541 ? 0.551   8.496  12.682  1.00 89.61  ?  585 THR A CA  1 
ATOM   4090 C C   . THR A 1 541 ? -0.030  9.541  11.748  1.00 85.86  ?  585 THR A C   1 
ATOM   4091 O O   . THR A 1 541 ? -0.747  10.447 12.183  1.00 82.84  ?  585 THR A O   1 
ATOM   4092 C CB  . THR A 1 541 ? -0.295  7.221  12.631  1.00 93.99  ?  585 THR A CB  1 
ATOM   4093 O OG1 . THR A 1 541 ? -0.190  6.631  11.328  1.00 95.89  ?  585 THR A OG1 1 
ATOM   4094 C CG2 . THR A 1 541 ? -1.747  7.541  12.944  1.00 93.69  ?  585 THR A CG2 1 
ATOM   4095 N N   . ILE A 1 542 ? 0.311   9.421  10.466  1.00 83.38  ?  586 ILE A N   1 
ATOM   4096 C CA  . ILE A 1 542 ? -0.179  10.330 9.426   1.00 80.20  ?  586 ILE A CA  1 
ATOM   4097 C C   . ILE A 1 542 ? -1.616  10.007 9.020   1.00 81.50  ?  586 ILE A C   1 
ATOM   4098 O O   . ILE A 1 542 ? -1.935  8.862  8.740   1.00 85.89  ?  586 ILE A O   1 
ATOM   4099 C CB  . ILE A 1 542 ? 0.733   10.278 8.188   1.00 80.46  ?  586 ILE A CB  1 
ATOM   4100 C CG1 . ILE A 1 542 ? 2.184   10.225 8.627   1.00 80.99  ?  586 ILE A CG1 1 
ATOM   4101 C CG2 . ILE A 1 542 ? 0.509   11.496 7.319   1.00 76.80  ?  586 ILE A CG2 1 
ATOM   4102 C CD1 . ILE A 1 542 ? 3.217   10.247 7.466   1.00 81.85  ?  586 ILE A CD1 1 
ATOM   4103 N N   . TRP A 1 543 ? -2.472  11.023 9.024   1.00 67.38  ?  587 TRP A N   1 
ATOM   4104 C CA  . TRP A 1 543 ? -3.901  10.883 8.667   1.00 68.42  ?  587 TRP A CA  1 
ATOM   4105 C C   . TRP A 1 543 ? -4.399  12.022 7.786   1.00 64.18  ?  587 TRP A C   1 
ATOM   4106 O O   . TRP A 1 543 ? -4.414  13.177 8.210   1.00 59.82  ?  587 TRP A O   1 
ATOM   4107 C CB  . TRP A 1 543 ? -4.753  10.857 9.933   1.00 68.99  ?  587 TRP A CB  1 
ATOM   4108 C CG  . TRP A 1 543 ? -6.249  10.801 9.730   1.00 70.30  ?  587 TRP A CG  1 
ATOM   4109 C CD1 . TRP A 1 543 ? -6.987  9.702  9.398   1.00 76.32  ?  587 TRP A CD1 1 
ATOM   4110 C CD2 . TRP A 1 543 ? -7.191  11.874 9.903   1.00 65.85  ?  587 TRP A CD2 1 
ATOM   4111 N NE1 . TRP A 1 543 ? -8.322  10.025 9.330   1.00 76.12  ?  587 TRP A NE1 1 
ATOM   4112 C CE2 . TRP A 1 543 ? -8.477  11.349 9.641   1.00 69.06  ?  587 TRP A CE2 1 
ATOM   4113 C CE3 . TRP A 1 543 ? -7.073  13.227 10.248  1.00 59.84  ?  587 TRP A CE3 1 
ATOM   4114 C CZ2 . TRP A 1 543 ? -9.633  12.124 9.712   1.00 65.28  ?  587 TRP A CZ2 1 
ATOM   4115 C CZ3 . TRP A 1 543 ? -8.237  14.001 10.321  1.00 56.61  ?  587 TRP A CZ3 1 
ATOM   4116 C CH2 . TRP A 1 543 ? -9.497  13.441 10.044  1.00 58.86  ?  587 TRP A CH2 1 
ATOM   4117 N N   . LEU A 1 544 ? -4.824  11.696 6.569   1.00 62.43  ?  588 LEU A N   1 
ATOM   4118 C CA  . LEU A 1 544 ? -5.428  12.678 5.669   1.00 59.15  ?  588 LEU A CA  1 
ATOM   4119 C C   . LEU A 1 544 ? -6.864  12.903 6.107   1.00 58.27  ?  588 LEU A C   1 
ATOM   4120 O O   . LEU A 1 544 ? -7.612  11.944 6.231   1.00 62.63  ?  588 LEU A O   1 
ATOM   4121 C CB  . LEU A 1 544 ? -5.398  12.155 4.223   1.00 62.35  ?  588 LEU A CB  1 
ATOM   4122 C CG  . LEU A 1 544 ? -6.093  12.947 3.107   1.00 60.60  ?  588 LEU A CG  1 
ATOM   4123 C CD1 . LEU A 1 544 ? -5.638  14.389 3.129   1.00 55.48  ?  588 LEU A CD1 1 
ATOM   4124 C CD2 . LEU A 1 544 ? -5.847  12.337 1.740   1.00 64.59  ?  588 LEU A CD2 1 
ATOM   4125 N N   . ALA A 1 545 ? -7.257  14.150 6.367   1.00 61.56  ?  589 ALA A N   1 
ATOM   4126 C CA  . ALA A 1 545 ? -8.665  14.444 6.673   1.00 60.25  ?  589 ALA A CA  1 
ATOM   4127 C C   . ALA A 1 545 ? -9.465  14.449 5.394   1.00 61.28  ?  589 ALA A C   1 
ATOM   4128 O O   . ALA A 1 545 ? -8.928  14.700 4.318   1.00 61.64  ?  589 ALA A O   1 
ATOM   4129 C CB  . ALA A 1 545 ? -8.808  15.779 7.357   1.00 55.23  ?  589 ALA A CB  1 
ATOM   4130 N N   . HIS A 1 546 ? -10.755 14.172 5.526   1.00 62.34  ?  590 HIS A N   1 
ATOM   4131 C CA  . HIS A 1 546 ? -11.702 14.285 4.432   1.00 63.41  ?  590 HIS A CA  1 
ATOM   4132 C C   . HIS A 1 546 ? -11.433 13.294 3.307   1.00 69.23  ?  590 HIS A C   1 
ATOM   4133 O O   . HIS A 1 546 ? -11.772 13.550 2.161   1.00 70.38  ?  590 HIS A O   1 
ATOM   4134 C CB  . HIS A 1 546 ? -11.740 15.729 3.909   1.00 59.10  ?  590 HIS A CB  1 
ATOM   4135 C CG  . HIS A 1 546 ? -12.461 16.690 4.817   1.00 54.99  ?  590 HIS A CG  1 
ATOM   4136 N ND1 . HIS A 1 546 ? -13.841 16.698 4.952   1.00 54.92  ?  590 HIS A ND1 1 
ATOM   4137 C CD2 . HIS A 1 546 ? -11.994 17.691 5.607   1.00 51.50  ?  590 HIS A CD2 1 
ATOM   4138 C CE1 . HIS A 1 546 ? -14.188 17.665 5.786   1.00 51.46  ?  590 HIS A CE1 1 
ATOM   4139 N NE2 . HIS A 1 546 ? -13.087 18.274 6.205   1.00 49.66  ?  590 HIS A NE2 1 
ATOM   4140 N N   . SER A 1 547 ? -10.847 12.148 3.630   1.00 54.96  ?  591 SER A N   1 
ATOM   4141 C CA  . SER A 1 547 ? -10.600 11.138 2.607   1.00 61.33  ?  591 SER A CA  1 
ATOM   4142 C C   . SER A 1 547 ? -11.845 10.346 2.233   1.00 66.81  ?  591 SER A C   1 
ATOM   4143 O O   . SER A 1 547 ? -12.604 9.907  3.103   1.00 68.32  ?  591 SER A O   1 
ATOM   4144 C CB  . SER A 1 547 ? -9.490  10.176 3.016   1.00 65.09  ?  591 SER A CB  1 
ATOM   4145 O OG  . SER A 1 547 ? -9.153  9.331  1.929   1.00 70.60  ?  591 SER A OG  1 
ATOM   4146 N N   . THR A 1 548 ? -12.038 10.158 0.930   1.00 76.33  ?  592 THR A N   1 
ATOM   4147 C CA  . THR A 1 548 ? -13.187 9.443  0.388   1.00 81.49  ?  592 THR A CA  1 
ATOM   4148 C C   . THR A 1 548 ? -12.748 8.320  -0.524  1.00 89.12  ?  592 THR A C   1 
ATOM   4149 O O   . THR A 1 548 ? -13.083 7.166  -0.292  1.00 95.63  ?  592 THR A O   1 
ATOM   4150 C CB  . THR A 1 548 ? -14.062 10.363 -0.436  1.00 78.26  ?  592 THR A CB  1 
ATOM   4151 O OG1 . THR A 1 548 ? -14.649 11.333 0.432   1.00 71.92  ?  592 THR A OG1 1 
ATOM   4152 C CG2 . THR A 1 548 ? -15.163 9.565  -1.106  1.00 83.61  ?  592 THR A CG2 1 
ATOM   4153 N N   . ASP A 1 549 ? -12.083 8.682  -1.620  1.00 105.70 ?  593 ASP A N   1 
ATOM   4154 C CA  . ASP A 1 549 ? -11.413 7.721  -2.493  1.00 111.07 ?  593 ASP A CA  1 
ATOM   4155 C C   . ASP A 1 549 ? -9.905  8.005  -2.609  1.00 107.93 ?  593 ASP A C   1 
ATOM   4156 O O   . ASP A 1 549 ? -9.495  8.923  -3.313  1.00 104.60 ?  593 ASP A O   1 
ATOM   4157 C CB  . ASP A 1 549 ? -12.085 7.737  -3.869  1.00 113.66 ?  593 ASP A CB  1 
ATOM   4158 C CG  . ASP A 1 549 ? -11.369 6.880  -4.880  1.00 117.81 ?  593 ASP A CG  1 
ATOM   4159 O OD1 . ASP A 1 549 ? -10.747 5.868  -4.487  1.00 120.48 ?  593 ASP A OD1 1 
ATOM   4160 O OD2 . ASP A 1 549 ? -11.435 7.227  -6.078  1.00 118.06 ?  593 ASP A OD2 1 
ATOM   4161 N N   . PRO A 1 550 ? -9.069  7.181  -1.967  1.00 93.59  ?  594 PRO A N   1 
ATOM   4162 C CA  . PRO A 1 550 ? -7.615  7.444  -1.919  1.00 90.02  ?  594 PRO A CA  1 
ATOM   4163 C C   . PRO A 1 550 ? -6.897  7.354  -3.281  1.00 91.23  ?  594 PRO A C   1 
ATOM   4164 O O   . PRO A 1 550 ? -5.784  7.859  -3.437  1.00 87.78  ?  594 PRO A O   1 
ATOM   4165 C CB  . PRO A 1 550 ? -7.088  6.371  -0.955  1.00 92.62  ?  594 PRO A CB  1 
ATOM   4166 C CG  . PRO A 1 550 ? -8.318  5.832  -0.226  1.00 96.37  ?  594 PRO A CG  1 
ATOM   4167 C CD  . PRO A 1 550 ? -9.468  6.007  -1.167  1.00 98.64  ?  594 PRO A CD  1 
ATOM   4168 N N   . GLU A 1 551 ? -7.520  6.724  -4.267  1.00 116.83 ?  595 GLU A N   1 
ATOM   4169 C CA  . GLU A 1 551 ? -6.925  6.686  -5.597  1.00 118.10 ?  595 GLU A CA  1 
ATOM   4170 C C   . GLU A 1 551 ? -7.066  8.031  -6.307  1.00 114.67 ?  595 GLU A C   1 
ATOM   4171 O O   . GLU A 1 551 ? -6.359  8.307  -7.279  1.00 114.40 ?  595 GLU A O   1 
ATOM   4172 C CB  . GLU A 1 551 ? -7.535  5.563  -6.441  1.00 124.21 ?  595 GLU A CB  1 
ATOM   4173 C CG  . GLU A 1 551 ? -7.279  4.165  -5.885  1.00 127.66 ?  595 GLU A CG  1 
ATOM   4174 C CD  . GLU A 1 551 ? -5.798  3.870  -5.655  1.00 126.31 ?  595 GLU A CD  1 
ATOM   4175 O OE1 . GLU A 1 551 ? -4.962  4.207  -6.531  1.00 125.50 ?  595 GLU A OE1 1 
ATOM   4176 O OE2 . GLU A 1 551 ? -5.470  3.299  -4.590  1.00 126.17 ?  595 GLU A OE2 1 
ATOM   4177 N N   . ASP A 1 552 ? -7.975  8.871  -5.818  1.00 106.57 ?  596 ASP A N   1 
ATOM   4178 C CA  . ASP A 1 552 ? -8.220  10.151 -6.469  1.00 103.62 ?  596 ASP A CA  1 
ATOM   4179 C C   . ASP A 1 552 ? -7.231  11.247 -6.074  1.00 97.21  ?  596 ASP A C   1 
ATOM   4180 O O   . ASP A 1 552 ? -7.059  11.568 -4.901  1.00 93.23  ?  596 ASP A O   1 
ATOM   4181 C CB  . ASP A 1 552 ? -9.650  10.631 -6.264  1.00 102.88 ?  596 ASP A CB  1 
ATOM   4182 C CG  . ASP A 1 552 ? -9.935  11.909 -7.022  1.00 100.28 ?  596 ASP A CG  1 
ATOM   4183 O OD1 . ASP A 1 552 ? -9.424  12.051 -8.145  1.00 101.26 ?  596 ASP A OD1 1 
ATOM   4184 O OD2 . ASP A 1 552 ? -10.658 12.782 -6.507  1.00 97.24  ?  596 ASP A OD2 1 
ATOM   4185 N N   . TYR A 1 553 ? -6.605  11.824 -7.092  1.00 89.41  ?  597 TYR A N   1 
ATOM   4186 C CA  . TYR A 1 553 ? -5.686  12.940 -6.958  1.00 84.52  ?  597 TYR A CA  1 
ATOM   4187 C C   . TYR A 1 553 ? -6.282  14.036 -6.099  1.00 79.84  ?  597 TYR A C   1 
ATOM   4188 O O   . TYR A 1 553 ? -5.561  14.756 -5.406  1.00 75.76  ?  597 TYR A O   1 
ATOM   4189 C CB  . TYR A 1 553 ? -5.411  13.503 -8.346  1.00 85.78  ?  597 TYR A CB  1 
ATOM   4190 C CG  . TYR A 1 553 ? -4.318  14.540 -8.449  1.00 82.62  ?  597 TYR A CG  1 
ATOM   4191 C CD1 . TYR A 1 553 ? -3.026  14.259 -8.016  1.00 81.55  ?  597 TYR A CD1 1 
ATOM   4192 C CD2 . TYR A 1 553 ? -4.562  15.780 -9.031  1.00 81.55  ?  597 TYR A CD2 1 
ATOM   4193 C CE1 . TYR A 1 553 ? -2.017  15.187 -8.132  1.00 79.53  ?  597 TYR A CE1 1 
ATOM   4194 C CE2 . TYR A 1 553 ? -3.563  16.721 -9.155  1.00 79.81  ?  597 TYR A CE2 1 
ATOM   4195 C CZ  . TYR A 1 553 ? -2.287  16.418 -8.701  1.00 78.81  ?  597 TYR A CZ  1 
ATOM   4196 O OH  . TYR A 1 553 ? -1.263  17.334 -8.821  1.00 77.75  ?  597 TYR A OH  1 
ATOM   4197 N N   . GLU A 1 554 ? -7.594  14.195 -6.160  1.00 77.06  ?  598 GLU A N   1 
ATOM   4198 C CA  . GLU A 1 554 ? -8.218  15.260 -5.400  1.00 72.70  ?  598 GLU A CA  1 
ATOM   4199 C C   . GLU A 1 554 ? -8.791  14.821 -4.078  1.00 71.15  ?  598 GLU A C   1 
ATOM   4200 O O   . GLU A 1 554 ? -9.464  15.597 -3.396  1.00 67.64  ?  598 GLU A O   1 
ATOM   4201 C CB  . GLU A 1 554 ? -9.211  16.022 -6.247  1.00 73.62  ?  598 GLU A CB  1 
ATOM   4202 C CG  . GLU A 1 554 ? -8.511  16.633 -7.434  1.00 74.93  ?  598 GLU A CG  1 
ATOM   4203 C CD  . GLU A 1 554 ? -9.470  17.079 -8.499  1.00 77.62  ?  598 GLU A CD  1 
ATOM   4204 O OE1 . GLU A 1 554 ? -10.603 17.480 -8.138  1.00 76.86  ?  598 GLU A OE1 1 
ATOM   4205 O OE2 . GLU A 1 554 ? -9.091  17.016 -9.692  1.00 80.58  ?  598 GLU A OE2 1 
ATOM   4206 N N   . ASP A 1 555 ? -8.522  13.574 -3.719  1.00 64.89  ?  599 ASP A N   1 
ATOM   4207 C CA  . ASP A 1 555 ? -9.086  13.045 -2.498  1.00 64.55  ?  599 ASP A CA  1 
ATOM   4208 C C   . ASP A 1 555 ? -8.765  13.941 -1.334  1.00 58.28  ?  599 ASP A C   1 
ATOM   4209 O O   . ASP A 1 555 ? -7.590  14.234 -1.039  1.00 55.87  ?  599 ASP A O   1 
ATOM   4210 C CB  . ASP A 1 555 ? -8.547  11.666 -2.179  1.00 68.82  ?  599 ASP A CB  1 
ATOM   4211 C CG  . ASP A 1 555 ? -9.257  11.045 -0.999  1.00 69.80  ?  599 ASP A CG  1 
ATOM   4212 O OD1 . ASP A 1 555 ? -10.490 11.214 -0.913  1.00 70.23  ?  599 ASP A OD1 1 
ATOM   4213 O OD2 . ASP A 1 555 ? -8.604  10.408 -0.149  1.00 70.33  ?  599 ASP A OD2 1 
ATOM   4214 N N   . GLY A 1 556 ? -9.819  14.364 -0.654  1.00 62.00  ?  600 GLY A N   1 
ATOM   4215 C CA  . GLY A 1 556 ? -9.651  15.165 0.525   1.00 56.68  ?  600 GLY A CA  1 
ATOM   4216 C C   . GLY A 1 556 ? -9.605  16.637 0.222   1.00 53.17  ?  600 GLY A C   1 
ATOM   4217 O O   . GLY A 1 556 ? -9.448  17.407 1.152   1.00 49.48  ?  600 GLY A O   1 
ATOM   4218 N N   . CYS A 1 557 ? -9.726  17.063 -1.036  1.00 72.10  ?  601 CYS A N   1 
ATOM   4219 C CA  . CYS A 1 557 ? -9.860  18.504 -1.246  1.00 69.97  ?  601 CYS A CA  1 
ATOM   4220 C C   . CYS A 1 557 ? -11.237 18.973 -0.726  1.00 68.40  ?  601 CYS A C   1 
ATOM   4221 O O   . CYS A 1 557 ? -12.291 18.545 -1.197  1.00 70.48  ?  601 CYS A O   1 
ATOM   4222 C CB  . CYS A 1 557 ? -9.690  18.889 -2.714  1.00 73.10  ?  601 CYS A CB  1 
ATOM   4223 S SG  . CYS A 1 557 ? -8.092  18.425 -3.465  1.00 75.11  ?  601 CYS A SG  1 
ATOM   4224 N N   . ILE A 1 558 ? -11.192 19.873 0.246   1.00 56.23  ?  602 ILE A N   1 
ATOM   4225 C CA  . ILE A 1 558 ? -12.348 20.555 0.758   1.00 54.79  ?  602 ILE A CA  1 
ATOM   4226 C C   . ILE A 1 558 ? -12.032 22.027 0.732   1.00 54.72  ?  602 ILE A C   1 
ATOM   4227 O O   . ILE A 1 558 ? -11.094 22.470 1.387   1.00 53.49  ?  602 ILE A O   1 
ATOM   4228 C CB  . ILE A 1 558 ? -12.617 20.181 2.238   1.00 51.93  ?  602 ILE A CB  1 
ATOM   4229 C CG1 . ILE A 1 558 ? -13.177 18.761 2.333   1.00 53.42  ?  602 ILE A CG1 1 
ATOM   4230 C CG2 . ILE A 1 558 ? -13.613 21.150 2.865   1.00 50.38  ?  602 ILE A CG2 1 
ATOM   4231 C CD1 . ILE A 1 558 ? -14.512 18.573 1.616   1.00 55.48  ?  602 ILE A CD1 1 
ATOM   4232 N N   . LEU A 1 559 ? -12.830 22.789 -0.001  1.00 58.63  ?  603 LEU A N   1 
ATOM   4233 C CA  . LEU A 1 559 ? -12.600 24.220 -0.137  1.00 60.60  ?  603 LEU A CA  1 
ATOM   4234 C C   . LEU A 1 559 ? -11.209 24.465 -0.726  1.00 62.34  ?  603 LEU A C   1 
ATOM   4235 O O   . LEU A 1 559 ? -10.462 25.320 -0.275  1.00 62.83  ?  603 LEU A O   1 
ATOM   4236 C CB  . LEU A 1 559 ? -12.852 24.980 1.178   1.00 58.97  ?  603 LEU A CB  1 
ATOM   4237 C CG  . LEU A 1 559 ? -14.305 25.520 1.367   1.00 59.58  ?  603 LEU A CG  1 
ATOM   4238 C CD1 . LEU A 1 559 ? -15.333 24.425 1.215   1.00 57.78  ?  603 LEU A CD1 1 
ATOM   4239 C CD2 . LEU A 1 559 ? -14.521 26.252 2.695   1.00 58.71  ?  603 LEU A CD2 1 
ATOM   4240 N N   . GLY A 1 560 ? -10.881 23.708 -1.762  1.00 55.29  ?  604 GLY A N   1 
ATOM   4241 C CA  . GLY A 1 560 ? -9.663  23.973 -2.495  1.00 57.31  ?  604 GLY A CA  1 
ATOM   4242 C C   . GLY A 1 560 ? -8.388  23.312 -1.980  1.00 55.08  ?  604 GLY A C   1 
ATOM   4243 O O   . GLY A 1 560 ? -7.358  23.313 -2.659  1.00 56.64  ?  604 GLY A O   1 
ATOM   4244 N N   . TYR A 1 561 ? -8.451  22.735 -0.786  1.00 65.54  ?  605 TYR A N   1 
ATOM   4245 C CA  . TYR A 1 561 ? -7.237  22.201 -0.209  1.00 64.01  ?  605 TYR A CA  1 
ATOM   4246 C C   . TYR A 1 561 ? -7.436  21.022 0.728   1.00 61.82  ?  605 TYR A C   1 
ATOM   4247 O O   . TYR A 1 561 ? -8.551  20.782 1.226   1.00 60.74  ?  605 TYR A O   1 
ATOM   4248 C CB  . TYR A 1 561 ? -6.420  23.313 0.429   1.00 63.62  ?  605 TYR A CB  1 
ATOM   4249 C CG  . TYR A 1 561 ? -6.949  23.956 1.692   1.00 61.77  ?  605 TYR A CG  1 
ATOM   4250 C CD1 . TYR A 1 561 ? -7.918  24.959 1.645   1.00 63.22  ?  605 TYR A CD1 1 
ATOM   4251 C CD2 . TYR A 1 561 ? -6.417  23.623 2.928   1.00 59.39  ?  605 TYR A CD2 1 
ATOM   4252 C CE1 . TYR A 1 561 ? -8.370  25.581 2.809   1.00 62.24  ?  605 TYR A CE1 1 
ATOM   4253 C CE2 . TYR A 1 561 ? -6.857  24.228 4.089   1.00 58.19  ?  605 TYR A CE2 1 
ATOM   4254 C CZ  . TYR A 1 561 ? -7.829  25.210 4.029   1.00 59.60  ?  605 TYR A CZ  1 
ATOM   4255 O OH  . TYR A 1 561 ? -8.234  25.807 5.213   1.00 59.05  ?  605 TYR A OH  1 
ATOM   4256 N N   . LYS A 1 562 ? -6.353  20.278 0.931   1.00 64.06  ?  606 LYS A N   1 
ATOM   4257 C CA  . LYS A 1 562 ? -6.359  19.083 1.762   1.00 63.46  ?  606 LYS A CA  1 
ATOM   4258 C C   . LYS A 1 562 ? -5.539  19.380 2.991   1.00 61.53  ?  606 LYS A C   1 
ATOM   4259 O O   . LYS A 1 562 ? -4.670  20.256 2.962   1.00 61.42  ?  606 LYS A O   1 
ATOM   4260 C CB  . LYS A 1 562 ? -5.675  17.892 1.079   1.00 66.39  ?  606 LYS A CB  1 
ATOM   4261 C CG  . LYS A 1 562 ? -5.755  17.844 -0.418  1.00 69.21  ?  606 LYS A CG  1 
ATOM   4262 C CD  . LYS A 1 562 ? -5.053  16.601 -0.900  1.00 72.34  ?  606 LYS A CD  1 
ATOM   4263 C CE  . LYS A 1 562 ? -5.438  16.253 -2.318  1.00 75.96  ?  606 LYS A CE  1 
ATOM   4264 N NZ  . LYS A 1 562 ? -5.033  14.854 -2.643  1.00 79.91  ?  606 LYS A NZ  1 
ATOM   4265 N N   . GLU A 1 563 ? -5.813  18.647 4.063   1.00 59.44  ?  607 GLU A N   1 
ATOM   4266 C CA  . GLU A 1 563 ? -4.960  18.663 5.228   1.00 58.55  ?  607 GLU A CA  1 
ATOM   4267 C C   . GLU A 1 563 ? -4.589  17.256 5.635   1.00 60.60  ?  607 GLU A C   1 
ATOM   4268 O O   . GLU A 1 563 ? -5.442  16.351 5.678   1.00 62.12  ?  607 GLU A O   1 
ATOM   4269 C CB  . GLU A 1 563 ? -5.609  19.422 6.376   1.00 56.30  ?  607 GLU A CB  1 
ATOM   4270 C CG  . GLU A 1 563 ? -5.818  20.873 6.018   1.00 55.64  ?  607 GLU A CG  1 
ATOM   4271 C CD  . GLU A 1 563 ? -6.529  21.656 7.087   1.00 54.19  ?  607 GLU A CD  1 
ATOM   4272 O OE1 . GLU A 1 563 ? -7.582  21.177 7.563   1.00 53.30  ?  607 GLU A OE1 1 
ATOM   4273 O OE2 . GLU A 1 563 ? -6.072  22.759 7.441   1.00 54.52  ?  607 GLU A OE2 1 
ATOM   4274 N N   . GLN A 1 564 ? -3.292  17.076 5.893   1.00 73.97  ?  608 GLN A N   1 
ATOM   4275 C CA  . GLN A 1 564 ? -2.793  15.852 6.491   1.00 76.56  ?  608 GLN A CA  1 
ATOM   4276 C C   . GLN A 1 564 ? -2.276  16.142 7.857   1.00 75.73  ?  608 GLN A C   1 
ATOM   4277 O O   . GLN A 1 564 ? -1.482  17.045 8.051   1.00 74.62  ?  608 GLN A O   1 
ATOM   4278 C CB  . GLN A 1 564 ? -1.703  15.222 5.662   1.00 79.18  ?  608 GLN A CB  1 
ATOM   4279 C CG  . GLN A 1 564 ? -2.234  14.681 4.376   1.00 81.24  ?  608 GLN A CG  1 
ATOM   4280 C CD  . GLN A 1 564 ? -1.386  13.561 3.846   1.00 84.98  ?  608 GLN A CD  1 
ATOM   4281 O OE1 . GLN A 1 564 ? -0.312  13.255 4.400   1.00 85.80  ?  608 GLN A OE1 1 
ATOM   4282 N NE2 . GLN A 1 564 ? -1.852  12.930 2.762   1.00 87.66  ?  608 GLN A NE2 1 
ATOM   4283 N N   . PHE A 1 565 ? -2.736  15.316 8.783   1.00 64.46  ?  609 PHE A N   1 
ATOM   4284 C CA  . PHE A 1 565 ? -2.590  15.501 10.212  1.00 64.10  ?  609 PHE A CA  1 
ATOM   4285 C C   . PHE A 1 565 ? -1.633  14.458 10.754  1.00 67.59  ?  609 PHE A C   1 
ATOM   4286 O O   . PHE A 1 565 ? -1.399  13.419 10.114  1.00 70.59  ?  609 PHE A O   1 
ATOM   4287 C CB  . PHE A 1 565 ? -3.956  15.310 10.876  1.00 63.97  ?  609 PHE A CB  1 
ATOM   4288 C CG  . PHE A 1 565 ? -4.866  16.466 10.685  1.00 60.41  ?  609 PHE A CG  1 
ATOM   4289 C CD1 . PHE A 1 565 ? -5.653  16.564 9.552   1.00 59.58  ?  609 PHE A CD1 1 
ATOM   4290 C CD2 . PHE A 1 565 ? -4.904  17.484 11.616  1.00 58.50  ?  609 PHE A CD2 1 
ATOM   4291 C CE1 . PHE A 1 565 ? -6.475  17.647 9.358   1.00 56.76  ?  609 PHE A CE1 1 
ATOM   4292 C CE2 . PHE A 1 565 ? -5.724  18.579 11.421  1.00 55.89  ?  609 PHE A CE2 1 
ATOM   4293 C CZ  . PHE A 1 565 ? -6.512  18.660 10.293  1.00 54.97  ?  609 PHE A CZ  1 
ATOM   4294 N N   . LEU A 1 566 ? -1.011  14.775 11.888  1.00 70.56  ?  610 LEU A N   1 
ATOM   4295 C CA  . LEU A 1 566 ? -0.422  13.752 12.743  1.00 74.05  ?  610 LEU A CA  1 
ATOM   4296 C C   . LEU A 1 566 ? -1.406  13.621 13.899  1.00 74.73  ?  610 LEU A C   1 
ATOM   4297 O O   . LEU A 1 566 ? -1.675  14.596 14.597  1.00 72.56  ?  610 LEU A O   1 
ATOM   4298 C CB  . LEU A 1 566 ? 0.974   14.149 13.224  1.00 74.74  ?  610 LEU A CB  1 
ATOM   4299 C CG  . LEU A 1 566 ? 2.112   14.089 12.192  1.00 75.96  ?  610 LEU A CG  1 
ATOM   4300 C CD1 . LEU A 1 566 ? 3.448   14.614 12.730  1.00 79.09  ?  610 LEU A CD1 1 
ATOM   4301 C CD2 . LEU A 1 566 ? 2.283   12.678 11.653  1.00 78.78  ?  610 LEU A CD2 1 
ATOM   4302 N N   . ARG A 1 567 ? -1.967  12.420 14.042  1.00 63.73  ?  611 ARG A N   1 
ATOM   4303 C CA  . ARG A 1 567 ? -2.937  12.069 15.073  1.00 64.97  ?  611 ARG A CA  1 
ATOM   4304 C C   . ARG A 1 567 ? -2.324  11.041 15.987  1.00 69.19  ?  611 ARG A C   1 
ATOM   4305 O O   . ARG A 1 567 ? -1.564  10.191 15.544  1.00 71.50  ?  611 ARG A O   1 
ATOM   4306 C CB  . ARG A 1 567 ? -4.136  11.380 14.444  1.00 67.17  ?  611 ARG A CB  1 
ATOM   4307 C CG  . ARG A 1 567 ? -5.070  12.275 13.665  1.00 63.45  ?  611 ARG A CG  1 
ATOM   4308 C CD  . ARG A 1 567 ? -6.265  11.494 13.156  1.00 66.87  ?  611 ARG A CD  1 
ATOM   4309 N NE  . ARG A 1 567 ? -7.197  11.216 14.234  1.00 69.86  ?  611 ARG A NE  1 
ATOM   4310 C CZ  . ARG A 1 567 ? -8.485  10.983 14.035  1.00 72.18  ?  611 ARG A CZ  1 
ATOM   4311 N NH1 . ARG A 1 567 ? -8.953  11.005 12.796  1.00 71.31  ?  611 ARG A NH1 1 
ATOM   4312 N NH2 . ARG A 1 567 ? -9.303  10.746 15.056  1.00 75.59  ?  611 ARG A NH2 1 
ATOM   4313 N N   . LEU A 1 568 ? -2.697  11.092 17.255  1.00 77.21  ?  612 LEU A N   1 
ATOM   4314 C CA  . LEU A 1 568 ? -2.263  10.119 18.243  1.00 81.22  ?  612 LEU A CA  1 
ATOM   4315 C C   . LEU A 1 568 ? -2.881  8.773  17.948  1.00 85.35  ?  612 LEU A C   1 
ATOM   4316 O O   . LEU A 1 568 ? -4.095  8.668  17.795  1.00 86.45  ?  612 LEU A O   1 
ATOM   4317 C CB  . LEU A 1 568 ? -2.711  10.575 19.626  1.00 81.70  ?  612 LEU A CB  1 
ATOM   4318 C CG  . LEU A 1 568 ? -2.229  9.742  20.802  1.00 85.23  ?  612 LEU A CG  1 
ATOM   4319 C CD1 . LEU A 1 568 ? -0.737  9.517  20.658  1.00 85.27  ?  612 LEU A CD1 1 
ATOM   4320 C CD2 . LEU A 1 568 ? -2.538  10.464 22.093  1.00 85.00  ?  612 LEU A CD2 1 
ATOM   4321 N N   . ARG A 1 569 ? -2.051  7.743  17.874  1.00 98.95  ?  613 ARG A N   1 
ATOM   4322 C CA  . ARG A 1 569 ? -2.542  6.393  17.628  1.00 103.08 ?  613 ARG A CA  1 
ATOM   4323 C C   . ARG A 1 569 ? -3.562  5.950  18.678  1.00 105.65 ?  613 ARG A C   1 
ATOM   4324 O O   . ARG A 1 569 ? -3.497  6.346  19.849  1.00 105.24 ?  613 ARG A O   1 
ATOM   4325 C CB  . ARG A 1 569 ? -1.376  5.408  17.573  1.00 105.25 ?  613 ARG A CB  1 
ATOM   4326 C CG  . ARG A 1 569 ? -0.394  5.685  16.451  1.00 103.44 ?  613 ARG A CG  1 
ATOM   4327 C CD  . ARG A 1 569 ? 0.790   4.728  16.538  1.00 105.82 ?  613 ARG A CD  1 
ATOM   4328 N NE  . ARG A 1 569 ? 1.868   5.086  15.619  1.00 104.05 ?  613 ARG A NE  1 
ATOM   4329 C CZ  . ARG A 1 569 ? 1.878   4.776  14.324  1.00 104.27 ?  613 ARG A CZ  1 
ATOM   4330 N NH1 . ARG A 1 569 ? 0.859   4.104  13.796  1.00 106.31 ?  613 ARG A NH1 1 
ATOM   4331 N NH2 . ARG A 1 569 ? 2.897   5.146  13.552  1.00 102.77 ?  613 ARG A NH2 1 
ATOM   4332 N N   . LYS A 1 570 ? -4.525  5.147  18.245  1.00 91.39  ?  614 LYS A N   1 
ATOM   4333 C CA  . LYS A 1 570 ? -5.455  4.552  19.186  1.00 94.05  ?  614 LYS A CA  1 
ATOM   4334 C C   . LYS A 1 570 ? -4.647  3.738  20.178  1.00 95.99  ?  614 LYS A C   1 
ATOM   4335 O O   . LYS A 1 570 ? -4.793  3.911  21.380  1.00 96.26  ?  614 LYS A O   1 
ATOM   4336 C CB  . LYS A 1 570 ? -6.466  3.643  18.478  1.00 96.75  ?  614 LYS A CB  1 
ATOM   4337 C CG  . LYS A 1 570 ? -7.701  4.327  17.956  1.00 95.16  ?  614 LYS A CG  1 
ATOM   4338 C CD  . LYS A 1 570 ? -7.403  5.163  16.743  1.00 93.87  ?  614 LYS A CD  1 
ATOM   4339 C CE  . LYS A 1 570 ? -8.632  5.987  16.306  1.00 92.58  ?  614 LYS A CE  1 
ATOM   4340 N NZ  . LYS A 1 570 ? -8.251  6.950  15.206  1.00 91.57  ?  614 LYS A NZ  1 
ATOM   4341 N N   . SER A 1 571 ? -3.793  2.855  19.667  1.00 117.26 ?  615 SER A N   1 
ATOM   4342 C CA  . SER A 1 571 ? -3.027  1.953  20.526  1.00 119.55 ?  615 SER A CA  1 
ATOM   4343 C C   . SER A 1 571 ? -2.171  2.683  21.565  1.00 118.00 ?  615 SER A C   1 
ATOM   4344 O O   . SER A 1 571 ? -2.210  2.362  22.754  1.00 119.56 ?  615 SER A O   1 
ATOM   4345 C CB  . SER A 1 571 ? -2.155  1.002  19.693  1.00 121.21 ?  615 SER A CB  1 
ATOM   4346 O OG  . SER A 1 571 ? -1.272  1.709  18.844  1.00 118.75 ?  615 SER A OG  1 
ATOM   4347 N N   . SER A 1 572 ? -1.413  3.674  21.109  1.00 112.40 ?  616 SER A N   1 
ATOM   4348 C CA  . SER A 1 572 ? -0.512  4.417  21.973  1.00 110.94 ?  616 SER A CA  1 
ATOM   4349 C C   . SER A 1 572 ? -1.256  5.158  23.078  1.00 110.29 ?  616 SER A C   1 
ATOM   4350 O O   . SER A 1 572 ? -2.119  5.979  22.808  1.00 108.30 ?  616 SER A O   1 
ATOM   4351 C CB  . SER A 1 572 ? 0.279   5.428  21.133  1.00 107.43 ?  616 SER A CB  1 
ATOM   4352 O OG  . SER A 1 572 ? 1.149   4.777  20.218  1.00 108.32 ?  616 SER A OG  1 
ATOM   4353 N N   . MET A 1 573 ? -0.898  4.888  24.325  1.00 116.68 ?  617 MET A N   1 
ATOM   4354 C CA  . MET A 1 573 ? -1.456  5.636  25.440  1.00 116.35 ?  617 MET A CA  1 
ATOM   4355 C C   . MET A 1 573 ? -0.366  6.472  26.087  1.00 115.19 ?  617 MET A C   1 
ATOM   4356 O O   . MET A 1 573 ? 0.639   5.965  26.574  1.00 117.28 ?  617 MET A O   1 
ATOM   4357 C CB  . MET A 1 573 ? -2.149  4.720  26.451  1.00 119.79 ?  617 MET A CB  1 
ATOM   4358 C CG  . MET A 1 573 ? -1.243  3.793  27.196  1.00 121.90 ?  617 MET A CG  1 
ATOM   4359 S SD  . MET A 1 573 ? -2.067  2.859  28.488  1.00 124.45 ?  617 MET A SD  1 
ATOM   4360 C CE  . MET A 1 573 ? -2.234  4.031  29.841  1.00 124.42 ?  617 MET A CE  1 
ATOM   4361 N N   . CYS A 1 574 ? -0.524  7.776  25.971  1.00 98.29  ?  618 CYS A N   1 
ATOM   4362 C CA  . CYS A 1 574 ? 0.390   8.710  26.576  1.00 97.01  ?  618 CYS A CA  1 
ATOM   4363 C C   . CYS A 1 574 ? -0.282  10.062 26.608  1.00 94.11  ?  618 CYS A C   1 
ATOM   4364 O O   . CYS A 1 574 ? -1.256  10.308 25.884  1.00 92.49  ?  618 CYS A O   1 
ATOM   4365 C CB  . CYS A 1 574 ? 1.672   8.781  25.758  1.00 96.07  ?  618 CYS A CB  1 
ATOM   4366 S SG  . CYS A 1 574 ? 1.385   9.154  24.008  1.00 92.41  ?  618 CYS A SG  1 
ATOM   4367 N N   . GLN A 1 575 ? 0.250   10.948 27.431  1.00 97.91  ?  619 GLN A N   1 
ATOM   4368 C CA  . GLN A 1 575 ? -0.267  12.296 27.506  1.00 95.40  ?  619 GLN A CA  1 
ATOM   4369 C C   . GLN A 1 575 ? 0.231   13.115 26.328  1.00 91.81  ?  619 GLN A C   1 
ATOM   4370 O O   . GLN A 1 575 ? 1.437   13.149 26.052  1.00 92.08  ?  619 GLN A O   1 
ATOM   4371 C CB  . GLN A 1 575 ? 0.166   12.928 28.819  1.00 96.69  ?  619 GLN A CB  1 
ATOM   4372 C CG  . GLN A 1 575 ? -0.130  14.399 28.948  1.00 94.36  ?  619 GLN A CG  1 
ATOM   4373 C CD  . GLN A 1 575 ? 0.569   15.022 30.151  1.00 96.56  ?  619 GLN A CD  1 
ATOM   4374 O OE1 . GLN A 1 575 ? 1.508   14.444 30.728  1.00 99.58  ?  619 GLN A OE1 1 
ATOM   4375 N NE2 . GLN A 1 575 ? 0.113   16.208 30.537  1.00 95.55  ?  619 GLN A NE2 1 
ATOM   4376 N N   . ASN A 1 576 ? -0.704  13.748 25.623  1.00 90.30  ?  620 ASN A N   1 
ATOM   4377 C CA  . ASN A 1 576 ? -0.370  14.729 24.598  1.00 86.54  ?  620 ASN A CA  1 
ATOM   4378 C C   . ASN A 1 576 ? 0.382   15.910 25.201  1.00 86.29  ?  620 ASN A C   1 
ATOM   4379 O O   . ASN A 1 576 ? 1.386   16.356 24.651  1.00 85.92  ?  620 ASN A O   1 
ATOM   4380 C CB  . ASN A 1 576 ? -1.629  15.250 23.900  1.00 83.88  ?  620 ASN A CB  1 
ATOM   4381 C CG  . ASN A 1 576 ? -2.159  14.300 22.830  1.00 83.90  ?  620 ASN A CG  1 
ATOM   4382 O OD1 . ASN A 1 576 ? -1.403  13.755 22.025  1.00 83.83  ?  620 ASN A OD1 1 
ATOM   4383 N ND2 . ASN A 1 576 ? -3.472  14.112 22.814  1.00 84.43  ?  620 ASN A ND2 1 
ATOM   4384 N N   . GLY A 1 577 ? -0.099  16.412 26.337  1.00 85.58  ?  621 GLY A N   1 
ATOM   4385 C CA  . GLY A 1 577 ? 0.528   17.538 27.011  1.00 86.37  ?  621 GLY A CA  1 
ATOM   4386 C C   . GLY A 1 577 ? -0.230  18.838 26.834  1.00 83.84  ?  621 GLY A C   1 
ATOM   4387 O O   . GLY A 1 577 ? -0.938  19.014 25.842  1.00 80.76  ?  621 GLY A O   1 
ATOM   4388 N N   . ARG A 1 578 ? -0.094  19.746 27.797  1.00 81.90  ?  622 ARG A N   1 
ATOM   4389 C CA  . ARG A 1 578 ? -0.784  21.036 27.756  1.00 80.11  ?  622 ARG A CA  1 
ATOM   4390 C C   . ARG A 1 578 ? -0.264  21.882 26.592  1.00 78.55  ?  622 ARG A C   1 
ATOM   4391 O O   . ARG A 1 578 ? -1.012  22.653 25.978  1.00 75.95  ?  622 ARG A O   1 
ATOM   4392 C CB  . ARG A 1 578 ? -0.649  21.813 29.082  1.00 83.16  ?  622 ARG A CB  1 
ATOM   4393 C CG  . ARG A 1 578 ? -1.101  21.083 30.358  1.00 85.63  ?  622 ARG A CG  1 
ATOM   4394 C CD  . ARG A 1 578 ? -1.348  22.082 31.502  1.00 87.81  ?  622 ARG A CD  1 
ATOM   4395 N NE  . ARG A 1 578 ? -2.234  23.154 31.050  1.00 85.67  ?  622 ARG A NE  1 
ATOM   4396 C CZ  . ARG A 1 578 ? -3.562  23.147 31.179  1.00 84.88  ?  622 ARG A CZ  1 
ATOM   4397 N NH1 . ARG A 1 578 ? -4.177  22.141 31.788  1.00 86.79  ?  622 ARG A NH1 1 
ATOM   4398 N NH2 . ARG A 1 578 ? -4.282  24.154 30.704  1.00 83.34  ?  622 ARG A NH2 1 
ATOM   4399 N N   . ASP A 1 579 ? 0.999   21.706 26.244  1.00 99.14  ?  623 ASP A N   1 
ATOM   4400 C CA  . ASP A 1 579 ? 1.567   22.483 25.156  1.00 98.78  ?  623 ASP A CA  1 
ATOM   4401 C C   . ASP A 1 579 ? 1.333   21.833 23.785  1.00 95.49  ?  623 ASP A C   1 
ATOM   4402 O O   . ASP A 1 579 ? 1.849   22.304 22.779  1.00 95.40  ?  623 ASP A O   1 
ATOM   4403 C CB  . ASP A 1 579 ? 3.055   22.692 25.389  1.00 103.84 ?  623 ASP A CB  1 
ATOM   4404 C CG  . ASP A 1 579 ? 3.790   21.391 25.620  1.00 106.38 ?  623 ASP A CG  1 
ATOM   4405 O OD1 . ASP A 1 579 ? 3.200   20.318 25.312  1.00 103.89 ?  623 ASP A OD1 1 
ATOM   4406 O OD2 . ASP A 1 579 ? 4.960   21.456 26.103  1.00 111.29 ?  623 ASP A OD2 1 
ATOM   4407 N N   . TYR A 1 580 ? 0.574   20.742 23.748  1.00 79.92  ?  624 TYR A N   1 
ATOM   4408 C CA  . TYR A 1 580 ? 0.383   19.984 22.505  1.00 77.51  ?  624 TYR A CA  1 
ATOM   4409 C C   . TYR A 1 580 ? -0.099  20.820 21.315  1.00 74.28  ?  624 TYR A C   1 
ATOM   4410 O O   . TYR A 1 580 ? -1.005  21.647 21.441  1.00 72.84  ?  624 TYR A O   1 
ATOM   4411 C CB  . TYR A 1 580 ? -0.539  18.790 22.735  1.00 77.47  ?  624 TYR A CB  1 
ATOM   4412 C CG  . TYR A 1 580 ? -0.981  18.126 21.458  1.00 75.36  ?  624 TYR A CG  1 
ATOM   4413 C CD1 . TYR A 1 580 ? -0.167  17.202 20.821  1.00 76.52  ?  624 TYR A CD1 1 
ATOM   4414 C CD2 . TYR A 1 580 ? -2.240  18.410 20.891  1.00 72.54  ?  624 TYR A CD2 1 
ATOM   4415 C CE1 . TYR A 1 580 ? -0.576  16.583 19.657  1.00 75.10  ?  624 TYR A CE1 1 
ATOM   4416 C CE2 . TYR A 1 580 ? -2.654  17.796 19.726  1.00 71.22  ?  624 TYR A CE2 1 
ATOM   4417 C CZ  . TYR A 1 580 ? -1.814  16.885 19.115  1.00 72.54  ?  624 TYR A CZ  1 
ATOM   4418 O OH  . TYR A 1 580 ? -2.210  16.272 17.962  1.00 71.92  ?  624 TYR A OH  1 
ATOM   4419 N N   . VAL A 1 581 ? 0.525   20.604 20.162  1.00 82.52  ?  625 VAL A N   1 
ATOM   4420 C CA  . VAL A 1 581 ? 0.211   21.358 18.949  1.00 80.06  ?  625 VAL A CA  1 
ATOM   4421 C C   . VAL A 1 581 ? -0.338  20.395 17.920  1.00 77.54  ?  625 VAL A C   1 
ATOM   4422 O O   . VAL A 1 581 ? 0.308   19.405 17.589  1.00 78.93  ?  625 VAL A O   1 
ATOM   4423 C CB  . VAL A 1 581 ? 1.477   22.019 18.329  1.00 82.88  ?  625 VAL A CB  1 
ATOM   4424 C CG1 . VAL A 1 581 ? 1.092   23.017 17.265  1.00 80.66  ?  625 VAL A CG1 1 
ATOM   4425 C CG2 . VAL A 1 581 ? 2.292   22.697 19.382  1.00 86.83  ?  625 VAL A CG2 1 
ATOM   4426 N N   . VAL A 1 582 ? -1.521  20.680 17.398  1.00 77.53  ?  626 VAL A N   1 
ATOM   4427 C CA  . VAL A 1 582 ? -2.056  19.856 16.331  1.00 75.94  ?  626 VAL A CA  1 
ATOM   4428 C C   . VAL A 1 582 ? -1.229  20.231 15.106  1.00 75.69  ?  626 VAL A C   1 
ATOM   4429 O O   . VAL A 1 582 ? -1.292  21.371 14.642  1.00 75.04  ?  626 VAL A O   1 
ATOM   4430 C CB  . VAL A 1 582 ? -3.518  20.254 16.062  1.00 73.45  ?  626 VAL A CB  1 
ATOM   4431 C CG1 . VAL A 1 582 ? -4.047  19.589 14.808  1.00 72.04  ?  626 VAL A CG1 1 
ATOM   4432 C CG2 . VAL A 1 582 ? -4.378  19.937 17.249  1.00 74.10  ?  626 VAL A CG2 1 
ATOM   4433 N N   . THR A 1 583 ? -0.485  19.280 14.553  1.00 71.26  ?  627 THR A N   1 
ATOM   4434 C CA  . THR A 1 583 ? 0.335   19.594 13.391  1.00 72.23  ?  627 THR A CA  1 
ATOM   4435 C C   . THR A 1 583 ? -0.326  19.054 12.114  1.00 70.17  ?  627 THR A C   1 
ATOM   4436 O O   . THR A 1 583 ? -0.822  17.934 12.095  1.00 70.06  ?  627 THR A O   1 
ATOM   4437 C CB  . THR A 1 583 ? 1.819   19.104 13.544  1.00 76.44  ?  627 THR A CB  1 
ATOM   4438 O OG1 . THR A 1 583 ? 1.956   17.771 13.047  1.00 77.04  ?  627 THR A OG1 1 
ATOM   4439 C CG2 . THR A 1 583 ? 2.295   19.155 15.011  1.00 78.90  ?  627 THR A CG2 1 
ATOM   4440 N N   . LYS A 1 584 ? -0.351  19.862 11.060  1.00 77.44  ?  628 LYS A N   1 
ATOM   4441 C CA  . LYS A 1 584 ? -0.999  19.465 9.813   1.00 75.79  ?  628 LYS A CA  1 
ATOM   4442 C C   . LYS A 1 584 ? -0.357  20.162 8.628   1.00 76.87  ?  628 LYS A C   1 
ATOM   4443 O O   . LYS A 1 584 ? 0.171   21.258 8.771   1.00 78.08  ?  628 LYS A O   1 
ATOM   4444 C CB  . LYS A 1 584 ? -2.486  19.831 9.850   1.00 73.28  ?  628 LYS A CB  1 
ATOM   4445 C CG  . LYS A 1 584 ? -2.699  21.257 10.304  1.00 72.54  ?  628 LYS A CG  1 
ATOM   4446 C CD  . LYS A 1 584 ? -4.051  21.815 9.947   1.00 70.80  ?  628 LYS A CD  1 
ATOM   4447 C CE  . LYS A 1 584 ? -4.190  23.217 10.529  1.00 71.13  ?  628 LYS A CE  1 
ATOM   4448 N NZ  . LYS A 1 584 ? -5.081  24.100 9.714   1.00 70.89  ?  628 LYS A NZ  1 
ATOM   4449 N N   . GLN A 1 585 ? -0.426  19.559 7.448   1.00 76.65  ?  629 GLN A N   1 
ATOM   4450 C CA  . GLN A 1 585 ? 0.079   20.252 6.277   1.00 77.84  ?  629 GLN A CA  1 
ATOM   4451 C C   . GLN A 1 585 ? -1.015  20.385 5.252   1.00 76.14  ?  629 GLN A C   1 
ATOM   4452 O O   . GLN A 1 585 ? -1.753  19.436 4.966   1.00 75.72  ?  629 GLN A O   1 
ATOM   4453 C CB  . GLN A 1 585 ? 1.175   19.452 5.605   1.00 80.70  ?  629 GLN A CB  1 
ATOM   4454 C CG  . GLN A 1 585 ? 2.388   19.143 6.398   1.00 83.86  ?  629 GLN A CG  1 
ATOM   4455 C CD  . GLN A 1 585 ? 3.120   18.013 5.715   1.00 86.44  ?  629 GLN A CD  1 
ATOM   4456 O OE1 . GLN A 1 585 ? 2.496   17.272 4.925   1.00 85.28  ?  629 GLN A OE1 1 
ATOM   4457 N NE2 . GLN A 1 585 ? 4.436   17.877 5.976   1.00 90.39  ?  629 GLN A NE2 1 
ATOM   4458 N N   . PRO A 1 586 ? -1.114  21.570 4.668   1.00 58.38  ?  630 PRO A N   1 
ATOM   4459 C CA  . PRO A 1 586 ? -2.108  21.776 3.608   1.00 56.65  ?  630 PRO A CA  1 
ATOM   4460 C C   . PRO A 1 586 ? -1.585  21.324 2.221   1.00 58.56  ?  630 PRO A C   1 
ATOM   4461 O O   . PRO A 1 586 ? -0.394  21.571 1.916   1.00 61.60  ?  630 PRO A O   1 
ATOM   4462 C CB  . PRO A 1 586 ? -2.331  23.282 3.655   1.00 56.69  ?  630 PRO A CB  1 
ATOM   4463 C CG  . PRO A 1 586 ? -0.953  23.835 4.123   1.00 59.91  ?  630 PRO A CG  1 
ATOM   4464 C CD  . PRO A 1 586 ? -0.361  22.789 5.011   1.00 60.47  ?  630 PRO A CD  1 
ATOM   4465 N N   . SER A 1 587 ? -2.446  20.737 1.382   1.00 65.35  ?  631 SER A N   1 
ATOM   4466 C CA  . SER A 1 587 ? -2.094  20.534 -0.022  1.00 67.97  ?  631 SER A CA  1 
ATOM   4467 C C   . SER A 1 587 ? -3.009  21.436 -0.849  1.00 68.92  ?  631 SER A C   1 
ATOM   4468 O O   . SER A 1 587 ? -4.207  21.412 -0.652  1.00 68.01  ?  631 SER A O   1 
ATOM   4469 C CB  . SER A 1 587 ? -2.299  19.076 -0.434  1.00 69.33  ?  631 SER A CB  1 
ATOM   4470 O OG  . SER A 1 587 ? -1.519  18.160 0.305   1.00 69.32  ?  631 SER A OG  1 
ATOM   4471 N N   . ILE A 1 588 ? -2.479  22.221 -1.784  1.00 71.91  ?  632 ILE A N   1 
ATOM   4472 C CA  . ILE A 1 588 ? -3.348  23.152 -2.517  1.00 73.64  ?  632 ILE A CA  1 
ATOM   4473 C C   . ILE A 1 588 ? -3.848  22.574 -3.827  1.00 76.02  ?  632 ILE A C   1 
ATOM   4474 O O   . ILE A 1 588 ? -3.078  22.363 -4.775  1.00 78.16  ?  632 ILE A O   1 
ATOM   4475 C CB  . ILE A 1 588 ? -2.684  24.519 -2.790  1.00 75.69  ?  632 ILE A CB  1 
ATOM   4476 C CG1 . ILE A 1 588 ? -1.969  25.026 -1.538  1.00 74.27  ?  632 ILE A CG1 1 
ATOM   4477 C CG2 . ILE A 1 588 ? -3.725  25.519 -3.259  1.00 77.84  ?  632 ILE A CG2 1 
ATOM   4478 C CD1 . ILE A 1 588 ? -2.902  25.356 -0.375  1.00 72.33  ?  632 ILE A CD1 1 
ATOM   4479 N N   . CYS A 1 589 ? -5.155  22.344 -3.873  1.00 59.16  ?  633 CYS A N   1 
ATOM   4480 C CA  . CYS A 1 589 ? -5.787  21.720 -5.026  1.00 61.20  ?  633 CYS A CA  1 
ATOM   4481 C C   . CYS A 1 589 ? -5.996  22.716 -6.132  1.00 64.48  ?  633 CYS A C   1 
ATOM   4482 O O   . CYS A 1 589 ? -6.084  23.922 -5.878  1.00 64.84  ?  633 CYS A O   1 
ATOM   4483 C CB  . CYS A 1 589 ? -7.110  21.092 -4.614  1.00 60.28  ?  633 CYS A CB  1 
ATOM   4484 S SG  . CYS A 1 589 ? -6.866  20.022 -3.203  1.00 56.98  ?  633 CYS A SG  1 
ATOM   4485 N N   . LEU A 1 590 ? -6.010  22.196 -7.361  1.00 67.75  ?  634 LEU A N   1 
ATOM   4486 C CA  . LEU A 1 590 ? -6.381  22.951 -8.554  1.00 71.34  ?  634 LEU A CA  1 
ATOM   4487 C C   . LEU A 1 590 ? -7.816  23.455 -8.441  1.00 72.16  ?  634 LEU A C   1 
ATOM   4488 O O   . LEU A 1 590 ? -8.711  22.668 -8.149  1.00 71.35  ?  634 LEU A O   1 
ATOM   4489 C CB  . LEU A 1 590 ? -6.378  22.030 -9.761  1.00 74.00  ?  634 LEU A CB  1 
ATOM   4490 C CG  . LEU A 1 590 ? -5.103  21.511 -10.379 1.00 74.96  ?  634 LEU A CG  1 
ATOM   4491 C CD1 . LEU A 1 590 ? -5.433  21.007 -11.789 1.00 78.40  ?  634 LEU A CD1 1 
ATOM   4492 C CD2 . LEU A 1 590 ? -4.042  22.602 -10.407 1.00 75.00  ?  634 LEU A CD2 1 
ATOM   4493 N N   . CYS A 1 591 ? -8.039  24.736 -8.723  1.00 76.04  ?  635 CYS A N   1 
ATOM   4494 C CA  . CYS A 1 591 ? -9.398  25.275 -8.805  1.00 77.97  ?  635 CYS A CA  1 
ATOM   4495 C C   . CYS A 1 591 ? -10.243 24.601 -9.868  1.00 80.62  ?  635 CYS A C   1 
ATOM   4496 O O   . CYS A 1 591 ? -9.823  24.476 -11.014 1.00 83.00  ?  635 CYS A O   1 
ATOM   4497 C CB  . CYS A 1 591 ? -9.372  26.765 -9.101  1.00 80.86  ?  635 CYS A CB  1 
ATOM   4498 S SG  . CYS A 1 591 ? -8.696  27.749 -7.779  1.00 79.06  ?  635 CYS A SG  1 
ATOM   4499 N N   . SER A 1 592 ? -11.430 24.160 -9.476  1.00 71.50  ?  636 SER A N   1 
ATOM   4500 C CA  . SER A 1 592 ? -12.430 23.707 -10.434 1.00 74.75  ?  636 SER A CA  1 
ATOM   4501 C C   . SER A 1 592 ? -13.644 24.633 -10.299 1.00 76.73  ?  636 SER A C   1 
ATOM   4502 O O   . SER A 1 592 ? -13.661 25.493 -9.421  1.00 75.45  ?  636 SER A O   1 
ATOM   4503 C CB  . SER A 1 592 ? -12.809 22.250 -10.161 1.00 73.36  ?  636 SER A CB  1 
ATOM   4504 O OG  . SER A 1 592 ? -13.527 22.113 -8.937  1.00 70.14  ?  636 SER A OG  1 
ATOM   4505 N N   . LEU A 1 593 ? -14.657 24.468 -11.141 1.00 75.67  ?  637 LEU A N   1 
ATOM   4506 C CA  . LEU A 1 593 ? -15.843 25.324 -11.011 1.00 77.80  ?  637 LEU A CA  1 
ATOM   4507 C C   . LEU A 1 593 ? -16.510 25.112 -9.637  1.00 73.60  ?  637 LEU A C   1 
ATOM   4508 O O   . LEU A 1 593 ? -17.118 26.034 -9.091  1.00 72.22  ?  637 LEU A O   1 
ATOM   4509 C CB  . LEU A 1 593 ? -16.827 25.134 -12.177 1.00 80.78  ?  637 LEU A CB  1 
ATOM   4510 C CG  . LEU A 1 593 ? -16.325 25.571 -13.576 1.00 82.47  ?  637 LEU A CG  1 
ATOM   4511 C CD1 . LEU A 1 593 ? -17.257 25.142 -14.728 1.00 84.16  ?  637 LEU A CD1 1 
ATOM   4512 C CD2 . LEU A 1 593 ? -16.064 27.081 -13.653 1.00 82.68  ?  637 LEU A CD2 1 
ATOM   4513 N N   . GLU A 1 594 ? -16.323 23.926 -9.053  1.00 99.12  ?  638 GLU A N   1 
ATOM   4514 C CA  . GLU A 1 594 ? -16.941 23.588 -7.776  1.00 93.69  ?  638 GLU A CA  1 
ATOM   4515 C C   . GLU A 1 594 ? -16.385 24.455 -6.657  1.00 90.21  ?  638 GLU A C   1 
ATOM   4516 O O   . GLU A 1 594 ? -16.900 24.440 -5.533  1.00 85.98  ?  638 GLU A O   1 
ATOM   4517 C CB  . GLU A 1 594 ? -16.740 22.111 -7.435  1.00 91.64  ?  638 GLU A CB  1 
ATOM   4518 C CG  . GLU A 1 594 ? -16.545 21.189 -8.631  1.00 96.34  ?  638 GLU A CG  1 
ATOM   4519 C CD  . GLU A 1 594 ? -17.848 20.790 -9.320  1.00 100.16 ?  638 GLU A CD  1 
ATOM   4520 O OE1 . GLU A 1 594 ? -18.861 20.573 -8.610  1.00 97.37  ?  638 GLU A OE1 1 
ATOM   4521 O OE2 . GLU A 1 594 ? -17.859 20.688 -10.575 1.00 105.48 ?  638 GLU A OE2 1 
ATOM   4522 N N   . ASP A 1 595 ? -15.334 25.209 -6.970  1.00 69.58  ?  639 ASP A N   1 
ATOM   4523 C CA  . ASP A 1 595 ? -14.691 26.104 -6.007  1.00 67.88  ?  639 ASP A CA  1 
ATOM   4524 C C   . ASP A 1 595 ? -15.302 27.510 -6.072  1.00 71.33  ?  639 ASP A C   1 
ATOM   4525 O O   . ASP A 1 595 ? -14.859 28.441 -5.398  1.00 72.03  ?  639 ASP A O   1 
ATOM   4526 C CB  . ASP A 1 595 ? -13.182 26.179 -6.258  1.00 68.62  ?  639 ASP A CB  1 
ATOM   4527 C CG  . ASP A 1 595 ? -12.470 24.888 -5.934  1.00 64.76  ?  639 ASP A CG  1 
ATOM   4528 O OD1 . ASP A 1 595 ? -12.452 24.534 -4.726  1.00 60.44  ?  639 ASP A OD1 1 
ATOM   4529 O OD2 . ASP A 1 595 ? -11.917 24.245 -6.876  1.00 66.47  ?  639 ASP A OD2 1 
ATOM   4530 N N   . PHE A 1 596 ? -16.323 27.668 -6.892  1.00 78.29  ?  640 PHE A N   1 
ATOM   4531 C CA  . PHE A 1 596 ? -16.939 28.973 -7.023  1.00 80.45  ?  640 PHE A CA  1 
ATOM   4532 C C   . PHE A 1 596 ? -18.411 28.935 -6.659  1.00 76.70  ?  640 PHE A C   1 
ATOM   4533 O O   . PHE A 1 596 ? -19.074 27.906 -6.804  1.00 74.67  ?  640 PHE A O   1 
ATOM   4534 C CB  . PHE A 1 596 ? -16.728 29.507 -8.445  1.00 85.69  ?  640 PHE A CB  1 
ATOM   4535 C CG  . PHE A 1 596 ? -15.292 29.706 -8.780  1.00 88.49  ?  640 PHE A CG  1 
ATOM   4536 C CD1 . PHE A 1 596 ? -14.666 30.904 -8.491  1.00 88.98  ?  640 PHE A CD1 1 
ATOM   4537 C CD2 . PHE A 1 596 ? -14.541 28.672 -9.325  1.00 88.30  ?  640 PHE A CD2 1 
ATOM   4538 C CE1 . PHE A 1 596 ? -13.322 31.080 -8.765  1.00 89.06  ?  640 PHE A CE1 1 
ATOM   4539 C CE2 . PHE A 1 596 ? -13.207 28.842 -9.601  1.00 87.57  ?  640 PHE A CE2 1 
ATOM   4540 C CZ  . PHE A 1 596 ? -12.596 30.050 -9.323  1.00 88.05  ?  640 PHE A CZ  1 
ATOM   4541 N N   . LEU A 1 597 ? -18.925 30.054 -6.171  1.00 80.75  ?  641 LEU A N   1 
ATOM   4542 C CA  . LEU A 1 597 ? -20.356 30.184 -5.963  1.00 78.03  ?  641 LEU A CA  1 
ATOM   4543 C C   . LEU A 1 597 ? -20.845 31.171 -7.014  1.00 80.99  ?  641 LEU A C   1 
ATOM   4544 O O   . LEU A 1 597 ? -20.109 32.083 -7.396  1.00 84.21  ?  641 LEU A O   1 
ATOM   4545 C CB  . LEU A 1 597 ? -20.657 30.675 -4.537  1.00 75.17  ?  641 LEU A CB  1 
ATOM   4546 C CG  . LEU A 1 597 ? -20.155 32.089 -4.183  1.00 77.71  ?  641 LEU A CG  1 
ATOM   4547 C CD1 . LEU A 1 597 ? -21.250 33.206 -4.320  1.00 78.30  ?  641 LEU A CD1 1 
ATOM   4548 C CD2 . LEU A 1 597 ? -19.496 32.116 -2.808  1.00 76.35  ?  641 LEU A CD2 1 
ATOM   4549 N N   . CYS A 1 598 ? -22.069 30.969 -7.500  1.00 91.21  ?  642 CYS A N   1 
ATOM   4550 C CA  . CYS A 1 598 ? -22.700 31.903 -8.427  1.00 93.00  ?  642 CYS A CA  1 
ATOM   4551 C C   . CYS A 1 598 ? -22.902 33.271 -7.811  1.00 93.07  ?  642 CYS A C   1 
ATOM   4552 O O   . CYS A 1 598 ? -23.399 33.397 -6.705  1.00 90.79  ?  642 CYS A O   1 
ATOM   4553 C CB  . CYS A 1 598 ? -24.040 31.362 -8.881  1.00 91.46  ?  642 CYS A CB  1 
ATOM   4554 S SG  . CYS A 1 598 ? -23.902 29.838 -9.795  1.00 92.55  ?  642 CYS A SG  1 
ATOM   4555 N N   . ASP A 1 599 ? -22.451 34.279 -8.566  1.00 91.01  ?  643 ASP A N   1 
ATOM   4556 C CA  . ASP A 1 599 ? -22.553 35.713 -8.262  1.00 91.79  ?  643 ASP A CA  1 
ATOM   4557 C C   . ASP A 1 599 ? -23.926 36.294 -8.604  1.00 90.97  ?  643 ASP A C   1 
ATOM   4558 O O   . ASP A 1 599 ? -24.733 35.633 -9.256  1.00 90.05  ?  643 ASP A O   1 
ATOM   4559 C CB  . ASP A 1 599 ? -21.457 36.493 -8.993  1.00 94.98  ?  643 ASP A CB  1 
ATOM   4560 C CG  . ASP A 1 599 ? -21.059 37.761 -8.264  1.00 96.37  ?  643 ASP A CG  1 
ATOM   4561 O OD1 . ASP A 1 599 ? -21.788 38.168 -7.335  1.00 95.09  ?  643 ASP A OD1 1 
ATOM   4562 O OD2 . ASP A 1 599 ? -20.017 38.350 -8.619  1.00 98.90  ?  643 ASP A OD2 1 
ATOM   4563 N N   . PHE A 1 600 ? -24.203 37.518 -8.150  1.00 93.06  ?  644 PHE A N   1 
ATOM   4564 C CA  . PHE A 1 600 ? -25.544 38.030 -8.235  1.00 96.74  ?  644 PHE A CA  1 
ATOM   4565 C C   . PHE A 1 600 ? -26.153 37.915 -9.613  1.00 100.91 ?  644 PHE A C   1 
ATOM   4566 O O   . PHE A 1 600 ? -25.557 38.325 -10.598 1.00 103.45 ?  644 PHE A O   1 
ATOM   4567 C CB  . PHE A 1 600 ? -25.617 39.469 -7.777  1.00 100.26 ?  644 PHE A CB  1 
ATOM   4568 C CG  . PHE A 1 600 ? -27.005 40.032 -7.839  1.00 105.00 ?  644 PHE A CG  1 
ATOM   4569 C CD1 . PHE A 1 600 ? -28.053 39.390 -7.167  1.00 103.68 ?  644 PHE A CD1 1 
ATOM   4570 C CD2 . PHE A 1 600 ? -27.269 41.189 -8.565  1.00 111.22 ?  644 PHE A CD2 1 
ATOM   4571 C CE1 . PHE A 1 600 ? -29.328 39.897 -7.211  1.00 108.44 ?  644 PHE A CE1 1 
ATOM   4572 C CE2 . PHE A 1 600 ? -28.532 41.702 -8.614  1.00 116.02 ?  644 PHE A CE2 1 
ATOM   4573 C CZ  . PHE A 1 600 ? -29.568 41.054 -7.941  1.00 114.66 ?  644 PHE A CZ  1 
ATOM   4574 N N   . GLY A 1 601 ? -27.355 37.363 -9.677  1.00 103.30 ?  645 GLY A N   1 
ATOM   4575 C CA  . GLY A 1 601 ? -28.063 37.274 -10.937 1.00 107.55 ?  645 GLY A CA  1 
ATOM   4576 C C   . GLY A 1 601 ? -27.586 36.136 -11.815 1.00 105.98 ?  645 GLY A C   1 
ATOM   4577 O O   . GLY A 1 601 ? -27.776 36.160 -13.036 1.00 109.72 ?  645 GLY A O   1 
ATOM   4578 N N   . TYR A 1 602 ? -26.963 35.145 -11.180 1.00 107.23 ?  646 TYR A N   1 
ATOM   4579 C CA  . TYR A 1 602 ? -26.527 33.926 -11.844 1.00 105.55 ?  646 TYR A CA  1 
ATOM   4580 C C   . TYR A 1 602 ? -26.979 32.733 -11.025 1.00 101.82 ?  646 TYR A C   1 
ATOM   4581 O O   . TYR A 1 602 ? -27.219 32.856 -9.827  1.00 99.41  ?  646 TYR A O   1 
ATOM   4582 C CB  . TYR A 1 602 ? -25.009 33.913 -11.992 1.00 103.97 ?  646 TYR A CB  1 
ATOM   4583 C CG  . TYR A 1 602 ? -24.528 34.729 -13.164 1.00 107.74 ?  646 TYR A CG  1 
ATOM   4584 C CD1 . TYR A 1 602 ? -24.407 36.109 -13.072 1.00 110.47 ?  646 TYR A CD1 1 
ATOM   4585 C CD2 . TYR A 1 602 ? -24.200 34.121 -14.368 1.00 109.37 ?  646 TYR A CD2 1 
ATOM   4586 C CE1 . TYR A 1 602 ? -23.973 36.856 -14.146 1.00 114.61 ?  646 TYR A CE1 1 
ATOM   4587 C CE2 . TYR A 1 602 ? -23.774 34.858 -15.443 1.00 113.35 ?  646 TYR A CE2 1 
ATOM   4588 C CZ  . TYR A 1 602 ? -23.660 36.224 -15.326 1.00 115.95 ?  646 TYR A CZ  1 
ATOM   4589 O OH  . TYR A 1 602 ? -23.221 36.965 -16.397 1.00 120.27 ?  646 TYR A OH  1 
ATOM   4590 N N   . TYR A 1 603 ? -27.088 31.579 -11.674 1.00 106.78 ?  647 TYR A N   1 
ATOM   4591 C CA  . TYR A 1 603 ? -27.545 30.363 -11.009 1.00 103.89 ?  647 TYR A CA  1 
ATOM   4592 C C   . TYR A 1 603 ? -26.997 29.117 -11.697 1.00 103.68 ?  647 TYR A C   1 
ATOM   4593 O O   . TYR A 1 603 ? -26.618 29.165 -12.870 1.00 106.71 ?  647 TYR A O   1 
ATOM   4594 C CB  . TYR A 1 603 ? -29.077 30.319 -11.000 1.00 106.84 ?  647 TYR A CB  1 
ATOM   4595 C CG  . TYR A 1 603 ? -29.722 30.086 -12.349 1.00 111.59 ?  647 TYR A CG  1 
ATOM   4596 C CD1 . TYR A 1 603 ? -29.716 31.072 -13.325 1.00 115.85 ?  647 TYR A CD1 1 
ATOM   4597 C CD2 . TYR A 1 603 ? -30.356 28.884 -12.635 1.00 112.27 ?  647 TYR A CD2 1 
ATOM   4598 C CE1 . TYR A 1 603 ? -30.309 30.863 -14.556 1.00 120.79 ?  647 TYR A CE1 1 
ATOM   4599 C CE2 . TYR A 1 603 ? -30.951 28.664 -13.863 1.00 117.22 ?  647 TYR A CE2 1 
ATOM   4600 C CZ  . TYR A 1 603 ? -30.923 29.655 -14.818 1.00 121.46 ?  647 TYR A CZ  1 
ATOM   4601 O OH  . TYR A 1 603 ? -31.522 29.437 -16.037 1.00 126.85 ?  647 TYR A OH  1 
ATOM   4602 N N   . ARG A 1 604 ? -26.960 28.002 -10.973 1.00 114.50 ?  648 ARG A N   1 
ATOM   4603 C CA  . ARG A 1 604 ? -26.605 26.736 -11.597 1.00 116.50 ?  648 ARG A CA  1 
ATOM   4604 C C   . ARG A 1 604 ? -27.845 25.919 -11.894 1.00 115.95 ?  648 ARG A C   1 
ATOM   4605 O O   . ARG A 1 604 ? -28.422 25.312 -10.997 1.00 113.48 ?  648 ARG A O   1 
ATOM   4606 C CB  . ARG A 1 604 ? -25.673 25.923 -10.699 1.00 115.56 ?  648 ARG A CB  1 
ATOM   4607 C CG  . ARG A 1 604 ? -24.251 26.406 -10.704 1.00 117.56 ?  648 ARG A CG  1 
ATOM   4608 C CD  . ARG A 1 604 ? -23.349 25.431 -9.977  1.00 116.98 ?  648 ARG A CD  1 
ATOM   4609 N NE  . ARG A 1 604 ? -21.975 25.916 -9.900  1.00 118.76 ?  648 ARG A NE  1 
ATOM   4610 C CZ  . ARG A 1 604 ? -21.514 26.687 -8.921  1.00 116.59 ?  648 ARG A CZ  1 
ATOM   4611 N NH1 . ARG A 1 604 ? -22.320 27.065 -7.934  1.00 112.65 ?  648 ARG A NH1 1 
ATOM   4612 N NH2 . ARG A 1 604 ? -20.250 27.082 -8.929  1.00 118.74 ?  648 ARG A NH2 1 
ATOM   4613 N N   . PRO A 1 605 ? -28.246 25.968 -13.141 1.00 136.15 ?  649 PRO A N   1 
ATOM   4614 C CA  . PRO A 1 605 ? -29.281 25.104 -13.675 1.00 138.88 ?  649 PRO A CA  1 
ATOM   4615 C C   . PRO A 1 605 ? -28.721 23.727 -13.827 1.00 137.85 ?  649 PRO A C   1 
ATOM   4616 O O   . PRO A 1 605 ? -27.549 23.597 -14.132 1.00 138.58 ?  649 PRO A O   1 
ATOM   4617 C CB  . PRO A 1 605 ? -29.533 25.688 -15.057 1.00 144.35 ?  649 PRO A CB  1 
ATOM   4618 C CG  . PRO A 1 605 ? -28.301 26.456 -15.383 1.00 143.80 ?  649 PRO A CG  1 
ATOM   4619 C CD  . PRO A 1 605 ? -27.836 27.010 -14.083 1.00 139.15 ?  649 PRO A CD  1 
ATOM   4620 N N   . GLU A 1 606 ? -29.536 22.710 -13.605 1.00 203.41 ?  650 GLU A N   1 
ATOM   4621 C CA  . GLU A 1 606 ? -29.220 21.374 -14.076 1.00 204.56 ?  650 GLU A CA  1 
ATOM   4622 C C   . GLU A 1 606 ? -28.059 20.700 -13.360 1.00 204.61 ?  650 GLU A C   1 
ATOM   4623 O O   . GLU A 1 606 ? -27.656 21.085 -12.269 1.00 202.80 ?  650 GLU A O   1 
ATOM   4624 C CB  . GLU A 1 606 ? -28.964 21.396 -15.594 1.00 209.96 ?  650 GLU A CB  1 
ATOM   4625 C CG  . GLU A 1 606 ? -27.508 21.538 -16.025 1.00 210.68 ?  650 GLU A CG  1 
ATOM   4626 C CD  . GLU A 1 606 ? -27.338 22.406 -17.247 1.00 215.82 ?  650 GLU A CD  1 
ATOM   4627 O OE1 . GLU A 1 606 ? -28.356 22.755 -17.873 1.00 218.62 ?  650 GLU A OE1 1 
ATOM   4628 O OE2 . GLU A 1 606 ? -26.184 22.743 -17.578 1.00 217.36 ?  650 GLU A OE2 1 
ATOM   4629 N N   . ASN A 1 607 ? -27.535 19.681 -14.025 1.00 198.17 ?  651 ASN A N   1 
ATOM   4630 C CA  . ASN A 1 607 ? -26.320 19.006 -13.621 1.00 200.10 ?  651 ASN A CA  1 
ATOM   4631 C C   . ASN A 1 607 ? -25.083 19.902 -13.683 1.00 200.92 ?  651 ASN A C   1 
ATOM   4632 O O   . ASN A 1 607 ? -24.217 19.827 -12.819 1.00 200.30 ?  651 ASN A O   1 
ATOM   4633 C CB  . ASN A 1 607 ? -26.117 17.729 -14.443 1.00 203.55 ?  651 ASN A CB  1 
ATOM   4634 C CG  . ASN A 1 607 ? -27.111 16.635 -14.081 1.00 205.17 ?  651 ASN A CG  1 
ATOM   4635 O OD1 . ASN A 1 607 ? -27.670 16.620 -12.984 1.00 206.00 ?  651 ASN A OD1 1 
ATOM   4636 N ND2 . ASN A 1 607 ? -27.332 15.713 -15.006 1.00 205.67 ?  651 ASN A ND2 1 
ATOM   4637 N N   . ASP A 1 608 ? -24.997 20.756 -14.696 1.00 169.54 ?  652 ASP A N   1 
ATOM   4638 C CA  . ASP A 1 608 ? -23.763 21.491 -14.928 1.00 171.04 ?  652 ASP A CA  1 
ATOM   4639 C C   . ASP A 1 608 ? -23.468 22.343 -13.730 1.00 167.87 ?  652 ASP A C   1 
ATOM   4640 O O   . ASP A 1 608 ? -24.368 22.785 -13.037 1.00 164.44 ?  652 ASP A O   1 
ATOM   4641 C CB  . ASP A 1 608 ? -23.849 22.390 -16.161 1.00 173.29 ?  652 ASP A CB  1 
ATOM   4642 C CG  . ASP A 1 608 ? -22.525 23.093 -16.470 1.00 175.81 ?  652 ASP A CG  1 
ATOM   4643 O OD1 . ASP A 1 608 ? -21.527 22.873 -15.742 1.00 175.46 ?  652 ASP A OD1 1 
ATOM   4644 O OD2 . ASP A 1 608 ? -22.482 23.865 -17.447 1.00 177.84 ?  652 ASP A OD2 1 
ATOM   4645 N N   . SER A 1 609 ? -22.186 22.529 -13.471 1.00 129.45 ?  653 SER A N   1 
ATOM   4646 C CA  . SER A 1 609 ? -21.740 23.393 -12.409 1.00 127.51 ?  653 SER A CA  1 
ATOM   4647 C C   . SER A 1 609 ? -21.457 24.769 -12.962 1.00 127.03 ?  653 SER A C   1 
ATOM   4648 O O   . SER A 1 609 ? -20.994 25.644 -12.262 1.00 125.74 ?  653 SER A O   1 
ATOM   4649 C CB  . SER A 1 609 ? -20.500 22.807 -11.764 1.00 126.76 ?  653 SER A CB  1 
ATOM   4650 O OG  . SER A 1 609 ? -20.614 21.402 -11.697 1.00 126.97 ?  653 SER A OG  1 
ATOM   4651 N N   . LYS A 1 610 ? -21.719 24.946 -14.240 1.00 133.25 ?  654 LYS A N   1 
ATOM   4652 C CA  . LYS A 1 610 ? -21.548 26.245 -14.869 1.00 133.13 ?  654 LYS A CA  1 
ATOM   4653 C C   . LYS A 1 610 ? -22.589 27.233 -14.342 1.00 132.58 ?  654 LYS A C   1 
ATOM   4654 O O   . LYS A 1 610 ? -23.783 26.955 -14.349 1.00 133.57 ?  654 LYS A O   1 
ATOM   4655 C CB  . LYS A 1 610 ? -21.660 26.097 -16.392 1.00 136.76 ?  654 LYS A CB  1 
ATOM   4656 C CG  . LYS A 1 610 ? -21.185 27.300 -17.224 1.00 138.35 ?  654 LYS A CG  1 
ATOM   4657 C CD  . LYS A 1 610 ? -19.658 27.448 -17.281 1.00 139.18 ?  654 LYS A CD  1 
ATOM   4658 C CE  . LYS A 1 610 ? -19.248 28.627 -18.176 1.00 142.49 ?  654 LYS A CE  1 
ATOM   4659 N NZ  . LYS A 1 610 ? -18.034 29.347 -17.692 1.00 141.21 ?  654 LYS A NZ  1 
ATOM   4660 N N   . CYS A 1 611 ? -22.118 28.381 -13.868 1.00 100.88 ?  655 CYS A N   1 
ATOM   4661 C CA  . CYS A 1 611 ? -22.993 29.450 -13.430 1.00 100.21 ?  655 CYS A CA  1 
ATOM   4662 C C   . CYS A 1 611 ? -23.490 30.193 -14.657 1.00 100.82 ?  655 CYS A C   1 
ATOM   4663 O O   . CYS A 1 611 ? -22.695 30.725 -15.431 1.00 102.08 ?  655 CYS A O   1 
ATOM   4664 C CB  . CYS A 1 611 ? -22.251 30.421 -12.512 1.00 99.14  ?  655 CYS A CB  1 
ATOM   4665 S SG  . CYS A 1 611 ? -22.105 29.903 -10.784 1.00 98.14  ?  655 CYS A SG  1 
ATOM   4666 N N   . VAL A 1 612 ? -24.808 30.229 -14.828 1.00 120.32 ?  656 VAL A N   1 
ATOM   4667 C CA  . VAL A 1 612 ? -25.419 30.886 -15.980 1.00 120.95 ?  656 VAL A CA  1 
ATOM   4668 C C   . VAL A 1 612 ? -26.329 32.038 -15.560 1.00 120.18 ?  656 VAL A C   1 
ATOM   4669 O O   . VAL A 1 612 ? -26.892 32.042 -14.464 1.00 119.49 ?  656 VAL A O   1 
ATOM   4670 C CB  . VAL A 1 612 ? -26.195 29.885 -16.873 1.00 123.24 ?  656 VAL A CB  1 
ATOM   4671 C CG1 . VAL A 1 612 ? -25.368 28.611 -17.067 1.00 124.89 ?  656 VAL A CG1 1 
ATOM   4672 C CG2 . VAL A 1 612 ? -27.558 29.559 -16.282 1.00 123.02 ?  656 VAL A CG2 1 
ATOM   4673 N N   . GLU A 1 613 ? -26.440 33.021 -16.442 1.00 109.53 ?  657 GLU A N   1 
ATOM   4674 C CA  . GLU A 1 613 ? -27.172 34.245 -16.158 1.00 108.83 ?  657 GLU A CA  1 
ATOM   4675 C C   . GLU A 1 613 ? -28.670 34.001 -15.990 1.00 109.01 ?  657 GLU A C   1 
ATOM   4676 O O   . GLU A 1 613 ? -29.279 33.274 -16.769 1.00 110.15 ?  657 GLU A O   1 
ATOM   4677 C CB  . GLU A 1 613 ? -26.917 35.264 -17.269 1.00 109.38 ?  657 GLU A CB  1 
ATOM   4678 C CG  . GLU A 1 613 ? -27.685 36.557 -17.133 1.00 108.87 ?  657 GLU A CG  1 
ATOM   4679 C CD  . GLU A 1 613 ? -27.448 37.493 -18.304 1.00 110.85 ?  657 GLU A CD  1 
ATOM   4680 O OE1 . GLU A 1 613 ? -26.459 37.263 -19.048 1.00 114.32 ?  657 GLU A OE1 1 
ATOM   4681 O OE2 . GLU A 1 613 ? -28.251 38.450 -18.473 1.00 110.60 ?  657 GLU A OE2 1 
ATOM   4682 N N   . GLN A 1 614 ? -29.256 34.602 -14.962 1.00 131.36 ?  658 GLN A N   1 
ATOM   4683 C CA  . GLN A 1 614 ? -30.696 34.514 -14.766 1.00 131.59 ?  658 GLN A CA  1 
ATOM   4684 C C   . GLN A 1 614 ? -31.429 35.172 -15.941 1.00 132.16 ?  658 GLN A C   1 
ATOM   4685 O O   . GLN A 1 614 ? -31.011 36.223 -16.426 1.00 131.85 ?  658 GLN A O   1 
ATOM   4686 C CB  . GLN A 1 614 ? -31.098 35.178 -13.446 1.00 130.60 ?  658 GLN A CB  1 
ATOM   4687 C CG  . GLN A 1 614 ? -30.636 34.441 -12.191 1.00 130.19 ?  658 GLN A CG  1 
ATOM   4688 C CD  . GLN A 1 614 ? -31.673 33.459 -11.670 1.00 130.77 ?  658 GLN A CD  1 
ATOM   4689 O OE1 . GLN A 1 614 ? -32.584 33.048 -12.399 1.00 131.84 ?  658 GLN A OE1 1 
ATOM   4690 N NE2 . GLN A 1 614 ? -31.544 33.084 -10.398 1.00 130.29 ?  658 GLN A NE2 1 
ATOM   4691 N N   . PRO A 1 615 ? -32.505 34.536 -16.424 1.00 142.24 ?  659 PRO A N   1 
ATOM   4692 C CA  . PRO A 1 615 ? -33.303 35.141 -17.497 1.00 142.85 ?  659 PRO A CA  1 
ATOM   4693 C C   . PRO A 1 615 ? -33.868 36.484 -17.036 1.00 141.59 ?  659 PRO A C   1 
ATOM   4694 O O   . PRO A 1 615 ? -33.795 37.486 -17.750 1.00 141.45 ?  659 PRO A O   1 
ATOM   4695 C CB  . PRO A 1 615 ? -34.440 34.133 -17.693 1.00 144.43 ?  659 PRO A CB  1 
ATOM   4696 C CG  . PRO A 1 615 ? -33.915 32.843 -17.147 1.00 144.98 ?  659 PRO A CG  1 
ATOM   4697 C CD  . PRO A 1 615 ? -33.019 33.219 -16.015 1.00 143.34 ?  659 PRO A CD  1 
ATOM   4698 N N   . GLU A 1 616 ? -34.427 36.490 -15.833 1.00 152.01 ?  660 GLU A N   1 
ATOM   4699 C CA  . GLU A 1 616 ? -34.815 37.723 -15.165 1.00 150.92 ?  660 GLU A CA  1 
ATOM   4700 C C   . GLU A 1 616 ? -34.770 37.501 -13.651 1.00 150.28 ?  660 GLU A C   1 
ATOM   4701 O O   . GLU A 1 616 ? -34.990 36.391 -13.165 1.00 150.79 ?  660 GLU A O   1 
ATOM   4702 C CB  . GLU A 1 616 ? -36.209 38.187 -15.623 1.00 151.24 ?  660 GLU A CB  1 
ATOM   4703 C CG  . GLU A 1 616 ? -36.556 39.650 -15.299 1.00 150.27 ?  660 GLU A CG  1 
ATOM   4704 C CD  . GLU A 1 616 ? -35.635 40.660 -15.987 1.00 150.07 ?  660 GLU A CD  1 
ATOM   4705 O OE1 . GLU A 1 616 ? -35.769 40.868 -17.218 1.00 150.52 ?  660 GLU A OE1 1 
ATOM   4706 O OE2 . GLU A 1 616 ? -34.781 41.253 -15.286 1.00 149.74 ?  660 GLU A OE2 1 
ATOM   4707 N N   . LEU A 1 617 ? -34.470 38.565 -12.917 1.00 108.45 ?  661 LEU A N   1 
ATOM   4708 C CA  . LEU A 1 617 ? -34.435 38.537 -11.463 1.00 107.98 ?  661 LEU A CA  1 
ATOM   4709 C C   . LEU A 1 617 ? -35.820 38.739 -10.832 1.00 107.90 ?  661 LEU A C   1 
ATOM   4710 O O   . LEU A 1 617 ? -36.523 39.695 -11.142 1.00 107.87 ?  661 LEU A O   1 
ATOM   4711 C CB  . LEU A 1 617 ? -33.501 39.638 -10.991 1.00 107.82 ?  661 LEU A CB  1 
ATOM   4712 C CG  . LEU A 1 617 ? -32.297 39.682 -11.917 1.00 108.46 ?  661 LEU A CG  1 
ATOM   4713 C CD1 . LEU A 1 617 ? -31.564 40.994 -11.795 1.00 108.94 ?  661 LEU A CD1 1 
ATOM   4714 C CD2 . LEU A 1 617 ? -31.380 38.504 -11.597 1.00 108.77 ?  661 LEU A CD2 1 
ATOM   4715 N N   . LYS A 1 618 ? -36.188 37.852 -9.919  1.00 145.34 ?  662 LYS A N   1 
ATOM   4716 C CA  . LYS A 1 618 ? -37.463 37.967 -9.232  1.00 145.41 ?  662 LYS A CA  1 
ATOM   4717 C C   . LYS A 1 618 ? -37.253 37.958 -7.724  1.00 144.88 ?  662 LYS A C   1 
ATOM   4718 O O   . LYS A 1 618 ? -36.153 37.684 -7.244  1.00 144.60 ?  662 LYS A O   1 
ATOM   4719 C CB  . LYS A 1 618 ? -38.431 36.857 -9.660  1.00 146.70 ?  662 LYS A CB  1 
ATOM   4720 C CG  . LYS A 1 618 ? -37.949 35.442 -9.363  1.00 147.00 ?  662 LYS A CG  1 
ATOM   4721 C CD  . LYS A 1 618 ? -39.006 34.387 -9.713  1.00 148.72 ?  662 LYS A CD  1 
ATOM   4722 C CE  . LYS A 1 618 ? -38.570 32.975 -9.293  1.00 149.25 ?  662 LYS A CE  1 
ATOM   4723 N NZ  . LYS A 1 618 ? -37.362 32.476 -10.021 1.00 149.22 ?  662 LYS A NZ  1 
ATOM   4724 N N   . GLY A 1 619 ? -38.308 38.304 -6.990  1.00 95.19  ?  663 GLY A N   1 
ATOM   4725 C CA  . GLY A 1 619 ? -38.264 38.366 -5.541  1.00 94.77  ?  663 GLY A CA  1 
ATOM   4726 C C   . GLY A 1 619 ? -37.190 39.285 -5.007  1.00 94.51  ?  663 GLY A C   1 
ATOM   4727 O O   . GLY A 1 619 ? -37.007 40.412 -5.475  1.00 94.70  ?  663 GLY A O   1 
ATOM   4728 N N   . HIS A 1 620 ? -36.457 38.779 -4.023  1.00 93.18  ?  664 HIS A N   1 
ATOM   4729 C CA  . HIS A 1 620 ? -35.463 39.584 -3.341  1.00 93.55  ?  664 HIS A CA  1 
ATOM   4730 C C   . HIS A 1 620 ? -34.269 39.801 -4.245  1.00 93.93  ?  664 HIS A C   1 
ATOM   4731 O O   . HIS A 1 620 ? -33.477 40.712 -4.029  1.00 94.90  ?  664 HIS A O   1 
ATOM   4732 C CB  . HIS A 1 620 ? -35.082 38.969 -1.990  1.00 93.46  ?  664 HIS A CB  1 
ATOM   4733 C CG  . HIS A 1 620 ? -34.477 37.604 -2.088  1.00 93.01  ?  664 HIS A CG  1 
ATOM   4734 N ND1 . HIS A 1 620 ? -33.111 37.395 -2.117  1.00 93.16  ?  664 HIS A ND1 1 
ATOM   4735 C CD2 . HIS A 1 620 ? -35.048 36.376 -2.148  1.00 92.71  ?  664 HIS A CD2 1 
ATOM   4736 C CE1 . HIS A 1 620 ? -32.869 36.099 -2.202  1.00 92.71  ?  664 HIS A CE1 1 
ATOM   4737 N NE2 . HIS A 1 620 ? -34.024 35.459 -2.222  1.00 92.59  ?  664 HIS A NE2 1 
ATOM   4738 N N   . ASP A 1 621 ? -34.158 38.977 -5.281  1.00 101.54 ?  665 ASP A N   1 
ATOM   4739 C CA  . ASP A 1 621 ? -33.161 39.234 -6.304  1.00 101.87 ?  665 ASP A CA  1 
ATOM   4740 C C   . ASP A 1 621 ? -33.540 40.508 -7.002  1.00 102.36 ?  665 ASP A C   1 
ATOM   4741 O O   . ASP A 1 621 ? -32.705 41.384 -7.203  1.00 103.22 ?  665 ASP A O   1 
ATOM   4742 C CB  . ASP A 1 621 ? -33.066 38.086 -7.306  1.00 101.64 ?  665 ASP A CB  1 
ATOM   4743 C CG  . ASP A 1 621 ? -32.302 36.903 -6.752  1.00 101.47 ?  665 ASP A CG  1 
ATOM   4744 O OD1 . ASP A 1 621 ? -31.053 37.005 -6.641  1.00 101.56 ?  665 ASP A OD1 1 
ATOM   4745 O OD2 . ASP A 1 621 ? -32.957 35.884 -6.421  1.00 101.42 ?  665 ASP A OD2 1 
ATOM   4746 N N   . LEU A 1 622 ? -34.818 40.621 -7.352  1.00 78.36  ?  666 LEU A N   1 
ATOM   4747 C CA  . LEU A 1 622 ? -35.290 41.834 -7.992  1.00 79.25  ?  666 LEU A CA  1 
ATOM   4748 C C   . LEU A 1 622 ? -35.278 43.018 -7.031  1.00 78.44  ?  666 LEU A C   1 
ATOM   4749 O O   . LEU A 1 622 ? -34.983 44.133 -7.438  1.00 79.22  ?  666 LEU A O   1 
ATOM   4750 C CB  . LEU A 1 622 ? -36.665 41.632 -8.619  1.00 80.26  ?  666 LEU A CB  1 
ATOM   4751 C CG  . LEU A 1 622 ? -37.326 42.900 -9.161  1.00 81.00  ?  666 LEU A CG  1 
ATOM   4752 C CD1 . LEU A 1 622 ? -36.563 43.463 -10.342 1.00 82.48  ?  666 LEU A CD1 1 
ATOM   4753 C CD2 . LEU A 1 622 ? -38.781 42.627 -9.521  1.00 81.81  ?  666 LEU A CD2 1 
ATOM   4754 N N   . GLU A 1 623 ? -35.588 42.789 -5.761  1.00 88.66  ?  667 GLU A N   1 
ATOM   4755 C CA  . GLU A 1 623 ? -35.457 43.867 -4.795  1.00 89.99  ?  667 GLU A CA  1 
ATOM   4756 C C   . GLU A 1 623 ? -34.035 44.387 -4.828  1.00 91.74  ?  667 GLU A C   1 
ATOM   4757 O O   . GLU A 1 623 ? -33.816 45.577 -4.995  1.00 93.51  ?  667 GLU A O   1 
ATOM   4758 C CB  . GLU A 1 623 ? -35.758 43.390 -3.382  1.00 89.62  ?  667 GLU A CB  1 
ATOM   4759 C CG  . GLU A 1 623 ? -37.181 42.946 -3.158  1.00 88.41  ?  667 GLU A CG  1 
ATOM   4760 C CD  . GLU A 1 623 ? -37.430 42.574 -1.712  1.00 88.31  ?  667 GLU A CD  1 
ATOM   4761 O OE1 . GLU A 1 623 ? -36.697 41.706 -1.176  1.00 88.14  ?  667 GLU A OE1 1 
ATOM   4762 O OE2 . GLU A 1 623 ? -38.338 43.172 -1.091  1.00 88.44  ?  667 GLU A OE2 1 
ATOM   4763 N N   . PHE A 1 624 ? -33.067 43.488 -4.685  1.00 104.65 ?  668 PHE A N   1 
ATOM   4764 C CA  . PHE A 1 624 ? -31.687 43.921 -4.574  1.00 106.46 ?  668 PHE A CA  1 
ATOM   4765 C C   . PHE A 1 624 ? -31.297 44.639 -5.840  1.00 107.39 ?  668 PHE A C   1 
ATOM   4766 O O   . PHE A 1 624 ? -30.707 45.716 -5.786  1.00 109.60 ?  668 PHE A O   1 
ATOM   4767 C CB  . PHE A 1 624 ? -30.740 42.752 -4.303  1.00 105.75 ?  668 PHE A CB  1 
ATOM   4768 C CG  . PHE A 1 624 ? -29.297 43.166 -4.165  1.00 107.68 ?  668 PHE A CG  1 
ATOM   4769 C CD1 . PHE A 1 624 ? -28.888 43.994 -3.124  1.00 109.65 ?  668 PHE A CD1 1 
ATOM   4770 C CD2 . PHE A 1 624 ? -28.343 42.726 -5.073  1.00 107.53 ?  668 PHE A CD2 1 
ATOM   4771 C CE1 . PHE A 1 624 ? -27.549 44.379 -2.994  1.00 111.47 ?  668 PHE A CE1 1 
ATOM   4772 C CE2 . PHE A 1 624 ? -27.004 43.100 -4.948  1.00 109.36 ?  668 PHE A CE2 1 
ATOM   4773 C CZ  . PHE A 1 624 ? -26.609 43.928 -3.909  1.00 111.35 ?  668 PHE A CZ  1 
ATOM   4774 N N   . CYS A 1 625 ? -31.683 44.063 -6.977  1.00 103.26 ?  669 CYS A N   1 
ATOM   4775 C CA  . CYS A 1 625 ? -31.268 44.577 -8.274  1.00 103.90 ?  669 CYS A CA  1 
ATOM   4776 C C   . CYS A 1 625 ? -31.686 46.026 -8.467  1.00 105.53 ?  669 CYS A C   1 
ATOM   4777 O O   . CYS A 1 625 ? -30.963 46.812 -9.074  1.00 107.28 ?  669 CYS A O   1 
ATOM   4778 C CB  . CYS A 1 625 ? -31.805 43.721 -9.413  1.00 102.00 ?  669 CYS A CB  1 
ATOM   4779 S SG  . CYS A 1 625 ? -31.203 44.317 -11.006 1.00 102.82 ?  669 CYS A SG  1 
ATOM   4780 N N   . LEU A 1 626 ? -32.848 46.384 -7.941  1.00 107.23 ?  670 LEU A N   1 
ATOM   4781 C CA  . LEU A 1 626 ? -33.244 47.777 -7.948  1.00 108.89 ?  670 LEU A CA  1 
ATOM   4782 C C   . LEU A 1 626 ? -32.400 48.541 -6.933  1.00 111.27 ?  670 LEU A C   1 
ATOM   4783 O O   . LEU A 1 626 ? -31.793 49.554 -7.260  1.00 113.25 ?  670 LEU A O   1 
ATOM   4784 C CB  . LEU A 1 626 ? -34.723 47.928 -7.604  1.00 107.59 ?  670 LEU A CB  1 
ATOM   4785 C CG  . LEU A 1 626 ? -35.763 47.022 -8.268  1.00 105.11 ?  670 LEU A CG  1 
ATOM   4786 C CD1 . LEU A 1 626 ? -37.134 47.416 -7.771  1.00 104.17 ?  670 LEU A CD1 1 
ATOM   4787 C CD2 . LEU A 1 626 ? -35.701 47.071 -9.779  1.00 105.12 ?  670 LEU A CD2 1 
ATOM   4788 N N   . TYR A 1 627 ? -32.348 48.033 -5.706  1.00 162.60 ?  671 TYR A N   1 
ATOM   4789 C CA  . TYR A 1 627 ? -31.819 48.792 -4.569  1.00 164.47 ?  671 TYR A CA  1 
ATOM   4790 C C   . TYR A 1 627 ? -30.376 48.531 -4.144  1.00 165.64 ?  671 TYR A C   1 
ATOM   4791 O O   . TYR A 1 627 ? -29.908 49.079 -3.142  1.00 166.94 ?  671 TYR A O   1 
ATOM   4792 C CB  . TYR A 1 627 ? -32.759 48.665 -3.382  1.00 163.63 ?  671 TYR A CB  1 
ATOM   4793 C CG  . TYR A 1 627 ? -34.181 48.978 -3.761  1.00 162.52 ?  671 TYR A CG  1 
ATOM   4794 C CD1 . TYR A 1 627 ? -34.642 50.283 -3.781  1.00 163.56 ?  671 TYR A CD1 1 
ATOM   4795 C CD2 . TYR A 1 627 ? -35.060 47.969 -4.120  1.00 160.30 ?  671 TYR A CD2 1 
ATOM   4796 C CE1 . TYR A 1 627 ? -35.940 50.570 -4.133  1.00 162.44 ?  671 TYR A CE1 1 
ATOM   4797 C CE2 . TYR A 1 627 ? -36.353 48.242 -4.478  1.00 159.32 ?  671 TYR A CE2 1 
ATOM   4798 C CZ  . TYR A 1 627 ? -36.792 49.545 -4.484  1.00 160.38 ?  671 TYR A CZ  1 
ATOM   4799 O OH  . TYR A 1 627 ? -38.090 49.830 -4.839  1.00 159.32 ?  671 TYR A OH  1 
ATOM   4800 N N   . GLY A 1 628 ? -29.670 47.701 -4.896  1.00 174.32 ?  672 GLY A N   1 
ATOM   4801 C CA  . GLY A 1 628 ? -28.274 47.450 -4.590  1.00 175.29 ?  672 GLY A CA  1 
ATOM   4802 C C   . GLY A 1 628 ? -27.369 48.631 -4.922  1.00 177.54 ?  672 GLY A C   1 
ATOM   4803 O O   . GLY A 1 628 ? -27.829 49.767 -5.095  1.00 178.43 ?  672 GLY A O   1 
ATOM   4804 N N   . ARG A 1 629 ? -26.072 48.349 -5.003  1.00 158.36 ?  673 ARG A N   1 
ATOM   4805 C CA  . ARG A 1 629 ? -25.061 49.340 -5.349  1.00 160.09 ?  673 ARG A CA  1 
ATOM   4806 C C   . ARG A 1 629 ? -24.022 48.847 -6.363  1.00 160.25 ?  673 ARG A C   1 
ATOM   4807 O O   . ARG A 1 629 ? -23.913 47.668 -6.683  1.00 159.05 ?  673 ARG A O   1 
ATOM   4808 C CB  . ARG A 1 629 ? -24.335 49.842 -4.112  1.00 160.71 ?  673 ARG A CB  1 
ATOM   4809 C CG  . ARG A 1 629 ? -23.578 48.728 -3.382  1.00 160.78 ?  673 ARG A CG  1 
ATOM   4810 C CD  . ARG A 1 629 ? -22.840 49.208 -2.136  1.00 158.36 ?  673 ARG A CD  1 
ATOM   4811 N NE  . ARG A 1 629 ? -21.769 50.144 -2.465  1.00 157.28 ?  673 ARG A NE  1 
ATOM   4812 C CZ  . ARG A 1 629 ? -21.018 50.801 -1.578  1.00 151.62 ?  673 ARG A CZ  1 
ATOM   4813 N NH1 . ARG A 1 629 ? -21.210 50.646 -0.270  1.00 146.53 ?  673 ARG A NH1 1 
ATOM   4814 N NH2 . ARG A 1 629 ? -20.082 51.638 -2.008  1.00 150.93 ?  673 ARG A NH2 1 
ATOM   4815 N N   . GLU A 1 630 ? -23.236 49.792 -6.838  1.00 167.21 ?  674 GLU A N   1 
ATOM   4816 C CA  . GLU A 1 630 ? -22.396 49.606 -8.000  1.00 167.74 ?  674 GLU A CA  1 
ATOM   4817 C C   . GLU A 1 630 ? -21.510 48.337 -7.989  1.00 167.12 ?  674 GLU A C   1 
ATOM   4818 O O   . GLU A 1 630 ? -21.487 47.588 -8.970  1.00 166.64 ?  674 GLU A O   1 
ATOM   4819 C CB  . GLU A 1 630 ? -21.570 50.868 -8.231  1.00 169.17 ?  674 GLU A CB  1 
ATOM   4820 C CG  . GLU A 1 630 ? -20.720 50.786 -9.467  1.00 171.51 ?  674 GLU A CG  1 
ATOM   4821 C CD  . GLU A 1 630 ? -20.048 52.095 -9.761  1.00 176.96 ?  674 GLU A CD  1 
ATOM   4822 O OE1 . GLU A 1 630 ? -20.031 52.991 -8.873  1.00 176.14 ?  674 GLU A OE1 1 
ATOM   4823 O OE2 . GLU A 1 630 ? -19.530 52.244 -10.885 1.00 182.15 ?  674 GLU A OE2 1 
ATOM   4824 N N   . GLU A 1 631 ? -20.814 48.101 -6.873  1.00 170.21 ?  675 GLU A N   1 
ATOM   4825 C CA  . GLU A 1 631 ? -19.885 46.969 -6.766  1.00 169.62 ?  675 GLU A CA  1 
ATOM   4826 C C   . GLU A 1 631 ? -20.600 45.656 -7.083  1.00 167.83 ?  675 GLU A C   1 
ATOM   4827 O O   . GLU A 1 631 ? -20.269 44.988 -8.064  1.00 167.28 ?  675 GLU A O   1 
ATOM   4828 C CB  . GLU A 1 631 ? -19.162 46.868 -5.397  1.00 169.14 ?  675 GLU A CB  1 
ATOM   4829 C CG  . GLU A 1 631 ? -18.064 45.746 -5.322  1.00 168.93 ?  675 GLU A CG  1 
ATOM   4830 C CD  . GLU A 1 631 ? -17.872 45.121 -3.914  1.00 162.96 ?  675 GLU A CD  1 
ATOM   4831 O OE1 . GLU A 1 631 ? -18.340 45.701 -2.917  1.00 159.29 ?  675 GLU A OE1 1 
ATOM   4832 O OE2 . GLU A 1 631 ? -17.260 44.030 -3.803  1.00 161.48 ?  675 GLU A OE2 1 
ATOM   4833 N N   . HIS A 1 632 ? -21.588 45.300 -6.257  1.00 127.34 ?  676 HIS A N   1 
ATOM   4834 C CA  . HIS A 1 632 ? -22.269 43.995 -6.337  1.00 124.98 ?  676 HIS A CA  1 
ATOM   4835 C C   . HIS A 1 632 ? -23.170 43.783 -7.559  1.00 123.68 ?  676 HIS A C   1 
ATOM   4836 O O   . HIS A 1 632 ? -23.242 42.664 -8.080  1.00 121.74 ?  676 HIS A O   1 
ATOM   4837 C CB  . HIS A 1 632 ? -23.066 43.681 -5.059  1.00 124.09 ?  676 HIS A CB  1 
ATOM   4838 C CG  . HIS A 1 632 ? -22.734 44.558 -3.894  1.00 125.63 ?  676 HIS A CG  1 
ATOM   4839 N ND1 . HIS A 1 632 ? -21.437 44.857 -3.527  1.00 126.60 ?  676 HIS A ND1 1 
ATOM   4840 C CD2 . HIS A 1 632 ? -23.531 45.196 -3.003  1.00 125.96 ?  676 HIS A CD2 1 
ATOM   4841 C CE1 . HIS A 1 632 ? -21.454 45.656 -2.477  1.00 127.07 ?  676 HIS A CE1 1 
ATOM   4842 N NE2 . HIS A 1 632 ? -22.712 45.866 -2.129  1.00 126.74 ?  676 HIS A NE2 1 
ATOM   4843 N N   . LEU A 1 633 ? -23.860 44.828 -8.012  1.00 158.65 ?  677 LEU A N   1 
ATOM   4844 C CA  . LEU A 1 633 ? -24.735 44.684 -9.168  1.00 157.31 ?  677 LEU A CA  1 
ATOM   4845 C C   . LEU A 1 633 ? -23.960 44.350 -10.430 1.00 157.17 ?  677 LEU A C   1 
ATOM   4846 O O   . LEU A 1 633 ? -24.435 43.596 -11.280 1.00 155.18 ?  677 LEU A O   1 
ATOM   4847 C CB  . LEU A 1 633 ? -25.589 45.942 -9.372  1.00 158.52 ?  677 LEU A CB  1 
ATOM   4848 C CG  . LEU A 1 633 ? -25.070 47.374 -9.608  1.00 161.24 ?  677 LEU A CG  1 
ATOM   4849 C CD1 . LEU A 1 633 ? -24.340 47.636 -10.984 1.00 162.25 ?  677 LEU A CD1 1 
ATOM   4850 C CD2 . LEU A 1 633 ? -26.354 48.201 -9.449  1.00 161.35 ?  677 LEU A CD2 1 
ATOM   4851 N N   . THR A 1 634 ? -22.762 44.910 -10.539 1.00 158.59 ?  678 THR A N   1 
ATOM   4852 C CA  . THR A 1 634 ? -21.858 44.545 -11.612 1.00 158.64 ?  678 THR A CA  1 
ATOM   4853 C C   . THR A 1 634 ? -21.122 43.290 -11.158 1.00 157.26 ?  678 THR A C   1 
ATOM   4854 O O   . THR A 1 634 ? -20.802 43.154 -9.980  1.00 157.62 ?  678 THR A O   1 
ATOM   4855 C CB  . THR A 1 634 ? -20.884 45.708 -11.973 1.00 161.67 ?  678 THR A CB  1 
ATOM   4856 O OG1 . THR A 1 634 ? -20.161 45.379 -13.165 1.00 161.72 ?  678 THR A OG1 1 
ATOM   4857 C CG2 . THR A 1 634 ? -19.893 46.010 -10.845 1.00 163.02 ?  678 THR A CG2 1 
ATOM   4858 N N   . THR A 1 635 ? -20.881 42.352 -12.066 1.00 130.86 ?  679 THR A N   1 
ATOM   4859 C CA  . THR A 1 635 ? -20.361 41.064 -11.630 1.00 129.18 ?  679 THR A CA  1 
ATOM   4860 C C   . THR A 1 635 ? -19.614 40.243 -12.670 1.00 128.47 ?  679 THR A C   1 
ATOM   4861 O O   . THR A 1 635 ? -19.744 40.474 -13.878 1.00 128.77 ?  679 THR A O   1 
ATOM   4862 C CB  . THR A 1 635 ? -21.481 40.172 -11.105 1.00 126.89 ?  679 THR A CB  1 
ATOM   4863 O OG1 . THR A 1 635 ? -20.939 38.879 -10.801 1.00 125.29 ?  679 THR A OG1 1 
ATOM   4864 C CG2 . THR A 1 635 ? -22.567 40.029 -12.151 1.00 125.94 ?  679 THR A CG2 1 
ATOM   4865 N N   . ASN A 1 636 ? -18.833 39.277 -12.174 1.00 142.32 ?  680 ASN A N   1 
ATOM   4866 C CA  . ASN A 1 636 ? -18.171 38.279 -13.012 1.00 141.59 ?  680 ASN A CA  1 
ATOM   4867 C C   . ASN A 1 636 ? -18.968 36.973 -13.100 1.00 139.40 ?  680 ASN A C   1 
ATOM   4868 O O   . ASN A 1 636 ? -18.551 36.040 -13.779 1.00 138.78 ?  680 ASN A O   1 
ATOM   4869 C CB  . ASN A 1 636 ? -16.741 38.002 -12.518 1.00 142.62 ?  680 ASN A CB  1 
ATOM   4870 C CG  . ASN A 1 636 ? -15.788 37.546 -13.650 1.00 148.65 ?  680 ASN A CG  1 
ATOM   4871 O OD1 . ASN A 1 636 ? -16.167 37.500 -14.820 1.00 153.68 ?  680 ASN A OD1 1 
ATOM   4872 N ND2 . ASN A 1 636 ? -14.545 37.226 -13.291 1.00 148.35 ?  680 ASN A ND2 1 
ATOM   4873 N N   . GLY A 1 637 ? -20.108 36.908 -12.407 1.00 105.86 ?  681 GLY A N   1 
ATOM   4874 C CA  . GLY A 1 637 ? -20.987 35.746 -12.465 1.00 104.58 ?  681 GLY A CA  1 
ATOM   4875 C C   . GLY A 1 637 ? -20.537 34.617 -11.559 1.00 103.98 ?  681 GLY A C   1 
ATOM   4876 O O   . GLY A 1 637 ? -21.275 33.664 -11.289 1.00 103.48 ?  681 GLY A O   1 
ATOM   4877 N N   . TYR A 1 638 ? -19.296 34.747 -11.100 1.00 90.57  ?  682 TYR A N   1 
ATOM   4878 C CA  . TYR A 1 638 ? -18.624 33.778 -10.259 1.00 88.41  ?  682 TYR A CA  1 
ATOM   4879 C C   . TYR A 1 638 ? -17.849 34.507 -9.187  1.00 86.58  ?  682 TYR A C   1 
ATOM   4880 O O   . TYR A 1 638 ? -17.167 35.502 -9.464  1.00 88.74  ?  682 TYR A O   1 
ATOM   4881 C CB  . TYR A 1 638 ? -17.593 33.013 -11.072 1.00 91.51  ?  682 TYR A CB  1 
ATOM   4882 C CG  . TYR A 1 638 ? -18.146 32.002 -12.028 1.00 93.71  ?  682 TYR A CG  1 
ATOM   4883 C CD1 . TYR A 1 638 ? -18.486 32.357 -13.321 1.00 97.70  ?  682 TYR A CD1 1 
ATOM   4884 C CD2 . TYR A 1 638 ? -18.302 30.684 -11.646 1.00 92.24  ?  682 TYR A CD2 1 
ATOM   4885 C CE1 . TYR A 1 638 ? -18.979 31.426 -14.198 1.00 100.25 ?  682 TYR A CE1 1 
ATOM   4886 C CE2 . TYR A 1 638 ? -18.797 29.747 -12.510 1.00 94.80  ?  682 TYR A CE2 1 
ATOM   4887 C CZ  . TYR A 1 638 ? -19.129 30.118 -13.788 1.00 98.88  ?  682 TYR A CZ  1 
ATOM   4888 O OH  . TYR A 1 638 ? -19.621 29.176 -14.657 1.00 101.96 ?  682 TYR A OH  1 
ATOM   4889 N N   . ARG A 1 639 ? -17.934 33.987 -7.970  1.00 83.66  ?  683 ARG A N   1 
ATOM   4890 C CA  . ARG A 1 639 ? -16.982 34.326 -6.911  1.00 83.22  ?  683 ARG A CA  1 
ATOM   4891 C C   . ARG A 1 639 ? -16.420 33.066 -6.251  1.00 81.51  ?  683 ARG A C   1 
ATOM   4892 O O   . ARG A 1 639 ? -17.120 32.068 -6.070  1.00 80.03  ?  683 ARG A O   1 
ATOM   4893 C CB  . ARG A 1 639 ? -17.637 35.206 -5.842  1.00 82.83  ?  683 ARG A CB  1 
ATOM   4894 C CG  . ARG A 1 639 ? -17.929 36.602 -6.310  1.00 84.72  ?  683 ARG A CG  1 
ATOM   4895 C CD  . ARG A 1 639 ? -18.399 37.475 -5.173  1.00 85.84  ?  683 ARG A CD  1 
ATOM   4896 N NE  . ARG A 1 639 ? -17.326 37.841 -4.248  1.00 87.11  ?  683 ARG A NE  1 
ATOM   4897 C CZ  . ARG A 1 639 ? -16.610 38.959 -4.350  1.00 89.70  ?  683 ARG A CZ  1 
ATOM   4898 N NH1 . ARG A 1 639 ? -16.833 39.824 -5.346  1.00 91.23  ?  683 ARG A NH1 1 
ATOM   4899 N NH2 . ARG A 1 639 ? -15.676 39.215 -3.448  1.00 90.78  ?  683 ARG A NH2 1 
ATOM   4900 N N   . LYS A 1 640 ? -15.155 33.127 -5.868  1.00 79.88  ?  684 LYS A N   1 
ATOM   4901 C CA  . LYS A 1 640 ? -14.571 32.069 -5.055  1.00 77.66  ?  684 LYS A CA  1 
ATOM   4902 C C   . LYS A 1 640 ? -15.382 31.873 -3.783  1.00 74.31  ?  684 LYS A C   1 
ATOM   4903 O O   . LYS A 1 640 ? -15.684 32.827 -3.082  1.00 74.42  ?  684 LYS A O   1 
ATOM   4904 C CB  . LYS A 1 640 ? -13.154 32.456 -4.661  1.00 78.45  ?  684 LYS A CB  1 
ATOM   4905 C CG  . LYS A 1 640 ? -12.200 31.305 -4.435  1.00 77.81  ?  684 LYS A CG  1 
ATOM   4906 C CD  . LYS A 1 640 ? -10.787 31.786 -4.752  1.00 80.64  ?  684 LYS A CD  1 
ATOM   4907 C CE  . LYS A 1 640 ? -9.884  30.657 -5.212  1.00 81.76  ?  684 LYS A CE  1 
ATOM   4908 N NZ  . LYS A 1 640 ? -8.601  30.630 -4.426  1.00 81.28  ?  684 LYS A NZ  1 
ATOM   4909 N N   . ILE A 1 641 ? -15.713 30.624 -3.497  1.00 72.37  ?  685 ILE A N   1 
ATOM   4910 C CA  . ILE A 1 641 ? -16.268 30.254 -2.216  1.00 69.35  ?  685 ILE A CA  1 
ATOM   4911 C C   . ILE A 1 641 ? -15.364 30.845 -1.150  1.00 68.24  ?  685 ILE A C   1 
ATOM   4912 O O   . ILE A 1 641 ? -14.138 30.754 -1.252  1.00 69.03  ?  685 ILE A O   1 
ATOM   4913 C CB  . ILE A 1 641 ? -16.343 28.718 -2.083  1.00 68.31  ?  685 ILE A CB  1 
ATOM   4914 C CG1 . ILE A 1 641 ? -17.435 28.155 -2.988  1.00 69.68  ?  685 ILE A CG1 1 
ATOM   4915 C CG2 . ILE A 1 641 ? -16.559 28.290 -0.642  1.00 65.48  ?  685 ILE A CG2 1 
ATOM   4916 C CD1 . ILE A 1 641 ? -17.352 26.661 -3.150  1.00 69.86  ?  685 ILE A CD1 1 
ATOM   4917 N N   . PRO A 1 642 ? -15.958 31.499 -0.147  1.00 66.98  ?  686 PRO A N   1 
ATOM   4918 C CA  . PRO A 1 642 ? -15.154 32.100 0.920   1.00 67.31  ?  686 PRO A CA  1 
ATOM   4919 C C   . PRO A 1 642 ? -14.383 31.033 1.681   1.00 65.41  ?  686 PRO A C   1 
ATOM   4920 O O   . PRO A 1 642 ? -14.946 29.989 1.978   1.00 63.50  ?  686 PRO A O   1 
ATOM   4921 C CB  . PRO A 1 642 ? -16.200 32.770 1.825   1.00 67.40  ?  686 PRO A CB  1 
ATOM   4922 C CG  . PRO A 1 642 ? -17.513 32.209 1.416   1.00 66.27  ?  686 PRO A CG  1 
ATOM   4923 C CD  . PRO A 1 642 ? -17.399 31.758 0.008   1.00 66.68  ?  686 PRO A CD  1 
ATOM   4924 N N   . GLY A 1 643 ? -13.107 31.285 1.962   1.00 70.59  ?  687 GLY A N   1 
ATOM   4925 C CA  . GLY A 1 643 ? -12.275 30.335 2.680   1.00 68.71  ?  687 GLY A CA  1 
ATOM   4926 C C   . GLY A 1 643 ? -11.679 29.275 1.772   1.00 67.99  ?  687 GLY A C   1 
ATOM   4927 O O   . GLY A 1 643 ? -10.913 28.410 2.230   1.00 66.40  ?  687 GLY A O   1 
ATOM   4928 N N   . ASP A 1 644 ? -12.040 29.341 0.490   1.00 67.59  ?  688 ASP A N   1 
ATOM   4929 C CA  . ASP A 1 644 ? -11.560 28.371 -0.479  1.00 67.86  ?  688 ASP A CA  1 
ATOM   4930 C C   . ASP A 1 644 ? -10.201 28.788 -1.038  1.00 69.65  ?  688 ASP A C   1 
ATOM   4931 O O   . ASP A 1 644 ? -10.033 29.852 -1.624  1.00 72.12  ?  688 ASP A O   1 
ATOM   4932 C CB  . ASP A 1 644 ? -12.578 28.127 -1.597  1.00 68.95  ?  688 ASP A CB  1 
ATOM   4933 C CG  . ASP A 1 644 ? -12.158 26.991 -2.527  1.00 70.24  ?  688 ASP A CG  1 
ATOM   4934 O OD1 . ASP A 1 644 ? -10.997 26.940 -2.971  1.00 72.00  ?  688 ASP A OD1 1 
ATOM   4935 O OD2 . ASP A 1 644 ? -12.993 26.117 -2.788  1.00 70.06  ?  688 ASP A OD2 1 
ATOM   4936 N N   . LYS A 1 645 ? -9.225  27.937 -0.802  1.00 80.94  ?  689 LYS A N   1 
ATOM   4937 C CA  . LYS A 1 645 ? -7.837  28.272 -1.027  1.00 81.17  ?  689 LYS A CA  1 
ATOM   4938 C C   . LYS A 1 645 ? -7.216  27.730 -2.324  1.00 82.31  ?  689 LYS A C   1 
ATOM   4939 O O   . LYS A 1 645 ? -5.993  27.735 -2.485  1.00 82.15  ?  689 LYS A O   1 
ATOM   4940 C CB  . LYS A 1 645 ? -7.022  27.923 0.208   1.00 78.39  ?  689 LYS A CB  1 
ATOM   4941 C CG  . LYS A 1 645 ? -7.306  28.807 1.413   1.00 77.77  ?  689 LYS A CG  1 
ATOM   4942 C CD  . LYS A 1 645 ? -6.236  28.552 2.482   1.00 77.14  ?  689 LYS A CD  1 
ATOM   4943 C CE  . LYS A 1 645 ? -6.568  29.179 3.840   1.00 76.86  ?  689 LYS A CE  1 
ATOM   4944 N NZ  . LYS A 1 645 ? -7.725  28.467 4.525   1.00 76.32  ?  689 LYS A NZ  1 
ATOM   4945 N N   . CYS A 1 646 ? -8.039  27.187 -3.209  1.00 76.41  ?  690 CYS A N   1 
ATOM   4946 C CA  . CYS A 1 646 ? -7.532  26.533 -4.422  1.00 78.66  ?  690 CYS A CA  1 
ATOM   4947 C C   . CYS A 1 646 ? -6.607  27.415 -5.278  1.00 83.00  ?  690 CYS A C   1 
ATOM   4948 O O   . CYS A 1 646 ? -6.750  28.629 -5.318  1.00 84.09  ?  690 CYS A O   1 
ATOM   4949 C CB  . CYS A 1 646 ? -8.695  25.990 -5.268  1.00 79.60  ?  690 CYS A CB  1 
ATOM   4950 S SG  . CYS A 1 646 ? -9.685  27.258 -6.061  1.00 81.69  ?  690 CYS A SG  1 
ATOM   4951 N N   . GLN A 1 647 ? -5.646  26.804 -5.949  1.00 99.60  ?  691 GLN A N   1 
ATOM   4952 C CA  . GLN A 1 647 ? -4.772  27.570 -6.832  1.00 100.97 ?  691 GLN A CA  1 
ATOM   4953 C C   . GLN A 1 647 ? -4.722  26.963 -8.215  1.00 102.25 ?  691 GLN A C   1 
ATOM   4954 O O   . GLN A 1 647 ? -4.814  25.746 -8.396  1.00 101.96 ?  691 GLN A O   1 
ATOM   4955 C CB  . GLN A 1 647 ? -3.354  27.677 -6.268  1.00 100.15 ?  691 GLN A CB  1 
ATOM   4956 C CG  . GLN A 1 647 ? -2.568  26.361 -6.331  1.00 101.47 ?  691 GLN A CG  1 
ATOM   4957 C CD  . GLN A 1 647 ? -1.067  26.528 -6.056  1.00 102.00 ?  691 GLN A CD  1 
ATOM   4958 O OE1 . GLN A 1 647 ? -0.661  27.411 -5.293  1.00 100.32 ?  691 GLN A OE1 1 
ATOM   4959 N NE2 . GLN A 1 647 ? -0.238  25.681 -6.684  1.00 105.01 ?  691 GLN A NE2 1 
ATOM   4960 N N   . GLY A 1 648 ? -4.584  27.835 -9.197  1.00 105.72 ?  692 GLY A N   1 
ATOM   4961 C CA  . GLY A 1 648 ? -4.395  27.395 -10.560 1.00 110.43 ?  692 GLY A CA  1 
ATOM   4962 C C   . GLY A 1 648 ? -5.644  26.759 -11.111 1.00 110.04 ?  692 GLY A C   1 
ATOM   4963 O O   . GLY A 1 648 ? -6.766  27.082 -10.675 1.00 106.77 ?  692 GLY A O   1 
ATOM   4964 N N   . GLY A 1 649 ? -5.454  25.851 -12.064 1.00 108.17 ?  693 GLY A N   1 
ATOM   4965 C CA  . GLY A 1 649 ? -6.564  25.291 -12.804 1.00 109.36 ?  693 GLY A CA  1 
ATOM   4966 C C   . GLY A 1 649 ? -7.428  26.404 -13.367 1.00 110.77 ?  693 GLY A C   1 
ATOM   4967 O O   . GLY A 1 649 ? -6.919  27.340 -13.983 1.00 114.62 ?  693 GLY A O   1 
ATOM   4968 N N   . VAL A 1 650 ? -8.730  26.313 -13.088 1.00 107.62 ?  694 VAL A N   1 
ATOM   4969 C CA  . VAL A 1 650 ? -9.766  27.190 -13.643 1.00 108.65 ?  694 VAL A CA  1 
ATOM   4970 C C   . VAL A 1 650 ? -10.014 28.509 -12.881 1.00 105.57 ?  694 VAL A C   1 
ATOM   4971 O O   . VAL A 1 650 ? -10.205 28.515 -11.674 1.00 100.63 ?  694 VAL A O   1 
ATOM   4972 C CB  . VAL A 1 650 ? -11.098 26.430 -13.714 1.00 107.09 ?  694 VAL A CB  1 
ATOM   4973 C CG1 . VAL A 1 650 ? -12.260 27.393 -13.902 1.00 106.45 ?  694 VAL A CG1 1 
ATOM   4974 C CG2 . VAL A 1 650 ? -11.044 25.378 -14.816 1.00 111.93 ?  694 VAL A CG2 1 
ATOM   4975 N N   . ASN A 1 651 ? -9.914  29.619 -13.603 1.00 130.95 ?  695 ASN A N   1 
ATOM   4976 C CA  . ASN A 1 651 ? -10.405 30.922 -13.185 1.00 129.28 ?  695 ASN A CA  1 
ATOM   4977 C C   . ASN A 1 651 ? -11.413 31.276 -14.276 1.00 132.01 ?  695 ASN A C   1 
ATOM   4978 O O   . ASN A 1 651 ? -10.990 31.316 -15.429 1.00 137.37 ?  695 ASN A O   1 
ATOM   4979 C CB  . ASN A 1 651 ? -9.252  31.918 -13.188 1.00 131.95 ?  695 ASN A CB  1 
ATOM   4980 C CG  . ASN A 1 651 ? -9.646  33.303 -12.691 1.00 130.79 ?  695 ASN A CG  1 
ATOM   4981 O OD1 . ASN A 1 651 ? -10.819 33.662 -12.634 1.00 129.26 ?  695 ASN A OD1 1 
ATOM   4982 N ND2 . ASN A 1 651 ? -8.624  34.102 -12.329 1.00 132.23 ?  695 ASN A ND2 1 
ATOM   4983 N N   . PRO A 1 652 ? -12.714 31.484 -13.972 1.00 141.19 ?  696 PRO A N   1 
ATOM   4984 C CA  . PRO A 1 652 ? -13.543 31.849 -15.129 1.00 144.49 ?  696 PRO A CA  1 
ATOM   4985 C C   . PRO A 1 652 ? -13.061 33.125 -15.819 1.00 148.54 ?  696 PRO A C   1 
ATOM   4986 O O   . PRO A 1 652 ? -12.836 34.119 -15.134 1.00 146.81 ?  696 PRO A O   1 
ATOM   4987 C CB  . PRO A 1 652 ? -14.924 32.104 -14.523 1.00 140.77 ?  696 PRO A CB  1 
ATOM   4988 C CG  . PRO A 1 652 ? -14.664 32.417 -13.111 1.00 139.24 ?  696 PRO A CG  1 
ATOM   4989 C CD  . PRO A 1 652 ? -13.448 31.618 -12.717 1.00 138.59 ?  696 PRO A CD  1 
ATOM   4990 N N   . VAL A 1 653 ? -12.874 33.079 -17.135 1.00 158.69 ?  697 VAL A N   1 
ATOM   4991 C CA  . VAL A 1 653 ? -12.486 34.263 -17.879 1.00 163.23 ?  697 VAL A CA  1 
ATOM   4992 C C   . VAL A 1 653 ? -13.670 34.818 -18.688 1.00 164.74 ?  697 VAL A C   1 
ATOM   4993 O O   . VAL A 1 653 ? -14.242 34.146 -19.556 1.00 167.21 ?  697 VAL A O   1 
ATOM   4994 C CB  . VAL A 1 653 ? -11.149 34.073 -18.709 1.00 169.54 ?  697 VAL A CB  1 
ATOM   4995 C CG1 . VAL A 1 653 ? -11.382 33.359 -20.036 1.00 174.83 ?  697 VAL A CG1 1 
ATOM   4996 C CG2 . VAL A 1 653 ? -10.424 35.402 -18.911 1.00 173.06 ?  697 VAL A CG2 1 
ATOM   4997 N N   . ARG A 1 654 ? -14.051 36.043 -18.334 1.00 177.74 ?  698 ARG A N   1 
ATOM   4998 C CA  . ARG A 1 654 ? -15.167 36.760 -18.934 1.00 178.53 ?  698 ARG A CA  1 
ATOM   4999 C C   . ARG A 1 654 ? -15.243 38.124 -18.282 1.00 176.64 ?  698 ARG A C   1 
ATOM   5000 O O   . ARG A 1 654 ? -14.781 38.327 -17.156 1.00 173.27 ?  698 ARG A O   1 
ATOM   5001 C CB  . ARG A 1 654 ? -16.482 36.028 -18.693 1.00 174.66 ?  698 ARG A CB  1 
ATOM   5002 C CG  . ARG A 1 654 ? -16.747 35.698 -17.238 1.00 168.19 ?  698 ARG A CG  1 
ATOM   5003 C CD  . ARG A 1 654 ? -18.156 35.188 -17.068 1.00 165.16 ?  698 ARG A CD  1 
ATOM   5004 N NE  . ARG A 1 654 ? -18.408 34.058 -17.952 1.00 168.08 ?  698 ARG A NE  1 
ATOM   5005 C CZ  . ARG A 1 654 ? -19.603 33.512 -18.145 1.00 167.27 ?  698 ARG A CZ  1 
ATOM   5006 N NH1 . ARG A 1 654 ? -20.665 33.997 -17.518 1.00 163.49 ?  698 ARG A NH1 1 
ATOM   5007 N NH2 . ARG A 1 654 ? -19.735 32.482 -18.967 1.00 170.67 ?  698 ARG A NH2 1 
ATOM   5008 N N   . GLU A 1 655 ? -15.884 39.052 -18.971 1.00 172.55 ?  699 GLU A N   1 
ATOM   5009 C CA  . GLU A 1 655 ? -15.846 40.425 -18.526 1.00 172.10 ?  699 GLU A CA  1 
ATOM   5010 C C   . GLU A 1 655 ? -16.960 40.722 -17.540 1.00 166.25 ?  699 GLU A C   1 
ATOM   5011 O O   . GLU A 1 655 ? -18.088 40.258 -17.700 1.00 164.18 ?  699 GLU A O   1 
ATOM   5012 C CB  . GLU A 1 655 ? -15.905 41.380 -19.716 1.00 177.74 ?  699 GLU A CB  1 
ATOM   5013 C CG  . GLU A 1 655 ? -15.407 42.771 -19.392 1.00 179.25 ?  699 GLU A CG  1 
ATOM   5014 C CD  . GLU A 1 655 ? -15.549 43.719 -20.556 1.00 184.85 ?  699 GLU A CD  1 
ATOM   5015 O OE1 . GLU A 1 655 ? -16.150 43.324 -21.576 1.00 187.09 ?  699 GLU A OE1 1 
ATOM   5016 O OE2 . GLU A 1 655 ? -15.057 44.860 -20.452 1.00 187.34 ?  699 GLU A OE2 1 
ATOM   5017 N N   . VAL A 1 656 ? -16.603 41.488 -16.513 1.00 147.12 ?  700 VAL A N   1 
ATOM   5018 C CA  . VAL A 1 656 ? -17.541 42.047 -15.559 1.00 144.32 ?  700 VAL A CA  1 
ATOM   5019 C C   . VAL A 1 656 ? -18.637 42.765 -16.352 1.00 144.66 ?  700 VAL A C   1 
ATOM   5020 O O   . VAL A 1 656 ? -18.350 43.515 -17.292 1.00 148.57 ?  700 VAL A O   1 
ATOM   5021 C CB  . VAL A 1 656 ? -16.807 43.001 -14.565 1.00 146.26 ?  700 VAL A CB  1 
ATOM   5022 C CG1 . VAL A 1 656 ? -16.202 44.194 -15.302 1.00 156.65 ?  700 VAL A CG1 1 
ATOM   5023 C CG2 . VAL A 1 656 ? -17.718 43.462 -13.444 1.00 144.08 ?  700 VAL A CG2 1 
ATOM   5024 N N   . LYS A 1 657 ? -19.892 42.489 -16.004 1.00 149.05 ?  701 LYS A N   1 
ATOM   5025 C CA  . LYS A 1 657 ? -21.028 43.065 -16.707 1.00 148.99 ?  701 LYS A CA  1 
ATOM   5026 C C   . LYS A 1 657 ? -21.705 44.021 -15.746 1.00 149.67 ?  701 LYS A C   1 
ATOM   5027 O O   . LYS A 1 657 ? -21.338 44.073 -14.583 1.00 150.12 ?  701 LYS A O   1 
ATOM   5028 C CB  . LYS A 1 657 ? -22.014 41.960 -17.099 1.00 146.80 ?  701 LYS A CB  1 
ATOM   5029 C CG  . LYS A 1 657 ? -21.396 40.847 -17.933 1.00 148.47 ?  701 LYS A CG  1 
ATOM   5030 C CD  . LYS A 1 657 ? -20.940 41.383 -19.289 1.00 154.54 ?  701 LYS A CD  1 
ATOM   5031 C CE  . LYS A 1 657 ? -20.467 40.272 -20.214 1.00 158.31 ?  701 LYS A CE  1 
ATOM   5032 N NZ  . LYS A 1 657 ? -19.996 40.809 -21.520 1.00 164.83 ?  701 LYS A NZ  1 
ATOM   5033 N N   . ASP A 1 658 ? -22.712 44.753 -16.211 1.00 139.05 ?  702 ASP A N   1 
ATOM   5034 C CA  . ASP A 1 658 ? -23.457 45.638 -15.320 1.00 139.69 ?  702 ASP A CA  1 
ATOM   5035 C C   . ASP A 1 658 ? -24.930 45.278 -15.355 1.00 137.58 ?  702 ASP A C   1 
ATOM   5036 O O   . ASP A 1 658 ? -25.586 45.381 -16.390 1.00 137.03 ?  702 ASP A O   1 
ATOM   5037 C CB  . ASP A 1 658 ? -23.251 47.111 -15.671 1.00 142.02 ?  702 ASP A CB  1 
ATOM   5038 C CG  . ASP A 1 658 ? -24.344 47.993 -15.111 1.00 142.61 ?  702 ASP A CG  1 
ATOM   5039 O OD1 . ASP A 1 658 ? -24.313 48.272 -13.895 1.00 142.94 ?  702 ASP A OD1 1 
ATOM   5040 O OD2 . ASP A 1 658 ? -25.236 48.402 -15.888 1.00 142.63 ?  702 ASP A OD2 1 
ATOM   5041 N N   . LEU A 1 659 ? -25.446 44.846 -14.214 1.00 112.65 ?  703 LEU A N   1 
ATOM   5042 C CA  . LEU A 1 659 ? -26.776 44.261 -14.194 1.00 110.41 ?  703 LEU A CA  1 
ATOM   5043 C C   . LEU A 1 659 ? -27.903 45.252 -13.922 1.00 110.70 ?  703 LEU A C   1 
ATOM   5044 O O   . LEU A 1 659 ? -29.063 44.900 -14.078 1.00 108.92 ?  703 LEU A O   1 
ATOM   5045 C CB  . LEU A 1 659 ? -26.833 43.077 -13.218 1.00 108.80 ?  703 LEU A CB  1 
ATOM   5046 C CG  . LEU A 1 659 ? -26.094 41.805 -13.654 1.00 107.68 ?  703 LEU A CG  1 
ATOM   5047 C CD1 . LEU A 1 659 ? -26.410 40.638 -12.730 1.00 106.23 ?  703 LEU A CD1 1 
ATOM   5048 C CD2 . LEU A 1 659 ? -26.442 41.451 -15.086 1.00 107.20 ?  703 LEU A CD2 1 
ATOM   5049 N N   . LYS A 1 660 ? -27.563 46.487 -13.552 1.00 145.50 ?  704 LYS A N   1 
ATOM   5050 C CA  . LYS A 1 660 ? -28.574 47.492 -13.206 1.00 146.04 ?  704 LYS A CA  1 
ATOM   5051 C C   . LYS A 1 660 ? -29.498 47.795 -14.384 1.00 145.03 ?  704 LYS A C   1 
ATOM   5052 O O   . LYS A 1 660 ? -30.683 48.079 -14.212 1.00 143.95 ?  704 LYS A O   1 
ATOM   5053 C CB  . LYS A 1 660 ? -27.916 48.785 -12.705 1.00 149.09 ?  704 LYS A CB  1 
ATOM   5054 C CG  . LYS A 1 660 ? -27.200 49.599 -13.780 1.00 151.02 ?  704 LYS A CG  1 
ATOM   5055 C CD  . LYS A 1 660 ? -26.793 50.976 -13.270 1.00 153.53 ?  704 LYS A CD  1 
ATOM   5056 C CE  . LYS A 1 660 ? -25.773 50.885 -12.138 1.00 154.33 ?  704 LYS A CE  1 
ATOM   5057 N NZ  . LYS A 1 660 ? -25.526 52.209 -11.494 1.00 155.61 ?  704 LYS A NZ  1 
ATOM   5058 N N   . LYS A 1 661 ? -28.934 47.718 -15.583 1.00 140.27 ?  705 LYS A N   1 
ATOM   5059 C CA  . LYS A 1 661 ? -29.664 47.981 -16.803 1.00 139.53 ?  705 LYS A CA  1 
ATOM   5060 C C   . LYS A 1 661 ? -30.708 46.897 -16.971 1.00 136.60 ?  705 LYS A C   1 
ATOM   5061 O O   . LYS A 1 661 ? -31.867 47.183 -17.257 1.00 135.15 ?  705 LYS A O   1 
ATOM   5062 C CB  . LYS A 1 661 ? -28.703 47.981 -17.991 1.00 140.63 ?  705 LYS A CB  1 
ATOM   5063 C CG  . LYS A 1 661 ? -29.280 48.579 -19.257 1.00 141.00 ?  705 LYS A CG  1 
ATOM   5064 C CD  . LYS A 1 661 ? -28.257 48.613 -20.384 1.00 143.66 ?  705 LYS A CD  1 
ATOM   5065 C CE  . LYS A 1 661 ? -27.956 47.216 -20.910 1.00 144.40 ?  705 LYS A CE  1 
ATOM   5066 N NZ  . LYS A 1 661 ? -29.204 46.554 -21.378 1.00 143.53 ?  705 LYS A NZ  1 
ATOM   5067 N N   . LYS A 1 662 ? -30.303 45.654 -16.750 1.00 133.04 ?  706 LYS A N   1 
ATOM   5068 C CA  . LYS A 1 662 ? -31.207 44.523 -16.916 1.00 130.99 ?  706 LYS A CA  1 
ATOM   5069 C C   . LYS A 1 662 ? -32.450 44.543 -16.007 1.00 129.86 ?  706 LYS A C   1 
ATOM   5070 O O   . LYS A 1 662 ? -33.536 44.160 -16.447 1.00 128.84 ?  706 LYS A O   1 
ATOM   5071 C CB  . LYS A 1 662 ? -30.463 43.203 -16.749 1.00 130.71 ?  706 LYS A CB  1 
ATOM   5072 C CG  . LYS A 1 662 ? -31.333 41.985 -17.006 1.00 129.64 ?  706 LYS A CG  1 
ATOM   5073 C CD  . LYS A 1 662 ? -30.668 40.728 -16.494 1.00 128.74 ?  706 LYS A CD  1 
ATOM   5074 C CE  . LYS A 1 662 ? -31.448 39.485 -16.883 1.00 128.28 ?  706 LYS A CE  1 
ATOM   5075 N NZ  . LYS A 1 662 ? -30.525 38.307 -16.976 1.00 128.70 ?  706 LYS A NZ  1 
ATOM   5076 N N   . CYS A 1 663 ? -32.310 44.966 -14.750 1.00 146.94 ?  707 CYS A N   1 
ATOM   5077 C CA  . CYS A 1 663 ? -33.493 45.084 -13.886 1.00 146.11 ?  707 CYS A CA  1 
ATOM   5078 C C   . CYS A 1 663 ? -34.381 46.244 -14.310 1.00 146.69 ?  707 CYS A C   1 
ATOM   5079 O O   . CYS A 1 663 ? -35.574 46.060 -14.533 1.00 145.80 ?  707 CYS A O   1 
ATOM   5080 C CB  . CYS A 1 663 ? -33.128 45.209 -12.403 1.00 146.68 ?  707 CYS A CB  1 
ATOM   5081 S SG  . CYS A 1 663 ? -31.561 46.027 -12.064 1.00 149.46 ?  707 CYS A SG  1 
ATOM   5082 N N   . THR A 1 664 ? -33.792 47.432 -14.441 1.00 91.79  ?  708 THR A N   1 
ATOM   5083 C CA  . THR A 1 664 ? -34.546 48.631 -14.825 1.00 92.61  ?  708 THR A CA  1 
ATOM   5084 C C   . THR A 1 664 ? -35.063 48.529 -16.245 1.00 95.01  ?  708 THR A C   1 
ATOM   5085 O O   . THR A 1 664 ? -35.923 49.294 -16.660 1.00 95.51  ?  708 THR A O   1 
ATOM   5086 C CB  . THR A 1 664 ? -33.685 49.902 -14.759 1.00 94.22  ?  708 THR A CB  1 
ATOM   5087 O OG1 . THR A 1 664 ? -32.501 49.706 -15.546 1.00 96.98  ?  708 THR A OG1 1 
ATOM   5088 C CG2 . THR A 1 664 ? -33.307 50.243 -13.328 1.00 92.32  ?  708 THR A CG2 1 
ATOM   5089 N N   . SER A 1 665 ? -34.501 47.578 -16.984 1.00 96.76  ?  709 SER A N   1 
ATOM   5090 C CA  . SER A 1 665 ? -34.868 47.320 -18.370 1.00 99.73  ?  709 SER A CA  1 
ATOM   5091 C C   . SER A 1 665 ? -36.405 47.271 -18.569 1.00 98.91  ?  709 SER A C   1 
ATOM   5092 O O   . SER A 1 665 ? -36.937 47.805 -19.539 1.00 101.01 ?  709 SER A O   1 
ATOM   5093 C CB  . SER A 1 665 ? -34.209 46.002 -18.786 1.00 101.16 ?  709 SER A CB  1 
ATOM   5094 O OG  . SER A 1 665 ? -34.877 45.403 -19.870 1.00 103.58 ?  709 SER A OG  1 
ATOM   5095 N N   . ASN A 1 666 ? -37.108 46.652 -17.626 1.00 96.09  ?  710 ASN A N   1 
ATOM   5096 C CA  . ASN A 1 666 ? -38.559 46.441 -17.741 1.00 95.57  ?  710 ASN A CA  1 
ATOM   5097 C C   . ASN A 1 666 ? -39.432 47.634 -17.386 1.00 94.30  ?  710 ASN A C   1 
ATOM   5098 O O   . ASN A 1 666 ? -40.542 47.758 -17.880 1.00 94.88  ?  710 ASN A O   1 
ATOM   5099 C CB  . ASN A 1 666 ? -38.972 45.252 -16.879 1.00 93.70  ?  710 ASN A CB  1 
ATOM   5100 C CG  . ASN A 1 666 ? -38.292 43.984 -17.312 1.00 95.24  ?  710 ASN A CG  1 
ATOM   5101 O OD1 . ASN A 1 666 ? -38.316 43.629 -18.498 1.00 98.30  ?  710 ASN A OD1 1 
ATOM   5102 N ND2 . ASN A 1 666 ? -37.651 43.308 -16.372 1.00 93.45  ?  710 ASN A ND2 1 
ATOM   5103 N N   . PHE A 1 667 ? -38.912 48.469 -16.494 1.00 92.78  ?  711 PHE A N   1 
ATOM   5104 C CA  . PHE A 1 667 ? -39.556 49.678 -16.013 1.00 91.78  ?  711 PHE A CA  1 
ATOM   5105 C C   . PHE A 1 667 ? -39.507 50.780 -17.065 1.00 94.12  ?  711 PHE A C   1 
ATOM   5106 O O   . PHE A 1 667 ? -38.521 50.904 -17.782 1.00 96.35  ?  711 PHE A O   1 
ATOM   5107 C CB  . PHE A 1 667 ? -38.848 50.164 -14.743 1.00 90.16  ?  711 PHE A CB  1 
ATOM   5108 C CG  . PHE A 1 667 ? -38.865 49.173 -13.622 1.00 87.99  ?  711 PHE A CG  1 
ATOM   5109 C CD1 . PHE A 1 667 ? -37.973 48.120 -13.586 1.00 87.94  ?  711 PHE A CD1 1 
ATOM   5110 C CD2 . PHE A 1 667 ? -39.767 49.303 -12.588 1.00 86.26  ?  711 PHE A CD2 1 
ATOM   5111 C CE1 . PHE A 1 667 ? -38.002 47.203 -12.534 1.00 86.04  ?  711 PHE A CE1 1 
ATOM   5112 C CE2 . PHE A 1 667 ? -39.804 48.399 -11.531 1.00 84.65  ?  711 PHE A CE2 1 
ATOM   5113 C CZ  . PHE A 1 667 ? -38.941 47.347 -11.502 1.00 84.45  ?  711 PHE A CZ  1 
ATOM   5114 N N   . LEU A 1 668 ? -40.590 51.552 -17.164 1.00 93.84  ?  712 LEU A N   1 
ATOM   5115 C CA  . LEU A 1 668 ? -40.580 52.827 -17.856 1.00 95.66  ?  712 LEU A CA  1 
ATOM   5116 C C   . LEU A 1 668 ? -39.901 53.828 -16.943 1.00 95.14  ?  712 LEU A C   1 
ATOM   5117 O O   . LEU A 1 668 ? -40.256 53.938 -15.785 1.00 93.02  ?  712 LEU A O   1 
ATOM   5118 C CB  . LEU A 1 668 ? -42.009 53.300 -18.140 1.00 95.30  ?  712 LEU A CB  1 
ATOM   5119 C CG  . LEU A 1 668 ? -42.110 54.644 -18.859 1.00 97.15  ?  712 LEU A CG  1 
ATOM   5120 C CD1 . LEU A 1 668 ? -41.520 54.529 -20.250 1.00 100.43 ?  712 LEU A CD1 1 
ATOM   5121 C CD2 . LEU A 1 668 ? -43.537 55.141 -18.934 1.00 96.36  ?  712 LEU A CD2 1 
ATOM   5122 N N   . SER A 1 669 ? -38.944 54.581 -17.462 1.00 103.43 ?  713 SER A N   1 
ATOM   5123 C CA  . SER A 1 669 ? -38.175 55.490 -16.626 1.00 105.72 ?  713 SER A CA  1 
ATOM   5124 C C   . SER A 1 669 ? -38.449 56.944 -16.986 1.00 107.24 ?  713 SER A C   1 
ATOM   5125 O O   . SER A 1 669 ? -38.763 57.248 -18.127 1.00 107.93 ?  713 SER A O   1 
ATOM   5126 C CB  . SER A 1 669 ? -36.687 55.206 -16.810 1.00 107.23 ?  713 SER A CB  1 
ATOM   5127 O OG  . SER A 1 669 ? -36.395 53.823 -16.637 1.00 105.38 ?  713 SER A OG  1 
ATOM   5128 N N   . PRO A 1 670 ? -38.315 57.854 -16.011 1.00 99.42  ?  714 PRO A N   1 
ATOM   5129 C CA  . PRO A 1 670 ? -38.440 59.296 -16.252 1.00 101.61 ?  714 PRO A CA  1 
ATOM   5130 C C   . PRO A 1 670 ? -37.232 59.866 -17.001 1.00 105.49 ?  714 PRO A C   1 
ATOM   5131 O O   . PRO A 1 670 ? -36.198 59.197 -17.126 1.00 106.36 ?  714 PRO A O   1 
ATOM   5132 C CB  . PRO A 1 670 ? -38.520 59.879 -14.846 1.00 100.53 ?  714 PRO A CB  1 
ATOM   5133 C CG  . PRO A 1 670 ? -37.770 58.907 -14.005 1.00 99.03  ?  714 PRO A CG  1 
ATOM   5134 C CD  . PRO A 1 670 ? -38.033 57.552 -14.598 1.00 97.41  ?  714 PRO A CD  1 
ATOM   5135 N N   . GLU A 1 671 ? -37.369 61.086 -17.508 1.00 137.15 ?  715 GLU A N   1 
ATOM   5136 C CA  . GLU A 1 671 ? -36.326 61.696 -18.330 1.00 139.22 ?  715 GLU A CA  1 
ATOM   5137 C C   . GLU A 1 671 ? -35.120 62.225 -17.544 1.00 140.62 ?  715 GLU A C   1 
ATOM   5138 O O   . GLU A 1 671 ? -34.087 62.577 -18.122 1.00 142.50 ?  715 GLU A O   1 
ATOM   5139 C CB  . GLU A 1 671 ? -36.928 62.797 -19.216 1.00 139.38 ?  715 GLU A CB  1 
ATOM   5140 C CG  . GLU A 1 671 ? -37.910 63.752 -18.520 1.00 138.69 ?  715 GLU A CG  1 
ATOM   5141 C CD  . GLU A 1 671 ? -38.383 64.879 -19.455 1.00 140.65 ?  715 GLU A CD  1 
ATOM   5142 O OE1 . GLU A 1 671 ? -38.195 64.764 -20.685 1.00 141.67 ?  715 GLU A OE1 1 
ATOM   5143 O OE2 . GLU A 1 671 ? -38.934 65.895 -18.976 1.00 141.56 ?  715 GLU A OE2 1 
HETATM 5144 C C1  . NAG B 2 .   ? -16.396 26.356 13.240  1.00 51.59  ?  801 NAG A C1  1 
HETATM 5145 C C2  . NAG B 2 .   ? -16.149 27.803 12.856  1.00 51.59  ?  801 NAG A C2  1 
HETATM 5146 C C3  . NAG B 2 .   ? -14.695 27.977 12.410  1.00 51.59  ?  801 NAG A C3  1 
HETATM 5147 C C4  . NAG B 2 .   ? -13.758 27.509 13.516  1.00 51.59  ?  801 NAG A C4  1 
HETATM 5148 C C5  . NAG B 2 .   ? -14.105 26.059 13.847  1.00 51.59  ?  801 NAG A C5  1 
HETATM 5149 C C6  . NAG B 2 .   ? -13.237 25.479 14.940  1.00 51.59  ?  801 NAG A C6  1 
HETATM 5150 C C7  . NAG B 2 .   ? -17.675 29.413 11.827  1.00 51.59  ?  801 NAG A C7  1 
HETATM 5151 C C8  . NAG B 2 .   ? -18.522 29.733 10.640  1.00 51.59  ?  801 NAG A C8  1 
HETATM 5152 N N2  . NAG B 2 .   ? -17.056 28.230 11.798  1.00 51.59  ?  801 NAG A N2  1 
HETATM 5153 O O3  . NAG B 2 .   ? -14.443 29.326 12.033  1.00 51.59  ?  801 NAG A O3  1 
HETATM 5154 O O4  . NAG B 2 .   ? -12.390 27.581 13.114  1.00 51.59  ?  801 NAG A O4  1 
HETATM 5155 O O5  . NAG B 2 .   ? -15.476 25.974 14.282  1.00 51.59  ?  801 NAG A O5  1 
HETATM 5156 O O6  . NAG B 2 .   ? -13.321 26.295 16.095  1.00 51.59  ?  801 NAG A O6  1 
HETATM 5157 O O7  . NAG B 2 .   ? -17.564 30.192 12.788  1.00 51.59  ?  801 NAG A O7  1 
HETATM 5158 C C1  . NAG C 2 .   ? -11.633 28.556 13.853  1.00 84.45  ?  802 NAG A C1  1 
HETATM 5159 C C2  . NAG C 2 .   ? -10.155 28.253 13.655  1.00 84.45  ?  802 NAG A C2  1 
HETATM 5160 C C3  . NAG C 2 .   ? -9.300  29.303 14.360  1.00 84.45  ?  802 NAG A C3  1 
HETATM 5161 C C4  . NAG C 2 .   ? -9.779  30.721 14.081  1.00 84.45  ?  802 NAG A C4  1 
HETATM 5162 C C5  . NAG C 2 .   ? -11.297 30.831 14.165  1.00 84.45  ?  802 NAG A C5  1 
HETATM 5163 C C6  . NAG C 2 .   ? -11.807 32.148 13.635  1.00 84.45  ?  802 NAG A C6  1 
HETATM 5164 C C7  . NAG C 2 .   ? -9.360  25.949 13.366  1.00 84.45  ?  802 NAG A C7  1 
HETATM 5165 C C8  . NAG C 2 .   ? -9.075  24.649 14.055  1.00 84.45  ?  802 NAG A C8  1 
HETATM 5166 N N2  . NAG C 2 .   ? -9.826  26.935 14.145  1.00 84.45  ?  802 NAG A N2  1 
HETATM 5167 O O3  . NAG C 2 .   ? -7.965  29.132 13.898  1.00 84.45  ?  802 NAG A O3  1 
HETATM 5168 O O4  . NAG C 2 .   ? -9.305  31.620 15.081  1.00 84.45  ?  802 NAG A O4  1 
HETATM 5169 O O5  . NAG C 2 .   ? -11.913 29.808 13.378  1.00 84.45  ?  802 NAG A O5  1 
HETATM 5170 O O6  . NAG C 2 .   ? -11.807 32.166 12.212  1.00 84.45  ?  802 NAG A O6  1 
HETATM 5171 O O7  . NAG C 2 .   ? -9.191  26.105 12.162  1.00 84.45  ?  802 NAG A O7  1 
HETATM 5172 C C1  . BMA D 3 .   ? -7.909  31.987 15.139  1.00 139.18 ?  803 BMA A C1  1 
HETATM 5173 C C2  . BMA D 3 .   ? -7.230  32.106 13.760  1.00 139.18 ?  803 BMA A C2  1 
HETATM 5174 C C3  . BMA D 3 .   ? -5.775  32.460 13.986  1.00 139.18 ?  803 BMA A C3  1 
HETATM 5175 C C4  . BMA D 3 .   ? -5.690  33.762 14.802  1.00 139.18 ?  803 BMA A C4  1 
HETATM 5176 C C5  . BMA D 3 .   ? -6.426  33.552 16.172  1.00 139.18 ?  803 BMA A C5  1 
HETATM 5177 C C6  . BMA D 3 .   ? -6.472  34.767 17.093  1.00 139.18 ?  803 BMA A C6  1 
HETATM 5178 O O2  . BMA D 3 .   ? -7.789  33.176 13.025  1.00 139.18 ?  803 BMA A O2  1 
HETATM 5179 O O3  . BMA D 3 .   ? -5.051  32.563 12.769  1.00 139.18 ?  803 BMA A O3  1 
HETATM 5180 O O4  . BMA D 3 .   ? -4.334  34.129 15.004  1.00 139.18 ?  803 BMA A O4  1 
HETATM 5181 O O5  . BMA D 3 .   ? -7.773  33.182 15.900  1.00 139.18 ?  803 BMA A O5  1 
HETATM 5182 O O6  . BMA D 3 .   ? -5.529  35.732 16.632  1.00 139.18 ?  803 BMA A O6  1 
HETATM 5183 C C1  . MAN E 4 .   ? -6.182  36.969 16.262  1.00 142.15 ?  804 MAN A C1  1 
HETATM 5184 C C2  . MAN E 4 .   ? -7.217  37.391 17.327  1.00 142.15 ?  804 MAN A C2  1 
HETATM 5185 C C3  . MAN E 4 .   ? -7.820  38.765 16.959  1.00 142.15 ?  804 MAN A C3  1 
HETATM 5186 C C4  . MAN E 4 .   ? -8.275  38.848 15.456  1.00 142.15 ?  804 MAN A C4  1 
HETATM 5187 C C5  . MAN E 4 .   ? -7.226  38.238 14.460  1.00 142.15 ?  804 MAN A C5  1 
HETATM 5188 C C6  . MAN E 4 .   ? -6.050  39.172 14.165  1.00 142.15 ?  804 MAN A C6  1 
HETATM 5189 O O2  . MAN E 4 .   ? -6.615  37.537 18.632  1.00 142.15 ?  804 MAN A O2  1 
HETATM 5190 O O3  . MAN E 4 .   ? -6.953  39.865 17.301  1.00 142.15 ?  804 MAN A O3  1 
HETATM 5191 O O4  . MAN E 4 .   ? -9.550  38.227 15.288  1.00 142.15 ?  804 MAN A O4  1 
HETATM 5192 O O5  . MAN E 4 .   ? -6.707  36.960 14.945  1.00 142.15 ?  804 MAN A O5  1 
HETATM 5193 O O6  . MAN E 4 .   ? -5.622  38.956 12.828  1.00 142.15 ?  804 MAN A O6  1 
HETATM 5194 C C1  . NAG F 2 .   ? -4.102  18.831 37.194  1.00 83.95  ?  805 NAG A C1  1 
HETATM 5195 C C2  . NAG F 2 .   ? -3.329  19.650 36.138  1.00 83.95  ?  805 NAG A C2  1 
HETATM 5196 C C3  . NAG F 2 .   ? -2.034  20.236 36.717  1.00 83.95  ?  805 NAG A C3  1 
HETATM 5197 C C4  . NAG F 2 .   ? -2.267  20.940 38.054  1.00 83.95  ?  805 NAG A C4  1 
HETATM 5198 C C5  . NAG F 2 .   ? -3.059  20.038 38.990  1.00 83.95  ?  805 NAG A C5  1 
HETATM 5199 C C6  . NAG F 2 .   ? -3.428  20.745 40.274  1.00 83.95  ?  805 NAG A C6  1 
HETATM 5200 C C7  . NAG F 2 .   ? -3.202  19.279 33.708  1.00 83.95  ?  805 NAG A C7  1 
HETATM 5201 C C8  . NAG F 2 .   ? -2.763  18.357 32.615  1.00 83.95  ?  805 NAG A C8  1 
HETATM 5202 N N2  . NAG F 2 .   ? -3.013  18.843 34.960  1.00 83.95  ?  805 NAG A N2  1 
HETATM 5203 O O3  . NAG F 2 .   ? -1.510  21.135 35.743  1.00 83.95  ?  805 NAG A O3  1 
HETATM 5204 O O4  . NAG F 2 .   ? -1.041  21.220 38.735  1.00 83.95  ?  805 NAG A O4  1 
HETATM 5205 O O5  . NAG F 2 .   ? -4.284  19.624 38.366  1.00 83.95  ?  805 NAG A O5  1 
HETATM 5206 O O6  . NAG F 2 .   ? -4.004  19.845 41.211  1.00 83.95  ?  805 NAG A O6  1 
HETATM 5207 O O7  . NAG F 2 .   ? -3.716  20.364 33.468  1.00 83.95  ?  805 NAG A O7  1 
HETATM 5208 C C1  . NAG G 2 .   ? -0.172  22.272 38.221  1.00 103.02 ?  806 NAG A C1  1 
HETATM 5209 C C2  . NAG G 2 .   ? 0.548   23.079 39.300  1.00 103.02 ?  806 NAG A C2  1 
HETATM 5210 C C3  . NAG G 2 .   ? 1.323   24.230 38.644  1.00 103.02 ?  806 NAG A C3  1 
HETATM 5211 C C4  . NAG G 2 .   ? 2.230   23.712 37.533  1.00 103.02 ?  806 NAG A C4  1 
HETATM 5212 C C5  . NAG G 2 .   ? 1.464   22.778 36.587  1.00 103.02 ?  806 NAG A C5  1 
HETATM 5213 C C6  . NAG G 2 .   ? 2.362   22.062 35.606  1.00 103.02 ?  806 NAG A C6  1 
HETATM 5214 C C7  . NAG G 2 .   ? -0.682  22.905 41.421  1.00 103.02 ?  806 NAG A C7  1 
HETATM 5215 C C8  . NAG G 2 .   ? -1.646  23.583 42.347  1.00 103.02 ?  806 NAG A C8  1 
HETATM 5216 N N2  . NAG G 2 .   ? -0.368  23.579 40.305  1.00 103.02 ?  806 NAG A N2  1 
HETATM 5217 O O3  . NAG G 2 .   ? 2.095   24.933 39.612  1.00 103.02 ?  806 NAG A O3  1 
HETATM 5218 O O4  . NAG G 2 .   ? 2.709   24.794 36.736  1.00 103.02 ?  806 NAG A O4  1 
HETATM 5219 O O5  . NAG G 2 .   ? 0.762   21.756 37.316  1.00 103.02 ?  806 NAG A O5  1 
HETATM 5220 O O6  . NAG G 2 .   ? 2.182   20.655 35.688  1.00 103.02 ?  806 NAG A O6  1 
HETATM 5221 O O7  . NAG G 2 .   ? -0.210  21.796 41.667  1.00 103.02 ?  806 NAG A O7  1 
HETATM 5222 C C1  . BMA H 3 .   ? 3.897   25.547 37.099  1.00 170.37 ?  807 BMA A C1  1 
HETATM 5223 C C2  . BMA H 3 .   ? 5.101   24.697 37.610  1.00 170.37 ?  807 BMA A C2  1 
HETATM 5224 C C3  . BMA H 3 .   ? 6.461   25.380 37.254  1.00 170.37 ?  807 BMA A C3  1 
HETATM 5225 C C4  . BMA H 3 .   ? 6.403   26.941 37.077  1.00 170.37 ?  807 BMA A C4  1 
HETATM 5226 C C5  . BMA H 3 .   ? 5.182   27.432 36.245  1.00 170.37 ?  807 BMA A C5  1 
HETATM 5227 C C6  . BMA H 3 .   ? 5.575   28.087 34.904  1.00 170.37 ?  807 BMA A C6  1 
HETATM 5228 O O2  . BMA H 3 .   ? 5.161   23.395 37.018  1.00 170.37 ?  807 BMA A O2  1 
HETATM 5229 O O3  . BMA H 3 .   ? 7.100   24.771 36.122  1.00 170.37 ?  807 BMA A O3  1 
HETATM 5230 O O4  . BMA H 3 .   ? 6.411   27.585 38.347  1.00 170.37 ?  807 BMA A O4  1 
HETATM 5231 O O5  . BMA H 3 .   ? 4.273   26.345 35.980  1.00 170.37 ?  807 BMA A O5  1 
HETATM 5232 O O6  . BMA H 3 .   ? 6.833   27.563 34.459  1.00 170.37 ?  807 BMA A O6  1 
HETATM 5233 O O1  . PG4 I 5 .   ? -26.730 22.103 40.312  1.00 104.88 ?  808 PG4 A O1  1 
HETATM 5234 C C1  . PG4 I 5 .   ? -26.202 22.512 39.075  1.00 104.88 ?  808 PG4 A C1  1 
HETATM 5235 C C2  . PG4 I 5 .   ? -24.808 23.141 39.078  1.00 104.88 ?  808 PG4 A C2  1 
HETATM 5236 O O2  . PG4 I 5 .   ? -24.161 23.264 40.320  1.00 104.88 ?  808 PG4 A O2  1 
HETATM 5237 C C3  . PG4 I 5 .   ? -23.318 22.245 40.789  1.00 104.88 ?  808 PG4 A C3  1 
HETATM 5238 C C4  . PG4 I 5 .   ? -22.412 21.576 39.760  1.00 104.88 ?  808 PG4 A C4  1 
HETATM 5239 O O3  . PG4 I 5 .   ? -21.482 22.388 39.095  1.00 104.88 ?  808 PG4 A O3  1 
HETATM 5240 C C5  . PG4 I 5 .   ? -20.978 22.002 37.846  1.00 104.88 ?  808 PG4 A C5  1 
HETATM 5241 C C6  . PG4 I 5 .   ? -21.755 22.426 36.602  1.00 104.88 ?  808 PG4 A C6  1 
HETATM 5242 O O4  . PG4 I 5 .   ? -22.007 21.440 35.642  1.00 104.88 ?  808 PG4 A O4  1 
HETATM 5243 C C7  . PG4 I 5 .   ? -22.979 21.638 34.652  1.00 104.88 ?  808 PG4 A C7  1 
HETATM 5244 C C8  . PG4 I 5 .   ? -23.141 23.034 34.049  1.00 104.88 ?  808 PG4 A C8  1 
HETATM 5245 O O5  . PG4 I 5 .   ? -24.333 23.730 34.310  1.00 104.88 ?  808 PG4 A O5  1 
HETATM 5246 C C10 . 2ET J 6 .   ? -32.919 38.564 15.849  1.00 63.34  ?  809 2ET A C10 1 
HETATM 5247 C C15 . 2ET J 6 .   ? -32.450 34.586 17.584  1.00 63.34  ?  809 2ET A C15 1 
HETATM 5248 C C17 . 2ET J 6 .   ? -33.886 36.390 16.800  1.00 63.34  ?  809 2ET A C17 1 
HETATM 5249 C C21 . 2ET J 6 .   ? -36.243 34.888 17.502  1.00 63.34  ?  809 2ET A C21 1 
HETATM 5250 C C22 . 2ET J 6 .   ? -34.962 34.321 17.706  1.00 63.34  ?  809 2ET A C22 1 
HETATM 5251 O O01 . 2ET J 6 .   ? -34.389 39.379 13.431  1.00 63.34  ?  809 2ET A O01 1 
HETATM 5252 C C02 . 2ET J 6 .   ? -33.645 40.383 13.601  1.00 63.34  ?  809 2ET A C02 1 
HETATM 5253 O O03 . 2ET J 6 .   ? -34.023 41.521 13.210  1.00 63.34  -1 809 2ET A O03 1 
HETATM 5254 C C04 . 2ET J 6 .   ? -32.338 40.228 14.251  1.00 63.34  ?  809 2ET A C04 1 
HETATM 5255 C C05 . 2ET J 6 .   ? -31.246 40.604 13.269  1.00 63.34  ?  809 2ET A C05 1 
HETATM 5256 C C06 . 2ET J 6 .   ? -29.887 41.040 13.851  1.00 63.34  ?  809 2ET A C06 1 
HETATM 5257 C C07 . 2ET J 6 .   ? -28.712 40.744 12.972  1.00 63.34  ?  809 2ET A C07 1 
HETATM 5258 C C08 . 2ET J 6 .   ? -29.691 40.629 15.251  1.00 63.34  ?  809 2ET A C08 1 
HETATM 5259 N N09 . 2ET J 6 .   ? -32.174 38.857 14.663  1.00 63.34  ?  809 2ET A N09 1 
HETATM 5260 C C11 . 2ET J 6 .   ? -32.752 37.147 16.467  1.00 63.34  ?  809 2ET A C11 1 
HETATM 5261 C C12 . 2ET J 6 .   ? -31.468 36.627 16.691  1.00 63.34  ?  809 2ET A C12 1 
HETATM 5262 O O13 . 2ET J 6 .   ? -30.366 37.357 16.369  1.00 63.34  ?  809 2ET A O13 1 
HETATM 5263 C C14 . 2ET J 6 .   ? -31.322 35.344 17.250  1.00 63.34  ?  809 2ET A C14 1 
HETATM 5264 C C16 . 2ET J 6 .   ? -33.746 35.101 17.362  1.00 63.34  ?  809 2ET A C16 1 
HETATM 5265 O O18 . 2ET J 6 .   ? -35.217 36.953 16.558  1.00 63.34  ?  809 2ET A O18 1 
HETATM 5266 C C19 . 2ET J 6 .   ? -36.372 36.243 16.952  1.00 63.34  ?  809 2ET A C19 1 
HETATM 5267 O O20 . 2ET J 6 .   ? -37.466 36.751 16.837  1.00 63.34  ?  809 2ET A O20 1 
HETATM 5268 C C23 . 2ET J 6 .   ? -34.885 32.925 18.273  1.00 63.34  ?  809 2ET A C23 1 
HETATM 5269 O O   . HOH K 7 .   ? -15.855 46.055 14.951  1.00 85.67  ?  901 HOH A O   1 
HETATM 5270 O O   . HOH K 7 .   ? -30.048 16.579 14.814  1.00 58.77  ?  902 HOH A O   1 
HETATM 5271 O O   . HOH K 7 .   ? -32.122 17.528 18.883  1.00 44.96  ?  903 HOH A O   1 
HETATM 5272 O O   . HOH K 7 .   ? -28.475 1.523  17.570  1.00 67.57  ?  904 HOH A O   1 
HETATM 5273 O O   . HOH K 7 .   ? -12.133 18.907 29.038  1.00 66.15  ?  905 HOH A O   1 
HETATM 5274 O O   . HOH K 7 .   ? -6.863  27.098 34.684  1.00 62.67  ?  906 HOH A O   1 
HETATM 5275 O O   . HOH K 7 .   ? -3.275  2.367  16.843  1.00 75.88  ?  907 HOH A O   1 
HETATM 5276 O O   . HOH K 7 .   ? -16.861 31.908 14.649  1.00 54.36  ?  908 HOH A O   1 
HETATM 5277 O O   . HOH K 7 .   ? -6.538  42.502 29.272  1.00 67.68  ?  909 HOH A O   1 
HETATM 5278 O O   . HOH K 7 .   ? -14.800 30.938 13.725  1.00 51.62  ?  910 HOH A O   1 
HETATM 5279 O O   . HOH K 7 .   ? -19.646 31.718 14.788  1.00 55.65  ?  911 HOH A O   1 
HETATM 5280 O O   . HOH K 7 .   ? -18.952 28.063 15.123  1.00 56.71  ?  912 HOH A O   1 
HETATM 5281 O O   . HOH K 7 .   ? -13.665 23.675 25.618  1.00 58.41  ?  913 HOH A O   1 
HETATM 5282 O O   . HOH K 7 .   ? -13.253 16.704 19.424  1.00 46.11  ?  914 HOH A O   1 
HETATM 5283 O O   . HOH K 7 .   ? -16.159 22.513 11.712  1.00 58.02  ?  915 HOH A O   1 
HETATM 5284 O O   . HOH K 7 .   ? -16.573 26.383 7.592   1.00 50.91  ?  916 HOH A O   1 
HETATM 5285 O O   . HOH K 7 .   ? -20.670 18.374 2.548   1.00 55.49  ?  917 HOH A O   1 
HETATM 5286 O O   . HOH K 7 .   ? -33.969 7.074  14.640  1.00 64.31  ?  918 HOH A O   1 
HETATM 5287 O O   . HOH K 7 .   ? -35.870 51.396 -17.369 1.00 74.23  ?  919 HOH A O   1 
HETATM 5288 O O   . HOH K 7 .   ? -21.070 39.871 37.997  1.00 73.23  ?  920 HOH A O   1 
HETATM 5289 O O   . HOH K 7 .   ? -38.115 39.505 0.265   1.00 72.67  ?  921 HOH A O   1 
HETATM 5290 O O   . HOH K 7 .   ? -14.727 24.927 9.286   1.00 61.09  ?  922 HOH A O   1 
HETATM 5291 O O   . HOH K 7 .   ? -27.344 19.782 -0.318  1.00 63.09  ?  923 HOH A O   1 
HETATM 5292 O O   . HOH K 7 .   ? -32.051 23.015 24.587  1.00 62.48  ?  924 HOH A O   1 
HETATM 5293 O O   . HOH K 7 .   ? -27.826 24.646 18.790  1.00 50.54  ?  925 HOH A O   1 
HETATM 5294 O O   . HOH K 7 .   ? -9.096  19.694 5.489   1.00 48.13  ?  926 HOH A O   1 
HETATM 5295 O O   . HOH K 7 .   ? -6.863  25.090 7.614   1.00 65.03  ?  927 HOH A O   1 
HETATM 5296 O O   . HOH K 7 .   ? -5.554  15.922 18.362  1.00 75.74  ?  928 HOH A O   1 
HETATM 5297 O O   . HOH K 7 .   ? -19.476 28.133 2.034   1.00 55.33  ?  929 HOH A O   1 
HETATM 5298 O O   . HOH K 7 .   ? -14.869 22.602 29.906  1.00 52.94  ?  930 HOH A O   1 
HETATM 5299 O O   . HOH K 7 .   ? -32.557 22.267 0.985   1.00 71.13  ?  931 HOH A O   1 
HETATM 5300 O O   . HOH K 7 .   ? -5.260  12.852 21.022  1.00 60.82  ?  932 HOH A O   1 
HETATM 5301 O O   . HOH K 7 .   ? -1.883  14.197 -0.480  1.00 64.78  ?  933 HOH A O   1 
HETATM 5302 O O   . HOH K 7 .   ? -13.321 21.422 -3.681  1.00 67.98  ?  934 HOH A O   1 
HETATM 5303 O O   . HOH K 7 .   ? -27.885 -0.978 17.293  1.00 78.36  ?  935 HOH A O   1 
HETATM 5304 O O   . HOH K 7 .   ? -41.769 30.667 10.820  1.00 74.49  ?  936 HOH A O   1 
HETATM 5305 O O   . HOH K 7 .   ? -8.784  19.125 7.754   1.00 50.73  ?  937 HOH A O   1 
HETATM 5306 O O   . HOH K 7 .   ? -10.160 20.533 34.693  1.00 66.84  ?  938 HOH A O   1 
HETATM 5307 O O   . HOH K 7 .   ? -9.714  29.417 6.927   1.00 63.26  ?  939 HOH A O   1 
HETATM 5308 O O   . HOH K 7 .   ? -4.651  5.880  22.520  1.00 103.46 ?  940 HOH A O   1 
HETATM 5309 O O   . HOH K 7 .   ? -25.031 20.308 26.428  1.00 68.24  ?  941 HOH A O   1 
HETATM 5310 O O   . HOH K 7 .   ? -15.393 21.663 -1.708  1.00 59.92  ?  942 HOH A O   1 
HETATM 5311 O O   . HOH K 7 .   ? -33.857 4.345  18.174  1.00 91.02  ?  943 HOH A O   1 
HETATM 5312 O O   . HOH K 7 .   ? -29.752 2.990  18.911  1.00 79.30  ?  944 HOH A O   1 
HETATM 5313 O O   . HOH K 7 .   ? -6.030  25.140 27.744  1.00 66.08  ?  945 HOH A O   1 
HETATM 5314 O O   . HOH K 7 .   ? -4.521  4.488  15.001  1.00 70.90  ?  946 HOH A O   1 
HETATM 5315 O O   . HOH K 7 .   ? -8.245  22.488 10.330  1.00 52.72  ?  947 HOH A O   1 
HETATM 5316 O O   . HOH K 7 .   ? -13.724 35.077 -11.554 1.00 63.51  ?  948 HOH A O   1 
HETATM 5317 O O   . HOH K 7 .   ? -16.092 56.828 15.866  1.00 101.91 ?  949 HOH A O   1 
HETATM 5318 O O   . HOH K 7 .   ? -8.307  17.168 3.773   1.00 60.00  ?  950 HOH A O   1 
HETATM 5319 O O   . HOH K 7 .   ? -31.790 22.902 13.945  1.00 61.91  ?  951 HOH A O   1 
HETATM 5320 O O   . HOH K 7 .   ? -14.701 18.000 26.673  1.00 68.23  ?  952 HOH A O   1 
HETATM 5321 O O   . HOH K 7 .   ? -43.401 29.921 14.648  1.00 91.65  ?  953 HOH A O   1 
HETATM 5322 O O   . HOH K 7 .   ? -43.694 32.994 11.062  1.00 92.96  ?  954 HOH A O   1 
HETATM 5323 O O   . HOH K 7 .   ? -17.676 30.283 15.913  1.00 69.97  ?  955 HOH A O   1 
HETATM 5324 O O   . HOH K 7 .   ? -9.596  20.245 10.188  1.00 50.10  ?  956 HOH A O   1 
HETATM 5325 O O   . HOH K 7 .   ? -26.167 14.405 22.130  1.00 50.92  ?  957 HOH A O   1 
HETATM 5326 O O   . HOH K 7 .   ? -29.728 4.920  20.172  1.00 77.44  ?  958 HOH A O   1 
HETATM 5327 O O   . HOH K 7 .   ? -15.189 7.444  13.127  1.00 71.00  ?  959 HOH A O   1 
HETATM 5328 O O   . HOH K 7 .   ? -8.663  26.882 29.465  1.00 64.83  ?  960 HOH A O   1 
HETATM 5329 O O   . HOH K 7 .   ? -15.153 45.568 52.975  1.00 102.34 ?  961 HOH A O   1 
HETATM 5330 O O   . HOH K 7 .   ? -22.256 18.134 32.441  1.00 70.78  ?  962 HOH A O   1 
HETATM 5331 O O   . HOH K 7 .   ? -2.600  17.792 29.088  1.00 70.83  ?  963 HOH A O   1 
HETATM 5332 O O   . HOH K 7 .   ? -7.168  23.854 23.308  1.00 54.10  ?  964 HOH A O   1 
HETATM 5333 O O   . HOH K 7 .   ? -28.899 11.511 9.077   1.00 49.32  ?  965 HOH A O   1 
HETATM 5334 O O   . HOH K 7 .   ? -33.773 8.333  20.694  1.00 56.53  ?  966 HOH A O   1 
HETATM 5335 O O   . HOH K 7 .   ? -11.345 26.645 5.943   1.00 62.67  ?  967 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . CYS A 9   ? 3.2626 1.4501 2.5581 0.3692  -0.7508 0.0691  53  CYS A N   
2    C CA  . CYS A 9   ? 3.2471 1.4593 2.4640 0.4182  -0.7246 0.0431  53  CYS A CA  
3    C C   . CYS A 9   ? 3.1830 1.4755 2.3997 0.4604  -0.6667 0.0757  53  CYS A C   
4    O O   . CYS A 9   ? 3.2518 1.5173 2.4142 0.5172  -0.6452 0.0747  53  CYS A O   
5    C CB  . CYS A 9   ? 3.1576 1.4121 2.3938 0.3825  -0.7374 0.0263  53  CYS A CB  
6    S SG  . CYS A 9   ? 2.9859 1.3704 2.3279 0.3330  -0.7080 0.0725  53  CYS A SG  
7    N N   . GLY A 10  ? 2.5581 0.9530 1.8384 0.4331  -0.6440 0.1050  54  GLY A N   
8    C CA  . GLY A 10  ? 2.4990 0.9848 1.7947 0.4662  -0.5971 0.1396  54  GLY A CA  
9    C C   . GLY A 10  ? 2.4075 0.9999 1.7826 0.4215  -0.5861 0.1746  54  GLY A C   
10   O O   . GLY A 10  ? 2.3759 0.9786 1.7792 0.3751  -0.6048 0.1644  54  GLY A O   
11   N N   . ARG A 11  ? 2.9736 1.6474 2.3829 0.4359  -0.5582 0.2153  55  ARG A N   
12   C CA  . ARG A 11  ? 2.8940 1.6829 2.3779 0.3903  -0.5452 0.2485  55  ARG A CA  
13   C C   . ARG A 11  ? 2.8488 1.7698 2.3529 0.4195  -0.4995 0.2676  55  ARG A C   
14   O O   . ARG A 11  ? 2.8805 1.7945 2.3425 0.4803  -0.4815 0.2600  55  ARG A O   
15   C CB  . ARG A 11  ? 2.8829 1.6500 2.4225 0.3444  -0.5654 0.2856  55  ARG A CB  
16   C CG  . ARG A 11  ? 2.9227 1.5843 2.4716 0.3070  -0.6019 0.2672  55  ARG A CG  
17   C CD  . ARG A 11  ? 2.8906 1.5634 2.4792 0.2503  -0.6228 0.2520  55  ARG A CD  
18   N NE  . ARG A 11  ? 2.9264 1.5070 2.5246 0.2203  -0.6620 0.2259  55  ARG A NE  
19   C CZ  . ARG A 11  ? 2.9170 1.4805 2.5868 0.1709  -0.6776 0.2499  55  ARG A CZ  
20   N NH1 . ARG A 11  ? 2.8764 1.5026 2.6059 0.1475  -0.6530 0.3023  55  ARG A NH1 
21   N NH2 . ARG A 11  ? 2.9656 1.4525 2.6476 0.1464  -0.7177 0.2226  55  ARG A NH2 
22   N N   . VAL A 12  ? 2.2987 1.3376 1.8688 0.3775  -0.4826 0.2922  56  VAL A N   
23   C CA  . VAL A 12  ? 2.2497 1.4182 1.8514 0.3958  -0.4493 0.3113  56  VAL A CA  
24   C C   . VAL A 12  ? 2.2586 1.4331 1.8784 0.4019  -0.4544 0.3530  56  VAL A C   
25   O O   . VAL A 12  ? 2.2733 1.4002 1.9086 0.3663  -0.4725 0.3742  56  VAL A O   
26   C CB  . VAL A 12  ? 2.1712 1.4624 1.8260 0.3472  -0.4315 0.3095  56  VAL A CB  
27   C CG1 . VAL A 12  ? 2.1243 1.5446 1.8138 0.3662  -0.4050 0.3238  56  VAL A CG1 
28   C CG2 . VAL A 12  ? 2.1602 1.4403 1.7983 0.3344  -0.4275 0.2719  56  VAL A CG2 
29   N N   . ARG A 13  ? 2.5520 1.7876 2.1740 0.4476  -0.4372 0.3679  57  ARG A N   
30   C CA  . ARG A 13  ? 2.5680 1.7970 2.1948 0.4627  -0.4440 0.4076  57  ARG A CA  
31   C C   . ARG A 13  ? 2.5061 1.8638 2.1787 0.4425  -0.4324 0.4334  57  ARG A C   
32   O O   . ARG A 13  ? 2.4517 1.9192 2.1545 0.4385  -0.4165 0.4194  57  ARG A O   
33   C CB  . ARG A 13  ? 2.6188 1.7998 2.2069 0.5346  -0.4418 0.4101  57  ARG A CB  
34   C CG  . ARG A 13  ? 2.6837 1.7323 2.2139 0.5568  -0.4544 0.3784  57  ARG A CG  
35   C CD  . ARG A 13  ? 2.7391 1.7241 2.2231 0.6284  -0.4496 0.3779  57  ARG A CD  
36   N NE  . ARG A 13  ? 2.8059 1.6598 2.2402 0.6274  -0.4628 0.3452  57  ARG A NE  
37   C CZ  . ARG A 13  ? 2.8740 1.6329 2.2902 0.6293  -0.4764 0.3501  57  ARG A CZ  
38   N NH1 . ARG A 13  ? 2.8887 1.6666 2.3304 0.6350  -0.4739 0.3898  57  ARG A NH1 
39   N NH2 . ARG A 13  ? 2.9584 1.6025 2.3283 0.6273  -0.4938 0.3148  57  ARG A NH2 
40   N N   . ASP A 14  ? 2.5752 1.9109 2.2504 0.4284  -0.4413 0.4709  58  ASP A N   
41   C CA  . ASP A 14  ? 2.5334 1.9705 2.2332 0.4171  -0.4342 0.4991  58  ASP A CA  
42   C C   . ASP A 14  ? 2.4674 1.9930 2.2007 0.3661  -0.4246 0.4836  58  ASP A C   
43   O O   . ASP A 14  ? 2.4258 2.0518 2.1761 0.3634  -0.4193 0.4927  58  ASP A O   
44   C CB  . ASP A 14  ? 2.5200 2.0364 2.2231 0.4717  -0.4301 0.5052  58  ASP A CB  
45   C CG  . ASP A 14  ? 2.5806 2.0157 2.2491 0.5278  -0.4380 0.5256  58  ASP A CG  
46   O OD1 . ASP A 14  ? 2.6384 1.9691 2.2815 0.5206  -0.4478 0.5496  58  ASP A OD1 
47   O OD2 . ASP A 14  ? 2.5691 2.0460 2.2410 0.5798  -0.4334 0.5193  58  ASP A OD2 
48   N N   . PHE A 15  ? 2.0340 1.5174 1.7735 0.3276  -0.4257 0.4593  59  PHE A N   
49   C CA  . PHE A 15  ? 1.9706 1.5322 1.7392 0.2845  -0.4153 0.4387  59  PHE A CA  
50   C C   . PHE A 15  ? 1.9362 1.5555 1.7214 0.2516  -0.4094 0.4663  59  PHE A C   
51   O O   . PHE A 15  ? 1.8794 1.5898 1.6834 0.2317  -0.4002 0.4533  59  PHE A O   
52   C CB  . PHE A 15  ? 1.9779 1.4704 1.7462 0.2520  -0.4217 0.4115  59  PHE A CB  
53   C CG  . PHE A 15  ? 2.0145 1.4110 1.7857 0.2233  -0.4372 0.4327  59  PHE A CG  
54   C CD1 . PHE A 15  ? 1.9806 1.4028 1.7850 0.1743  -0.4317 0.4512  59  PHE A CD1 
55   C CD2 . PHE A 15  ? 2.0846 1.3632 1.8295 0.2458  -0.4569 0.4346  59  PHE A CD2 
56   C CE1 . PHE A 15  ? 2.0123 1.3522 1.8357 0.1457  -0.4434 0.4747  59  PHE A CE1 
57   C CE2 . PHE A 15  ? 2.1173 1.3065 1.8780 0.2151  -0.4739 0.4546  59  PHE A CE2 
58   C CZ  . PHE A 15  ? 2.0789 1.3026 1.8851 0.1637  -0.4661 0.4764  59  PHE A CZ  
59   N N   . VAL A 16  ? 1.9962 1.5567 1.7712 0.2484  -0.4133 0.5052  60  VAL A N   
60   C CA  . VAL A 16  ? 1.9796 1.5757 1.7623 0.2196  -0.4023 0.5369  60  VAL A CA  
61   C C   . VAL A 16  ? 1.9441 1.6482 1.7168 0.2390  -0.3975 0.5400  60  VAL A C   
62   O O   . VAL A 16  ? 1.9016 1.6712 1.6822 0.2119  -0.3882 0.5358  60  VAL A O   
63   C CB  . VAL A 16  ? 2.0394 1.5531 1.8109 0.2239  -0.4024 0.5860  60  VAL A CB  
64   C CG1 . VAL A 16  ? 2.0279 1.5724 1.8080 0.1928  -0.3831 0.6211  60  VAL A CG1 
65   C CG2 . VAL A 16  ? 2.0790 1.4759 1.8635 0.2091  -0.4166 0.5798  60  VAL A CG2 
66   N N   . ALA A 17  ? 2.0288 1.7489 1.7845 0.2879  -0.4069 0.5457  61  ALA A N   
67   C CA  . ALA A 17  ? 1.9977 1.8201 1.7496 0.3113  -0.4121 0.5446  61  ALA A CA  
68   C C   . ALA A 17  ? 1.9294 1.8378 1.7161 0.2917  -0.4103 0.5005  61  ALA A C   
69   O O   . ALA A 17  ? 1.8878 1.8802 1.6791 0.2844  -0.4139 0.4942  61  ALA A O   
70   C CB  . ALA A 17  ? 2.0326 1.8535 1.7716 0.3692  -0.4250 0.5567  61  ALA A CB  
71   N N   . LYS A 18  ? 1.6298 1.5105 1.4366 0.2845  -0.4051 0.4704  62  LYS A N   
72   C CA  . LYS A 18  ? 1.5738 1.5280 1.4150 0.2706  -0.3990 0.4318  62  LYS A CA  
73   C C   . LYS A 18  ? 1.5273 1.5075 1.3773 0.2190  -0.3905 0.4195  62  LYS A C   
74   O O   . LYS A 18  ? 1.4727 1.5326 1.3476 0.2045  -0.3881 0.3961  62  LYS A O   
75   C CB  . LYS A 18  ? 1.5961 1.5030 1.4434 0.2847  -0.3916 0.4070  62  LYS A CB  
76   C CG  . LYS A 18  ? 1.6555 1.5092 1.4833 0.3377  -0.3973 0.4210  62  LYS A CG  
77   C CD  . LYS A 18  ? 1.6720 1.5107 1.5054 0.3650  -0.3854 0.3938  62  LYS A CD  
78   C CE  . LYS A 18  ? 1.7289 1.5081 1.5364 0.4229  -0.3896 0.4083  62  LYS A CE  
79   N NZ  . LYS A 18  ? 1.7447 1.5240 1.5564 0.4615  -0.3722 0.3860  62  LYS A NZ  
80   N N   . LEU A 19  ? 1.3901 1.3023 1.2252 0.1914  -0.3860 0.4362  63  LEU A N   
81   C CA  . LEU A 19  ? 1.3399 1.2738 1.1844 0.1458  -0.3756 0.4296  63  LEU A CA  
82   C C   . LEU A 19  ? 1.3552 1.3241 1.1785 0.1415  -0.3722 0.4592  63  LEU A C   
83   O O   . LEU A 19  ? 1.3170 1.3184 1.1424 0.1110  -0.3617 0.4541  63  LEU A O   
84   C CB  . LEU A 19  ? 1.3561 1.2047 1.2080 0.1167  -0.3725 0.4299  63  LEU A CB  
85   C CG  . LEU A 19  ? 1.3595 1.1747 1.2176 0.1239  -0.3768 0.3945  63  LEU A CG  
86   C CD1 . LEU A 19  ? 1.3969 1.1128 1.2554 0.1047  -0.3855 0.3929  63  LEU A CD1 
87   C CD2 . LEU A 19  ? 1.3000 1.1892 1.1770 0.1064  -0.3664 0.3606  63  LEU A CD2 
88   N N   . ALA A 20  ? 1.5470 1.5062 1.3432 0.1768  -0.3801 0.4906  64  ALA A N   
89   C CA  . ALA A 20  ? 1.5671 1.5456 1.3277 0.1816  -0.3753 0.5237  64  ALA A CA  
90   C C   . ALA A 20  ? 1.5196 1.5909 1.2727 0.1780  -0.3815 0.5002  64  ALA A C   
91   O O   . ALA A 20  ? 1.5090 1.5962 1.2482 0.1532  -0.3682 0.5025  64  ALA A O   
92   C CB  . ALA A 20  ? 1.6259 1.5755 1.3530 0.2271  -0.3849 0.5605  64  ALA A CB  
93   N N   . ASN A 21  ? 1.8224 1.9537 1.5895 0.2027  -0.4023 0.4766  65  ASN A N   
94   C CA  . ASN A 21  ? 1.7783 1.9958 1.5451 0.2004  -0.4170 0.4517  65  ASN A CA  
95   C C   . ASN A 21  ? 1.7178 1.9667 1.5217 0.1589  -0.4071 0.4123  65  ASN A C   
96   O O   . ASN A 21  ? 1.6827 1.9909 1.4850 0.1481  -0.4168 0.3904  65  ASN A O   
97   C CB  . ASN A 21  ? 1.7657 2.0421 1.5518 0.2389  -0.4457 0.4415  65  ASN A CB  
98   C CG  . ASN A 21  ? 1.7910 2.1027 1.5277 0.2697  -0.4704 0.4583  65  ASN A CG  
99   O OD1 . ASN A 21  ? 1.8051 2.1180 1.4942 0.2585  -0.4670 0.4642  65  ASN A OD1 
100  N ND2 . ASN A 21  ? 1.8020 2.1407 1.5455 0.3130  -0.4958 0.4662  65  ASN A ND2 
101  N N   . ASN A 22  ? 1.4194 1.6228 1.2523 0.1378  -0.3904 0.4025  66  ASN A N   
102  C CA  . ASN A 22  ? 1.3681 1.5920 1.2330 0.1021  -0.3793 0.3675  66  ASN A CA  
103  C C   . ASN A 22  ? 1.3710 1.5602 1.2236 0.0657  -0.3601 0.3728  66  ASN A C   
104  O O   . ASN A 22  ? 1.3308 1.5357 1.2042 0.0367  -0.3508 0.3455  66  ASN A O   
105  C CB  . ASN A 22  ? 1.3641 1.5626 1.2632 0.1068  -0.3740 0.3496  66  ASN A CB  
106  C CG  . ASN A 22  ? 1.3464 1.6039 1.2776 0.1361  -0.3858 0.3359  66  ASN A CG  
107  O OD1 . ASN A 22  ? 1.3016 1.6355 1.2566 0.1308  -0.3958 0.3181  66  ASN A OD1 
108  N ND2 . ASN A 22  ? 1.3852 1.6076 1.3211 0.1682  -0.3856 0.3444  66  ASN A ND2 
109  N N   . THR A 23  ? 1.2557 1.3985 1.0792 0.0680  -0.3519 0.4104  67  THR A N   
110  C CA  . THR A 23  ? 1.2625 1.3803 1.0847 0.0355  -0.3310 0.4211  67  THR A CA  
111  C C   . THR A 23  ? 1.2550 1.4259 1.0422 0.0354  -0.3273 0.4202  67  THR A C   
112  O O   . THR A 23  ? 1.2880 1.4725 1.0321 0.0643  -0.3350 0.4417  67  THR A O   
113  C CB  . THR A 23  ? 1.3206 1.3677 1.1369 0.0373  -0.3202 0.4666  67  THR A CB  
114  O OG1 . THR A 23  ? 1.3388 1.3306 1.1748 0.0477  -0.3321 0.4657  67  THR A OG1 
115  C CG2 . THR A 23  ? 1.3226 1.3466 1.1600 0.0009  -0.2982 0.4778  67  THR A CG2 
116  N N   . HIS A 24  ? 1.3131 1.5103 1.1114 0.0072  -0.3178 0.3936  68  HIS A N   
117  C CA  . HIS A 24  ? 1.3113 1.5527 1.0695 0.0092  -0.3168 0.3863  68  HIS A CA  
118  C C   . HIS A 24  ? 1.3299 1.5547 1.0776 -0.0131 -0.2872 0.4002  68  HIS A C   
119  O O   . HIS A 24  ? 1.2973 1.5232 1.0779 -0.0425 -0.2771 0.3776  68  HIS A O   
120  C CB  . HIS A 24  ? 1.2503 1.5488 1.0278 0.0016  -0.3356 0.3382  68  HIS A CB  
121  C CG  . HIS A 24  ? 1.2290 1.5552 1.0312 0.0237  -0.3617 0.3260  68  HIS A CG  
122  N ND1 . HIS A 24  ? 1.1905 1.5166 1.0459 0.0159  -0.3618 0.3057  68  HIS A ND1 
123  C CD2 . HIS A 24  ? 1.2473 1.6025 1.0288 0.0571  -0.3872 0.3335  68  HIS A CD2 
124  C CE1 . HIS A 24  ? 1.1855 1.5436 1.0581 0.0429  -0.3827 0.3025  68  HIS A CE1 
125  N NE2 . HIS A 24  ? 1.2164 1.5944 1.0483 0.0671  -0.4010 0.3184  68  HIS A NE2 
126  N N   . GLN A 25  ? 1.3387 1.5500 1.0387 0.0045  -0.2712 0.4391  69  GLN A N   
127  C CA  . GLN A 25  ? 1.3598 1.5593 1.0516 -0.0108 -0.2370 0.4594  69  GLN A CA  
128  C C   . GLN A 25  ? 1.3563 1.5957 1.0015 -0.0082 -0.2356 0.4318  69  GLN A C   
129  O O   . GLN A 25  ? 1.3693 1.6354 0.9604 0.0180  -0.2584 0.4177  69  GLN A O   
130  C CB  . GLN A 25  ? 1.4197 1.5835 1.0820 0.0093  -0.2120 0.5193  69  GLN A CB  
131  C CG  . GLN A 25  ? 1.4404 1.6001 1.0925 0.0007  -0.1706 0.5467  69  GLN A CG  
132  C CD  . GLN A 25  ? 1.5026 1.6348 1.1096 0.0297  -0.1413 0.6084  69  GLN A CD  
133  O OE1 . GLN A 25  ? 1.5478 1.6751 1.0958 0.0660  -0.1561 0.6222  69  GLN A OE1 
134  N NE2 . GLN A 25  ? 1.5028 1.6178 1.1401 0.0157  -0.0979 0.6489  69  GLN A NE2 
135  N N   . HIS A 26  ? 1.3019 1.5428 0.9689 -0.0343 -0.2128 0.4219  70  HIS A N   
136  C CA  . HIS A 26  ? 1.3146 1.5796 0.9298 -0.0290 -0.2038 0.4033  70  HIS A CA  
137  C C   . HIS A 26  ? 1.3393 1.5870 0.9587 -0.0372 -0.1590 0.4362  70  HIS A C   
138  O O   . HIS A 26  ? 1.3074 1.5446 0.9954 -0.0676 -0.1454 0.4377  70  HIS A O   
139  C CB  . HIS A 26  ? 1.2580 1.5514 0.8974 -0.0518 -0.2232 0.3466  70  HIS A CB  
140  C CG  . HIS A 26  ? 1.2769 1.5872 0.8575 -0.0443 -0.2193 0.3237  70  HIS A CG  
141  N ND1 . HIS A 26  ? 1.2819 1.6162 0.8109 -0.0256 -0.2530 0.2924  70  HIS A ND1 
142  C CD2 . HIS A 26  ? 1.2980 1.6011 0.8608 -0.0500 -0.1873 0.3277  70  HIS A CD2 
143  C CE1 . HIS A 26  ? 1.3101 1.6445 0.7859 -0.0206 -0.2439 0.2750  70  HIS A CE1 
144  N NE2 . HIS A 26  ? 1.3208 1.6370 0.8138 -0.0334 -0.2013 0.2970  70  HIS A NE2 
145  N N   . VAL A 27  ? 1.5050 1.7502 1.0500 -0.0071 -0.1363 0.4630  71  VAL A N   
146  C CA  . VAL A 27  ? 1.5255 1.7603 1.0716 -0.0082 -0.0865 0.4991  71  VAL A CA  
147  C C   . VAL A 27  ? 1.5228 1.7770 1.0378 -0.0114 -0.0789 0.4621  71  VAL A C   
148  O O   . VAL A 27  ? 1.5423 1.8090 0.9872 0.0069  -0.1042 0.4250  71  VAL A O   
149  C CB  . VAL A 27  ? 1.5923 1.8083 1.0690 0.0318  -0.0559 0.5547  71  VAL A CB  
150  C CG1 . VAL A 27  ? 1.5939 1.8005 1.1050 0.0255  0.0023  0.6036  71  VAL A CG1 
151  C CG2 . VAL A 27  ? 1.6032 1.7972 1.0920 0.0419  -0.0723 0.5842  71  VAL A CG2 
152  N N   . PHE A 28  ? 1.5603 1.8152 1.1313 -0.0347 -0.0472 0.4714  72  PHE A N   
153  C CA  . PHE A 28  ? 1.5535 1.8229 1.1066 -0.0410 -0.0404 0.4343  72  PHE A CA  
154  C C   . PHE A 28  ? 1.6057 1.8723 1.0920 -0.0110 0.0050  0.4585  72  PHE A C   
155  O O   . PHE A 28  ? 1.6034 1.8771 1.0768 -0.0148 0.0145  0.4300  72  PHE A O   
156  C CB  . PHE A 28  ? 1.4882 1.7626 1.1373 -0.0828 -0.0435 0.4142  72  PHE A CB  
157  C CG  . PHE A 28  ? 1.4486 1.7281 1.1262 -0.1035 -0.0891 0.3670  72  PHE A CG  
158  C CD1 . PHE A 28  ? 1.4286 1.6969 1.1502 -0.1123 -0.1111 0.3767  72  PHE A CD1 
159  C CD2 . PHE A 28  ? 1.4317 1.7244 1.0913 -0.1120 -0.1074 0.3147  72  PHE A CD2 
160  C CE1 . PHE A 28  ? 1.3909 1.6647 1.1367 -0.1261 -0.1464 0.3369  72  PHE A CE1 
161  C CE2 . PHE A 28  ? 1.3862 1.6859 1.0776 -0.1296 -0.1423 0.2769  72  PHE A CE2 
162  C CZ  . PHE A 28  ? 1.3642 1.6564 1.0978 -0.1350 -0.1600 0.2888  72  PHE A CZ  
163  N N   . ASP A 29  ? 2.1858 2.4387 1.6275 0.0213  0.0359  0.5123  73  ASP A N   
164  C CA  . ASP A 29  ? 2.2446 2.4907 1.6053 0.0602  0.0835  0.5392  73  ASP A CA  
165  C C   . ASP A 29  ? 2.2113 2.4709 1.6272 0.0421  0.1199  0.5387  73  ASP A C   
166  O O   . ASP A 29  ? 2.1500 2.4197 1.6797 0.0085  0.1356  0.5631  73  ASP A O   
167  C CB  . ASP A 29  ? 2.3106 2.5476 1.5375 0.0987  0.0555  0.4976  73  ASP A CB  
168  C CG  . ASP A 29  ? 2.3746 2.5922 1.5092 0.1434  0.0494  0.5272  73  ASP A CG  
169  O OD1 . ASP A 29  ? 2.3640 2.5760 1.5450 0.1385  0.0554  0.5706  73  ASP A OD1 
170  O OD2 . ASP A 29  ? 2.4388 2.6418 1.4495 0.1855  0.0360  0.5057  73  ASP A OD2 
171  N N   . ASP A 30  ? 2.3518 2.6095 1.6887 0.0643  0.1272  0.5067  74  ASP A N   
172  C CA  . ASP A 30  ? 2.3272 2.5967 1.7067 0.0545  0.1640  0.5068  74  ASP A CA  
173  C C   . ASP A 30  ? 2.2472 2.5324 1.7359 0.0020  0.1330  0.4706  74  ASP A C   
174  O O   . ASP A 30  ? 2.2371 2.5206 1.7125 -0.0144 0.0852  0.4132  74  ASP A O   
175  C CB  . ASP A 30  ? 2.3960 2.6507 1.6576 0.0910  0.1709  0.4714  74  ASP A CB  
176  C CG  . ASP A 30  ? 2.4812 2.7113 1.6109 0.1511  0.1972  0.5016  74  ASP A CG  
177  O OD1 . ASP A 30  ? 2.4995 2.7300 1.6293 0.1769  0.2615  0.5638  74  ASP A OD1 
178  O OD2 . ASP A 30  ? 2.5272 2.7374 1.5540 0.1742  0.1535  0.4641  74  ASP A OD2 
179  N N   . LEU A 31  ? 2.9303 3.2301 2.5287 -0.0225 0.1608  0.5064  75  LEU A N   
180  C CA  . LEU A 31  ? 2.8560 3.1663 2.5525 -0.0661 0.1361  0.4772  75  LEU A CA  
181  C C   . LEU A 31  ? 2.8060 3.1352 2.5997 -0.0772 0.1793  0.5208  75  LEU A C   
182  O O   . LEU A 31  ? 2.8064 3.1412 2.6302 -0.0658 0.2187  0.5815  75  LEU A O   
183  C CB  . LEU A 31  ? 2.8163 3.1185 2.5656 -0.0951 0.0904  0.4679  75  LEU A CB  
184  C CG  . LEU A 31  ? 2.7649 3.0658 2.5571 -0.1284 0.0462  0.4140  75  LEU A CG  
185  C CD1 . LEU A 31  ? 2.7577 3.0467 2.5567 -0.1393 0.0034  0.4004  75  LEU A CD1 
186  C CD2 . LEU A 31  ? 2.6945 3.0017 2.5904 -0.1567 0.0543  0.4242  75  LEU A CD2 
187  N N   . ARG A 32  ? 1.8501 2.1897 1.6989 -0.0994 0.1716  0.4923  76  ARG A N   
188  C CA  . ARG A 32  ? 1.7900 2.1527 1.7487 -0.1139 0.2019  0.5287  76  ARG A CA  
189  C C   . ARG A 32  ? 1.7409 2.1072 1.7489 -0.1400 0.1742  0.4841  76  ARG A C   
190  O O   . ARG A 32  ? 1.7523 2.1013 1.7123 -0.1480 0.1361  0.4293  76  ARG A O   
191  C CB  . ARG A 32  ? 1.8303 2.2104 1.7603 -0.0769 0.2672  0.5687  76  ARG A CB  
192  C CG  . ARG A 32  ? 1.7703 2.1829 1.8308 -0.0888 0.3066  0.6265  76  ARG A CG  
193  C CD  . ARG A 32  ? 1.7350 2.1451 1.8690 -0.1069 0.3049  0.6761  76  ARG A CD  
194  N NE  . ARG A 32  ? 1.7926 2.1836 1.8238 -0.0720 0.3276  0.7015  76  ARG A NE  
195  C CZ  . ARG A 32  ? 1.8272 2.2258 1.8040 -0.0291 0.3911  0.7468  76  ARG A CZ  
196  N NH1 . ARG A 32  ? 1.8090 2.2302 1.8331 -0.0159 0.4325  0.7581  76  ARG A NH1 
197  N NH2 . ARG A 32  ? 1.8859 2.2572 1.7591 0.0055  0.4017  0.7603  76  ARG A NH2 
198  N N   . GLY A 33  ? 1.4569 1.8465 1.5664 -0.1524 0.1940  0.5111  77  GLY A N   
199  C CA  . GLY A 33  ? 1.4200 1.8157 1.5698 -0.1664 0.1795  0.4776  77  GLY A CA  
200  C C   . GLY A 33  ? 1.3858 1.7561 1.5407 -0.1946 0.1206  0.4278  77  GLY A C   
201  O O   . GLY A 33  ? 1.3556 1.7117 1.5430 -0.2138 0.0899  0.4328  77  GLY A O   
202  N N   . SER A 34  ? 1.7967 2.1574 1.9146 -0.1941 0.1077  0.3808  78  SER A N   
203  C CA  . SER A 34  ? 1.7603 2.0954 1.8771 -0.2163 0.0591  0.3356  78  SER A CA  
204  C C   . SER A 34  ? 1.7970 2.1132 1.8393 -0.2143 0.0366  0.3126  78  SER A C   
205  O O   . SER A 34  ? 1.8652 2.1799 1.8237 -0.1943 0.0486  0.2983  78  SER A O   
206  C CB  . SER A 34  ? 1.7652 2.0922 1.8609 -0.2144 0.0565  0.2959  78  SER A CB  
207  O OG  . SER A 34  ? 1.7080 2.0119 1.8279 -0.2357 0.0156  0.2648  78  SER A OG  
208  N N   . VAL A 35  ? 1.3421 1.6426 1.4165 -0.2330 0.0016  0.3087  79  VAL A N   
209  C CA  . VAL A 35  ? 1.3709 1.6572 1.3906 -0.2318 -0.0232 0.2868  79  VAL A CA  
210  C C   . VAL A 35  ? 1.3212 1.5860 1.3475 -0.2479 -0.0579 0.2451  79  VAL A C   
211  O O   . VAL A 35  ? 1.2576 1.5056 1.3376 -0.2623 -0.0798 0.2484  79  VAL A O   
212  C CB  . VAL A 35  ? 1.3717 1.6537 1.4178 -0.2337 -0.0303 0.3229  79  VAL A CB  
213  C CG1 . VAL A 35  ? 1.4312 1.7087 1.4076 -0.2211 -0.0451 0.3091  79  VAL A CG1 
214  C CG2 . VAL A 35  ? 1.3849 1.6852 1.4624 -0.2238 0.0084  0.3768  79  VAL A CG2 
215  N N   . SER A 36  ? 1.0526 1.3142 1.0227 -0.2439 -0.0626 0.2064  80  SER A N   
216  C CA  . SER A 36  ? 0.9961 1.2381 0.9673 -0.2558 -0.0875 0.1702  80  SER A CA  
217  C C   . SER A 36  ? 1.0135 1.2561 0.9570 -0.2540 -0.1076 0.1586  80  SER A C   
218  O O   . SER A 36  ? 1.1010 1.3594 1.0022 -0.2422 -0.1039 0.1611  80  SER A O   
219  C CB  . SER A 36  ? 1.0049 1.2423 0.9445 -0.2552 -0.0781 0.1368  80  SER A CB  
220  O OG  . SER A 36  ? 0.9836 1.2166 0.9545 -0.2564 -0.0649 0.1426  80  SER A OG  
221  N N   . LEU A 37  ? 0.8830 1.1071 0.8475 -0.2619 -0.1293 0.1459  81  LEU A N   
222  C CA  . LEU A 37  ? 0.8744 1.1020 0.8221 -0.2586 -0.1469 0.1335  81  LEU A CA  
223  C C   . LEU A 37  ? 0.7979 1.0124 0.7460 -0.2653 -0.1531 0.1003  81  LEU A C   
224  O O   . LEU A 37  ? 0.7563 0.9439 0.7239 -0.2693 -0.1554 0.0961  81  LEU A O   
225  C CB  . LEU A 37  ? 0.8791 1.0928 0.8517 -0.2558 -0.1621 0.1576  81  LEU A CB  
226  C CG  . LEU A 37  ? 0.8923 1.1143 0.8498 -0.2461 -0.1780 0.1553  81  LEU A CG  
227  C CD1 . LEU A 37  ? 0.9502 1.1596 0.9224 -0.2393 -0.1854 0.1895  81  LEU A CD1 
228  C CD2 . LEU A 37  ? 0.8213 1.0288 0.7868 -0.2471 -0.1898 0.1300  81  LEU A CD2 
229  N N   . SER A 38  ? 0.9620 1.1939 0.8904 -0.2654 -0.1565 0.0779  82  SER A N   
230  C CA  . SER A 38  ? 0.9045 1.1268 0.8415 -0.2718 -0.1573 0.0518  82  SER A CA  
231  C C   . SER A 38  ? 0.8881 1.1309 0.8343 -0.2685 -0.1704 0.0441  82  SER A C   
232  O O   . SER A 38  ? 0.9075 1.1801 0.8429 -0.2663 -0.1801 0.0406  82  SER A O   
233  C CB  . SER A 38  ? 0.9049 1.1267 0.8266 -0.2803 -0.1444 0.0282  82  SER A CB  
234  O OG  . SER A 38  ? 0.9176 1.1182 0.8375 -0.2810 -0.1306 0.0331  82  SER A OG  
235  N N   . TRP A 39  ? 0.8272 1.0537 0.7921 -0.2648 -0.1711 0.0417  83  TRP A N   
236  C CA  . TRP A 39  ? 0.8195 1.0696 0.8036 -0.2606 -0.1773 0.0344  83  TRP A CA  
237  C C   . TRP A 39  ? 0.7970 1.0591 0.7943 -0.2743 -0.1667 0.0103  83  TRP A C   
238  O O   . TRP A 39  ? 0.7904 1.0245 0.7807 -0.2810 -0.1507 0.0016  83  TRP A O   
239  C CB  . TRP A 39  ? 0.8336 1.0570 0.8272 -0.2462 -0.1763 0.0426  83  TRP A CB  
240  C CG  . TRP A 39  ? 0.8637 1.0764 0.8514 -0.2329 -0.1918 0.0645  83  TRP A CG  
241  C CD1 . TRP A 39  ? 0.8803 1.0577 0.8584 -0.2315 -0.1977 0.0792  83  TRP A CD1 
242  C CD2 . TRP A 39  ? 0.8874 1.1236 0.8841 -0.2193 -0.2047 0.0751  83  TRP A CD2 
243  N NE1 . TRP A 39  ? 0.9183 1.0907 0.8977 -0.2197 -0.2121 0.0990  83  TRP A NE1 
244  C CE2 . TRP A 39  ? 0.9244 1.1312 0.9105 -0.2099 -0.2159 0.0969  83  TRP A CE2 
245  C CE3 . TRP A 39  ? 0.8840 1.1638 0.9026 -0.2140 -0.2095 0.0691  83  TRP A CE3 
246  C CZ2 . TRP A 39  ? 0.9621 1.1762 0.9498 -0.1935 -0.2291 0.1131  83  TRP A CZ2 
247  C CZ3 . TRP A 39  ? 0.9153 1.2084 0.9377 -0.1960 -0.2243 0.0847  83  TRP A CZ3 
248  C CH2 . TRP A 39  ? 0.9555 1.2133 0.9581 -0.1848 -0.2328 0.1067  83  TRP A CH2 
249  N N   . VAL A 40  ? 0.7781 1.0800 0.7970 -0.2790 -0.1779 -0.0003 84  VAL A N   
250  C CA  . VAL A 40  ? 0.7615 1.0734 0.8065 -0.2956 -0.1702 -0.0224 84  VAL A CA  
251  C C   . VAL A 40  ? 0.7569 1.0989 0.8565 -0.2940 -0.1693 -0.0224 84  VAL A C   
252  O O   . VAL A 40  ? 0.7543 1.1403 0.8799 -0.2926 -0.1917 -0.0240 84  VAL A O   
253  C CB  . VAL A 40  ? 0.7680 1.0999 0.7985 -0.3072 -0.1879 -0.0410 84  VAL A CB  
254  C CG1 . VAL A 40  ? 0.7570 1.0867 0.8155 -0.3279 -0.1807 -0.0651 84  VAL A CG1 
255  C CG2 . VAL A 40  ? 0.7974 1.1050 0.7733 -0.3022 -0.1843 -0.0357 84  VAL A CG2 
256  N N   . GLY A 41  ? 0.7786 1.0981 0.8964 -0.2925 -0.1423 -0.0201 85  GLY A N   
257  C CA  . GLY A 41  ? 0.7939 1.1398 0.9683 -0.2882 -0.1298 -0.0155 85  GLY A CA  
258  C C   . GLY A 41  ? 0.8337 1.1771 1.0037 -0.2599 -0.1288 0.0046  85  GLY A C   
259  O O   . GLY A 41  ? 0.8371 1.1725 0.9730 -0.2484 -0.1481 0.0134  85  GLY A O   
260  N N   . ASP A 42  ? 0.6622 1.0082 0.8653 -0.2467 -0.1035 0.0136  86  ASP A N   
261  C CA  . ASP A 42  ? 0.6725 1.0172 0.8735 -0.2153 -0.1015 0.0312  86  ASP A CA  
262  C C   . ASP A 42  ? 0.6678 1.0824 0.9335 -0.2134 -0.1173 0.0353  86  ASP A C   
263  O O   . ASP A 42  ? 0.6612 1.1227 0.9928 -0.2328 -0.1150 0.0276  86  ASP A O   
264  C CB  . ASP A 42  ? 0.7136 1.0203 0.9064 -0.1926 -0.0626 0.0409  86  ASP A CB  
265  C CG  . ASP A 42  ? 0.8013 1.0932 0.9766 -0.1545 -0.0607 0.0568  86  ASP A CG  
266  O OD1 . ASP A 42  ? 0.8114 1.0741 0.9403 -0.1443 -0.0866 0.0590  86  ASP A OD1 
267  O OD2 . ASP A 42  ? 0.8603 1.1694 1.0714 -0.1341 -0.0320 0.0684  86  ASP A OD2 
268  N N   . SER A 43  ? 0.9206 1.3409 1.1709 -0.1909 -0.1365 0.0473  87  SER A N   
269  C CA  . SER A 43  ? 0.9102 1.3963 1.2192 -0.1827 -0.1542 0.0533  87  SER A CA  
270  C C   . SER A 43  ? 0.8411 1.3764 1.1737 -0.2077 -0.1907 0.0381  87  SER A C   
271  O O   . SER A 43  ? 0.8283 1.4225 1.2137 -0.2033 -0.2127 0.0395  87  SER A O   
272  C CB  . SER A 43  ? 0.9416 1.4637 1.3251 -0.1721 -0.1233 0.0623  87  SER A CB  
273  O OG  . SER A 43  ? 1.0370 1.5102 1.3846 -0.1380 -0.0919 0.0776  87  SER A OG  
274  N N   . THR A 44  ? 0.8677 1.3781 1.1615 -0.2315 -0.1976 0.0223  88  THR A N   
275  C CA  . THR A 44  ? 0.8319 1.3734 1.1240 -0.2488 -0.2336 0.0057  88  THR A CA  
276  C C   . THR A 44  ? 0.8496 1.3843 1.0838 -0.2312 -0.2604 0.0164  88  THR A C   
277  O O   . THR A 44  ? 0.8490 1.4244 1.0932 -0.2258 -0.2933 0.0135  88  THR A O   
278  C CB  . THR A 44  ? 0.8087 1.3216 1.0743 -0.2758 -0.2282 -0.0149 88  THR A CB  
279  O OG1 . THR A 44  ? 0.8204 1.2789 1.0111 -0.2699 -0.2185 -0.0079 88  THR A OG1 
280  C CG2 . THR A 44  ? 0.8019 1.3091 1.1175 -0.2919 -0.1958 -0.0207 88  THR A CG2 
281  N N   . GLY A 45  ? 0.9142 1.3965 1.0900 -0.2210 -0.2474 0.0304  89  GLY A N   
282  C CA  . GLY A 45  ? 0.9392 1.4111 1.0657 -0.2058 -0.2667 0.0458  89  GLY A CA  
283  C C   . GLY A 45  ? 0.9369 1.3902 1.0116 -0.2187 -0.2717 0.0388  89  GLY A C   
284  O O   . GLY A 45  ? 0.9693 1.4067 0.9988 -0.2071 -0.2788 0.0559  89  GLY A O   
285  N N   . VAL A 46  ? 0.8371 1.2896 0.9190 -0.2410 -0.2643 0.0160  90  VAL A N   
286  C CA  . VAL A 46  ? 0.8485 1.2818 0.8802 -0.2507 -0.2654 0.0064  90  VAL A CA  
287  C C   . VAL A 46  ? 0.8628 1.2490 0.8567 -0.2491 -0.2423 0.0228  90  VAL A C   
288  O O   . VAL A 46  ? 0.8409 1.1989 0.8485 -0.2551 -0.2213 0.0231  90  VAL A O   
289  C CB  . VAL A 46  ? 0.8235 1.2619 0.8754 -0.2742 -0.2637 -0.0236 90  VAL A CB  
290  C CG1 . VAL A 46  ? 0.8532 1.2658 0.8457 -0.2788 -0.2624 -0.0340 90  VAL A CG1 
291  C CG2 . VAL A 46  ? 0.8135 1.3023 0.9147 -0.2798 -0.2939 -0.0414 90  VAL A CG2 
292  N N   . ILE A 47  ? 0.8031 1.1810 0.7505 -0.2391 -0.2464 0.0378  91  ILE A N   
293  C CA  . ILE A 47  ? 0.8267 1.1682 0.7502 -0.2400 -0.2256 0.0549  91  ILE A CA  
294  C C   . ILE A 47  ? 0.8757 1.2151 0.7537 -0.2402 -0.2204 0.0500  91  ILE A C   
295  O O   . ILE A 47  ? 0.9182 1.2756 0.7619 -0.2284 -0.2361 0.0483  91  ILE A O   
296  C CB  . ILE A 47  ? 0.8656 1.1930 0.7848 -0.2249 -0.2268 0.0887  91  ILE A CB  
297  C CG1 . ILE A 47  ? 0.8390 1.1648 0.7925 -0.2177 -0.2344 0.0918  91  ILE A CG1 
298  C CG2 . ILE A 47  ? 0.8903 1.1835 0.8057 -0.2302 -0.2079 0.1067  91  ILE A CG2 
299  C CD1 . ILE A 47  ? 0.8841 1.1857 0.8340 -0.2032 -0.2383 0.1223  91  ILE A CD1 
300  N N   . LEU A 48  ? 0.9431 1.2584 0.8156 -0.2495 -0.1990 0.0473  92  LEU A N   
301  C CA  . LEU A 48  ? 1.0112 1.3208 0.8375 -0.2440 -0.1879 0.0470  92  LEU A CA  
302  C C   . LEU A 48  ? 1.0683 1.3627 0.8930 -0.2371 -0.1664 0.0816  92  LEU A C   
303  O O   . LEU A 48  ? 1.0325 1.3098 0.8948 -0.2461 -0.1580 0.0909  92  LEU A O   
304  C CB  . LEU A 48  ? 0.9902 1.2866 0.8129 -0.2577 -0.1787 0.0167  92  LEU A CB  
305  C CG  . LEU A 48  ? 0.9651 1.2748 0.7874 -0.2667 -0.2001 -0.0188 92  LEU A CG  
306  C CD1 . LEU A 48  ? 0.9722 1.2581 0.7797 -0.2775 -0.1882 -0.0448 92  LEU A CD1 
307  C CD2 . LEU A 48  ? 1.0193 1.3491 0.7999 -0.2507 -0.2259 -0.0223 92  LEU A CD2 
308  N N   . VAL A 49  ? 0.9622 1.2617 0.7446 -0.2195 -0.1583 0.1018  93  VAL A N   
309  C CA  . VAL A 49  ? 1.0318 1.3219 0.8210 -0.2134 -0.1316 0.1389  93  VAL A CA  
310  C C   . VAL A 49  ? 1.0862 1.3734 0.8320 -0.2022 -0.1069 0.1369  93  VAL A C   
311  O O   . VAL A 49  ? 1.1202 1.4111 0.8026 -0.1824 -0.1076 0.1326  93  VAL A O   
312  C CB  . VAL A 49  ? 1.0707 1.3652 0.8540 -0.1980 -0.1317 0.1783  93  VAL A CB  
313  C CG1 . VAL A 49  ? 1.1071 1.3970 0.8962 -0.1903 -0.0985 0.2183  93  VAL A CG1 
314  C CG2 . VAL A 49  ? 1.0296 1.3167 0.8621 -0.2076 -0.1502 0.1860  93  VAL A CG2 
315  N N   . LEU A 50  ? 1.0128 1.2906 0.7884 -0.2114 -0.0866 0.1385  94  LEU A N   
316  C CA  . LEU A 50  ? 1.0447 1.3186 0.7836 -0.1979 -0.0592 0.1376  94  LEU A CA  
317  C C   . LEU A 50  ? 1.0407 1.3220 0.8096 -0.1888 -0.0263 0.1845  94  LEU A C   
318  O O   . LEU A 50  ? 0.9854 1.2672 0.8257 -0.2049 -0.0257 0.2019  94  LEU A O   
319  C CB  . LEU A 50  ? 1.0291 1.2883 0.7809 -0.2120 -0.0584 0.1041  94  LEU A CB  
320  C CG  . LEU A 50  ? 1.0642 1.3139 0.7797 -0.1969 -0.0301 0.0992  94  LEU A CG  
321  C CD1 . LEU A 50  ? 1.1162 1.3588 0.7431 -0.1734 -0.0309 0.0831  94  LEU A CD1 
322  C CD2 . LEU A 50  ? 1.0470 1.2775 0.7811 -0.2118 -0.0314 0.0684  94  LEU A CD2 
323  N N   . THR A 51  ? 1.2710 1.5567 0.9865 -0.1616 0.0003  0.2055  95  THR A N   
324  C CA  . THR A 51  ? 1.2662 1.5640 1.0144 -0.1501 0.0398  0.2558  95  THR A CA  
325  C C   . THR A 51  ? 1.3101 1.6063 1.0131 -0.1254 0.0766  0.2558  95  THR A C   
326  O O   . THR A 51  ? 1.3659 1.6461 0.9816 -0.1063 0.0726  0.2251  95  THR A O   
327  C CB  . THR A 51  ? 1.2928 1.5964 1.0194 -0.1319 0.0504  0.2979  95  THR A CB  
328  O OG1 . THR A 51  ? 1.3644 1.6615 0.9902 -0.0953 0.0696  0.2978  95  THR A OG1 
329  C CG2 . THR A 51  ? 1.2808 1.5798 1.0123 -0.1449 0.0095  0.2861  95  THR A CG2 
330  N N   . THR A 52  ? 1.6440 1.9558 1.4085 -0.1242 0.1109  0.2899  96  THR A N   
331  C CA  . THR A 52  ? 1.6880 2.0013 1.4158 -0.0955 0.1532  0.2968  96  THR A CA  
332  C C   . THR A 52  ? 1.6840 2.0230 1.4510 -0.0759 0.2038  0.3619  96  THR A C   
333  O O   . THR A 52  ? 1.6215 1.9804 1.4853 -0.0969 0.2041  0.3991  96  THR A O   
334  C CB  . THR A 52  ? 1.6622 1.9723 1.4310 -0.1090 0.1510  0.2698  96  THR A CB  
335  O OG1 . THR A 52  ? 1.5917 1.9261 1.4761 -0.1298 0.1551  0.3014  96  THR A OG1 
336  C CG2 . THR A 52  ? 1.6536 1.9384 1.4001 -0.1321 0.1052  0.2128  96  THR A CG2 
337  N N   . PHE A 53  ? 1.8338 2.1688 1.5249 -0.0343 0.2471  0.3759  97  PHE A N   
338  C CA  . PHE A 53  ? 1.8335 2.1927 1.5508 -0.0079 0.3060  0.4419  97  PHE A CA  
339  C C   . PHE A 53  ? 1.8379 2.2096 1.5702 0.0132  0.3490  0.4485  97  PHE A C   
340  O O   . PHE A 53  ? 1.8727 2.2219 1.5523 0.0186  0.3353  0.3993  97  PHE A O   
341  C CB  . PHE A 53  ? 1.9128 2.2516 1.5066 0.0362  0.3282  0.4576  97  PHE A CB  
342  C CG  . PHE A 53  ? 1.9170 2.2459 1.4910 0.0251  0.2933  0.4614  97  PHE A CG  
343  C CD1 . PHE A 53  ? 1.9054 2.2191 1.4680 -0.0038 0.2298  0.4082  97  PHE A CD1 
344  C CD2 . PHE A 53  ? 1.9352 2.2688 1.4973 0.0482  0.3278  0.5207  97  PHE A CD2 
345  C CE1 . PHE A 53  ? 1.9100 2.2170 1.4551 -0.0094 0.1992  0.4127  97  PHE A CE1 
346  C CE2 . PHE A 53  ? 1.9463 2.2677 1.4850 0.0423  0.2963  0.5253  97  PHE A CE2 
347  C CZ  . PHE A 53  ? 1.9340 2.2434 1.4646 0.0141  0.2306  0.4701  97  PHE A CZ  
348  N N   . HIS A 54  ? 2.0351 2.4427 1.8432 0.0262  0.4027  0.5107  98  HIS A N   
349  C CA  . HIS A 54  ? 2.0388 2.4638 1.8635 0.0531  0.4501  0.5229  98  HIS A CA  
350  C C   . HIS A 54  ? 2.0422 2.4950 1.8782 0.0939  0.5271  0.5958  98  HIS A C   
351  O O   . HIS A 54  ? 2.0049 2.4786 1.9072 0.0836  0.5417  0.6477  98  HIS A O   
352  C CB  . HIS A 54  ? 1.9625 2.4160 1.9224 0.0154  0.4282  0.5157  98  HIS A CB  
353  C CG  . HIS A 54  ? 1.9248 2.3484 1.8374 0.0096  0.3941  0.4496  98  HIS A CG  
354  N ND1 . HIS A 54  ? 2.0222 2.4103 1.8100 0.0473  0.4106  0.4157  98  HIS A ND1 
355  C CD2 . HIS A 54  ? 1.8021 2.2205 1.7723 -0.0276 0.3455  0.4126  98  HIS A CD2 
356  C CE1 . HIS A 54  ? 1.9571 2.3209 1.7358 0.0302  0.3748  0.3623  98  HIS A CE1 
357  N NE2 . HIS A 54  ? 1.8243 2.2068 1.7102 -0.0137 0.3371  0.3609  98  HIS A NE2 
358  N N   . VAL A 55  ? 1.9275 2.3748 1.6958 0.1424  0.5768  0.5982  99  VAL A N   
359  C CA  . VAL A 55  ? 1.9382 2.3907 1.7190 0.1838  0.6311  0.6403  99  VAL A CA  
360  C C   . VAL A 55  ? 1.8534 2.3627 1.8230 0.1584  0.6484  0.6908  99  VAL A C   
361  O O   . VAL A 55  ? 1.8215 2.3472 1.8781 0.1286  0.6356  0.7228  99  VAL A O   
362  C CB  . VAL A 55  ? 2.0009 2.4267 1.6835 0.2388  0.6668  0.6181  99  VAL A CB  
363  C CG1 . VAL A 55  ? 2.0816 2.5175 1.7853 0.2837  0.7258  0.6675  99  VAL A CG1 
364  C CG2 . VAL A 55  ? 2.0829 2.4435 1.5768 0.2652  0.6414  0.5615  99  VAL A CG2 
365  N N   . GLY A 63  ? 2.1825 2.4681 1.6325 0.1140  0.3963  0.3496  107 GLY A N   
366  C CA  . GLY A 63  ? 2.2183 2.4938 1.5941 0.1335  0.3976  0.3694  107 GLY A CA  
367  C C   . GLY A 63  ? 2.2644 2.4985 1.5470 0.1228  0.3349  0.3099  107 GLY A C   
368  O O   . GLY A 63  ? 2.3206 2.5119 1.5100 0.1382  0.3162  0.2574  107 GLY A O   
369  N N   . GLN A 64  ? 2.1575 2.4040 1.4709 0.0964  0.3014  0.3186  108 GLN A N   
370  C CA  . GLN A 64  ? 2.1892 2.4071 1.4313 0.0859  0.2412  0.2689  108 GLN A CA  
371  C C   . GLN A 64  ? 2.1124 2.3493 1.4551 0.0294  0.1916  0.2507  108 GLN A C   
372  O O   . GLN A 64  ? 2.0447 2.3136 1.4954 0.0041  0.2009  0.2880  108 GLN A O   
373  C CB  . GLN A 64  ? 2.2422 2.4487 1.3917 0.1224  0.2463  0.2939  108 GLN A CB  
374  C CG  . GLN A 64  ? 2.1921 2.4318 1.4209 0.1065  0.2556  0.3506  108 GLN A CG  
375  C CD  . GLN A 64  ? 2.2527 2.4791 1.3862 0.1545  0.2822  0.3917  108 GLN A CD  
376  O OE1 . GLN A 64  ? 2.3285 2.5233 1.3361 0.2062  0.3047  0.3862  108 GLN A OE1 
377  N NE2 . GLN A 64  ? 2.2206 2.4654 1.4081 0.1406  0.2798  0.4333  108 GLN A NE2 
378  N N   . SER A 65  ? 1.5255 1.7403 0.8336 0.0113  0.1389  0.1932  109 SER A N   
379  C CA  . SER A 65  ? 1.4503 1.6794 0.8393 -0.0355 0.0943  0.1746  109 SER A CA  
380  C C   . SER A 65  ? 1.4640 1.6890 0.8049 -0.0337 0.0531  0.1602  109 SER A C   
381  O O   . SER A 65  ? 1.5219 1.7214 0.7653 -0.0104 0.0337  0.1285  109 SER A O   
382  C CB  . SER A 65  ? 1.4236 1.6359 0.8336 -0.0617 0.0701  0.1234  109 SER A CB  
383  O OG  . SER A 65  ? 1.3986 1.6193 0.8720 -0.0684 0.1009  0.1382  109 SER A OG  
384  N N   . LYS A 66  ? 1.4617 1.7095 0.8695 -0.0556 0.0374  0.1829  110 LYS A N   
385  C CA  . LYS A 66  ? 1.4654 1.7143 0.8417 -0.0549 -0.0038 0.1704  110 LYS A CA  
386  C C   . LYS A 66  ? 1.3922 1.6515 0.8431 -0.0962 -0.0440 0.1392  110 LYS A C   
387  O O   . LYS A 66  ? 1.3414 1.6098 0.8769 -0.1227 -0.0355 0.1496  110 LYS A O   
388  C CB  . LYS A 66  ? 1.4740 1.7360 0.8586 -0.0401 0.0134  0.2258  110 LYS A CB  
389  C CG  . LYS A 66  ? 1.5329 1.7887 0.8648 -0.0002 0.0673  0.2713  110 LYS A CG  
390  C CD  . LYS A 66  ? 1.6218 1.8483 0.8172 0.0435  0.0653  0.2460  110 LYS A CD  
391  C CE  . LYS A 66  ? 1.6526 1.8705 0.7787 0.0582  0.0183  0.2281  110 LYS A CE  
392  N NZ  . LYS A 66  ? 1.7480 1.9302 0.7309 0.1050  0.0094  0.2013  110 LYS A NZ  
393  N N   . LEU A 67  ? 1.3935 1.6510 0.8138 -0.0996 -0.0881 0.1018  111 LEU A N   
394  C CA  . LEU A 67  ? 1.3156 1.5851 0.8064 -0.1349 -0.1212 0.0745  111 LEU A CA  
395  C C   . LEU A 67  ? 1.2946 1.5818 0.7835 -0.1321 -0.1591 0.0724  111 LEU A C   
396  O O   . LEU A 67  ? 1.3323 1.6161 0.7527 -0.1112 -0.1846 0.0546  111 LEU A O   
397  C CB  . LEU A 67  ? 1.2974 1.5507 0.7799 -0.1498 -0.1368 0.0238  111 LEU A CB  
398  C CG  . LEU A 67  ? 1.2057 1.4700 0.7611 -0.1845 -0.1635 -0.0029 111 LEU A CG  
399  C CD1 . LEU A 67  ? 1.1580 1.4272 0.7900 -0.2038 -0.1422 0.0207  111 LEU A CD1 
400  C CD2 . LEU A 67  ? 1.1943 1.4376 0.7370 -0.1978 -0.1774 -0.0503 111 LEU A CD2 
401  N N   . TYR A 68  ? 1.2923 1.5956 0.8529 -0.1500 -0.1651 0.0898  112 TYR A N   
402  C CA  . TYR A 68  ? 1.2717 1.5933 0.8369 -0.1439 -0.1970 0.0937  112 TYR A CA  
403  C C   . TYR A 68  ? 1.1792 1.5169 0.8154 -0.1717 -0.2227 0.0664  112 TYR A C   
404  O O   . TYR A 68  ? 1.1310 1.4616 0.8196 -0.1942 -0.2080 0.0612  112 TYR A O   
405  C CB  . TYR A 68  ? 1.2939 1.6157 0.8745 -0.1325 -0.1790 0.1451  112 TYR A CB  
406  C CG  . TYR A 68  ? 1.3686 1.6767 0.8955 -0.1059 -0.1426 0.1836  112 TYR A CG  
407  C CD1 . TYR A 68  ? 1.3772 1.6763 0.9294 -0.1128 -0.1027 0.2028  112 TYR A CD1 
408  C CD2 . TYR A 68  ? 1.4257 1.7309 0.8799 -0.0713 -0.1460 0.2045  112 TYR A CD2 
409  C CE1 . TYR A 68  ? 1.4296 1.7213 0.9430 -0.0870 -0.0632 0.2432  112 TYR A CE1 
410  C CE2 . TYR A 68  ? 1.4881 1.7794 0.8921 -0.0434 -0.1056 0.2450  112 TYR A CE2 
411  C CZ  . TYR A 68  ? 1.4856 1.7723 0.9231 -0.0518 -0.0621 0.2654  112 TYR A CZ  
412  O OH  . TYR A 68  ? 1.5377 1.8155 0.9335 -0.0221 -0.0159 0.3107  112 TYR A OH  
413  N N   . ARG A 69  ? 1.3613 1.7211 0.9997 -0.1671 -0.2595 0.0515  113 ARG A N   
414  C CA  . ARG A 69  ? 1.2729 1.6540 0.9840 -0.1894 -0.2793 0.0306  113 ARG A CA  
415  C C   . ARG A 69  ? 1.2583 1.6647 0.9918 -0.1767 -0.3026 0.0464  113 ARG A C   
416  O O   . ARG A 69  ? 1.3108 1.7256 0.9953 -0.1520 -0.3231 0.0540  113 ARG A O   
417  C CB  . ARG A 69  ? 1.2510 1.6402 0.9640 -0.2030 -0.3045 -0.0150 113 ARG A CB  
418  C CG  . ARG A 69  ? 1.1690 1.5873 0.9628 -0.2239 -0.3239 -0.0338 113 ARG A CG  
419  C CD  . ARG A 69  ? 1.1698 1.6000 0.9650 -0.2341 -0.3587 -0.0752 113 ARG A CD  
420  N NE  . ARG A 69  ? 1.1209 1.5956 0.9882 -0.2426 -0.3904 -0.0861 113 ARG A NE  
421  C CZ  . ARG A 69  ? 1.0588 1.5492 1.0066 -0.2701 -0.3889 -0.1037 113 ARG A CZ  
422  N NH1 . ARG A 69  ? 1.0380 1.4974 0.9943 -0.2903 -0.3591 -0.1134 113 ARG A NH1 
423  N NH2 . ARG A 69  ? 1.0236 1.5613 1.0459 -0.2754 -0.4147 -0.1089 113 ARG A NH2 
424  N N   . SER A 70  ? 1.1274 1.5423 0.9286 -0.1895 -0.2991 0.0514  114 SER A N   
425  C CA  . SER A 70  ? 1.1135 1.5514 0.9439 -0.1762 -0.3183 0.0655  114 SER A CA  
426  C C   . SER A 70  ? 1.0403 1.5056 0.9448 -0.1919 -0.3284 0.0440  114 SER A C   
427  O O   . SER A 70  ? 0.9975 1.4474 0.9368 -0.2097 -0.3057 0.0381  114 SER A O   
428  C CB  . SER A 70  ? 1.1323 1.5436 0.9686 -0.1680 -0.2969 0.1035  114 SER A CB  
429  O OG  . SER A 70  ? 1.1175 1.5444 0.9858 -0.1550 -0.3125 0.1146  114 SER A OG  
430  N N   . GLU A 71  ? 1.2005 1.7070 1.1306 -0.1828 -0.3609 0.0346  115 GLU A N   
431  C CA  . GLU A 71  ? 1.1443 1.6847 1.1570 -0.1934 -0.3660 0.0224  115 GLU A CA  
432  C C   . GLU A 71  ? 1.1467 1.6938 1.1875 -0.1729 -0.3618 0.0493  115 GLU A C   
433  O O   . GLU A 71  ? 1.1166 1.6920 1.2239 -0.1743 -0.3603 0.0456  115 GLU A O   
434  C CB  . GLU A 71  ? 1.1355 1.7252 1.1807 -0.1974 -0.4072 -0.0051 115 GLU A CB  
435  C CG  . GLU A 71  ? 1.1491 1.7293 1.1607 -0.2136 -0.4232 -0.0373 115 GLU A CG  
436  C CD  . GLU A 71  ? 1.1453 1.7722 1.1986 -0.2192 -0.4734 -0.0673 115 GLU A CD  
437  O OE1 . GLU A 71  ? 1.1543 1.8216 1.2303 -0.1997 -0.5054 -0.0598 115 GLU A OE1 
438  O OE2 . GLU A 71  ? 1.1369 1.7586 1.2032 -0.2432 -0.4840 -0.0993 115 GLU A OE2 
439  N N   . ASP A 72  ? 1.1435 1.6641 1.1343 -0.1519 -0.3593 0.0777  116 ASP A N   
440  C CA  . ASP A 72  ? 1.1606 1.6761 1.1659 -0.1288 -0.3579 0.1044  116 ASP A CA  
441  C C   . ASP A 72  ? 1.1698 1.6330 1.1741 -0.1301 -0.3278 0.1227  116 ASP A C   
442  O O   . ASP A 72  ? 1.2036 1.6476 1.2025 -0.1091 -0.3287 0.1465  116 ASP A O   
443  C CB  . ASP A 72  ? 1.2108 1.7305 1.1696 -0.1000 -0.3805 0.1265  116 ASP A CB  
444  C CG  . ASP A 72  ? 1.2612 1.7717 1.1518 -0.0994 -0.3878 0.1239  116 ASP A CG  
445  O OD1 . ASP A 72  ? 1.2643 1.7586 1.1424 -0.1216 -0.3712 0.1080  116 ASP A OD1 
446  O OD2 . ASP A 72  ? 1.3058 1.8229 1.1506 -0.0726 -0.4090 0.1385  116 ASP A OD2 
447  N N   . TYR A 73  ? 1.0192 1.4549 1.0237 -0.1526 -0.3051 0.1114  117 TYR A N   
448  C CA  . TYR A 73  ? 1.0342 1.4144 1.0294 -0.1551 -0.2838 0.1259  117 TYR A CA  
449  C C   . TYR A 73  ? 1.0858 1.4327 1.0396 -0.1514 -0.2811 0.1526  117 TYR A C   
450  O O   . TYR A 73  ? 1.1161 1.4211 1.0697 -0.1458 -0.2759 0.1721  117 TYR A O   
451  C CB  . TYR A 73  ? 1.0510 1.4145 1.0701 -0.1359 -0.2819 0.1353  117 TYR A CB  
452  C CG  . TYR A 73  ? 1.0237 1.4019 1.0844 -0.1384 -0.2689 0.1162  117 TYR A CG  
453  C CD1 . TYR A 73  ? 1.0351 1.4728 1.1388 -0.1434 -0.2753 0.0998  117 TYR A CD1 
454  C CD2 . TYR A 73  ? 0.9992 1.3290 1.0567 -0.1344 -0.2505 0.1156  117 TYR A CD2 
455  C CE1 . TYR A 73  ? 1.0281 1.4802 1.1787 -0.1460 -0.2563 0.0882  117 TYR A CE1 
456  C CE2 . TYR A 73  ? 0.9941 1.3324 1.0820 -0.1318 -0.2317 0.1027  117 TYR A CE2 
457  C CZ  . TYR A 73  ? 1.0114 1.4122 1.1493 -0.1383 -0.2309 0.0914  117 TYR A CZ  
458  O OH  . TYR A 73  ? 1.0242 1.4315 1.1979 -0.1353 -0.2051 0.0845  117 TYR A OH  
459  N N   . GLY A 74  ? 0.9144 1.2762 0.8338 -0.1537 -0.2836 0.1543  118 GLY A N   
460  C CA  . GLY A 74  ? 0.9786 1.3133 0.8632 -0.1478 -0.2738 0.1856  118 GLY A CA  
461  C C   . GLY A 74  ? 1.0311 1.3680 0.8870 -0.1212 -0.2860 0.2148  118 GLY A C   
462  O O   . GLY A 74  ? 1.0869 1.3980 0.9185 -0.1152 -0.2728 0.2472  118 GLY A O   
463  N N   . LYS A 75  ? 1.0930 1.4611 0.9551 -0.1037 -0.3098 0.2068  119 LYS A N   
464  C CA  . LYS A 75  ? 1.1430 1.5116 0.9716 -0.0745 -0.3230 0.2351  119 LYS A CA  
465  C C   . LYS A 75  ? 1.1846 1.5668 0.9511 -0.0633 -0.3272 0.2386  119 LYS A C   
466  O O   . LYS A 75  ? 1.2456 1.6081 0.9671 -0.0419 -0.3214 0.2731  119 LYS A O   
467  C CB  . LYS A 75  ? 1.1207 1.5223 0.9762 -0.0549 -0.3495 0.2266  119 LYS A CB  
468  C CG  . LYS A 75  ? 1.1022 1.4832 1.0050 -0.0546 -0.3427 0.2280  119 LYS A CG  
469  C CD  . LYS A 75  ? 1.0847 1.5096 1.0208 -0.0330 -0.3649 0.2191  119 LYS A CD  
470  C CE  . LYS A 75  ? 1.0899 1.4878 1.0594 -0.0226 -0.3549 0.2245  119 LYS A CE  
471  N NZ  . LYS A 75  ? 1.0682 1.5194 1.0862 -0.0053 -0.3682 0.2121  119 LYS A NZ  
472  N N   . ASN A 76  ? 1.2128 1.6231 0.9724 -0.0753 -0.3364 0.2037  120 ASN A N   
473  C CA  . ASN A 76  ? 1.2627 1.6768 0.9513 -0.0622 -0.3409 0.2009  120 ASN A CA  
474  C C   . ASN A 76  ? 1.2421 1.6564 0.9290 -0.0865 -0.3295 0.1700  120 ASN A C   
475  O O   . ASN A 76  ? 1.1762 1.6078 0.9159 -0.1098 -0.3364 0.1385  120 ASN A O   
476  C CB  . ASN A 76  ? 1.2727 1.7227 0.9351 -0.0381 -0.3844 0.1845  120 ASN A CB  
477  C CG  . ASN A 76  ? 1.2939 1.7461 0.9568 -0.0096 -0.3985 0.2141  120 ASN A CG  
478  O OD1 . ASN A 76  ? 1.3592 1.7840 0.9643 0.0162  -0.3879 0.2510  120 ASN A OD1 
479  N ND2 . ASN A 76  ? 1.2418 1.7250 0.9713 -0.0118 -0.4189 0.2011  120 ASN A ND2 
480  N N   . PHE A 77  ? 1.2244 1.6174 0.8505 -0.0788 -0.3085 0.1811  121 PHE A N   
481  C CA  . PHE A 77  ? 1.2178 1.6084 0.8304 -0.0955 -0.3002 0.1498  121 PHE A CA  
482  C C   . PHE A 77  ? 1.2773 1.6698 0.8045 -0.0708 -0.3209 0.1328  121 PHE A C   
483  O O   . PHE A 77  ? 1.3288 1.7215 0.8016 -0.0387 -0.3359 0.1513  121 PHE A O   
484  C CB  . PHE A 77  ? 1.2410 1.6026 0.8573 -0.1067 -0.2551 0.1728  121 PHE A CB  
485  C CG  . PHE A 77  ? 1.1843 1.5380 0.8794 -0.1348 -0.2416 0.1749  121 PHE A CG  
486  C CD1 . PHE A 77  ? 1.1774 1.5207 0.9099 -0.1332 -0.2410 0.2029  121 PHE A CD1 
487  C CD2 . PHE A 77  ? 1.1457 1.4951 0.8694 -0.1593 -0.2305 0.1487  121 PHE A CD2 
488  C CE1 . PHE A 77  ? 1.1363 1.4634 0.9287 -0.1543 -0.2329 0.2018  121 PHE A CE1 
489  C CE2 . PHE A 77  ? 1.0985 1.4348 0.8825 -0.1797 -0.2205 0.1500  121 PHE A CE2 
490  C CZ  . PHE A 77  ? 1.0953 1.4194 0.9112 -0.1766 -0.2231 0.1753  121 PHE A CZ  
491  N N   . LYS A 78  ? 1.4397 1.8265 0.9480 -0.0827 -0.3212 0.0983  122 LYS A N   
492  C CA  . LYS A 78  ? 1.5078 1.8841 0.9245 -0.0580 -0.3415 0.0764  122 LYS A CA  
493  C C   . LYS A 78  ? 1.5360 1.8840 0.9213 -0.0650 -0.3089 0.0654  122 LYS A C   
494  O O   . LYS A 78  ? 1.4790 1.8280 0.9254 -0.0976 -0.2976 0.0463  122 LYS A O   
495  C CB  . LYS A 78  ? 1.4757 1.8791 0.9105 -0.0654 -0.3993 0.0288  122 LYS A CB  
496  C CG  . LYS A 78  ? 1.5086 1.9315 0.9098 -0.0338 -0.4427 0.0349  122 LYS A CG  
497  C CD  . LYS A 78  ? 1.4453 1.9000 0.9296 -0.0404 -0.4467 0.0588  122 LYS A CD  
498  C CE  . LYS A 78  ? 1.4978 1.9617 0.9324 0.0006  -0.4767 0.0805  122 LYS A CE  
499  N NZ  . LYS A 78  ? 1.4483 1.9348 0.9545 0.0001  -0.4755 0.1080  122 LYS A NZ  
500  N N   . ASP A 79  ? 1.5066 1.8272 0.7928 -0.0306 -0.2914 0.0789  123 ASP A N   
501  C CA  . ASP A 79  ? 1.5401 1.8339 0.7956 -0.0311 -0.2537 0.0744  123 ASP A CA  
502  C C   . ASP A 79  ? 1.5457 1.8271 0.7716 -0.0390 -0.2871 0.0153  123 ASP A C   
503  O O   . ASP A 79  ? 1.6127 1.8773 0.7494 -0.0103 -0.3197 -0.0087 123 ASP A O   
504  C CB  . ASP A 79  ? 1.6369 1.9052 0.7956 0.0138  -0.2166 0.1140  123 ASP A CB  
505  C CG  . ASP A 79  ? 1.6828 1.9233 0.7950 0.0236  -0.1784 0.1080  123 ASP A CG  
506  O OD1 . ASP A 79  ? 1.6387 1.8788 0.8027 -0.0073 -0.1751 0.0794  123 ASP A OD1 
507  O OD2 . ASP A 79  ? 1.7654 1.9827 0.7861 0.0662  -0.1476 0.1352  123 ASP A OD2 
508  N N   . ILE A 80  ? 1.3956 1.6789 0.6932 -0.0763 -0.2779 -0.0066 124 ILE A N   
509  C CA  . ILE A 80  ? 1.3887 1.6554 0.6801 -0.0928 -0.3020 -0.0599 124 ILE A CA  
510  C C   . ILE A 80  ? 1.4423 1.6698 0.6819 -0.0834 -0.2645 -0.0663 124 ILE A C   
511  O O   . ILE A 80  ? 1.4272 1.6360 0.6777 -0.1029 -0.2748 -0.1057 124 ILE A O   
512  C CB  . ILE A 80  ? 1.2800 1.5726 0.6831 -0.1381 -0.3216 -0.0834 124 ILE A CB  
513  C CG1 . ILE A 80  ? 1.2199 1.5166 0.6971 -0.1612 -0.2767 -0.0565 124 ILE A CG1 
514  C CG2 . ILE A 80  ? 1.2464 1.5784 0.6920 -0.1404 -0.3630 -0.0829 124 ILE A CG2 
515  C CD1 . ILE A 80  ? 1.1190 1.4336 0.6911 -0.1984 -0.2885 -0.0762 124 ILE A CD1 
516  N N   . THR A 81  ? 1.6483 1.8652 0.8434 -0.0551 -0.2172 -0.0236 125 THR A N   
517  C CA  . THR A 81  ? 1.7061 1.8899 0.8490 -0.0378 -0.1766 -0.0233 125 THR A CA  
518  C C   . THR A 81  ? 1.7779 1.9190 0.8219 -0.0172 -0.2058 -0.0740 125 THR A C   
519  O O   . THR A 81  ? 1.8059 1.9155 0.8245 -0.0144 -0.1847 -0.0923 125 THR A O   
520  C CB  . THR A 81  ? 1.7694 1.9504 0.8629 0.0010  -0.1251 0.0328  125 THR A CB  
521  O OG1 . THR A 81  ? 1.7160 1.9311 0.8911 -0.0146 -0.1100 0.0791  125 THR A OG1 
522  C CG2 . THR A 81  ? 1.7982 1.9605 0.8807 0.0112  -0.0731 0.0436  125 THR A CG2 
523  N N   . ASP A 82  ? 2.0827 2.2196 1.0697 -0.0010 -0.2577 -0.0979 126 ASP A N   
524  C CA  . ASP A 82  ? 2.1613 2.2516 1.0493 0.0199  -0.2970 -0.1505 126 ASP A CA  
525  C C   . ASP A 82  ? 2.1047 2.1853 1.0579 -0.0245 -0.3288 -0.2033 126 ASP A C   
526  O O   . ASP A 82  ? 2.1656 2.1972 1.0499 -0.0142 -0.3519 -0.2484 126 ASP A O   
527  C CB  . ASP A 82  ? 2.2141 2.3035 1.0290 0.0490  -0.3525 -0.1635 126 ASP A CB  
528  C CG  . ASP A 82  ? 2.3285 2.3570 0.9947 0.1006  -0.3576 -0.1822 126 ASP A CG  
529  O OD1 . ASP A 82  ? 2.3769 2.3723 0.9817 0.1271  -0.3042 -0.1674 126 ASP A OD1 
530  O OD2 . ASP A 82  ? 2.3546 2.3713 0.9919 0.1091  -0.4054 -0.2055 126 ASP A OD2 
531  N N   . LEU A 83  ? 1.8732 1.9956 0.9560 -0.0716 -0.3279 -0.1960 127 LEU A N   
532  C CA  . LEU A 83  ? 1.8094 1.9262 0.9679 -0.1156 -0.3488 -0.2364 127 LEU A CA  
533  C C   . LEU A 83  ? 1.8164 1.9000 0.9771 -0.1223 -0.3016 -0.2368 127 LEU A C   
534  O O   . LEU A 83  ? 1.8064 1.8611 0.9865 -0.1454 -0.3167 -0.2760 127 LEU A O   
535  C CB  . LEU A 83  ? 1.6880 1.8589 0.9770 -0.1568 -0.3577 -0.2236 127 LEU A CB  
536  C CG  . LEU A 83  ? 1.6648 1.8775 0.9775 -0.1549 -0.4044 -0.2219 127 LEU A CG  
537  C CD1 . LEU A 83  ? 1.5452 1.8052 0.9899 -0.1953 -0.4075 -0.2140 127 LEU A CD1 
538  C CD2 . LEU A 83  ? 1.7237 1.9170 0.9820 -0.1455 -0.4691 -0.2711 127 LEU A CD2 
539  N N   . ILE A 84  ? 1.8788 1.9679 1.0288 -0.1032 -0.2450 -0.1917 128 ILE A N   
540  C CA  . ILE A 84  ? 1.8918 1.9537 1.0434 -0.1034 -0.1997 -0.1883 128 ILE A CA  
541  C C   . ILE A 84  ? 2.0057 2.0191 1.0347 -0.0560 -0.1796 -0.1953 128 ILE A C   
542  O O   . ILE A 84  ? 2.0278 2.0231 1.0490 -0.0448 -0.1341 -0.1829 128 ILE A O   
543  C CB  . ILE A 84  ? 1.8392 1.9353 1.0683 -0.1139 -0.1511 -0.1383 128 ILE A CB  
544  C CG1 . ILE A 84  ? 1.8728 1.9945 1.0751 -0.0840 -0.1278 -0.0885 128 ILE A CG1 
545  C CG2 . ILE A 84  ? 1.7297 1.8565 1.0718 -0.1594 -0.1665 -0.1400 128 ILE A CG2 
546  C CD1 . ILE A 84  ? 1.8215 1.9769 1.1114 -0.0983 -0.0896 -0.0401 128 ILE A CD1 
547  N N   . ASN A 85  ? 2.0915 2.0848 1.0224 -0.0236 -0.2126 -0.2123 129 ASN A N   
548  C CA  . ASN A 85  ? 2.2091 2.1494 1.0018 0.0310  -0.1960 -0.2199 129 ASN A CA  
549  C C   . ASN A 85  ? 2.2372 2.1946 1.0105 0.0660  -0.1249 -0.1579 129 ASN A C   
550  O O   . ASN A 85  ? 2.2973 2.2188 0.9986 0.1028  -0.0841 -0.1531 129 ASN A O   
551  C CB  . ASN A 85  ? 2.2449 2.1238 0.9994 0.0292  -0.2020 -0.2691 129 ASN A CB  
552  C CG  . ASN A 85  ? 2.2708 2.1094 0.9841 0.0188  -0.2780 -0.3346 129 ASN A CG  
553  O OD1 . ASN A 85  ? 2.2120 2.0854 0.9913 -0.0137 -0.3274 -0.3474 129 ASN A OD1 
554  N ND2 . ASN A 85  ? 2.3527 2.1221 0.9720 0.0451  -0.2855 -0.3734 129 ASN A ND2 
555  N N   . ASN A 86  ? 2.0872 2.0993 0.9319 0.0539  -0.1101 -0.1097 130 ASN A N   
556  C CA  . ASN A 86  ? 2.1023 2.1386 0.9546 0.0792  -0.0459 -0.0448 130 ASN A CA  
557  C C   . ASN A 86  ? 2.1011 2.1299 0.9808 0.0828  0.0090  -0.0308 130 ASN A C   
558  O O   . ASN A 86  ? 2.1478 2.1707 0.9777 0.1250  0.0625  0.0060  130 ASN A O   
559  C CB  . ASN A 86  ? 2.1896 2.2044 0.9126 0.1398  -0.0322 -0.0224 130 ASN A CB  
560  C CG  . ASN A 86  ? 2.1819 2.2194 0.8985 0.1400  -0.0719 -0.0119 130 ASN A CG  
561  O OD1 . ASN A 86  ? 2.1509 2.2260 0.9204 0.1375  -0.0455 0.0419  130 ASN A OD1 
562  N ND2 . ASN A 86  ? 2.2094 2.2218 0.8618 0.1446  -0.1374 -0.0632 130 ASN A ND2 
563  N N   . THR A 87  ? 1.9624 1.9910 0.9203 0.0418  -0.0025 -0.0583 131 THR A N   
564  C CA  . THR A 87  ? 1.9621 1.9831 0.9477 0.0462  0.0442  -0.0475 131 THR A CA  
565  C C   . THR A 87  ? 1.8808 1.9553 0.9936 0.0176  0.0720  -0.0006 131 THR A C   
566  O O   . THR A 87  ? 1.8267 1.9367 0.9992 -0.0057 0.0545  0.0197  131 THR A O   
567  C CB  . THR A 87  ? 1.9524 1.9318 0.9388 0.0247  0.0201  -0.1029 131 THR A CB  
568  O OG1 . THR A 87  ? 1.8575 1.8615 0.9492 -0.0297 -0.0116 -0.1159 131 THR A OG1 
569  C CG2 . THR A 87  ? 2.0286 1.9488 0.8956 0.0471  -0.0203 -0.1567 131 THR A CG2 
570  N N   . PHE A 88  ? 1.8081 1.8855 0.9617 0.0209  0.1119  0.0149  132 PHE A N   
571  C CA  . PHE A 88  ? 1.7411 1.8670 1.0105 0.0007  0.1380  0.0618  132 PHE A CA  
572  C C   . PHE A 88  ? 1.6672 1.7978 1.0272 -0.0448 0.1136  0.0404  132 PHE A C   
573  O O   . PHE A 88  ? 1.6764 1.7793 1.0313 -0.0468 0.1168  0.0128  132 PHE A O   
574  C CB  . PHE A 88  ? 1.7756 1.9130 1.0482 0.0361  0.1992  0.1028  132 PHE A CB  
575  C CG  . PHE A 88  ? 1.7064 1.8978 1.0973 0.0202  0.2244  0.1588  132 PHE A CG  
576  C CD1 . PHE A 88  ? 1.6806 1.9012 1.0967 0.0177  0.2268  0.1992  132 PHE A CD1 
577  C CD2 . PHE A 88  ? 1.6650 1.8748 1.1436 0.0079  0.2421  0.1704  132 PHE A CD2 
578  C CE1 . PHE A 88  ? 1.6096 1.8743 1.1405 0.0000  0.2455  0.2491  132 PHE A CE1 
579  C CE2 . PHE A 88  ? 1.5937 1.8513 1.1872 -0.0083 0.2573  0.2191  132 PHE A CE2 
580  C CZ  . PHE A 88  ? 1.5632 1.8470 1.1850 -0.0139 0.2585  0.2578  132 PHE A CZ  
581  N N   . ILE A 89  ? 1.5772 1.7381 1.0135 -0.0775 0.0907  0.0543  133 ILE A N   
582  C CA  . ILE A 89  ? 1.5138 1.6768 1.0280 -0.1159 0.0684  0.0376  133 ILE A CA  
583  C C   . ILE A 89  ? 1.4759 1.6643 1.0772 -0.1219 0.0931  0.0735  133 ILE A C   
584  O O   . ILE A 89  ? 1.4557 1.6766 1.0995 -0.1167 0.1101  0.1178  133 ILE A O   
585  C CB  . ILE A 89  ? 1.4656 1.6429 1.0126 -0.1443 0.0292  0.0309  133 ILE A CB  
586  C CG1 . ILE A 89  ? 1.4905 1.6496 0.9638 -0.1390 -0.0014 -0.0040 133 ILE A CG1 
587  C CG2 . ILE A 89  ? 1.4118 1.5837 1.0246 -0.1772 0.0110  0.0129  133 ILE A CG2 
588  C CD1 . ILE A 89  ? 1.5043 1.6229 0.9393 -0.1437 -0.0140 -0.0526 133 ILE A CD1 
589  N N   . ARG A 90  ? 1.5556 1.7272 1.1852 -0.1325 0.0929  0.0545  134 ARG A N   
590  C CA  . ARG A 90  ? 1.5183 1.7107 1.2306 -0.1378 0.1070  0.0819  134 ARG A CA  
591  C C   . ARG A 90  ? 1.4464 1.6506 1.2275 -0.1694 0.0756  0.0870  134 ARG A C   
592  O O   . ARG A 90  ? 1.4317 1.6136 1.2059 -0.1889 0.0491  0.0559  134 ARG A O   
593  C CB  . ARG A 90  ? 1.5449 1.7086 1.2495 -0.1315 0.1170  0.0586  134 ARG A CB  
594  C CG  . ARG A 90  ? 1.6108 1.7644 1.2595 -0.0933 0.1556  0.0622  134 ARG A CG  
595  C CD  . ARG A 90  ? 1.6412 1.7579 1.2738 -0.0852 0.1634  0.0353  134 ARG A CD  
596  N NE  . ARG A 90  ? 1.6100 1.7444 1.3280 -0.0949 0.1631  0.0525  134 ARG A NE  
597  C CZ  . ARG A 90  ? 1.6118 1.7829 1.3880 -0.0765 0.1901  0.0900  134 ARG A CZ  
598  N NH1 . ARG A 90  ? 1.6410 1.8361 1.4000 -0.0466 0.2277  0.1185  134 ARG A NH1 
599  N NH2 . ARG A 90  ? 1.5879 1.7719 1.4410 -0.0862 0.1794  0.1003  134 ARG A NH2 
600  N N   . THR A 91  ? 1.4790 1.7156 1.3272 -0.1731 0.0798  0.1273  135 THR A N   
601  C CA  . THR A 91  ? 1.4036 1.6449 1.3072 -0.1987 0.0481  0.1327  135 THR A CA  
602  C C   . THR A 91  ? 1.3557 1.5813 1.3060 -0.2120 0.0303  0.1200  135 THR A C   
603  O O   . THR A 91  ? 1.2936 1.5067 1.2640 -0.2295 0.0012  0.1108  135 THR A O   
604  C CB  . THR A 91  ? 1.3637 1.6369 1.3258 -0.1996 0.0547  0.1795  135 THR A CB  
605  O OG1 . THR A 91  ? 1.4193 1.7078 1.3379 -0.1766 0.0856  0.2017  135 THR A OG1 
606  C CG2 . THR A 91  ? 1.3051 1.5728 1.2869 -0.2200 0.0206  0.1784  135 THR A CG2 
607  N N   . GLU A 92  ? 1.4466 1.6704 1.4088 -0.1993 0.0486  0.1205  136 GLU A N   
608  C CA  . GLU A 92  ? 1.4241 1.6298 1.4214 -0.2053 0.0325  0.1091  136 GLU A CA  
609  C C   . GLU A 92  ? 1.4062 1.5728 1.3622 -0.2188 0.0101  0.0724  136 GLU A C   
610  O O   . GLU A 92  ? 1.3523 1.5012 1.3329 -0.2281 -0.0137 0.0668  136 GLU A O   
611  C CB  . GLU A 92  ? 1.4946 1.6967 1.4847 -0.1841 0.0587  0.1065  136 GLU A CB  
612  C CG  . GLU A 92  ? 1.5138 1.7584 1.5461 -0.1645 0.0913  0.1452  136 GLU A CG  
613  C CD  . GLU A 92  ? 1.5612 1.8126 1.5294 -0.1456 0.1242  0.1509  136 GLU A CD  
614  O OE1 . GLU A 92  ? 1.5566 1.7964 1.4747 -0.1546 0.1120  0.1375  136 GLU A OE1 
615  O OE2 . GLU A 92  ? 1.6059 1.8731 1.5708 -0.1182 0.1619  0.1689  136 GLU A OE2 
616  N N   . PHE A 93  ? 1.1367 1.2884 1.0298 -0.2181 0.0180  0.0482  137 PHE A N   
617  C CA  . PHE A 93  ? 1.1159 1.2357 0.9784 -0.2319 0.0025  0.0160  137 PHE A CA  
618  C C   . PHE A 93  ? 1.0496 1.1814 0.9127 -0.2465 -0.0178 0.0153  137 PHE A C   
619  O O   . PHE A 93  ? 0.9931 1.1065 0.8469 -0.2588 -0.0305 -0.0057 137 PHE A O   
620  C CB  . PHE A 93  ? 1.1901 1.2842 0.9947 -0.2258 0.0170  -0.0125 137 PHE A CB  
621  C CG  . PHE A 93  ? 1.2549 1.3321 1.0516 -0.2075 0.0392  -0.0133 137 PHE A CG  
622  C CD1 . PHE A 93  ? 1.2500 1.2949 1.0553 -0.2084 0.0376  -0.0242 137 PHE A CD1 
623  C CD2 . PHE A 93  ? 1.3091 1.4006 1.0850 -0.1848 0.0642  -0.0015 137 PHE A CD2 
624  C CE1 . PHE A 93  ? 1.3175 1.3465 1.1152 -0.1883 0.0572  -0.0241 137 PHE A CE1 
625  C CE2 . PHE A 93  ? 1.3554 1.4327 1.1253 -0.1638 0.0867  -0.0011 137 PHE A CE2 
626  C CZ  . PHE A 93  ? 1.3654 1.4122 1.1482 -0.1663 0.0817  -0.0131 137 PHE A CZ  
627  N N   . GLY A 94  ? 1.1438 1.3067 1.0201 -0.2431 -0.0180 0.0406  138 GLY A N   
628  C CA  . GLY A 94  ? 1.0964 1.2712 0.9746 -0.2530 -0.0375 0.0435  138 GLY A CA  
629  C C   . GLY A 94  ? 1.0976 1.2632 0.9352 -0.2600 -0.0468 0.0123  138 GLY A C   
630  O O   . GLY A 94  ? 1.1629 1.3174 0.9587 -0.2548 -0.0377 -0.0082 138 GLY A O   
631  N N   . MET A 95  ? 1.1280 1.2964 0.9819 -0.2713 -0.0667 0.0082  139 MET A N   
632  C CA  . MET A 95  ? 1.1016 1.2701 0.9384 -0.2807 -0.0790 -0.0178 139 MET A CA  
633  C C   . MET A 95  ? 1.0329 1.1779 0.8913 -0.2920 -0.0800 -0.0327 139 MET A C   
634  O O   . MET A 95  ? 0.9835 1.1242 0.8676 -0.2922 -0.0863 -0.0210 139 MET A O   
635  C CB  . MET A 95  ? 1.0845 1.2802 0.9275 -0.2803 -0.0973 -0.0060 139 MET A CB  
636  C CG  . MET A 95  ? 1.1750 1.3896 0.9909 -0.2651 -0.0926 0.0146  139 MET A CG  
637  S SD  . MET A 95  ? 1.1770 1.4190 0.9865 -0.2600 -0.1152 0.0263  139 MET A SD  
638  C CE  . MET A 95  ? 1.1339 1.3756 0.9950 -0.2621 -0.1176 0.0600  139 MET A CE  
639  N N   . ALA A 96  ? 1.0394 1.1634 0.8839 -0.2989 -0.0723 -0.0574 140 ALA A N   
640  C CA  . ALA A 96  ? 1.0015 1.0989 0.8641 -0.3062 -0.0657 -0.0657 140 ALA A CA  
641  C C   . ALA A 96  ? 0.9609 1.0724 0.8468 -0.3197 -0.0754 -0.0769 140 ALA A C   
642  O O   . ALA A 96  ? 0.9720 1.0879 0.8565 -0.3315 -0.0807 -0.0976 140 ALA A O   
643  C CB  . ALA A 96  ? 1.0458 1.1076 0.8885 -0.3062 -0.0482 -0.0816 140 ALA A CB  
644  N N   . ILE A 97  ? 0.9808 1.0981 0.8907 -0.3167 -0.0789 -0.0633 141 ILE A N   
645  C CA  . ILE A 97  ? 0.9527 1.0939 0.8939 -0.3249 -0.0867 -0.0674 141 ILE A CA  
646  C C   . ILE A 97  ? 0.9566 1.0759 0.9207 -0.3311 -0.0672 -0.0732 141 ILE A C   
647  O O   . ILE A 97  ? 0.9774 1.0625 0.9299 -0.3195 -0.0515 -0.0641 141 ILE A O   
648  C CB  . ILE A 97  ? 0.9322 1.0944 0.8851 -0.3135 -0.1002 -0.0474 141 ILE A CB  
649  C CG1 . ILE A 97  ? 0.9429 1.1203 0.8753 -0.3060 -0.1132 -0.0342 141 ILE A CG1 
650  C CG2 . ILE A 97  ? 0.9149 1.1117 0.9037 -0.3191 -0.1097 -0.0510 141 ILE A CG2 
651  C CD1 . ILE A 97  ? 0.9707 1.1704 0.8835 -0.3104 -0.1223 -0.0459 141 ILE A CD1 
652  N N   . GLY A 98  ? 0.8155 0.9537 0.8134 -0.3483 -0.0689 -0.0874 142 GLY A N   
653  C CA  . GLY A 98  ? 0.8279 0.9509 0.8602 -0.3563 -0.0456 -0.0882 142 GLY A CA  
654  C C   . GLY A 98  ? 0.8367 0.9637 0.8849 -0.3397 -0.0338 -0.0675 142 GLY A C   
655  O O   . GLY A 98  ? 0.8210 0.9736 0.8690 -0.3285 -0.0510 -0.0575 142 GLY A O   
656  N N   . PRO A 99  ? 0.9161 1.0122 0.9720 -0.3345 -0.0024 -0.0599 143 PRO A N   
657  C CA  . PRO A 99  ? 0.9587 1.0470 1.0150 -0.3110 0.0141  -0.0402 143 PRO A CA  
658  C C   . PRO A 99  ? 0.9382 1.0813 1.0535 -0.3146 0.0084  -0.0342 143 PRO A C   
659  O O   . PRO A 99  ? 0.9010 1.0816 1.0725 -0.3393 0.0025  -0.0444 143 PRO A O   
660  C CB  . PRO A 99  ? 1.0184 1.0637 1.0732 -0.3069 0.0542  -0.0339 143 PRO A CB  
661  C CG  . PRO A 99  ? 0.9842 1.0371 1.0753 -0.3388 0.0566  -0.0502 143 PRO A CG  
662  C CD  . PRO A 99  ? 0.9410 1.0047 1.0042 -0.3483 0.0217  -0.0683 143 PRO A CD  
663  N N   . GLU A 100 ? 1.1687 1.3144 1.2726 -0.2894 0.0072  -0.0191 144 GLU A N   
664  C CA  . GLU A 100 ? 1.1721 1.3657 1.3328 -0.2849 0.0100  -0.0088 144 GLU A CA  
665  C C   . GLU A 100 ? 1.0987 1.3554 1.3085 -0.3074 -0.0238 -0.0203 144 GLU A C   
666  O O   . GLU A 100 ? 1.0627 1.3254 1.2405 -0.3110 -0.0553 -0.0288 144 GLU A O   
667  C CB  . GLU A 100 ? 1.2139 1.4065 1.4217 -0.2851 0.0531  0.0023  144 GLU A CB  
668  C CG  . GLU A 100 ? 1.3164 1.4471 1.4684 -0.2509 0.0894  0.0186  144 GLU A CG  
669  C CD  . GLU A 100 ? 1.3493 1.4683 1.5382 -0.2522 0.1393  0.0322  144 GLU A CD  
670  O OE1 . GLU A 100 ? 1.3204 1.4245 1.5215 -0.2774 0.1475  0.0230  144 GLU A OE1 
671  O OE2 . GLU A 100 ? 1.4070 1.5287 1.6118 -0.2261 0.1731  0.0539  144 GLU A OE2 
672  N N   . ASN A 101 ? 1.0847 1.3879 1.3736 -0.3205 -0.0166 -0.0189 145 ASN A N   
673  C CA  . ASN A 101 ? 1.0311 1.3959 1.3737 -0.3400 -0.0531 -0.0314 145 ASN A CA  
674  C C   . ASN A 101 ? 0.9968 1.3671 1.3652 -0.3749 -0.0693 -0.0564 145 ASN A C   
675  O O   . ASN A 101 ? 0.9689 1.3884 1.3922 -0.3922 -0.1006 -0.0694 145 ASN A O   
676  C CB  . ASN A 101 ? 1.0386 1.4610 1.4610 -0.3314 -0.0483 -0.0162 145 ASN A CB  
677  C CG  . ASN A 101 ? 1.0611 1.4921 1.4512 -0.2993 -0.0609 -0.0016 145 ASN A CG  
678  O OD1 . ASN A 101 ? 1.0848 1.4681 1.3967 -0.2810 -0.0617 0.0023  145 ASN A OD1 
679  N ND2 . ASN A 101 ? 1.0558 1.5473 1.5115 -0.2925 -0.0727 0.0067  145 ASN A ND2 
680  N N   . SER A 102 ? 0.9863 1.3030 1.3164 -0.3832 -0.0494 -0.0637 146 SER A N   
681  C CA  . SER A 102 ? 0.9731 1.2780 1.3115 -0.4128 -0.0636 -0.0895 146 SER A CA  
682  C C   . SER A 102 ? 0.9529 1.2785 1.2630 -0.4195 -0.1125 -0.1123 146 SER A C   
683  O O   . SER A 102 ? 0.9507 1.2855 1.2886 -0.4432 -0.1373 -0.1366 146 SER A O   
684  C CB  . SER A 102 ? 1.0013 1.2383 1.2784 -0.4102 -0.0372 -0.0918 146 SER A CB  
685  O OG  . SER A 102 ? 1.0095 1.2205 1.2104 -0.3838 -0.0371 -0.0820 146 SER A OG  
686  N N   . GLY A 103 ? 1.0002 1.3273 1.2513 -0.3968 -0.1261 -0.1039 147 GLY A N   
687  C CA  . GLY A 103 ? 0.9995 1.3419 1.2114 -0.3953 -0.1658 -0.1191 147 GLY A CA  
688  C C   . GLY A 103 ? 1.0255 1.3234 1.1711 -0.3990 -0.1674 -0.1368 147 GLY A C   
689  O O   . GLY A 103 ? 1.0463 1.3499 1.1510 -0.3954 -0.1965 -0.1510 147 GLY A O   
690  N N   . LYS A 104 ? 1.0768 1.3286 1.2064 -0.4018 -0.1352 -0.1350 148 LYS A N   
691  C CA  . LYS A 104 ? 1.1112 1.3205 1.1828 -0.4031 -0.1337 -0.1517 148 LYS A CA  
692  C C   . LYS A 104 ? 1.1264 1.3264 1.1308 -0.3792 -0.1333 -0.1381 148 LYS A C   
693  O O   . LYS A 104 ? 1.1102 1.3083 1.1097 -0.3644 -0.1190 -0.1143 148 LYS A O   
694  C CB  . LYS A 104 ? 1.1265 1.2885 1.2051 -0.4121 -0.1000 -0.1532 148 LYS A CB  
695  C CG  . LYS A 104 ? 1.1180 1.2877 1.2751 -0.4362 -0.0905 -0.1578 148 LYS A CG  
696  C CD  . LYS A 104 ? 1.1335 1.3018 1.3126 -0.4619 -0.1194 -0.1902 148 LYS A CD  
697  C CE  . LYS A 104 ? 1.1182 1.3103 1.3992 -0.4894 -0.1165 -0.1911 148 LYS A CE  
698  N NZ  . LYS A 104 ? 1.1321 1.2859 1.4363 -0.4934 -0.0670 -0.1733 148 LYS A NZ  
699  N N   . VAL A 105 ? 1.0229 1.2158 0.9773 -0.3743 -0.1496 -0.1529 149 VAL A N   
700  C CA  . VAL A 105 ? 1.0535 1.2419 0.9520 -0.3519 -0.1452 -0.1367 149 VAL A CA  
701  C C   . VAL A 105 ? 1.1196 1.2720 0.9633 -0.3463 -0.1376 -0.1530 149 VAL A C   
702  O O   . VAL A 105 ? 1.1569 1.3004 0.9798 -0.3520 -0.1567 -0.1804 149 VAL A O   
703  C CB  . VAL A 105 ? 1.0635 1.2898 0.9473 -0.3401 -0.1718 -0.1292 149 VAL A CB  
704  C CG1 . VAL A 105 ? 1.1193 1.3387 0.9466 -0.3178 -0.1630 -0.1113 149 VAL A CG1 
705  C CG2 . VAL A 105 ? 1.0082 1.2674 0.9417 -0.3397 -0.1767 -0.1096 149 VAL A CG2 
706  N N   . VAL A 106 ? 0.9866 1.1164 0.8075 -0.3334 -0.1121 -0.1374 150 VAL A N   
707  C CA  . VAL A 106 ? 1.0601 1.1556 0.8314 -0.3235 -0.0995 -0.1502 150 VAL A CA  
708  C C   . VAL A 106 ? 1.1133 1.2160 0.8522 -0.2992 -0.0845 -0.1251 150 VAL A C   
709  O O   . VAL A 106 ? 1.0892 1.1987 0.8542 -0.2948 -0.0714 -0.0994 150 VAL A O   
710  C CB  . VAL A 106 ? 1.0584 1.1120 0.8412 -0.3315 -0.0773 -0.1583 150 VAL A CB  
711  C CG1 . VAL A 106 ? 1.1418 1.1598 0.8714 -0.3162 -0.0630 -0.1693 150 VAL A CG1 
712  C CG2 . VAL A 106 ? 1.0260 1.0686 0.8471 -0.3570 -0.0858 -0.1802 150 VAL A CG2 
713  N N   . LEU A 107 ? 1.2037 1.3031 0.8868 -0.2822 -0.0867 -0.1320 151 LEU A N   
714  C CA  . LEU A 107 ? 1.2742 1.3822 0.9299 -0.2567 -0.0651 -0.1042 151 LEU A CA  
715  C C   . LEU A 107 ? 1.3503 1.4238 0.9601 -0.2396 -0.0428 -0.1156 151 LEU A C   
716  O O   . LEU A 107 ? 1.3739 1.4143 0.9432 -0.2405 -0.0520 -0.1494 151 LEU A O   
717  C CB  . LEU A 107 ? 1.3123 1.4466 0.9330 -0.2404 -0.0765 -0.0914 151 LEU A CB  
718  C CG  . LEU A 107 ? 1.2528 1.4227 0.9130 -0.2499 -0.0962 -0.0738 151 LEU A CG  
719  C CD1 . LEU A 107 ? 1.2054 1.3802 0.8706 -0.2655 -0.1301 -0.1040 151 LEU A CD1 
720  C CD2 . LEU A 107 ? 1.3117 1.5036 0.9441 -0.2270 -0.0901 -0.0420 151 LEU A CD2 
721  N N   . THR A 108 ? 1.2681 1.3485 0.8875 -0.2230 -0.0149 -0.0874 152 THR A N   
722  C CA  . THR A 108 ? 1.3293 1.3801 0.9124 -0.2028 0.0105  -0.0940 152 THR A CA  
723  C C   . THR A 108 ? 1.3934 1.4560 0.9268 -0.1687 0.0326  -0.0742 152 THR A C   
724  O O   . THR A 108 ? 1.3924 1.4909 0.9584 -0.1586 0.0501  -0.0344 152 THR A O   
725  C CB  . THR A 108 ? 1.3216 1.3688 0.9556 -0.2054 0.0279  -0.0785 152 THR A CB  
726  O OG1 . THR A 108 ? 1.2527 1.2850 0.9221 -0.2317 0.0113  -0.0934 152 THR A OG1 
727  C CG2 . THR A 108 ? 1.3752 1.3885 0.9731 -0.1838 0.0527  -0.0888 152 THR A CG2 
728  N N   . ALA A 109 ? 1.3724 1.4012 0.8261 -0.1498 0.0319  -0.1016 153 ALA A N   
729  C CA  . ALA A 109 ? 1.4395 1.4696 0.8271 -0.1098 0.0571  -0.0850 153 ALA A CA  
730  C C   . ALA A 109 ? 1.4747 1.4974 0.8622 -0.0831 0.1002  -0.0673 153 ALA A C   
731  O O   . ALA A 109 ? 1.4679 1.4644 0.8745 -0.0912 0.1039  -0.0841 153 ALA A O   
732  C CB  . ALA A 109 ? 1.4939 1.4826 0.7832 -0.0945 0.0347  -0.1249 153 ALA A CB  
733  N N   . GLU A 110 ? 1.6889 1.7353 1.0570 -0.0491 0.1350  -0.0306 154 GLU A N   
734  C CA  . GLU A 110 ? 1.7263 1.7698 1.0908 -0.0165 0.1800  -0.0117 154 GLU A CA  
735  C C   . GLU A 110 ? 1.8052 1.7906 1.0532 0.0197  0.1893  -0.0457 154 GLU A C   
736  O O   . GLU A 110 ? 1.8497 1.8156 1.0124 0.0379  0.1780  -0.0593 154 GLU A O   
737  C CB  . GLU A 110 ? 1.7252 1.8225 1.1314 0.0054  0.2197  0.0478  154 GLU A CB  
738  C CG  . GLU A 110 ? 1.7326 1.8451 1.1810 0.0298  0.2640  0.0745  154 GLU A CG  
739  C CD  . GLU A 110 ? 1.7301 1.8907 1.2064 0.0611  0.3132  0.1336  154 GLU A CD  
740  O OE1 . GLU A 110 ? 1.7293 1.9089 1.1899 0.0640  0.3151  0.1573  154 GLU A OE1 
741  O OE2 . GLU A 110 ? 1.7235 1.9035 1.2410 0.0845  0.3522  0.1589  154 GLU A OE2 
742  N N   . VAL A 111 ? 1.5186 1.4717 0.7584 0.0330  0.2078  -0.0601 155 VAL A N   
743  C CA  . VAL A 111 ? 1.5905 1.4757 0.7186 0.0669  0.2136  -0.0981 155 VAL A CA  
744  C C   . VAL A 111 ? 1.6346 1.5243 0.7342 0.1214  0.2725  -0.0670 155 VAL A C   
745  O O   . VAL A 111 ? 1.5954 1.5376 0.7845 0.1236  0.3043  -0.0231 155 VAL A O   
746  C CB  . VAL A 111 ? 1.5799 1.4096 0.7109 0.0408  0.1871  -0.1450 155 VAL A CB  
747  C CG1 . VAL A 111 ? 1.5240 1.3561 0.6944 -0.0111 0.1359  -0.1695 155 VAL A CG1 
748  C CG2 . VAL A 111 ? 1.5483 1.3942 0.7586 0.0377  0.2125  -0.1236 155 VAL A CG2 
749  N N   . SER A 112 ? 1.9273 1.7611 0.9031 0.1670  0.2855  -0.0902 156 SER A N   
750  C CA  . SER A 112 ? 1.9678 1.7955 0.9003 0.2264  0.3452  -0.0652 156 SER A CA  
751  C C   . SER A 112 ? 1.9419 1.7732 0.9485 0.2220  0.3642  -0.0603 156 SER A C   
752  O O   . SER A 112 ? 1.9226 1.7245 0.9588 0.1841  0.3283  -0.0945 156 SER A O   
753  C CB  . SER A 112 ? 2.0582 1.7994 0.8317 0.2717  0.3420  -0.1099 156 SER A CB  
754  O OG  . SER A 112 ? 2.0976 1.8182 0.8270 0.3292  0.3982  -0.0955 156 SER A OG  
755  N N   . GLY A 113 ? 2.0418 1.9130 1.0857 0.2608  0.4211  -0.0140 157 GLY A N   
756  C CA  . GLY A 113 ? 2.0190 1.9030 1.1410 0.2620  0.4395  -0.0032 157 GLY A CA  
757  C C   . GLY A 113 ? 2.0580 1.8565 1.1157 0.2651  0.4214  -0.0577 157 GLY A C   
758  O O   . GLY A 113 ? 2.0240 1.8185 1.1487 0.2330  0.4002  -0.0686 157 GLY A O   
759  N N   . GLY A 114 ? 2.2941 2.0171 1.2162 0.3050  0.4279  -0.0930 158 GLY A N   
760  C CA  . GLY A 114 ? 2.3385 1.9723 1.1947 0.3158  0.4174  -0.1419 158 GLY A CA  
761  C C   . GLY A 114 ? 2.3353 1.9077 1.1725 0.2635  0.3546  -0.1985 158 GLY A C   
762  O O   . GLY A 114 ? 2.3657 1.8608 1.1600 0.2662  0.3443  -0.2377 158 GLY A O   
763  N N   . SER A 115 ? 2.0872 1.6936 0.9614 0.2166  0.3147  -0.2006 159 SER A N   
764  C CA  . SER A 115 ? 2.0774 1.6350 0.9422 0.1669  0.2563  -0.2504 159 SER A CA  
765  C C   . SER A 115 ? 2.0432 1.5735 0.9706 0.1362  0.2475  -0.2636 159 SER A C   
766  O O   . SER A 115 ? 2.0031 1.5800 1.0139 0.1356  0.2725  -0.2273 159 SER A O   
767  C CB  . SER A 115 ? 2.0215 1.6404 0.9457 0.1224  0.2229  -0.2374 159 SER A CB  
768  O OG  . SER A 115 ? 2.0484 1.6981 0.9216 0.1533  0.2363  -0.2157 159 SER A OG  
769  N N   . ARG A 116 ? 2.5320 1.9837 1.4182 0.1127  0.2114  -0.3149 160 ARG A N   
770  C CA  . ARG A 116 ? 2.5057 1.9183 1.4401 0.0849  0.2049  -0.3283 160 ARG A CA  
771  C C   . ARG A 116 ? 2.4201 1.8929 1.4673 0.0314  0.1859  -0.3066 160 ARG A C   
772  O O   . ARG A 116 ? 2.3859 1.8614 1.4938 0.0198  0.1967  -0.2917 160 ARG A O   
773  C CB  . ARG A 116 ? 2.5544 1.8646 1.4206 0.0705  0.1703  -0.3877 160 ARG A CB  
774  C CG  . ARG A 116 ? 2.5396 1.8523 1.4073 0.0278  0.1173  -0.4163 160 ARG A CG  
775  C CD  . ARG A 116 ? 2.5864 1.7998 1.4083 0.0063  0.0773  -0.4750 160 ARG A CD  
776  N NE  . ARG A 116 ? 2.5413 1.7263 1.4378 -0.0344 0.0749  -0.4784 160 ARG A NE  
777  C CZ  . ARG A 116 ? 2.4688 1.6879 1.4575 -0.0898 0.0512  -0.4733 160 ARG A CZ  
778  N NH1 . ARG A 116 ? 2.4280 1.7137 1.4506 -0.1128 0.0246  -0.4662 160 ARG A NH1 
779  N NH2 . ARG A 116 ? 2.4383 1.6234 1.4833 -0.1189 0.0572  -0.4729 160 ARG A NH2 
780  N N   . GLY A 117 ? 1.8740 1.3912 0.9421 0.0032  0.1573  -0.3052 161 GLY A N   
781  C CA  . GLY A 117 ? 1.7964 1.3640 0.9601 -0.0446 0.1375  -0.2885 161 GLY A CA  
782  C C   . GLY A 117 ? 1.7600 1.4021 0.9503 -0.0532 0.1263  -0.2642 161 GLY A C   
783  O O   . GLY A 117 ? 1.7989 1.4480 0.9269 -0.0259 0.1288  -0.2647 161 GLY A O   
784  N N   . GLY A 118 ? 1.6562 1.3490 0.9332 -0.0877 0.1150  -0.2420 162 GLY A N   
785  C CA  . GLY A 118 ? 1.6161 1.3782 0.9275 -0.0968 0.1054  -0.2152 162 GLY A CA  
786  C C   . GLY A 118 ? 1.6083 1.3610 0.8885 -0.1173 0.0665  -0.2451 162 GLY A C   
787  O O   . GLY A 118 ? 1.6420 1.3351 0.8715 -0.1216 0.0465  -0.2870 162 GLY A O   
788  N N   . ARG A 119 ? 1.7179 1.5274 1.0308 -0.1299 0.0521  -0.2247 163 ARG A N   
789  C CA  . ARG A 119 ? 1.7038 1.5109 0.9988 -0.1503 0.0107  -0.2518 163 ARG A CA  
790  C C   . ARG A 119 ? 1.6240 1.4916 0.9942 -0.1788 -0.0058 -0.2283 163 ARG A C   
791  O O   . ARG A 119 ? 1.6065 1.5212 1.0130 -0.1707 0.0136  -0.1882 163 ARG A O   
792  C CB  . ARG A 119 ? 1.7812 1.5752 0.9798 -0.1141 0.0061  -0.2621 163 ARG A CB  
793  C CG  . ARG A 119 ? 1.7778 1.5703 0.9531 -0.1304 -0.0435 -0.2913 163 ARG A CG  
794  C CD  . ARG A 119 ? 1.8691 1.6397 0.9323 -0.0867 -0.0481 -0.3015 163 ARG A CD  
795  N NE  . ARG A 119 ? 1.9512 1.6454 0.9262 -0.0590 -0.0423 -0.3366 163 ARG A NE  
796  C CZ  . ARG A 119 ? 2.0397 1.7021 0.9021 -0.0069 -0.0284 -0.3406 163 ARG A CZ  
797  N NH1 . ARG A 119 ? 2.0561 1.7595 0.8857 0.0208  -0.0165 -0.3081 163 ARG A NH1 
798  N NH2 . ARG A 119 ? 2.1129 1.6983 0.8914 0.0202  -0.0241 -0.3753 163 ARG A NH2 
799  N N   . ILE A 120 ? 1.4869 1.3522 0.8852 -0.2119 -0.0418 -0.2529 164 ILE A N   
800  C CA  . ILE A 120 ? 1.4090 1.3284 0.8734 -0.2357 -0.0587 -0.2336 164 ILE A CA  
801  C C   . ILE A 120 ? 1.4021 1.3358 0.8502 -0.2443 -0.1006 -0.2542 164 ILE A C   
802  O O   . ILE A 120 ? 1.4459 1.3412 0.8470 -0.2442 -0.1269 -0.2929 164 ILE A O   
803  C CB  . ILE A 120 ? 1.3309 1.2490 0.8722 -0.2681 -0.0570 -0.2322 164 ILE A CB  
804  C CG1 . ILE A 120 ? 1.3369 1.2035 0.8763 -0.2894 -0.0726 -0.2721 164 ILE A CG1 
805  C CG2 . ILE A 120 ? 1.3318 1.2491 0.8960 -0.2569 -0.0220 -0.2038 164 ILE A CG2 
806  C CD1 . ILE A 120 ? 1.2704 1.1288 0.8809 -0.3183 -0.0634 -0.2676 164 ILE A CD1 
807  N N   . PHE A 121 ? 1.4649 1.4518 0.9510 -0.2499 -0.1097 -0.2288 165 PHE A N   
808  C CA  . PHE A 121 ? 1.4464 1.4561 0.9322 -0.2586 -0.1513 -0.2436 165 PHE A CA  
809  C C   . PHE A 121 ? 1.3429 1.3860 0.9227 -0.2922 -0.1616 -0.2357 165 PHE A C   
810  O O   . PHE A 121 ? 1.2942 1.3686 0.9162 -0.2930 -0.1430 -0.2017 165 PHE A O   
811  C CB  . PHE A 121 ? 1.4849 1.5259 0.9261 -0.2291 -0.1506 -0.2169 165 PHE A CB  
812  C CG  . PHE A 121 ? 1.5916 1.5983 0.9266 -0.1906 -0.1456 -0.2280 165 PHE A CG  
813  C CD1 . PHE A 121 ? 1.6449 1.6261 0.9437 -0.1665 -0.1036 -0.2158 165 PHE A CD1 
814  C CD2 . PHE A 121 ? 1.6410 1.6401 0.9093 -0.1744 -0.1832 -0.2501 165 PHE A CD2 
815  C CE1 . PHE A 121 ? 1.7421 1.6892 0.9376 -0.1253 -0.0934 -0.2241 165 PHE A CE1 
816  C CE2 . PHE A 121 ? 1.7462 1.7057 0.9018 -0.1323 -0.1775 -0.2609 165 PHE A CE2 
817  C CZ  . PHE A 121 ? 1.7957 1.7286 0.9132 -0.1067 -0.1298 -0.2471 165 PHE A CZ  
818  N N   . ARG A 122 ? 1.4150 1.4490 1.0296 -0.3191 -0.1906 -0.2669 166 ARG A N   
819  C CA  . ARG A 122 ? 1.3222 1.3838 1.0299 -0.3493 -0.1922 -0.2588 166 ARG A CA  
820  C C   . ARG A 122 ? 1.2875 1.3877 1.0367 -0.3646 -0.2349 -0.2719 166 ARG A C   
821  O O   . ARG A 122 ? 1.3338 1.4227 1.0523 -0.3647 -0.2733 -0.3039 166 ARG A O   
822  C CB  . ARG A 122 ? 1.3121 1.3320 1.0539 -0.3715 -0.1752 -0.2737 166 ARG A CB  
823  C CG  . ARG A 122 ? 1.3707 1.3436 1.0849 -0.3816 -0.1999 -0.3169 166 ARG A CG  
824  C CD  . ARG A 122 ? 1.3867 1.3035 1.1095 -0.3931 -0.1725 -0.3258 166 ARG A CD  
825  N NE  . ARG A 122 ? 1.4361 1.3065 1.1495 -0.4098 -0.2027 -0.3690 166 ARG A NE  
826  C CZ  . ARG A 122 ? 1.4021 1.2729 1.1956 -0.4469 -0.2214 -0.3843 166 ARG A CZ  
827  N NH1 . ARG A 122 ? 1.3207 1.2368 1.2031 -0.4664 -0.2063 -0.3573 166 ARG A NH1 
828  N NH2 . ARG A 122 ? 1.4551 1.2789 1.2421 -0.4635 -0.2544 -0.4256 166 ARG A NH2 
829  N N   . SER A 123 ? 1.3531 1.4973 1.1711 -0.3748 -0.2299 -0.2474 167 SER A N   
830  C CA  . SER A 123 ? 1.3138 1.5037 1.1887 -0.3882 -0.2656 -0.2535 167 SER A CA  
831  C C   . SER A 123 ? 1.2364 1.4488 1.2068 -0.4107 -0.2465 -0.2380 167 SER A C   
832  O O   . SER A 123 ? 1.2032 1.4159 1.1813 -0.4025 -0.2120 -0.2089 167 SER A O   
833  C CB  . SER A 123 ? 1.3188 1.5471 1.1637 -0.3633 -0.2788 -0.2316 167 SER A CB  
834  O OG  . SER A 123 ? 1.2730 1.5509 1.1847 -0.3737 -0.3068 -0.2301 167 SER A OG  
835  N N   . SER A 124 ? 1.1727 1.4002 1.2154 -0.4376 -0.2683 -0.2573 168 SER A N   
836  C CA  . SER A 124 ? 1.1161 1.3719 1.2557 -0.4558 -0.2478 -0.2392 168 SER A CA  
837  C C   . SER A 124 ? 1.0862 1.4087 1.2827 -0.4533 -0.2738 -0.2283 168 SER A C   
838  O O   . SER A 124 ? 1.0472 1.4017 1.3264 -0.4630 -0.2572 -0.2108 168 SER A O   
839  C CB  . SER A 124 ? 1.1335 1.3650 1.3359 -0.4873 -0.2462 -0.2596 168 SER A CB  
840  O OG  . SER A 124 ? 1.1772 1.4117 1.4022 -0.4916 -0.2962 -0.2884 168 SER A OG  
841  N N   . ASP A 125 ? 1.3259 1.6667 1.4742 -0.4369 -0.3133 -0.2381 169 ASP A N   
842  C CA  . ASP A 125 ? 1.3145 1.7132 1.5079 -0.4287 -0.3477 -0.2327 169 ASP A CA  
843  C C   . ASP A 125 ? 1.2866 1.7133 1.4525 -0.4024 -0.3368 -0.1995 169 ASP A C   
844  O O   . ASP A 125 ? 1.2899 1.7598 1.4692 -0.3905 -0.3692 -0.1958 169 ASP A O   
845  C CB  . ASP A 125 ? 1.3802 1.7736 1.5472 -0.4193 -0.4036 -0.2649 169 ASP A CB  
846  C CG  . ASP A 125 ? 1.4445 1.7847 1.4923 -0.4046 -0.4092 -0.2835 169 ASP A CG  
847  O OD1 . ASP A 125 ? 1.4572 1.7537 1.4717 -0.4138 -0.3752 -0.2858 169 ASP A OD1 
848  O OD2 . ASP A 125 ? 1.4929 1.8342 1.4768 -0.3811 -0.4471 -0.2956 169 ASP A OD2 
849  N N   . PHE A 126 ? 0.9640 1.3596 1.0901 -0.3903 -0.2939 -0.1760 170 PHE A N   
850  C CA  . PHE A 126 ? 0.9640 1.3646 1.0473 -0.3628 -0.2821 -0.1454 170 PHE A CA  
851  C C   . PHE A 126 ? 1.0213 1.4097 1.0160 -0.3412 -0.3008 -0.1468 170 PHE A C   
852  O O   . PHE A 126 ? 1.0316 1.4387 1.0042 -0.3199 -0.3085 -0.1252 170 PHE A O   
853  C CB  . PHE A 126 ? 0.9349 1.3856 1.0758 -0.3542 -0.2923 -0.1264 170 PHE A CB  
854  C CG  . PHE A 126 ? 0.8962 1.3588 1.1163 -0.3652 -0.2638 -0.1152 170 PHE A CG  
855  C CD1 . PHE A 126 ? 0.8389 1.2779 1.0474 -0.3516 -0.2268 -0.0897 170 PHE A CD1 
856  C CD2 . PHE A 126 ? 0.9289 1.4244 1.2350 -0.3871 -0.2741 -0.1291 170 PHE A CD2 
857  C CE1 . PHE A 126 ? 0.8250 1.2687 1.0925 -0.3546 -0.1973 -0.0782 170 PHE A CE1 
858  C CE2 . PHE A 126 ? 0.9118 1.4187 1.2906 -0.3935 -0.2404 -0.1137 170 PHE A CE2 
859  C CZ  . PHE A 126 ? 0.8645 1.3439 1.2178 -0.3747 -0.2003 -0.0881 170 PHE A CZ  
860  N N   . ALA A 127 ? 1.4623 1.8148 1.4035 -0.3439 -0.3037 -0.1697 171 ALA A N   
861  C CA  . ALA A 127 ? 1.5390 1.8733 1.3868 -0.3188 -0.3139 -0.1707 171 ALA A CA  
862  C C   . ALA A 127 ? 1.5768 1.9375 1.3999 -0.3046 -0.3621 -0.1829 171 ALA A C   
863  O O   . ALA A 127 ? 1.6305 1.9900 1.3860 -0.2756 -0.3653 -0.1658 171 ALA A O   
864  C CB  . ALA A 127 ? 1.5513 1.8769 1.3641 -0.2982 -0.2803 -0.1325 171 ALA A CB  
865  N N   . LYS A 128 ? 1.4272 1.8122 1.3083 -0.3239 -0.3999 -0.2105 172 LYS A N   
866  C CA  . LYS A 128 ? 1.4750 1.8770 1.3257 -0.3107 -0.4561 -0.2325 172 LYS A CA  
867  C C   . LYS A 128 ? 1.5553 1.9068 1.3241 -0.3058 -0.4767 -0.2698 172 LYS A C   
868  O O   . LYS A 128 ? 1.6328 1.9713 1.3153 -0.2761 -0.5075 -0.2802 172 LYS A O   
869  C CB  . LYS A 128 ? 1.4385 1.8849 1.3991 -0.3265 -0.4889 -0.2441 172 LYS A CB  
870  C CG  . LYS A 128 ? 1.3869 1.8887 1.3994 -0.3181 -0.4848 -0.2103 172 LYS A CG  
871  C CD  . LYS A 128 ? 1.3527 1.8993 1.4910 -0.3341 -0.5035 -0.2176 172 LYS A CD  
872  C CE  . LYS A 128 ? 1.3156 1.9187 1.4971 -0.3185 -0.5066 -0.1870 172 LYS A CE  
873  N NZ  . LYS A 128 ? 1.3724 1.9847 1.4872 -0.2835 -0.5479 -0.1853 172 LYS A NZ  
874  N N   . ASN A 129 ? 1.3310 1.6477 1.1216 -0.3305 -0.4581 -0.2893 173 ASN A N   
875  C CA  . ASN A 129 ? 1.4131 1.6693 1.1233 -0.3231 -0.4688 -0.3237 173 ASN A CA  
876  C C   . ASN A 129 ? 1.4029 1.6199 1.1073 -0.3340 -0.4153 -0.3159 173 ASN A C   
877  O O   . ASN A 129 ? 1.3272 1.5578 1.1143 -0.3589 -0.3854 -0.3005 173 ASN A O   
878  C CB  . ASN A 129 ? 1.4485 1.6874 1.2124 -0.3353 -0.5158 -0.3655 173 ASN A CB  
879  C CG  . ASN A 129 ? 1.4658 1.7469 1.2717 -0.3234 -0.5686 -0.3721 173 ASN A CG  
880  O OD1 . ASN A 129 ? 1.5435 1.8414 1.2724 -0.3083 -0.5898 -0.3912 173 ASN A OD1 
881  N ND2 . ASN A 129 ? 1.3880 1.7238 1.3115 -0.3433 -0.5642 -0.3517 173 ASN A ND2 
882  N N   . PHE A 130 ? 1.3464 1.5116 0.9495 -0.3098 -0.4023 -0.3256 174 PHE A N   
883  C CA  . PHE A 130 ? 1.3526 1.4777 0.9415 -0.3120 -0.3528 -0.3181 174 PHE A CA  
884  C C   . PHE A 130 ? 1.4224 1.4860 0.9619 -0.3150 -0.3715 -0.3632 174 PHE A C   
885  O O   . PHE A 130 ? 1.4863 1.5319 0.9732 -0.3046 -0.4203 -0.3973 174 PHE A O   
886  C CB  . PHE A 130 ? 1.3992 1.5190 0.9151 -0.2755 -0.3127 -0.2830 174 PHE A CB  
887  C CG  . PHE A 130 ? 1.3305 1.4932 0.9030 -0.2780 -0.2823 -0.2373 174 PHE A CG  
888  C CD1 . PHE A 130 ? 1.2810 1.4379 0.9026 -0.2924 -0.2419 -0.2187 174 PHE A CD1 
889  C CD2 . PHE A 130 ? 1.3216 1.5248 0.8939 -0.2637 -0.2966 -0.2137 174 PHE A CD2 
890  C CE1 . PHE A 130 ? 1.2245 1.4124 0.8923 -0.2931 -0.2199 -0.1807 174 PHE A CE1 
891  C CE2 . PHE A 130 ? 1.2654 1.4993 0.8872 -0.2655 -0.2712 -0.1738 174 PHE A CE2 
892  C CZ  . PHE A 130 ? 1.2169 1.4418 0.8859 -0.2806 -0.2343 -0.1587 174 PHE A CZ  
893  N N   . VAL A 131 ? 1.8059 1.8321 1.3583 -0.3270 -0.3354 -0.3647 175 VAL A N   
894  C CA  . VAL A 131 ? 1.8836 1.8403 1.3773 -0.3243 -0.3455 -0.4046 175 VAL A CA  
895  C C   . VAL A 131 ? 1.9218 1.8422 1.3619 -0.3010 -0.2898 -0.3858 175 VAL A C   
896  O O   . VAL A 131 ? 1.8641 1.8018 1.3581 -0.3106 -0.2482 -0.3543 175 VAL A O   
897  C CB  . VAL A 131 ? 1.8489 1.7869 1.4276 -0.3696 -0.3696 -0.4363 175 VAL A CB  
898  C CG1 . VAL A 131 ? 1.7454 1.7228 1.4379 -0.4001 -0.3354 -0.4042 175 VAL A CG1 
899  C CG2 . VAL A 131 ? 1.9221 1.7780 1.4459 -0.3679 -0.3649 -0.4697 175 VAL A CG2 
900  N N   . GLN A 132 ? 1.7099 1.5805 1.0404 -0.2660 -0.2907 -0.4046 176 GLN A N   
901  C CA  . GLN A 132 ? 1.7592 1.5938 1.0359 -0.2389 -0.2401 -0.3901 176 GLN A CA  
902  C C   . GLN A 132 ? 1.7602 1.5392 1.0624 -0.2621 -0.2332 -0.4167 176 GLN A C   
903  O O   . GLN A 132 ? 1.7804 1.5209 1.0858 -0.2828 -0.2743 -0.4596 176 GLN A O   
904  C CB  . GLN A 132 ? 1.8741 1.6719 1.0194 -0.1887 -0.2431 -0.4021 176 GLN A CB  
905  C CG  . GLN A 132 ? 1.9358 1.6947 1.0167 -0.1530 -0.1916 -0.3898 176 GLN A CG  
906  C CD  . GLN A 132 ? 2.0469 1.7684 0.9914 -0.0981 -0.1927 -0.4004 176 GLN A CD  
907  O OE1 . GLN A 132 ? 2.1154 1.7882 0.9873 -0.0638 -0.1606 -0.4048 176 GLN A OE1 
908  N NE2 . GLN A 132 ? 2.0671 1.8091 0.9711 -0.0853 -0.2287 -0.4037 176 GLN A NE2 
909  N N   . THR A 133 ? 1.7621 1.5357 1.0880 -0.2597 -0.1841 -0.3907 177 THR A N   
910  C CA  . THR A 133 ? 1.7736 1.4883 1.1142 -0.2758 -0.1725 -0.4118 177 THR A CA  
911  C C   . THR A 133 ? 1.8189 1.5075 1.1135 -0.2422 -0.1223 -0.3921 177 THR A C   
912  O O   . THR A 133 ? 1.7812 1.5138 1.1104 -0.2340 -0.0878 -0.3502 177 THR A O   
913  C CB  . THR A 133 ? 1.6769 1.4157 1.1317 -0.3199 -0.1669 -0.3987 177 THR A CB  
914  O OG1 . THR A 133 ? 1.6371 1.4013 1.1465 -0.3518 -0.2126 -0.4179 177 THR A OG1 
915  C CG2 . THR A 133 ? 1.6929 1.3674 1.1600 -0.3329 -0.1470 -0.4129 177 THR A CG2 
916  N N   . ASP A 134 ? 1.9559 1.5714 1.1774 -0.2227 -0.1205 -0.4232 178 ASP A N   
917  C CA  . ASP A 134 ? 1.9992 1.5885 1.1792 -0.1875 -0.0726 -0.4060 178 ASP A CA  
918  C C   . ASP A 134 ? 1.9570 1.5250 1.2032 -0.2114 -0.0497 -0.3984 178 ASP A C   
919  O O   . ASP A 134 ? 1.9551 1.4739 1.2228 -0.2405 -0.0689 -0.4283 178 ASP A O   
920  C CB  . ASP A 134 ? 2.1069 1.6206 1.1708 -0.1496 -0.0774 -0.4421 178 ASP A CB  
921  C CG  . ASP A 134 ? 2.1633 1.6918 1.1422 -0.1141 -0.0925 -0.4448 178 ASP A CG  
922  O OD1 . ASP A 134 ? 2.1606 1.7405 1.1314 -0.0849 -0.0571 -0.4020 178 ASP A OD1 
923  O OD2 . ASP A 134 ? 2.2145 1.7009 1.1348 -0.1143 -0.1404 -0.4886 178 ASP A OD2 
924  N N   . LEU A 135 ? 1.6221 1.2254 0.9020 -0.1984 -0.0101 -0.3572 179 LEU A N   
925  C CA  . LEU A 135 ? 1.5886 1.1724 0.9228 -0.2144 0.0117  -0.3459 179 LEU A CA  
926  C C   . LEU A 135 ? 1.6586 1.1735 0.9364 -0.1852 0.0370  -0.3586 179 LEU A C   
927  O O   . LEU A 135 ? 1.7206 1.2261 0.9297 -0.1442 0.0521  -0.3588 179 LEU A O   
928  C CB  . LEU A 135 ? 1.5329 1.1818 0.9268 -0.2118 0.0348  -0.2990 179 LEU A CB  
929  C CG  . LEU A 135 ? 1.4657 1.1822 0.9083 -0.2332 0.0135  -0.2827 179 LEU A CG  
930  C CD1 . LEU A 135 ? 1.4380 1.2115 0.9189 -0.2203 0.0340  -0.2387 179 LEU A CD1 
931  C CD2 . LEU A 135 ? 1.4007 1.1128 0.9048 -0.2752 -0.0054 -0.2936 179 LEU A CD2 
932  N N   . PRO A 136 ? 1.7509 1.2147 1.0558 -0.2036 0.0445  -0.3674 180 PRO A N   
933  C CA  . PRO A 136 ? 1.8066 1.2040 1.0701 -0.1766 0.0723  -0.3733 180 PRO A CA  
934  C C   . PRO A 136 ? 1.8024 1.2394 1.0769 -0.1418 0.1096  -0.3322 180 PRO A C   
935  O O   . PRO A 136 ? 1.8492 1.2419 1.0874 -0.1105 0.1347  -0.3328 180 PRO A O   
936  C CB  . PRO A 136 ? 1.7834 1.1303 1.0935 -0.2127 0.0698  -0.3833 180 PRO A CB  
937  C CG  . PRO A 136 ? 1.7018 1.1097 1.0915 -0.2511 0.0546  -0.3664 180 PRO A CG  
938  C CD  . PRO A 136 ? 1.6917 1.1538 1.0684 -0.2516 0.0266  -0.3730 180 PRO A CD  
939  N N   . PHE A 137 ? 1.6375 1.1545 0.9668 -0.1481 0.1106  -0.2976 181 PHE A N   
940  C CA  . PHE A 137 ? 1.6314 1.1913 0.9903 -0.1217 0.1378  -0.2582 181 PHE A CA  
941  C C   . PHE A 137 ? 1.6119 1.2549 0.9966 -0.1132 0.1376  -0.2278 181 PHE A C   
942  O O   . PHE A 137 ? 1.6021 1.2692 0.9734 -0.1244 0.1183  -0.2360 181 PHE A O   
943  C CB  . PHE A 137 ? 1.5854 1.1441 1.0034 -0.1415 0.1401  -0.2413 181 PHE A CB  
944  C CG  . PHE A 137 ? 1.5174 1.1104 0.9865 -0.1809 0.1172  -0.2374 181 PHE A CG  
945  C CD1 . PHE A 137 ? 1.4976 1.0533 0.9726 -0.2147 0.1010  -0.2635 181 PHE A CD1 
946  C CD2 . PHE A 137 ? 1.4752 1.1370 0.9912 -0.1837 0.1119  -0.2071 181 PHE A CD2 
947  C CE1 . PHE A 137 ? 1.4311 1.0225 0.9582 -0.2474 0.0837  -0.2575 181 PHE A CE1 
948  C CE2 . PHE A 137 ? 1.4106 1.1003 0.9685 -0.2150 0.0929  -0.2037 181 PHE A CE2 
949  C CZ  . PHE A 137 ? 1.3857 1.0428 0.9494 -0.2455 0.0807  -0.2280 181 PHE A CZ  
950  N N   . HIS A 138 ? 1.6339 1.3193 1.0595 -0.0935 0.1570  -0.1919 182 HIS A N   
951  C CA  . HIS A 138 ? 1.6137 1.3771 1.0834 -0.0910 0.1565  -0.1578 182 HIS A CA  
952  C C   . HIS A 138 ? 1.5640 1.3607 1.1077 -0.1138 0.1427  -0.1357 182 HIS A C   
953  O O   . HIS A 138 ? 1.5726 1.3606 1.1435 -0.1041 0.1503  -0.1235 182 HIS A O   
954  C CB  . HIS A 138 ? 1.6593 1.4521 1.1265 -0.0487 0.1883  -0.1310 182 HIS A CB  
955  C CG  . HIS A 138 ? 1.7163 1.4782 1.0996 -0.0177 0.2056  -0.1488 182 HIS A CG  
956  N ND1 . HIS A 138 ? 1.7631 1.4953 1.1086 0.0240  0.2373  -0.1489 182 HIS A ND1 
957  C CD2 . HIS A 138 ? 1.7390 1.4904 1.0616 -0.0178 0.1941  -0.1682 182 HIS A CD2 
958  C CE1 . HIS A 138 ? 1.8164 1.5172 1.0759 0.0495  0.2465  -0.1682 182 HIS A CE1 
959  N NE2 . HIS A 138 ? 1.8047 1.5153 1.0467 0.0247  0.2185  -0.1812 182 HIS A NE2 
960  N N   . PRO A 139 ? 1.3502 1.1816 0.9210 -0.1407 0.1205  -0.1315 183 PRO A N   
961  C CA  . PRO A 139 ? 1.3044 1.1578 0.9338 -0.1606 0.1050  -0.1148 183 PRO A CA  
962  C C   . PRO A 139 ? 1.3286 1.2250 1.0087 -0.1433 0.1103  -0.0801 183 PRO A C   
963  O O   . PRO A 139 ? 1.3456 1.2858 1.0397 -0.1293 0.1198  -0.0592 183 PRO A O   
964  C CB  . PRO A 139 ? 1.2548 1.1401 0.8956 -0.1855 0.0831  -0.1164 183 PRO A CB  
965  C CG  . PRO A 139 ? 1.2889 1.1888 0.8890 -0.1714 0.0889  -0.1201 183 PRO A CG  
966  C CD  . PRO A 139 ? 1.3422 1.1932 0.8857 -0.1484 0.1082  -0.1405 183 PRO A CD  
967  N N   . LEU A 140 ? 1.1916 1.0717 0.8980 -0.1421 0.1045  -0.0738 184 LEU A N   
968  C CA  . LEU A 140 ? 1.2176 1.1361 0.9830 -0.1324 0.0952  -0.0444 184 LEU A CA  
969  C C   . LEU A 140 ? 1.1488 1.0937 0.9497 -0.1558 0.0681  -0.0348 184 LEU A C   
970  O O   . LEU A 140 ? 1.1349 1.1224 0.9885 -0.1543 0.0559  -0.0102 184 LEU A O   
971  C CB  . LEU A 140 ? 1.2517 1.1337 1.0186 -0.1154 0.0951  -0.0447 184 LEU A CB  
972  C CG  . LEU A 140 ? 1.2896 1.2054 1.1182 -0.1020 0.0779  -0.0185 184 LEU A CG  
973  C CD1 . LEU A 140 ? 1.3052 1.2851 1.1855 -0.0910 0.0882  0.0076  184 LEU A CD1 
974  C CD2 . LEU A 140 ? 1.3347 1.2101 1.1497 -0.0771 0.0812  -0.0217 184 LEU A CD2 
975  N N   . THR A 141 ? 1.1756 1.0940 0.9515 -0.1771 0.0592  -0.0537 185 THR A N   
976  C CA  . THR A 141 ? 1.0942 1.0259 0.8959 -0.1946 0.0356  -0.0470 185 THR A CA  
977  C C   . THR A 141 ? 1.0333 0.9774 0.8228 -0.2162 0.0308  -0.0582 185 THR A C   
978  O O   . THR A 141 ? 1.0559 0.9917 0.8132 -0.2196 0.0414  -0.0755 185 THR A O   
979  C CB  . THR A 141 ? 1.0741 0.9590 0.8634 -0.1941 0.0291  -0.0542 185 THR A CB  
980  O OG1 . THR A 141 ? 1.0668 0.9096 0.8186 -0.2036 0.0455  -0.0761 185 THR A OG1 
981  C CG2 . THR A 141 ? 1.1415 1.0097 0.9380 -0.1693 0.0273  -0.0444 185 THR A CG2 
982  N N   . GLN A 142 ? 1.2832 1.2456 1.0972 -0.2286 0.0115  -0.0494 186 GLN A N   
983  C CA  . GLN A 142 ? 1.2219 1.1968 1.0301 -0.2475 0.0042  -0.0595 186 GLN A CA  
984  C C   . GLN A 142 ? 1.2089 1.1423 0.9975 -0.2578 0.0120  -0.0809 186 GLN A C   
985  O O   . GLN A 142 ? 1.2305 1.1267 1.0120 -0.2496 0.0198  -0.0811 186 GLN A O   
986  C CB  . GLN A 142 ? 1.1491 1.1479 0.9882 -0.2537 -0.0165 -0.0434 186 GLN A CB  
987  C CG  . GLN A 142 ? 1.0927 1.1134 0.9327 -0.2696 -0.0259 -0.0493 186 GLN A CG  
988  C CD  . GLN A 142 ? 1.0310 1.0694 0.8984 -0.2715 -0.0452 -0.0323 186 GLN A CD  
989  O OE1 . GLN A 142 ? 1.0143 1.0284 0.8863 -0.2678 -0.0518 -0.0308 186 GLN A OE1 
990  N NE2 . GLN A 142 ? 1.0156 1.0901 0.8944 -0.2737 -0.0538 -0.0191 186 GLN A NE2 
991  N N   . MET A 143 ? 1.3152 1.2537 1.0972 -0.2748 0.0097  -0.0977 187 MET A N   
992  C CA  . MET A 143 ? 1.3047 1.2080 1.0847 -0.2888 0.0181  -0.1148 187 MET A CA  
993  C C   . MET A 143 ? 1.2522 1.1597 1.0588 -0.2958 0.0144  -0.1049 187 MET A C   
994  O O   . MET A 143 ? 1.2026 1.1473 1.0292 -0.3008 -0.0011 -0.0969 187 MET A O   
995  C CB  . MET A 143 ? 1.3091 1.2142 1.0800 -0.3052 0.0123  -0.1389 187 MET A CB  
996  C CG  . MET A 143 ? 1.3817 1.2736 1.1123 -0.2909 0.0183  -0.1494 187 MET A CG  
997  S SD  . MET A 143 ? 1.4055 1.2847 1.1092 -0.3051 0.0039  -0.1841 187 MET A SD  
998  C CE  . MET A 143 ? 1.5050 1.3544 1.1480 -0.2753 0.0208  -0.1909 187 MET A CE  
999  N N   . MET A 144 ? 1.2842 1.1491 1.0853 -0.2918 0.0313  -0.1035 188 MET A N   
1000 C CA  . MET A 144 ? 1.2692 1.1277 1.0831 -0.2891 0.0348  -0.0912 188 MET A CA  
1001 C C   . MET A 144 ? 1.2590 1.1096 1.0977 -0.3090 0.0506  -0.0989 188 MET A C   
1002 O O   . MET A 144 ? 1.2927 1.1069 1.1269 -0.3165 0.0689  -0.1084 188 MET A O   
1003 C CB  . MET A 144 ? 1.3305 1.1432 1.1151 -0.2642 0.0446  -0.0801 188 MET A CB  
1004 C CG  . MET A 144 ? 1.3491 1.1695 1.1232 -0.2456 0.0267  -0.0720 188 MET A CG  
1005 S SD  . MET A 144 ? 1.2898 1.1605 1.0909 -0.2461 -0.0042 -0.0590 188 MET A SD  
1006 C CE  . MET A 144 ? 1.3033 1.1475 1.0936 -0.2344 -0.0071 -0.0511 188 MET A CE  
1007 N N   . TYR A 145 ? 1.0953 0.9807 0.9663 -0.3174 0.0435  -0.0932 189 TYR A N   
1008 C CA  . TYR A 145 ? 1.0856 0.9756 0.9987 -0.3363 0.0584  -0.0955 189 TYR A CA  
1009 C C   . TYR A 145 ? 1.1403 0.9875 1.0453 -0.3212 0.0912  -0.0783 189 TYR A C   
1010 O O   . TYR A 145 ? 1.1764 1.0058 1.0472 -0.2942 0.0923  -0.0640 189 TYR A O   
1011 C CB  . TYR A 145 ? 1.0314 0.9780 0.9849 -0.3448 0.0404  -0.0919 189 TYR A CB  
1012 C CG  . TYR A 145 ? 0.9868 0.9764 0.9435 -0.3554 0.0080  -0.1052 189 TYR A CG  
1013 C CD1 . TYR A 145 ? 0.9747 0.9784 0.9013 -0.3399 -0.0094 -0.0980 189 TYR A CD1 
1014 C CD2 . TYR A 145 ? 0.9670 0.9816 0.9583 -0.3796 -0.0060 -0.1237 189 TYR A CD2 
1015 C CE1 . TYR A 145 ? 0.9528 0.9916 0.8753 -0.3449 -0.0330 -0.1055 189 TYR A CE1 
1016 C CE2 . TYR A 145 ? 0.9492 0.9964 0.9294 -0.3831 -0.0364 -0.1361 189 TYR A CE2 
1017 C CZ  . TYR A 145 ? 0.9458 1.0046 0.8881 -0.3640 -0.0466 -0.1250 189 TYR A CZ  
1018 O OH  . TYR A 145 ? 0.9466 1.0344 0.8713 -0.3632 -0.0713 -0.1328 189 TYR A OH  
1019 N N   . SER A 146 ? 1.0410 0.8682 0.9763 -0.3371 0.1175  -0.0788 190 SER A N   
1020 C CA  . SER A 146 ? 1.0932 0.8855 1.0261 -0.3213 0.1553  -0.0568 190 SER A CA  
1021 C C   . SER A 146 ? 1.0751 0.9094 1.0445 -0.3169 0.1578  -0.0422 190 SER A C   
1022 O O   . SER A 146 ? 1.0214 0.9057 1.0564 -0.3423 0.1490  -0.0478 190 SER A O   
1023 C CB  . SER A 146 ? 1.1086 0.8694 1.0758 -0.3419 0.1872  -0.0567 190 SER A CB  
1024 O OG  . SER A 146 ? 1.1435 0.8872 1.1278 -0.3301 0.2285  -0.0302 190 SER A OG  
1025 N N   . PRO A 147 ? 1.1756 0.9870 1.1001 -0.2819 0.1674  -0.0247 191 PRO A N   
1026 C CA  . PRO A 147 ? 1.1818 1.0232 1.1276 -0.2688 0.1726  -0.0097 191 PRO A CA  
1027 C C   . PRO A 147 ? 1.1661 1.0312 1.1868 -0.2852 0.2085  0.0036  191 PRO A C   
1028 O O   . PRO A 147 ? 1.1406 1.0568 1.2112 -0.2882 0.2050  0.0102  191 PRO A O   
1029 C CB  . PRO A 147 ? 1.2782 1.0609 1.1453 -0.2236 0.1858  0.0051  191 PRO A CB  
1030 C CG  . PRO A 147 ? 1.2975 1.0440 1.1101 -0.2169 0.1636  -0.0073 191 PRO A CG  
1031 C CD  . PRO A 147 ? 1.2498 1.0006 1.0957 -0.2491 0.1703  -0.0198 191 PRO A CD  
1032 N N   . GLN A 148 ? 1.5731 1.4017 1.6068 -0.2954 0.2431  0.0095  192 GLN A N   
1033 C CA  . GLN A 148 ? 1.5541 1.4041 1.6739 -0.3161 0.2796  0.0248  192 GLN A CA  
1034 C C   . GLN A 148 ? 1.4728 1.3845 1.6825 -0.3631 0.2478  0.0033  192 GLN A C   
1035 O O   . GLN A 148 ? 1.4375 1.4081 1.7267 -0.3759 0.2474  0.0103  192 GLN A O   
1036 C CB  . GLN A 148 ? 1.5978 1.3821 1.7035 -0.3140 0.3258  0.0390  192 GLN A CB  
1037 C CG  . GLN A 148 ? 1.5865 1.3844 1.7834 -0.3303 0.3753  0.0648  192 GLN A CG  
1038 C CD  . GLN A 148 ? 1.6285 1.4256 1.8124 -0.2896 0.4188  0.0995  192 GLN A CD  
1039 O OE1 . GLN A 148 ? 1.6770 1.4530 1.7733 -0.2481 0.4082  0.1010  192 GLN A OE1 
1040 N NE2 . GLN A 148 ? 1.6142 1.4319 1.8866 -0.3000 0.4681  0.1282  192 GLN A NE2 
1041 N N   . ASN A 149 ? 1.2312 1.1275 1.4246 -0.3852 0.2193  -0.0238 193 ASN A N   
1042 C CA  . ASN A 149 ? 1.1721 1.1115 1.4343 -0.4266 0.1848  -0.0492 193 ASN A CA  
1043 C C   . ASN A 149 ? 1.1445 1.0967 1.3548 -0.4271 0.1344  -0.0773 193 ASN A C   
1044 O O   . ASN A 149 ? 1.1689 1.0761 1.3162 -0.4206 0.1295  -0.0897 193 ASN A O   
1045 C CB  . ASN A 149 ? 1.1880 1.0863 1.4875 -0.4557 0.2035  -0.0560 193 ASN A CB  
1046 C CG  . ASN A 149 ? 1.1421 1.0811 1.5266 -0.5001 0.1669  -0.0824 193 ASN A CG  
1047 O OD1 . ASN A 149 ? 1.1098 1.0834 1.4813 -0.5069 0.1172  -0.1086 193 ASN A OD1 
1048 N ND2 . ASN A 149 ? 1.1447 1.0764 1.6168 -0.5296 0.1907  -0.0748 193 ASN A ND2 
1049 N N   . SER A 150 ? 1.1663 1.1807 1.4062 -0.4334 0.0993  -0.0854 194 SER A N   
1050 C CA  . SER A 150 ? 1.1409 1.1711 1.3299 -0.4284 0.0567  -0.1050 194 SER A CA  
1051 C C   . SER A 150 ? 1.1399 1.1566 1.3219 -0.4519 0.0297  -0.1369 194 SER A C   
1052 O O   . SER A 150 ? 1.1321 1.1575 1.2669 -0.4453 -0.0007 -0.1522 194 SER A O   
1053 C CB  . SER A 150 ? 1.0988 1.1942 1.3162 -0.4243 0.0293  -0.1011 194 SER A CB  
1054 O OG  . SER A 150 ? 1.0670 1.2059 1.3476 -0.4526 -0.0013 -0.1201 194 SER A OG  
1055 N N   . ASP A 151 ? 1.3068 1.2997 1.5359 -0.4780 0.0413  -0.1461 195 ASP A N   
1056 C CA  . ASP A 151 ? 1.3279 1.2909 1.5408 -0.4974 0.0167  -0.1790 195 ASP A CA  
1057 C C   . ASP A 151 ? 1.3815 1.2715 1.5257 -0.4833 0.0426  -0.1797 195 ASP A C   
1058 O O   . ASP A 151 ? 1.4154 1.2685 1.5287 -0.4914 0.0274  -0.2061 195 ASP A O   
1059 C CB  . ASP A 151 ? 1.3232 1.2942 1.6302 -0.5366 0.0080  -0.1923 195 ASP A CB  
1060 C CG  . ASP A 151 ? 1.2786 1.3228 1.6509 -0.5522 -0.0343 -0.2025 195 ASP A CG  
1061 O OD1 . ASP A 151 ? 1.2596 1.3389 1.5877 -0.5330 -0.0618 -0.2058 195 ASP A OD1 
1062 O OD2 . ASP A 151 ? 1.2787 1.3437 1.7469 -0.5759 -0.0424 -0.2018 195 ASP A OD2 
1063 N N   . TYR A 152 ? 1.1123 0.9786 1.2288 -0.4587 0.0800  -0.1516 196 TYR A N   
1064 C CA  . TYR A 152 ? 1.1682 0.9671 1.2210 -0.4404 0.1045  -0.1485 196 TYR A CA  
1065 C C   . TYR A 152 ? 1.1755 0.9779 1.1552 -0.4082 0.0926  -0.1452 196 TYR A C   
1066 O O   . TYR A 152 ? 1.1572 0.9882 1.1301 -0.3900 0.0918  -0.1268 196 TYR A O   
1067 C CB  . TYR A 152 ? 1.2011 0.9628 1.2649 -0.4301 0.1526  -0.1190 196 TYR A CB  
1068 C CG  . TYR A 152 ? 1.2028 0.9508 1.3449 -0.4616 0.1755  -0.1155 196 TYR A CG  
1069 C CD1 . TYR A 152 ? 1.1868 0.9418 1.3798 -0.4987 0.1477  -0.1442 196 TYR A CD1 
1070 C CD2 . TYR A 152 ? 1.2274 0.9523 1.3930 -0.4528 0.2248  -0.0825 196 TYR A CD2 
1071 C CE1 . TYR A 152 ? 1.1880 0.9313 1.4667 -0.5316 0.1654  -0.1403 196 TYR A CE1 
1072 C CE2 . TYR A 152 ? 1.2257 0.9412 1.4756 -0.4832 0.2505  -0.0739 196 TYR A CE2 
1073 C CZ  . TYR A 152 ? 1.2028 0.9291 1.5156 -0.5252 0.2192  -0.1029 196 TYR A CZ  
1074 O OH  . TYR A 152 ? 1.2013 0.9208 1.6088 -0.5551 0.2391  -0.0922 196 TYR A OH  
1075 N N   . LEU A 153 ? 1.2413 1.0138 1.1704 -0.4008 0.0835  -0.1623 197 LEU A N   
1076 C CA  . LEU A 153 ? 1.2505 1.0320 1.1250 -0.3725 0.0734  -0.1570 197 LEU A CA  
1077 C C   . LEU A 153 ? 1.3157 1.0387 1.1416 -0.3529 0.0928  -0.1565 197 LEU A C   
1078 O O   . LEU A 153 ? 1.3528 1.0287 1.1749 -0.3634 0.1047  -0.1703 197 LEU A O   
1079 C CB  . LEU A 153 ? 1.2347 1.0523 1.0950 -0.3762 0.0410  -0.1760 197 LEU A CB  
1080 C CG  . LEU A 153 ? 1.1887 1.0555 1.0885 -0.3981 0.0123  -0.1886 197 LEU A CG  
1081 C CD1 . LEU A 153 ? 1.2020 1.0897 1.0608 -0.3892 -0.0145 -0.2037 197 LEU A CD1 
1082 C CD2 . LEU A 153 ? 1.1351 1.0481 1.0735 -0.3967 0.0112  -0.1663 197 LEU A CD2 
1083 N N   . LEU A 154 ? 1.2068 0.9313 0.9990 -0.3243 0.0935  -0.1409 198 LEU A N   
1084 C CA  . LEU A 154 ? 1.2685 0.9491 1.0170 -0.3020 0.1049  -0.1415 198 LEU A CA  
1085 C C   . LEU A 154 ? 1.2716 0.9871 1.0016 -0.2825 0.0874  -0.1375 198 LEU A C   
1086 O O   . LEU A 154 ? 1.2308 0.9935 0.9779 -0.2813 0.0705  -0.1263 198 LEU A O   
1087 C CB  . LEU A 154 ? 1.3112 0.9449 1.0410 -0.2818 0.1285  -0.1223 198 LEU A CB  
1088 C CG  . LEU A 154 ? 1.3090 0.9579 1.0342 -0.2617 0.1232  -0.1004 198 LEU A CG  
1089 C CD1 . LEU A 154 ? 1.3260 0.9909 1.0304 -0.2368 0.1030  -0.0943 198 LEU A CD1 
1090 C CD2 . LEU A 154 ? 1.3614 0.9531 1.0649 -0.2465 0.1521  -0.0852 198 LEU A CD2 
1091 N N   . ALA A 155 ? 1.1847 0.8760 0.8835 -0.2662 0.0938  -0.1444 199 ALA A N   
1092 C CA  . ALA A 155 ? 1.2026 0.9284 0.8925 -0.2457 0.0841  -0.1363 199 ALA A CA  
1093 C C   . ALA A 155 ? 1.2677 0.9572 0.9312 -0.2177 0.0989  -0.1317 199 ALA A C   
1094 O O   . ALA A 155 ? 1.2995 0.9322 0.9394 -0.2157 0.1162  -0.1423 199 ALA A O   
1095 C CB  . ALA A 155 ? 1.2031 0.9556 0.8840 -0.2536 0.0748  -0.1522 199 ALA A CB  
1096 N N   . LEU A 156 ? 1.3426 1.0649 1.0158 -0.1959 0.0917  -0.1146 200 LEU A N   
1097 C CA  . LEU A 156 ? 1.4070 1.1084 1.0635 -0.1665 0.1038  -0.1100 200 LEU A CA  
1098 C C   . LEU A 156 ? 1.4440 1.1699 1.0910 -0.1555 0.1117  -0.1147 200 LEU A C   
1099 O O   . LEU A 156 ? 1.4384 1.2192 1.1073 -0.1583 0.1029  -0.1047 200 LEU A O   
1100 C CB  . LEU A 156 ? 1.4256 1.1470 1.1073 -0.1458 0.0901  -0.0868 200 LEU A CB  
1101 C CG  . LEU A 156 ? 1.4265 1.1133 1.1002 -0.1437 0.0826  -0.0809 200 LEU A CG  
1102 C CD1 . LEU A 156 ? 1.3668 1.0675 1.0595 -0.1187 0.0607  -0.0628 200 LEU A CD1 
1103 C CD2 . LEU A 156 ? 1.5353 1.1509 1.1678 -0.1395 0.1065  -0.0912 200 LEU A CD2 
1104 N N   . SER A 157 ? 1.2960 0.9761 0.9054 -0.1395 0.1309  -0.1284 201 SER A N   
1105 C CA  . SER A 157 ? 1.3393 1.0335 0.9286 -0.1181 0.1440  -0.1312 201 SER A CA  
1106 C C   . SER A 157 ? 1.3799 1.1140 1.0024 -0.0869 0.1501  -0.1031 201 SER A C   
1107 O O   . SER A 157 ? 1.3893 1.1211 1.0380 -0.0780 0.1422  -0.0886 201 SER A O   
1108 C CB  . SER A 157 ? 1.3712 0.9948 0.9041 -0.1091 0.1613  -0.1580 201 SER A CB  
1109 O OG  . SER A 157 ? 1.4095 1.0011 0.9330 -0.0782 0.1779  -0.1496 201 SER A OG  
1110 N N   . THR A 158 ? 1.2393 1.0104 0.8615 -0.0688 0.1634  -0.0946 202 THR A N   
1111 C CA  . THR A 158 ? 1.2829 1.0949 0.9433 -0.0365 0.1766  -0.0671 202 THR A CA  
1112 C C   . THR A 158 ? 1.3183 1.0832 0.9579 -0.0067 0.1922  -0.0714 202 THR A C   
1113 O O   . THR A 158 ? 1.3503 1.1464 1.0332 0.0199  0.1971  -0.0480 202 THR A O   
1114 C CB  . THR A 158 ? 1.3001 1.1433 0.9438 -0.0179 0.1998  -0.0605 202 THR A CB  
1115 O OG1 . THR A 158 ? 1.3122 1.0927 0.8733 -0.0117 0.2128  -0.0939 202 THR A OG1 
1116 C CG2 . THR A 158 ? 1.2665 1.1624 0.9354 -0.0408 0.1867  -0.0483 202 THR A CG2 
1117 N N   . GLU A 159 ? 1.7410 1.4307 1.3190 -0.0111 0.1989  -0.1005 203 GLU A N   
1118 C CA  . GLU A 159 ? 1.7708 1.4027 1.3208 0.0162  0.2139  -0.1059 203 GLU A CA  
1119 C C   . GLU A 159 ? 1.7553 1.3600 1.3205 0.0070  0.1969  -0.1004 203 GLU A C   
1120 O O   . GLU A 159 ? 1.7756 1.3232 1.3131 0.0269  0.2068  -0.1039 203 GLU A O   
1121 C CB  . GLU A 159 ? 1.7838 1.3382 1.2590 0.0160  0.2294  -0.1398 203 GLU A CB  
1122 C CG  . GLU A 159 ? 1.8122 1.3774 1.2501 0.0359  0.2469  -0.1487 203 GLU A CG  
1123 C CD  . GLU A 159 ? 1.8492 1.4450 1.3014 0.0847  0.2732  -0.1250 203 GLU A CD  
1124 O OE1 . GLU A 159 ? 1.8683 1.4347 1.3244 0.1087  0.2816  -0.1189 203 GLU A OE1 
1125 O OE2 . GLU A 159 ? 1.8570 1.5073 1.3187 0.1011  0.2873  -0.1099 203 GLU A OE2 
1126 N N   . ASN A 160 ? 1.5112 1.1522 1.1134 -0.0199 0.1726  -0.0912 204 ASN A N   
1127 C CA  . ASN A 160 ? 1.4928 1.1059 1.0986 -0.0274 0.1562  -0.0864 204 ASN A CA  
1128 C C   . ASN A 160 ? 1.4736 1.0078 1.0291 -0.0428 0.1692  -0.1068 204 ASN A C   
1129 O O   . ASN A 160 ? 1.4830 0.9666 1.0185 -0.0315 0.1722  -0.1023 204 ASN A O   
1130 C CB  . ASN A 160 ? 1.5331 1.1481 1.1584 0.0078  0.1481  -0.0672 204 ASN A CB  
1131 C CG  . ASN A 160 ? 1.5597 1.2574 1.2559 0.0163  0.1291  -0.0439 204 ASN A CG  
1132 O OD1 . ASN A 160 ? 1.5440 1.2881 1.2761 -0.0080 0.1106  -0.0375 204 ASN A OD1 
1133 N ND2 . ASN A 160 ? 1.6007 1.3177 1.3237 0.0511  0.1341  -0.0296 204 ASN A ND2 
1134 N N   . GLY A 161 ? 1.5964 1.1188 1.1331 -0.0678 0.1763  -0.1283 205 GLY A N   
1135 C CA  . GLY A 161 ? 1.5825 1.0401 1.0923 -0.0919 0.1847  -0.1465 205 GLY A CA  
1136 C C   . GLY A 161 ? 1.5299 1.0138 1.0690 -0.1262 0.1698  -0.1438 205 GLY A C   
1137 O O   . GLY A 161 ? 1.4995 1.0485 1.0692 -0.1362 0.1522  -0.1371 205 GLY A O   
1138 N N   . LEU A 162 ? 1.4513 0.8843 0.9832 -0.1425 0.1797  -0.1463 206 LEU A N   
1139 C CA  . LEU A 162 ? 1.4046 0.8603 0.9664 -0.1726 0.1713  -0.1426 206 LEU A CA  
1140 C C   . LEU A 162 ? 1.3874 0.8273 0.9588 -0.2084 0.1733  -0.1661 206 LEU A C   
1141 O O   . LEU A 162 ? 1.4136 0.7890 0.9730 -0.2175 0.1909  -0.1759 206 LEU A O   
1142 C CB  . LEU A 162 ? 1.4173 0.8332 0.9703 -0.1630 0.1837  -0.1236 206 LEU A CB  
1143 C CG  . LEU A 162 ? 1.3819 0.8123 0.9617 -0.1874 0.1840  -0.1159 206 LEU A CG  
1144 C CD1 . LEU A 162 ? 1.3345 0.8410 0.9452 -0.1952 0.1562  -0.1121 206 LEU A CD1 
1145 C CD2 . LEU A 162 ? 1.4151 0.7975 0.9692 -0.1661 0.2014  -0.0945 206 LEU A CD2 
1146 N N   . TRP A 163 ? 1.5388 1.0357 1.1344 -0.2285 0.1529  -0.1749 207 TRP A N   
1147 C CA  . TRP A 163 ? 1.5237 1.0120 1.1311 -0.2610 0.1448  -0.2003 207 TRP A CA  
1148 C C   . TRP A 163 ? 1.4645 0.9855 1.1216 -0.2909 0.1372  -0.1936 207 TRP A C   
1149 O O   . TRP A 163 ? 1.4255 0.9971 1.1015 -0.2863 0.1286  -0.1751 207 TRP A O   
1150 C CB  . TRP A 163 ? 1.5303 1.0523 1.1186 -0.2573 0.1260  -0.2183 207 TRP A CB  
1151 C CG  . TRP A 163 ? 1.5936 1.0815 1.1317 -0.2262 0.1375  -0.2271 207 TRP A CG  
1152 C CD1 . TRP A 163 ? 1.6178 1.1260 1.1430 -0.1908 0.1474  -0.2076 207 TRP A CD1 
1153 C CD2 . TRP A 163 ? 1.6432 1.0700 1.1399 -0.2257 0.1396  -0.2577 207 TRP A CD2 
1154 N NE1 . TRP A 163 ? 1.6753 1.1426 1.1539 -0.1655 0.1604  -0.2217 207 TRP A NE1 
1155 C CE2 . TRP A 163 ? 1.6940 1.1060 1.1475 -0.1852 0.1555  -0.2540 207 TRP A CE2 
1156 C CE3 . TRP A 163 ? 1.6529 1.0347 1.1483 -0.2553 0.1272  -0.2887 207 TRP A CE3 
1157 C CZ2 . TRP A 163 ? 1.7544 1.1030 1.1525 -0.1696 0.1622  -0.2809 207 TRP A CZ2 
1158 C CZ3 . TRP A 163 ? 1.7178 1.0328 1.1591 -0.2432 0.1283  -0.3181 207 TRP A CZ3 
1159 C CH2 . TRP A 163 ? 1.7682 1.0645 1.1558 -0.1987 0.1471  -0.3143 207 TRP A CH2 
1160 N N   . VAL A 164 ? 1.4855 0.9761 1.1682 -0.3213 0.1401  -0.2086 208 VAL A N   
1161 C CA  . VAL A 164 ? 1.4318 0.9534 1.1731 -0.3501 0.1373  -0.2011 208 VAL A CA  
1162 C C   . VAL A 164 ? 1.4103 0.9457 1.1850 -0.3845 0.1116  -0.2300 208 VAL A C   
1163 O O   . VAL A 164 ? 1.4523 0.9389 1.2103 -0.3938 0.1060  -0.2562 208 VAL A O   
1164 C CB  . VAL A 164 ? 1.4502 0.9220 1.2110 -0.3548 0.1719  -0.1819 208 VAL A CB  
1165 C CG1 . VAL A 164 ? 1.3979 0.9092 1.2228 -0.3782 0.1755  -0.1679 208 VAL A CG1 
1166 C CG2 . VAL A 164 ? 1.4879 0.9344 1.2028 -0.3160 0.1924  -0.1569 208 VAL A CG2 
1167 N N   . SER A 165 ? 1.4894 1.0881 1.3092 -0.4012 0.0925  -0.2266 209 SER A N   
1168 C CA  . SER A 165 ? 1.4683 1.0848 1.3300 -0.4343 0.0631  -0.2525 209 SER A CA  
1169 C C   . SER A 165 ? 1.4207 1.0633 1.3670 -0.4622 0.0720  -0.2371 209 SER A C   
1170 O O   . SER A 165 ? 1.3800 1.0657 1.3459 -0.4525 0.0828  -0.2103 209 SER A O   
1171 C CB  . SER A 165 ? 1.4457 1.1192 1.2862 -0.4270 0.0274  -0.2646 209 SER A CB  
1172 O OG  . SER A 165 ? 1.4297 1.1220 1.3103 -0.4565 -0.0070 -0.2900 209 SER A OG  
1173 N N   . LYS A 166 ? 1.4638 1.0772 1.4626 -0.4955 0.0688  -0.2531 210 LYS A N   
1174 C CA  . LYS A 166 ? 1.4207 1.0663 1.5173 -0.5254 0.0770  -0.2383 210 LYS A CA  
1175 C C   . LYS A 166 ? 1.3715 1.0873 1.5197 -0.5459 0.0320  -0.2551 210 LYS A C   
1176 O O   . LYS A 166 ? 1.3241 1.0895 1.5527 -0.5615 0.0376  -0.2368 210 LYS A O   
1177 C CB  . LYS A 166 ? 1.4539 1.0396 1.6025 -0.5557 0.0948  -0.2434 210 LYS A CB  
1178 C CG  . LYS A 166 ? 1.4986 1.0155 1.6114 -0.5362 0.1472  -0.2176 210 LYS A CG  
1179 C CD  . LYS A 166 ? 1.5089 0.9913 1.7013 -0.5617 0.1705  -0.2040 210 LYS A CD  
1180 C CE  . LYS A 166 ? 1.5692 0.9651 1.7167 -0.5445 0.2201  -0.1843 210 LYS A CE  
1181 N NZ  . LYS A 166 ? 1.5978 0.9720 1.8282 -0.5640 0.2386  -0.1646 210 LYS A NZ  
1182 N N   . ASN A 167 ? 1.5553 1.2731 1.6565 -0.5434 -0.0117 -0.2891 211 ASN A N   
1183 C CA  . ASN A 167 ? 1.5166 1.3001 1.6516 -0.5544 -0.0578 -0.3037 211 ASN A CA  
1184 C C   . ASN A 167 ? 1.5076 1.3272 1.5672 -0.5224 -0.0755 -0.3033 211 ASN A C   
1185 O O   . ASN A 167 ? 1.5524 1.3538 1.5469 -0.5115 -0.1047 -0.3314 211 ASN A O   
1186 C CB  . ASN A 167 ? 1.5732 1.3288 1.7185 -0.5660 -0.1046 -0.3396 211 ASN A CB  
1187 C CG  . ASN A 167 ? 1.6476 1.3238 1.6967 -0.5523 -0.1040 -0.3677 211 ASN A CG  
1188 O OD1 . ASN A 167 ? 1.6549 1.3125 1.6226 -0.5277 -0.0780 -0.3610 211 ASN A OD1 
1189 N ND2 . ASN A 167 ? 1.7164 1.3448 1.7777 -0.5636 -0.1345 -0.3962 211 ASN A ND2 
1190 N N   . PHE A 168 ? 1.2355 1.1063 1.3073 -0.5069 -0.0599 -0.2715 212 PHE A N   
1191 C CA  . PHE A 168 ? 1.2161 1.1308 1.2389 -0.4813 -0.0783 -0.2655 212 PHE A CA  
1192 C C   . PHE A 168 ? 1.2742 1.1566 1.2009 -0.4561 -0.0866 -0.2815 212 PHE A C   
1193 O O   . PHE A 168 ? 1.2821 1.1922 1.1705 -0.4429 -0.1142 -0.2902 212 PHE A O   
1194 C CB  . PHE A 168 ? 1.1754 1.1537 1.2476 -0.4945 -0.1175 -0.2727 212 PHE A CB  
1195 C CG  . PHE A 168 ? 1.1520 1.1759 1.1843 -0.4684 -0.1296 -0.2579 212 PHE A CG  
1196 C CD1 . PHE A 168 ? 1.1397 1.1616 1.1339 -0.4427 -0.1004 -0.2296 212 PHE A CD1 
1197 C CD2 . PHE A 168 ? 1.1508 1.2154 1.1825 -0.4687 -0.1731 -0.2725 212 PHE A CD2 
1198 C CE1 . PHE A 168 ? 1.1223 1.1818 1.0868 -0.4215 -0.1114 -0.2144 212 PHE A CE1 
1199 C CE2 . PHE A 168 ? 1.1381 1.2393 1.1310 -0.4436 -0.1812 -0.2556 212 PHE A CE2 
1200 C CZ  . PHE A 168 ? 1.1222 1.2204 1.0851 -0.4218 -0.1489 -0.2258 212 PHE A CZ  
1201 N N   . GLY A 169 ? 1.4274 1.2508 1.3148 -0.4463 -0.0598 -0.2831 213 GLY A N   
1202 C CA  . GLY A 169 ? 1.4903 1.2838 1.2925 -0.4185 -0.0597 -0.2942 213 GLY A CA  
1203 C C   . GLY A 169 ? 1.5559 1.3073 1.3152 -0.4224 -0.0880 -0.3354 213 GLY A C   
1204 O O   . GLY A 169 ? 1.6175 1.3436 1.2991 -0.3940 -0.0861 -0.3448 213 GLY A O   
1205 N N   . GLY A 170 ? 1.4971 1.2394 1.3077 -0.4556 -0.1151 -0.3600 214 GLY A N   
1206 C CA  . GLY A 170 ? 1.5654 1.2592 1.3370 -0.4617 -0.1510 -0.4047 214 GLY A CA  
1207 C C   . GLY A 170 ? 1.6368 1.2454 1.3585 -0.4526 -0.1290 -0.4198 214 GLY A C   
1208 O O   . GLY A 170 ? 1.7111 1.2778 1.3449 -0.4266 -0.1392 -0.4438 214 GLY A O   
1209 N N   . LYS A 171 ? 1.8457 1.4254 1.6190 -0.4703 -0.0961 -0.4039 215 LYS A N   
1210 C CA  . LYS A 171 ? 1.9089 1.4055 1.6395 -0.4601 -0.0701 -0.4124 215 LYS A CA  
1211 C C   . LYS A 171 ? 1.8883 1.3870 1.6180 -0.4398 -0.0189 -0.3711 215 LYS A C   
1212 O O   . LYS A 171 ? 1.8274 1.3662 1.6187 -0.4516 -0.0011 -0.3408 215 LYS A O   
1213 C CB  . LYS A 171 ? 1.9279 1.3675 1.7167 -0.5003 -0.0807 -0.4352 215 LYS A CB  
1214 C CG  . LYS A 171 ? 1.9886 1.4023 1.7639 -0.5014 -0.1368 -0.4776 215 LYS A CG  
1215 C CD  . LYS A 171 ? 1.9542 1.4432 1.7861 -0.5145 -0.1841 -0.4825 215 LYS A CD  
1216 C CE  . LYS A 171 ? 2.0431 1.5011 1.8624 -0.5127 -0.2457 -0.5278 215 LYS A CE  
1217 N NZ  . LYS A 171 ? 2.0157 1.5468 1.8934 -0.5227 -0.2934 -0.5310 215 LYS A NZ  
1218 N N   . TRP A 172 ? 1.5955 1.0493 1.2530 -0.4060 0.0032  -0.3706 216 TRP A N   
1219 C CA  . TRP A 172 ? 1.5883 1.0428 1.2374 -0.3812 0.0442  -0.3343 216 TRP A CA  
1220 C C   . TRP A 172 ? 1.6460 1.0153 1.2680 -0.3719 0.0719  -0.3377 216 TRP A C   
1221 O O   . TRP A 172 ? 1.7087 1.0188 1.2802 -0.3635 0.0638  -0.3675 216 TRP A O   
1222 C CB  . TRP A 172 ? 1.5963 1.0936 1.1944 -0.3424 0.0476  -0.3199 216 TRP A CB  
1223 C CG  . TRP A 172 ? 1.5393 1.1172 1.1632 -0.3475 0.0271  -0.3081 216 TRP A CG  
1224 C CD1 . TRP A 172 ? 1.5377 1.1433 1.1507 -0.3548 -0.0071 -0.3293 216 TRP A CD1 
1225 C CD2 . TRP A 172 ? 1.4809 1.1164 1.1406 -0.3428 0.0372  -0.2728 216 TRP A CD2 
1226 N NE1 . TRP A 172 ? 1.4783 1.1568 1.1209 -0.3554 -0.0158 -0.3069 216 TRP A NE1 
1227 C CE2 . TRP A 172 ? 1.4413 1.1380 1.1139 -0.3491 0.0106  -0.2730 216 TRP A CE2 
1228 C CE3 . TRP A 172 ? 1.4653 1.1009 1.1414 -0.3314 0.0630  -0.2427 216 TRP A CE3 
1229 C CZ2 . TRP A 172 ? 1.3824 1.1378 1.0872 -0.3462 0.0110  -0.2440 216 TRP A CZ2 
1230 C CZ3 . TRP A 172 ? 1.4117 1.1045 1.1162 -0.3279 0.0597  -0.2166 216 TRP A CZ3 
1231 C CH2 . TRP A 172 ? 1.3679 1.1189 1.0885 -0.3363 0.0348  -0.2174 216 TRP A CH2 
1232 N N   . GLU A 173 ? 2.0176 1.3761 1.6658 -0.3693 0.1046  -0.3067 217 GLU A N   
1233 C CA  . GLU A 173 ? 2.0725 1.3500 1.6932 -0.3562 0.1343  -0.3034 217 GLU A CA  
1234 C C   . GLU A 173 ? 2.0781 1.3673 1.6690 -0.3165 0.1603  -0.2708 217 GLU A C   
1235 O O   . GLU A 173 ? 2.0338 1.3777 1.6511 -0.3131 0.1634  -0.2442 217 GLU A O   
1236 C CB  . GLU A 173 ? 2.0651 1.3026 1.7466 -0.3910 0.1507  -0.2961 217 GLU A CB  
1237 C CG  . GLU A 173 ? 2.1183 1.2642 1.7719 -0.3786 0.1837  -0.2897 217 GLU A CG  
1238 C CD  . GLU A 173 ? 2.1549 1.2370 1.8558 -0.4195 0.1839  -0.3067 217 GLU A CD  
1239 O OE1 . GLU A 173 ? 2.1405 1.2320 1.8693 -0.4503 0.1464  -0.3400 217 GLU A OE1 
1240 O OE2 . GLU A 173 ? 2.2015 1.2219 1.9129 -0.4205 0.2200  -0.2859 217 GLU A OE2 
1241 N N   . GLU A 174 ? 1.7667 1.0025 1.3027 -0.2848 0.1760  -0.2741 218 GLU A N   
1242 C CA  . GLU A 174 ? 1.7760 1.0226 1.2881 -0.2453 0.1949  -0.2451 218 GLU A CA  
1243 C C   . GLU A 174 ? 1.7943 0.9803 1.3104 -0.2428 0.2243  -0.2247 218 GLU A C   
1244 O O   . GLU A 174 ? 1.8415 0.9478 1.3323 -0.2392 0.2407  -0.2344 218 GLU A O   
1245 C CB  . GLU A 174 ? 1.8259 1.0525 1.2809 -0.2074 0.1981  -0.2563 218 GLU A CB  
1246 C CG  . GLU A 174 ? 1.8328 1.0862 1.2750 -0.1655 0.2100  -0.2278 218 GLU A CG  
1247 C CD  . GLU A 174 ? 1.8832 1.1188 1.2780 -0.1264 0.2182  -0.2368 218 GLU A CD  
1248 O OE1 . GLU A 174 ? 1.9262 1.0993 1.2825 -0.1270 0.2216  -0.2650 218 GLU A OE1 
1249 O OE2 . GLU A 174 ? 1.8839 1.1672 1.2826 -0.0943 0.2208  -0.2157 218 GLU A OE2 
1250 N N   . ILE A 175 ? 1.7690 0.9871 1.3115 -0.2426 0.2316  -0.1960 219 ILE A N   
1251 C CA  . ILE A 175 ? 1.7919 0.9528 1.3327 -0.2374 0.2627  -0.1724 219 ILE A CA  
1252 C C   . ILE A 175 ? 1.8344 0.9592 1.3234 -0.1895 0.2786  -0.1517 219 ILE A C   
1253 O O   . ILE A 175 ? 1.8708 0.9253 1.3397 -0.1790 0.3072  -0.1366 219 ILE A O   
1254 C CB  . ILE A 175 ? 1.7510 0.9486 1.3377 -0.2573 0.2684  -0.1514 219 ILE A CB  
1255 C CG1 . ILE A 175 ? 1.7259 0.9895 1.3053 -0.2336 0.2515  -0.1348 219 ILE A CG1 
1256 C CG2 . ILE A 175 ? 1.7075 0.9377 1.3553 -0.3049 0.2533  -0.1702 219 ILE A CG2 
1257 C CD1 . ILE A 175 ? 1.7004 0.9867 1.3087 -0.2422 0.2610  -0.1126 219 ILE A CD1 
1258 N N   . HIS A 176 ? 1.8289 1.0022 1.3008 -0.1600 0.2599  -0.1489 220 HIS A N   
1259 C CA  . HIS A 176 ? 1.8659 1.0128 1.2967 -0.1131 0.2669  -0.1326 220 HIS A CA  
1260 C C   . HIS A 176 ? 1.8647 1.0628 1.2924 -0.0908 0.2476  -0.1406 220 HIS A C   
1261 O O   . HIS A 176 ? 1.8296 1.0998 1.2874 -0.1052 0.2266  -0.1456 220 HIS A O   
1262 C CB  . HIS A 176 ? 1.8623 1.0216 1.2890 -0.0944 0.2650  -0.1046 220 HIS A CB  
1263 C CG  . HIS A 176 ? 1.9077 1.0152 1.2865 -0.0477 0.2746  -0.0871 220 HIS A CG  
1264 N ND1 . HIS A 176 ? 1.9178 1.0525 1.2868 -0.0117 0.2555  -0.0845 220 HIS A ND1 
1265 C CD2 . HIS A 176 ? 1.9468 0.9777 1.2861 -0.0289 0.3011  -0.0691 220 HIS A CD2 
1266 C CE1 . HIS A 176 ? 1.9575 1.0354 1.2826 0.0275  0.2651  -0.0685 220 HIS A CE1 
1267 N NE2 . HIS A 176 ? 1.9772 0.9882 1.2772 0.0193  0.2936  -0.0586 220 HIS A NE2 
1268 N N   . LYS A 177 ? 2.0357 1.1982 1.4297 -0.0537 0.2572  -0.1391 221 LYS A N   
1269 C CA  . LYS A 177 ? 2.0427 1.2521 1.4388 -0.0317 0.2472  -0.1456 221 LYS A CA  
1270 C C   . LYS A 177 ? 2.0390 1.3140 1.4597 -0.0011 0.2292  -0.1225 221 LYS A C   
1271 O O   . LYS A 177 ? 2.0434 1.3749 1.4843 0.0119  0.2223  -0.1222 221 LYS A O   
1272 C CB  . LYS A 177 ? 2.0909 1.2342 1.4435 -0.0085 0.2674  -0.1610 221 LYS A CB  
1273 C CG  . LYS A 177 ? 2.1013 1.2028 1.4374 -0.0395 0.2719  -0.1935 221 LYS A CG  
1274 C CD  . LYS A 177 ? 2.1533 1.2036 1.4413 -0.0088 0.2858  -0.2118 221 LYS A CD  
1275 C CE  . LYS A 177 ? 2.1744 1.1759 1.4390 -0.0379 0.2817  -0.2492 221 LYS A CE  
1276 N NZ  . LYS A 177 ? 2.2344 1.1735 1.4395 -0.0038 0.2949  -0.2704 221 LYS A NZ  
1277 N N   . ALA A 178 ? 1.8493 1.1165 1.2699 0.0113  0.2209  -0.1029 222 ALA A N   
1278 C CA  . ALA A 178 ? 1.8504 1.1792 1.3022 0.0350  0.1940  -0.0843 222 ALA A CA  
1279 C C   . ALA A 178 ? 1.8255 1.1729 1.2899 0.0203  0.1733  -0.0738 222 ALA A C   
1280 O O   . ALA A 178 ? 1.8387 1.1303 1.2669 0.0309  0.1794  -0.0655 222 ALA A O   
1281 C CB  . ALA A 178 ? 1.8916 1.1863 1.3206 0.0826  0.1955  -0.0719 222 ALA A CB  
1282 N N   . VAL A 179 ? 1.6036 1.0252 1.1144 0.0003  0.1505  -0.0726 223 VAL A N   
1283 C CA  . VAL A 179 ? 1.5796 1.0184 1.1009 -0.0130 0.1298  -0.0649 223 VAL A CA  
1284 C C   . VAL A 179 ? 1.5795 1.0940 1.1532 -0.0100 0.0947  -0.0553 223 VAL A C   
1285 O O   . VAL A 179 ? 1.5754 1.1465 1.1893 -0.0208 0.0934  -0.0567 223 VAL A O   
1286 C CB  . VAL A 179 ? 1.5338 0.9770 1.0615 -0.0543 0.1412  -0.0756 223 VAL A CB  
1287 C CG1 . VAL A 179 ? 1.5504 0.9182 1.0395 -0.0604 0.1717  -0.0787 223 VAL A CG1 
1288 C CG2 . VAL A 179 ? 1.5110 0.9934 1.0625 -0.0757 0.1462  -0.0904 223 VAL A CG2 
1289 N N   . CYS A 180 ? 1.6500 1.1597 1.2209 0.0080  0.0660  -0.0446 224 CYS A N   
1290 C CA  . CYS A 180 ? 1.6548 1.2279 1.2803 0.0067  0.0264  -0.0359 224 CYS A CA  
1291 C C   . CYS A 180 ? 1.6091 1.2075 1.2491 -0.0241 0.0145  -0.0381 224 CYS A C   
1292 O O   . CYS A 180 ? 1.5963 1.2574 1.2910 -0.0413 -0.0023 -0.0339 224 CYS A O   
1293 C CB  . CYS A 180 ? 1.6938 1.2440 1.3077 0.0432  -0.0076 -0.0272 224 CYS A CB  
1294 S SG  . CYS A 180 ? 1.7549 1.2627 1.3391 0.0833  0.0108  -0.0242 224 CYS A SG  
1295 N N   . LEU A 181 ? 1.4379 0.9863 1.0298 -0.0281 0.0261  -0.0420 225 LEU A N   
1296 C CA  . LEU A 181 ? 1.3969 0.9622 0.9966 -0.0498 0.0157  -0.0427 225 LEU A CA  
1297 C C   . LEU A 181 ? 1.3793 0.8997 0.9403 -0.0629 0.0513  -0.0470 225 LEU A C   
1298 O O   . LEU A 181 ? 1.4152 0.8729 0.9281 -0.0439 0.0736  -0.0442 225 LEU A O   
1299 C CB  . LEU A 181 ? 1.4214 0.9735 1.0088 -0.0265 -0.0247 -0.0365 225 LEU A CB  
1300 C CG  . LEU A 181 ? 1.3862 0.9473 0.9742 -0.0403 -0.0400 -0.0370 225 LEU A CG  
1301 C CD1 . LEU A 181 ? 1.3326 0.9671 0.9888 -0.0718 -0.0523 -0.0365 225 LEU A CD1 
1302 C CD2 . LEU A 181 ? 1.4238 0.9498 0.9793 -0.0089 -0.0818 -0.0350 225 LEU A CD2 
1303 N N   . ALA A 182 ? 1.2939 0.8469 0.8806 -0.0944 0.0572  -0.0514 226 ALA A N   
1304 C CA  . ALA A 182 ? 1.2841 0.8070 0.8554 -0.1115 0.0906  -0.0538 226 ALA A CA  
1305 C C   . ALA A 182 ? 1.2471 0.7996 0.8384 -0.1292 0.0841  -0.0515 226 ALA A C   
1306 O O   . ALA A 182 ? 1.1968 0.8061 0.8269 -0.1458 0.0616  -0.0546 226 ALA A O   
1307 C CB  . ALA A 182 ? 1.2648 0.7913 0.8531 -0.1360 0.1143  -0.0664 226 ALA A CB  
1308 N N   . LYS A 183 ? 1.3336 0.8465 0.8982 -0.1230 0.1071  -0.0436 227 LYS A N   
1309 C CA  . LYS A 183 ? 1.3140 0.8504 0.8931 -0.1317 0.1037  -0.0390 227 LYS A CA  
1310 C C   . LYS A 183 ? 1.3186 0.8374 0.9061 -0.1456 0.1450  -0.0324 227 LYS A C   
1311 O O   . LYS A 183 ? 1.3612 0.8256 0.9207 -0.1349 0.1786  -0.0243 227 LYS A O   
1312 C CB  . LYS A 183 ? 1.3544 0.8646 0.8899 -0.0963 0.0787  -0.0310 227 LYS A CB  
1313 C CG  . LYS A 183 ? 1.3230 0.8697 0.8792 -0.0930 0.0303  -0.0361 227 LYS A CG  
1314 C CD  . LYS A 183 ? 1.3676 0.8736 0.8754 -0.0559 -0.0007 -0.0325 227 LYS A CD  
1315 C CE  . LYS A 183 ? 1.3417 0.8833 0.8851 -0.0560 -0.0524 -0.0364 227 LYS A CE  
1316 N NZ  . LYS A 183 ? 1.3803 0.8768 0.8766 -0.0218 -0.0911 -0.0374 227 LYS A NZ  
1317 N N   . TRP A 184 ? 1.3834 0.9494 1.0149 -0.1687 0.1433  -0.0334 228 TRP A N   
1318 C CA  . TRP A 184 ? 1.3770 0.9375 1.0319 -0.1808 0.1802  -0.0234 228 TRP A CA  
1319 C C   . TRP A 184 ? 1.4423 0.9646 1.0504 -0.1446 0.1962  -0.0043 228 TRP A C   
1320 O O   . TRP A 184 ? 1.4610 0.9942 1.0486 -0.1263 0.1682  -0.0043 228 TRP A O   
1321 C CB  . TRP A 184 ? 1.2939 0.9235 1.0159 -0.2147 0.1689  -0.0309 228 TRP A CB  
1322 C CG  . TRP A 184 ? 1.2279 0.8900 0.9937 -0.2504 0.1594  -0.0498 228 TRP A CG  
1323 C CD1 . TRP A 184 ? 1.1708 0.8807 0.9531 -0.2641 0.1256  -0.0644 228 TRP A CD1 
1324 C CD2 . TRP A 184 ? 1.2185 0.8630 1.0142 -0.2755 0.1835  -0.0565 228 TRP A CD2 
1325 N NE1 . TRP A 184 ? 1.1370 0.8574 0.9467 -0.2919 0.1257  -0.0819 228 TRP A NE1 
1326 C CE2 . TRP A 184 ? 1.1660 0.8457 0.9869 -0.3014 0.1578  -0.0794 228 TRP A CE2 
1327 C CE3 . TRP A 184 ? 1.2530 0.8512 1.0562 -0.2779 0.2248  -0.0442 228 TRP A CE3 
1328 C CZ2 . TRP A 184 ? 1.1567 0.8229 1.0063 -0.3293 0.1656  -0.0953 228 TRP A CZ2 
1329 C CZ3 . TRP A 184 ? 1.2331 0.8215 1.0769 -0.3102 0.2347  -0.0571 228 TRP A CZ3 
1330 C CH2 . TRP A 184 ? 1.1895 0.8098 1.0542 -0.3356 0.2020  -0.0849 228 TRP A CH2 
1331 N N   . GLY A 185 ? 1.3847 0.8578 0.9739 -0.1326 0.2426  0.0128  229 GLY A N   
1332 C CA  . GLY A 185 ? 1.4348 0.8724 0.9801 -0.0968 0.2687  0.0341  229 GLY A CA  
1333 C C   . GLY A 185 ? 1.3901 0.8691 1.0034 -0.1188 0.3005  0.0463  229 GLY A C   
1334 O O   . GLY A 185 ? 1.3186 0.8622 1.0100 -0.1603 0.2857  0.0337  229 GLY A O   
1335 N N   . SER A 186 ? 1.6608 1.1028 1.2433 -0.0877 0.3442  0.0721  230 SER A N   
1336 C CA  . SER A 186 ? 1.6231 1.1037 1.2801 -0.1057 0.3842  0.0900  230 SER A CA  
1337 C C   . SER A 186 ? 1.5882 1.0666 1.3122 -0.1428 0.4205  0.0968  230 SER A C   
1338 O O   . SER A 186 ? 1.6165 1.0416 1.3024 -0.1390 0.4282  0.0952  230 SER A O   
1339 C CB  . SER A 186 ? 1.6816 1.1170 1.2786 -0.0543 0.4271  0.1194  230 SER A CB  
1340 O OG  . SER A 186 ? 1.8034 1.1546 1.3211 -0.0198 0.4608  0.1361  230 SER A OG  
1341 N N   . ASP A 187 ? 1.5062 1.0416 1.3336 -0.1787 0.4393  0.1036  231 ASP A N   
1342 C CA  . ASP A 187 ? 1.4716 1.0055 1.3785 -0.2177 0.4723  0.1109  231 ASP A CA  
1343 C C   . ASP A 187 ? 1.4526 0.9719 1.3613 -0.2491 0.4401  0.0814  231 ASP A C   
1344 O O   . ASP A 187 ? 1.4764 0.9409 1.3807 -0.2548 0.4699  0.0895  231 ASP A O   
1345 C CB  . ASP A 187 ? 1.5261 0.9927 1.4038 -0.1877 0.5433  0.1507  231 ASP A CB  
1346 C CG  . ASP A 187 ? 1.5517 1.0268 1.4189 -0.1495 0.5826  0.1824  231 ASP A CG  
1347 O OD1 . ASP A 187 ? 1.5062 1.0554 1.4428 -0.1654 0.5672  0.1782  231 ASP A OD1 
1348 O OD2 . ASP A 187 ? 1.6199 1.0249 1.4045 -0.0997 0.6295  0.2119  231 ASP A OD2 
1349 N N   . ASN A 188 ? 1.4699 1.0334 1.3796 -0.2652 0.3821  0.0493  232 ASN A N   
1350 C CA  . ASN A 188 ? 1.4478 1.0061 1.3619 -0.2931 0.3509  0.0198  232 ASN A CA  
1351 C C   . ASN A 188 ? 1.5136 0.9937 1.3462 -0.2670 0.3620  0.0212  232 ASN A C   
1352 O O   . ASN A 188 ? 1.5118 0.9683 1.3493 -0.2868 0.3548  0.0040  232 ASN A O   
1353 C CB  . ASN A 188 ? 1.3966 0.9786 1.4107 -0.3440 0.3569  0.0109  232 ASN A CB  
1354 C CG  . ASN A 188 ? 1.3304 0.9951 1.4327 -0.3693 0.3406  0.0086  232 ASN A CG  
1355 O OD1 . ASN A 188 ? 1.2967 1.0115 1.3904 -0.3676 0.2985  -0.0077 232 ASN A OD1 
1356 N ND2 . ASN A 188 ? 1.3117 0.9916 1.5047 -0.3925 0.3749  0.0273  232 ASN A ND2 
1357 N N   . THR A 189 ? 1.4220 0.8586 1.1748 -0.2191 0.3768  0.0406  233 THR A N   
1358 C CA  . THR A 189 ? 1.4875 0.8517 1.1577 -0.1872 0.3824  0.0432  233 THR A CA  
1359 C C   . THR A 189 ? 1.4823 0.8687 1.1238 -0.1841 0.3280  0.0159  233 THR A C   
1360 O O   . THR A 189 ? 1.4512 0.8934 1.1061 -0.1877 0.2916  0.0048  233 THR A O   
1361 C CB  . THR A 189 ? 1.5584 0.8686 1.1433 -0.1315 0.4061  0.0697  233 THR A CB  
1362 O OG1 . THR A 189 ? 1.5538 0.8666 1.1700 -0.1289 0.4541  0.0978  233 THR A OG1 
1363 C CG2 . THR A 189 ? 1.6227 0.8485 1.1337 -0.1007 0.4265  0.0797  233 THR A CG2 
1364 N N   . ILE A 190 ? 1.6062 0.9490 1.2112 -0.1757 0.3249  0.0078  234 ILE A N   
1365 C CA  . ILE A 190 ? 1.6072 0.9702 1.1866 -0.1660 0.2796  -0.0120 234 ILE A CA  
1366 C C   . ILE A 190 ? 1.6785 0.9821 1.1777 -0.1186 0.2774  -0.0027 234 ILE A C   
1367 O O   . ILE A 190 ? 1.7160 0.9570 1.1837 -0.1058 0.3054  0.0054  234 ILE A O   
1368 C CB  . ILE A 190 ? 1.5693 0.9501 1.1857 -0.1989 0.2673  -0.0361 234 ILE A CB  
1369 C CG1 . ILE A 190 ? 1.4930 0.9403 1.1814 -0.2410 0.2531  -0.0501 234 ILE A CG1 
1370 C CG2 . ILE A 190 ? 1.5785 0.9731 1.1655 -0.1810 0.2321  -0.0495 234 ILE A CG2 
1371 C CD1 . ILE A 190 ? 1.4629 0.9179 1.1799 -0.2720 0.2409  -0.0763 234 ILE A CD1 
1372 N N   . PHE A 191 ? 1.3948 0.7152 0.8621 -0.0917 0.2416  -0.0038 235 PHE A N   
1373 C CA  . PHE A 191 ? 1.4492 0.7235 0.8494 -0.0479 0.2249  0.0000  235 PHE A CA  
1374 C C   . PHE A 191 ? 1.4177 0.7315 0.8418 -0.0545 0.1867  -0.0180 235 PHE A C   
1375 O O   . PHE A 191 ? 1.3653 0.7458 0.8385 -0.0787 0.1595  -0.0297 235 PHE A O   
1376 C CB  . PHE A 191 ? 1.4876 0.7472 0.8365 -0.0107 0.2037  0.0088  235 PHE A CB  
1377 C CG  . PHE A 191 ? 1.5220 0.7371 0.8344 0.0071  0.2465  0.0302  235 PHE A CG  
1378 C CD1 . PHE A 191 ? 1.5742 0.7096 0.8223 0.0398  0.2859  0.0498  235 PHE A CD1 
1379 C CD2 . PHE A 191 ? 1.4977 0.7494 0.8381 -0.0049 0.2502  0.0336  235 PHE A CD2 
1380 C CE1 . PHE A 191 ? 1.5995 0.6937 0.8132 0.0601  0.3324  0.0745  235 PHE A CE1 
1381 C CE2 . PHE A 191 ? 1.5209 0.7350 0.8304 0.0158  0.2948  0.0565  235 PHE A CE2 
1382 C CZ  . PHE A 191 ? 1.5719 0.7075 0.8181 0.0485  0.3378  0.0781  235 PHE A CZ  
1383 N N   . PHE A 192 ? 1.6369 0.9102 1.0273 -0.0306 0.1878  -0.0174 236 PHE A N   
1384 C CA  . PHE A 192 ? 1.6152 0.9274 1.0295 -0.0291 0.1551  -0.0297 236 PHE A CA  
1385 C C   . PHE A 192 ? 1.6623 0.9290 1.0284 0.0151  0.1443  -0.0236 236 PHE A C   
1386 O O   . PHE A 192 ? 1.7069 0.9018 1.0171 0.0404  0.1711  -0.0122 236 PHE A O   
1387 C CB  . PHE A 192 ? 1.5794 0.9199 1.0391 -0.0646 0.1693  -0.0447 236 PHE A CB  
1388 C CG  . PHE A 192 ? 1.6072 0.8835 1.0451 -0.0672 0.2094  -0.0442 236 PHE A CG  
1389 C CD1 . PHE A 192 ? 1.6032 0.8572 1.0549 -0.0934 0.2422  -0.0406 236 PHE A CD1 
1390 C CD2 . PHE A 192 ? 1.6376 0.8757 1.0477 -0.0434 0.2145  -0.0459 236 PHE A CD2 
1391 C CE1 . PHE A 192 ? 1.6286 0.8197 1.0689 -0.0992 0.2785  -0.0388 236 PHE A CE1 
1392 C CE2 . PHE A 192 ? 1.6653 0.8364 1.0543 -0.0459 0.2512  -0.0453 236 PHE A CE2 
1393 C CZ  . PHE A 192 ? 1.6617 0.8072 1.0668 -0.0755 0.2828  -0.0418 236 PHE A CZ  
1394 N N   . THR A 193 ? 1.4378 0.7485 0.8306 0.0252  0.1055  -0.0290 237 THR A N   
1395 C CA  . THR A 193 ? 1.4784 0.7602 0.8421 0.0662  0.0891  -0.0243 237 THR A CA  
1396 C C   . THR A 193 ? 1.4734 0.7685 0.8646 0.0587  0.1062  -0.0310 237 THR A C   
1397 O O   . THR A 193 ? 1.4381 0.7826 0.8773 0.0247  0.1133  -0.0413 237 THR A O   
1398 C CB  . THR A 193 ? 1.4863 0.8077 0.8713 0.0854  0.0323  -0.0238 237 THR A CB  
1399 O OG1 . THR A 193 ? 1.4461 0.8486 0.9054 0.0504  0.0140  -0.0300 237 THR A OG1 
1400 C CG2 . THR A 193 ? 1.5124 0.7900 0.8399 0.1097  0.0137  -0.0188 237 THR A CG2 
1401 N N   . THR A 194 ? 1.7126 0.9562 1.0643 0.0940  0.1149  -0.0254 238 THR A N   
1402 C CA  . THR A 194 ? 1.7181 0.9595 1.0826 0.0962  0.1343  -0.0313 238 THR A CA  
1403 C C   . THR A 194 ? 1.7511 0.9953 1.1137 0.1407  0.1091  -0.0241 238 THR A C   
1404 O O   . THR A 194 ? 1.7766 1.0001 1.1101 0.1731  0.0806  -0.0149 238 THR A O   
1405 C CB  . THR A 194 ? 1.7368 0.8950 1.0525 0.0948  0.1815  -0.0308 238 THR A CB  
1406 O OG1 . THR A 194 ? 1.7769 0.8636 1.0264 0.1301  0.1879  -0.0143 238 THR A OG1 
1407 C CG2 . THR A 194 ? 1.7054 0.8681 1.0415 0.0472  0.2057  -0.0391 238 THR A CG2 
1408 N N   . TYR A 195 ? 1.9559 0.9237 1.4218 0.4112  0.4616  -0.1285 239 TYR A N   
1409 C CA  . TYR A 195 ? 1.9703 0.9799 1.4770 0.4720  0.4692  -0.1182 239 TYR A CA  
1410 C C   . TYR A 195 ? 2.0911 1.0064 1.5618 0.4891  0.4899  -0.1246 239 TYR A C   
1411 O O   . TYR A 195 ? 2.1599 0.9814 1.5745 0.4511  0.4985  -0.1390 239 TYR A O   
1412 C CB  . TYR A 195 ? 1.9138 1.0235 1.4650 0.4856  0.4746  -0.1362 239 TYR A CB  
1413 C CG  . TYR A 195 ? 1.9537 1.0351 1.4683 0.4542  0.4942  -0.1731 239 TYR A CG  
1414 C CD1 . TYR A 195 ? 2.0455 1.0816 1.5428 0.4757  0.5181  -0.1905 239 TYR A CD1 
1415 C CD2 . TYR A 195 ? 1.9067 1.0067 1.4011 0.4036  0.4883  -0.1902 239 TYR A CD2 
1416 C CE1 . TYR A 195 ? 2.0878 1.0986 1.5472 0.4477  0.5355  -0.2240 239 TYR A CE1 
1417 C CE2 . TYR A 195 ? 1.9489 1.0248 1.4040 0.3744  0.5038  -0.2223 239 TYR A CE2 
1418 C CZ  . TYR A 195 ? 2.0386 1.0704 1.4757 0.3966  0.5273  -0.2391 239 TYR A CZ  
1419 O OH  . TYR A 195 ? 2.0865 1.0941 1.4803 0.3683  0.5424  -0.2708 239 TYR A OH  
1420 N N   . ALA A 196 ? 2.0329 0.9758 1.5378 0.5453  0.4972  -0.1148 240 ALA A N   
1421 C CA  . ALA A 196 ? 2.1564 1.0106 1.6317 0.5702  0.5164  -0.1159 240 ALA A CA  
1422 C C   . ALA A 196 ? 2.1969 1.0810 1.6958 0.6057  0.5376  -0.1378 240 ALA A C   
1423 O O   . ALA A 196 ? 2.2658 1.0930 1.7254 0.5870  0.5589  -0.1682 240 ALA A O   
1424 C CB  . ALA A 196 ? 2.1833 1.0212 1.6696 0.6082  0.5052  -0.0769 240 ALA A CB  
1425 N N   . ASN A 197 ? 2.8320 1.8093 2.3960 0.6548  0.5308  -0.1235 241 ASN A N   
1426 C CA  . ASN A 197 ? 2.8720 1.8861 2.4688 0.6932  0.5509  -0.1417 241 ASN A CA  
1427 C C   . ASN A 197 ? 2.8350 1.8964 2.4360 0.6655  0.5649  -0.1765 241 ASN A C   
1428 O O   . ASN A 197 ? 2.9134 1.9287 2.4856 0.6642  0.5909  -0.2043 241 ASN A O   
1429 C CB  . ASN A 197 ? 2.8276 1.9444 2.5013 0.7470  0.5359  -0.1181 241 ASN A CB  
1430 C CG  . ASN A 197 ? 2.8995 1.9659 2.5676 0.7884  0.5290  -0.0868 241 ASN A CG  
1431 O OD1 . ASN A 197 ? 3.0128 1.9746 2.6351 0.7975  0.5480  -0.0904 241 ASN A OD1 
1432 N ND2 . ASN A 197 ? 2.8394 1.9790 2.5514 0.8127  0.5012  -0.0558 241 ASN A ND2 
1433 N N   . GLY A 198 ? 2.5604 1.7124 2.1940 0.6423  0.5480  -0.1746 242 GLY A N   
1434 C CA  . GLY A 198 ? 2.5173 1.7389 2.1700 0.6247  0.5600  -0.2018 242 GLY A CA  
1435 C C   . GLY A 198 ? 2.4039 1.6874 2.0668 0.5836  0.5395  -0.1975 242 GLY A C   
1436 O O   . GLY A 198 ? 2.3717 1.6264 2.0155 0.5643  0.5192  -0.1785 242 GLY A O   
1437 N N   . SER A 199 ? 2.1247 1.4958 1.8207 0.5719  0.5456  -0.2137 243 SER A N   
1438 C CA  . SER A 199 ? 2.0413 1.4525 1.7294 0.5237  0.5335  -0.2178 243 SER A CA  
1439 C C   . SER A 199 ? 1.9608 1.4034 1.6712 0.5179  0.5031  -0.1895 243 SER A C   
1440 O O   . SER A 199 ? 1.9420 1.4188 1.6963 0.5559  0.4882  -0.1651 243 SER A O   
1441 C CB  . SER A 199 ? 1.9855 1.5036 1.7225 0.5216  0.5435  -0.2319 243 SER A CB  
1442 O OG  . SER A 199 ? 1.9296 1.5487 1.7506 0.5588  0.5312  -0.2141 243 SER A OG  
1443 N N   . CYS A 200 ? 2.0652 1.4896 1.7389 0.4689  0.4935  -0.1934 244 CYS A N   
1444 C CA  . CYS A 200 ? 2.0021 1.4615 1.6939 0.4561  0.4673  -0.1713 244 CYS A CA  
1445 C C   . CYS A 200 ? 1.9218 1.5059 1.6973 0.4867  0.4544  -0.1566 244 CYS A C   
1446 O O   . CYS A 200 ? 1.8937 1.5048 1.7000 0.5110  0.4331  -0.1310 244 CYS A O   
1447 C CB  . CYS A 200 ? 1.9905 1.4445 1.6451 0.3991  0.4644  -0.1856 244 CYS A CB  
1448 S SG  . CYS A 200 ? 1.9777 1.3746 1.5952 0.3632  0.4404  -0.1696 244 CYS A SG  
1449 N N   . LYS A 201 ? 1.9286 1.5883 1.7391 0.4831  0.4670  -0.1733 245 LYS A N   
1450 C CA  . LYS A 201 ? 1.8558 1.6391 1.7509 0.5062  0.4570  -0.1648 245 LYS A CA  
1451 C C   . LYS A 201 ? 1.8725 1.6755 1.8120 0.5608  0.4471  -0.1468 245 LYS A C   
1452 O O   . LYS A 201 ? 1.8152 1.6877 1.8044 0.5767  0.4212  -0.1262 245 LYS A O   
1453 C CB  . LYS A 201 ? 1.8494 1.6905 1.7682 0.4963  0.4808  -0.1891 245 LYS A CB  
1454 C CG  . LYS A 201 ? 1.7613 1.7249 1.7476 0.4818  0.4711  -0.1868 245 LYS A CG  
1455 C CD  . LYS A 201 ? 1.7265 1.6896 1.6849 0.4349  0.4571  -0.1813 245 LYS A CD  
1456 C CE  . LYS A 201 ? 1.6457 1.7256 1.6703 0.4182  0.4479  -0.1782 245 LYS A CE  
1457 N NZ  . LYS A 201 ? 1.6155 1.6945 1.6175 0.3786  0.4314  -0.1686 245 LYS A NZ  
1458 N N   . ALA A 202 ? 1.7112 1.4519 1.6300 0.5886  0.4667  -0.1545 246 ALA A N   
1459 C CA  . ALA A 202 ? 1.7487 1.5029 1.7061 0.6423  0.4601  -0.1380 246 ALA A CA  
1460 C C   . ALA A 202 ? 1.7543 1.4628 1.6908 0.6566  0.4348  -0.1067 246 ALA A C   
1461 O O   . ALA A 202 ? 1.7334 1.4995 1.7165 0.6895  0.4126  -0.0847 246 ALA A O   
1462 C CB  . ALA A 202 ? 1.8552 1.5425 1.7880 0.6668  0.4900  -0.1547 246 ALA A CB  
1463 N N   . ASP A 203 ? 1.7514 1.3571 1.6162 0.6289  0.4376  -0.1051 247 ASP A N   
1464 C CA  . ASP A 203 ? 1.7776 1.3207 1.6120 0.6402  0.4206  -0.0767 247 ASP A CA  
1465 C C   . ASP A 203 ? 1.6883 1.2816 1.5358 0.6198  0.3922  -0.0586 247 ASP A C   
1466 O O   . ASP A 203 ? 1.7017 1.2395 1.5150 0.6161  0.3795  -0.0371 247 ASP A O   
1467 C CB  . ASP A 203 ? 1.8660 1.2714 1.6206 0.6191  0.4385  -0.0839 247 ASP A CB  
1468 C CG  . ASP A 203 ? 1.9733 1.3173 1.7138 0.6535  0.4604  -0.0902 247 ASP A CG  
1469 O OD1 . ASP A 203 ? 1.9812 1.3880 1.7698 0.6855  0.4698  -0.1000 247 ASP A OD1 
1470 O OD2 . ASP A 203 ? 2.0560 1.2884 1.7387 0.6472  0.4690  -0.0859 247 ASP A OD2 
1471 N N   . LEU A 204 ? 1.8129 1.5074 1.7074 0.6030  0.3846  -0.0686 248 LEU A N   
1472 C CA  . LEU A 204 ? 1.7439 1.4924 1.6537 0.5821  0.3588  -0.0550 248 LEU A CA  
1473 C C   . LEU A 204 ? 1.7324 1.4998 1.6582 0.6151  0.3310  -0.0229 248 LEU A C   
1474 O O   . LEU A 204 ? 1.7315 1.5569 1.7029 0.6525  0.3210  -0.0143 248 LEU A O   
1475 C CB  . LEU A 204 ? 1.6650 1.5319 1.6356 0.5673  0.3543  -0.0688 248 LEU A CB  
1476 C CG  . LEU A 204 ? 1.6038 1.5136 1.5787 0.5318  0.3358  -0.0641 248 LEU A CG  
1477 C CD1 . LEU A 204 ? 1.6497 1.4768 1.5601 0.4789  0.3440  -0.0750 248 LEU A CD1 
1478 C CD2 . LEU A 204 ? 1.5278 1.5585 1.5693 0.5192  0.3302  -0.0753 248 LEU A CD2 
1479 N N   . GLY A 205 ? 1.4142 1.1317 1.3004 0.5995  0.3187  -0.0054 249 GLY A N   
1480 C CA  . GLY A 205 ? 1.4196 1.1350 1.3029 0.6269  0.2952  0.0267  249 GLY A CA  
1481 C C   . GLY A 205 ? 1.5075 1.1075 1.3364 0.6449  0.3082  0.0413  249 GLY A C   
1482 O O   . GLY A 205 ? 1.5305 1.0971 1.3339 0.6546  0.2944  0.0687  249 GLY A O   
1483 N N   . ALA A 206 ? 1.4863 1.0256 1.2960 0.6482  0.3356  0.0227  250 ALA A N   
1484 C CA  . ALA A 206 ? 1.5961 1.0208 1.3538 0.6620  0.3511  0.0328  250 ALA A CA  
1485 C C   . ALA A 206 ? 1.6324 0.9468 1.3259 0.6155  0.3699  0.0197  250 ALA A C   
1486 O O   . ALA A 206 ? 1.7271 0.9388 1.3739 0.6161  0.3853  0.0233  250 ALA A O   
1487 C CB  . ALA A 206 ? 1.6636 1.0872 1.4406 0.6987  0.3685  0.0212  250 ALA A CB  
1488 N N   . LEU A 207 ? 1.5525 0.8905 1.2452 0.5731  0.3679  0.0034  251 LEU A N   
1489 C CA  . LEU A 207 ? 1.5931 0.8389 1.2298 0.5227  0.3820  -0.0132 251 LEU A CA  
1490 C C   . LEU A 207 ? 1.6329 0.7975 1.2277 0.5062  0.3761  0.0111  251 LEU A C   
1491 O O   . LEU A 207 ? 1.6038 0.8022 1.2137 0.5236  0.3570  0.0406  251 LEU A O   
1492 C CB  . LEU A 207 ? 1.5271 0.8305 1.1776 0.4818  0.3761  -0.0325 251 LEU A CB  
1493 C CG  . LEU A 207 ? 1.4822 0.8741 1.1765 0.4950  0.3836  -0.0541 251 LEU A CG  
1494 C CD1 . LEU A 207 ? 1.4158 0.8763 1.1261 0.4403  0.3681  -0.0670 251 LEU A CD1 
1495 C CD2 . LEU A 207 ? 1.5494 0.8858 1.2186 0.4986  0.4098  -0.0779 251 LEU A CD2 
1496 N N   . GLU A 208 ? 1.7506 0.8110 1.2926 0.4692  0.3921  -0.0019 252 GLU A N   
1497 C CA  . GLU A 208 ? 1.7896 0.7714 1.2933 0.4417  0.3893  0.0180  252 GLU A CA  
1498 C C   . GLU A 208 ? 1.7605 0.7398 1.2528 0.3767  0.3807  0.0045  252 GLU A C   
1499 O O   . GLU A 208 ? 1.7687 0.7483 1.2518 0.3420  0.3854  -0.0269 252 GLU A O   
1500 C CB  . GLU A 208 ? 1.8876 0.7628 1.3469 0.4398  0.4091  0.0149  252 GLU A CB  
1501 C CG  . GLU A 208 ? 1.9455 0.7855 1.3941 0.4697  0.4067  0.0515  252 GLU A CG  
1502 C CD  . GLU A 208 ? 2.0713 0.8132 1.4820 0.4782  0.4283  0.0476  252 GLU A CD  
1503 O OE1 . GLU A 208 ? 2.1084 0.8474 1.5233 0.5002  0.4420  0.0257  252 GLU A OE1 
1504 O OE2 . GLU A 208 ? 2.1362 0.8051 1.5139 0.4627  0.4328  0.0663  252 GLU A OE2 
1505 N N   . LEU A 209 ? 1.7062 0.7069 1.2061 0.3527  0.3613  0.0295  253 LEU A N   
1506 C CA  . LEU A 209 ? 1.6876 0.7157 1.1920 0.2851  0.3447  0.0205  253 LEU A CA  
1507 C C   . LEU A 209 ? 1.7404 0.6618 1.2004 0.2442  0.3561  0.0222  253 LEU A C   
1508 O O   . LEU A 209 ? 1.7614 0.6297 1.2042 0.2579  0.3627  0.0499  253 LEU A O   
1509 C CB  . LEU A 209 ? 1.6235 0.7508 1.1695 0.2796  0.3174  0.0430  253 LEU A CB  
1510 C CG  . LEU A 209 ? 1.5990 0.7600 1.1560 0.2153  0.2999  0.0374  253 LEU A CG  
1511 C CD1 . LEU A 209 ? 1.5903 0.7881 1.1560 0.1838  0.2948  0.0051  253 LEU A CD1 
1512 C CD2 . LEU A 209 ? 1.5403 0.7882 1.1341 0.2164  0.2774  0.0600  253 LEU A CD2 
1513 N N   . TRP A 210 ? 1.7921 0.6840 1.2330 0.1924  0.3577  -0.0069 254 TRP A N   
1514 C CA  . TRP A 210 ? 1.8393 0.6311 1.2406 0.1472  0.3680  -0.0112 254 TRP A CA  
1515 C C   . TRP A 210 ? 1.8011 0.6395 1.2208 0.0807  0.3455  -0.0164 254 TRP A C   
1516 O O   . TRP A 210 ? 1.7499 0.6853 1.2040 0.0681  0.3242  -0.0236 254 TRP A O   
1517 C CB  . TRP A 210 ? 1.9115 0.6102 1.2658 0.1415  0.3904  -0.0446 254 TRP A CB  
1518 C CG  . TRP A 210 ? 1.9577 0.6264 1.3025 0.1994  0.4087  -0.0389 254 TRP A CG  
1519 C CD1 . TRP A 210 ? 1.9324 0.6502 1.3046 0.2637  0.4096  -0.0191 254 TRP A CD1 
1520 C CD2 . TRP A 210 ? 2.0488 0.6354 1.3570 0.1976  0.4269  -0.0533 254 TRP A CD2 
1521 N NE1 . TRP A 210 ? 1.9979 0.6705 1.3547 0.3020  0.4267  -0.0193 254 TRP A NE1 
1522 C CE2 . TRP A 210 ? 2.0854 0.6727 1.4011 0.2633  0.4392  -0.0402 254 TRP A CE2 
1523 C CE3 . TRP A 210 ? 2.1243 0.6405 1.3961 0.1464  0.4324  -0.0766 254 TRP A CE3 
1524 C CZ2 . TRP A 210 ? 2.1971 0.7103 1.4834 0.2804  0.4592  -0.0489 254 TRP A CZ2 
1525 C CZ3 . TRP A 210 ? 2.2361 0.6774 1.4766 0.1632  0.4525  -0.0865 254 TRP A CZ3 
1526 C CH2 . TRP A 210 ? 2.2726 0.7098 1.5196 0.2301  0.4669  -0.0724 254 TRP A CH2 
1527 N N   . ARG A 211 ? 1.8454 0.6140 1.2443 0.0390  0.3510  -0.0115 255 ARG A N   
1528 C CA  . ARG A 211 ? 1.8056 0.6125 1.2247 -0.0252 0.3312  -0.0161 255 ARG A CA  
1529 C C   . ARG A 211 ? 1.8600 0.5691 1.2413 -0.0760 0.3418  -0.0358 255 ARG A C   
1530 O O   . ARG A 211 ? 1.9190 0.5647 1.2785 -0.0634 0.3583  -0.0290 255 ARG A O   
1531 C CB  . ARG A 211 ? 1.7543 0.6099 1.2076 -0.0276 0.3225  0.0197  255 ARG A CB  
1532 C CG  . ARG A 211 ? 1.6988 0.5962 1.1802 -0.0906 0.3047  0.0178  255 ARG A CG  
1533 C CD  . ARG A 211 ? 1.6668 0.5819 1.1704 -0.0940 0.3074  0.0530  255 ARG A CD  
1534 N NE  . ARG A 211 ? 1.7336 0.5481 1.2052 -0.1050 0.3315  0.0655  255 ARG A NE  
1535 C CZ  . ARG A 211 ? 1.7286 0.5464 1.2079 -0.0950 0.3397  0.0977  255 ARG A CZ  
1536 N NH1 . ARG A 211 ? 1.6667 0.5470 1.1690 -0.0755 0.3341  0.1229  255 ARG A NH1 
1537 N NH2 . ARG A 211 ? 1.8119 0.5689 1.2726 -0.1042 0.3542  0.1042  255 ARG A NH2 
1538 N N   . THR A 212 ? 1.9260 0.6647 1.3142 -0.1318 0.3227  -0.0592 256 THR A N   
1539 C CA  . THR A 212 ? 1.9636 0.6644 1.3374 -0.1845 0.3184  -0.0783 256 THR A CA  
1540 C C   . THR A 212 ? 1.8998 0.6682 1.3132 -0.2429 0.2914  -0.0776 256 THR A C   
1541 O O   . THR A 212 ? 1.8421 0.6744 1.2730 -0.2562 0.2716  -0.0855 256 THR A O   
1542 C CB  . THR A 212 ? 2.0307 0.6870 1.3599 -0.1885 0.3228  -0.1172 256 THR A CB  
1543 O OG1 . THR A 212 ? 2.1354 0.7139 1.4371 -0.1985 0.3376  -0.1239 256 THR A OG1 
1544 C CG2 . THR A 212 ? 2.0074 0.7108 1.3383 -0.2392 0.2961  -0.1444 256 THR A CG2 
1545 N N   . SER A 213 ? 2.0518 0.8126 1.4845 -0.2743 0.2909  -0.0649 257 SER A N   
1546 C CA  . SER A 213 ? 1.9984 0.8292 1.4766 -0.3274 0.2657  -0.0644 257 SER A CA  
1547 C C   . SER A 213 ? 2.0564 0.8721 1.5233 -0.3773 0.2506  -0.0958 257 SER A C   
1548 O O   . SER A 213 ? 2.0140 0.8956 1.5157 -0.4192 0.2235  -0.1029 257 SER A O   
1549 C CB  . SER A 213 ? 1.9886 0.8333 1.5027 -0.3322 0.2742  -0.0313 257 SER A CB  
1550 O OG  . SER A 213 ? 1.9830 0.8060 1.4852 -0.2781 0.2953  -0.0036 257 SER A OG  
1551 N N   . ASP A 214 ? 2.2607 0.9916 1.6787 -0.3693 0.2674  -0.1146 258 ASP A N   
1552 C CA  . ASP A 214 ? 2.3389 1.0396 1.7381 -0.4138 0.2573  -0.1444 258 ASP A CA  
1553 C C   . ASP A 214 ? 2.3563 1.0527 1.7142 -0.4166 0.2463  -0.1793 258 ASP A C   
1554 O O   . ASP A 214 ? 2.4364 1.0957 1.7656 -0.4460 0.2411  -0.2067 258 ASP A O   
1555 C CB  . ASP A 214 ? 2.4532 1.0595 1.8245 -0.4101 0.2832  -0.1433 258 ASP A CB  
1556 C CG  . ASP A 214 ? 2.4864 1.0302 1.8224 -0.3486 0.3136  -0.1313 258 ASP A CG  
1557 O OD1 . ASP A 214 ? 2.4886 1.0194 1.7916 -0.3187 0.3183  -0.1489 258 ASP A OD1 
1558 O OD2 . ASP A 214 ? 2.5107 1.0234 1.8536 -0.3283 0.3324  -0.1029 258 ASP A OD2 
1559 N N   . LEU A 215 ? 2.0594 0.7895 1.4113 -0.3840 0.2453  -0.1781 259 LEU A N   
1560 C CA  . LEU A 215 ? 2.0708 0.8029 1.3823 -0.3814 0.2378  -0.2082 259 LEU A CA  
1561 C C   . LEU A 215 ? 2.1759 0.8183 1.4297 -0.3560 0.2648  -0.2294 259 LEU A C   
1562 O O   . LEU A 215 ? 2.2329 0.8561 1.4477 -0.3746 0.2586  -0.2600 259 LEU A O   
1563 C CB  . LEU A 215 ? 2.0609 0.8462 1.3802 -0.4353 0.2020  -0.2274 259 LEU A CB  
1564 C CG  . LEU A 215 ? 1.9506 0.8362 1.3297 -0.4543 0.1735  -0.2071 259 LEU A CG  
1565 C CD1 . LEU A 215 ? 1.9515 0.8902 1.3419 -0.5038 0.1367  -0.2236 259 LEU A CD1 
1566 C CD2 . LEU A 215 ? 1.8714 0.7978 1.2522 -0.4197 0.1745  -0.1983 259 LEU A CD2 
1567 N N   . GLY A 216 ? 2.0931 0.6831 1.3418 -0.3110 0.2944  -0.2115 260 GLY A N   
1568 C CA  . GLY A 216 ? 2.1870 0.6984 1.3878 -0.2761 0.3222  -0.2273 260 GLY A CA  
1569 C C   . GLY A 216 ? 2.2944 0.7228 1.4791 -0.2837 0.3396  -0.2253 260 GLY A C   
1570 O O   . GLY A 216 ? 2.3778 0.7364 1.5264 -0.2499 0.3651  -0.2338 260 GLY A O   
1571 N N   . LYS A 217 ? 2.2741 0.7109 1.4875 -0.3269 0.3271  -0.2139 261 LYS A N   
1572 C CA  . LYS A 217 ? 2.3819 0.7382 1.5807 -0.3382 0.3443  -0.2118 261 LYS A CA  
1573 C C   . LYS A 217 ? 2.4028 0.7143 1.6013 -0.2845 0.3727  -0.1797 261 LYS A C   
1574 O O   . LYS A 217 ? 2.5080 0.7348 1.6722 -0.2645 0.3964  -0.1836 261 LYS A O   
1575 C CB  . LYS A 217 ? 2.3807 0.7637 1.6156 -0.3990 0.3244  -0.2079 261 LYS A CB  
1576 C CG  . LYS A 217 ? 2.4452 0.8175 1.6607 -0.4526 0.3058  -0.2451 261 LYS A CG  
1577 C CD  . LYS A 217 ? 2.4615 0.8526 1.7177 -0.5089 0.2902  -0.2399 261 LYS A CD  
1578 C CE  . LYS A 217 ? 2.5558 0.8638 1.8062 -0.5065 0.3178  -0.2244 261 LYS A CE  
1579 N NZ  . LYS A 217 ? 2.6972 0.9041 1.8920 -0.5141 0.3337  -0.2537 261 LYS A NZ  
1580 N N   . SER A 218 ? 2.5572 0.9263 1.7924 -0.2597 0.3694  -0.1478 262 SER A N   
1581 C CA  . SER A 218 ? 2.5697 0.9091 1.8057 -0.2059 0.3918  -0.1140 262 SER A CA  
1582 C C   . SER A 218 ? 2.4611 0.8693 1.7213 -0.1618 0.3870  -0.0941 262 SER A C   
1583 O O   . SER A 218 ? 2.3648 0.8493 1.6548 -0.1839 0.3655  -0.0955 262 SER A O   
1584 C CB  . SER A 218 ? 2.5915 0.9184 1.8499 -0.2297 0.3950  -0.0862 262 SER A CB  
1585 O OG  . SER A 218 ? 2.4846 0.8989 1.7916 -0.2532 0.3750  -0.0690 262 SER A OG  
1586 N N   . PHE A 219 ? 2.3342 0.7176 1.5836 -0.0988 0.4059  -0.0751 263 PHE A N   
1587 C CA  . PHE A 219 ? 2.2393 0.6877 1.5127 -0.0531 0.4012  -0.0562 263 PHE A CA  
1588 C C   . PHE A 219 ? 2.2418 0.6858 1.5258 -0.0107 0.4109  -0.0143 263 PHE A C   
1589 O O   . PHE A 219 ? 2.3333 0.7106 1.5964 -0.0010 0.4271  -0.0019 263 PHE A O   
1590 C CB  . PHE A 219 ? 2.2456 0.6933 1.5016 -0.0082 0.4101  -0.0765 263 PHE A CB  
1591 C CG  . PHE A 219 ? 2.2605 0.7061 1.4954 -0.0449 0.4034  -0.1182 263 PHE A CG  
1592 C CD1 . PHE A 219 ? 2.3691 0.7407 1.5646 -0.0593 0.4161  -0.1433 263 PHE A CD1 
1593 C CD2 . PHE A 219 ? 2.1738 0.6906 1.4250 -0.0649 0.3841  -0.1321 263 PHE A CD2 
1594 C CE1 . PHE A 219 ? 2.3877 0.7597 1.5590 -0.0925 0.4087  -0.1812 263 PHE A CE1 
1595 C CE2 . PHE A 219 ? 2.1925 0.7104 1.4191 -0.0983 0.3763  -0.1689 263 PHE A CE2 
1596 C CZ  . PHE A 219 ? 2.2986 0.7454 1.4843 -0.1118 0.3882  -0.1934 263 PHE A CZ  
1597 N N   . LYS A 220 ? 2.1907 0.7060 1.5048 0.0141  0.4002  0.0074  264 LYS A N   
1598 C CA  . LYS A 220 ? 2.1855 0.7102 1.5073 0.0614  0.4057  0.0469  264 LYS A CA  
1599 C C   . LYS A 220 ? 2.1172 0.7032 1.4564 0.1167  0.3994  0.0520  264 LYS A C   
1600 O O   . LYS A 220 ? 2.0371 0.6849 1.3995 0.1029  0.3849  0.0409  264 LYS A O   
1601 C CB  . LYS A 220 ? 2.1370 0.6998 1.4839 0.0279  0.3960  0.0722  264 LYS A CB  
1602 C CG  . LYS A 220 ? 2.1297 0.7103 1.4804 0.0739  0.3991  0.1136  264 LYS A CG  
1603 C CD  . LYS A 220 ? 2.0791 0.7047 1.4550 0.0388  0.3913  0.1360  264 LYS A CD  
1604 C CE  . LYS A 220 ? 2.1016 0.7284 1.4683 0.0791  0.3975  0.1760  264 LYS A CE  
1605 N NZ  . LYS A 220 ? 2.0661 0.7318 1.4538 0.0440  0.3944  0.1965  264 LYS A NZ  
1606 N N   . THR A 221 ? 2.0115 0.5860 1.3432 0.1791  0.4087  0.0690  265 THR A N   
1607 C CA  . THR A 221 ? 1.9442 0.5885 1.3005 0.2326  0.4008  0.0721  265 THR A CA  
1608 C C   . THR A 221 ? 1.8798 0.5830 1.2586 0.2489  0.3866  0.1080  265 THR A C   
1609 O O   . THR A 221 ? 1.9236 0.6094 1.2917 0.2744  0.3898  0.1379  265 THR A O   
1610 C CB  . THR A 221 ? 2.0103 0.6328 1.3572 0.2938  0.4134  0.0737  265 THR A CB  
1611 O OG1 . THR A 221 ? 2.0512 0.6615 1.3922 0.3289  0.4142  0.1111  265 THR A OG1 
1612 C CG2 . THR A 221 ? 2.1100 0.6482 1.4227 0.2753  0.4324  0.0456  265 THR A CG2 
1613 N N   . ILE A 222 ? 2.0254 0.7972 1.4326 0.2326  0.3709  0.1044  266 ILE A N   
1614 C CA  . ILE A 222 ? 1.9680 0.8062 1.3982 0.2354  0.3549  0.1346  266 ILE A CA  
1615 C C   . ILE A 222 ? 1.9246 0.8564 1.3858 0.2916  0.3382  0.1449  266 ILE A C   
1616 O O   . ILE A 222 ? 1.8803 0.8810 1.3616 0.2973  0.3214  0.1657  266 ILE A O   
1617 C CB  . ILE A 222 ? 1.9149 0.8185 1.3757 0.1720  0.3371  0.1231  266 ILE A CB  
1618 C CG1 . ILE A 222 ? 1.8779 0.8675 1.3729 0.1636  0.3192  0.0926  266 ILE A CG1 
1619 C CG2 . ILE A 222 ? 1.9484 0.7680 1.3846 0.1135  0.3507  0.1127  266 ILE A CG2 
1620 C CD1 . ILE A 222 ? 1.8334 0.8771 1.3550 0.1032  0.3019  0.0802  266 ILE A CD1 
1621 N N   . GLY A 223 ? 1.8214 0.7591 1.2880 0.3318  0.3431  0.1284  267 GLY A N   
1622 C CA  . GLY A 223 ? 1.7790 0.8051 1.2788 0.3862  0.3278  0.1381  267 GLY A CA  
1623 C C   . GLY A 223 ? 1.8100 0.8099 1.3066 0.4379  0.3428  0.1270  267 GLY A C   
1624 O O   . GLY A 223 ? 1.8498 0.7951 1.3291 0.4208  0.3601  0.1004  267 GLY A O   
1625 N N   . VAL A 224 ? 1.6843 0.7470 1.2050 0.4917  0.3301  0.1446  268 VAL A N   
1626 C CA  . VAL A 224 ? 1.7030 0.7797 1.2389 0.5360  0.3365  0.1348  268 VAL A CA  
1627 C C   . VAL A 224 ? 1.6281 0.8286 1.2188 0.5737  0.3139  0.1378  268 VAL A C   
1628 O O   . VAL A 224 ? 1.5740 0.8361 1.1812 0.5693  0.2932  0.1516  268 VAL A O   
1629 C CB  . VAL A 224 ? 1.8026 0.8131 1.3077 0.5652  0.3449  0.1579  268 VAL A CB  
1630 C CG1 . VAL A 224 ? 1.8882 0.7785 1.3434 0.5260  0.3688  0.1504  268 VAL A CG1 
1631 C CG2 . VAL A 224 ? 1.7948 0.8356 1.2958 0.5837  0.3257  0.1952  268 VAL A CG2 
1632 N N   . LYS A 225 ? 1.7668 1.0062 1.3876 0.6081  0.3176  0.1240  269 LYS A N   
1633 C CA  . LYS A 225 ? 1.6886 1.0541 1.3706 0.6349  0.2974  0.1197  269 LYS A CA  
1634 C C   . LYS A 225 ? 1.6134 1.0425 1.3207 0.6000  0.2890  0.1024  269 LYS A C   
1635 O O   . LYS A 225 ? 1.5473 1.0710 1.2918 0.6077  0.2645  0.1105  269 LYS A O   
1636 C CB  . LYS A 225 ? 1.6874 1.1053 1.3816 0.6706  0.2709  0.1518  269 LYS A CB  
1637 C CG  . LYS A 225 ? 1.7769 1.1681 1.4654 0.7169  0.2743  0.1667  269 LYS A CG  
1638 C CD  . LYS A 225 ? 1.7678 1.2274 1.5109 0.7462  0.2766  0.1460  269 LYS A CD  
1639 C CE  . LYS A 225 ? 1.8144 1.3165 1.5803 0.7988  0.2598  0.1671  269 LYS A CE  
1640 N NZ  . LYS A 225 ? 1.9381 1.3368 1.6590 0.8249  0.2768  0.1842  269 LYS A NZ  
1641 N N   . ILE A 226 ? 1.4395 0.8164 1.1248 0.5601  0.3087  0.0774  270 ILE A N   
1642 C CA  . ILE A 226 ? 1.3407 0.7875 1.0495 0.5030  0.2925  0.0609  270 ILE A CA  
1643 C C   . ILE A 226 ? 1.2797 0.8204 1.0387 0.5066  0.2920  0.0361  270 ILE A C   
1644 O O   . ILE A 226 ? 1.3215 0.8441 1.0820 0.5281  0.3153  0.0174  270 ILE A O   
1645 C CB  . ILE A 226 ? 1.3585 0.7284 1.0255 0.4421  0.3031  0.0461  270 ILE A CB  
1646 C CG1 . ILE A 226 ? 1.4213 0.7001 1.0431 0.4338  0.3065  0.0706  270 ILE A CG1 
1647 C CG2 . ILE A 226 ? 1.2629 0.7063 0.9549 0.3882  0.2836  0.0341  270 ILE A CG2 
1648 C CD1 . ILE A 226 ? 1.3665 0.6977 1.0018 0.4271  0.2819  0.0974  270 ILE A CD1 
1649 N N   . TYR A 227 ? 1.5185 1.1575 1.3177 0.4851  0.2674  0.0363  271 TYR A N   
1650 C CA  . TYR A 227 ? 1.4615 1.1889 1.3072 0.4754  0.2664  0.0139  271 TYR A CA  
1651 C C   . TYR A 227 ? 1.4730 1.1816 1.2987 0.4122  0.2694  -0.0052 271 TYR A C   
1652 O O   . TYR A 227 ? 1.4925 1.1781 1.3060 0.4004  0.2900  -0.0280 271 TYR A O   
1653 C CB  . TYR A 227 ? 1.3861 1.2240 1.2839 0.4850  0.2375  0.0244  271 TYR A CB  
1654 C CG  . TYR A 227 ? 1.3208 1.2573 1.2751 0.4813  0.2370  0.0042  271 TYR A CG  
1655 C CD1 . TYR A 227 ? 1.2889 1.2636 1.2547 0.4287  0.2306  -0.0103 271 TYR A CD1 
1656 C CD2 . TYR A 227 ? 1.2905 1.2841 1.2893 0.5307  0.2432  0.0011  271 TYR A CD2 
1657 C CE1 . TYR A 227 ? 1.2312 1.2921 1.2470 0.4223  0.2325  -0.0271 271 TYR A CE1 
1658 C CE2 . TYR A 227 ? 1.2302 1.3181 1.2855 0.5243  0.2450  -0.0170 271 TYR A CE2 
1659 C CZ  . TYR A 227 ? 1.2018 1.3204 1.2633 0.4682  0.2406  -0.0309 271 TYR A CZ  
1660 O OH  . TYR A 227 ? 1.1455 1.3529 1.2610 0.4586  0.2451  -0.0477 271 TYR A OH  
1661 N N   . SER A 228 ? 1.2630 0.9803 1.0829 0.3729  0.2490  0.0045  272 SER A N   
1662 C CA  . SER A 228 ? 1.2775 0.9769 1.0789 0.3155  0.2483  -0.0101 272 SER A CA  
1663 C C   . SER A 228 ? 1.2975 0.9675 1.0793 0.2850  0.2328  0.0072  272 SER A C   
1664 O O   . SER A 228 ? 1.3032 0.9614 1.0805 0.3087  0.2262  0.0298  272 SER A O   
1665 C CB  . SER A 228 ? 1.2098 1.0007 1.0526 0.2946  0.2383  -0.0233 272 SER A CB  
1666 O OG  . SER A 228 ? 1.2275 0.9989 1.0490 0.2440  0.2386  -0.0370 272 SER A OG  
1667 N N   . PHE A 229 ? 1.1863 0.8458 0.9562 0.2338  0.2275  -0.0023 273 PHE A N   
1668 C CA  . PHE A 229 ? 1.2009 0.8439 0.9611 0.2018  0.2137  0.0126  273 PHE A CA  
1669 C C   . PHE A 229 ? 1.1814 0.8619 0.9543 0.1537  0.1999  0.0023  273 PHE A C   
1670 O O   . PHE A 229 ? 1.1680 0.8681 0.9440 0.1408  0.2033  -0.0164 273 PHE A O   
1671 C CB  . PHE A 229 ? 1.2700 0.8122 0.9849 0.1919  0.2277  0.0179  273 PHE A CB  
1672 C CG  . PHE A 229 ? 1.3107 0.8012 0.9961 0.1530  0.2365  -0.0042 273 PHE A CG  
1673 C CD1 . PHE A 229 ? 1.3358 0.7949 1.0015 0.1666  0.2552  -0.0258 273 PHE A CD1 
1674 C CD2 . PHE A 229 ? 1.3162 0.7911 0.9934 0.1037  0.2261  -0.0043 273 PHE A CD2 
1675 C CE1 . PHE A 229 ? 1.3755 0.7841 1.0059 0.1298  0.2624  -0.0483 273 PHE A CE1 
1676 C CE2 . PHE A 229 ? 1.3463 0.7765 0.9942 0.0667  0.2302  -0.0255 273 PHE A CE2 
1677 C CZ  . PHE A 229 ? 1.3824 0.7771 1.0030 0.0789  0.2479  -0.0482 273 PHE A CZ  
1678 N N   . GLY A 230 ? 1.0852 0.7760 0.8648 0.1294  0.1854  0.0160  274 GLY A N   
1679 C CA  . GLY A 230 ? 1.0626 0.7890 0.8570 0.0878  0.1707  0.0098  274 GLY A CA  
1680 C C   . GLY A 230 ? 1.0431 0.7631 0.8406 0.0622  0.1606  0.0249  274 GLY A C   
1681 O O   . GLY A 230 ? 1.0381 0.7461 0.8330 0.0794  0.1628  0.0427  274 GLY A O   
1682 N N   . LEU A 231 ? 1.0906 0.8206 0.8937 0.0222  0.1499  0.0190  275 LEU A N   
1683 C CA  . LEU A 231 ? 1.0354 0.7653 0.8484 -0.0027 0.1419  0.0325  275 LEU A CA  
1684 C C   . LEU A 231 ? 0.9602 0.7585 0.8094 -0.0150 0.1245  0.0356  275 LEU A C   
1685 O O   . LEU A 231 ? 0.9426 0.7696 0.8004 -0.0276 0.1158  0.0241  275 LEU A O   
1686 C CB  . LEU A 231 ? 1.0451 0.7248 0.8376 -0.0413 0.1430  0.0251  275 LEU A CB  
1687 C CG  . LEU A 231 ? 1.1125 0.7106 0.8663 -0.0335 0.1624  0.0229  275 LEU A CG  
1688 C CD1 . LEU A 231 ? 1.1710 0.7344 0.8946 -0.0378 0.1691  -0.0007 275 LEU A CD1 
1689 C CD2 . LEU A 231 ? 1.1018 0.6579 0.8493 -0.0654 0.1650  0.0312  275 LEU A CD2 
1690 N N   . GLY A 232 ? 1.0093 0.8292 0.8759 -0.0110 0.1213  0.0513  276 GLY A N   
1691 C CA  . GLY A 232 ? 0.9419 0.8122 0.8405 -0.0295 0.1070  0.0542  276 GLY A CA  
1692 C C   . GLY A 232 ? 0.9138 0.7852 0.8231 -0.0354 0.1099  0.0706  276 GLY A C   
1693 O O   . GLY A 232 ? 0.9372 0.7891 0.8318 -0.0141 0.1210  0.0827  276 GLY A O   
1694 N N   . GLY A 233 ? 0.8863 0.7843 0.8220 -0.0617 0.1003  0.0724  277 GLY A N   
1695 C CA  . GLY A 233 ? 0.8647 0.7633 0.8143 -0.0728 0.1065  0.0867  277 GLY A CA  
1696 C C   . GLY A 233 ? 0.9090 0.7471 0.8322 -0.0802 0.1229  0.0942  277 GLY A C   
1697 O O   . GLY A 233 ? 0.9441 0.7405 0.8472 -0.0944 0.1242  0.0847  277 GLY A O   
1698 N N   . ARG A 234 ? 1.1477 0.9757 1.0661 -0.0702 0.1372  0.1109  278 ARG A N   
1699 C CA  . ARG A 234 ? 1.1925 0.9564 1.0830 -0.0766 0.1557  0.1208  278 ARG A CA  
1700 C C   . ARG A 234 ? 1.2487 0.9680 1.0984 -0.0427 0.1642  0.1219  278 ARG A C   
1701 O O   . ARG A 234 ? 1.2946 0.9494 1.1139 -0.0417 0.1807  0.1305  278 ARG A O   
1702 C CB  . ARG A 234 ? 1.1819 0.9479 1.0776 -0.0781 0.1714  0.1412  278 ARG A CB  
1703 C CG  . ARG A 234 ? 1.1339 0.9423 1.0745 -0.1101 0.1684  0.1428  278 ARG A CG  
1704 C CD  . ARG A 234 ? 1.1266 0.9442 1.0710 -0.1049 0.1877  0.1625  278 ARG A CD  
1705 N NE  . ARG A 234 ? 1.1155 0.9654 1.0501 -0.0689 0.1852  0.1654  278 ARG A NE  
1706 C CZ  . ARG A 234 ? 1.1491 0.9730 1.0439 -0.0403 0.1984  0.1795  278 ARG A CZ  
1707 N NH1 . ARG A 234 ? 1.1949 0.9555 1.0558 -0.0420 0.2172  0.1944  278 ARG A NH1 
1708 N NH2 . ARG A 234 ? 1.1395 0.9987 1.0262 -0.0106 0.1921  0.1789  278 ARG A NH2 
1709 N N   . PHE A 235 ? 1.0478 0.8016 0.8991 -0.0140 0.1536  0.1141  279 PHE A N   
1710 C CA  . PHE A 235 ? 1.0989 0.8253 0.9200 0.0249  0.1603  0.1177  279 PHE A CA  
1711 C C   . PHE A 235 ? 1.1492 0.8355 0.9521 0.0279  0.1633  0.1022  279 PHE A C   
1712 O O   . PHE A 235 ? 1.1413 0.8440 0.9567 0.0078  0.1541  0.0841  279 PHE A O   
1713 C CB  . PHE A 235 ? 1.0779 0.8651 0.9121 0.0556  0.1482  0.1175  279 PHE A CB  
1714 C CG  . PHE A 235 ? 1.0359 0.8596 0.8828 0.0533  0.1465  0.1289  279 PHE A CG  
1715 C CD1 . PHE A 235 ? 1.0516 0.8435 0.8741 0.0602  0.1615  0.1500  279 PHE A CD1 
1716 C CD2 . PHE A 235 ? 0.9855 0.8704 0.8656 0.0440  0.1324  0.1188  279 PHE A CD2 
1717 C CE1 . PHE A 235 ? 1.0208 0.8450 0.8509 0.0586  0.1635  0.1596  279 PHE A CE1 
1718 C CE2 . PHE A 235 ? 0.9536 0.8683 0.8434 0.0432  0.1335  0.1270  279 PHE A CE2 
1719 C CZ  . PHE A 235 ? 0.9727 0.8589 0.8370 0.0508  0.1496  0.1468  279 PHE A CZ  
1720 N N   . LEU A 236 ? 1.0315 0.6603 0.8010 0.0536  0.1778  0.1103  280 LEU A N   
1721 C CA  . LEU A 236 ? 1.0862 0.6781 0.8367 0.0688  0.1840  0.0960  280 LEU A CA  
1722 C C   . LEU A 236 ? 1.1015 0.7179 0.8503 0.1203  0.1825  0.1027  280 LEU A C   
1723 O O   . LEU A 236 ? 1.1137 0.7056 0.8426 0.1473  0.1893  0.1235  280 LEU A O   
1724 C CB  . LEU A 236 ? 1.1386 0.6359 0.8519 0.0587  0.2036  0.0992  280 LEU A CB  
1725 C CG  . LEU A 236 ? 1.2026 0.6479 0.8879 0.0888  0.2162  0.0890  280 LEU A CG  
1726 C CD1 . LEU A 236 ? 1.2074 0.6761 0.9020 0.0746  0.2097  0.0608  280 LEU A CD1 
1727 C CD2 . LEU A 236 ? 1.2564 0.5974 0.9004 0.0828  0.2379  0.0945  280 LEU A CD2 
1728 N N   . PHE A 237 ? 1.0979 0.7662 0.8686 0.1332  0.1729  0.0862  281 PHE A N   
1729 C CA  . PHE A 237 ? 1.0937 0.8000 0.8730 0.1798  0.1682  0.0905  281 PHE A CA  
1730 C C   . PHE A 237 ? 1.1308 0.7982 0.8950 0.2082  0.1822  0.0817  281 PHE A C   
1731 O O   . PHE A 237 ? 1.1566 0.7980 0.9147 0.1887  0.1906  0.0628  281 PHE A O   
1732 C CB  . PHE A 237 ? 1.0455 0.8410 0.8651 0.1766  0.1502  0.0784  281 PHE A CB  
1733 C CG  . PHE A 237 ? 1.0061 0.8410 0.8412 0.1550  0.1375  0.0855  281 PHE A CG  
1734 C CD1 . PHE A 237 ? 0.9857 0.8406 0.8159 0.1772  0.1314  0.1021  281 PHE A CD1 
1735 C CD2 . PHE A 237 ? 0.9768 0.8285 0.8294 0.1146  0.1317  0.0755  281 PHE A CD2 
1736 C CE1 . PHE A 237 ? 0.9436 0.8322 0.7856 0.1587  0.1229  0.1064  281 PHE A CE1 
1737 C CE2 . PHE A 237 ? 0.9171 0.8041 0.7867 0.0982  0.1222  0.0815  281 PHE A CE2 
1738 C CZ  . PHE A 237 ? 0.9063 0.8108 0.7705 0.1200  0.1193  0.0957  281 PHE A CZ  
1739 N N   . ALA A 238 ? 1.2824 0.9450 1.0388 0.2559  0.1847  0.0953  282 ALA A N   
1740 C CA  . ALA A 238 ? 1.3021 0.9410 1.0534 0.2910  0.1977  0.0867  282 ALA A CA  
1741 C C   . ALA A 238 ? 1.2549 0.9643 1.0350 0.3385  0.1853  0.0924  282 ALA A C   
1742 O O   . ALA A 238 ? 1.2402 0.9703 1.0170 0.3589  0.1727  0.1130  282 ALA A O   
1743 C CB  . ALA A 238 ? 1.3653 0.8997 1.0706 0.3054  0.2186  0.0992  282 ALA A CB  
1744 N N   . SER A 239 ? 1.0721 0.8220 0.8806 0.3552  0.1886  0.0739  283 SER A N   
1745 C CA  . SER A 239 ? 1.0264 0.8445 0.8674 0.4027  0.1775  0.0786  283 SER A CA  
1746 C C   . SER A 239 ? 1.0691 0.8299 0.8890 0.4539  0.1935  0.0896  283 SER A C   
1747 O O   . SER A 239 ? 1.1108 0.8101 0.9124 0.4538  0.2168  0.0774  283 SER A O   
1748 C CB  . SER A 239 ? 0.9637 0.8691 0.8558 0.3951  0.1725  0.0550  283 SER A CB  
1749 O OG  . SER A 239 ? 0.9855 0.8606 0.8729 0.3795  0.1943  0.0336  283 SER A OG  
1750 N N   . VAL A 240 ? 1.2695 1.0442 1.0865 0.4978  0.1812  0.1134  284 VAL A N   
1751 C CA  . VAL A 240 ? 1.3138 1.0269 1.1066 0.5512  0.1951  0.1296  284 VAL A CA  
1752 C C   . VAL A 240 ? 1.2678 1.0637 1.1033 0.6083  0.1795  0.1349  284 VAL A C   
1753 O O   . VAL A 240 ? 1.2171 1.0965 1.0783 0.6115  0.1518  0.1407  284 VAL A O   
1754 C CB  . VAL A 240 ? 1.3681 0.9979 1.1043 0.5568  0.1971  0.1614  284 VAL A CB  
1755 C CG1 . VAL A 240 ? 1.4272 0.9729 1.1316 0.6089  0.2162  0.1782  284 VAL A CG1 
1756 C CG2 . VAL A 240 ? 1.3998 0.9673 1.1048 0.4962  0.2082  0.1570  284 VAL A CG2 
1757 N N   . MET A 241 ? 1.7944 1.5723 1.6389 0.6426  0.1940  0.1303  285 MET A N   
1758 C CA  . MET A 241 ? 1.7669 1.6333 1.6600 0.6769  0.1753  0.1309  285 MET A CA  
1759 C C   . MET A 241 ? 1.8270 1.6746 1.6923 0.7100  0.1582  0.1623  285 MET A C   
1760 O O   . MET A 241 ? 1.9029 1.6497 1.7133 0.7160  0.1732  0.1802  285 MET A O   
1761 C CB  . MET A 241 ? 1.7992 1.6582 1.7166 0.6932  0.1980  0.1115  285 MET A CB  
1762 C CG  . MET A 241 ? 1.7718 1.7444 1.7608 0.7158  0.1830  0.1010  285 MET A CG  
1763 S SD  . MET A 241 ? 1.6578 1.7387 1.7111 0.6788  0.1810  0.0688  285 MET A SD  
1764 C CE  . MET A 241 ? 1.6645 1.6513 1.6729 0.6433  0.2187  0.0492  285 MET A CE  
1765 N N   . ALA A 242 ? 1.8897 1.8334 1.7914 0.7284  0.1274  0.1679  286 ALA A N   
1766 C CA  . ALA A 242 ? 1.9558 1.8934 1.8336 0.7630  0.1090  0.1960  286 ALA A CA  
1767 C C   . ALA A 242 ? 2.0402 1.9457 1.9244 0.8033  0.1221  0.2006  286 ALA A C   
1768 O O   . ALA A 242 ? 2.0254 1.9751 1.9610 0.8119  0.1301  0.1796  286 ALA A O   
1769 C CB  . ALA A 242 ? 1.9081 1.9603 1.8236 0.7675  0.0710  0.1959  286 ALA A CB  
1770 N N   . ASP A 243 ? 2.2244 2.0527 2.0566 0.8276  0.1256  0.2282  287 ASP A N   
1771 C CA  . ASP A 243 ? 2.3190 2.1037 2.1501 0.8686  0.1390  0.2359  287 ASP A CA  
1772 C C   . ASP A 243 ? 2.3152 2.2049 2.2121 0.9045  0.1168  0.2313  287 ASP A C   
1773 O O   . ASP A 243 ? 2.2953 2.2611 2.2077 0.9135  0.0839  0.2415  287 ASP A O   
1774 C CB  . ASP A 243 ? 2.4201 2.1110 2.1827 0.8868  0.1426  0.2697  287 ASP A CB  
1775 C CG  . ASP A 243 ? 2.4458 2.0190 2.1473 0.8521  0.1713  0.2732  287 ASP A CG  
1776 O OD1 . ASP A 243 ? 2.4370 1.9664 2.1425 0.8321  0.1975  0.2507  287 ASP A OD1 
1777 O OD2 . ASP A 243 ? 2.4789 2.0041 2.1282 0.8429  0.1682  0.2976  287 ASP A OD2 
1778 N N   . LYS A 244 ? 2.1827 2.0750 2.1178 0.9233  0.1358  0.2146  288 LYS A N   
1779 C CA  . LYS A 244 ? 2.1770 2.1719 2.1858 0.9541  0.1199  0.2061  288 LYS A CA  
1780 C C   . LYS A 244 ? 2.0715 2.1920 2.1375 0.9287  0.0927  0.1895  288 LYS A C   
1781 O O   . LYS A 244 ? 2.0692 2.2768 2.1740 0.9484  0.0621  0.1958  288 LYS A O   
1782 C CB  . LYS A 244 ? 2.2691 2.2616 2.2685 1.0044  0.1012  0.2355  288 LYS A CB  
1783 C CG  . LYS A 244 ? 2.3833 2.2691 2.3475 1.0381  0.1290  0.2477  288 LYS A CG  
1784 C CD  . LYS A 244 ? 2.4763 2.3613 2.4292 1.0880  0.1082  0.2794  288 LYS A CD  
1785 C CE  . LYS A 244 ? 2.5967 2.3704 2.5136 1.1217  0.1369  0.2919  288 LYS A CE  
1786 N NZ  . LYS A 244 ? 2.6048 2.3868 2.5724 1.1349  0.1627  0.2649  288 LYS A NZ  
1787 N N   . ASP A 245 ? 1.9209 2.0488 1.9915 0.8837  0.1040  0.1677  289 ASP A N   
1788 C CA  . ASP A 245 ? 1.8232 2.0596 1.9426 0.8536  0.0809  0.1511  289 ASP A CA  
1789 C C   . ASP A 245 ? 1.7537 2.0003 1.8989 0.8154  0.1052  0.1209  289 ASP A C   
1790 O O   . ASP A 245 ? 1.7765 1.9376 1.8877 0.8067  0.1371  0.1141  289 ASP A O   
1791 C CB  . ASP A 245 ? 1.7944 2.0298 1.8703 0.8333  0.0559  0.1667  289 ASP A CB  
1792 C CG  . ASP A 245 ? 1.7281 2.0836 1.8533 0.8181  0.0208  0.1564  289 ASP A CG  
1793 O OD1 . ASP A 245 ? 1.6710 2.1046 1.8621 0.8014  0.0220  0.1312  289 ASP A OD1 
1794 O OD2 . ASP A 245 ? 1.7388 2.1076 1.8343 0.8209  -0.0066 0.1730  289 ASP A OD2 
1795 N N   . THR A 246 ? 1.5032 1.8539 1.7074 0.7915  0.0900  0.1020  290 THR A N   
1796 C CA  . THR A 246 ? 1.4358 1.8084 1.6676 0.7528  0.1108  0.0739  290 THR A CA  
1797 C C   . THR A 246 ? 1.3631 1.7351 1.5692 0.7082  0.1018  0.0702  290 THR A C   
1798 O O   . THR A 246 ? 1.3054 1.7012 1.5327 0.6725  0.1153  0.0483  290 THR A O   
1799 C CB  . THR A 246 ? 1.4023 1.8871 1.7198 0.7511  0.1055  0.0543  290 THR A CB  
1800 O OG1 . THR A 246 ? 1.3635 1.8523 1.7029 0.7213  0.1361  0.0281  290 THR A OG1 
1801 C CG2 . THR A 246 ? 1.3460 1.9255 1.6960 0.7319  0.0673  0.0542  290 THR A CG2 
1802 N N   . THR A 247 ? 1.0848 1.4313 1.2455 0.7108  0.0798  0.0918  291 THR A N   
1803 C CA  . THR A 247 ? 1.0246 1.3716 1.1621 0.6723  0.0706  0.0896  291 THR A CA  
1804 C C   . THR A 247 ? 1.0521 1.2866 1.1190 0.6638  0.0901  0.1026  291 THR A C   
1805 O O   . THR A 247 ? 1.1244 1.2724 1.1519 0.6865  0.1087  0.1157  291 THR A O   
1806 C CB  . THR A 247 ? 1.0111 1.4136 1.1459 0.6733  0.0320  0.1017  291 THR A CB  
1807 O OG1 . THR A 247 ? 1.0845 1.4205 1.1612 0.7042  0.0261  0.1312  291 THR A OG1 
1808 C CG2 . THR A 247 ? 0.9962 1.5071 1.1988 0.6815  0.0092  0.0903  291 THR A CG2 
1809 N N   . ARG A 248 ? 0.9582 1.1940 1.0098 0.6300  0.0849  0.0995  292 ARG A N   
1810 C CA  . ARG A 248 ? 0.9759 1.1116 0.9703 0.6148  0.1059  0.1079  292 ARG A CA  
1811 C C   . ARG A 248 ? 0.9460 1.0889 0.9186 0.5734  0.0878  0.1123  292 ARG A C   
1812 O O   . ARG A 248 ? 0.8910 1.1201 0.8970 0.5613  0.0632  0.1040  292 ARG A O   
1813 C CB  . ARG A 248 ? 0.9765 1.0745 0.9751 0.5852  0.1370  0.0840  292 ARG A CB  
1814 C CG  . ARG A 248 ? 0.9144 1.0697 0.9448 0.5298  0.1332  0.0594  292 ARG A CG  
1815 C CD  . ARG A 248 ? 0.9330 1.0568 0.9652 0.5068  0.1636  0.0363  292 ARG A CD  
1816 N NE  . ARG A 248 ? 0.8910 1.0600 0.9453 0.4539  0.1600  0.0173  292 ARG A NE  
1817 C CZ  . ARG A 248 ? 0.8296 1.0892 0.9403 0.4492  0.1565  0.0011  292 ARG A CZ  
1818 N NH1 . ARG A 248 ? 0.8011 1.1231 0.9570 0.4938  0.1551  0.0004  292 ARG A NH1 
1819 N NH2 . ARG A 248 ? 0.7975 1.0869 0.9219 0.4008  0.1545  -0.0132 292 ARG A NH2 
1820 N N   . ARG A 249 ? 1.1244 1.1763 1.0419 0.5500  0.1006  0.1244  293 ARG A N   
1821 C CA  . ARG A 249 ? 1.1194 1.1762 1.0163 0.5139  0.0864  0.1299  293 ARG A CA  
1822 C C   . ARG A 249 ? 1.1691 1.1387 1.0261 0.4714  0.1071  0.1314  293 ARG A C   
1823 O O   . ARG A 249 ? 1.2199 1.1113 1.0520 0.4748  0.1303  0.1337  293 ARG A O   
1824 C CB  . ARG A 249 ? 1.1320 1.1941 0.9993 0.5492  0.0666  0.1569  293 ARG A CB  
1825 C CG  . ARG A 249 ? 1.1998 1.1650 1.0129 0.5809  0.0828  0.1852  293 ARG A CG  
1826 C CD  . ARG A 249 ? 1.2153 1.1794 0.9877 0.6051  0.0644  0.2139  293 ARG A CD  
1827 N NE  . ARG A 249 ? 1.1757 1.2364 0.9798 0.6324  0.0329  0.2104  293 ARG A NE  
1828 C CZ  . ARG A 249 ? 1.1301 1.2692 0.9499 0.6176  0.0065  0.2012  293 ARG A CZ  
1829 N NH1 . ARG A 249 ? 1.1235 1.2562 0.9309 0.5729  0.0092  0.1936  293 ARG A NH1 
1830 N NH2 . ARG A 249 ? 1.1086 1.3288 0.9574 0.6336  -0.0211 0.1939  293 ARG A NH2 
1831 N N   . ILE A 250 ? 1.1003 1.0846 0.9527 0.4314  0.0983  0.1292  294 ILE A N   
1832 C CA  . ILE A 250 ? 1.1373 1.0566 0.9639 0.3869  0.1145  0.1286  294 ILE A CA  
1833 C C   . ILE A 250 ? 1.1913 1.0308 0.9642 0.3921  0.1251  0.1561  294 ILE A C   
1834 O O   . ILE A 250 ? 1.1890 1.0403 0.9413 0.4140  0.1136  0.1759  294 ILE A O   
1835 C CB  . ILE A 250 ? 1.0969 1.0685 0.9467 0.3440  0.1021  0.1150  294 ILE A CB  
1836 C CG1 . ILE A 250 ? 1.0414 1.0805 0.9406 0.3327  0.0959  0.0889  294 ILE A CG1 
1837 C CG2 . ILE A 250 ? 1.1324 1.0473 0.9610 0.3007  0.1155  0.1167  294 ILE A CG2 
1838 C CD1 . ILE A 250 ? 1.0624 1.0640 0.9638 0.3150  0.1155  0.0744  294 ILE A CD1 
1839 N N   . HIS A 251 ? 1.3156 1.0732 1.0635 0.3707  0.1475  0.1571  295 HIS A N   
1840 C CA  . HIS A 251 ? 1.3566 1.0389 1.0589 0.3606  0.1608  0.1806  295 HIS A CA  
1841 C C   . HIS A 251 ? 1.3571 1.0197 1.0636 0.3024  0.1692  0.1700  295 HIS A C   
1842 O O   . HIS A 251 ? 1.3545 1.0244 1.0831 0.2761  0.1713  0.1468  295 HIS A O   
1843 C CB  . HIS A 251 ? 1.4139 1.0051 1.0788 0.3900  0.1810  0.1955  295 HIS A CB  
1844 C CG  . HIS A 251 ? 1.4158 1.0209 1.0734 0.4520  0.1723  0.2122  295 HIS A CG  
1845 N ND1 . HIS A 251 ? 1.4558 1.0092 1.0671 0.4836  0.1762  0.2456  295 HIS A ND1 
1846 C CD2 . HIS A 251 ? 1.3815 1.0485 1.0737 0.4892  0.1598  0.2015  295 HIS A CD2 
1847 C CE1 . HIS A 251 ? 1.4483 1.0316 1.0649 0.5398  0.1635  0.2552  295 HIS A CE1 
1848 N NE2 . HIS A 251 ? 1.4007 1.0561 1.0698 0.5440  0.1535  0.2280  295 HIS A NE2 
1849 N N   . VAL A 252 ? 1.3077 0.9491 0.9935 0.2829  0.1737  0.1872  296 VAL A N   
1850 C CA  . VAL A 252 ? 1.2893 0.9268 0.9881 0.2298  0.1789  0.1784  296 VAL A CA  
1851 C C   . VAL A 252 ? 1.3221 0.8733 0.9882 0.2081  0.2015  0.1939  296 VAL A C   
1852 O O   . VAL A 252 ? 1.3490 0.8550 0.9782 0.2293  0.2124  0.2198  296 VAL A O   
1853 C CB  . VAL A 252 ? 1.2393 0.9408 0.9552 0.2156  0.1663  0.1809  296 VAL A CB  
1854 C CG1 . VAL A 252 ? 1.2039 0.9240 0.9502 0.1662  0.1659  0.1653  296 VAL A CG1 
1855 C CG2 . VAL A 252 ? 1.2122 0.9913 0.9504 0.2425  0.1444  0.1712  296 VAL A CG2 
1856 N N   . SER A 253 ? 1.3363 0.8653 1.0151 0.1642  0.2079  0.1786  297 SER A N   
1857 C CA  . SER A 253 ? 1.3575 0.8143 1.0144 0.1328  0.2278  0.1898  297 SER A CA  
1858 C C   . SER A 253 ? 1.3109 0.7985 1.0005 0.0797  0.2240  0.1788  297 SER A C   
1859 O O   . SER A 253 ? 1.2877 0.8093 1.0051 0.0582  0.2114  0.1553  297 SER A O   
1860 C CB  . SER A 253 ? 1.4178 0.7886 1.0473 0.1340  0.2435  0.1831  297 SER A CB  
1861 O OG  . SER A 253 ? 1.4397 0.7401 1.0504 0.0977  0.2624  0.1920  297 SER A OG  
1862 N N   . THR A 254 ? 1.4810 0.9602 1.1677 0.0606  0.2352  0.1973  298 THR A N   
1863 C CA  . THR A 254 ? 1.4400 0.9427 1.1602 0.0110  0.2348  0.1902  298 THR A CA  
1864 C C   . THR A 254 ? 1.4746 0.9022 1.1818 -0.0263 0.2531  0.1918  298 THR A C   
1865 O O   . THR A 254 ? 1.4457 0.8909 1.1837 -0.0707 0.2511  0.1836  298 THR A O   
1866 C CB  . THR A 254 ? 1.4001 0.9515 1.1350 0.0090  0.2374  0.2061  298 THR A CB  
1867 O OG1 . THR A 254 ? 1.4393 0.9399 1.1326 0.0270  0.2586  0.2341  298 THR A OG1 
1868 C CG2 . THR A 254 ? 1.3644 0.9908 1.1155 0.0374  0.2169  0.1982  298 THR A CG2 
1869 N N   . ASP A 255 ? 1.6193 0.9629 1.2819 -0.0081 0.2703  0.2024  299 ASP A N   
1870 C CA  . ASP A 255 ? 1.6618 0.9216 1.3063 -0.0437 0.2897  0.2028  299 ASP A CA  
1871 C C   . ASP A 255 ? 1.6992 0.9104 1.3310 -0.0541 0.2867  0.1762  299 ASP A C   
1872 O O   . ASP A 255 ? 1.7515 0.8752 1.3551 -0.0737 0.3048  0.1760  299 ASP A O   
1873 C CB  . ASP A 255 ? 1.7145 0.8973 1.3148 -0.0284 0.3169  0.2343  299 ASP A CB  
1874 C CG  . ASP A 255 ? 1.7509 0.9100 1.3125 0.0333  0.3173  0.2482  299 ASP A CG  
1875 O OD1 . ASP A 255 ? 1.7799 0.9158 1.3310 0.0555  0.3112  0.2316  299 ASP A OD1 
1876 O OD2 . ASP A 255 ? 1.7522 0.9204 1.2945 0.0604  0.3231  0.2754  299 ASP A OD2 
1877 N N   . GLN A 256 ? 1.7756 1.0371 1.4224 -0.0381 0.2666  0.1545  300 GLN A N   
1878 C CA  . GLN A 256 ? 1.8147 1.0367 1.4453 -0.0426 0.2646  0.1275  300 GLN A CA  
1879 C C   . GLN A 256 ? 1.8876 1.0259 1.4720 -0.0020 0.2833  0.1327  300 GLN A C   
1880 O O   . GLN A 256 ? 1.9412 1.0022 1.4972 -0.0155 0.2952  0.1169  300 GLN A O   
1881 C CB  . GLN A 256 ? 1.8207 1.0084 1.4546 -0.1018 0.2653  0.1098  300 GLN A CB  
1882 C CG  . GLN A 256 ? 1.7531 1.0246 1.4353 -0.1406 0.2435  0.1009  300 GLN A CG  
1883 C CD  . GLN A 256 ? 1.7759 1.0178 1.4592 -0.1957 0.2385  0.0791  300 GLN A CD  
1884 O OE1 . GLN A 256 ? 1.8267 0.9919 1.4881 -0.2209 0.2560  0.0809  300 GLN A OE1 
1885 N NE2 . GLN A 256 ? 1.7434 1.0432 1.4494 -0.2157 0.2140  0.0584  300 GLN A NE2 
1886 N N   . GLY A 257 ? 1.5898 0.7430 1.1656 0.0488  0.2851  0.1547  301 GLY A N   
1887 C CA  . GLY A 257 ? 1.6491 0.7392 1.1882 0.0980  0.2986  0.1613  301 GLY A CA  
1888 C C   . GLY A 257 ? 1.6961 0.6977 1.1939 0.1113  0.3218  0.1920  301 GLY A C   
1889 O O   . GLY A 257 ? 1.7390 0.6940 1.2065 0.1616  0.3314  0.2060  301 GLY A O   
1890 N N   . ASP A 258 ? 1.9710 0.9493 1.4683 0.0671  0.3318  0.2040  302 ASP A N   
1891 C CA  . ASP A 258 ? 2.0304 0.9427 1.4961 0.0717  0.3513  0.2292  302 ASP A CA  
1892 C C   . ASP A 258 ? 2.0308 0.9685 1.4801 0.1278  0.3485  0.2600  302 ASP A C   
1893 O O   . ASP A 258 ? 2.1050 0.9944 1.5230 0.1634  0.3568  0.2729  302 ASP A O   
1894 C CB  . ASP A 258 ? 2.0231 0.9453 1.5100 0.0123  0.3564  0.2318  302 ASP A CB  
1895 C CG  . ASP A 258 ? 2.0499 0.9359 1.5464 -0.0413 0.3580  0.2023  302 ASP A CG  
1896 O OD1 . ASP A 258 ? 2.1283 0.9413 1.5952 -0.0340 0.3672  0.1898  302 ASP A OD1 
1897 O OD2 . ASP A 258 ? 1.9962 0.9305 1.5303 -0.0897 0.3485  0.1909  302 ASP A OD2 
1898 N N   . THR A 259 ? 1.6734 0.6892 1.1429 0.1357  0.3352  0.2705  303 THR A N   
1899 C CA  . THR A 259 ? 1.6678 0.7212 1.1221 0.1897  0.3261  0.2948  303 THR A CA  
1900 C C   . THR A 259 ? 1.6034 0.7622 1.0949 0.2131  0.2975  0.2782  303 THR A C   
1901 O O   . THR A 259 ? 1.5557 0.7785 1.0901 0.1796  0.2839  0.2529  303 THR A O   
1902 C CB  . THR A 259 ? 1.6648 0.7378 1.1105 0.1778  0.3320  0.3193  303 THR A CB  
1903 O OG1 . THR A 259 ? 1.6116 0.7255 1.0913 0.1256  0.3336  0.3115  303 THR A OG1 
1904 C CG2 . THR A 259 ? 1.7668 0.7621 1.1805 0.1719  0.3517  0.3329  303 THR A CG2 
1905 N N   . TRP A 260 ? 1.6859 0.8663 1.1632 0.2700  0.2866  0.2915  304 TRP A N   
1906 C CA  . TRP A 260 ? 1.6394 0.9206 1.1544 0.2936  0.2590  0.2737  304 TRP A CA  
1907 C C   . TRP A 260 ? 1.6212 0.9545 1.1239 0.3278  0.2445  0.2961  304 TRP A C   
1908 O O   . TRP A 260 ? 1.6580 0.9394 1.1141 0.3505  0.2557  0.3279  304 TRP A O   
1909 C CB  . TRP A 260 ? 1.6646 0.9322 1.1825 0.3337  0.2564  0.2612  304 TRP A CB  
1910 C CG  . TRP A 260 ? 1.6781 0.9172 1.2118 0.3030  0.2650  0.2308  304 TRP A CG  
1911 C CD1 . TRP A 260 ? 1.7358 0.8728 1.2393 0.2939  0.2883  0.2279  304 TRP A CD1 
1912 C CD2 . TRP A 260 ? 1.6387 0.9485 1.2166 0.2767  0.2507  0.1983  304 TRP A CD2 
1913 N NE1 . TRP A 260 ? 1.7336 0.8763 1.2580 0.2630  0.2880  0.1937  304 TRP A NE1 
1914 C CE2 . TRP A 260 ? 1.6754 0.9238 1.2447 0.2527  0.2653  0.1768  304 TRP A CE2 
1915 C CE3 . TRP A 260 ? 1.5807 0.9950 1.2010 0.2705  0.2276  0.1855  304 TRP A CE3 
1916 C CZ2 . TRP A 260 ? 1.6567 0.9474 1.2551 0.2243  0.2568  0.1451  304 TRP A CZ2 
1917 C CZ3 . TRP A 260 ? 1.5631 1.0157 1.2150 0.2424  0.2208  0.1556  304 TRP A CZ3 
1918 C CH2 . TRP A 260 ? 1.6014 0.9938 1.2408 0.2202  0.2350  0.1367  304 TRP A CH2 
1919 N N   . SER A 261 ? 1.5195 0.9524 1.0599 0.3309  0.2198  0.2794  305 SER A N   
1920 C CA  . SER A 261 ? 1.5057 0.9928 1.0334 0.3669  0.2017  0.2952  305 SER A CA  
1921 C C   . SER A 261 ? 1.4581 1.0400 1.0314 0.3849  0.1739  0.2706  305 SER A C   
1922 O O   . SER A 261 ? 1.4253 1.0497 1.0424 0.3538  0.1684  0.2424  305 SER A O   
1923 C CB  . SER A 261 ? 1.4940 1.0005 1.0097 0.3394  0.2052  0.3064  305 SER A CB  
1924 O OG  . SER A 261 ? 1.4091 0.9252 0.9591 0.2848  0.2134  0.2871  305 SER A OG  
1925 N N   . MET A 262 ? 1.5117 1.1254 1.0741 0.4350  0.1565  0.2826  306 MET A N   
1926 C CA  . MET A 262 ? 1.4642 1.1711 1.0720 0.4537  0.1300  0.2609  306 MET A CA  
1927 C C   . MET A 262 ? 1.4151 1.2006 1.0478 0.4243  0.1130  0.2447  306 MET A C   
1928 O O   . MET A 262 ? 1.4186 1.2032 1.0207 0.4178  0.1125  0.2593  306 MET A O   
1929 C CB  . MET A 262 ? 1.4722 1.1981 1.0631 0.5147  0.1130  0.2797  306 MET A CB  
1930 C CG  . MET A 262 ? 1.4152 1.2490 1.0564 0.5309  0.0832  0.2579  306 MET A CG  
1931 S SD  . MET A 262 ? 1.4180 1.2941 1.0361 0.5936  0.0545  0.2814  306 MET A SD  
1932 C CE  . MET A 262 ? 1.4777 1.2848 1.0872 0.6273  0.0723  0.2924  306 MET A CE  
1933 N N   . ALA A 263 ? 1.1494 0.9979 0.8352 0.4060  0.1018  0.2145  307 ALA A N   
1934 C CA  . ALA A 263 ? 1.1044 1.0228 0.8176 0.3773  0.0867  0.1963  307 ALA A CA  
1935 C C   . ALA A 263 ? 1.0783 1.0667 0.7914 0.4072  0.0593  0.1969  307 ALA A C   
1936 O O   . ALA A 263 ? 1.0819 1.0839 0.7909 0.4502  0.0476  0.2059  307 ALA A O   
1937 C CB  . ALA A 263 ? 1.0725 1.0259 0.8378 0.3467  0.0858  0.1663  307 ALA A CB  
1938 N N   . GLN A 264 ? 1.4516 1.4855 1.1708 0.3845  0.0483  0.1858  308 GLN A N   
1939 C CA  . GLN A 264 ? 1.4343 1.5319 1.1468 0.4055  0.0215  0.1830  308 GLN A CA  
1940 C C   . GLN A 264 ? 1.3845 1.5633 1.1548 0.4068  -0.0006 0.1553  308 GLN A C   
1941 O O   . GLN A 264 ? 1.3701 1.6124 1.1479 0.4123  -0.0250 0.1439  308 GLN A O   
1942 C CB  . GLN A 264 ? 1.4326 1.5378 1.1231 0.3798  0.0224  0.1803  308 GLN A CB  
1943 C CG  . GLN A 264 ? 1.4473 1.5768 1.0913 0.4078  0.0036  0.1917  308 GLN A CG  
1944 C CD  . GLN A 264 ? 1.4121 1.6220 1.0807 0.3978  -0.0231 0.1631  308 GLN A CD  
1945 O OE1 . GLN A 264 ? 1.3856 1.6159 1.0898 0.3616  -0.0193 0.1394  308 GLN A OE1 
1946 N NE2 . GLN A 264 ? 1.4138 1.6679 1.0624 0.4301  -0.0513 0.1653  308 GLN A NE2 
1947 N N   . LEU A 265 ? 0.9407 1.1167 0.7512 0.3973  0.0094  0.1427  309 LEU A N   
1948 C CA  . LEU A 265 ? 0.8883 1.1385 0.7573 0.3933  -0.0053 0.1166  309 LEU A CA  
1949 C C   . LEU A 265 ? 0.8745 1.1665 0.7614 0.4389  -0.0207 0.1204  309 LEU A C   
1950 O O   . LEU A 265 ? 0.9140 1.1629 0.7699 0.4762  -0.0152 0.1439  309 LEU A O   
1951 C CB  . LEU A 265 ? 0.8790 1.1075 0.7789 0.3626  0.0146  0.1020  309 LEU A CB  
1952 C CG  . LEU A 265 ? 0.8826 1.0878 0.7781 0.3167  0.0246  0.0952  309 LEU A CG  
1953 C CD1 . LEU A 265 ? 0.8925 1.0559 0.7998 0.2929  0.0451  0.0892  309 LEU A CD1 
1954 C CD2 . LEU A 265 ? 0.8309 1.1036 0.7583 0.2952  0.0071  0.0733  309 LEU A CD2 
1955 N N   . PRO A 266 ? 0.9085 1.2857 0.8483 0.4366  -0.0397 0.0976  310 PRO A N   
1956 C CA  . PRO A 266 ? 0.8866 1.3162 0.8585 0.4793  -0.0536 0.0987  310 PRO A CA  
1957 C C   . PRO A 266 ? 0.8973 1.2896 0.8869 0.4921  -0.0282 0.1003  310 PRO A C   
1958 O O   . PRO A 266 ? 0.9030 1.2536 0.8958 0.4583  -0.0049 0.0907  310 PRO A O   
1959 C CB  . PRO A 266 ? 0.8204 1.3477 0.8529 0.4589  -0.0737 0.0693  310 PRO A CB  
1960 C CG  . PRO A 266 ? 0.8181 1.3406 0.8344 0.4143  -0.0770 0.0570  310 PRO A CG  
1961 C CD  . PRO A 266 ? 0.8649 1.2948 0.8364 0.3962  -0.0502 0.0714  310 PRO A CD  
1962 N N   . SER A 267 ? 0.9230 1.3285 0.9212 0.5424  -0.0331 0.1127  311 SER A N   
1963 C CA  . SER A 267 ? 0.9250 1.3126 0.9504 0.5595  -0.0104 0.1084  311 SER A CA  
1964 C C   . SER A 267 ? 0.8570 1.3320 0.9555 0.5403  -0.0131 0.0786  311 SER A C   
1965 O O   . SER A 267 ? 0.8128 1.3630 0.9414 0.5198  -0.0367 0.0639  311 SER A O   
1966 C CB  . SER A 267 ? 0.9702 1.3341 0.9792 0.6049  -0.0127 0.1279  311 SER A CB  
1967 O OG  . SER A 267 ? 0.9703 1.3936 0.9814 0.6164  -0.0451 0.1319  311 SER A OG  
1968 N N   . VAL A 268 ? 0.8594 1.3170 0.9815 0.5411  0.0136  0.0683  312 VAL A N   
1969 C CA  . VAL A 268 ? 0.8059 1.3363 0.9928 0.5189  0.0175  0.0416  312 VAL A CA  
1970 C C   . VAL A 268 ? 0.8279 1.3546 1.0398 0.5459  0.0354  0.0393  312 VAL A C   
1971 O O   . VAL A 268 ? 0.8843 1.3363 1.0589 0.5754  0.0515  0.0547  312 VAL A O   
1972 C CB  . VAL A 268 ? 0.7945 1.2994 0.9800 0.4656  0.0373  0.0243  312 VAL A CB  
1973 C CG1 . VAL A 268 ? 0.7888 1.2883 0.9499 0.4260  0.0203  0.0241  312 VAL A CG1 
1974 C CG2 . VAL A 268 ? 0.8534 1.2586 0.9969 0.4628  0.0694  0.0292  312 VAL A CG2 
1975 N N   . GLY A 269 ? 0.7537 1.3577 1.0286 0.5349  0.0341  0.0199  313 GLY A N   
1976 C CA  . GLY A 269 ? 0.7840 1.3918 1.0900 0.5582  0.0545  0.0148  313 GLY A CA  
1977 C C   . GLY A 269 ? 0.7699 1.3442 1.0760 0.5351  0.0910  -0.0018 313 GLY A C   
1978 O O   . GLY A 269 ? 0.7581 1.3012 1.0361 0.5046  0.0988  -0.0061 313 GLY A O   
1979 N N   . GLN A 270 ? 1.0394 1.6225 1.3766 0.5489  0.1139  -0.0119 314 GLN A N   
1980 C CA  . GLN A 270 ? 1.0452 1.5863 1.3710 0.5309  0.1517  -0.0277 314 GLN A CA  
1981 C C   . GLN A 270 ? 0.9915 1.5878 1.3503 0.4828  0.1583  -0.0479 314 GLN A C   
1982 O O   . GLN A 270 ? 1.0002 1.5542 1.3302 0.4579  0.1832  -0.0578 314 GLN A O   
1983 C CB  . GLN A 270 ? 1.0971 1.6239 1.4401 0.5624  0.1767  -0.0330 314 GLN A CB  
1984 C CG  . GLN A 270 ? 1.1721 1.6069 1.4628 0.6023  0.1839  -0.0158 314 GLN A CG  
1985 C CD  . GLN A 270 ? 1.2326 1.6678 1.5506 0.6390  0.2020  -0.0201 314 GLN A CD  
1986 O OE1 . GLN A 270 ? 1.2177 1.7349 1.6018 0.6398  0.2040  -0.0328 314 GLN A OE1 
1987 N NE2 . GLN A 270 ? 1.3066 1.6481 1.5750 0.6687  0.2164  -0.0095 314 GLN A NE2 
1988 N N   . GLU A 271 ? 0.8778 1.5641 1.2927 0.4678  0.1360  -0.0536 315 GLU A N   
1989 C CA  . GLU A 271 ? 0.8295 1.5638 1.2745 0.4188  0.1406  -0.0705 315 GLU A CA  
1990 C C   . GLU A 271 ? 0.8068 1.5222 1.2172 0.3878  0.1245  -0.0678 315 GLU A C   
1991 O O   . GLU A 271 ? 0.7757 1.5072 1.1942 0.3451  0.1313  -0.0796 315 GLU A O   
1992 C CB  . GLU A 271 ? 0.8043 1.6340 1.3194 0.4104  0.1220  -0.0776 315 GLU A CB  
1993 C CG  . GLU A 271 ? 0.8387 1.7055 1.4049 0.4330  0.1414  -0.0837 315 GLU A CG  
1994 C CD  . GLU A 271 ? 0.8243 1.7880 1.4616 0.4230  0.1203  -0.0895 315 GLU A CD  
1995 O OE1 . GLU A 271 ? 0.7882 1.7836 1.4296 0.3937  0.0928  -0.0916 315 GLU A OE1 
1996 O OE2 . GLU A 271 ? 0.8557 1.8627 1.5448 0.4438  0.1317  -0.0929 315 GLU A OE2 
1997 N N   . GLN A 272 ? 0.6474 1.3308 1.0210 0.4098  0.1027  -0.0510 316 GLN A N   
1998 C CA  . GLN A 272 ? 0.6432 1.2961 0.9782 0.3839  0.0876  -0.0454 316 GLN A CA  
1999 C C   . GLN A 272 ? 0.7050 1.2480 0.9728 0.3638  0.1073  -0.0389 316 GLN A C   
2000 O O   . GLN A 272 ? 0.7522 1.2387 0.9943 0.3871  0.1289  -0.0349 316 GLN A O   
2001 C CB  . GLN A 272 ? 0.6452 1.3137 0.9690 0.4119  0.0548  -0.0299 316 GLN A CB  
2002 C CG  . GLN A 272 ? 0.5994 1.3490 0.9643 0.3923  0.0244  -0.0394 316 GLN A CG  
2003 C CD  . GLN A 272 ? 0.6207 1.3770 0.9639 0.4208  -0.0071 -0.0239 316 GLN A CD  
2004 O OE1 . GLN A 272 ? 0.6529 1.4077 0.9963 0.4598  -0.0113 -0.0120 316 GLN A OE1 
2005 N NE2 . GLN A 272 ? 0.6082 1.3688 0.9290 0.4021  -0.0284 -0.0237 316 GLN A NE2 
2006 N N   . PHE A 273 ? 0.5960 1.1091 0.8367 0.3211  0.0995  -0.0388 317 PHE A N   
2007 C CA  . PHE A 273 ? 0.6548 1.0706 0.8352 0.3027  0.1126  -0.0311 317 PHE A CA  
2008 C C   . PHE A 273 ? 0.6648 1.0488 0.8121 0.2819  0.0936  -0.0194 317 PHE A C   
2009 O O   . PHE A 273 ? 0.6245 1.0588 0.7921 0.2737  0.0721  -0.0210 317 PHE A O   
2010 C CB  . PHE A 273 ? 0.6610 1.0573 0.8369 0.2653  0.1345  -0.0451 317 PHE A CB  
2011 C CG  . PHE A 273 ? 0.6145 1.0510 0.8125 0.2230  0.1246  -0.0535 317 PHE A CG  
2012 C CD1 . PHE A 273 ? 0.5586 1.0762 0.8122 0.2171  0.1245  -0.0668 317 PHE A CD1 
2013 C CD2 . PHE A 273 ? 0.6267 1.0204 0.7925 0.1896  0.1159  -0.0478 317 PHE A CD2 
2014 C CE1 . PHE A 273 ? 0.5190 1.0664 0.7912 0.1776  0.1168  -0.0742 317 PHE A CE1 
2015 C CE2 . PHE A 273 ? 0.5854 1.0093 0.7698 0.1539  0.1075  -0.0544 317 PHE A CE2 
2016 C CZ  . PHE A 273 ? 0.5329 1.0299 0.7683 0.1471  0.1082  -0.0676 317 PHE A CZ  
2017 N N   . TYR A 274 ? 0.7096 1.0109 0.8069 0.2727  0.1029  -0.0093 318 TYR A N   
2018 C CA  . TYR A 274 ? 0.7202 0.9906 0.7902 0.2453  0.0914  -0.0005 318 TYR A CA  
2019 C C   . TYR A 274 ? 0.7301 0.9682 0.7882 0.2022  0.1020  -0.0085 318 TYR A C   
2020 O O   . TYR A 274 ? 0.7592 0.9663 0.8059 0.1979  0.1205  -0.0155 318 TYR A O   
2021 C CB  . TYR A 274 ? 0.7805 0.9829 0.8050 0.2630  0.0938  0.0189  318 TYR A CB  
2022 C CG  . TYR A 274 ? 0.7860 1.0033 0.8082 0.3089  0.0840  0.0326  318 TYR A CG  
2023 C CD1 . TYR A 274 ? 0.7629 1.0193 0.7874 0.3161  0.0617  0.0399  318 TYR A CD1 
2024 C CD2 . TYR A 274 ? 0.8190 1.0073 0.8321 0.3468  0.0970  0.0386  318 TYR A CD2 
2025 C CE1 . TYR A 274 ? 0.7723 1.0425 0.7889 0.3592  0.0500  0.0542  318 TYR A CE1 
2026 C CE2 . TYR A 274 ? 0.8254 1.0253 0.8342 0.3924  0.0864  0.0544  318 TYR A CE2 
2027 C CZ  . TYR A 274 ? 0.8019 1.0445 0.8116 0.3983  0.0616  0.0629  318 TYR A CZ  
2028 O OH  . TYR A 274 ? 0.8118 1.0670 0.8123 0.4457  0.0485  0.0803  318 TYR A OH  
2029 N N   . SER A 275 ? 0.7677 1.0105 0.8251 0.1722  0.0903  -0.0072 319 SER A N   
2030 C CA  . SER A 275 ? 0.7817 0.9903 0.8242 0.1343  0.0964  -0.0103 319 SER A CA  
2031 C C   . SER A 275 ? 0.7900 0.9739 0.8160 0.1162  0.0860  0.0008  319 SER A C   
2032 O O   . SER A 275 ? 0.7600 0.9742 0.7974 0.1206  0.0725  0.0040  319 SER A O   
2033 C CB  . SER A 275 ? 0.7341 0.9880 0.8068 0.1113  0.0968  -0.0241 319 SER A CB  
2034 O OG  . SER A 275 ? 0.7541 0.9738 0.8081 0.0790  0.1030  -0.0256 319 SER A OG  
2035 N N   . ILE A 276 ? 0.6105 0.7417 0.6103 0.0952  0.0925  0.0053  320 ILE A N   
2036 C CA  . ILE A 276 ? 0.6133 0.7262 0.6045 0.0769  0.0850  0.0155  320 ILE A CA  
2037 C C   . ILE A 276 ? 0.5664 0.7068 0.5780 0.0487  0.0776  0.0083  320 ILE A C   
2038 O O   . ILE A 276 ? 0.5763 0.7027 0.5819 0.0286  0.0820  0.0029  320 ILE A O   
2039 C CB  . ILE A 276 ? 0.6688 0.7202 0.6306 0.0604  0.0931  0.0220  320 ILE A CB  
2040 C CG1 . ILE A 276 ? 0.7325 0.7380 0.6673 0.0840  0.1055  0.0278  320 ILE A CG1 
2041 C CG2 . ILE A 276 ? 0.6505 0.6954 0.6146 0.0392  0.0857  0.0326  320 ILE A CG2 
2042 C CD1 . ILE A 276 ? 0.7352 0.7541 0.6700 0.1162  0.1027  0.0386  320 ILE A CD1 
2043 N N   . LEU A 277 ? 0.6332 0.8082 0.6645 0.0470  0.0667  0.0084  321 LEU A N   
2044 C CA  . LEU A 277 ? 0.5906 0.7839 0.6397 0.0220  0.0611  0.0027  321 LEU A CA  
2045 C C   . LEU A 277 ? 0.5951 0.7586 0.6350 0.0006  0.0584  0.0121  321 LEU A C   
2046 O O   . LEU A 277 ? 0.5768 0.7362 0.6194 -0.0207 0.0561  0.0110  321 LEU A O   
2047 C CB  . LEU A 277 ? 0.5430 0.7800 0.6162 0.0262  0.0513  -0.0037 321 LEU A CB  
2048 C CG  . LEU A 277 ? 0.5255 0.8047 0.6162 0.0451  0.0499  -0.0142 321 LEU A CG  
2049 C CD1 . LEU A 277 ? 0.4934 0.8103 0.6007 0.0491  0.0368  -0.0210 321 LEU A CD1 
2050 C CD2 . LEU A 277 ? 0.5086 0.8049 0.6159 0.0320  0.0581  -0.0246 321 LEU A CD2 
2051 N N   . ALA A 278 ? 0.6464 0.7939 0.6780 0.0067  0.0581  0.0224  322 ALA A N   
2052 C CA  . ALA A 278 ? 0.6386 0.7651 0.6692 -0.0130 0.0561  0.0314  322 ALA A CA  
2053 C C   . ALA A 278 ? 0.6680 0.7698 0.6837 -0.0039 0.0628  0.0426  322 ALA A C   
2054 O O   . ALA A 278 ? 0.6812 0.7905 0.6905 0.0182  0.0654  0.0454  322 ALA A O   
2055 C CB  . ALA A 278 ? 0.5849 0.7360 0.6391 -0.0226 0.0479  0.0317  322 ALA A CB  
2056 N N   . ALA A 279 ? 0.7038 0.7769 0.7131 -0.0220 0.0651  0.0495  323 ALA A N   
2057 C CA  . ALA A 279 ? 0.7268 0.7734 0.7234 -0.0182 0.0743  0.0611  323 ALA A CA  
2058 C C   . ALA A 279 ? 0.6961 0.7384 0.7080 -0.0444 0.0719  0.0680  323 ALA A C   
2059 O O   . ALA A 279 ? 0.6781 0.7221 0.6980 -0.0656 0.0625  0.0636  323 ALA A O   
2060 C CB  . ALA A 279 ? 0.7847 0.7888 0.7518 -0.0100 0.0842  0.0611  323 ALA A CB  
2061 N N   . ASN A 280 ? 0.6448 0.6846 0.6608 -0.0426 0.0803  0.0795  324 ASN A N   
2062 C CA  . ASN A 280 ? 0.6146 0.6584 0.6529 -0.0661 0.0799  0.0868  324 ASN A CA  
2063 C C   . ASN A 280 ? 0.6389 0.6576 0.6664 -0.0657 0.0972  0.1000  324 ASN A C   
2064 O O   . ASN A 280 ? 0.6848 0.6706 0.6799 -0.0494 0.1076  0.1036  324 ASN A O   
2065 C CB  . ASN A 280 ? 0.5586 0.6458 0.6318 -0.0684 0.0708  0.0861  324 ASN A CB  
2066 C CG  . ASN A 280 ? 0.5533 0.6609 0.6307 -0.0474 0.0797  0.0892  324 ASN A CG  
2067 O OD1 . ASN A 280 ? 0.5849 0.6780 0.6405 -0.0333 0.0929  0.0957  324 ASN A OD1 
2068 N ND2 . ASN A 280 ? 0.5166 0.6548 0.6191 -0.0457 0.0728  0.0848  324 ASN A ND2 
2069 N N   . ASP A 281 ? 1.0650 1.0969 1.1194 -0.0833 0.1017  0.1085  325 ASP A N   
2070 C CA  . ASP A 281 ? 1.0916 1.0948 1.1353 -0.0895 0.1208  0.1217  325 ASP A CA  
2071 C C   . ASP A 281 ? 1.1088 1.1109 1.1311 -0.0620 0.1364  0.1313  325 ASP A C   
2072 O O   . ASP A 281 ? 1.1441 1.1096 1.1393 -0.0580 0.1538  0.1438  325 ASP A O   
2073 C CB  . ASP A 281 ? 1.0581 1.0830 1.1433 -0.1188 0.1219  0.1275  325 ASP A CB  
2074 C CG  . ASP A 281 ? 1.0887 1.0857 1.1680 -0.1314 0.1442  0.1413  325 ASP A CG  
2075 O OD1 . ASP A 281 ? 1.1367 1.0868 1.1937 -0.1468 0.1476  0.1407  325 ASP A OD1 
2076 O OD2 . ASP A 281 ? 1.0685 1.0878 1.1641 -0.1266 0.1603  0.1522  325 ASP A OD2 
2077 N N   . ASP A 282 ? 0.9014 0.9412 0.9332 -0.0441 0.1299  0.1255  326 ASP A N   
2078 C CA  . ASP A 282 ? 0.9196 0.9638 0.9271 -0.0176 0.1402  0.1309  326 ASP A CA  
2079 C C   . ASP A 282 ? 0.9566 0.9880 0.9267 0.0103  0.1337  0.1267  326 ASP A C   
2080 O O   . ASP A 282 ? 0.9897 1.0033 0.9255 0.0298  0.1442  0.1376  326 ASP A O   
2081 C CB  . ASP A 282 ? 0.8834 0.9718 0.9174 -0.0132 0.1382  0.1248  326 ASP A CB  
2082 C CG  . ASP A 282 ? 0.8461 0.9540 0.9230 -0.0357 0.1450  0.1301  326 ASP A CG  
2083 O OD1 . ASP A 282 ? 0.8576 0.9494 0.9344 -0.0480 0.1626  0.1437  326 ASP A OD1 
2084 O OD2 . ASP A 282 ? 0.8061 0.9454 0.9190 -0.0417 0.1330  0.1220  326 ASP A OD2 
2085 N N   . MET A 283 ? 0.8175 0.8614 0.7951 0.0130  0.1166  0.1120  327 MET A N   
2086 C CA  . MET A 283 ? 0.8451 0.8941 0.7999 0.0402  0.1086  0.1058  327 MET A CA  
2087 C C   . MET A 283 ? 0.8458 0.9010 0.8100 0.0386  0.0956  0.0915  327 MET A C   
2088 O O   . MET A 283 ? 0.8253 0.8780 0.8082 0.0157  0.0915  0.0859  327 MET A O   
2089 C CB  . MET A 283 ? 0.8318 0.9189 0.7884 0.0550  0.1031  0.0992  327 MET A CB  
2090 C CG  . MET A 283 ? 0.7846 0.9038 0.7779 0.0386  0.0959  0.0875  327 MET A CG  
2091 S SD  . MET A 283 ? 0.7608 0.9056 0.7753 0.0348  0.0766  0.0677  327 MET A SD  
2092 C CE  . MET A 283 ? 0.7737 0.9461 0.7714 0.0606  0.0679  0.0566  327 MET A CE  
2093 N N   . VAL A 284 ? 0.7432 0.8098 0.6944 0.0634  0.0892  0.0859  328 VAL A N   
2094 C CA  . VAL A 284 ? 0.7372 0.8229 0.7029 0.0637  0.0789  0.0706  328 VAL A CA  
2095 C C   . VAL A 284 ? 0.7156 0.8478 0.6922 0.0790  0.0667  0.0590  328 VAL A C   
2096 O O   . VAL A 284 ? 0.7301 0.8747 0.6915 0.0993  0.0641  0.0628  328 VAL A O   
2097 C CB  . VAL A 284 ? 0.7861 0.8414 0.7330 0.0774  0.0843  0.0717  328 VAL A CB  
2098 C CG1 . VAL A 284 ? 0.8087 0.8120 0.7405 0.0608  0.0963  0.0803  328 VAL A CG1 
2099 C CG2 . VAL A 284 ? 0.8252 0.8797 0.7497 0.1122  0.0849  0.0801  328 VAL A CG2 
2100 N N   . PHE A 285 ? 0.6802 0.8372 0.6812 0.0671  0.0590  0.0445  329 PHE A N   
2101 C CA  . PHE A 285 ? 0.6505 0.8513 0.6665 0.0778  0.0481  0.0306  329 PHE A CA  
2102 C C   . PHE A 285 ? 0.6646 0.8673 0.6801 0.0927  0.0499  0.0272  329 PHE A C   
2103 O O   . PHE A 285 ? 0.6654 0.8557 0.6871 0.0794  0.0556  0.0228  329 PHE A O   
2104 C CB  . PHE A 285 ? 0.6009 0.8238 0.6448 0.0544  0.0426  0.0179  329 PHE A CB  
2105 C CG  . PHE A 285 ? 0.5814 0.8059 0.6322 0.0420  0.0410  0.0184  329 PHE A CG  
2106 C CD1 . PHE A 285 ? 0.5821 0.7807 0.6333 0.0271  0.0472  0.0290  329 PHE A CD1 
2107 C CD2 . PHE A 285 ? 0.5629 0.8164 0.6227 0.0445  0.0331  0.0065  329 PHE A CD2 
2108 C CE1 . PHE A 285 ? 0.5602 0.7641 0.6234 0.0191  0.0472  0.0293  329 PHE A CE1 
2109 C CE2 . PHE A 285 ? 0.5529 0.8037 0.6186 0.0354  0.0343  0.0053  329 PHE A CE2 
2110 C CZ  . PHE A 285 ? 0.5492 0.7764 0.6183 0.0245  0.0421  0.0175  329 PHE A CZ  
2111 N N   . MET A 286 ? 0.6691 0.8888 0.6763 0.1218  0.0451  0.0291  330 MET A N   
2112 C CA  . MET A 286 ? 0.6769 0.9036 0.6884 0.1422  0.0474  0.0265  330 MET A CA  
2113 C C   . MET A 286 ? 0.6236 0.9145 0.6693 0.1458  0.0351  0.0097  330 MET A C   
2114 O O   . MET A 286 ? 0.6067 0.9326 0.6571 0.1516  0.0211  0.0052  330 MET A O   
2115 C CB  . MET A 286 ? 0.7266 0.9293 0.7080 0.1755  0.0494  0.0426  330 MET A CB  
2116 C CG  . MET A 286 ? 0.7384 0.9387 0.7223 0.2017  0.0547  0.0425  330 MET A CG  
2117 S SD  . MET A 286 ? 0.7802 0.9197 0.7521 0.1862  0.0760  0.0415  330 MET A SD  
2118 C CE  . MET A 286 ? 0.8606 0.9254 0.7854 0.1995  0.0871  0.0649  330 MET A CE  
2119 N N   . HIS A 287 ? 0.6627 0.9692 0.7316 0.1391  0.0413  -0.0010 331 HIS A N   
2120 C CA  . HIS A 287 ? 0.6160 0.9866 0.7231 0.1428  0.0332  -0.0165 331 HIS A CA  
2121 C C   . HIS A 287 ? 0.6269 1.0174 0.7402 0.1802  0.0336  -0.0138 331 HIS A C   
2122 O O   . HIS A 287 ? 0.6574 1.0140 0.7591 0.1914  0.0492  -0.0089 331 HIS A O   
2123 C CB  . HIS A 287 ? 0.5893 0.9679 0.7194 0.1145  0.0438  -0.0284 331 HIS A CB  
2124 C CG  . HIS A 287 ? 0.5441 0.9886 0.7176 0.1142  0.0399  -0.0441 331 HIS A CG  
2125 N ND1 . HIS A 287 ? 0.5047 0.9862 0.7037 0.0912  0.0297  -0.0564 331 HIS A ND1 
2126 C CD2 . HIS A 287 ? 0.5334 1.0147 0.7329 0.1329  0.0464  -0.0502 331 HIS A CD2 
2127 C CE1 . HIS A 287 ? 0.4716 1.0116 0.7114 0.0924  0.0292  -0.0695 331 HIS A CE1 
2128 N NE2 . HIS A 287 ? 0.4853 1.0301 0.7286 0.1185  0.0395  -0.0657 331 HIS A NE2 
2129 N N   . VAL A 288 ? 0.5708 1.0155 0.7017 0.2008  0.0160  -0.0175 332 VAL A N   
2130 C CA  . VAL A 288 ? 0.5706 1.0466 0.7174 0.2394  0.0141  -0.0152 332 VAL A CA  
2131 C C   . VAL A 288 ? 0.5150 1.0711 0.7192 0.2345  0.0081  -0.0345 332 VAL A C   
2132 O O   . VAL A 288 ? 0.4834 1.0903 0.7089 0.2222  -0.0110 -0.0458 332 VAL A O   
2133 C CB  . VAL A 288 ? 0.5937 1.0777 0.7175 0.2748  -0.0044 -0.0015 332 VAL A CB  
2134 C CG1 . VAL A 288 ? 0.5842 1.1129 0.7341 0.3168  -0.0099 0.0003  332 VAL A CG1 
2135 C CG2 . VAL A 288 ? 0.6555 1.0594 0.7226 0.2821  0.0053  0.0202  332 VAL A CG2 
2136 N N   . ASP A 289 ? 0.6632 1.2302 0.8921 0.2427  0.0257  -0.0394 333 ASP A N   
2137 C CA  . ASP A 289 ? 0.6121 1.2604 0.9018 0.2405  0.0247  -0.0566 333 ASP A CA  
2138 C C   . ASP A 289 ? 0.5872 1.3103 0.9081 0.2701  -0.0017 -0.0586 333 ASP A C   
2139 O O   . ASP A 289 ? 0.6148 1.3284 0.9164 0.3114  -0.0101 -0.0437 333 ASP A O   
2140 C CB  . ASP A 289 ? 0.6199 1.2647 0.9258 0.2548  0.0513  -0.0591 333 ASP A CB  
2141 C CG  . ASP A 289 ? 0.5678 1.2980 0.9401 0.2465  0.0556  -0.0770 333 ASP A CG  
2142 O OD1 . ASP A 289 ? 0.5343 1.2963 0.9288 0.2086  0.0484  -0.0890 333 ASP A OD1 
2143 O OD2 . ASP A 289 ? 0.5607 1.3271 0.9653 0.2774  0.0670  -0.0793 333 ASP A OD2 
2144 N N   . GLU A 290 ? 0.5812 1.3779 0.9495 0.2483  -0.0155 -0.0767 334 GLU A N   
2145 C CA  . GLU A 290 ? 0.5670 1.4307 0.9644 0.2672  -0.0425 -0.0809 334 GLU A CA  
2146 C C   . GLU A 290 ? 0.5725 1.4645 1.0069 0.2921  -0.0317 -0.0796 334 GLU A C   
2147 O O   . GLU A 290 ? 0.5630 1.4521 1.0209 0.2804  -0.0041 -0.0858 334 GLU A O   
2148 C CB  . GLU A 290 ? 0.5369 1.4443 0.9628 0.2243  -0.0578 -0.1016 334 GLU A CB  
2149 C CG  . GLU A 290 ? 0.5495 1.4862 0.9636 0.2308  -0.0924 -0.1048 334 GLU A CG  
2150 C CD  . GLU A 290 ? 0.5840 1.4783 0.9381 0.2600  -0.1038 -0.0870 334 GLU A CD  
2151 O OE1 . GLU A 290 ? 0.5969 1.4376 0.9170 0.2491  -0.0910 -0.0808 334 GLU A OE1 
2152 O OE2 . GLU A 290 ? 0.6102 1.5194 0.9479 0.2923  -0.1246 -0.0773 334 GLU A OE2 
2153 N N   . PRO A 291 ? 0.6019 1.5200 1.0396 0.3276  -0.0524 -0.0709 335 PRO A N   
2154 C CA  . PRO A 291 ? 0.6267 1.5754 1.1050 0.3534  -0.0426 -0.0694 335 PRO A CA  
2155 C C   . PRO A 291 ? 0.6062 1.6179 1.1479 0.3196  -0.0375 -0.0894 335 PRO A C   
2156 O O   . PRO A 291 ? 0.5871 1.6309 1.1420 0.2853  -0.0548 -0.1027 335 PRO A O   
2157 C CB  . PRO A 291 ? 0.6705 1.6432 1.1405 0.3907  -0.0731 -0.0573 335 PRO A CB  
2158 C CG  . PRO A 291 ? 0.6606 1.6420 1.1041 0.3700  -0.1008 -0.0621 335 PRO A CG  
2159 C CD  . PRO A 291 ? 0.6269 1.5507 1.0324 0.3452  -0.0848 -0.0625 335 PRO A CD  
2160 N N   . GLY A 292 ? 0.8208 1.8460 1.3995 0.3287  -0.0120 -0.0915 336 GLY A N   
2161 C CA  . GLY A 292 ? 0.8113 1.9009 1.4543 0.3013  -0.0059 -0.1073 336 GLY A CA  
2162 C C   . GLY A 292 ? 0.7753 1.8612 1.4281 0.2477  0.0116  -0.1217 336 GLY A C   
2163 O O   . GLY A 292 ? 0.7637 1.8891 1.4423 0.2143  -0.0039 -0.1339 336 GLY A O   
2164 N N   . ASP A 293 ? 1.2747 2.3080 1.9017 0.2391  0.0433  -0.1200 337 ASP A N   
2165 C CA  . ASP A 293 ? 1.2546 2.2875 1.8975 0.1938  0.0682  -0.1310 337 ASP A CA  
2166 C C   . ASP A 293 ? 1.2305 2.2752 1.8763 0.1482  0.0500  -0.1411 337 ASP A C   
2167 O O   . ASP A 293 ? 1.2300 2.3130 1.9167 0.1166  0.0542  -0.1516 337 ASP A O   
2168 C CB  . ASP A 293 ? 1.2739 2.3563 1.9747 0.1953  0.0902  -0.1366 337 ASP A CB  
2169 C CG  . ASP A 293 ? 1.2654 2.3330 1.9699 0.1553  0.1244  -0.1432 337 ASP A CG  
2170 O OD1 . ASP A 293 ? 1.2731 2.2923 1.9450 0.1620  0.1545  -0.1398 337 ASP A OD1 
2171 O OD2 . ASP A 293 ? 1.2578 2.3588 1.9938 0.1168  0.1215  -0.1517 337 ASP A OD2 
2172 N N   . THR A 294 ? 0.7085 1.7185 1.3106 0.1466  0.0300  -0.1377 338 THR A N   
2173 C CA  . THR A 294 ? 0.6919 1.7022 1.2892 0.1073  0.0131  -0.1479 338 THR A CA  
2174 C C   . THR A 294 ? 0.6725 1.6362 1.2504 0.0678  0.0369  -0.1500 338 THR A C   
2175 O O   . THR A 294 ? 0.6677 1.6368 1.2602 0.0277  0.0366  -0.1600 338 THR A O   
2176 C CB  . THR A 294 ? 0.6928 1.6860 1.2504 0.1253  -0.0164 -0.1430 338 THR A CB  
2177 O OG1 . THR A 294 ? 0.6965 1.6303 1.2066 0.1413  -0.0044 -0.1299 338 THR A OG1 
2178 C CG2 . THR A 294 ? 0.7210 1.7556 1.2908 0.1662  -0.0395 -0.1377 338 THR A CG2 
2179 N N   . GLY A 295 ? 0.5153 1.4304 1.0584 0.0795  0.0577  -0.1400 339 GLY A N   
2180 C CA  . GLY A 295 ? 0.5139 1.3806 1.0300 0.0452  0.0770  -0.1393 339 GLY A CA  
2181 C C   . GLY A 295 ? 0.5125 1.3453 0.9936 0.0363  0.0581  -0.1369 339 GLY A C   
2182 O O   . GLY A 295 ? 0.5173 1.3055 0.9754 0.0036  0.0652  -0.1355 339 GLY A O   
2183 N N   . PHE A 296 ? 0.4711 1.3151 0.9418 0.0667  0.0332  -0.1335 340 PHE A N   
2184 C CA  . PHE A 296 ? 0.4925 1.2901 0.9195 0.0624  0.0148  -0.1280 340 PHE A CA  
2185 C C   . PHE A 296 ? 0.5206 1.3072 0.9180 0.1057  -0.0011 -0.1154 340 PHE A C   
2186 O O   . PHE A 296 ? 0.5175 1.3446 0.9361 0.1405  -0.0041 -0.1129 340 PHE A O   
2187 C CB  . PHE A 296 ? 0.4695 1.3009 0.9184 0.0330  -0.0044 -0.1451 340 PHE A CB  
2188 C CG  . PHE A 296 ? 0.4658 1.3530 0.9380 0.0486  -0.0300 -0.1540 340 PHE A CG  
2189 C CD1 . PHE A 296 ? 0.4835 1.3759 0.9292 0.0786  -0.0548 -0.1494 340 PHE A CD1 
2190 C CD2 . PHE A 296 ? 0.4556 1.3875 0.9731 0.0310  -0.0292 -0.1658 340 PHE A CD2 
2191 C CE1 . PHE A 296 ? 0.4894 1.4291 0.9499 0.0914  -0.0795 -0.1566 340 PHE A CE1 
2192 C CE2 . PHE A 296 ? 0.4682 1.4531 1.0080 0.0427  -0.0546 -0.1742 340 PHE A CE2 
2193 C CZ  . PHE A 296 ? 0.4822 1.4705 0.9920 0.0729  -0.0804 -0.1698 340 PHE A CZ  
2194 N N   . GLY A 297 ? 0.4247 1.1569 0.7742 0.1038  -0.0106 -0.1067 341 GLY A N   
2195 C CA  . GLY A 297 ? 0.4623 1.1626 0.7704 0.1394  -0.0193 -0.0901 341 GLY A CA  
2196 C C   . GLY A 297 ? 0.4841 1.1570 0.7567 0.1305  -0.0349 -0.0888 341 GLY A C   
2197 O O   . GLY A 297 ? 0.4687 1.1574 0.7536 0.1018  -0.0432 -0.1040 341 GLY A O   
2198 N N   . THR A 298 ? 0.4860 1.1164 0.7136 0.1561  -0.0371 -0.0711 342 THR A N   
2199 C CA  . THR A 298 ? 0.5158 1.1187 0.7048 0.1532  -0.0479 -0.0676 342 THR A CA  
2200 C C   . THR A 298 ? 0.5498 1.0771 0.7007 0.1496  -0.0289 -0.0496 342 THR A C   
2201 O O   . THR A 298 ? 0.5677 1.0659 0.7083 0.1660  -0.0158 -0.0362 342 THR A O   
2202 C CB  . THR A 298 ? 0.5393 1.1692 0.7087 0.1892  -0.0691 -0.0613 342 THR A CB  
2203 O OG1 . THR A 298 ? 0.5024 1.2125 0.7178 0.1963  -0.0871 -0.0769 342 THR A OG1 
2204 C CG2 . THR A 298 ? 0.5742 1.1875 0.7048 0.1836  -0.0808 -0.0631 342 THR A CG2 
2205 N N   . ILE A 299 ? 0.4736 0.9696 0.6069 0.1269  -0.0267 -0.0508 343 ILE A N   
2206 C CA  . ILE A 299 ? 0.5031 0.9351 0.6051 0.1216  -0.0113 -0.0342 343 ILE A CA  
2207 C C   . ILE A 299 ? 0.5507 0.9621 0.6120 0.1414  -0.0159 -0.0217 343 ILE A C   
2208 O O   . ILE A 299 ? 0.5613 0.9940 0.6149 0.1410  -0.0284 -0.0310 343 ILE A O   
2209 C CB  . ILE A 299 ? 0.4856 0.8991 0.5957 0.0881  -0.0057 -0.0411 343 ILE A CB  
2210 C CG1 . ILE A 299 ? 0.4489 0.8724 0.5905 0.0659  0.0018  -0.0497 343 ILE A CG1 
2211 C CG2 . ILE A 299 ? 0.5130 0.8720 0.5951 0.0836  0.0059  -0.0247 343 ILE A CG2 
2212 C CD1 . ILE A 299 ? 0.4330 0.8351 0.5806 0.0352  0.0059  -0.0537 343 ILE A CD1 
2213 N N   . PHE A 300 ? 0.6003 0.9673 0.6327 0.1568  -0.0043 -0.0013 344 PHE A N   
2214 C CA  . PHE A 300 ? 0.6538 0.9923 0.6437 0.1717  -0.0028 0.0141  344 PHE A CA  
2215 C C   . PHE A 300 ? 0.6716 0.9578 0.6486 0.1523  0.0157  0.0259  344 PHE A C   
2216 O O   . PHE A 300 ? 0.6616 0.9225 0.6496 0.1396  0.0266  0.0294  344 PHE A O   
2217 C CB  . PHE A 300 ? 0.6902 1.0170 0.6543 0.2076  -0.0037 0.0317  344 PHE A CB  
2218 C CG  . PHE A 300 ? 0.6678 1.0519 0.6468 0.2329  -0.0243 0.0235  344 PHE A CG  
2219 C CD1 . PHE A 300 ? 0.6229 1.0441 0.6456 0.2330  -0.0269 0.0112  344 PHE A CD1 
2220 C CD2 . PHE A 300 ? 0.6925 1.0953 0.6413 0.2580  -0.0407 0.0293  344 PHE A CD2 
2221 C CE1 . PHE A 300 ? 0.5995 1.0817 0.6441 0.2567  -0.0462 0.0039  344 PHE A CE1 
2222 C CE2 . PHE A 300 ? 0.6687 1.1312 0.6346 0.2828  -0.0636 0.0225  344 PHE A CE2 
2223 C CZ  . PHE A 300 ? 0.6211 1.1256 0.6389 0.2817  -0.0664 0.0096  344 PHE A CZ  
2224 N N   . THR A 301 ? 0.6084 0.8806 0.5627 0.1493  0.0196  0.0311  345 THR A N   
2225 C CA  . THR A 301 ? 0.6152 0.8438 0.5617 0.1335  0.0377  0.0446  345 THR A CA  
2226 C C   . THR A 301 ? 0.6707 0.8636 0.5760 0.1532  0.0483  0.0671  345 THR A C   
2227 O O   . THR A 301 ? 0.6987 0.9025 0.5747 0.1770  0.0410  0.0714  345 THR A O   
2228 C CB  . THR A 301 ? 0.5884 0.8233 0.5441 0.1149  0.0406  0.0364  345 THR A CB  
2229 O OG1 . THR A 301 ? 0.6149 0.8682 0.5458 0.1295  0.0340  0.0309  345 THR A OG1 
2230 C CG2 . THR A 301 ? 0.5376 0.7953 0.5318 0.0939  0.0328  0.0179  345 THR A CG2 
2231 N N   . SER A 302 ? 0.7369 0.8860 0.6373 0.1430  0.0646  0.0817  346 SER A N   
2232 C CA  . SER A 302 ? 0.7733 0.8818 0.6340 0.1597  0.0770  0.1042  346 SER A CA  
2233 C C   . SER A 302 ? 0.7647 0.8573 0.6107 0.1482  0.0925  0.1149  346 SER A C   
2234 O O   . SER A 302 ? 0.7307 0.8399 0.6033 0.1263  0.0949  0.1053  346 SER A O   
2235 C CB  . SER A 302 ? 0.7887 0.8519 0.6497 0.1528  0.0886  0.1134  346 SER A CB  
2236 O OG  . SER A 302 ? 0.7585 0.8092 0.6420 0.1197  0.0978  0.1114  346 SER A OG  
2237 N N   . ASP A 303 ? 0.8583 0.9149 0.6629 0.1631  0.1057  0.1368  347 ASP A N   
2238 C CA  . ASP A 303 ? 0.8563 0.8897 0.6474 0.1498  0.1274  0.1510  347 ASP A CA  
2239 C C   . ASP A 303 ? 0.8477 0.8445 0.6593 0.1240  0.1418  0.1586  347 ASP A C   
2240 O O   . ASP A 303 ? 0.8464 0.8348 0.6760 0.1183  0.1340  0.1511  347 ASP A O   
2241 C CB  . ASP A 303 ? 0.8977 0.9058 0.6308 0.1754  0.1368  0.1728  347 ASP A CB  
2242 C CG  . ASP A 303 ? 0.9351 0.8887 0.6389 0.1895  0.1452  0.1946  347 ASP A CG  
2243 O OD1 . ASP A 303 ? 0.9351 0.8723 0.6608 0.1838  0.1417  0.1899  347 ASP A OD1 
2244 O OD2 . ASP A 303 ? 0.9698 0.8926 0.6232 0.2078  0.1567  0.2173  347 ASP A OD2 
2245 N N   . ASP A 304 ? 1.1168 1.0933 0.9257 0.1070  0.1635  0.1723  348 ASP A N   
2246 C CA  . ASP A 304 ? 1.1022 1.0540 0.9386 0.0759  0.1745  0.1759  348 ASP A CA  
2247 C C   . ASP A 304 ? 1.1430 1.0345 0.9513 0.0787  0.1840  0.1905  348 ASP A C   
2248 O O   . ASP A 304 ? 1.1402 1.0043 0.9655 0.0519  0.1916  0.1913  348 ASP A O   
2249 C CB  . ASP A 304 ? 1.0797 1.0403 0.9345 0.0540  0.1943  0.1836  348 ASP A CB  
2250 C CG  . ASP A 304 ? 1.1170 1.0442 0.9278 0.0631  0.2194  0.2075  348 ASP A CG  
2251 O OD1 . ASP A 304 ? 1.1527 1.0700 0.9151 0.0939  0.2168  0.2152  348 ASP A OD1 
2252 O OD2 . ASP A 304 ? 1.1116 1.0243 0.9367 0.0385  0.2416  0.2194  348 ASP A OD2 
2253 N N   . ARG A 305 ? 1.1077 0.9769 0.8716 0.1117  0.1828  0.2017  349 ARG A N   
2254 C CA  . ARG A 305 ? 1.1507 0.9591 0.8871 0.1212  0.1899  0.2138  349 ARG A CA  
2255 C C   . ARG A 305 ? 1.1568 0.9743 0.9060 0.1357  0.1708  0.1967  349 ARG A C   
2256 O O   . ARG A 305 ? 1.1916 0.9595 0.9253 0.1420  0.1767  0.2010  349 ARG A O   
2257 C CB  . ARG A 305 ? 1.1957 0.9670 0.8749 0.1518  0.2013  0.2400  349 ARG A CB  
2258 C CG  . ARG A 305 ? 1.2030 0.9482 0.8644 0.1333  0.2285  0.2604  349 ARG A CG  
2259 C CD  . ARG A 305 ? 1.2433 0.9687 0.8436 0.1660  0.2366  0.2849  349 ARG A CD  
2260 N NE  . ARG A 305 ? 1.2314 1.0149 0.8249 0.1940  0.2124  0.2727  349 ARG A NE  
2261 C CZ  . ARG A 305 ? 1.2639 1.0446 0.8037 0.2288  0.2076  0.2881  349 ARG A CZ  
2262 N NH1 . ARG A 305 ? 1.3127 1.0315 0.7970 0.2427  0.2273  0.3199  349 ARG A NH1 
2263 N NH2 . ARG A 305 ? 1.2496 1.0886 0.7896 0.2485  0.1825  0.2718  349 ARG A NH2 
2264 N N   . GLY A 306 ? 0.9913 0.8703 0.7693 0.1396  0.1505  0.1767  350 GLY A N   
2265 C CA  . GLY A 306 ? 0.9986 0.8973 0.7899 0.1557  0.1341  0.1611  350 GLY A CA  
2266 C C   . GLY A 306 ? 1.0345 0.9270 0.7936 0.1993  0.1283  0.1721  350 GLY A C   
2267 O O   . GLY A 306 ? 1.0469 0.9489 0.8155 0.2180  0.1191  0.1631  350 GLY A O   
2268 N N   . ILE A 307 ? 1.1172 0.9916 0.8370 0.2163  0.1353  0.1933  351 ILE A N   
2269 C CA  . ILE A 307 ? 1.1467 1.0168 0.8309 0.2605  0.1270  0.2077  351 ILE A CA  
2270 C C   . ILE A 307 ? 1.1259 1.0659 0.8129 0.2823  0.1022  0.1977  351 ILE A C   
2271 O O   . ILE A 307 ? 1.1269 1.0938 0.8182 0.3131  0.0847  0.1940  351 ILE A O   
2272 C CB  . ILE A 307 ? 1.1853 0.9908 0.8153 0.2706  0.1475  0.2394  351 ILE A CB  
2273 C CG1 . ILE A 307 ? 1.2127 0.9439 0.8395 0.2526  0.1697  0.2472  351 ILE A CG1 
2274 C CG2 . ILE A 307 ? 1.2151 1.0185 0.8026 0.3195  0.1360  0.2578  351 ILE A CG2 
2275 C CD1 . ILE A 307 ? 1.2450 0.9078 0.8286 0.2447  0.1965  0.2760  351 ILE A CD1 
2276 N N   . VAL A 308 ? 1.1479 1.1188 0.8350 0.2658  0.1008  0.1916  352 VAL A N   
2277 C CA  . VAL A 308 ? 1.1377 1.1658 0.8163 0.2837  0.0788  0.1820  352 VAL A CA  
2278 C C   . VAL A 308 ? 1.0977 1.1846 0.8285 0.2621  0.0635  0.1505  352 VAL A C   
2279 O O   . VAL A 308 ? 1.0751 1.1602 0.8332 0.2294  0.0741  0.1407  352 VAL A O   
2280 C CB  . VAL A 308 ? 1.1492 1.1690 0.7848 0.2819  0.0893  0.1939  352 VAL A CB  
2281 C CG1 . VAL A 308 ? 1.1468 1.2218 0.7663 0.3003  0.0646  0.1811  352 VAL A CG1 
2282 C CG2 . VAL A 308 ? 1.1922 1.1474 0.7721 0.2991  0.1088  0.2281  352 VAL A CG2 
2283 N N   . TYR A 309 ? 0.8911 1.0307 0.6376 0.2801  0.0386  0.1356  353 TYR A N   
2284 C CA  . TYR A 309 ? 0.8545 1.0450 0.6528 0.2579  0.0260  0.1063  353 TYR A CA  
2285 C C   . TYR A 309 ? 0.8399 1.0848 0.6377 0.2594  0.0055  0.0880  353 TYR A C   
2286 O O   . TYR A 309 ? 0.8410 1.1176 0.6236 0.2861  -0.0146 0.0880  353 TYR A O   
2287 C CB  . TYR A 309 ? 0.8363 1.0439 0.6709 0.2653  0.0190  0.0979  353 TYR A CB  
2288 C CG  . TYR A 309 ? 0.8523 1.0071 0.6935 0.2519  0.0399  0.1061  353 TYR A CG  
2289 C CD1 . TYR A 309 ? 0.8898 0.9866 0.6959 0.2700  0.0542  0.1296  353 TYR A CD1 
2290 C CD2 . TYR A 309 ? 0.8324 0.9914 0.7102 0.2203  0.0451  0.0905  353 TYR A CD2 
2291 C CE1 . TYR A 309 ? 0.9084 0.9543 0.7180 0.2544  0.0725  0.1337  353 TYR A CE1 
2292 C CE2 . TYR A 309 ? 0.8534 0.9659 0.7326 0.2063  0.0614  0.0957  353 TYR A CE2 
2293 C CZ  . TYR A 309 ? 0.8912 0.9476 0.7370 0.2220  0.0749  0.1156  353 TYR A CZ  
2294 O OH  . TYR A 309 ? 0.9124 0.9197 0.7583 0.2040  0.0906  0.1172  353 TYR A OH  
2295 N N   . SER A 310 ? 0.9423 1.1957 0.7549 0.2312  0.0102  0.0726  354 SER A N   
2296 C CA  . SER A 310 ? 0.9311 1.2316 0.7492 0.2261  -0.0081 0.0490  354 SER A CA  
2297 C C   . SER A 310 ? 0.8950 1.2391 0.7674 0.2137  -0.0229 0.0265  354 SER A C   
2298 O O   . SER A 310 ? 0.8747 1.2062 0.7790 0.2009  -0.0133 0.0275  354 SER A O   
2299 C CB  . SER A 310 ? 0.9301 1.2159 0.7429 0.2033  0.0063  0.0417  354 SER A CB  
2300 O OG  . SER A 310 ? 0.9291 1.2523 0.7430 0.1976  -0.0098 0.0163  354 SER A OG  
2301 N N   . LYS A 311 ? 0.8839 1.2790 0.7652 0.2157  -0.0457 0.0057  355 LYS A N   
2302 C CA  . LYS A 311 ? 0.8339 1.2732 0.7687 0.2011  -0.0576 -0.0156 355 LYS A CA  
2303 C C   . LYS A 311 ? 0.8240 1.2646 0.7808 0.1670  -0.0535 -0.0370 355 LYS A C   
2304 O O   . LYS A 311 ? 0.8457 1.2980 0.7861 0.1609  -0.0621 -0.0526 355 LYS A O   
2305 C CB  . LYS A 311 ? 0.8144 1.3146 0.7552 0.2200  -0.0861 -0.0272 355 LYS A CB  
2306 C CG  . LYS A 311 ? 0.7600 1.3114 0.7584 0.1982  -0.0971 -0.0529 355 LYS A CG  
2307 C CD  . LYS A 311 ? 0.7398 1.3606 0.7549 0.2178  -0.1260 -0.0630 355 LYS A CD  
2308 C CE  . LYS A 311 ? 0.7266 1.3927 0.7576 0.1930  -0.1459 -0.0949 355 LYS A CE  
2309 N NZ  . LYS A 311 ? 0.7114 1.4519 0.7546 0.2107  -0.1796 -0.1066 355 LYS A NZ  
2310 N N   . SER A 312 ? 0.5499 0.9722 0.5393 0.1458  -0.0393 -0.0366 356 SER A N   
2311 C CA  . SER A 312 ? 0.5304 0.9450 0.5416 0.1153  -0.0332 -0.0519 356 SER A CA  
2312 C C   . SER A 312 ? 0.4887 0.9432 0.5400 0.0948  -0.0452 -0.0768 356 SER A C   
2313 O O   . SER A 312 ? 0.5018 0.9571 0.5563 0.0768  -0.0479 -0.0948 356 SER A O   
2314 C CB  . SER A 312 ? 0.5034 0.8757 0.5248 0.1016  -0.0130 -0.0369 356 SER A CB  
2315 O OG  . SER A 312 ? 0.4842 0.8453 0.5233 0.0767  -0.0074 -0.0474 356 SER A OG  
2316 N N   . LEU A 313 ? 0.5911 1.0749 0.6741 0.0960  -0.0492 -0.0780 357 LEU A N   
2317 C CA  . LEU A 313 ? 0.5488 1.0680 0.6741 0.0717  -0.0553 -0.0995 357 LEU A CA  
2318 C C   . LEU A 313 ? 0.5098 1.0875 0.6699 0.0801  -0.0668 -0.1069 357 LEU A C   
2319 O O   . LEU A 313 ? 0.4940 1.0731 0.6627 0.0960  -0.0590 -0.0934 357 LEU A O   
2320 C CB  . LEU A 313 ? 0.5224 1.0068 0.6652 0.0457  -0.0373 -0.0959 357 LEU A CB  
2321 C CG  . LEU A 313 ? 0.4927 0.9943 0.6708 0.0146  -0.0379 -0.1153 357 LEU A CG  
2322 C CD1 . LEU A 313 ? 0.5248 1.0285 0.6952 0.0028  -0.0479 -0.1353 357 LEU A CD1 
2323 C CD2 . LEU A 313 ? 0.4738 0.9348 0.6593 -0.0053 -0.0204 -0.1050 357 LEU A CD2 
2324 N N   . ASP A 314 ? 0.7070 1.3331 0.8916 0.0666  -0.0833 -0.1305 358 ASP A N   
2325 C CA  . ASP A 314 ? 0.6657 1.3597 0.8929 0.0720  -0.0957 -0.1403 358 ASP A CA  
2326 C C   . ASP A 314 ? 0.6203 1.3279 0.8954 0.0421  -0.0817 -0.1494 358 ASP A C   
2327 O O   . ASP A 314 ? 0.6210 1.2938 0.8969 0.0119  -0.0703 -0.1551 358 ASP A O   
2328 C CB  . ASP A 314 ? 0.6694 1.4186 0.9012 0.0718  -0.1244 -0.1623 358 ASP A CB  
2329 C CG  . ASP A 314 ? 0.7045 1.4615 0.8944 0.1103  -0.1418 -0.1503 358 ASP A CG  
2330 O OD1 . ASP A 314 ? 0.7118 1.4484 0.8863 0.1401  -0.1327 -0.1254 358 ASP A OD1 
2331 O OD2 . ASP A 314 ? 0.7280 1.5079 0.8972 0.1102  -0.1641 -0.1659 358 ASP A OD2 
2332 N N   . ARG A 315 ? 0.5089 1.2641 0.8215 0.0537  -0.0805 -0.1482 359 ARG A N   
2333 C CA  . ARG A 315 ? 0.4675 1.2507 0.8298 0.0272  -0.0669 -0.1583 359 ARG A CA  
2334 C C   . ARG A 315 ? 0.4720 1.1906 0.8193 0.0049  -0.0413 -0.1480 359 ARG A C   
2335 O O   . ARG A 315 ? 0.4561 1.1710 0.8243 -0.0299 -0.0319 -0.1581 359 ARG A O   
2336 C CB  . ARG A 315 ? 0.4457 1.2820 0.8461 -0.0026 -0.0822 -0.1856 359 ARG A CB  
2337 C CG  . ARG A 315 ? 0.4502 1.3391 0.8574 0.0193  -0.1083 -0.1924 359 ARG A CG  
2338 C CD  . ARG A 315 ? 0.4567 1.3694 0.8815 -0.0117 -0.1232 -0.2169 359 ARG A CD  
2339 N NE  . ARG A 315 ? 0.4363 1.3629 0.9070 -0.0426 -0.1071 -0.2241 359 ARG A NE  
2340 C CZ  . ARG A 315 ? 0.4378 1.4135 0.9488 -0.0345 -0.1070 -0.2229 359 ARG A CZ  
2341 N NH1 . ARG A 315 ? 0.4487 1.4612 0.9591 0.0046  -0.1233 -0.2145 359 ARG A NH1 
2342 N NH2 . ARG A 315 ? 0.4369 1.4235 0.9876 -0.0644 -0.0899 -0.2286 359 ARG A NH2 
2343 N N   . HIS A 316 ? 0.3643 1.0301 0.6730 0.0249  -0.0310 -0.1269 360 HIS A N   
2344 C CA  . HIS A 316 ? 0.3709 0.9783 0.6621 0.0084  -0.0100 -0.1148 360 HIS A CA  
2345 C C   . HIS A 316 ? 0.3485 0.9747 0.6677 0.0021  0.0083  -0.1146 360 HIS A C   
2346 O O   . HIS A 316 ? 0.3478 0.9982 0.6760 0.0281  0.0115  -0.1107 360 HIS A O   
2347 C CB  . HIS A 316 ? 0.4058 0.9604 0.6527 0.0310  -0.0059 -0.0945 360 HIS A CB  
2348 C CG  . HIS A 316 ? 0.4143 0.9126 0.6425 0.0144  0.0115  -0.0824 360 HIS A CG  
2349 N ND1 . HIS A 316 ? 0.4376 0.9008 0.6426 0.0282  0.0229  -0.0673 360 HIS A ND1 
2350 C CD2 . HIS A 316 ? 0.4076 0.8782 0.6356 -0.0148 0.0177  -0.0831 360 HIS A CD2 
2351 C CE1 . HIS A 316 ? 0.4435 0.8650 0.6352 0.0070  0.0332  -0.0603 360 HIS A CE1 
2352 N NE2 . HIS A 316 ? 0.4232 0.8488 0.6286 -0.0174 0.0301  -0.0680 360 HIS A NE2 
2353 N N   . LEU A 317 ? 0.6341 1.2440 0.9628 -0.0304 0.0224  -0.1174 361 LEU A N   
2354 C CA  . LEU A 317 ? 0.6187 1.2492 0.9719 -0.0395 0.0422  -0.1189 361 LEU A CA  
2355 C C   . LEU A 317 ? 0.6478 1.2321 0.9671 -0.0251 0.0588  -0.1027 361 LEU A C   
2356 O O   . LEU A 317 ? 0.6707 1.1960 0.9535 -0.0353 0.0627  -0.0910 361 LEU A O   
2357 C CB  . LEU A 317 ? 0.6066 1.2269 0.9727 -0.0803 0.0522  -0.1248 361 LEU A CB  
2358 C CG  . LEU A 317 ? 0.5937 1.2344 0.9839 -0.0976 0.0763  -0.1267 361 LEU A CG  
2359 C CD1 . LEU A 317 ? 0.5720 1.2386 0.9976 -0.1344 0.0783  -0.1406 361 LEU A CD1 
2360 C CD2 . LEU A 317 ? 0.6227 1.1991 0.9700 -0.1054 0.0946  -0.1098 361 LEU A CD2 
2361 N N   . TYR A 318 ? 0.5079 1.1193 0.8395 0.0000  0.0673  -0.1028 362 TYR A N   
2362 C CA  . TYR A 318 ? 0.5432 1.1113 0.8440 0.0104  0.0864  -0.0923 362 TYR A CA  
2363 C C   . TYR A 318 ? 0.5330 1.1470 0.8669 0.0206  0.1055  -0.1006 362 TYR A C   
2364 O O   . TYR A 318 ? 0.5231 1.1820 0.8833 0.0516  0.0993  -0.1044 362 TYR A O   
2365 C CB  . TYR A 318 ? 0.5769 1.1120 0.8449 0.0429  0.0768  -0.0811 362 TYR A CB  
2366 C CG  . TYR A 318 ? 0.6265 1.0924 0.8473 0.0446  0.0894  -0.0691 362 TYR A CG  
2367 C CD1 . TYR A 318 ? 0.6482 1.0972 0.8592 0.0376  0.1116  -0.0710 362 TYR A CD1 
2368 C CD2 . TYR A 318 ? 0.6569 1.0755 0.8423 0.0524  0.0795  -0.0570 362 TYR A CD2 
2369 C CE1 . TYR A 318 ? 0.7014 1.0864 0.8660 0.0369  0.1205  -0.0629 362 TYR A CE1 
2370 C CE2 . TYR A 318 ? 0.7059 1.0646 0.8519 0.0507  0.0892  -0.0478 362 TYR A CE2 
2371 C CZ  . TYR A 318 ? 0.7294 1.0710 0.8642 0.0425  0.1080  -0.0517 362 TYR A CZ  
2372 O OH  . TYR A 318 ? 0.7848 1.0667 0.8778 0.0384  0.1154  -0.0456 362 TYR A OH  
2373 N N   . THR A 319 ? 0.5826 1.1861 0.9139 -0.0011 0.1296  -0.1023 363 THR A N   
2374 C CA  . THR A 319 ? 0.5708 1.2258 0.9393 0.0097  0.1515  -0.1118 363 THR A CA  
2375 C C   . THR A 319 ? 0.6110 1.2418 0.9564 0.0468  0.1637  -0.1078 363 THR A C   
2376 O O   . THR A 319 ? 0.6566 1.2171 0.9478 0.0494  0.1658  -0.0984 363 THR A O   
2377 C CB  . THR A 319 ? 0.5712 1.2230 0.9406 -0.0238 0.1785  -0.1148 363 THR A CB  
2378 O OG1 . THR A 319 ? 0.6222 1.1972 0.9285 -0.0315 0.1900  -0.1043 363 THR A OG1 
2379 C CG2 . THR A 319 ? 0.5383 1.2069 0.9302 -0.0617 0.1704  -0.1183 363 THR A CG2 
2380 N N   . THR A 320 ? 1.1500 1.8389 1.5382 0.0756  0.1717  -0.1155 364 THR A N   
2381 C CA  . THR A 320 ? 1.1872 1.8524 1.5569 0.1166  0.1835  -0.1123 364 THR A CA  
2382 C C   . THR A 320 ? 1.2229 1.8458 1.5602 0.1097  0.2185  -0.1157 364 THR A C   
2383 O O   . THR A 320 ? 1.2745 1.8313 1.5621 0.1263  0.2267  -0.1110 364 THR A O   
2384 C CB  . THR A 320 ? 1.1529 1.8999 1.5843 0.1536  0.1800  -0.1188 364 THR A CB  
2385 O OG1 . THR A 320 ? 1.1081 1.9225 1.5949 0.1264  0.1755  -0.1279 364 THR A OG1 
2386 C CG2 . THR A 320 ? 1.1525 1.9013 1.5792 0.1867  0.1482  -0.1092 364 THR A CG2 
2387 N N   . THR A 321 ? 1.1685 1.8271 1.5311 0.0833  0.2403  -0.1244 365 THR A N   
2388 C CA  . THR A 321 ? 1.2001 1.8183 1.5249 0.0732  0.2745  -0.1281 365 THR A CA  
2389 C C   . THR A 321 ? 1.2223 1.7929 1.5033 0.0271  0.2755  -0.1219 365 THR A C   
2390 O O   . THR A 321 ? 1.1892 1.7907 1.4971 -0.0037 0.2689  -0.1211 365 THR A O   
2391 C CB  . THR A 321 ? 1.1829 1.8691 1.5592 0.0822  0.3069  -0.1410 365 THR A CB  
2392 O OG1 . THR A 321 ? 1.2018 1.9018 1.5967 0.1324  0.3108  -0.1435 365 THR A OG1 
2393 C CG2 . THR A 321 ? 1.2070 1.8529 1.5388 0.0600  0.3434  -0.1448 365 THR A CG2 
2394 N N   . GLY A 322 ? 1.0837 1.5768 1.2959 0.0233  0.2830  -0.1176 366 GLY A N   
2395 C CA  . GLY A 322 ? 1.1073 1.5467 1.2694 -0.0142 0.2769  -0.1083 366 GLY A CA  
2396 C C   . GLY A 322 ? 1.0963 1.5345 1.2702 -0.0215 0.2415  -0.0985 366 GLY A C   
2397 O O   . GLY A 322 ? 1.0954 1.5492 1.2851 -0.0500 0.2338  -0.0945 366 GLY A O   
2398 N N   . GLY A 323 ? 0.6477 1.0668 0.8143 0.0050  0.2224  -0.0948 367 GLY A N   
2399 C CA  . GLY A 323 ? 0.6373 1.0739 0.8274 0.0067  0.1925  -0.0887 367 GLY A CA  
2400 C C   . GLY A 323 ? 0.6284 1.0287 0.7934 -0.0240 0.1760  -0.0785 367 GLY A C   
2401 O O   . GLY A 323 ? 0.6646 1.0085 0.7856 -0.0275 0.1680  -0.0697 367 GLY A O   
2402 N N   . GLU A 324 ? 0.8810 1.3178 1.0802 -0.0441 0.1687  -0.0802 368 GLU A N   
2403 C CA  . GLU A 324 ? 0.8733 1.2791 1.0549 -0.0730 0.1568  -0.0710 368 GLU A CA  
2404 C C   . GLU A 324 ? 0.8375 1.2657 1.0473 -0.0700 0.1326  -0.0720 368 GLU A C   
2405 O O   . GLU A 324 ? 0.8016 1.2855 1.0561 -0.0660 0.1292  -0.0829 368 GLU A O   
2406 C CB  . GLU A 324 ? 0.8650 1.2772 1.0500 -0.1046 0.1751  -0.0714 368 GLU A CB  
2407 C CG  . GLU A 324 ? 0.8275 1.3086 1.0688 -0.1081 0.1894  -0.0849 368 GLU A CG  
2408 C CD  . GLU A 324 ? 0.8491 1.3408 1.0858 -0.1143 0.2231  -0.0893 368 GLU A CD  
2409 O OE1 . GLU A 324 ? 0.8530 1.2919 1.0350 -0.1234 0.2350  -0.0812 368 GLU A OE1 
2410 O OE2 . GLU A 324 ? 0.8630 1.4187 1.1509 -0.1097 0.2380  -0.1014 368 GLU A OE2 
2411 N N   . THR A 325 ? 0.5018 0.8879 0.6843 -0.0711 0.1161  -0.0615 369 THR A N   
2412 C CA  . THR A 325 ? 0.4768 0.8719 0.6743 -0.0684 0.0953  -0.0618 369 THR A CA  
2413 C C   . THR A 325 ? 0.4771 0.8326 0.6564 -0.0919 0.0892  -0.0519 369 THR A C   
2414 O O   . THR A 325 ? 0.5012 0.8180 0.6496 -0.1022 0.0947  -0.0415 369 THR A O   
2415 C CB  . THR A 325 ? 0.4955 0.8792 0.6787 -0.0398 0.0837  -0.0572 369 THR A CB  
2416 O OG1 . THR A 325 ? 0.4757 0.8692 0.6693 -0.0379 0.0662  -0.0585 369 THR A OG1 
2417 C CG2 . THR A 325 ? 0.5371 0.8645 0.6787 -0.0407 0.0855  -0.0445 369 THR A CG2 
2418 N N   . ASP A 326 ? 0.5489 0.9137 0.7468 -0.1003 0.0778  -0.0559 370 ASP A N   
2419 C CA  . ASP A 326 ? 0.5529 0.8789 0.7368 -0.1186 0.0731  -0.0460 370 ASP A CA  
2420 C C   . ASP A 326 ? 0.5629 0.8637 0.7306 -0.1039 0.0592  -0.0374 370 ASP A C   
2421 O O   . ASP A 326 ? 0.5656 0.8400 0.7281 -0.1123 0.0530  -0.0298 370 ASP A O   
2422 C CB  . ASP A 326 ? 0.5354 0.8753 0.7458 -0.1379 0.0719  -0.0555 370 ASP A CB  
2423 C CG  . ASP A 326 ? 0.5284 0.8868 0.7545 -0.1599 0.0893  -0.0606 370 ASP A CG  
2424 O OD1 . ASP A 326 ? 0.5434 0.8910 0.7504 -0.1632 0.1034  -0.0528 370 ASP A OD1 
2425 O OD2 . ASP A 326 ? 0.5122 0.8960 0.7690 -0.1760 0.0905  -0.0735 370 ASP A OD2 
2426 N N   . PHE A 327 ? 0.5311 0.8404 0.6926 -0.0809 0.0561  -0.0380 371 PHE A N   
2427 C CA  . PHE A 327 ? 0.5416 0.8321 0.6906 -0.0675 0.0461  -0.0304 371 PHE A CA  
2428 C C   . PHE A 327 ? 0.5534 0.8035 0.6824 -0.0780 0.0445  -0.0150 371 PHE A C   
2429 O O   . PHE A 327 ? 0.5712 0.8025 0.6806 -0.0836 0.0495  -0.0086 371 PHE A O   
2430 C CB  . PHE A 327 ? 0.5608 0.8582 0.7003 -0.0424 0.0461  -0.0299 371 PHE A CB  
2431 C CG  . PHE A 327 ? 0.5750 0.8538 0.7015 -0.0307 0.0392  -0.0213 371 PHE A CG  
2432 C CD1 . PHE A 327 ? 0.5694 0.8676 0.7028 -0.0186 0.0315  -0.0271 371 PHE A CD1 
2433 C CD2 . PHE A 327 ? 0.5962 0.8395 0.7032 -0.0344 0.0408  -0.0080 371 PHE A CD2 
2434 C CE1 . PHE A 327 ? 0.5865 0.8673 0.7055 -0.0085 0.0292  -0.0184 371 PHE A CE1 
2435 C CE2 . PHE A 327 ? 0.6061 0.8362 0.7062 -0.0262 0.0376  0.0004  371 PHE A CE2 
2436 C CZ  . PHE A 327 ? 0.6019 0.8501 0.7071 -0.0124 0.0336  -0.0042 371 PHE A CZ  
2437 N N   . THR A 328 ? 0.5275 0.7666 0.6618 -0.0798 0.0369  -0.0103 372 THR A N   
2438 C CA  . THR A 328 ? 0.5308 0.7409 0.6558 -0.0897 0.0328  0.0043  372 THR A CA  
2439 C C   . THR A 328 ? 0.5307 0.7337 0.6602 -0.0793 0.0267  0.0114  372 THR A C   
2440 O O   . THR A 328 ? 0.5311 0.7424 0.6738 -0.0724 0.0254  0.0053  372 THR A O   
2441 C CB  . THR A 328 ? 0.5286 0.7285 0.6600 -0.1070 0.0331  0.0066  372 THR A CB  
2442 O OG1 . THR A 328 ? 0.5301 0.7353 0.6548 -0.1195 0.0425  0.0025  372 THR A OG1 
2443 C CG2 . THR A 328 ? 0.5356 0.7084 0.6586 -0.1130 0.0253  0.0244  372 THR A CG2 
2444 N N   . ASN A 329 ? 0.5478 0.7360 0.6661 -0.0797 0.0241  0.0230  373 ASN A N   
2445 C CA  . ASN A 329 ? 0.5411 0.7251 0.6697 -0.0749 0.0198  0.0322  373 ASN A CA  
2446 C C   . ASN A 329 ? 0.5339 0.7094 0.6753 -0.0838 0.0131  0.0409  373 ASN A C   
2447 O O   . ASN A 329 ? 0.5362 0.6995 0.6679 -0.0963 0.0072  0.0498  373 ASN A O   
2448 C CB  . ASN A 329 ? 0.5467 0.7198 0.6640 -0.0770 0.0187  0.0412  373 ASN A CB  
2449 C CG  . ASN A 329 ? 0.5377 0.7147 0.6708 -0.0708 0.0187  0.0493  373 ASN A CG  
2450 O OD1 . ASN A 329 ? 0.5250 0.7096 0.6791 -0.0672 0.0171  0.0520  373 ASN A OD1 
2451 N ND2 . ASN A 329 ? 0.5516 0.7211 0.6748 -0.0693 0.0230  0.0532  373 ASN A ND2 
2452 N N   . VAL A 330 ? 0.4857 0.6650 0.6457 -0.0755 0.0141  0.0388  374 VAL A N   
2453 C CA  . VAL A 330 ? 0.4927 0.6605 0.6666 -0.0790 0.0084  0.0489  374 VAL A CA  
2454 C C   . VAL A 330 ? 0.4801 0.6540 0.6678 -0.0743 0.0034  0.0625  374 VAL A C   
2455 O O   . VAL A 330 ? 0.4766 0.6613 0.6802 -0.0620 0.0095  0.0611  374 VAL A O   
2456 C CB  . VAL A 330 ? 0.5152 0.6804 0.7029 -0.0710 0.0140  0.0383  374 VAL A CB  
2457 C CG1 . VAL A 330 ? 0.5383 0.6863 0.7420 -0.0695 0.0101  0.0498  374 VAL A CG1 
2458 C CG2 . VAL A 330 ? 0.5266 0.6924 0.7056 -0.0794 0.0182  0.0229  374 VAL A CG2 
2459 N N   . THR A 331 ? 0.5570 0.7255 0.7385 -0.0857 -0.0076 0.0755  375 THR A N   
2460 C CA  . THR A 331 ? 0.5441 0.7234 0.7369 -0.0877 -0.0142 0.0858  375 THR A CA  
2461 C C   . THR A 331 ? 0.5468 0.7375 0.7747 -0.0792 -0.0203 0.0980  375 THR A C   
2462 O O   . THR A 331 ? 0.5314 0.7406 0.7815 -0.0785 -0.0227 0.1052  375 THR A O   
2463 C CB  . THR A 331 ? 0.5497 0.7202 0.7176 -0.1051 -0.0249 0.0909  375 THR A CB  
2464 O OG1 . THR A 331 ? 0.5724 0.7294 0.7253 -0.1135 -0.0347 0.0982  375 THR A OG1 
2465 C CG2 . THR A 331 ? 0.5533 0.7151 0.6934 -0.1073 -0.0140 0.0777  375 THR A CG2 
2466 N N   . SER A 332 ? 0.5483 0.7280 0.7840 -0.0719 -0.0205 0.0995  376 SER A N   
2467 C CA  . SER A 332 ? 0.5659 0.7535 0.8362 -0.0591 -0.0250 0.1115  376 SER A CA  
2468 C C   . SER A 332 ? 0.5640 0.7610 0.8588 -0.0404 -0.0082 0.1021  376 SER A C   
2469 O O   . SER A 332 ? 0.5819 0.7846 0.9082 -0.0256 -0.0077 0.1098  376 SER A O   
2470 C CB  . SER A 332 ? 0.6160 0.7791 0.8804 -0.0587 -0.0333 0.1212  376 SER A CB  
2471 O OG  . SER A 332 ? 0.6366 0.7766 0.8860 -0.0582 -0.0204 0.1067  376 SER A OG  
2472 N N   . LEU A 333 ? 0.4118 0.6095 0.6903 -0.0389 0.0057  0.0856  377 LEU A N   
2473 C CA  . LEU A 333 ? 0.4132 0.6218 0.7067 -0.0227 0.0220  0.0773  377 LEU A CA  
2474 C C   . LEU A 333 ? 0.3963 0.6129 0.6684 -0.0237 0.0323  0.0677  377 LEU A C   
2475 O O   . LEU A 333 ? 0.4013 0.6084 0.6443 -0.0296 0.0313  0.0573  377 LEU A O   
2476 C CB  . LEU A 333 ? 0.4579 0.6468 0.7505 -0.0112 0.0304  0.0642  377 LEU A CB  
2477 C CG  . LEU A 333 ? 0.4660 0.6643 0.7717 0.0072  0.0485  0.0554  377 LEU A CG  
2478 C CD1 . LEU A 333 ? 0.4446 0.6658 0.7920 0.0173  0.0501  0.0723  377 LEU A CD1 
2479 C CD2 . LEU A 333 ? 0.5221 0.6946 0.8208 0.0169  0.0572  0.0381  377 LEU A CD2 
2480 N N   . ARG A 334 ? 0.4802 0.7144 0.7672 -0.0161 0.0439  0.0715  378 ARG A N   
2481 C CA  . ARG A 334 ? 0.4772 0.7148 0.7419 -0.0164 0.0544  0.0679  378 ARG A CA  
2482 C C   . ARG A 334 ? 0.5075 0.7352 0.7410 -0.0062 0.0622  0.0501  378 ARG A C   
2483 O O   . ARG A 334 ? 0.5309 0.7550 0.7677 0.0048  0.0686  0.0393  378 ARG A O   
2484 C CB  . ARG A 334 ? 0.4644 0.7219 0.7542 -0.0113 0.0687  0.0773  378 ARG A CB  
2485 C CG  . ARG A 334 ? 0.4770 0.7337 0.7423 -0.0073 0.0858  0.0757  378 ARG A CG  
2486 C CD  . ARG A 334 ? 0.4633 0.7423 0.7608 -0.0055 0.1026  0.0869  378 ARG A CD  
2487 N NE  . ARG A 334 ? 0.4745 0.7621 0.7856 0.0136  0.1183  0.0797  378 ARG A NE  
2488 C CZ  . ARG A 334 ? 0.5037 0.7850 0.7851 0.0269  0.1378  0.0708  378 ARG A CZ  
2489 N NH1 . ARG A 334 ? 0.5239 0.7920 0.7635 0.0240  0.1416  0.0714  378 ARG A NH1 
2490 N NH2 . ARG A 334 ? 0.5187 0.8042 0.8083 0.0442  0.1536  0.0614  378 ARG A NH2 
2491 N N   . GLY A 335 ? 0.5210 0.7441 0.7244 -0.0095 0.0606  0.0465  379 GLY A N   
2492 C CA  . GLY A 335 ? 0.5517 0.7727 0.7255 0.0001  0.0635  0.0311  379 GLY A CA  
2493 C C   . GLY A 335 ? 0.5629 0.7801 0.7298 -0.0054 0.0523  0.0170  379 GLY A C   
2494 O O   . GLY A 335 ? 0.5865 0.8090 0.7327 0.0006  0.0511  0.0035  379 GLY A O   
2495 N N   . VAL A 336 ? 0.5021 0.7118 0.6861 -0.0171 0.0440  0.0206  380 VAL A N   
2496 C CA  . VAL A 336 ? 0.5189 0.7228 0.7001 -0.0247 0.0377  0.0076  380 VAL A CA  
2497 C C   . VAL A 336 ? 0.5019 0.7081 0.6727 -0.0366 0.0306  0.0081  380 VAL A C   
2498 O O   . VAL A 336 ? 0.4795 0.6797 0.6512 -0.0456 0.0266  0.0213  380 VAL A O   
2499 C CB  . VAL A 336 ? 0.5288 0.7164 0.7303 -0.0296 0.0357  0.0113  380 VAL A CB  
2500 C CG1 . VAL A 336 ? 0.5509 0.7276 0.7481 -0.0415 0.0320  -0.0008 380 VAL A CG1 
2501 C CG2 . VAL A 336 ? 0.5540 0.7380 0.7679 -0.0150 0.0455  0.0078  380 VAL A CG2 
2502 N N   . TYR A 337 ? 0.5032 0.7206 0.6645 -0.0366 0.0293  -0.0074 381 TYR A N   
2503 C CA  . TYR A 337 ? 0.4856 0.7103 0.6414 -0.0454 0.0260  -0.0091 381 TYR A CA  
2504 C C   . TYR A 337 ? 0.4906 0.7243 0.6543 -0.0551 0.0241  -0.0262 381 TYR A C   
2505 O O   . TYR A 337 ? 0.5122 0.7527 0.6772 -0.0505 0.0233  -0.0410 381 TYR A O   
2506 C CB  . TYR A 337 ? 0.4859 0.7240 0.6259 -0.0323 0.0270  -0.0090 381 TYR A CB  
2507 C CG  . TYR A 337 ? 0.4876 0.7127 0.6191 -0.0263 0.0310  0.0069  381 TYR A CG  
2508 C CD1 . TYR A 337 ? 0.4980 0.7211 0.6287 -0.0161 0.0364  0.0112  381 TYR A CD1 
2509 C CD2 . TYR A 337 ? 0.4842 0.6979 0.6077 -0.0327 0.0313  0.0164  381 TYR A CD2 
2510 C CE1 . TYR A 337 ? 0.4969 0.7101 0.6241 -0.0146 0.0421  0.0259  381 TYR A CE1 
2511 C CE2 . TYR A 337 ? 0.4906 0.6909 0.6080 -0.0318 0.0348  0.0290  381 TYR A CE2 
2512 C CZ  . TYR A 337 ? 0.4936 0.6951 0.6152 -0.0237 0.0403  0.0345  381 TYR A CZ  
2513 O OH  . TYR A 337 ? 0.4983 0.6878 0.6178 -0.0268 0.0457  0.0476  381 TYR A OH  
2514 N N   . ILE A 338 ? 0.5565 0.7893 0.7243 -0.0705 0.0246  -0.0252 382 ILE A N   
2515 C CA  . ILE A 338 ? 0.5548 0.8007 0.7340 -0.0835 0.0250  -0.0415 382 ILE A CA  
2516 C C   . ILE A 338 ? 0.5311 0.8054 0.7120 -0.0847 0.0267  -0.0463 382 ILE A C   
2517 O O   . ILE A 338 ? 0.5244 0.7941 0.6940 -0.0804 0.0296  -0.0348 382 ILE A O   
2518 C CB  . ILE A 338 ? 0.5660 0.7847 0.7521 -0.1028 0.0284  -0.0370 382 ILE A CB  
2519 C CG1 . ILE A 338 ? 0.5542 0.7608 0.7306 -0.1123 0.0313  -0.0202 382 ILE A CG1 
2520 C CG2 . ILE A 338 ? 0.5975 0.7874 0.7850 -0.0967 0.0275  -0.0305 382 ILE A CG2 
2521 C CD1 . ILE A 338 ? 0.5652 0.7534 0.7440 -0.1348 0.0374  -0.0177 382 ILE A CD1 
2522 N N   . THR A 339 ? 0.4644 0.7698 0.6609 -0.0897 0.0248  -0.0645 383 THR A N   
2523 C CA  . THR A 339 ? 0.4425 0.7805 0.6493 -0.0908 0.0285  -0.0690 383 THR A CA  
2524 C C   . THR A 339 ? 0.4295 0.8025 0.6643 -0.1069 0.0278  -0.0887 383 THR A C   
2525 O O   . THR A 339 ? 0.4424 0.8085 0.6847 -0.1194 0.0239  -0.1003 383 THR A O   
2526 C CB  . THR A 339 ? 0.4442 0.8022 0.6410 -0.0640 0.0246  -0.0666 383 THR A CB  
2527 O OG1 . THR A 339 ? 0.4316 0.8124 0.6369 -0.0616 0.0317  -0.0673 383 THR A OG1 
2528 C CG2 . THR A 339 ? 0.4521 0.8390 0.6522 -0.0498 0.0127  -0.0800 383 THR A CG2 
2529 N N   . SER A 340 ? 0.5382 0.9491 0.7900 -0.1065 0.0325  -0.0936 384 SER A N   
2530 C CA  . SER A 340 ? 0.5196 0.9742 0.8062 -0.1238 0.0326  -0.1126 384 SER A CA  
2531 C C   . SER A 340 ? 0.5091 1.0192 0.8120 -0.1035 0.0187  -0.1260 384 SER A C   
2532 O O   . SER A 340 ? 0.5110 1.0302 0.8023 -0.0759 0.0165  -0.1173 384 SER A O   
2533 C CB  . SER A 340 ? 0.5033 0.9688 0.8050 -0.1408 0.0506  -0.1091 384 SER A CB  
2534 O OG  . SER A 340 ? 0.5167 0.9328 0.8028 -0.1634 0.0613  -0.0977 384 SER A OG  
2535 N N   . VAL A 341 ? 0.3110 0.8548 0.6383 -0.1171 0.0080  -0.1469 385 VAL A N   
2536 C CA  . VAL A 341 ? 0.3094 0.9163 0.6570 -0.1004 -0.0086 -0.1609 385 VAL A CA  
2537 C C   . VAL A 341 ? 0.3144 0.9787 0.7126 -0.1253 -0.0076 -0.1798 385 VAL A C   
2538 O O   . VAL A 341 ? 0.3257 0.9746 0.7389 -0.1601 0.0031  -0.1868 385 VAL A O   
2539 C CB  . VAL A 341 ? 0.3253 0.9301 0.6530 -0.0919 -0.0284 -0.1724 385 VAL A CB  
2540 C CG1 . VAL A 341 ? 0.3386 0.8952 0.6201 -0.0657 -0.0277 -0.1534 385 VAL A CG1 
2541 C CG2 . VAL A 341 ? 0.3428 0.9255 0.6762 -0.1250 -0.0284 -0.1895 385 VAL A CG2 
2542 N N   . LEU A 342 ? 0.5167 1.2491 0.9439 -0.1072 -0.0183 -0.1872 386 LEU A N   
2543 C CA  . LEU A 342 ? 0.5013 1.2740 0.9682 -0.1251 -0.0166 -0.1989 386 LEU A CA  
2544 C C   . LEU A 342 ? 0.5150 1.3183 0.9889 -0.1291 -0.0428 -0.2194 386 LEU A C   
2545 O O   . LEU A 342 ? 0.5214 1.3501 0.9819 -0.1009 -0.0644 -0.2217 386 LEU A O   
2546 C CB  . LEU A 342 ? 0.4849 1.2959 0.9739 -0.1018 -0.0071 -0.1893 386 LEU A CB  
2547 C CG  . LEU A 342 ? 0.4843 1.3440 1.0191 -0.1145 -0.0043 -0.1986 386 LEU A CG  
2548 C CD1 . LEU A 342 ? 0.4982 1.3323 1.0453 -0.1584 0.0144  -0.2028 386 LEU A CD1 
2549 C CD2 . LEU A 342 ? 0.4782 1.3714 1.0334 -0.0867 0.0084  -0.1883 386 LEU A CD2 
2550 N N   . SER A 343 ? 0.6143 1.4098 1.1041 -0.1650 -0.0408 -0.2340 387 SER A N   
2551 C CA  . SER A 343 ? 0.6371 1.4553 1.1296 -0.1736 -0.0647 -0.2560 387 SER A CA  
2552 C C   . SER A 343 ? 0.6493 1.5360 1.1821 -0.1686 -0.0761 -0.2630 387 SER A C   
2553 O O   . SER A 343 ? 0.6365 1.5506 1.1970 -0.1590 -0.0627 -0.2511 387 SER A O   
2554 C CB  . SER A 343 ? 0.6640 1.4378 1.1537 -0.2147 -0.0578 -0.2702 387 SER A CB  
2555 O OG  . SER A 343 ? 0.6907 1.4731 1.1684 -0.2204 -0.0817 -0.2935 387 SER A OG  
2556 N N   . GLU A 344 ? 0.8112 1.7256 1.3471 -0.1755 -0.1007 -0.2831 388 GLU A N   
2557 C CA  . GLU A 344 ? 0.8316 1.8161 1.4082 -0.1723 -0.1165 -0.2913 388 GLU A CA  
2558 C C   . GLU A 344 ? 0.8461 1.8443 1.4699 -0.2087 -0.0992 -0.2967 388 GLU A C   
2559 O O   . GLU A 344 ? 0.8482 1.9005 1.5153 -0.2018 -0.0963 -0.2923 388 GLU A O   
2560 C CB  . GLU A 344 ? 0.8682 1.8733 1.4290 -0.1730 -0.1486 -0.3120 388 GLU A CB  
2561 C CG  . GLU A 344 ? 0.8636 1.8604 1.3749 -0.1352 -0.1668 -0.3060 388 GLU A CG  
2562 C CD  . GLU A 344 ? 0.8468 1.8846 1.3653 -0.0906 -0.1727 -0.2858 388 GLU A CD  
2563 O OE1 . GLU A 344 ? 0.8534 1.9466 1.4182 -0.0865 -0.1758 -0.2845 388 GLU A OE1 
2564 O OE2 . GLU A 344 ? 0.8311 1.8443 1.3092 -0.0589 -0.1735 -0.2708 388 GLU A OE2 
2565 N N   . ASP A 345 ? 0.9606 1.9067 1.5751 -0.2462 -0.0858 -0.3046 389 ASP A N   
2566 C CA  . ASP A 345 ? 0.9831 1.9272 1.6342 -0.2841 -0.0651 -0.3068 389 ASP A CA  
2567 C C   . ASP A 345 ? 0.9557 1.8894 1.6172 -0.2785 -0.0341 -0.2839 389 ASP A C   
2568 O O   . ASP A 345 ? 0.9734 1.8938 1.6552 -0.3079 -0.0113 -0.2804 389 ASP A O   
2569 C CB  . ASP A 345 ? 1.0161 1.8969 1.6477 -0.3231 -0.0588 -0.3195 389 ASP A CB  
2570 C CG  . ASP A 345 ? 0.9958 1.8029 1.5753 -0.3152 -0.0513 -0.3115 389 ASP A CG  
2571 O OD1 . ASP A 345 ? 0.9578 1.7450 1.5233 -0.2963 -0.0351 -0.2898 389 ASP A OD1 
2572 O OD2 . ASP A 345 ? 1.0247 1.7940 1.5778 -0.3284 -0.0617 -0.3281 389 ASP A OD2 
2573 N N   . ASN A 346 ? 0.7938 1.7255 1.4340 -0.2416 -0.0326 -0.2681 390 ASN A N   
2574 C CA  . ASN A 346 ? 0.7698 1.6925 1.4128 -0.2303 -0.0055 -0.2475 390 ASN A CA  
2575 C C   . ASN A 346 ? 0.7692 1.6193 1.3843 -0.2544 0.0207  -0.2361 390 ASN A C   
2576 O O   . ASN A 346 ? 0.7730 1.6156 1.3989 -0.2657 0.0470  -0.2245 390 ASN A O   
2577 C CB  . ASN A 346 ? 0.7828 1.7675 1.4791 -0.2313 0.0046  -0.2469 390 ASN A CB  
2578 C CG  . ASN A 346 ? 0.7574 1.7660 1.4575 -0.1924 0.0138  -0.2317 390 ASN A CG  
2579 O OD1 . ASN A 346 ? 0.7366 1.7437 1.4112 -0.1575 -0.0013 -0.2266 390 ASN A OD1 
2580 N ND2 . ASN A 346 ? 0.7641 1.7915 1.4936 -0.1975 0.0405  -0.2239 390 ASN A ND2 
2581 N N   . SER A 347 ? 0.5057 1.3022 1.0828 -0.2604 0.0131  -0.2389 391 SER A N   
2582 C CA  . SER A 347 ? 0.5109 1.2349 1.0590 -0.2809 0.0332  -0.2274 391 SER A CA  
2583 C C   . SER A 347 ? 0.4796 1.1708 0.9884 -0.2549 0.0296  -0.2158 391 SER A C   
2584 O O   . SER A 347 ? 0.4607 1.1820 0.9637 -0.2247 0.0113  -0.2187 391 SER A O   
2585 C CB  . SER A 347 ? 0.5482 1.2349 1.0912 -0.3136 0.0284  -0.2424 391 SER A CB  
2586 O OG  . SER A 347 ? 0.5481 1.2444 1.0779 -0.3013 0.0018  -0.2597 391 SER A OG  
2587 N N   . ILE A 348 ? 0.4858 1.1169 0.9677 -0.2658 0.0476  -0.2003 392 ILE A N   
2588 C CA  . ILE A 348 ? 0.4762 1.0791 0.9256 -0.2438 0.0458  -0.1878 392 ILE A CA  
2589 C C   . ILE A 348 ? 0.5023 1.0489 0.9262 -0.2557 0.0410  -0.1906 392 ILE A C   
2590 O O   . ILE A 348 ? 0.5268 1.0266 0.9458 -0.2836 0.0522  -0.1894 392 ILE A O   
2591 C CB  . ILE A 348 ? 0.4678 1.0535 0.9047 -0.2392 0.0685  -0.1659 392 ILE A CB  
2592 C CG1 . ILE A 348 ? 0.4518 1.0951 0.9170 -0.2253 0.0748  -0.1669 392 ILE A CG1 
2593 C CG2 . ILE A 348 ? 0.4719 1.0298 0.8742 -0.2139 0.0644  -0.1520 392 ILE A CG2 
2594 C CD1 . ILE A 348 ? 0.4580 1.0882 0.9216 -0.2381 0.1033  -0.1534 392 ILE A CD1 
2595 N N   . GLN A 349 ? 0.6002 1.1428 1.0017 -0.2294 0.0246  -0.1917 393 GLN A N   
2596 C CA  . GLN A 349 ? 0.6445 1.1224 1.0113 -0.2281 0.0204  -0.1897 393 GLN A CA  
2597 C C   . GLN A 349 ? 0.6589 1.0993 0.9878 -0.1972 0.0209  -0.1661 393 GLN A C   
2598 O O   . GLN A 349 ? 0.6444 1.1124 0.9667 -0.1698 0.0145  -0.1594 393 GLN A O   
2599 C CB  . GLN A 349 ? 0.6678 1.1657 1.0361 -0.2276 0.0002  -0.2162 393 GLN A CB  
2600 C CG  . GLN A 349 ? 0.6563 1.1957 1.0663 -0.2620 -0.0016 -0.2407 393 GLN A CG  
2601 C CD  . GLN A 349 ? 0.6514 1.2378 1.0669 -0.2536 -0.0258 -0.2635 393 GLN A CD  
2602 O OE1 . GLN A 349 ? 0.6212 1.2274 1.0173 -0.2252 -0.0426 -0.2663 393 GLN A OE1 
2603 N NE2 . GLN A 349 ? 0.6941 1.2961 1.1317 -0.2772 -0.0285 -0.2786 393 GLN A NE2 
2604 N N   . THR A 350 ? 0.4811 0.8578 0.7871 -0.2023 0.0290  -0.1527 394 THR A N   
2605 C CA  . THR A 350 ? 0.4955 0.8392 0.7707 -0.1763 0.0282  -0.1317 394 THR A CA  
2606 C C   . THR A 350 ? 0.5310 0.8679 0.7903 -0.1580 0.0162  -0.1417 394 THR A C   
2607 O O   . THR A 350 ? 0.5658 0.8898 0.8274 -0.1704 0.0130  -0.1603 394 THR A O   
2608 C CB  . THR A 350 ? 0.5149 0.7997 0.7743 -0.1851 0.0395  -0.1106 394 THR A CB  
2609 O OG1 . THR A 350 ? 0.4929 0.7811 0.7592 -0.2030 0.0524  -0.1006 394 THR A OG1 
2610 C CG2 . THR A 350 ? 0.5212 0.7847 0.7563 -0.1594 0.0364  -0.0900 394 THR A CG2 
2611 N N   . MET A 351 ? 0.5807 0.9240 0.8217 -0.1298 0.0114  -0.1301 395 MET A N   
2612 C CA  . MET A 351 ? 0.6205 0.9531 0.8399 -0.1099 0.0045  -0.1342 395 MET A CA  
2613 C C   . MET A 351 ? 0.6278 0.9245 0.8294 -0.0946 0.0114  -0.1099 395 MET A C   
2614 O O   . MET A 351 ? 0.5970 0.8891 0.7977 -0.0928 0.0162  -0.0911 395 MET A O   
2615 C CB  . MET A 351 ? 0.6137 0.9921 0.8267 -0.0895 -0.0077 -0.1416 395 MET A CB  
2616 C CG  . MET A 351 ? 0.5987 1.0288 0.8350 -0.1015 -0.0194 -0.1654 395 MET A CG  
2617 S SD  . MET A 351 ? 0.6572 1.0846 0.8818 -0.1099 -0.0315 -0.1957 395 MET A SD  
2618 C CE  . MET A 351 ? 0.6498 1.0490 0.9017 -0.1499 -0.0201 -0.2057 395 MET A CE  
2619 N N   . ILE A 352 ? 0.4960 0.7698 0.6831 -0.0834 0.0120  -0.1121 396 ILE A N   
2620 C CA  . ILE A 352 ? 0.4999 0.7476 0.6771 -0.0691 0.0183  -0.0911 396 ILE A CA  
2621 C C   . ILE A 352 ? 0.5278 0.7832 0.6850 -0.0470 0.0176  -0.0941 396 ILE A C   
2622 O O   . ILE A 352 ? 0.5719 0.8348 0.7188 -0.0447 0.0137  -0.1146 396 ILE A O   
2623 C CB  . ILE A 352 ? 0.5320 0.7377 0.7171 -0.0781 0.0253  -0.0866 396 ILE A CB  
2624 C CG1 . ILE A 352 ? 0.5330 0.7194 0.7164 -0.0630 0.0302  -0.0650 396 ILE A CG1 
2625 C CG2 . ILE A 352 ? 0.5942 0.7858 0.7777 -0.0840 0.0261  -0.1115 396 ILE A CG2 
2626 C CD1 . ILE A 352 ? 0.5549 0.7046 0.7501 -0.0699 0.0342  -0.0538 396 ILE A CD1 
2627 N N   . THR A 353 ? 0.5350 0.7877 0.6839 -0.0327 0.0217  -0.0742 397 THR A N   
2628 C CA  . THR A 353 ? 0.5571 0.8110 0.6857 -0.0131 0.0259  -0.0718 397 THR A CA  
2629 C C   . THR A 353 ? 0.5526 0.7830 0.6902 -0.0096 0.0363  -0.0549 397 THR A C   
2630 O O   . THR A 353 ? 0.5212 0.7440 0.6732 -0.0174 0.0360  -0.0383 397 THR A O   
2631 C CB  . THR A 353 ? 0.5391 0.8125 0.6508 0.0007  0.0229  -0.0620 397 THR A CB  
2632 O OG1 . THR A 353 ? 0.5642 0.8336 0.6518 0.0182  0.0298  -0.0577 397 THR A OG1 
2633 C CG2 . THR A 353 ? 0.5000 0.7658 0.6205 -0.0035 0.0255  -0.0419 397 THR A CG2 
2634 N N   . PHE A 354 ? 0.5687 0.7892 0.6995 0.0013  0.0454  -0.0603 398 PHE A N   
2635 C CA  . PHE A 354 ? 0.5585 0.7659 0.7047 0.0078  0.0567  -0.0439 398 PHE A CA  
2636 C C   . PHE A 354 ? 0.5450 0.7624 0.6783 0.0208  0.0659  -0.0311 398 PHE A C   
2637 O O   . PHE A 354 ? 0.5221 0.7374 0.6732 0.0238  0.0749  -0.0155 398 PHE A O   
2638 C CB  . PHE A 354 ? 0.5995 0.7883 0.7511 0.0133  0.0659  -0.0569 398 PHE A CB  
2639 C CG  . PHE A 354 ? 0.6282 0.7976 0.7912 -0.0004 0.0599  -0.0683 398 PHE A CG  
2640 C CD1 . PHE A 354 ? 0.6114 0.7666 0.7987 -0.0093 0.0566  -0.0519 398 PHE A CD1 
2641 C CD2 . PHE A 354 ? 0.6790 0.8433 0.8260 -0.0065 0.0567  -0.0953 398 PHE A CD2 
2642 C CE1 . PHE A 354 ? 0.6484 0.7794 0.8427 -0.0232 0.0533  -0.0597 398 PHE A CE1 
2643 C CE2 . PHE A 354 ? 0.7172 0.8594 0.8754 -0.0233 0.0532  -0.1061 398 PHE A CE2 
2644 C CZ  . PHE A 354 ? 0.7022 0.8253 0.8834 -0.0313 0.0530  -0.0870 398 PHE A CZ  
2645 N N   . ASP A 355 ? 0.6123 0.8413 0.7152 0.0287  0.0638  -0.0378 399 ASP A N   
2646 C CA  . ASP A 355 ? 0.6126 0.8455 0.6930 0.0419  0.0743  -0.0260 399 ASP A CA  
2647 C C   . ASP A 355 ? 0.5948 0.8319 0.6641 0.0424  0.0695  -0.0106 399 ASP A C   
2648 O O   . ASP A 355 ? 0.6159 0.8549 0.6538 0.0553  0.0734  -0.0064 399 ASP A O   
2649 C CB  . ASP A 355 ? 0.6554 0.8895 0.7014 0.0562  0.0820  -0.0403 399 ASP A CB  
2650 C CG  . ASP A 355 ? 0.6843 0.9307 0.7055 0.0573  0.0654  -0.0604 399 ASP A CG  
2651 O OD1 . ASP A 355 ? 0.6698 0.9260 0.7070 0.0463  0.0500  -0.0651 399 ASP A OD1 
2652 O OD2 . ASP A 355 ? 0.7217 0.9703 0.7068 0.0690  0.0684  -0.0721 399 ASP A OD2 
2653 N N   . GLN A 356 ? 0.5944 0.8310 0.6825 0.0299  0.0598  -0.0054 400 GLN A N   
2654 C CA  . GLN A 356 ? 0.5881 0.8232 0.6645 0.0313  0.0568  0.0064  400 GLN A CA  
2655 C C   . GLN A 356 ? 0.6132 0.8627 0.6639 0.0445  0.0479  -0.0034 400 GLN A C   
2656 O O   . GLN A 356 ? 0.6333 0.8789 0.6602 0.0575  0.0501  0.0070  400 GLN A O   
2657 C CB  . GLN A 356 ? 0.5919 0.8139 0.6605 0.0350  0.0707  0.0257  400 GLN A CB  
2658 C CG  . GLN A 356 ? 0.5933 0.8019 0.6551 0.0312  0.0698  0.0389  400 GLN A CG  
2659 C CD  . GLN A 356 ? 0.6032 0.7952 0.6593 0.0298  0.0851  0.0572  400 GLN A CD  
2660 O OE1 . GLN A 356 ? 0.6339 0.8194 0.6620 0.0434  0.0960  0.0638  400 GLN A OE1 
2661 N NE2 . GLN A 356 ? 0.5777 0.7631 0.6587 0.0119  0.0858  0.0659  400 GLN A NE2 
2662 N N   . GLY A 357 ? 0.5369 0.8033 0.5935 0.0412  0.0373  -0.0231 401 GLY A N   
2663 C CA  . GLY A 357 ? 0.5524 0.8428 0.5961 0.0506  0.0244  -0.0336 401 GLY A CA  
2664 C C   . GLY A 357 ? 0.5986 0.8998 0.6083 0.0681  0.0209  -0.0408 401 GLY A C   
2665 O O   . GLY A 357 ? 0.6197 0.9429 0.6150 0.0811  0.0085  -0.0443 401 GLY A O   
2666 N N   . GLY A 358 ? 0.5185 0.8055 0.5138 0.0703  0.0320  -0.0427 402 GLY A N   
2667 C CA  . GLY A 358 ? 0.5636 0.8590 0.5204 0.0846  0.0289  -0.0535 402 GLY A CA  
2668 C C   . GLY A 358 ? 0.5847 0.8987 0.5483 0.0747  0.0143  -0.0829 402 GLY A C   
2669 O O   . GLY A 358 ? 0.6193 0.9528 0.5546 0.0839  0.0012  -0.0964 402 GLY A O   
2670 N N   . ARG A 359 ? 0.7984 1.1048 0.7971 0.0550  0.0158  -0.0929 403 ARG A N   
2671 C CA  . ARG A 359 ? 0.8290 1.1462 0.8352 0.0414  0.0042  -0.1214 403 ARG A CA  
2672 C C   . ARG A 359 ? 0.7991 1.1150 0.8486 0.0196  0.0019  -0.1230 403 ARG A C   
2673 O O   . ARG A 359 ? 0.7664 1.0589 0.8359 0.0132  0.0135  -0.1082 403 ARG A O   
2674 C CB  . ARG A 359 ? 0.8603 1.1522 0.8496 0.0418  0.0164  -0.1354 403 ARG A CB  
2675 C CG  . ARG A 359 ? 0.8999 1.1907 0.8895 0.0268  0.0078  -0.1679 403 ARG A CG  
2676 C CD  . ARG A 359 ? 0.9291 1.1870 0.8948 0.0337  0.0256  -0.1796 403 ARG A CD  
2677 N NE  . ARG A 359 ? 0.9715 1.2215 0.9248 0.0208  0.0182  -0.2151 403 ARG A NE  
2678 C CZ  . ARG A 359 ? 0.9841 1.2128 0.9671 0.0001  0.0189  -0.2293 403 ARG A CZ  
2679 N NH1 . ARG A 359 ? 0.9618 1.1771 0.9858 -0.0076 0.0261  -0.2086 403 ARG A NH1 
2680 N NH2 . ARG A 359 ? 1.0188 1.2364 0.9869 -0.0137 0.0125  -0.2639 403 ARG A NH2 
2681 N N   . TRP A 360 ? 0.6015 0.9454 0.6653 0.0074  -0.0135 -0.1406 404 TRP A N   
2682 C CA  . TRP A 360 ? 0.5618 0.9034 0.6632 -0.0160 -0.0130 -0.1437 404 TRP A CA  
2683 C C   . TRP A 360 ? 0.6037 0.9411 0.7116 -0.0360 -0.0179 -0.1725 404 TRP A C   
2684 O O   . TRP A 360 ? 0.6437 0.9964 0.7308 -0.0330 -0.0284 -0.1937 404 TRP A O   
2685 C CB  . TRP A 360 ? 0.5024 0.8800 0.6233 -0.0171 -0.0217 -0.1378 404 TRP A CB  
2686 C CG  . TRP A 360 ? 0.4687 0.8415 0.5830 -0.0001 -0.0152 -0.1112 404 TRP A CG  
2687 C CD1 . TRP A 360 ? 0.4855 0.8662 0.5733 0.0244  -0.0178 -0.1001 404 TRP A CD1 
2688 C CD2 . TRP A 360 ? 0.4219 0.7772 0.5528 -0.0080 -0.0052 -0.0934 404 TRP A CD2 
2689 N NE1 . TRP A 360 ? 0.4531 0.8191 0.5424 0.0311  -0.0088 -0.0776 404 TRP A NE1 
2690 C CE2 . TRP A 360 ? 0.4154 0.7678 0.5303 0.0111  -0.0021 -0.0746 404 TRP A CE2 
2691 C CE3 . TRP A 360 ? 0.3945 0.7341 0.5481 -0.0297 0.0010  -0.0915 404 TRP A CE3 
2692 C CZ2 . TRP A 360 ? 0.3867 0.7214 0.5078 0.0075  0.0064  -0.0574 404 TRP A CZ2 
2693 C CZ3 . TRP A 360 ? 0.3637 0.6886 0.5209 -0.0319 0.0085  -0.0724 404 TRP A CZ3 
2694 C CH2 . TRP A 360 ? 0.3617 0.6846 0.5029 -0.0142 0.0107  -0.0573 404 TRP A CH2 
2695 N N   . THR A 361 ? 0.4839 0.7962 0.6169 -0.0569 -0.0101 -0.1730 405 THR A N   
2696 C CA  . THR A 361 ? 0.5253 0.8169 0.6628 -0.0775 -0.0100 -0.1986 405 THR A CA  
2697 C C   . THR A 361 ? 0.4804 0.7573 0.6504 -0.1030 -0.0040 -0.1935 405 THR A C   
2698 O O   . THR A 361 ? 0.4360 0.7127 0.6178 -0.1007 0.0015  -0.1691 405 THR A O   
2699 C CB  . THR A 361 ? 0.6018 0.8465 0.7181 -0.0672 0.0032  -0.2020 405 THR A CB  
2700 O OG1 . THR A 361 ? 0.6276 0.8419 0.7495 -0.0883 0.0057  -0.2258 405 THR A OG1 
2701 C CG2 . THR A 361 ? 0.5871 0.8021 0.7133 -0.0564 0.0182  -0.1720 405 THR A CG2 
2702 N N   . HIS A 362 ? 0.9342 1.1968 1.1152 -0.1284 -0.0044 -0.2160 406 HIS A N   
2703 C CA  . HIS A 362 ? 0.9045 1.1443 1.1110 -0.1533 0.0048  -0.2081 406 HIS A CA  
2704 C C   . HIS A 362 ? 0.9436 1.1230 1.1431 -0.1457 0.0195  -0.1889 406 HIS A C   
2705 O O   . HIS A 362 ? 1.0039 1.1561 1.1854 -0.1293 0.0238  -0.1934 406 HIS A O   
2706 C CB  . HIS A 362 ? 0.9074 1.1473 1.1293 -0.1864 0.0015  -0.2375 406 HIS A CB  
2707 C CG  . HIS A 362 ? 0.8563 1.1651 1.0991 -0.1985 -0.0136 -0.2537 406 HIS A CG  
2708 N ND1 . HIS A 362 ? 0.8627 1.2163 1.0925 -0.1848 -0.0319 -0.2718 406 HIS A ND1 
2709 C CD2 . HIS A 362 ? 0.8011 1.1448 1.0787 -0.2218 -0.0128 -0.2540 406 HIS A CD2 
2710 C CE1 . HIS A 362 ? 0.8109 1.2269 1.0702 -0.1973 -0.0443 -0.2819 406 HIS A CE1 
2711 N NE2 . HIS A 362 ? 0.7728 1.1856 1.0639 -0.2201 -0.0314 -0.2721 406 HIS A NE2 
2712 N N   . LEU A 363 ? 0.6340 0.7958 0.8473 -0.1560 0.0271  -0.1665 407 LEU A N   
2713 C CA  . LEU A 363 ? 0.6638 0.7721 0.8742 -0.1497 0.0378  -0.1453 407 LEU A CA  
2714 C C   . LEU A 363 ? 0.7186 0.7748 0.9293 -0.1654 0.0457  -0.1605 407 LEU A C   
2715 O O   . LEU A 363 ? 0.7055 0.7572 0.9270 -0.1947 0.0474  -0.1736 407 LEU A O   
2716 C CB  . LEU A 363 ? 0.6150 0.7200 0.8333 -0.1583 0.0414  -0.1175 407 LEU A CB  
2717 C CG  . LEU A 363 ? 0.5655 0.7019 0.7794 -0.1408 0.0369  -0.0966 407 LEU A CG  
2718 C CD1 . LEU A 363 ? 0.5201 0.7115 0.7387 -0.1429 0.0301  -0.1095 407 LEU A CD1 
2719 C CD2 . LEU A 363 ? 0.5444 0.6606 0.7570 -0.1472 0.0410  -0.0688 407 LEU A CD2 
2720 N N   . ARG A 364 ? 0.8645 0.8803 1.0654 -0.1463 0.0524  -0.1591 408 ARG A N   
2721 C CA  . ARG A 364 ? 0.9192 0.8750 1.1173 -0.1560 0.0622  -0.1732 408 ARG A CA  
2722 C C   . ARG A 364 ? 0.9030 0.8230 1.1115 -0.1771 0.0687  -0.1540 408 ARG A C   
2723 O O   . ARG A 364 ? 0.8709 0.7994 1.0835 -0.1719 0.0675  -0.1235 408 ARG A O   
2724 C CB  . ARG A 364 ? 0.9783 0.8993 1.1683 -0.1252 0.0710  -0.1680 408 ARG A CB  
2725 C CG  . ARG A 364 ? 1.0321 0.8862 1.2164 -0.1304 0.0829  -0.1852 408 ARG A CG  
2726 C CD  . ARG A 364 ? 1.0805 0.9069 1.2574 -0.0973 0.0940  -0.1877 408 ARG A CD  
2727 N NE  . ARG A 364 ? 1.1274 0.8868 1.2936 -0.1042 0.1064  -0.2132 408 ARG A NE  
2728 C CZ  . ARG A 364 ? 1.1662 0.8790 1.3287 -0.0776 0.1217  -0.2157 408 ARG A CZ  
2729 N NH1 . ARG A 364 ? 1.1571 0.8903 1.3309 -0.0427 0.1260  -0.1932 408 ARG A NH1 
2730 N NH2 . ARG A 364 ? 1.2095 0.8552 1.3590 -0.0862 0.1338  -0.2417 408 ARG A NH2 
2731 N N   . LYS A 365 ? 0.9271 0.8076 1.1367 -0.2039 0.0755  -0.1724 409 LYS A N   
2732 C CA  . LYS A 365 ? 0.9235 0.7628 1.1383 -0.2258 0.0848  -0.1530 409 LYS A CA  
2733 C C   . LYS A 365 ? 0.9835 0.7476 1.1896 -0.2077 0.0952  -0.1353 409 LYS A C   
2734 O O   . LYS A 365 ? 1.0281 0.7670 1.2280 -0.1870 0.0986  -0.1498 409 LYS A O   
2735 C CB  . LYS A 365 ? 0.9179 0.7503 1.1412 -0.2678 0.0891  -0.1803 409 LYS A CB  
2736 C CG  . LYS A 365 ? 0.9824 0.7509 1.1965 -0.2767 0.0973  -0.2073 409 LYS A CG  
2737 C CD  . LYS A 365 ? 0.9776 0.7326 1.2032 -0.3239 0.1032  -0.2288 409 LYS A CD  
2738 C CE  . LYS A 365 ? 1.0466 0.7136 1.2594 -0.3362 0.1161  -0.2491 409 LYS A CE  
2739 N NZ  . LYS A 365 ? 1.0822 0.6681 1.2869 -0.3337 0.1330  -0.2150 409 LYS A NZ  
2740 N N   . PRO A 366 ? 1.1039 0.8325 1.3082 -0.2134 0.1008  -0.1031 410 PRO A N   
2741 C CA  . PRO A 366 ? 1.1609 0.8146 1.3578 -0.1962 0.1096  -0.0821 410 PRO A CA  
2742 C C   . PRO A 366 ? 1.2152 0.8037 1.4069 -0.2072 0.1224  -0.1105 410 PRO A C   
2743 O O   . PRO A 366 ? 1.2064 0.7959 1.3994 -0.2430 0.1258  -0.1380 410 PRO A O   
2744 C CB  . PRO A 366 ? 1.1520 0.7818 1.3415 -0.2154 0.1136  -0.0499 410 PRO A CB  
2745 C CG  . PRO A 366 ? 1.0851 0.7897 1.2786 -0.2232 0.1038  -0.0435 410 PRO A CG  
2746 C CD  . PRO A 366 ? 1.0527 0.8124 1.2587 -0.2328 0.0990  -0.0823 410 PRO A CD  
2747 N N   . GLU A 367 ? 1.6286 1.1626 1.8163 -0.1771 0.1295  -0.1051 411 GLU A N   
2748 C CA  . GLU A 367 ? 1.6853 1.1482 1.8641 -0.1830 0.1437  -0.1342 411 GLU A CA  
2749 C C   . GLU A 367 ? 1.7058 1.1053 1.8774 -0.2223 0.1553  -0.1336 411 GLU A C   
2750 O O   . GLU A 367 ? 1.7225 1.0981 1.8902 -0.2538 0.1620  -0.1702 411 GLU A O   
2751 C CB  . GLU A 367 ? 1.7320 1.1429 1.9106 -0.1389 0.1521  -0.1204 411 GLU A CB  
2752 C CG  . GLU A 367 ? 1.7181 1.1806 1.9039 -0.1033 0.1478  -0.1312 411 GLU A CG  
2753 C CD  . GLU A 367 ? 1.7272 1.2086 1.9005 -0.1170 0.1494  -0.1804 411 GLU A CD  
2754 O OE1 . GLU A 367 ? 1.7742 1.1920 1.9331 -0.1323 0.1615  -0.2104 411 GLU A OE1 
2755 O OE2 . GLU A 367 ? 1.6897 1.2467 1.8643 -0.1131 0.1381  -0.1890 411 GLU A OE2 
2756 N N   . ASN A 368 ? 1.6709 1.0438 1.8390 -0.2220 0.1574  -0.0917 412 ASN A N   
2757 C CA  . ASN A 368 ? 1.7014 1.0021 1.8584 -0.2561 0.1724  -0.0830 412 ASN A CA  
2758 C C   . ASN A 368 ? 1.6528 0.9995 1.8149 -0.3014 0.1720  -0.0829 412 ASN A C   
2759 O O   . ASN A 368 ? 1.6770 0.9713 1.8317 -0.3366 0.1870  -0.0771 412 ASN A O   
2760 C CB  . ASN A 368 ? 1.7425 0.9754 1.8860 -0.2298 0.1773  -0.0355 412 ASN A CB  
2761 C CG  . ASN A 368 ? 1.7880 0.9770 1.9335 -0.1818 0.1797  -0.0339 412 ASN A CG  
2762 O OD1 . ASN A 368 ? 1.8099 0.9821 1.9579 -0.1770 0.1867  -0.0723 412 ASN A OD1 
2763 N ND2 . ASN A 368 ? 1.8018 0.9743 1.9461 -0.1452 0.1738  0.0101  412 ASN A ND2 
2764 N N   . SER A 369 ? 1.3868 0.8295 1.5622 -0.3008 0.1573  -0.0891 413 SER A N   
2765 C CA  . SER A 369 ? 1.3353 0.8278 1.5202 -0.3399 0.1587  -0.0907 413 SER A CA  
2766 C C   . SER A 369 ? 1.3333 0.8279 1.5329 -0.3836 0.1653  -0.1342 413 SER A C   
2767 O O   . SER A 369 ? 1.3580 0.8422 1.5591 -0.3802 0.1618  -0.1697 413 SER A O   
2768 C CB  . SER A 369 ? 1.2669 0.8574 1.4621 -0.3251 0.1423  -0.0855 413 SER A CB  
2769 O OG  . SER A 369 ? 1.2360 0.8391 1.4224 -0.3316 0.1451  -0.0502 413 SER A OG  
2770 N N   . GLU A 370 ? 1.6159 1.1314 1.8235 -0.4201 0.1719  -0.1293 414 GLU A N   
2771 C CA  . GLU A 370 ? 1.6178 1.1609 1.8403 -0.4521 0.1692  -0.1615 414 GLU A CA  
2772 C C   . GLU A 370 ? 1.5386 1.1905 1.7881 -0.4623 0.1576  -0.1734 414 GLU A C   
2773 O O   . GLU A 370 ? 1.4923 1.1841 1.7441 -0.4547 0.1585  -0.1479 414 GLU A O   
2774 C CB  . GLU A 370 ? 1.6916 1.1816 1.9045 -0.4774 0.1836  -0.1423 414 GLU A CB  
2775 C CG  . GLU A 370 ? 1.6999 1.1513 1.8904 -0.4660 0.1942  -0.0919 414 GLU A CG  
2776 C CD  . GLU A 370 ? 1.7452 1.1921 1.9340 -0.4961 0.2070  -0.0724 414 GLU A CD  
2777 O OE1 . GLU A 370 ? 1.7741 1.2411 1.9832 -0.5270 0.2093  -0.0973 414 GLU A OE1 
2778 O OE2 . GLU A 370 ? 1.7563 1.1807 1.9230 -0.4889 0.2147  -0.0320 414 GLU A OE2 
2779 N N   . CYS A 371 ? 1.1450 0.8443 1.4130 -0.4769 0.1458  -0.2117 415 CYS A N   
2780 C CA  . CYS A 371 ? 1.0813 0.8845 1.3778 -0.4834 0.1334  -0.2234 415 CYS A CA  
2781 C C   . CYS A 371 ? 1.1001 0.9235 1.4125 -0.5107 0.1445  -0.2079 415 CYS A C   
2782 O O   . CYS A 371 ? 1.1708 0.9336 1.4751 -0.5316 0.1578  -0.2007 415 CYS A O   
2783 C CB  . CYS A 371 ? 1.0828 0.9274 1.3912 -0.4891 0.1153  -0.2672 415 CYS A CB  
2784 S SG  . CYS A 371 ? 1.0737 0.9093 1.3628 -0.4561 0.1030  -0.2889 415 CYS A SG  
2785 N N   . ASP A 372 ? 1.0522 0.9596 1.3871 -0.5085 0.1402  -0.2028 416 ASP A N   
2786 C CA  . ASP A 372 ? 1.0638 0.9993 1.4163 -0.5303 0.1534  -0.1879 416 ASP A CA  
2787 C C   . ASP A 372 ? 1.0485 1.0703 1.4418 -0.5453 0.1429  -0.2144 416 ASP A C   
2788 O O   . ASP A 372 ? 1.0279 1.0873 1.4319 -0.5384 0.1229  -0.2434 416 ASP A O   
2789 C CB  . ASP A 372 ? 1.0224 0.9730 1.3635 -0.5140 0.1633  -0.1537 416 ASP A CB  
2790 C CG  . ASP A 372 ? 0.9413 0.9628 1.2919 -0.4870 0.1485  -0.1598 416 ASP A CG  
2791 O OD1 . ASP A 372 ? 0.9159 0.9879 1.2873 -0.4827 0.1304  -0.1900 416 ASP A OD1 
2792 O OD2 . ASP A 372 ? 0.9075 0.9319 1.2417 -0.4693 0.1538  -0.1343 416 ASP A OD2 
2793 N N   . ALA A 373 ? 1.0359 1.0933 1.4511 -0.5626 0.1561  -0.2027 417 ALA A N   
2794 C CA  . ALA A 373 ? 1.0328 1.1705 1.4928 -0.5794 0.1483  -0.2256 417 ALA A CA  
2795 C C   . ALA A 373 ? 0.9615 1.1878 1.4428 -0.5543 0.1253  -0.2435 417 ALA A C   
2796 O O   . ALA A 373 ? 0.9659 1.2522 1.4805 -0.5646 0.1109  -0.2682 417 ALA A O   
2797 C CB  . ALA A 373 ? 1.0554 1.2151 1.5363 -0.6001 0.1705  -0.2075 417 ALA A CB  
2798 N N   . THR A 374 ? 1.0285 1.2632 1.4906 -0.5213 0.1210  -0.2301 418 THR A N   
2799 C CA  . THR A 374 ? 0.9670 1.2754 1.4428 -0.4943 0.0989  -0.2449 418 THR A CA  
2800 C C   . THR A 374 ? 0.9748 1.2782 1.4415 -0.4893 0.0755  -0.2747 418 THR A C   
2801 O O   . THR A 374 ? 0.9439 1.3114 1.4238 -0.4731 0.0539  -0.2923 418 THR A O   
2802 C CB  . THR A 374 ? 0.9071 1.2202 1.3620 -0.4612 0.1017  -0.2219 418 THR A CB  
2803 O OG1 . THR A 374 ? 0.8582 1.2426 1.3275 -0.4352 0.0811  -0.2352 418 THR A OG1 
2804 C CG2 . THR A 374 ? 0.9045 1.1497 1.3223 -0.4494 0.1010  -0.2144 418 THR A CG2 
2805 N N   . ALA A 375 ? 0.8318 1.0558 1.2728 -0.5021 0.0802  -0.2801 419 ALA A N   
2806 C CA  . ALA A 375 ? 0.8443 1.0499 1.2670 -0.4946 0.0623  -0.3074 419 ALA A CA  
2807 C C   . ALA A 375 ? 0.9063 1.1157 1.3424 -0.5233 0.0527  -0.3378 419 ALA A C   
2808 O O   . ALA A 375 ? 0.9657 1.1337 1.4080 -0.5533 0.0671  -0.3356 419 ALA A O   
2809 C CB  . ALA A 375 ? 0.8655 0.9793 1.2512 -0.4873 0.0738  -0.2976 419 ALA A CB  
2810 N N   . LYS A 376 ? 1.1628 1.4201 1.6008 -0.5143 0.0276  -0.3657 420 LYS A N   
2811 C CA  . LYS A 376 ? 1.2232 1.4933 1.6742 -0.5419 0.0144  -0.3963 420 LYS A CA  
2812 C C   . LYS A 376 ? 1.2977 1.4758 1.7156 -0.5582 0.0195  -0.4147 420 LYS A C   
2813 O O   . LYS A 376 ? 1.3665 1.5280 1.7942 -0.5906 0.0183  -0.4334 420 LYS A O   
2814 C CB  . LYS A 376 ? 1.1970 1.5516 1.6580 -0.5258 -0.0161 -0.4180 420 LYS A CB  
2815 C CG  . LYS A 376 ? 1.2334 1.5624 1.6581 -0.5207 -0.0348 -0.4489 420 LYS A CG  
2816 C CD  . LYS A 376 ? 1.2070 1.6224 1.6372 -0.5006 -0.0655 -0.4637 420 LYS A CD  
2817 C CE  . LYS A 376 ? 1.2393 1.6283 1.6225 -0.4887 -0.0829 -0.4910 420 LYS A CE  
2818 N NZ  . LYS A 376 ? 1.2474 1.7151 1.6350 -0.4811 -0.1160 -0.5104 420 LYS A NZ  
2819 N N   . ASN A 377 ? 1.2044 1.3217 1.5847 -0.5355 0.0261  -0.4095 421 ASN A N   
2820 C CA  . ASN A 377 ? 1.2765 1.2956 1.6232 -0.5441 0.0360  -0.4226 421 ASN A CA  
2821 C C   . ASN A 377 ? 1.2806 1.2210 1.6126 -0.5371 0.0625  -0.3896 421 ASN A C   
2822 O O   . ASN A 377 ? 1.2223 1.1698 1.5481 -0.5100 0.0668  -0.3672 421 ASN A O   
2823 C CB  . ASN A 377 ? 1.2795 1.2903 1.5913 -0.5201 0.0207  -0.4490 421 ASN A CB  
2824 C CG  . ASN A 377 ? 1.3640 1.2742 1.6398 -0.5269 0.0310  -0.4682 421 ASN A CG  
2825 O OD1 . ASN A 377 ? 1.4025 1.2325 1.6713 -0.5341 0.0537  -0.4507 421 ASN A OD1 
2826 N ND2 . ASN A 377 ? 1.3994 1.3111 1.6485 -0.5221 0.0144  -0.5034 421 ASN A ND2 
2827 N N   . LYS A 378 ? 1.4188 1.2831 1.7443 -0.5614 0.0793  -0.3858 422 LYS A N   
2828 C CA  . LYS A 378 ? 1.4379 1.2207 1.7460 -0.5546 0.1034  -0.3521 422 LYS A CA  
2829 C C   . LYS A 378 ? 1.4396 1.1601 1.7138 -0.5220 0.1072  -0.3514 422 LYS A C   
2830 O O   . LYS A 378 ? 1.4221 1.1037 1.6860 -0.5031 0.1207  -0.3191 422 LYS A O   
2831 C CB  . LYS A 378 ? 1.5329 1.2436 1.8384 -0.5866 0.1192  -0.3498 422 LYS A CB  
2832 C CG  . LYS A 378 ? 1.5355 1.2886 1.8736 -0.6156 0.1269  -0.3334 422 LYS A CG  
2833 C CD  . LYS A 378 ? 1.6390 1.3266 1.9767 -0.6518 0.1401  -0.3385 422 LYS A CD  
2834 C CE  . LYS A 378 ? 1.6437 1.3808 2.0176 -0.6824 0.1490  -0.3249 422 LYS A CE  
2835 N NZ  . LYS A 378 ? 1.7482 1.4159 2.1212 -0.7187 0.1653  -0.3248 422 LYS A NZ  
2836 N N   . ASN A 379 ? 1.6096 1.3202 1.8658 -0.5150 0.0957  -0.3872 423 ASN A N   
2837 C CA  . ASN A 379 ? 1.6177 1.2713 1.8429 -0.4823 0.1013  -0.3915 423 ASN A CA  
2838 C C   . ASN A 379 ? 1.5468 1.2620 1.7748 -0.4513 0.0913  -0.3869 423 ASN A C   
2839 O O   . ASN A 379 ? 1.5579 1.2327 1.7740 -0.4234 0.1023  -0.3704 423 ASN A O   
2840 C CB  . ASN A 379 ? 1.6909 1.3032 1.8891 -0.4852 0.0960  -0.4328 423 ASN A CB  
2841 C CG  . ASN A 379 ? 1.7889 1.3208 1.9795 -0.5120 0.1088  -0.4368 423 ASN A CG  
2842 O OD1 . ASN A 379 ? 1.8407 1.3802 2.0308 -0.5386 0.0984  -0.4676 423 ASN A OD1 
2843 N ND2 . ASN A 379 ? 1.8198 1.2735 2.0037 -0.5049 0.1304  -0.4045 423 ASN A ND2 
2844 N N   . GLU A 380 ? 1.6028 1.4151 1.8481 -0.4549 0.0703  -0.4004 424 GLU A N   
2845 C CA  . GLU A 380 ? 1.5597 1.4315 1.8035 -0.4254 0.0581  -0.4009 424 GLU A CA  
2846 C C   . GLU A 380 ? 1.4816 1.4406 1.7563 -0.4230 0.0500  -0.3773 424 GLU A C   
2847 O O   . GLU A 380 ? 1.4453 1.4740 1.7410 -0.4365 0.0356  -0.3855 424 GLU A O   
2848 C CB  . GLU A 380 ? 1.5757 1.4796 1.7980 -0.4179 0.0380  -0.4406 424 GLU A CB  
2849 C CG  . GLU A 380 ? 1.6444 1.4621 1.8277 -0.4095 0.0481  -0.4650 424 GLU A CG  
2850 C CD  . GLU A 380 ? 1.6843 1.5346 1.8362 -0.3967 0.0292  -0.5015 424 GLU A CD  
2851 O OE1 . GLU A 380 ? 1.6786 1.6188 1.8410 -0.3971 0.0056  -0.5069 424 GLU A OE1 
2852 O OE2 . GLU A 380 ? 1.7270 1.5123 1.8412 -0.3836 0.0387  -0.5228 424 GLU A OE2 
2853 N N   . CYS A 381 ? 0.9551 0.9094 1.2273 -0.3961 0.0582  -0.3420 425 CYS A N   
2854 C CA  . CYS A 381 ? 0.8845 0.9116 1.1775 -0.3862 0.0527  -0.3168 425 CYS A CA  
2855 C C   . CYS A 381 ? 0.8923 0.9050 1.1628 -0.3406 0.0552  -0.2822 425 CYS A C   
2856 O O   . CYS A 381 ? 0.9508 0.9101 1.1962 -0.3181 0.0596  -0.2809 425 CYS A O   
2857 C CB  . CYS A 381 ? 0.8561 0.8767 1.1730 -0.4167 0.0685  -0.2971 425 CYS A CB  
2858 S SG  . CYS A 381 ? 0.9138 0.8225 1.2091 -0.4182 0.0939  -0.2661 425 CYS A SG  
2859 N N   . SER A 382 ? 0.8387 0.8977 1.1200 -0.3285 0.0539  -0.2550 426 SER A N   
2860 C CA  . SER A 382 ? 0.8399 0.8919 1.1034 -0.2902 0.0545  -0.2233 426 SER A CA  
2861 C C   . SER A 382 ? 0.8067 0.8540 1.0750 -0.2922 0.0648  -0.1873 426 SER A C   
2862 O O   . SER A 382 ? 0.7847 0.8338 1.0689 -0.3226 0.0745  -0.1845 426 SER A O   
2863 C CB  . SER A 382 ? 0.8128 0.9294 1.0716 -0.2629 0.0381  -0.2289 426 SER A CB  
2864 O OG  . SER A 382 ? 0.7572 0.9432 1.0400 -0.2787 0.0282  -0.2432 426 SER A OG  
2865 N N   . LEU A 383 ? 0.7731 0.8154 1.0260 -0.2605 0.0631  -0.1602 427 LEU A N   
2866 C CA  . LEU A 383 ? 0.7453 0.7831 0.9948 -0.2597 0.0698  -0.1271 427 LEU A CA  
2867 C C   . LEU A 383 ? 0.6834 0.7884 0.9399 -0.2505 0.0628  -0.1236 427 LEU A C   
2868 O O   . LEU A 383 ? 0.6722 0.8112 0.9257 -0.2274 0.0515  -0.1308 427 LEU A O   
2869 C CB  . LEU A 383 ? 0.7809 0.7734 1.0113 -0.2330 0.0703  -0.0994 427 LEU A CB  
2870 C CG  . LEU A 383 ? 0.7560 0.7481 0.9764 -0.2300 0.0725  -0.0659 427 LEU A CG  
2871 C CD1 . LEU A 383 ? 0.7684 0.7232 0.9846 -0.2594 0.0865  -0.0531 427 LEU A CD1 
2872 C CD2 . LEU A 383 ? 0.7803 0.7501 0.9880 -0.1997 0.0661  -0.0416 427 LEU A CD2 
2873 N N   . HIS A 384 ? 0.6752 0.7955 0.9388 -0.2682 0.0718  -0.1118 428 HIS A N   
2874 C CA  . HIS A 384 ? 0.6213 0.8002 0.8917 -0.2593 0.0689  -0.1085 428 HIS A CA  
2875 C C   . HIS A 384 ? 0.6158 0.7732 0.8657 -0.2558 0.0774  -0.0776 428 HIS A C   
2876 O O   . HIS A 384 ? 0.6443 0.7545 0.8823 -0.2712 0.0877  -0.0618 428 HIS A O   
2877 C CB  . HIS A 384 ? 0.5876 0.8183 0.8903 -0.2847 0.0730  -0.1302 428 HIS A CB  
2878 C CG  . HIS A 384 ? 0.5944 0.8505 0.9152 -0.2905 0.0605  -0.1625 428 HIS A CG  
2879 N ND1 . HIS A 384 ? 0.5705 0.8822 0.8979 -0.2696 0.0438  -0.1773 428 HIS A ND1 
2880 C CD2 . HIS A 384 ? 0.6282 0.8583 0.9573 -0.3152 0.0615  -0.1833 428 HIS A CD2 
2881 C CE1 . HIS A 384 ? 0.5890 0.9121 0.9266 -0.2813 0.0333  -0.2061 428 HIS A CE1 
2882 N NE2 . HIS A 384 ? 0.6233 0.8970 0.9629 -0.3102 0.0441  -0.2120 428 HIS A NE2 
2883 N N   . ILE A 385 ? 0.6068 0.7950 0.8488 -0.2357 0.0726  -0.0690 429 ILE A N   
2884 C CA  . ILE A 385 ? 0.6099 0.7756 0.8256 -0.2291 0.0762  -0.0422 429 ILE A CA  
2885 C C   . ILE A 385 ? 0.5817 0.7786 0.7971 -0.2385 0.0882  -0.0398 429 ILE A C   
2886 O O   . ILE A 385 ? 0.5483 0.7962 0.7825 -0.2315 0.0874  -0.0550 429 ILE A O   
2887 C CB  . ILE A 385 ? 0.6082 0.7742 0.8100 -0.1989 0.0625  -0.0334 429 ILE A CB  
2888 C CG1 . ILE A 385 ? 0.6454 0.7783 0.8469 -0.1884 0.0551  -0.0326 429 ILE A CG1 
2889 C CG2 . ILE A 385 ? 0.6121 0.7603 0.7872 -0.1944 0.0629  -0.0094 429 ILE A CG2 
2890 C CD1 . ILE A 385 ? 0.6893 0.7684 0.8808 -0.1995 0.0602  -0.0158 429 ILE A CD1 
2891 N N   . HIS A 386 ? 0.6874 0.8527 0.8795 -0.2526 0.0999  -0.0201 430 HIS A N   
2892 C CA  . HIS A 386 ? 0.6758 0.8625 0.8585 -0.2605 0.1150  -0.0159 430 HIS A CA  
2893 C C   . HIS A 386 ? 0.6766 0.8594 0.8300 -0.2377 0.1061  -0.0039 430 HIS A C   
2894 O O   . HIS A 386 ? 0.7008 0.8452 0.8283 -0.2300 0.0952  0.0141  430 HIS A O   
2895 C CB  . HIS A 386 ? 0.7088 0.8566 0.8694 -0.2864 0.1325  0.0014  430 HIS A CB  
2896 C CG  . HIS A 386 ? 0.7099 0.8586 0.8983 -0.3155 0.1465  -0.0097 430 HIS A CG  
2897 N ND1 . HIS A 386 ? 0.6798 0.8822 0.9038 -0.3315 0.1611  -0.0289 430 HIS A ND1 
2898 C CD2 . HIS A 386 ? 0.7419 0.8429 0.9288 -0.3328 0.1493  -0.0041 430 HIS A CD2 
2899 C CE1 . HIS A 386 ? 0.6921 0.8810 0.9357 -0.3589 0.1705  -0.0355 430 HIS A CE1 
2900 N NE2 . HIS A 386 ? 0.7296 0.8534 0.9495 -0.3624 0.1655  -0.0211 430 HIS A NE2 
2901 N N   . ALA A 387 ? 0.5842 0.8064 0.7433 -0.2269 0.1107  -0.0139 431 ALA A N   
2902 C CA  . ALA A 387 ? 0.5897 0.8065 0.7224 -0.2064 0.1031  -0.0067 431 ALA A CA  
2903 C C   . ALA A 387 ? 0.5893 0.8336 0.7188 -0.2066 0.1210  -0.0140 431 ALA A C   
2904 O O   . ALA A 387 ? 0.5871 0.8476 0.7296 -0.2252 0.1395  -0.0188 431 ALA A O   
2905 C CB  . ALA A 387 ? 0.5721 0.8044 0.7195 -0.1827 0.0863  -0.0147 431 ALA A CB  
2906 N N   . SER A 388 ? 0.7054 0.9537 0.8188 -0.1869 0.1181  -0.0154 432 SER A N   
2907 C CA  . SER A 388 ? 0.7202 0.9850 0.8235 -0.1836 0.1373  -0.0218 432 SER A CA  
2908 C C   . SER A 388 ? 0.6966 1.0117 0.8410 -0.1903 0.1552  -0.0368 432 SER A C   
2909 O O   . SER A 388 ? 0.7114 1.0331 0.8475 -0.2020 0.1788  -0.0376 432 SER A O   
2910 C CB  . SER A 388 ? 0.7296 1.0008 0.8273 -0.1565 0.1311  -0.0278 432 SER A CB  
2911 O OG  . SER A 388 ? 0.7512 0.9808 0.8142 -0.1527 0.1162  -0.0156 432 SER A OG  
2912 N N   . TYR A 389 ? 0.7937 1.1465 0.9822 -0.1841 0.1446  -0.0491 433 TYR A N   
2913 C CA  . TYR A 389 ? 0.7661 1.1773 1.0016 -0.1899 0.1576  -0.0651 433 TYR A CA  
2914 C C   . TYR A 389 ? 0.7669 1.1741 1.0099 -0.2251 0.1763  -0.0626 433 TYR A C   
2915 O O   . TYR A 389 ? 0.7683 1.2010 1.0212 -0.2348 0.2014  -0.0663 433 TYR A O   
2916 C CB  . TYR A 389 ? 0.7318 1.1868 1.0097 -0.1773 0.1386  -0.0799 433 TYR A CB  
2917 C CG  . TYR A 389 ? 0.7030 1.2262 1.0321 -0.1822 0.1506  -0.0964 433 TYR A CG  
2918 C CD1 . TYR A 389 ? 0.7006 1.2626 1.0435 -0.1584 0.1609  -0.1020 433 TYR A CD1 
2919 C CD2 . TYR A 389 ? 0.6820 1.2299 1.0474 -0.2122 0.1543  -0.1061 433 TYR A CD2 
2920 C CE1 . TYR A 389 ? 0.6713 1.3034 1.0682 -0.1619 0.1732  -0.1164 433 TYR A CE1 
2921 C CE2 . TYR A 389 ? 0.6684 1.2686 1.0761 -0.2142 0.1615  -0.1177 433 TYR A CE2 
2922 C CZ  . TYR A 389 ? 0.6632 1.3063 1.0874 -0.1882 0.1699  -0.1218 433 TYR A CZ  
2923 O OH  . TYR A 389 ? 0.6592 1.3546 1.1284 -0.1879 0.1757  -0.1312 433 TYR A OH  
2924 N N   . SER A 390 ? 0.6287 1.0010 0.8658 -0.2435 0.1667  -0.0555 434 SER A N   
2925 C CA  . SER A 390 ? 0.6414 0.9945 0.8771 -0.2778 0.1851  -0.0488 434 SER A CA  
2926 C C   . SER A 390 ? 0.6749 1.0028 0.8678 -0.2854 0.2080  -0.0341 434 SER A C   
2927 O O   . SER A 390 ? 0.6803 1.0279 0.8848 -0.3031 0.2335  -0.0366 434 SER A O   
2928 C CB  . SER A 390 ? 0.6601 0.9571 0.8773 -0.2891 0.1715  -0.0366 434 SER A CB  
2929 O OG  . SER A 390 ? 0.6376 0.9538 0.8925 -0.2906 0.1567  -0.0531 434 SER A OG  
2930 N N   . ILE A 391 ? 0.6343 0.9178 0.7759 -0.2705 0.1974  -0.0193 435 ILE A N   
2931 C CA  . ILE A 391 ? 0.6752 0.9291 0.7648 -0.2769 0.2153  -0.0062 435 ILE A CA  
2932 C C   . ILE A 391 ? 0.6723 0.9713 0.7761 -0.2734 0.2429  -0.0205 435 ILE A C   
2933 O O   . ILE A 391 ? 0.6937 0.9892 0.7812 -0.2933 0.2708  -0.0157 435 ILE A O   
2934 C CB  . ILE A 391 ? 0.7040 0.9161 0.7430 -0.2592 0.1958  0.0057  435 ILE A CB  
2935 C CG1 . ILE A 391 ? 0.7205 0.8833 0.7366 -0.2674 0.1762  0.0260  435 ILE A CG1 
2936 C CG2 . ILE A 391 ? 0.7468 0.9401 0.7336 -0.2623 0.2143  0.0106  435 ILE A CG2 
2937 C CD1 . ILE A 391 ? 0.7272 0.8675 0.7226 -0.2471 0.1483  0.0331  435 ILE A CD1 
2938 N N   . SER A 392 ? 0.7532 1.0941 0.8881 -0.2469 0.2362  -0.0370 436 SER A N   
2939 C CA  . SER A 392 ? 0.7536 1.1363 0.9034 -0.2349 0.2606  -0.0504 436 SER A CA  
2940 C C   . SER A 392 ? 0.7293 1.1629 0.9302 -0.2531 0.2830  -0.0595 436 SER A C   
2941 O O   . SER A 392 ? 0.7492 1.2016 0.9520 -0.2484 0.3076  -0.0639 436 SER A O   
2942 C CB  . SER A 392 ? 0.7354 1.1491 0.9111 -0.1993 0.2449  -0.0634 436 SER A CB  
2943 O OG  . SER A 392 ? 0.6851 1.1572 0.9260 -0.1963 0.2352  -0.0762 436 SER A OG  
2944 N N   . GLN A 393 ? 0.8880 1.3316 1.1259 -0.2670 0.2675  -0.0609 437 GLN A N   
2945 C CA  . GLN A 393 ? 0.8873 1.3639 1.1694 -0.2814 0.2779  -0.0670 437 GLN A CA  
2946 C C   . GLN A 393 ? 0.9332 1.3598 1.1800 -0.3113 0.2945  -0.0496 437 GLN A C   
2947 O O   . GLN A 393 ? 0.9572 1.3993 1.2331 -0.3297 0.3059  -0.0510 437 GLN A O   
2948 C CB  . GLN A 393 ? 0.8513 1.3589 1.1847 -0.2835 0.2531  -0.0793 437 GLN A CB  
2949 C CG  . GLN A 393 ? 0.8124 1.3704 1.1787 -0.2523 0.2342  -0.0945 437 GLN A CG  
2950 C CD  . GLN A 393 ? 0.8118 1.4241 1.2071 -0.2305 0.2498  -0.1035 437 GLN A CD  
2951 O OE1 . GLN A 393 ? 0.8218 1.4763 1.2601 -0.2381 0.2585  -0.1102 437 GLN A OE1 
2952 N NE2 . GLN A 393 ? 0.8149 1.4256 1.1879 -0.2027 0.2541  -0.1036 437 GLN A NE2 
2953 N N   . LYS A 394 ? 0.9516 1.3177 1.1342 -0.3159 0.2950  -0.0321 438 LYS A N   
2954 C CA  . LYS A 394 ? 1.0092 1.3262 1.1458 -0.3379 0.3134  -0.0126 438 LYS A CA  
2955 C C   . LYS A 394 ? 1.0287 1.3183 1.1793 -0.3623 0.3071  -0.0035 438 LYS A C   
2956 O O   . LYS A 394 ? 1.0805 1.3479 1.2179 -0.3823 0.3255  0.0083  438 LYS A O   
2957 C CB  . LYS A 394 ? 1.0422 1.3885 1.1813 -0.3367 0.3451  -0.0174 438 LYS A CB  
2958 C CG  . LYS A 394 ? 1.1125 1.4205 1.2108 -0.3588 0.3693  0.0006  438 LYS A CG  
2959 C CD  . LYS A 394 ? 1.1538 1.3898 1.1661 -0.3625 0.3664  0.0228  438 LYS A CD  
2960 C CE  . LYS A 394 ? 1.2485 1.4451 1.2221 -0.3854 0.3886  0.0437  438 LYS A CE  
2961 N NZ  . LYS A 394 ? 1.3182 1.4524 1.2008 -0.3872 0.3919  0.0654  438 LYS A NZ  
2962 N N   . LEU A 395 ? 0.9173 1.2048 1.0915 -0.3594 0.2813  -0.0092 439 LEU A N   
2963 C CA  . LEU A 395 ? 0.9397 1.1796 1.1090 -0.3775 0.2713  0.0020  439 LEU A CA  
2964 C C   . LEU A 395 ? 0.9790 1.1474 1.0787 -0.3807 0.2702  0.0301  439 LEU A C   
2965 O O   . LEU A 395 ? 0.9781 1.1381 1.0377 -0.3672 0.2674  0.0366  439 LEU A O   
2966 C CB  . LEU A 395 ? 0.8919 1.1456 1.0954 -0.3682 0.2440  -0.0127 439 LEU A CB  
2967 C CG  . LEU A 395 ? 0.8606 1.1798 1.1287 -0.3654 0.2374  -0.0393 439 LEU A CG  
2968 C CD1 . LEU A 395 ? 0.8341 1.1458 1.1190 -0.3612 0.2113  -0.0496 439 LEU A CD1 
2969 C CD2 . LEU A 395 ? 0.9008 1.2310 1.1955 -0.3898 0.2548  -0.0421 439 LEU A CD2 
2970 N N   . ASN A 396 ? 1.0910 1.2060 1.1744 -0.3973 0.2699  0.0473  440 ASN A N   
2971 C CA  . ASN A 396 ? 1.1394 1.1902 1.1549 -0.3985 0.2693  0.0770  440 ASN A CA  
2972 C C   . ASN A 396 ? 1.1158 1.1421 1.1190 -0.3847 0.2414  0.0832  440 ASN A C   
2973 O O   . ASN A 396 ? 1.1309 1.1173 1.1374 -0.3887 0.2298  0.0926  440 ASN A O   
2974 C CB  . ASN A 396 ? 1.2015 1.2031 1.2087 -0.4187 0.2789  0.0945  440 ASN A CB  
2975 C CG  . ASN A 396 ? 1.2729 1.2194 1.2097 -0.4228 0.2888  0.1260  440 ASN A CG  
2976 O OD1 . ASN A 396 ? 1.2927 1.2523 1.1974 -0.4212 0.3042  0.1285  440 ASN A OD1 
2977 N ND2 . ASN A 396 ? 1.3190 1.2017 1.2298 -0.4269 0.2803  0.1503  440 ASN A ND2 
2978 N N   . VAL A 397 ? 0.9801 1.0235 0.9619 -0.3690 0.2326  0.0811  441 VAL A N   
2979 C CA  . VAL A 397 ? 0.9640 0.9997 0.9449 -0.3431 0.1997  0.0820  441 VAL A CA  
2980 C C   . VAL A 397 ? 0.9960 1.0092 0.9181 -0.3292 0.1885  0.0980  441 VAL A C   
2981 O O   . VAL A 397 ? 0.9853 1.0278 0.8999 -0.3194 0.1929  0.0854  441 VAL A O   
2982 C CB  . VAL A 397 ? 0.9069 1.0003 0.9416 -0.3249 0.1890  0.0533  441 VAL A CB  
2983 C CG1 . VAL A 397 ? 0.9010 0.9833 0.9333 -0.2981 0.1577  0.0561  441 VAL A CG1 
2984 C CG2 . VAL A 397 ? 0.8782 0.9978 0.9693 -0.3408 0.1966  0.0349  441 VAL A CG2 
2985 N N   . PRO A 398 ? 1.0584 1.0182 0.9363 -0.3297 0.1752  0.1257  442 PRO A N   
2986 C CA  . PRO A 398 ? 1.0934 1.0325 0.9130 -0.3195 0.1601  0.1411  442 PRO A CA  
2987 C C   . PRO A 398 ? 1.0648 1.0288 0.8989 -0.2946 0.1338  0.1286  442 PRO A C   
2988 O O   . PRO A 398 ? 1.0776 1.0477 0.8781 -0.2902 0.1326  0.1242  442 PRO A O   
2989 C CB  . PRO A 398 ? 1.1434 1.0267 0.9298 -0.3210 0.1447  0.1735  442 PRO A CB  
2990 C CG  . PRO A 398 ? 1.1446 1.0097 0.9609 -0.3369 0.1615  0.1761  442 PRO A CG  
2991 C CD  . PRO A 398 ? 1.0843 1.0000 0.9664 -0.3382 0.1715  0.1434  442 PRO A CD  
2992 N N   . MET A 399 ? 0.8987 0.8730 0.7785 -0.2799 0.1152  0.1228  443 MET A N   
2993 C CA  . MET A 399 ? 0.8730 0.8687 0.7674 -0.2581 0.0925  0.1134  443 MET A CA  
2994 C C   . MET A 399 ? 0.8229 0.8523 0.7755 -0.2457 0.0899  0.0925  443 MET A C   
2995 O O   . MET A 399 ? 0.8140 0.8411 0.7975 -0.2503 0.0941  0.0894  443 MET A O   
2996 C CB  . MET A 399 ? 0.8980 0.8672 0.7775 -0.2471 0.0638  0.1352  443 MET A CB  
2997 C CG  . MET A 399 ? 0.9451 0.8899 0.7647 -0.2526 0.0541  0.1537  443 MET A CG  
2998 S SD  . MET A 399 ? 0.9685 0.8978 0.7891 -0.2365 0.0163  0.1775  443 MET A SD  
2999 C CE  . MET A 399 ? 0.9099 0.8816 0.7822 -0.2187 0.0048  0.1543  443 MET A CE  
3000 N N   . ALA A 400 ? 0.6967 0.7523 0.6591 -0.2299 0.0816  0.0791  444 ALA A N   
3001 C CA  . ALA A 400 ? 0.6556 0.7408 0.6638 -0.2144 0.0754  0.0623  444 ALA A CA  
3002 C C   . ALA A 400 ? 0.6569 0.7262 0.6794 -0.2032 0.0548  0.0732  444 ALA A C   
3003 O O   . ALA A 400 ? 0.6889 0.7277 0.6897 -0.2059 0.0445  0.0941  444 ALA A O   
3004 C CB  . ALA A 400 ? 0.6407 0.7494 0.6470 -0.2008 0.0745  0.0493  444 ALA A CB  
3005 N N   . PRO A 401 ? 0.6725 0.7629 0.7307 -0.1889 0.0493  0.0600  445 PRO A N   
3006 C CA  . PRO A 401 ? 0.6838 0.7571 0.7543 -0.1782 0.0342  0.0712  445 PRO A CA  
3007 C C   . PRO A 401 ? 0.6865 0.7562 0.7422 -0.1691 0.0173  0.0850  445 PRO A C   
3008 O O   . PRO A 401 ? 0.6712 0.7559 0.7154 -0.1670 0.0168  0.0785  445 PRO A O   
3009 C CB  . PRO A 401 ? 0.6594 0.7573 0.7647 -0.1654 0.0347  0.0520  445 PRO A CB  
3010 C CG  . PRO A 401 ? 0.6413 0.7637 0.7558 -0.1747 0.0490  0.0332  445 PRO A CG  
3011 C CD  . PRO A 401 ? 0.6403 0.7665 0.7284 -0.1822 0.0565  0.0371  445 PRO A CD  
3012 N N   . LEU A 402 ? 0.5838 0.6338 0.6418 -0.1639 0.0039  0.1034  446 LEU A N   
3013 C CA  . LEU A 402 ? 0.5898 0.6426 0.6424 -0.1564 -0.0156 0.1176  446 LEU A CA  
3014 C C   . LEU A 402 ? 0.5802 0.6451 0.6715 -0.1379 -0.0248 0.1194  446 LEU A C   
3015 O O   . LEU A 402 ? 0.5989 0.6513 0.7109 -0.1298 -0.0219 0.1217  446 LEU A O   
3016 C CB  . LEU A 402 ? 0.6388 0.6647 0.6600 -0.1641 -0.0271 0.1418  446 LEU A CB  
3017 C CG  . LEU A 402 ? 0.6579 0.6916 0.6746 -0.1589 -0.0521 0.1574  446 LEU A CG  
3018 C CD1 . LEU A 402 ? 0.6548 0.6977 0.6394 -0.1707 -0.0556 0.1497  446 LEU A CD1 
3019 C CD2 . LEU A 402 ? 0.7135 0.7219 0.7132 -0.1575 -0.0670 0.1847  446 LEU A CD2 
3020 N N   . SER A 403 ? 0.7174 0.8044 0.8176 -0.1323 -0.0336 0.1178  447 SER A N   
3021 C CA  . SER A 403 ? 0.7135 0.8156 0.8492 -0.1167 -0.0429 0.1243  447 SER A CA  
3022 C C   . SER A 403 ? 0.7039 0.8241 0.8385 -0.1206 -0.0583 0.1313  447 SER A C   
3023 O O   . SER A 403 ? 0.6926 0.8128 0.8003 -0.1328 -0.0573 0.1238  447 SER A O   
3024 C CB  . SER A 403 ? 0.6835 0.8001 0.8460 -0.1043 -0.0289 0.1068  447 SER A CB  
3025 O OG  . SER A 403 ? 0.6489 0.7804 0.8014 -0.1075 -0.0220 0.0928  447 SER A OG  
3026 N N   . GLU A 404 ? 0.7305 0.8664 0.8963 -0.1107 -0.0718 0.1445  448 GLU A N   
3027 C CA  . GLU A 404 ? 0.7188 0.8776 0.8925 -0.1172 -0.0875 0.1502  448 GLU A CA  
3028 C C   . GLU A 404 ? 0.6844 0.8731 0.9087 -0.1031 -0.0839 0.1497  448 GLU A C   
3029 O O   . GLU A 404 ? 0.6959 0.8873 0.9502 -0.0853 -0.0787 0.1539  448 GLU A O   
3030 C CB  . GLU A 404 ? 0.7737 0.9301 0.9345 -0.1230 -0.1128 0.1708  448 GLU A CB  
3031 C CG  . GLU A 404 ? 0.8180 0.9416 0.9233 -0.1365 -0.1134 0.1738  448 GLU A CG  
3032 C CD  . GLU A 404 ? 0.8265 0.9474 0.8895 -0.1573 -0.1216 0.1675  448 GLU A CD  
3033 O OE1 . GLU A 404 ? 0.7868 0.9235 0.8608 -0.1626 -0.1189 0.1544  448 GLU A OE1 
3034 O OE2 . GLU A 404 ? 0.8779 0.9770 0.8934 -0.1686 -0.1294 0.1757  448 GLU A OE2 
3035 N N   . PRO A 405 ? 0.7294 0.9375 0.9621 -0.1114 -0.0837 0.1439  449 PRO A N   
3036 C CA  . PRO A 405 ? 0.6950 0.9317 0.9739 -0.1001 -0.0750 0.1435  449 PRO A CA  
3037 C C   . PRO A 405 ? 0.7004 0.9671 1.0265 -0.0903 -0.0903 0.1609  449 PRO A C   
3038 O O   . PRO A 405 ? 0.6782 0.9670 1.0461 -0.0749 -0.0782 0.1610  449 PRO A O   
3039 C CB  . PRO A 405 ? 0.6710 0.9154 0.9424 -0.1168 -0.0731 0.1366  449 PRO A CB  
3040 C CG  . PRO A 405 ? 0.6906 0.9061 0.9107 -0.1316 -0.0752 0.1284  449 PRO A CG  
3041 C CD  . PRO A 405 ? 0.7265 0.9253 0.9235 -0.1316 -0.0865 0.1358  449 PRO A CD  
3042 N N   . ASN A 406 ? 0.5884 0.8581 0.9075 -0.0978 -0.1160 0.1754  450 ASN A N   
3043 C CA  . ASN A 406 ? 0.5909 0.8955 0.9587 -0.0861 -0.1345 0.1940  450 ASN A CA  
3044 C C   . ASN A 406 ? 0.6352 0.9216 1.0106 -0.0621 -0.1341 0.2054  450 ASN A C   
3045 O O   . ASN A 406 ? 0.6377 0.9488 1.0556 -0.0448 -0.1469 0.2221  450 ASN A O   
3046 C CB  . ASN A 406 ? 0.6025 0.9266 0.9630 -0.1052 -0.1672 0.2053  450 ASN A CB  
3047 C CG  . ASN A 406 ? 0.6518 0.9363 0.9424 -0.1226 -0.1769 0.2032  450 ASN A CG  
3048 O OD1 . ASN A 406 ? 0.6528 0.9043 0.9035 -0.1297 -0.1570 0.1876  450 ASN A OD1 
3049 N ND2 . ASN A 406 ? 0.6915 0.9816 0.9667 -0.1286 -0.2073 0.2194  450 ASN A ND2 
3050 N N   . ALA A 407 ? 0.6654 0.9079 1.0009 -0.0614 -0.1190 0.1965  451 ALA A N   
3051 C CA  . ALA A 407 ? 0.7172 0.9330 1.0583 -0.0409 -0.1124 0.2035  451 ALA A CA  
3052 C C   . ALA A 407 ? 0.6982 0.9042 1.0494 -0.0303 -0.0831 0.1831  451 ALA A C   
3053 O O   . ALA A 407 ? 0.7061 0.8847 1.0229 -0.0395 -0.0693 0.1678  451 ALA A O   
3054 C CB  . ALA A 407 ? 0.7867 0.9589 1.0743 -0.0520 -0.1177 0.2092  451 ALA A CB  
3055 N N   . VAL A 408 ? 0.5991 0.8272 0.9977 -0.0091 -0.0741 0.1837  452 VAL A N   
3056 C CA  . VAL A 408 ? 0.5761 0.8036 0.9836 0.0001  -0.0470 0.1634  452 VAL A CA  
3057 C C   . VAL A 408 ? 0.6347 0.8167 1.0191 0.0075  -0.0325 0.1515  452 VAL A C   
3058 O O   . VAL A 408 ? 0.6906 0.8475 1.0806 0.0200  -0.0368 0.1625  452 VAL A O   
3059 C CB  . VAL A 408 ? 0.5389 0.8043 1.0035 0.0212  -0.0388 0.1677  452 VAL A CB  
3060 C CG1 . VAL A 408 ? 0.5242 0.7797 0.9901 0.0349  -0.0091 0.1472  452 VAL A CG1 
3061 C CG2 . VAL A 408 ? 0.5223 0.8346 1.0101 0.0071  -0.0476 0.1735  452 VAL A CG2 
3062 N N   . GLY A 409 ? 0.5616 0.7326 0.9195 -0.0012 -0.0166 0.1295  453 GLY A N   
3063 C CA  . GLY A 409 ? 0.6140 0.7470 0.9509 0.0005  -0.0035 0.1136  453 GLY A CA  
3064 C C   . GLY A 409 ? 0.6544 0.7523 0.9580 -0.0161 -0.0106 0.1169  453 GLY A C   
3065 O O   . GLY A 409 ? 0.6830 0.7514 0.9705 -0.0204 0.0004  0.1020  453 GLY A O   
3066 N N   . ILE A 410 ? 0.6504 0.7508 0.9415 -0.0276 -0.0282 0.1355  454 ILE A N   
3067 C CA  . ILE A 410 ? 0.6795 0.7426 0.9392 -0.0408 -0.0317 0.1425  454 ILE A CA  
3068 C C   . ILE A 410 ? 0.6340 0.6944 0.8592 -0.0640 -0.0253 0.1277  454 ILE A C   
3069 O O   . ILE A 410 ? 0.5873 0.6721 0.8016 -0.0736 -0.0297 0.1247  454 ILE A O   
3070 C CB  . ILE A 410 ? 0.7111 0.7694 0.9663 -0.0397 -0.0533 0.1718  454 ILE A CB  
3071 C CG1 . ILE A 410 ? 0.7561 0.7992 1.0418 -0.0140 -0.0559 0.1872  454 ILE A CG1 
3072 C CG2 . ILE A 410 ? 0.7152 0.7407 0.9253 -0.0598 -0.0554 0.1791  454 ILE A CG2 
3073 C CD1 . ILE A 410 ? 0.7681 0.8107 1.0523 -0.0079 -0.0803 0.2183  454 ILE A CD1 
3074 N N   . VAL A 411 ? 0.6311 0.6622 0.8419 -0.0729 -0.0134 0.1170  455 VAL A N   
3075 C CA  . VAL A 411 ? 0.5983 0.6314 0.7821 -0.0947 -0.0067 0.1049  455 VAL A CA  
3076 C C   . VAL A 411 ? 0.6324 0.6271 0.7946 -0.1103 -0.0014 0.1122  455 VAL A C   
3077 O O   . VAL A 411 ? 0.6743 0.6365 0.8445 -0.1072 0.0058  0.1111  455 VAL A O   
3078 C CB  . VAL A 411 ? 0.5702 0.6238 0.7610 -0.0954 0.0058  0.0764  455 VAL A CB  
3079 C CG1 . VAL A 411 ? 0.5278 0.6024 0.6994 -0.1096 0.0075  0.0686  455 VAL A CG1 
3080 C CG2 . VAL A 411 ? 0.5561 0.6337 0.7691 -0.0760 0.0059  0.0702  455 VAL A CG2 
3081 N N   . ILE A 412 ? 0.7166 0.7113 0.8493 -0.1276 -0.0030 0.1197  456 ILE A N   
3082 C CA  . ILE A 412 ? 0.7489 0.7078 0.8561 -0.1456 0.0052  0.1292  456 ILE A CA  
3083 C C   . ILE A 412 ? 0.7191 0.6942 0.8128 -0.1665 0.0197  0.1121  456 ILE A C   
3084 O O   . ILE A 412 ? 0.6855 0.6883 0.7675 -0.1688 0.0172  0.1078  456 ILE A O   
3085 C CB  . ILE A 412 ? 0.7798 0.7193 0.8571 -0.1464 -0.0089 0.1594  456 ILE A CB  
3086 C CG1 . ILE A 412 ? 0.8124 0.7428 0.9103 -0.1226 -0.0252 0.1782  456 ILE A CG1 
3087 C CG2 . ILE A 412 ? 0.8157 0.7142 0.8607 -0.1654 0.0027  0.1716  456 ILE A CG2 
3088 C CD1 . ILE A 412 ? 0.8437 0.7654 0.9158 -0.1200 -0.0460 0.2085  456 ILE A CD1 
3089 N N   . ALA A 413 ? 0.7376 0.6967 0.8359 -0.1816 0.0356  0.1010  457 ALA A N   
3090 C CA  . ALA A 413 ? 0.7070 0.6916 0.8042 -0.2007 0.0505  0.0824  457 ALA A CA  
3091 C C   . ALA A 413 ? 0.7323 0.6895 0.8260 -0.2252 0.0681  0.0815  457 ALA A C   
3092 O O   . ALA A 413 ? 0.7713 0.6928 0.8747 -0.2268 0.0708  0.0826  457 ALA A O   
3093 C CB  . ALA A 413 ? 0.6698 0.6958 0.7965 -0.1920 0.0507  0.0546  457 ALA A CB  
3094 N N   . HIS A 414 ? 0.8468 0.8196 0.9278 -0.2447 0.0823  0.0784  458 HIS A N   
3095 C CA  . HIS A 414 ? 0.8533 0.8155 0.9430 -0.2719 0.1027  0.0704  458 HIS A CA  
3096 C C   . HIS A 414 ? 0.8175 0.8172 0.9496 -0.2723 0.1031  0.0382  458 HIS A C   
3097 O O   . HIS A 414 ? 0.7775 0.8212 0.9241 -0.2552 0.0935  0.0235  458 HIS A O   
3098 C CB  . HIS A 414 ? 0.8409 0.8195 0.9113 -0.2916 0.1208  0.0735  458 HIS A CB  
3099 C CG  . HIS A 414 ? 0.8828 0.8224 0.9022 -0.2942 0.1213  0.1042  458 HIS A CG  
3100 N ND1 . HIS A 414 ? 0.8819 0.8290 0.8728 -0.2776 0.1064  0.1149  458 HIS A ND1 
3101 C CD2 . HIS A 414 ? 0.9311 0.8215 0.9192 -0.3120 0.1335  0.1270  458 HIS A CD2 
3102 C CE1 . HIS A 414 ? 0.9279 0.8360 0.8711 -0.2846 0.1072  0.1418  458 HIS A CE1 
3103 N NE2 . HIS A 414 ? 0.9593 0.8313 0.8983 -0.3041 0.1239  0.1513  458 HIS A NE2 
3104 N N   . GLY A 415 ? 0.8057 0.7855 0.9551 -0.2922 0.1134  0.0273  459 GLY A N   
3105 C CA  . GLY A 415 ? 0.7781 0.7935 0.9640 -0.2955 0.1112  -0.0048 459 GLY A CA  
3106 C C   . GLY A 415 ? 0.7895 0.7893 0.9935 -0.3289 0.1267  -0.0184 459 GLY A C   
3107 O O   . GLY A 415 ? 0.8175 0.7773 1.0052 -0.3505 0.1426  -0.0010 459 GLY A O   
3108 N N   . SER A 416 ? 0.7968 0.8283 1.0326 -0.3350 0.1220  -0.0497 460 SER A N   
3109 C CA  . SER A 416 ? 0.8174 0.8277 1.0724 -0.3682 0.1332  -0.0672 460 SER A CA  
3110 C C   . SER A 416 ? 0.8313 0.8419 1.1009 -0.3605 0.1192  -0.0960 460 SER A C   
3111 O O   . SER A 416 ? 0.8080 0.8594 1.0820 -0.3347 0.1029  -0.1077 460 SER A O   
3112 C CB  . SER A 416 ? 0.7797 0.8428 1.0624 -0.3963 0.1460  -0.0797 460 SER A CB  
3113 O OG  . SER A 416 ? 0.7258 0.8678 1.0344 -0.3823 0.1337  -0.1001 460 SER A OG  
3114 N N   . VAL A 417 ? 0.7684 0.7270 1.0406 -0.3833 0.1273  -0.1065 461 VAL A N   
3115 C CA  . VAL A 417 ? 0.7955 0.7418 1.0746 -0.3802 0.1172  -0.1363 461 VAL A CA  
3116 C C   . VAL A 417 ? 0.7741 0.7605 1.0856 -0.4164 0.1182  -0.1703 461 VAL A C   
3117 O O   . VAL A 417 ? 0.8098 0.7687 1.1220 -0.4399 0.1297  -0.1648 461 VAL A O   
3118 C CB  . VAL A 417 ? 0.8695 0.7200 1.1255 -0.3767 0.1251  -0.1255 461 VAL A CB  
3119 C CG1 . VAL A 417 ? 0.9047 0.7358 1.1617 -0.3703 0.1172  -0.1579 461 VAL A CG1 
3120 C CG2 . VAL A 417 ? 0.8900 0.7103 1.1195 -0.3415 0.1221  -0.0879 461 VAL A CG2 
3121 N N   . GLY A 418 ? 0.7689 0.8219 1.0983 -0.4076 0.1004  -0.1982 462 GLY A N   
3122 C CA  . GLY A 418 ? 0.7552 0.8591 1.1081 -0.4236 0.0904  -0.2253 462 GLY A CA  
3123 C C   . GLY A 418 ? 0.7145 0.8968 1.0798 -0.4027 0.0685  -0.2455 462 GLY A C   
3124 O O   . GLY A 418 ? 0.7179 0.8990 1.0670 -0.3759 0.0605  -0.2436 462 GLY A O   
3125 N N   . ASP A 419 ? 0.8366 1.0856 1.2276 -0.4099 0.0579  -0.2608 463 ASP A N   
3126 C CA  . ASP A 419 ? 0.8006 1.1242 1.2009 -0.3871 0.0355  -0.2766 463 ASP A CA  
3127 C C   . ASP A 419 ? 0.7444 1.1253 1.1573 -0.3649 0.0364  -0.2561 463 ASP A C   
3128 O O   . ASP A 419 ? 0.7155 1.1528 1.1326 -0.3404 0.0193  -0.2629 463 ASP A O   
3129 C CB  . ASP A 419 ? 0.8186 1.1837 1.2377 -0.4022 0.0191  -0.3057 463 ASP A CB  
3130 C CG  . ASP A 419 ? 0.8785 1.1867 1.2777 -0.4196 0.0153  -0.3309 463 ASP A CG  
3131 O OD1 . ASP A 419 ? 0.9049 1.1353 1.2821 -0.4240 0.0310  -0.3221 463 ASP A OD1 
3132 O OD2 . ASP A 419 ? 0.9065 1.2437 1.3099 -0.4277 -0.0030 -0.3591 463 ASP A OD2 
3133 N N   . ALA A 420 ? 0.6647 1.0273 1.0793 -0.3722 0.0570  -0.2305 464 ALA A N   
3134 C CA  . ALA A 420 ? 0.6194 1.0265 1.0410 -0.3520 0.0613  -0.2123 464 ALA A CA  
3135 C C   . ALA A 420 ? 0.6247 0.9837 1.0275 -0.3580 0.0842  -0.1829 464 ALA A C   
3136 O O   . ALA A 420 ? 0.6621 0.9602 1.0524 -0.3801 0.0970  -0.1752 464 ALA A O   
3137 C CB  . ALA A 420 ? 0.6098 1.0846 1.0669 -0.3562 0.0589  -0.2209 464 ALA A CB  
3138 N N   . ILE A 421 ? 0.5936 0.9768 0.9904 -0.3372 0.0885  -0.1663 465 ILE A N   
3139 C CA  . ILE A 421 ? 0.6003 0.9492 0.9768 -0.3428 0.1096  -0.1394 465 ILE A CA  
3140 C C   . ILE A 421 ? 0.6255 0.9761 1.0177 -0.3689 0.1266  -0.1375 465 ILE A C   
3141 O O   . ILE A 421 ? 0.6195 1.0291 1.0441 -0.3699 0.1260  -0.1498 465 ILE A O   
3142 C CB  . ILE A 421 ? 0.5668 0.9514 0.9370 -0.3174 0.1115  -0.1280 465 ILE A CB  
3143 C CG1 . ILE A 421 ? 0.5672 0.9419 0.9154 -0.2866 0.0935  -0.1252 465 ILE A CG1 
3144 C CG2 . ILE A 421 ? 0.5819 0.9310 0.9245 -0.3251 0.1331  -0.1023 465 ILE A CG2 
3145 C CD1 . ILE A 421 ? 0.5522 0.9419 0.8830 -0.2585 0.0942  -0.1108 465 ILE A CD1 
3146 N N   . SER A 422 ? 0.9405 1.2273 1.3105 -0.3892 0.1423  -0.1205 466 SER A N   
3147 C CA  . SER A 422 ? 0.9851 1.2679 1.3677 -0.4160 0.1603  -0.1171 466 SER A CA  
3148 C C   . SER A 422 ? 0.9950 1.2647 1.3538 -0.4163 0.1821  -0.0911 466 SER A C   
3149 O O   . SER A 422 ? 0.9841 1.2218 1.3066 -0.4024 0.1835  -0.0720 466 SER A O   
3150 C CB  . SER A 422 ? 1.0423 1.2576 1.4141 -0.4405 0.1642  -0.1163 466 SER A CB  
3151 O OG  . SER A 422 ? 1.0675 1.2115 1.3972 -0.4399 0.1752  -0.0877 466 SER A OG  
3152 N N   . VAL A 423 ? 0.6751 0.9722 1.0545 -0.4330 0.1992  -0.0915 467 VAL A N   
3153 C CA  . VAL A 423 ? 0.6915 0.9858 1.0505 -0.4343 0.2228  -0.0711 467 VAL A CA  
3154 C C   . VAL A 423 ? 0.7495 0.9650 1.0646 -0.4514 0.2385  -0.0444 467 VAL A C   
3155 O O   . VAL A 423 ? 0.7716 0.9749 1.0580 -0.4523 0.2575  -0.0251 467 VAL A O   
3156 C CB  . VAL A 423 ? 0.7070 1.0612 1.1075 -0.4471 0.2387  -0.0811 467 VAL A CB  
3157 C CG1 . VAL A 423 ? 0.6554 1.0904 1.0986 -0.4260 0.2234  -0.1036 467 VAL A CG1 
3158 C CG2 . VAL A 423 ? 0.7608 1.0983 1.1833 -0.4802 0.2445  -0.0870 467 VAL A CG2 
3159 N N   . MET A 424 ? 1.2421 1.4022 1.5492 -0.4637 0.2311  -0.0428 468 MET A N   
3160 C CA  . MET A 424 ? 1.3078 1.3905 1.5751 -0.4789 0.2457  -0.0156 468 MET A CA  
3161 C C   . MET A 424 ? 1.3046 1.3407 1.5178 -0.4602 0.2435  0.0119  468 MET A C   
3162 O O   . MET A 424 ? 1.2504 1.3107 1.4580 -0.4374 0.2301  0.0083  468 MET A O   
3163 C CB  . MET A 424 ? 1.3477 1.3793 1.6214 -0.4944 0.2385  -0.0225 468 MET A CB  
3164 C CG  . MET A 424 ? 1.3786 1.4378 1.6961 -0.5219 0.2438  -0.0446 468 MET A CG  
3165 S SD  . MET A 424 ? 1.3736 1.4252 1.7160 -0.5249 0.2196  -0.0772 468 MET A SD  
3166 C CE  . MET A 424 ? 1.4314 1.3677 1.7267 -0.5246 0.2211  -0.0554 468 MET A CE  
3167 N N   . VAL A 425 ? 1.0393 1.0072 1.2117 -0.4702 0.2553  0.0404  469 VAL A N   
3168 C CA  . VAL A 425 ? 1.0496 0.9722 1.1661 -0.4542 0.2522  0.0700  469 VAL A CA  
3169 C C   . VAL A 425 ? 1.0388 0.9177 1.1464 -0.4395 0.2307  0.0738  469 VAL A C   
3170 O O   . VAL A 425 ? 1.0857 0.9065 1.1893 -0.4471 0.2300  0.0810  469 VAL A O   
3171 C CB  . VAL A 425 ? 1.1317 0.9984 1.2034 -0.4677 0.2716  0.1020  469 VAL A CB  
3172 C CG1 . VAL A 425 ? 1.1509 0.9667 1.1621 -0.4500 0.2624  0.1336  469 VAL A CG1 
3173 C CG2 . VAL A 425 ? 1.1441 1.0550 1.2193 -0.4793 0.2952  0.0995  469 VAL A CG2 
3174 N N   . PRO A 426 ? 1.0086 0.9136 1.1128 -0.4182 0.2147  0.0691  470 PRO A N   
3175 C CA  . PRO A 426 ? 0.9958 0.8810 1.1060 -0.4033 0.1948  0.0639  470 PRO A CA  
3176 C C   . PRO A 426 ? 1.0515 0.8626 1.1179 -0.3899 0.1861  0.0969  470 PRO A C   
3177 O O   . PRO A 426 ? 1.0746 0.8672 1.0968 -0.3855 0.1876  0.1244  470 PRO A O   
3178 C CB  . PRO A 426 ? 0.9413 0.8871 1.0581 -0.3789 0.1800  0.0529  470 PRO A CB  
3179 C CG  . PRO A 426 ? 0.9453 0.8996 1.0272 -0.3838 0.1939  0.0702  470 PRO A CG  
3180 C CD  . PRO A 426 ? 0.9768 0.9240 1.0631 -0.4071 0.2170  0.0723  470 PRO A CD  
3181 N N   . ASP A 427 ? 1.0196 0.7914 1.0972 -0.3784 0.1746  0.0938  471 ASP A N   
3182 C CA  . ASP A 427 ? 1.0725 0.7900 1.1185 -0.3515 0.1589  0.1235  471 ASP A CA  
3183 C C   . ASP A 427 ? 1.0423 0.8049 1.0943 -0.3166 0.1336  0.1198  471 ASP A C   
3184 O O   . ASP A 427 ? 0.9847 0.8102 1.0615 -0.3137 0.1300  0.0948  471 ASP A O   
3185 C CB  . ASP A 427 ? 1.1194 0.7783 1.1782 -0.3482 0.1584  0.1201  471 ASP A CB  
3186 C CG  . ASP A 427 ? 1.1355 0.7607 1.2037 -0.3872 0.1834  0.1097  471 ASP A CG  
3187 O OD1 . ASP A 427 ? 1.1629 0.7676 1.2048 -0.4050 0.1984  0.1315  471 ASP A OD1 
3188 O OD2 . ASP A 427 ? 1.1285 0.7548 1.2303 -0.3959 0.1847  0.0788  471 ASP A OD2 
3189 N N   . VAL A 428 ? 1.0067 0.7368 1.0380 -0.2900 0.1161  0.1454  472 VAL A N   
3190 C CA  . VAL A 428 ? 0.9834 0.7521 1.0233 -0.2589 0.0926  0.1438  472 VAL A CA  
3191 C C   . VAL A 428 ? 1.0046 0.7611 1.0748 -0.2361 0.0828  0.1331  472 VAL A C   
3192 O O   . VAL A 428 ? 1.0595 0.7586 1.1267 -0.2311 0.0855  0.1454  472 VAL A O   
3193 C CB  . VAL A 428 ? 1.0030 0.7595 1.0035 -0.2451 0.0771  0.1777  472 VAL A CB  
3194 C CG1 . VAL A 428 ? 0.9762 0.7695 0.9926 -0.2152 0.0526  0.1762  472 VAL A CG1 
3195 C CG2 . VAL A 428 ? 0.9857 0.7595 0.9516 -0.2660 0.0881  0.1829  472 VAL A CG2 
3196 N N   . TYR A 429 ? 0.8580 0.6658 0.9550 -0.2216 0.0736  0.1100  473 TYR A N   
3197 C CA  . TYR A 429 ? 0.8664 0.6699 0.9897 -0.1988 0.0666  0.0972  473 TYR A CA  
3198 C C   . TYR A 429 ? 0.8449 0.6797 0.9749 -0.1692 0.0479  0.1069  473 TYR A C   
3199 O O   . TYR A 429 ? 0.8028 0.6785 0.9250 -0.1692 0.0403  0.1091  473 TYR A O   
3200 C CB  . TYR A 429 ? 0.8333 0.6684 0.9821 -0.2089 0.0740  0.0592  473 TYR A CB  
3201 C CG  . TYR A 429 ? 0.8466 0.6527 0.9979 -0.2399 0.0912  0.0455  473 TYR A CG  
3202 C CD1 . TYR A 429 ? 0.8149 0.6440 0.9629 -0.2691 0.1027  0.0413  473 TYR A CD1 
3203 C CD2 . TYR A 429 ? 0.8907 0.6460 1.0493 -0.2409 0.0978  0.0354  473 TYR A CD2 
3204 C CE1 . TYR A 429 ? 0.8238 0.6303 0.9797 -0.3013 0.1196  0.0283  473 TYR A CE1 
3205 C CE2 . TYR A 429 ? 0.9039 0.6294 1.0657 -0.2730 0.1137  0.0215  473 TYR A CE2 
3206 C CZ  . TYR A 429 ? 0.8690 0.6222 1.0313 -0.3046 0.1243  0.0184  473 TYR A CZ  
3207 O OH  . TYR A 429 ? 0.8820 0.6081 1.0528 -0.3404 0.1413  0.0038  473 TYR A OH  
3208 N N   . ILE A 430 ? 0.7667 0.5816 0.9132 -0.1445 0.0423  0.1110  474 ILE A N   
3209 C CA  . ILE A 430 ? 0.7498 0.5969 0.9108 -0.1172 0.0265  0.1200  474 ILE A CA  
3210 C C   . ILE A 430 ? 0.7556 0.6158 0.9463 -0.0977 0.0302  0.0977  474 ILE A C   
3211 O O   . ILE A 430 ? 0.7882 0.6177 0.9849 -0.1001 0.0427  0.0795  474 ILE A O   
3212 C CB  . ILE A 430 ? 0.7863 0.6049 0.9394 -0.1004 0.0131  0.1562  474 ILE A CB  
3213 C CG1 . ILE A 430 ? 0.7585 0.6242 0.9261 -0.0812 -0.0061 0.1670  474 ILE A CG1 
3214 C CG2 . ILE A 430 ? 0.8444 0.6087 1.0094 -0.0842 0.0201  0.1616  474 ILE A CG2 
3215 C CD1 . ILE A 430 ? 0.7916 0.6420 0.9638 -0.0595 -0.0228 0.1992  474 ILE A CD1 
3216 N N   . SER A 431 ? 0.7879 0.6922 0.9943 -0.0802 0.0208  0.0981  475 SER A N   
3217 C CA  . SER A 431 ? 0.8023 0.7210 1.0339 -0.0587 0.0257  0.0817  475 SER A CA  
3218 C C   . SER A 431 ? 0.7985 0.7442 1.0509 -0.0358 0.0135  0.1023  475 SER A C   
3219 O O   . SER A 431 ? 0.7584 0.7362 1.0054 -0.0418 0.0010  0.1143  475 SER A O   
3220 C CB  . SER A 431 ? 0.7645 0.7218 0.9945 -0.0669 0.0310  0.0536  475 SER A CB  
3221 O OG  . SER A 431 ? 0.7819 0.7569 1.0295 -0.0457 0.0358  0.0413  475 SER A OG  
3222 N N   . ASP A 432 ? 0.8140 0.7471 1.0917 -0.0102 0.0173  0.1060  476 ASP A N   
3223 C CA  . ASP A 432 ? 0.8026 0.7722 1.1105 0.0117  0.0070  0.1233  476 ASP A CA  
3224 C C   . ASP A 432 ? 0.7894 0.7985 1.1175 0.0225  0.0174  0.1043  476 ASP A C   
3225 O O   . ASP A 432 ? 0.7493 0.7970 1.1050 0.0354  0.0115  0.1158  476 ASP A O   
3226 C CB  . ASP A 432 ? 0.8256 0.7680 1.1556 0.0373  0.0032  0.1452  476 ASP A CB  
3227 C CG  . ASP A 432 ? 0.8588 0.7651 1.2017 0.0563  0.0237  0.1277  476 ASP A CG  
3228 O OD1 . ASP A 432 ? 0.8629 0.7777 1.2027 0.0530  0.0392  0.0981  476 ASP A OD1 
3229 O OD2 . ASP A 432 ? 0.8836 0.7504 1.2371 0.0761  0.0240  0.1438  476 ASP A OD2 
3230 N N   . ASP A 433 ? 0.7263 0.7256 1.0400 0.0164  0.0328  0.0757  477 ASP A N   
3231 C CA  . ASP A 433 ? 0.6934 0.7247 1.0148 0.0258  0.0443  0.0570  477 ASP A CA  
3232 C C   . ASP A 433 ? 0.6229 0.6878 0.9243 0.0090  0.0420  0.0460  477 ASP A C   
3233 O O   . ASP A 433 ? 0.5975 0.6805 0.8960 0.0157  0.0527  0.0298  477 ASP A O   
3234 C CB  . ASP A 433 ? 0.7330 0.7355 1.0530 0.0389  0.0633  0.0328  477 ASP A CB  
3235 C CG  . ASP A 433 ? 0.7908 0.7581 1.0810 0.0184  0.0668  0.0106  477 ASP A CG  
3236 O OD1 . ASP A 433 ? 0.7675 0.7491 1.0390 -0.0047 0.0585  0.0073  477 ASP A OD1 
3237 O OD2 . ASP A 433 ? 0.8257 0.7513 1.1134 0.0254  0.0788  -0.0047 477 ASP A OD2 
3238 N N   . GLY A 434 ? 0.6238 0.6933 0.9077 -0.0113 0.0301  0.0538  478 GLY A N   
3239 C CA  . GLY A 434 ? 0.5566 0.6558 0.8242 -0.0224 0.0288  0.0452  478 GLY A CA  
3240 C C   . GLY A 434 ? 0.5665 0.6588 0.8118 -0.0345 0.0346  0.0207  478 GLY A C   
3241 O O   . GLY A 434 ? 0.5291 0.6459 0.7618 -0.0375 0.0353  0.0102  478 GLY A O   
3242 N N   . GLY A 435 ? 0.5861 0.6452 0.8274 -0.0419 0.0380  0.0123  479 GLY A N   
3243 C CA  . GLY A 435 ? 0.5896 0.6464 0.8154 -0.0590 0.0407  -0.0099 479 GLY A CA  
3244 C C   . GLY A 435 ? 0.6498 0.6931 0.8724 -0.0551 0.0496  -0.0372 479 GLY A C   
3245 O O   . GLY A 435 ? 0.6525 0.6990 0.8655 -0.0711 0.0494  -0.0577 479 GLY A O   
3246 N N   . TYR A 436 ? 0.6275 0.6572 0.8585 -0.0345 0.0577  -0.0389 480 TYR A N   
3247 C CA  . TYR A 436 ? 0.7056 0.7138 0.9276 -0.0305 0.0678  -0.0669 480 TYR A CA  
3248 C C   . TYR A 436 ? 0.7472 0.7045 0.9691 -0.0440 0.0716  -0.0740 480 TYR A C   
3249 O O   . TYR A 436 ? 0.7770 0.7162 0.9864 -0.0553 0.0760  -0.1025 480 TYR A O   
3250 C CB  . TYR A 436 ? 0.7173 0.7230 0.9480 -0.0028 0.0797  -0.0664 480 TYR A CB  
3251 C CG  . TYR A 436 ? 0.6475 0.6964 0.8711 0.0085  0.0818  -0.0674 480 TYR A CG  
3252 C CD1 . TYR A 436 ? 0.5746 0.6548 0.8126 0.0135  0.0767  -0.0422 480 TYR A CD1 
3253 C CD2 . TYR A 436 ? 0.6612 0.7163 0.8599 0.0131  0.0888  -0.0935 480 TYR A CD2 
3254 C CE1 . TYR A 436 ? 0.5257 0.6383 0.7554 0.0221  0.0812  -0.0417 480 TYR A CE1 
3255 C CE2 . TYR A 436 ? 0.6137 0.7026 0.8003 0.0238  0.0922  -0.0916 480 TYR A CE2 
3256 C CZ  . TYR A 436 ? 0.5490 0.6648 0.7521 0.0281  0.0897  -0.0649 480 TYR A CZ  
3257 O OH  . TYR A 436 ? 0.5159 0.6587 0.7044 0.0373  0.0957  -0.0621 480 TYR A OH  
3258 N N   . SER A 437 ? 0.7087 0.6404 0.9421 -0.0440 0.0694  -0.0481 481 SER A N   
3259 C CA  . SER A 437 ? 0.7379 0.6117 0.9690 -0.0547 0.0754  -0.0501 481 SER A CA  
3260 C C   . SER A 437 ? 0.7053 0.5674 0.9363 -0.0681 0.0679  -0.0209 481 SER A C   
3261 O O   . SER A 437 ? 0.6742 0.5620 0.9118 -0.0582 0.0583  0.0050  481 SER A O   
3262 C CB  . SER A 437 ? 0.7853 0.6179 1.0269 -0.0280 0.0866  -0.0486 481 SER A CB  
3263 O OG  . SER A 437 ? 0.7710 0.6023 1.0306 -0.0100 0.0808  -0.0134 481 SER A OG  
3264 N N   . TRP A 438 ? 0.8018 0.6241 1.0231 -0.0922 0.0728  -0.0253 482 TRP A N   
3265 C CA  . TRP A 438 ? 0.7785 0.5887 0.9918 -0.1086 0.0685  0.0012  482 TRP A CA  
3266 C C   . TRP A 438 ? 0.8253 0.5639 1.0310 -0.1165 0.0775  0.0122  482 TRP A C   
3267 O O   . TRP A 438 ? 0.8695 0.5630 1.0758 -0.1168 0.0886  -0.0070 482 TRP A O   
3268 C CB  . TRP A 438 ? 0.7284 0.5739 0.9344 -0.1385 0.0674  -0.0109 482 TRP A CB  
3269 C CG  . TRP A 438 ? 0.6767 0.5868 0.8863 -0.1317 0.0589  -0.0185 482 TRP A CG  
3270 C CD1 . TRP A 438 ? 0.6734 0.6158 0.8869 -0.1246 0.0582  -0.0448 482 TRP A CD1 
3271 C CD2 . TRP A 438 ? 0.6248 0.5705 0.8293 -0.1315 0.0505  0.0006  482 TRP A CD2 
3272 N NE1 . TRP A 438 ? 0.6186 0.6127 0.8312 -0.1187 0.0503  -0.0406 482 TRP A NE1 
3273 C CE2 . TRP A 438 ? 0.5862 0.5822 0.7944 -0.1233 0.0461  -0.0144 482 TRP A CE2 
3274 C CE3 . TRP A 438 ? 0.6125 0.5491 0.8050 -0.1377 0.0464  0.0286  482 TRP A CE3 
3275 C CZ2 . TRP A 438 ? 0.5327 0.5655 0.7357 -0.1212 0.0392  -0.0032 482 TRP A CZ2 
3276 C CZ3 . TRP A 438 ? 0.5626 0.5389 0.7481 -0.1368 0.0387  0.0374  482 TRP A CZ3 
3277 C CH2 . TRP A 438 ? 0.5219 0.5438 0.7142 -0.1285 0.0358  0.0212  482 TRP A CH2 
3278 N N   . THR A 439 ? 1.0361 0.7606 1.2298 -0.1240 0.0731  0.0433  483 THR A N   
3279 C CA  . THR A 439 ? 1.0834 0.7364 1.2635 -0.1315 0.0812  0.0619  483 THR A CA  
3280 C C   . THR A 439 ? 1.0626 0.7196 1.2208 -0.1574 0.0802  0.0826  483 THR A C   
3281 O O   . THR A 439 ? 1.0197 0.7277 1.1737 -0.1557 0.0689  0.0931  483 THR A O   
3282 C CB  . THR A 439 ? 1.1188 0.7410 1.3051 -0.0948 0.0747  0.0904  483 THR A CB  
3283 O OG1 . THR A 439 ? 1.1415 0.7580 1.3483 -0.0705 0.0808  0.0689  483 THR A OG1 
3284 C CG2 . THR A 439 ? 1.1703 0.7143 1.3376 -0.0990 0.0818  0.1155  483 THR A CG2 
3285 N N   . LYS A 440 ? 1.0931 0.6942 1.2353 -0.1824 0.0941  0.0880  484 LYS A N   
3286 C CA  . LYS A 440 ? 1.0852 0.6842 1.2020 -0.2060 0.0971  0.1109  484 LYS A CA  
3287 C C   . LYS A 440 ? 1.1141 0.6915 1.2106 -0.1811 0.0834  0.1533  484 LYS A C   
3288 O O   . LYS A 440 ? 1.1662 0.6844 1.2585 -0.1627 0.0837  0.1723  484 LYS A O   
3289 C CB  . LYS A 440 ? 1.1163 0.6572 1.2213 -0.2410 0.1186  0.1075  484 LYS A CB  
3290 C CG  . LYS A 440 ? 1.1104 0.6498 1.1871 -0.2686 0.1272  0.1301  484 LYS A CG  
3291 C CD  . LYS A 440 ? 1.1415 0.6215 1.2086 -0.3062 0.1518  0.1286  484 LYS A CD  
3292 C CE  . LYS A 440 ? 1.1071 0.6149 1.2071 -0.3357 0.1629  0.0837  484 LYS A CE  
3293 N NZ  . LYS A 440 ? 1.1544 0.5921 1.2488 -0.3723 0.1867  0.0812  484 LYS A NZ  
3294 N N   . MET A 441 ? 1.1847 0.8103 1.2686 -0.1794 0.0703  0.1674  485 MET A N   
3295 C CA  . MET A 441 ? 1.2035 0.8186 1.2668 -0.1579 0.0525  0.2058  485 MET A CA  
3296 C C   . MET A 441 ? 1.2531 0.8103 1.2726 -0.1756 0.0607  0.2367  485 MET A C   
3297 O O   . MET A 441 ? 1.3029 0.8088 1.3070 -0.1568 0.0537  0.2682  485 MET A O   
3298 C CB  . MET A 441 ? 1.1482 0.8318 1.2094 -0.1533 0.0354  0.2064  485 MET A CB  
3299 C CG  . MET A 441 ? 1.1596 0.8484 1.2116 -0.1277 0.0108  0.2386  485 MET A CG  
3300 S SD  . MET A 441 ? 1.0960 0.8618 1.1471 -0.1277 -0.0076 0.2325  485 MET A SD  
3301 C CE  . MET A 441 ? 1.1090 0.8580 1.0986 -0.1559 -0.0042 0.2516  485 MET A CE  
3302 N N   . LEU A 442 ? 1.1836 0.7494 1.1836 -0.2105 0.0769  0.2287  486 LEU A N   
3303 C CA  . LEU A 442 ? 1.2264 0.7423 1.1799 -0.2313 0.0888  0.2577  486 LEU A CA  
3304 C C   . LEU A 442 ? 1.2054 0.7211 1.1623 -0.2728 0.1176  0.2348  486 LEU A C   
3305 O O   . LEU A 442 ? 1.1453 0.7192 1.1333 -0.2841 0.1219  0.2002  486 LEU A O   
3306 C CB  . LEU A 442 ? 1.2101 0.7548 1.1241 -0.2286 0.0739  0.2815  486 LEU A CB  
3307 C CG  . LEU A 442 ? 1.2159 0.7739 1.1233 -0.1934 0.0414  0.3062  486 LEU A CG  
3308 C CD1 . LEU A 442 ? 1.1954 0.7901 1.0632 -0.2005 0.0292  0.3173  486 LEU A CD1 
3309 C CD2 . LEU A 442 ? 1.2864 0.7749 1.1748 -0.1733 0.0341  0.3435  486 LEU A CD2 
3310 N N   . GLU A 443 ? 1.5368 0.9890 1.4633 -0.2958 0.1376  0.2547  487 GLU A N   
3311 C CA  . GLU A 443 ? 1.5109 0.9694 1.4448 -0.3385 0.1662  0.2344  487 GLU A CA  
3312 C C   . GLU A 443 ? 1.4895 0.9815 1.3893 -0.3551 0.1738  0.2467  487 GLU A C   
3313 O O   . GLU A 443 ? 1.5325 0.9951 1.3817 -0.3464 0.1674  0.2828  487 GLU A O   
3314 C CB  . GLU A 443 ? 1.5757 0.9552 1.5007 -0.3563 0.1858  0.2457  487 GLU A CB  
3315 C CG  . GLU A 443 ? 1.5988 0.9276 1.5476 -0.3402 0.1822  0.2348  487 GLU A CG  
3316 C CD  . GLU A 443 ? 1.6631 0.9292 1.6110 -0.3537 0.1953  0.2379  487 GLU A CD  
3317 O OE1 . GLU A 443 ? 1.7232 0.9666 1.6416 -0.3666 0.2043  0.2644  487 GLU A OE1 
3318 O OE2 . GLU A 443 ? 1.6726 0.9112 1.6478 -0.3517 0.1974  0.2124  487 GLU A OE2 
3319 N N   . GLY A 444 ? 1.1790 0.7345 1.1053 -0.3770 0.1865  0.2161  488 GLY A N   
3320 C CA  . GLY A 444 ? 1.1626 0.7604 1.0656 -0.3862 0.1956  0.2208  488 GLY A CA  
3321 C C   . GLY A 444 ? 1.1149 0.7635 1.0073 -0.3671 0.1761  0.2177  488 GLY A C   
3322 O O   . GLY A 444 ? 1.1169 0.7684 1.0149 -0.3355 0.1484  0.2220  488 GLY A O   
3323 N N   . PRO A 445 ? 1.0540 0.7500 0.9375 -0.3804 0.1893  0.2078  489 PRO A N   
3324 C CA  . PRO A 445 ? 1.0098 0.7589 0.8896 -0.3584 0.1702  0.1986  489 PRO A CA  
3325 C C   . PRO A 445 ? 1.0537 0.7725 0.8769 -0.3394 0.1485  0.2312  489 PRO A C   
3326 O O   . PRO A 445 ? 1.1101 0.7804 0.8815 -0.3510 0.1580  0.2606  489 PRO A O   
3327 C CB  . PRO A 445 ? 0.9840 0.7774 0.8624 -0.3804 0.1968  0.1828  489 PRO A CB  
3328 C CG  . PRO A 445 ? 1.0383 0.7974 0.9007 -0.3964 0.2195  0.1967  489 PRO A CG  
3329 C CD  . PRO A 445 ? 1.0623 0.7776 0.9511 -0.4005 0.2168  0.1998  489 PRO A CD  
3330 N N   . HIS A 446 ? 1.0515 0.7984 0.8836 -0.3120 0.1196  0.2270  490 HIS A N   
3331 C CA  . HIS A 446 ? 1.0887 0.8170 0.8729 -0.2953 0.0945  0.2550  490 HIS A CA  
3332 C C   . HIS A 446 ? 1.0490 0.8288 0.8350 -0.2825 0.0776  0.2388  490 HIS A C   
3333 O O   . HIS A 446 ? 0.9940 0.8174 0.8264 -0.2769 0.0788  0.2100  490 HIS A O   
3334 C CB  . HIS A 446 ? 1.1186 0.8161 0.9175 -0.2705 0.0694  0.2742  490 HIS A CB  
3335 C CG  . HIS A 446 ? 1.1779 0.8081 0.9612 -0.2774 0.0810  0.2989  490 HIS A CG  
3336 N ND1 . HIS A 446 ? 1.1765 0.7866 0.9907 -0.2952 0.1062  0.2841  490 HIS A ND1 
3337 C CD2 . HIS A 446 ? 1.2433 0.8188 0.9833 -0.2680 0.0696  0.3379  490 HIS A CD2 
3338 C CE1 . HIS A 446 ? 1.2406 0.7809 1.0304 -0.2977 0.1123  0.3124  490 HIS A CE1 
3339 N NE2 . HIS A 446 ? 1.2824 0.8001 1.0265 -0.2795 0.0904  0.3470  490 HIS A NE2 
3340 N N   . TYR A 447 ? 1.1246 0.8968 0.8573 -0.2787 0.0614  0.2572  491 TYR A N   
3341 C CA  . TYR A 447 ? 1.0992 0.9099 0.8348 -0.2644 0.0380  0.2455  491 TYR A CA  
3342 C C   . TYR A 447 ? 1.1064 0.9145 0.8677 -0.2400 0.0052  0.2604  491 TYR A C   
3343 O O   . TYR A 447 ? 1.1535 0.9234 0.8962 -0.2335 -0.0058 0.2897  491 TYR A O   
3344 C CB  . TYR A 447 ? 1.1354 0.9405 0.8016 -0.2736 0.0341  0.2543  491 TYR A CB  
3345 C CG  . TYR A 447 ? 1.1380 0.9443 0.7738 -0.2958 0.0696  0.2418  491 TYR A CG  
3346 C CD1 . TYR A 447 ? 1.1723 0.9430 0.7813 -0.3144 0.0959  0.2579  491 TYR A CD1 
3347 C CD2 . TYR A 447 ? 1.1123 0.9531 0.7454 -0.2978 0.0787  0.2151  491 TYR A CD2 
3348 C CE1 . TYR A 447 ? 1.1758 0.9525 0.7609 -0.3353 0.1315  0.2470  491 TYR A CE1 
3349 C CE2 . TYR A 447 ? 1.1188 0.9640 0.7273 -0.3150 0.1133  0.2035  491 TYR A CE2 
3350 C CZ  . TYR A 447 ? 1.1480 0.9646 0.7346 -0.3342 0.1402  0.2192  491 TYR A CZ  
3351 O OH  . TYR A 447 ? 1.1572 0.9832 0.7245 -0.3523 0.1784  0.2079  491 TYR A OH  
3352 N N   . TYR A 448 ? 1.0433 0.8917 0.8485 -0.2254 -0.0087 0.2415  492 TYR A N   
3353 C CA  . TYR A 448 ? 1.0462 0.9004 0.8855 -0.2020 -0.0356 0.2530  492 TYR A CA  
3354 C C   . TYR A 448 ? 1.0259 0.9205 0.8742 -0.1935 -0.0591 0.2448  492 TYR A C   
3355 O O   . TYR A 448 ? 0.9934 0.9136 0.8399 -0.2017 -0.0507 0.2218  492 TYR A O   
3356 C CB  . TYR A 448 ? 1.0194 0.8755 0.9177 -0.1912 -0.0247 0.2392  492 TYR A CB  
3357 C CG  . TYR A 448 ? 0.9676 0.8508 0.8917 -0.2017 -0.0014 0.2059  492 TYR A CG  
3358 C CD1 . TYR A 448 ? 0.9191 0.8460 0.8662 -0.1950 -0.0063 0.1843  492 TYR A CD1 
3359 C CD2 . TYR A 448 ? 0.9700 0.8355 0.8958 -0.2188 0.0246  0.1974  492 TYR A CD2 
3360 C CE1 . TYR A 448 ? 0.8749 0.8275 0.8436 -0.2010 0.0122  0.1569  492 TYR A CE1 
3361 C CE2 . TYR A 448 ? 0.9234 0.8213 0.8767 -0.2272 0.0423  0.1674  492 TYR A CE2 
3362 C CZ  . TYR A 448 ? 0.8767 0.8183 0.8502 -0.2163 0.0350  0.1481  492 TYR A CZ  
3363 O OH  . TYR A 448 ? 0.8345 0.8092 0.8341 -0.2209 0.0500  0.1209  492 TYR A OH  
3364 N N   . THR A 449 ? 1.0375 0.9371 0.8969 -0.1770 -0.0883 0.2645  493 THR A N   
3365 C CA  . THR A 449 ? 1.0247 0.9642 0.8994 -0.1713 -0.1126 0.2588  493 THR A CA  
3366 C C   . THR A 449 ? 1.0243 0.9818 0.9540 -0.1468 -0.1328 0.2712  493 THR A C   
3367 O O   . THR A 449 ? 1.0500 0.9813 0.9876 -0.1327 -0.1356 0.2922  493 THR A O   
3368 C CB  . THR A 449 ? 1.0684 1.0025 0.8823 -0.1833 -0.1339 0.2728  493 THR A CB  
3369 O OG1 . THR A 449 ? 1.0601 1.0328 0.8935 -0.1801 -0.1611 0.2683  493 THR A OG1 
3370 C CG2 . THR A 449 ? 1.1219 1.0224 0.9049 -0.1762 -0.1489 0.3082  493 THR A CG2 
3371 N N   . ILE A 450 ? 0.8180 0.8183 0.7861 -0.1413 -0.1442 0.2583  494 ILE A N   
3372 C CA  . ILE A 450 ? 0.8171 0.8449 0.8417 -0.1186 -0.1624 0.2691  494 ILE A CA  
3373 C C   . ILE A 450 ? 0.8316 0.8923 0.8546 -0.1203 -0.1974 0.2819  494 ILE A C   
3374 O O   . ILE A 450 ? 0.8250 0.9057 0.8325 -0.1380 -0.2029 0.2668  494 ILE A O   
3375 C CB  . ILE A 450 ? 0.7740 0.8300 0.8532 -0.1105 -0.1459 0.2452  494 ILE A CB  
3376 C CG1 . ILE A 450 ? 0.7560 0.7839 0.8433 -0.1064 -0.1164 0.2326  494 ILE A CG1 
3377 C CG2 . ILE A 450 ? 0.7720 0.8644 0.9100 -0.0891 -0.1628 0.2551  494 ILE A CG2 
3378 C CD1 . ILE A 450 ? 0.7038 0.7556 0.8245 -0.1040 -0.0976 0.2048  494 ILE A CD1 
3379 N N   . LEU A 451 ? 0.9219 0.9880 0.9627 -0.1016 -0.2217 0.3092  495 LEU A N   
3380 C CA  . LEU A 451 ? 0.9198 1.0261 0.9689 -0.1014 -0.2597 0.3230  495 LEU A CA  
3381 C C   . LEU A 451 ? 0.8780 1.0318 1.0095 -0.0779 -0.2698 0.3274  495 LEU A C   
3382 O O   . LEU A 451 ? 0.8702 1.0130 1.0406 -0.0557 -0.2508 0.3283  495 LEU A O   
3383 C CB  . LEU A 451 ? 0.9636 1.0448 0.9632 -0.0973 -0.2854 0.3553  495 LEU A CB  
3384 C CG  . LEU A 451 ? 1.0036 1.0392 0.9165 -0.1218 -0.2742 0.3527  495 LEU A CG  
3385 C CD1 . LEU A 451 ? 1.0509 1.0479 0.9138 -0.1132 -0.2895 0.3880  495 LEU A CD1 
3386 C CD2 . LEU A 451 ? 1.0076 1.0665 0.8862 -0.1480 -0.2884 0.3352  495 LEU A CD2 
3387 N N   . ASP A 452 ? 0.9944 1.2009 1.1522 -0.0842 -0.2979 0.3283  496 ASP A N   
3388 C CA  . ASP A 452 ? 0.9450 1.2066 1.1849 -0.0627 -0.3107 0.3360  496 ASP A CA  
3389 C C   . ASP A 452 ? 0.9092 1.1750 1.2024 -0.0484 -0.2752 0.3182  496 ASP A C   
3390 O O   . ASP A 452 ? 0.8970 1.1697 1.2392 -0.0184 -0.2701 0.3296  496 ASP A O   
3391 C CB  . ASP A 452 ? 0.9647 1.2266 1.2183 -0.0334 -0.3361 0.3710  496 ASP A CB  
3392 C CG  . ASP A 452 ? 0.9111 1.2390 1.2546 -0.0088 -0.3523 0.3812  496 ASP A CG  
3393 O OD1 . ASP A 452 ? 0.8659 1.2540 1.2461 -0.0241 -0.3688 0.3718  496 ASP A OD1 
3394 O OD2 . ASP A 452 ? 0.9149 1.2328 1.2938 0.0260  -0.3465 0.3982  496 ASP A OD2 
3395 N N   . SER A 453 ? 0.7180 0.9756 0.9965 -0.0682 -0.2501 0.2905  497 SER A N   
3396 C CA  . SER A 453 ? 0.6803 0.9449 1.0014 -0.0576 -0.2184 0.2719  497 SER A CA  
3397 C C   . SER A 453 ? 0.7086 0.9384 1.0402 -0.0314 -0.1989 0.2772  497 SER A C   
3398 O O   . SER A 453 ? 0.6784 0.9256 1.0624 -0.0101 -0.1841 0.2732  497 SER A O   
3399 C CB  . SER A 453 ? 0.6124 0.9399 1.0054 -0.0508 -0.2251 0.2717  497 SER A CB  
3400 O OG  . SER A 453 ? 0.5819 0.9395 0.9686 -0.0788 -0.2415 0.2642  497 SER A OG  
3401 N N   . GLY A 454 ? 0.8084 0.9867 1.0885 -0.0338 -0.1974 0.2859  498 GLY A N   
3402 C CA  . GLY A 454 ? 0.8346 0.9697 1.1178 -0.0142 -0.1776 0.2889  498 GLY A CA  
3403 C C   . GLY A 454 ? 0.8534 0.9773 1.1523 0.0126  -0.1959 0.3198  498 GLY A C   
3404 O O   . GLY A 454 ? 0.8793 0.9607 1.1814 0.0308  -0.1801 0.3244  498 GLY A O   
3405 N N   . GLY A 455 ? 0.9896 1.1502 1.2980 0.0155  -0.2302 0.3410  499 GLY A N   
3406 C CA  . GLY A 455 ? 1.0086 1.1626 1.3312 0.0441  -0.2522 0.3741  499 GLY A CA  
3407 C C   . GLY A 455 ? 1.0687 1.1538 1.3207 0.0388  -0.2527 0.3921  499 GLY A C   
3408 O O   . GLY A 455 ? 1.0997 1.1485 1.3526 0.0647  -0.2559 0.4169  499 GLY A O   
3409 N N   . ILE A 456 ? 1.0111 1.0764 1.2010 0.0054  -0.2475 0.3803  500 ILE A N   
3410 C CA  . ILE A 456 ? 1.0634 1.0651 1.1816 -0.0055 -0.2430 0.3954  500 ILE A CA  
3411 C C   . ILE A 456 ? 1.0627 1.0375 1.1456 -0.0342 -0.2104 0.3668  500 ILE A C   
3412 O O   . ILE A 456 ? 1.0366 1.0432 1.1162 -0.0549 -0.2072 0.3432  500 ILE A O   
3413 C CB  . ILE A 456 ? 1.0887 1.0973 1.1520 -0.0182 -0.2775 0.4176  500 ILE A CB  
3414 C CG1 . ILE A 456 ? 1.0828 1.1304 1.1833 0.0095  -0.3169 0.4469  500 ILE A CG1 
3415 C CG2 . ILE A 456 ? 1.1453 1.0840 1.1315 -0.0282 -0.2681 0.4362  500 ILE A CG2 
3416 C CD1 . ILE A 456 ? 1.1241 1.1235 1.2215 0.0414  -0.3194 0.4809  500 ILE A CD1 
3417 N N   . ILE A 457 ? 1.0046 0.9204 1.0629 -0.0355 -0.1860 0.3692  501 ILE A N   
3418 C CA  . ILE A 457 ? 1.0015 0.8924 1.0215 -0.0645 -0.1577 0.3469  501 ILE A CA  
3419 C C   . ILE A 457 ? 1.0483 0.8881 0.9982 -0.0786 -0.1574 0.3702  501 ILE A C   
3420 O O   . ILE A 457 ? 1.0901 0.8870 1.0280 -0.0630 -0.1624 0.3992  501 ILE A O   
3421 C CB  . ILE A 457 ? 0.9887 0.8587 1.0402 -0.0618 -0.1256 0.3240  501 ILE A CB  
3422 C CG1 . ILE A 457 ? 0.9480 0.8678 1.0612 -0.0479 -0.1240 0.3014  501 ILE A CG1 
3423 C CG2 . ILE A 457 ? 0.9761 0.8290 0.9928 -0.0920 -0.0996 0.3026  501 ILE A CG2 
3424 C CD1 . ILE A 457 ? 0.9379 0.8416 1.0786 -0.0447 -0.0948 0.2757  501 ILE A CD1 
3425 N N   . VAL A 458 ? 1.1057 0.9479 1.0074 -0.1069 -0.1498 0.3586  502 VAL A N   
3426 C CA  . VAL A 458 ? 1.1519 0.9492 0.9804 -0.1231 -0.1466 0.3797  502 VAL A CA  
3427 C C   . VAL A 458 ? 1.1404 0.9150 0.9459 -0.1501 -0.1082 0.3580  502 VAL A C   
3428 O O   . VAL A 458 ? 1.0932 0.9017 0.9199 -0.1612 -0.0947 0.3259  502 VAL A O   
3429 C CB  . VAL A 458 ? 1.1669 0.9888 0.9484 -0.1320 -0.1759 0.3893  502 VAL A CB  
3430 C CG1 . VAL A 458 ? 1.2186 0.9946 0.9171 -0.1499 -0.1690 0.4086  502 VAL A CG1 
3431 C CG2 . VAL A 458 ? 1.1737 1.0224 0.9811 -0.1065 -0.2165 0.4133  502 VAL A CG2 
3432 N N   . ALA A 459 ? 1.1260 0.8446 0.8903 -0.1602 -0.0906 0.3766  503 ALA A N   
3433 C CA  . ALA A 459 ? 1.1168 0.8168 0.8632 -0.1880 -0.0532 0.3586  503 ALA A CA  
3434 C C   . ALA A 459 ? 1.1711 0.8248 0.8404 -0.2083 -0.0405 0.3827  503 ALA A C   
3435 O O   . ALA A 459 ? 1.2294 0.8361 0.8633 -0.1995 -0.0509 0.4191  503 ALA A O   
3436 C CB  . ALA A 459 ? 1.1074 0.7854 0.9017 -0.1857 -0.0305 0.3461  503 ALA A CB  
3437 N N   . ILE A 460 ? 1.3259 0.9923 0.9694 -0.2344 -0.0159 0.3630  504 ILE A N   
3438 C CA  . ILE A 460 ? 1.3735 1.0006 0.9455 -0.2570 0.0045  0.3809  504 ILE A CA  
3439 C C   . ILE A 460 ? 1.3564 0.9719 0.9475 -0.2815 0.0479  0.3630  504 ILE A C   
3440 O O   . ILE A 460 ? 1.2984 0.9579 0.9318 -0.2891 0.0626  0.3279  504 ILE A O   
3441 C CB  . ILE A 460 ? 1.3757 1.0298 0.8951 -0.2679 -0.0010 0.3724  504 ILE A CB  
3442 C CG1 . ILE A 460 ? 1.4069 1.0671 0.8964 -0.2497 -0.0456 0.3939  504 ILE A CG1 
3443 C CG2 . ILE A 460 ? 1.4249 1.0451 0.8759 -0.2916 0.0293  0.3827  504 ILE A CG2 
3444 C CD1 . ILE A 460 ? 1.4870 1.0965 0.9030 -0.2484 -0.0539 0.4337  504 ILE A CD1 
3445 N N   . GLU A 461 ? 1.6509 1.2081 1.2121 -0.2941 0.0678  0.3874  505 GLU A N   
3446 C CA  . GLU A 461 ? 1.6416 1.1952 1.2291 -0.3170 0.1092  0.3673  505 GLU A CA  
3447 C C   . GLU A 461 ? 1.6165 1.2127 1.1908 -0.3357 0.1337  0.3426  505 GLU A C   
3448 O O   . GLU A 461 ? 1.6476 1.2461 1.1655 -0.3345 0.1298  0.3514  505 GLU A O   
3449 C CB  . GLU A 461 ? 1.7185 1.2113 1.2831 -0.3186 0.1258  0.3938  505 GLU A CB  
3450 C CG  . GLU A 461 ? 1.7362 1.2328 1.3109 -0.3455 0.1674  0.3790  505 GLU A CG  
3451 C CD  . GLU A 461 ? 1.8168 1.2531 1.3852 -0.3498 0.1835  0.4035  505 GLU A CD  
3452 O OE1 . GLU A 461 ? 1.8603 1.2478 1.4151 -0.3287 0.1638  0.4322  505 GLU A OE1 
3453 O OE2 . GLU A 461 ? 1.8408 1.2799 1.4208 -0.3737 0.2155  0.3946  505 GLU A OE2 
3454 N N   . HIS A 462 ? 1.6208 1.2520 1.2482 -0.3512 0.1583  0.3107  506 HIS A N   
3455 C CA  . HIS A 462 ? 1.5996 1.2732 1.2239 -0.3655 0.1841  0.2873  506 HIS A CA  
3456 C C   . HIS A 462 ? 1.6563 1.3113 1.2770 -0.3830 0.2174  0.2924  506 HIS A C   
3457 O O   . HIS A 462 ? 1.6485 1.3005 1.3188 -0.3941 0.2318  0.2833  506 HIS A O   
3458 C CB  . HIS A 462 ? 1.5193 1.2510 1.2082 -0.3692 0.1899  0.2501  506 HIS A CB  
3459 C CG  . HIS A 462 ? 1.4971 1.2750 1.1944 -0.3800 0.2178  0.2254  506 HIS A CG  
3460 N ND1 . HIS A 462 ? 1.5157 1.3044 1.1623 -0.3771 0.2211  0.2248  506 HIS A ND1 
3461 C CD2 . HIS A 462 ? 1.4671 1.2844 1.2190 -0.3921 0.2426  0.2000  506 HIS A CD2 
3462 C CE1 . HIS A 462 ? 1.4991 1.3292 1.1691 -0.3854 0.2495  0.2011  506 HIS A CE1 
3463 N NE2 . HIS A 462 ? 1.4685 1.3199 1.2045 -0.3942 0.2616  0.1867  506 HIS A NE2 
3464 N N   . SER A 463 ? 1.2987 0.9420 0.8602 -0.3866 0.2291  0.3061  507 SER A N   
3465 C CA  . SER A 463 ? 1.3688 0.9900 0.9189 -0.4036 0.2603  0.3175  507 SER A CA  
3466 C C   . SER A 463 ? 1.3879 1.0412 0.9139 -0.4146 0.2879  0.3045  507 SER A C   
3467 O O   . SER A 463 ? 1.3800 1.0511 0.8667 -0.4058 0.2798  0.2975  507 SER A O   
3468 C CB  . SER A 463 ? 1.4606 1.0151 0.9544 -0.3962 0.2503  0.3593  507 SER A CB  
3469 O OG  . SER A 463 ? 1.5300 1.0607 1.0189 -0.4149 0.2816  0.3714  507 SER A OG  
3470 N N   . SER A 464 ? 1.4416 1.1016 0.9924 -0.4345 0.3210  0.3004  508 SER A N   
3471 C CA  . SER A 464 ? 1.4780 1.1613 1.0034 -0.4450 0.3512  0.2936  508 SER A CA  
3472 C C   . SER A 464 ? 1.5761 1.2105 1.0110 -0.4414 0.3509  0.3263  508 SER A C   
3473 O O   . SER A 464 ? 1.6089 1.2568 1.0004 -0.4426 0.3666  0.3215  508 SER A O   
3474 C CB  . SER A 464 ? 1.4890 1.1941 1.0689 -0.4685 0.3850  0.2830  508 SER A CB  
3475 O OG  . SER A 464 ? 1.5449 1.1988 1.1271 -0.4795 0.3869  0.3076  508 SER A OG  
3476 N N   . ARG A 465 ? 1.9286 1.5064 1.3347 -0.4345 0.3317  0.3590  509 ARG A N   
3477 C CA  . ARG A 465 ? 2.0285 1.5581 1.3497 -0.4287 0.3272  0.3941  509 ARG A CA  
3478 C C   . ARG A 465 ? 2.0288 1.5347 1.3067 -0.4034 0.2825  0.4113  509 ARG A C   
3479 O O   . ARG A 465 ? 1.9621 1.4750 1.2814 -0.3919 0.2567  0.4041  509 ARG A O   
3480 C CB  . ARG A 465 ? 2.1085 1.5893 1.4277 -0.4413 0.3449  0.4239  509 ARG A CB  
3481 C CG  . ARG A 465 ? 2.1285 1.6311 1.4807 -0.4690 0.3887  0.4114  509 ARG A CG  
3482 C CD  . ARG A 465 ? 2.2248 1.6716 1.5607 -0.4826 0.4048  0.4451  509 ARG A CD  
3483 N NE  . ARG A 465 ? 2.3251 1.7260 1.5697 -0.4724 0.3994  0.4821  509 ARG A NE  
3484 C CZ  . ARG A 465 ? 2.4234 1.7655 1.6350 -0.4769 0.4060  0.5201  509 ARG A CZ  
3485 N NH1 . ARG A 465 ? 2.4355 1.7538 1.6983 -0.4932 0.4191  0.5247  509 ARG A NH1 
3486 N NH2 . ARG A 465 ? 2.5148 1.8208 1.6408 -0.4653 0.3987  0.5533  509 ARG A NH2 
3487 N N   . PRO A 466 ? 1.9394 1.4202 1.1343 -0.3950 0.2722  0.4338  510 PRO A N   
3488 C CA  . PRO A 466 ? 1.9472 1.4138 1.0987 -0.3716 0.2267  0.4491  510 PRO A CA  
3489 C C   . PRO A 466 ? 1.9398 1.3745 1.1177 -0.3538 0.1962  0.4733  510 PRO A C   
3490 O O   . PRO A 466 ? 1.9676 1.3691 1.1729 -0.3582 0.2111  0.4903  510 PRO A O   
3491 C CB  . PRO A 466 ? 2.0580 1.4958 1.1181 -0.3698 0.2285  0.4743  510 PRO A CB  
3492 C CG  . PRO A 466 ? 2.0762 1.5350 1.1302 -0.3914 0.2736  0.4551  510 PRO A CG  
3493 C CD  . PRO A 466 ? 2.0232 1.4970 1.1614 -0.4077 0.3028  0.4411  510 PRO A CD  
3494 N N   . ILE A 467 ? 1.8970 1.3429 1.0695 -0.3338 0.1540  0.4734  511 ILE A N   
3495 C CA  . ILE A 467 ? 1.8881 1.3099 1.0873 -0.3122 0.1222  0.4951  511 ILE A CA  
3496 C C   . ILE A 467 ? 1.9363 1.3500 1.0794 -0.2883 0.0779  0.5196  511 ILE A C   
3497 O O   . ILE A 467 ? 1.9276 1.3719 1.0351 -0.2889 0.0607  0.5050  511 ILE A O   
3498 C CB  . ILE A 467 ? 1.7763 1.2321 1.0529 -0.3103 0.1111  0.4676  511 ILE A CB  
3499 C CG1 . ILE A 467 ? 1.7095 1.2192 0.9846 -0.3134 0.0976  0.4366  511 ILE A CG1 
3500 C CG2 . ILE A 467 ? 1.7384 1.1972 1.0780 -0.3301 0.1488  0.4481  511 ILE A CG2 
3501 C CD1 . ILE A 467 ? 1.6893 1.2133 0.9587 -0.2923 0.0479  0.4444  511 ILE A CD1 
3502 N N   . ASN A 468 ? 2.0113 1.3835 1.1452 -0.2673 0.0604  0.5564  512 ASN A N   
3503 C CA  . ASN A 468 ? 2.0483 1.4207 1.1471 -0.2393 0.0122  0.5798  512 ASN A CA  
3504 C C   . ASN A 468 ? 1.9865 1.3731 1.1452 -0.2150 -0.0247 0.5817  512 ASN A C   
3505 O O   . ASN A 468 ? 2.0167 1.4083 1.1595 -0.1888 -0.0661 0.6025  512 ASN A O   
3506 C CB  . ASN A 468 ? 2.1716 1.4952 1.2087 -0.2260 0.0118  0.6232  512 ASN A CB  
3507 C CG  . ASN A 468 ? 2.2054 1.4774 1.2761 -0.2174 0.0297  0.6496  512 ASN A CG  
3508 O OD1 . ASN A 468 ? 2.1514 1.4187 1.2810 -0.2327 0.0573  0.6314  512 ASN A OD1 
3509 N ND2 . ASN A 468 ? 2.2995 1.5323 1.3336 -0.1925 0.0136  0.6920  512 ASN A ND2 
3510 N N   . VAL A 469 ? 1.9236 1.3194 1.1532 -0.2225 -0.0101 0.5603  513 VAL A N   
3511 C CA  . VAL A 469 ? 1.8831 1.2791 1.1720 -0.1978 -0.0365 0.5675  513 VAL A CA  
3512 C C   . VAL A 469 ? 1.7722 1.2229 1.1222 -0.2011 -0.0522 0.5358  513 VAL A C   
3513 O O   . VAL A 469 ? 1.7138 1.1900 1.0816 -0.2263 -0.0277 0.5041  513 VAL A O   
3514 C CB  . VAL A 469 ? 1.9119 1.2516 1.2334 -0.1952 -0.0080 0.5811  513 VAL A CB  
3515 C CG1 . VAL A 469 ? 1.9397 1.2591 1.2471 -0.2282 0.0418  0.5710  513 VAL A CG1 
3516 C CG2 . VAL A 469 ? 1.8297 1.1804 1.2296 -0.1883 -0.0132 0.5631  513 VAL A CG2 
3517 N N   . ILE A 470 ? 1.7376 1.2103 1.1227 -0.1740 -0.0928 0.5454  514 ILE A N   
3518 C CA  . ILE A 470 ? 1.6455 1.1672 1.0991 -0.1730 -0.1072 0.5217  514 ILE A CA  
3519 C C   . ILE A 470 ? 1.6359 1.1386 1.1544 -0.1473 -0.1142 0.5337  514 ILE A C   
3520 O O   . ILE A 470 ? 1.6954 1.1550 1.2025 -0.1235 -0.1199 0.5627  514 ILE A O   
3521 C CB  . ILE A 470 ? 1.6209 1.2017 1.0700 -0.1657 -0.1494 0.5163  514 ILE A CB  
3522 C CG1 . ILE A 470 ? 1.5408 1.1764 1.0495 -0.1747 -0.1501 0.4822  514 ILE A CG1 
3523 C CG2 . ILE A 470 ? 1.6473 1.2358 1.1124 -0.1295 -0.1914 0.5444  514 ILE A CG2 
3524 C CD1 . ILE A 470 ? 1.5259 1.2129 1.0157 -0.1810 -0.1777 0.4674  514 ILE A CD1 
3525 N N   . LYS A 471 ? 1.4934 1.0304 1.0828 -0.1478 -0.1090 0.5055  515 LYS A N   
3526 C CA  . LYS A 471 ? 1.4862 1.0104 1.1428 -0.1216 -0.1086 0.5055  515 LYS A CA  
3527 C C   . LYS A 471 ? 1.4281 1.0235 1.1538 -0.1002 -0.1333 0.4842  515 LYS A C   
3528 O O   . LYS A 471 ? 1.3782 1.0277 1.1175 -0.1151 -0.1326 0.4533  515 LYS A O   
3529 C CB  . LYS A 471 ? 1.4709 0.9689 1.1566 -0.1412 -0.0661 0.4782  515 LYS A CB  
3530 C CG  . LYS A 471 ? 1.5120 0.9547 1.1401 -0.1736 -0.0329 0.4876  515 LYS A CG  
3531 C CD  . LYS A 471 ? 1.4844 0.9187 1.1559 -0.1947 0.0047  0.4539  515 LYS A CD  
3532 C CE  . LYS A 471 ? 1.5310 0.9095 1.1572 -0.2282 0.0412  0.4635  515 LYS A CE  
3533 N NZ  . LYS A 471 ? 1.5119 0.8743 1.1864 -0.2470 0.0725  0.4349  515 LYS A NZ  
3534 N N   . PHE A 472 ? 1.4905 1.0847 1.2617 -0.0648 -0.1521 0.5003  516 PHE A N   
3535 C CA  . PHE A 472 ? 1.4364 1.1001 1.2773 -0.0442 -0.1728 0.4823  516 PHE A CA  
3536 C C   . PHE A 472 ? 1.4295 1.0823 1.3380 -0.0137 -0.1648 0.4787  516 PHE A C   
3537 O O   . PHE A 472 ? 1.4773 1.0657 1.3773 0.0013  -0.1553 0.5008  516 PHE A O   
3538 C CB  . PHE A 472 ? 1.4408 1.1464 1.2710 -0.0288 -0.2181 0.5068  516 PHE A CB  
3539 C CG  . PHE A 472 ? 1.4950 1.1610 1.3075 0.0014  -0.2406 0.5534  516 PHE A CG  
3540 C CD1 . PHE A 472 ? 1.5590 1.1742 1.2892 -0.0074 -0.2417 0.5802  516 PHE A CD1 
3541 C CD2 . PHE A 472 ? 1.4852 1.1658 1.3630 0.0413  -0.2557 0.5657  516 PHE A CD2 
3542 C CE1 . PHE A 472 ? 1.6233 1.2050 1.3356 0.0249  -0.2543 0.6102  516 PHE A CE1 
3543 C CE2 . PHE A 472 ? 1.5393 1.1871 1.4021 0.0736  -0.2703 0.5979  516 PHE A CE2 
3544 C CZ  . PHE A 472 ? 1.6162 1.2136 1.3943 0.0658  -0.2697 0.6192  516 PHE A CZ  
3545 N N   . SER A 473 ? 1.2349 0.9475 1.2071 -0.0046 -0.1672 0.4507  517 SER A N   
3546 C CA  . SER A 473 ? 1.2234 0.9370 1.2624 0.0261  -0.1596 0.4432  517 SER A CA  
3547 C C   . SER A 473 ? 1.1744 0.9666 1.2737 0.0469  -0.1834 0.4372  517 SER A C   
3548 O O   . SER A 473 ? 1.1327 0.9797 1.2391 0.0278  -0.1878 0.4150  517 SER A O   
3549 C CB  . SER A 473 ? 1.2067 0.9044 1.2649 0.0100  -0.1223 0.4046  517 SER A CB  
3550 O OG  . SER A 473 ? 1.1930 0.9011 1.3133 0.0389  -0.1155 0.3921  517 SER A OG  
3551 N N   . THR A 474 ? 1.4050 1.2022 1.5492 0.0860  -0.1973 0.4576  518 THR A N   
3552 C CA  . THR A 474 ? 1.3529 1.2287 1.5653 0.1062  -0.2154 0.4512  518 THR A CA  
3553 C C   . THR A 474 ? 1.3256 1.2100 1.5992 0.1227  -0.1870 0.4228  518 THR A C   
3554 O O   . THR A 474 ? 1.2770 1.2260 1.6097 0.1371  -0.1938 0.4136  518 THR A O   
3555 C CB  . THR A 474 ? 1.3624 1.2574 1.5983 0.1425  -0.2511 0.4908  518 THR A CB  
3556 O OG1 . THR A 474 ? 1.3812 1.2393 1.6569 0.1819  -0.2369 0.5007  518 THR A OG1 
3557 C CG2 . THR A 474 ? 1.4144 1.2724 1.5765 0.1337  -0.2750 0.5257  518 THR A CG2 
3558 N N   . ASP A 475 ? 1.0695 0.8876 1.3268 0.1195  -0.1550 0.4093  519 ASP A N   
3559 C CA  . ASP A 475 ? 1.0571 0.8696 1.3579 0.1327  -0.1255 0.3796  519 ASP A CA  
3560 C C   . ASP A 475 ? 1.0357 0.8590 1.3256 0.0998  -0.1010 0.3383  519 ASP A C   
3561 O O   . ASP A 475 ? 1.0480 0.8402 1.3478 0.1018  -0.0736 0.3135  519 ASP A O   
3562 C CB  . ASP A 475 ? 1.1088 0.8425 1.4096 0.1576  -0.1075 0.3891  519 ASP A CB  
3563 C CG  . ASP A 475 ? 1.1622 0.8163 1.4003 0.1297  -0.0911 0.3905  519 ASP A CG  
3564 O OD1 . ASP A 475 ? 1.1525 0.8176 1.3519 0.0911  -0.0891 0.3787  519 ASP A OD1 
3565 O OD2 . ASP A 475 ? 1.2137 0.7927 1.4435 0.1467  -0.0780 0.4031  519 ASP A OD2 
3566 N N   . GLU A 476 ? 1.0808 0.9363 1.3407 0.0683  -0.1105 0.3321  520 GLU A N   
3567 C CA  . GLU A 476 ? 1.0581 0.9276 1.3059 0.0387  -0.0906 0.2964  520 GLU A CA  
3568 C C   . GLU A 476 ? 1.0897 0.8966 1.3004 0.0180  -0.0660 0.2834  520 GLU A C   
3569 O O   . GLU A 476 ? 1.0790 0.8862 1.2979 0.0074  -0.0446 0.2515  520 GLU A O   
3570 C CB  . GLU A 476 ? 1.0251 0.9373 1.3232 0.0517  -0.0779 0.2696  520 GLU A CB  
3571 C CG  . GLU A 476 ? 0.9847 0.9664 1.3249 0.0653  -0.0977 0.2780  520 GLU A CG  
3572 C CD  . GLU A 476 ? 0.9481 0.9698 1.3290 0.0722  -0.0800 0.2510  520 GLU A CD  
3573 O OE1 . GLU A 476 ? 0.9675 0.9595 1.3504 0.0778  -0.0548 0.2294  520 GLU A OE1 
3574 O OE2 . GLU A 476 ? 0.8992 0.9804 1.3076 0.0707  -0.0911 0.2512  520 GLU A OE2 
3575 N N   . GLY A 477 ? 1.3031 1.0582 1.4728 0.0112  -0.0697 0.3088  521 GLY A N   
3576 C CA  . GLY A 477 ? 1.3285 1.0296 1.4605 -0.0163 -0.0470 0.2992  521 GLY A CA  
3577 C C   . GLY A 477 ? 1.3777 1.0079 1.5148 -0.0058 -0.0275 0.2989  521 GLY A C   
3578 O O   . GLY A 477 ? 1.4010 0.9847 1.5108 -0.0319 -0.0074 0.2899  521 GLY A O   
3579 N N   . GLN A 478 ? 1.3621 0.9830 1.5355 0.0313  -0.0314 0.3073  522 GLN A N   
3580 C CA  . GLN A 478 ? 1.4126 0.9594 1.5905 0.0440  -0.0110 0.3042  522 GLN A CA  
3581 C C   . GLN A 478 ? 1.4707 0.9423 1.6064 0.0426  -0.0123 0.3410  522 GLN A C   
3582 O O   . GLN A 478 ? 1.5088 0.9140 1.6191 0.0214  0.0100  0.3339  522 GLN A O   
3583 C CB  . GLN A 478 ? 1.4073 0.9673 1.6374 0.0875  -0.0118 0.3015  522 GLN A CB  
3584 C CG  . GLN A 478 ? 1.3468 0.9615 1.6116 0.0869  -0.0006 0.2615  522 GLN A CG  
3585 C CD  . GLN A 478 ? 1.3558 0.9891 1.6719 0.1296  0.0019  0.2593  522 GLN A CD  
3586 O OE1 . GLN A 478 ? 1.4198 1.0375 1.7541 0.1634  -0.0090 0.2896  522 GLN A OE1 
3587 N NE2 . GLN A 478 ? 1.2906 0.9593 1.6302 0.1299  0.0170  0.2240  522 GLN A NE2 
3588 N N   . CYS A 479 ? 1.5582 1.0389 1.6849 0.0640  -0.0388 0.3810  523 CYS A N   
3589 C CA  . CYS A 479 ? 1.6116 1.0266 1.6829 0.0554  -0.0417 0.4182  523 CYS A CA  
3590 C C   . CYS A 479 ? 1.5969 1.0512 1.6302 0.0430  -0.0678 0.4432  523 CYS A C   
3591 O O   . CYS A 479 ? 1.5486 1.0793 1.6041 0.0519  -0.0924 0.4420  523 CYS A O   
3592 C CB  . CYS A 479 ? 1.6745 1.0193 1.7495 0.0942  -0.0434 0.4505  523 CYS A CB  
3593 S SG  . CYS A 479 ? 1.6431 1.0125 1.7951 0.1425  -0.0410 0.4325  523 CYS A SG  
3594 N N   . TRP A 480 ? 1.4821 0.8783 1.4544 0.0210  -0.0606 0.4661  524 TRP A N   
3595 C CA  . TRP A 480 ? 1.4782 0.8998 1.3988 0.0008  -0.0780 0.4851  524 TRP A CA  
3596 C C   . TRP A 480 ? 1.5447 0.9097 1.4142 0.0165  -0.0939 0.5368  524 TRP A C   
3597 O O   . TRP A 480 ? 1.6008 0.8910 1.4659 0.0351  -0.0838 0.5581  524 TRP A O   
3598 C CB  . TRP A 480 ? 1.4679 0.8841 1.3551 -0.0476 -0.0504 0.4604  524 TRP A CB  
3599 C CG  . TRP A 480 ? 1.3977 0.8835 1.3257 -0.0615 -0.0437 0.4152  524 TRP A CG  
3600 C CD1 . TRP A 480 ? 1.3752 0.8664 1.3498 -0.0618 -0.0244 0.3795  524 TRP A CD1 
3601 C CD2 . TRP A 480 ? 1.3447 0.9018 1.2669 -0.0758 -0.0567 0.4012  524 TRP A CD2 
3602 N NE1 . TRP A 480 ? 1.3109 0.8737 1.3088 -0.0741 -0.0253 0.3467  524 TRP A NE1 
3603 C CE2 . TRP A 480 ? 1.2908 0.8929 1.2587 -0.0827 -0.0440 0.3593  524 TRP A CE2 
3604 C CE3 . TRP A 480 ? 1.3430 0.9262 1.2214 -0.0838 -0.0777 0.4195  524 TRP A CE3 
3605 C CZ2 . TRP A 480 ? 1.2347 0.9032 1.2080 -0.0953 -0.0505 0.3375  524 TRP A CZ2 
3606 C CZ3 . TRP A 480 ? 1.2885 0.9368 1.1728 -0.0982 -0.0836 0.3944  524 TRP A CZ3 
3607 C CH2 . TRP A 480 ? 1.2346 0.9233 1.1671 -0.1031 -0.0694 0.3550  524 TRP A CH2 
3608 N N   . GLN A 481 ? 1.9322 1.3307 1.7585 0.0086  -0.1191 0.5566  525 GLN A N   
3609 C CA  . GLN A 481 ? 2.0063 1.3613 1.7666 0.0191  -0.1320 0.5966  525 GLN A CA  
3610 C C   . GLN A 481 ? 2.0148 1.3785 1.7052 -0.0188 -0.1270 0.5960  525 GLN A C   
3611 O O   . GLN A 481 ? 1.9546 1.3633 1.6523 -0.0491 -0.1223 0.5708  525 GLN A O   
3612 C CB  . GLN A 481 ? 2.0087 1.4090 1.7887 0.0617  -0.1737 0.6171  525 GLN A CB  
3613 C CG  . GLN A 481 ? 2.0271 1.4061 1.8630 0.1054  -0.1744 0.6226  525 GLN A CG  
3614 C CD  . GLN A 481 ? 2.0371 1.4730 1.8983 0.1456  -0.2152 0.6397  525 GLN A CD  
3615 O OE1 . GLN A 481 ? 1.9620 1.4840 1.8659 0.1451  -0.2390 0.6272  525 GLN A OE1 
3616 N NE2 . GLN A 481 ? 2.1369 1.5259 1.9698 0.1790  -0.2242 0.6683  525 GLN A NE2 
3617 N N   . THR A 482 ? 1.7678 1.0873 1.3893 -0.0148 -0.1257 0.6236  526 THR A N   
3618 C CA  . THR A 482 ? 1.7945 1.1109 1.3465 -0.0489 -0.1112 0.6233  526 THR A CA  
3619 C C   . THR A 482 ? 1.8561 1.1889 1.3514 -0.0317 -0.1427 0.6504  526 THR A C   
3620 O O   . THR A 482 ? 1.9305 1.2333 1.4126 0.0035  -0.1583 0.6811  526 THR A O   
3621 C CB  . THR A 482 ? 1.8619 1.1012 1.3819 -0.0694 -0.0652 0.6287  526 THR A CB  
3622 O OG1 . THR A 482 ? 1.8373 1.0436 1.4138 -0.0694 -0.0438 0.6120  526 THR A OG1 
3623 C CG2 . THR A 482 ? 1.8409 1.0978 1.3276 -0.1138 -0.0385 0.6088  526 THR A CG2 
3624 N N   . TYR A 483 ? 1.8748 1.2547 1.3354 -0.0561 -0.1516 0.6371  527 TYR A N   
3625 C CA  . TYR A 483 ? 1.9298 1.3318 1.3340 -0.0456 -0.1828 0.6558  527 TYR A CA  
3626 C C   . TYR A 483 ? 1.9666 1.3566 1.2963 -0.0796 -0.1589 0.6505  527 TYR A C   
3627 O O   . TYR A 483 ? 1.9051 1.3200 1.2391 -0.1120 -0.1397 0.6194  527 TYR A O   
3628 C CB  . TYR A 483 ? 1.8592 1.3441 1.3016 -0.0375 -0.2264 0.6406  527 TYR A CB  
3629 C CG  . TYR A 483 ? 1.9137 1.4274 1.2991 -0.0322 -0.2605 0.6530  527 TYR A CG  
3630 C CD1 . TYR A 483 ? 2.0051 1.4985 1.3634 0.0019  -0.2835 0.6879  527 TYR A CD1 
3631 C CD2 . TYR A 483 ? 1.8812 1.4403 1.2380 -0.0603 -0.2697 0.6286  527 TYR A CD2 
3632 C CE1 . TYR A 483 ? 2.0614 1.5831 1.3669 0.0063  -0.3163 0.6981  527 TYR A CE1 
3633 C CE2 . TYR A 483 ? 1.9369 1.5198 1.2399 -0.0573 -0.3009 0.6365  527 TYR A CE2 
3634 C CZ  . TYR A 483 ? 2.0269 1.5929 1.3048 -0.0246 -0.3251 0.6713  527 TYR A CZ  
3635 O OH  . TYR A 483 ? 2.0892 1.6810 1.3125 -0.0218 -0.3580 0.6785  527 TYR A OH  
3636 N N   . THR A 484 ? 1.9515 1.3048 1.2139 -0.0701 -0.1589 0.6813  528 THR A N   
3637 C CA  . THR A 484 ? 1.9988 1.3446 1.1879 -0.0980 -0.1385 0.6791  528 THR A CA  
3638 C C   . THR A 484 ? 2.0004 1.4008 1.1546 -0.0953 -0.1798 0.6730  528 THR A C   
3639 O O   . THR A 484 ? 2.0609 1.4665 1.1936 -0.0668 -0.2155 0.6986  528 THR A O   
3640 C CB  . THR A 484 ? 2.1220 1.4035 1.2542 -0.0881 -0.1196 0.7190  528 THR A CB  
3641 O OG1 . THR A 484 ? 2.1282 1.3561 1.2964 -0.0928 -0.0806 0.7248  528 THR A OG1 
3642 C CG2 . THR A 484 ? 2.1771 1.4561 1.2325 -0.1152 -0.0998 0.7181  528 THR A CG2 
3643 N N   . PHE A 485 ? 2.0152 1.4565 1.1647 -0.1246 -0.1749 0.6379  529 PHE A N   
3644 C CA  . PHE A 485 ? 2.0091 1.5035 1.1343 -0.1254 -0.2143 0.6255  529 PHE A CA  
3645 C C   . PHE A 485 ? 2.0976 1.5797 1.1297 -0.1384 -0.2100 0.6306  529 PHE A C   
3646 O O   . PHE A 485 ? 2.1131 1.6322 1.1156 -0.1382 -0.2442 0.6223  529 PHE A O   
3647 C CB  . PHE A 485 ? 1.8987 1.4458 1.0707 -0.1464 -0.2166 0.5844  529 PHE A CB  
3648 C CG  . PHE A 485 ? 1.8623 1.3967 1.0277 -0.1788 -0.1683 0.5576  529 PHE A CG  
3649 C CD1 . PHE A 485 ? 1.8937 1.4299 0.9952 -0.2022 -0.1514 0.5407  529 PHE A CD1 
3650 C CD2 . PHE A 485 ? 1.7974 1.3221 1.0245 -0.1848 -0.1400 0.5470  529 PHE A CD2 
3651 C CE1 . PHE A 485 ? 1.8591 1.3909 0.9628 -0.2286 -0.1063 0.5148  529 PHE A CE1 
3652 C CE2 . PHE A 485 ? 1.7630 1.2848 0.9915 -0.2133 -0.0971 0.5207  529 PHE A CE2 
3653 C CZ  . PHE A 485 ? 1.7921 1.3196 0.9616 -0.2341 -0.0798 0.5050  529 PHE A CZ  
3654 N N   . THR A 486 ? 2.1807 1.6126 1.1692 -0.1510 -0.1671 0.6426  530 THR A N   
3655 C CA  . THR A 486 ? 2.2704 1.6876 1.1697 -0.1638 -0.1562 0.6484  530 THR A CA  
3656 C C   . THR A 486 ? 2.3588 1.7148 1.2235 -0.1628 -0.1191 0.6815  530 THR A C   
3657 O O   . THR A 486 ? 2.3309 1.6583 1.2434 -0.1660 -0.0886 0.6854  530 THR A O   
3658 C CB  . THR A 486 ? 2.2238 1.6637 1.1082 -0.1982 -0.1288 0.6068  530 THR A CB  
3659 O OG1 . THR A 486 ? 2.3190 1.7388 1.1167 -0.2100 -0.1115 0.6131  530 THR A OG1 
3660 C CG2 . THR A 486 ? 2.1547 1.5834 1.0936 -0.2167 -0.0822 0.5892  530 THR A CG2 
3661 N N   . ARG A 487 ? 2.4371 1.7735 1.2193 -0.1597 -0.1218 0.7051  531 ARG A N   
3662 C CA  . ARG A 487 ? 2.5265 1.8090 1.2671 -0.1673 -0.0804 0.7335  531 ARG A CA  
3663 C C   . ARG A 487 ? 2.5040 1.7887 1.2327 -0.2051 -0.0311 0.7034  531 ARG A C   
3664 O O   . ARG A 487 ? 2.4982 1.7555 1.2562 -0.2205 0.0119  0.7059  531 ARG A O   
3665 C CB  . ARG A 487 ? 2.6569 1.9213 1.3103 -0.1507 -0.1008 0.7701  531 ARG A CB  
3666 C CG  . ARG A 487 ? 2.7005 1.9582 1.3634 -0.1089 -0.1446 0.8073  531 ARG A CG  
3667 C CD  . ARG A 487 ? 2.8284 2.0807 1.4009 -0.0923 -0.1713 0.8393  531 ARG A CD  
3668 N NE  . ARG A 487 ? 2.9371 2.1372 1.4468 -0.1025 -0.1319 0.8714  531 ARG A NE  
3669 C CZ  . ARG A 487 ? 2.9864 2.1835 1.4276 -0.1300 -0.1063 0.8605  531 ARG A CZ  
3670 N NH1 . ARG A 487 ? 2.9385 2.1783 1.3629 -0.1490 -0.1152 0.8174  531 ARG A NH1 
3671 N NH2 . ARG A 487 ? 3.0877 2.2380 1.4781 -0.1388 -0.0706 0.8929  531 ARG A NH2 
3672 N N   . ASP A 488 ? 2.4925 1.8116 1.1816 -0.2197 -0.0375 0.6737  532 ASP A N   
3673 C CA  . ASP A 488 ? 2.4750 1.8012 1.1521 -0.2514 0.0084  0.6432  532 ASP A CA  
3674 C C   . ASP A 488 ? 2.3445 1.7017 1.1067 -0.2640 0.0214  0.6052  532 ASP A C   
3675 O O   . ASP A 488 ? 2.2738 1.6704 1.0589 -0.2616 -0.0073 0.5785  532 ASP A O   
3676 C CB  . ASP A 488 ? 2.5111 1.8615 1.1180 -0.2597 -0.0041 0.6218  532 ASP A CB  
3677 C CG  . ASP A 488 ? 2.6307 1.9643 1.1550 -0.2417 -0.0364 0.6554  532 ASP A CG  
3678 O OD1 . ASP A 488 ? 2.7233 2.0155 1.2122 -0.2343 -0.0218 0.6958  532 ASP A OD1 
3679 O OD2 . ASP A 488 ? 2.6351 1.9984 1.1308 -0.2355 -0.0771 0.6412  532 ASP A OD2 
3680 N N   . PRO A 489 ? 2.2827 1.6246 1.0918 -0.2793 0.0650  0.6017  533 PRO A N   
3681 C CA  . PRO A 489 ? 2.1628 1.5352 1.0549 -0.2905 0.0781  0.5668  533 PRO A CA  
3682 C C   . PRO A 489 ? 2.1175 1.5296 1.0029 -0.3104 0.0969  0.5247  533 PRO A C   
3683 O O   . PRO A 489 ? 2.1848 1.5923 1.0071 -0.3206 0.1154  0.5225  533 PRO A O   
3684 C CB  . PRO A 489 ? 2.1716 1.5138 1.1045 -0.3032 0.1203  0.5778  533 PRO A CB  
3685 C CG  . PRO A 489 ? 2.2901 1.5810 1.1698 -0.2922 0.1197  0.6246  533 PRO A CG  
3686 C CD  . PRO A 489 ? 2.3629 1.6597 1.1550 -0.2874 0.1021  0.6311  533 PRO A CD  
3687 N N   . ILE A 490 ? 1.9392 1.3886 0.8882 -0.3143 0.0929  0.4922  534 ILE A N   
3688 C CA  . ILE A 490 ? 1.8924 1.3802 0.8403 -0.3286 0.1076  0.4517  534 ILE A CA  
3689 C C   . ILE A 490 ? 1.8044 1.3177 0.8299 -0.3425 0.1420  0.4240  534 ILE A C   
3690 O O   . ILE A 490 ? 1.7658 1.2715 0.8506 -0.3409 0.1456  0.4321  534 ILE A O   
3691 C CB  . ILE A 490 ? 1.8456 1.3639 0.7918 -0.3188 0.0629  0.4344  534 ILE A CB  
3692 C CG1 . ILE A 490 ? 1.7419 1.2832 0.7715 -0.3121 0.0458  0.4254  534 ILE A CG1 
3693 C CG2 . ILE A 490 ? 1.9222 1.4240 0.8088 -0.3026 0.0197  0.4618  534 ILE A CG2 
3694 C CD1 . ILE A 490 ? 1.6969 1.2699 0.7328 -0.3040 0.0023  0.4116  534 ILE A CD1 
3695 N N   . TYR A 491 ? 1.6665 1.5654 0.8685 -0.3776 0.2466  0.2698  535 TYR A N   
3696 C CA  . TYR A 491 ? 1.5860 1.5335 0.8789 -0.3936 0.2631  0.2392  535 TYR A CA  
3697 C C   . TYR A 491 ? 1.5463 1.5195 0.9026 -0.3664 0.2224  0.2133  535 TYR A C   
3698 O O   . TYR A 491 ? 1.5571 1.5583 0.9032 -0.3471 0.2044  0.1911  535 TYR A O   
3699 C CB  . TYR A 491 ? 1.5644 1.5746 0.8586 -0.4056 0.2970  0.2124  535 TYR A CB  
3700 C CG  . TYR A 491 ? 1.5893 1.5987 0.8501 -0.4423 0.3476  0.2295  535 TYR A CG  
3701 C CD1 . TYR A 491 ? 1.5570 1.5982 0.8814 -0.4750 0.3781  0.2216  535 TYR A CD1 
3702 C CD2 . TYR A 491 ? 1.6927 1.6751 0.8577 -0.4466 0.3656  0.2525  535 TYR A CD2 
3703 C CE1 . TYR A 491 ? 1.6234 1.6701 0.9250 -0.5118 0.4242  0.2349  535 TYR A CE1 
3704 C CE2 . TYR A 491 ? 1.7623 1.7445 0.8968 -0.4826 0.4147  0.2690  535 TYR A CE2 
3705 C CZ  . TYR A 491 ? 1.7227 1.7382 0.9406 -0.5080 0.4385  0.2567  535 TYR A CZ  
3706 O OH  . TYR A 491 ? 1.7870 1.8083 1.0038 -0.5300 0.4750  0.2661  535 TYR A OH  
3707 N N   . PHE A 492 ? 1.3658 1.3276 0.7847 -0.3669 0.2102  0.2142  536 PHE A N   
3708 C CA  . PHE A 492 ? 1.2877 1.2686 0.7634 -0.3418 0.1723  0.1944  536 PHE A CA  
3709 C C   . PHE A 492 ? 1.2251 1.2696 0.7570 -0.3385 0.1778  0.1538  536 PHE A C   
3710 O O   . PHE A 492 ? 1.1844 1.2619 0.7603 -0.3556 0.2046  0.1414  536 PHE A O   
3711 C CB  . PHE A 492 ? 1.2554 1.2070 0.7788 -0.3439 0.1638  0.2062  536 PHE A CB  
3712 C CG  . PHE A 492 ? 1.1923 1.1661 0.7775 -0.3212 0.1299  0.1874  536 PHE A CG  
3713 C CD1 . PHE A 492 ? 1.1263 1.1471 0.7829 -0.3245 0.1350  0.1571  536 PHE A CD1 
3714 C CD2 . PHE A 492 ? 1.2010 1.1528 0.7719 -0.2957 0.0933  0.2015  536 PHE A CD2 
3715 C CE1 . PHE A 492 ? 1.0759 1.1119 0.7824 -0.3047 0.1064  0.1426  536 PHE A CE1 
3716 C CE2 . PHE A 492 ? 1.1470 1.1212 0.7735 -0.2785 0.0651  0.1857  536 PHE A CE2 
3717 C CZ  . PHE A 492 ? 1.0862 1.0980 0.7787 -0.2838 0.0724  0.1568  536 PHE A CZ  
3718 N N   . THR A 493 ? 1.6344 1.6965 1.1599 -0.3171 0.1547  0.1330  537 THR A N   
3719 C CA  . THR A 493 ? 1.5866 1.6934 1.1674 -0.3066 0.1546  0.0966  537 THR A CA  
3720 C C   . THR A 493 ? 1.5448 1.6548 1.1912 -0.2921 0.1250  0.0860  537 THR A C   
3721 O O   . THR A 493 ? 1.4789 1.6219 1.1821 -0.2874 0.1322  0.0641  537 THR A O   
3722 C CB  . THR A 493 ? 1.6367 1.7592 1.1734 -0.2953 0.1583  0.0724  537 THR A CB  
3723 O OG1 . THR A 493 ? 1.5810 1.7223 1.1625 -0.2778 0.1451  0.0416  537 THR A OG1 
3724 C CG2 . THR A 493 ? 1.6692 1.7589 1.1337 -0.2894 0.1330  0.0846  537 THR A CG2 
3725 N N   . GLY A 494 ? 1.2483 1.3283 0.8856 -0.2828 0.0920  0.1022  538 GLY A N   
3726 C CA  . GLY A 494 ? 1.2181 1.3057 0.9083 -0.2685 0.0641  0.0894  538 GLY A CA  
3727 C C   . GLY A 494 ? 1.2445 1.3109 0.9277 -0.2576 0.0282  0.1079  538 GLY A C   
3728 O O   . GLY A 494 ? 1.2911 1.3369 0.9196 -0.2559 0.0188  0.1300  538 GLY A O   
3729 N N   . LEU A 495 ? 0.9588 1.0349 0.6989 -0.2485 0.0091  0.0999  539 LEU A N   
3730 C CA  . LEU A 495 ? 0.9680 1.0403 0.7150 -0.2364 -0.0255 0.1121  539 LEU A CA  
3731 C C   . LEU A 495 ? 0.9703 1.0632 0.7353 -0.2338 -0.0444 0.0854  539 LEU A C   
3732 O O   . LEU A 495 ? 0.9332 1.0356 0.7314 -0.2349 -0.0319 0.0624  539 LEU A O   
3733 C CB  . LEU A 495 ? 0.9207 0.9864 0.7208 -0.2298 -0.0289 0.1250  539 LEU A CB  
3734 C CG  . LEU A 495 ? 0.9363 0.9671 0.7164 -0.2331 -0.0126 0.1529  539 LEU A CG  
3735 C CD1 . LEU A 495 ? 0.8935 0.9139 0.7248 -0.2256 -0.0157 0.1599  539 LEU A CD1 
3736 C CD2 . LEU A 495 ? 1.0026 1.0113 0.7204 -0.2236 -0.0266 0.1800  539 LEU A CD2 
3737 N N   . ALA A 496 ? 0.9255 1.0251 0.6665 -0.2306 -0.0745 0.0892  540 ALA A N   
3738 C CA  . ALA A 496 ? 0.9099 1.0262 0.6716 -0.2336 -0.0961 0.0660  540 ALA A CA  
3739 C C   . ALA A 496 ? 0.8875 1.0244 0.6758 -0.2261 -0.1282 0.0833  540 ALA A C   
3740 O O   . ALA A 496 ? 0.9242 1.0646 0.6838 -0.2171 -0.1422 0.1086  540 ALA A O   
3741 C CB  . ALA A 496 ? 0.9614 1.0756 0.6640 -0.2435 -0.1015 0.0453  540 ALA A CB  
3742 N N   . SER A 497 ? 0.8365 0.9883 0.6799 -0.2272 -0.1379 0.0718  541 SER A N   
3743 C CA  . SER A 497 ? 0.8204 1.0036 0.6955 -0.2212 -0.1672 0.0847  541 SER A CA  
3744 C C   . SER A 497 ? 0.7864 0.9837 0.7021 -0.2342 -0.1751 0.0606  541 SER A C   
3745 O O   . SER A 497 ? 0.7627 0.9380 0.6936 -0.2388 -0.1545 0.0422  541 SER A O   
3746 C CB  . SER A 497 ? 0.7892 0.9695 0.7002 -0.2018 -0.1621 0.1116  541 SER A CB  
3747 O OG  . SER A 497 ? 0.7296 0.9069 0.6956 -0.2020 -0.1484 0.1012  541 SER A OG  
3748 N N   . GLU A 498 ? 0.9637 1.1996 0.8964 -0.2399 -0.2043 0.0618  542 GLU A N   
3749 C CA  . GLU A 498 ? 0.9113 1.1587 0.8762 -0.2595 -0.2120 0.0389  542 GLU A CA  
3750 C C   . GLU A 498 ? 0.8440 1.0776 0.8634 -0.2527 -0.1924 0.0384  542 GLU A C   
3751 O O   . GLU A 498 ? 0.8011 1.0490 0.8581 -0.2345 -0.1906 0.0596  542 GLU A O   
3752 C CB  . GLU A 498 ? 0.8805 1.1859 0.8647 -0.2682 -0.2464 0.0440  542 GLU A CB  
3753 C CG  . GLU A 498 ? 0.8436 1.1593 0.8543 -0.2974 -0.2536 0.0191  542 GLU A CG  
3754 C CD  . GLU A 498 ? 0.8034 1.1925 0.8526 -0.3062 -0.2849 0.0271  542 GLU A CD  
3755 O OE1 . GLU A 498 ? 0.8310 1.2440 0.8678 -0.3385 -0.3047 0.0059  542 GLU A OE1 
3756 O OE2 . GLU A 498 ? 0.7592 1.1838 0.8512 -0.2812 -0.2888 0.0535  542 GLU A OE2 
3757 N N   . PRO A 499 ? 0.7577 0.9589 0.7754 -0.2645 -0.1762 0.0142  543 PRO A N   
3758 C CA  . PRO A 499 ? 0.7043 0.8920 0.7672 -0.2584 -0.1589 0.0119  543 PRO A CA  
3759 C C   . PRO A 499 ? 0.6508 0.8770 0.7663 -0.2609 -0.1743 0.0235  543 PRO A C   
3760 O O   . PRO A 499 ? 0.6617 0.9197 0.7803 -0.2795 -0.1970 0.0194  543 PRO A O   
3761 C CB  . PRO A 499 ? 0.7441 0.8924 0.7835 -0.2737 -0.1482 -0.0165 543 PRO A CB  
3762 C CG  . PRO A 499 ? 0.8160 0.9465 0.7944 -0.2786 -0.1472 -0.0292 543 PRO A CG  
3763 C CD  . PRO A 499 ? 0.8262 0.9943 0.7888 -0.2783 -0.1694 -0.0112 543 PRO A CD  
3764 N N   . GLY A 500 ? 0.7178 0.9464 0.8741 -0.2433 -0.1617 0.0365  544 GLY A N   
3765 C CA  . GLY A 500 ? 0.6533 0.9195 0.8596 -0.2405 -0.1712 0.0490  544 GLY A CA  
3766 C C   . GLY A 500 ? 0.6413 0.9357 0.8625 -0.2169 -0.1789 0.0743  544 GLY A C   
3767 O O   . GLY A 500 ? 0.5921 0.9211 0.8556 -0.2083 -0.1847 0.0860  544 GLY A O   
3768 N N   . ALA A 501 ? 0.6515 0.9289 0.8355 -0.2058 -0.1773 0.0833  545 ALA A N   
3769 C CA  . ALA A 501 ? 0.6714 0.9553 0.8587 -0.1806 -0.1794 0.1086  545 ALA A CA  
3770 C C   . ALA A 501 ? 0.6524 0.9906 0.8653 -0.1696 -0.2036 0.1247  545 ALA A C   
3771 O O   . ALA A 501 ? 0.6403 0.9868 0.8774 -0.1446 -0.2011 0.1430  545 ALA A O   
3772 C CB  . ALA A 501 ? 0.6378 0.8982 0.8505 -0.1667 -0.1575 0.1128  545 ALA A CB  
3773 N N   . ARG A 502 ? 0.7545 1.1326 0.9648 -0.1883 -0.2260 0.1159  546 ARG A N   
3774 C CA  . ARG A 502 ? 0.7321 1.1786 0.9701 -0.1790 -0.2516 0.1301  546 ARG A CA  
3775 C C   . ARG A 502 ? 0.7889 1.2621 0.9882 -0.1674 -0.2761 0.1449  546 ARG A C   
3776 O O   . ARG A 502 ? 0.7678 1.3068 0.9915 -0.1534 -0.2989 0.1594  546 ARG A O   
3777 C CB  . ARG A 502 ? 0.6791 1.1705 0.9534 -0.2101 -0.2627 0.1116  546 ARG A CB  
3778 C CG  . ARG A 502 ? 0.6202 1.0977 0.9380 -0.2137 -0.2411 0.1057  546 ARG A CG  
3779 C CD  . ARG A 502 ? 0.5805 1.0983 0.9342 -0.2464 -0.2482 0.0910  546 ARG A CD  
3780 N NE  . ARG A 502 ? 0.5285 1.0326 0.9203 -0.2401 -0.2256 0.0932  546 ARG A NE  
3781 C CZ  . ARG A 502 ? 0.4821 1.0391 0.9255 -0.2273 -0.2256 0.1067  546 ARG A CZ  
3782 N NH1 . ARG A 502 ? 0.4772 1.1120 0.9464 -0.2186 -0.2483 0.1194  546 ARG A NH1 
3783 N NH2 . ARG A 502 ? 0.4452 0.9819 0.9135 -0.2213 -0.2028 0.1077  546 ARG A NH2 
3784 N N   . SER A 503 ? 0.7585 1.1876 0.8974 -0.1712 -0.2716 0.1428  547 SER A N   
3785 C CA  . SER A 503 ? 0.8101 1.2667 0.9058 -0.1617 -0.2964 0.1568  547 SER A CA  
3786 C C   . SER A 503 ? 0.8570 1.2889 0.9306 -0.1210 -0.2908 0.1911  547 SER A C   
3787 O O   . SER A 503 ? 0.8565 1.2460 0.9471 -0.1050 -0.2668 0.1999  547 SER A O   
3788 C CB  . SER A 503 ? 0.8694 1.2963 0.9029 -0.1878 -0.2966 0.1369  547 SER A CB  
3789 O OG  . SER A 503 ? 0.9395 1.3047 0.9226 -0.1753 -0.2750 0.1480  547 SER A OG  
3790 N N   . MET A 504 ? 1.0951 1.5525 1.1286 -0.1040 -0.3137 0.2106  548 MET A N   
3791 C CA  . MET A 504 ? 1.1607 1.5752 1.1502 -0.0678 -0.3062 0.2441  548 MET A CA  
3792 C C   . MET A 504 ? 1.2376 1.5986 1.1509 -0.0823 -0.2956 0.2421  548 MET A C   
3793 O O   . MET A 504 ? 1.3000 1.6148 1.1629 -0.0598 -0.2861 0.2693  548 MET A O   
3794 C CB  . MET A 504 ? 1.1567 1.6342 1.1473 -0.0309 -0.3375 0.2729  548 MET A CB  
3795 C CG  . MET A 504 ? 1.0795 1.6255 1.1477 -0.0141 -0.3485 0.2757  548 MET A CG  
3796 S SD  . MET A 504 ? 1.0803 1.5724 1.1762 0.0281  -0.3193 0.2981  548 MET A SD  
3797 C CE  . MET A 504 ? 1.0980 1.6402 1.1818 0.0899  -0.3459 0.3403  548 MET A CE  
3798 N N   . ASN A 505 ? 1.0057 1.3703 0.9071 -0.1195 -0.2955 0.2102  549 ASN A N   
3799 C CA  . ASN A 505 ? 1.0745 1.4039 0.9020 -0.1335 -0.2886 0.2049  549 ASN A CA  
3800 C C   . ASN A 505 ? 1.1042 1.3666 0.9195 -0.1506 -0.2492 0.1899  549 ASN A C   
3801 O O   . ASN A 505 ? 1.0685 1.3272 0.9220 -0.1707 -0.2367 0.1626  549 ASN A O   
3802 C CB  . ASN A 505 ? 1.0687 1.4465 0.8763 -0.1606 -0.3158 0.1789  549 ASN A CB  
3803 C CG  . ASN A 505 ? 1.0467 1.5032 0.8607 -0.1456 -0.3573 0.1940  549 ASN A CG  
3804 O OD1 . ASN A 505 ? 1.0960 1.5582 0.8617 -0.1191 -0.3706 0.2229  549 ASN A OD1 
3805 N ND2 . ASN A 505 ? 0.9934 1.5147 0.8664 -0.1630 -0.3780 0.1753  549 ASN A ND2 
3806 N N   . ILE A 506 ? 1.0100 1.2226 0.7710 -0.1418 -0.2296 0.2096  550 ILE A N   
3807 C CA  . ILE A 506 ? 1.0410 1.2008 0.7874 -0.1583 -0.1918 0.1983  550 ILE A CA  
3808 C C   . ILE A 506 ? 1.1042 1.2412 0.7715 -0.1685 -0.1816 0.1994  550 ILE A C   
3809 O O   . ILE A 506 ? 1.1452 1.2746 0.7572 -0.1533 -0.1915 0.2270  550 ILE A O   
3810 C CB  . ILE A 506 ? 1.0482 1.1620 0.8132 -0.1449 -0.1663 0.2193  550 ILE A CB  
3811 C CG1 . ILE A 506 ? 1.0654 1.1414 0.8232 -0.1665 -0.1291 0.2048  550 ILE A CG1 
3812 C CG2 . ILE A 506 ? 1.0934 1.1771 0.8093 -0.1192 -0.1693 0.2592  550 ILE A CG2 
3813 C CD1 . ILE A 506 ? 1.0271 1.1234 0.8358 -0.1833 -0.1213 0.1704  550 ILE A CD1 
3814 N N   . SER A 507 ? 1.0436 1.1704 0.7038 -0.1913 -0.1609 0.1702  551 SER A N   
3815 C CA  . SER A 507 ? 1.1064 1.2147 0.6950 -0.2021 -0.1459 0.1663  551 SER A CA  
3816 C C   . SER A 507 ? 1.1076 1.1757 0.6901 -0.2091 -0.1037 0.1726  551 SER A C   
3817 O O   . SER A 507 ? 1.0503 1.1174 0.6840 -0.2175 -0.0842 0.1542  551 SER A O   
3818 C CB  . SER A 507 ? 1.1032 1.2299 0.6838 -0.2210 -0.1502 0.1262  551 SER A CB  
3819 O OG  . SER A 507 ? 1.1260 1.2893 0.6937 -0.2226 -0.1885 0.1195  551 SER A OG  
3820 N N   . ILE A 508 ? 1.2383 1.2763 0.7581 -0.2064 -0.0900 0.1994  552 ILE A N   
3821 C CA  . ILE A 508 ? 1.2467 1.2509 0.7529 -0.2204 -0.0480 0.2052  552 ILE A CA  
3822 C C   . ILE A 508 ? 1.2758 1.2861 0.7276 -0.2349 -0.0301 0.1882  552 ILE A C   
3823 O O   . ILE A 508 ? 1.3311 1.3381 0.7123 -0.2307 -0.0405 0.2001  552 ILE A O   
3824 C CB  . ILE A 508 ? 1.2836 1.2395 0.7470 -0.2122 -0.0372 0.2476  552 ILE A CB  
3825 C CG1 . ILE A 508 ? 1.2612 1.2023 0.7724 -0.1937 -0.0505 0.2651  552 ILE A CG1 
3826 C CG2 . ILE A 508 ? 1.3003 1.2254 0.7453 -0.2355 0.0078  0.2510  552 ILE A CG2 
3827 C CD1 . ILE A 508 ? 1.2910 1.2381 0.7745 -0.1629 -0.0867 0.2924  552 ILE A CD1 
3828 N N   . TRP A 509 ? 1.3000 1.3222 0.7821 -0.2492 -0.0029 0.1606  553 TRP A N   
3829 C CA  . TRP A 509 ? 1.3270 1.3591 0.7620 -0.2590 0.0167  0.1402  553 TRP A CA  
3830 C C   . TRP A 509 ? 1.3311 1.3498 0.7414 -0.2740 0.0603  0.1526  553 TRP A C   
3831 O O   . TRP A 509 ? 1.2919 1.3073 0.7500 -0.2836 0.0815  0.1579  553 TRP A O   
3832 C CB  . TRP A 509 ? 1.3036 1.3617 0.7817 -0.2597 0.0177  0.0988  553 TRP A CB  
3833 C CG  . TRP A 509 ? 1.3187 1.3864 0.7912 -0.2538 -0.0194 0.0817  553 TRP A CG  
3834 C CD1 . TRP A 509 ? 1.2938 1.3705 0.8104 -0.2472 -0.0522 0.0861  553 TRP A CD1 
3835 C CD2 . TRP A 509 ? 1.3577 1.4286 0.7763 -0.2572 -0.0265 0.0554  553 TRP A CD2 
3836 N NE1 . TRP A 509 ? 1.3077 1.3970 0.8043 -0.2502 -0.0799 0.0643  553 TRP A NE1 
3837 C CE2 . TRP A 509 ? 1.3508 1.4326 0.7846 -0.2570 -0.0654 0.0441  553 TRP A CE2 
3838 C CE3 . TRP A 509 ? 1.3957 1.4619 0.7536 -0.2616 -0.0025 0.0387  553 TRP A CE3 
3839 C CZ2 . TRP A 509 ? 1.3819 1.4652 0.7704 -0.2649 -0.0818 0.0151  553 TRP A CZ2 
3840 C CZ3 . TRP A 509 ? 1.4332 1.4974 0.7425 -0.2646 -0.0183 0.0102  553 TRP A CZ3 
3841 C CH2 . TRP A 509 ? 1.4271 1.4975 0.7510 -0.2681 -0.0581 -0.0023 553 TRP A CH2 
3842 N N   . GLY A 510 ? 1.5708 1.5851 0.9055 -0.2788 0.0741  0.1559  554 GLY A N   
3843 C CA  . GLY A 510 ? 1.5782 1.5838 0.8834 -0.2964 0.1177  0.1688  554 GLY A CA  
3844 C C   . GLY A 510 ? 1.6332 1.6398 0.8510 -0.2993 0.1326  0.1674  554 GLY A C   
3845 O O   . GLY A 510 ? 1.6665 1.6815 0.8446 -0.2881 0.1087  0.1506  554 GLY A O   
3846 N N   . PHE A 511 ? 1.8671 1.8653 1.0523 -0.3174 0.1737  0.1842  555 PHE A N   
3847 C CA  . PHE A 511 ? 1.9222 1.9197 1.0187 -0.3213 0.1936  0.1871  555 PHE A CA  
3848 C C   . PHE A 511 ? 1.9549 1.9142 0.9986 -0.3391 0.2234  0.2302  555 PHE A C   
3849 O O   . PHE A 511 ? 1.9211 1.8682 1.0087 -0.3576 0.2458  0.2442  555 PHE A O   
3850 C CB  . PHE A 511 ? 1.9011 1.9448 1.0119 -0.3249 0.2244  0.1475  555 PHE A CB  
3851 C CG  . PHE A 511 ? 1.8362 1.9125 1.0222 -0.3414 0.2611  0.1393  555 PHE A CG  
3852 C CD1 . PHE A 511 ? 1.8359 1.9183 1.0014 -0.3668 0.3067  0.1579  555 PHE A CD1 
3853 C CD2 . PHE A 511 ? 1.7749 1.8803 1.0505 -0.3329 0.2506  0.1125  555 PHE A CD2 
3854 C CE1 . PHE A 511 ? 1.7694 1.8943 1.0078 -0.3857 0.3389  0.1479  555 PHE A CE1 
3855 C CE2 . PHE A 511 ? 1.7094 1.8553 1.0543 -0.3470 0.2816  0.1041  555 PHE A CE2 
3856 C CZ  . PHE A 511 ? 1.7037 1.8636 1.0324 -0.3744 0.3248  0.1206  555 PHE A CZ  
3857 N N   . THR A 512 ? 1.8701 1.8062 0.8151 -0.3342 0.2223  0.2515  556 THR A N   
3858 C CA  . THR A 512 ? 1.9455 1.8343 0.8213 -0.3490 0.2509  0.2968  556 THR A CA  
3859 C C   . THR A 512 ? 1.9689 1.8796 0.8342 -0.3792 0.3099  0.2912  556 THR A C   
3860 O O   . THR A 512 ? 1.9348 1.9010 0.8247 -0.3800 0.3254  0.2524  556 THR A O   
3861 C CB  . THR A 512 ? 2.0371 1.8988 0.8051 -0.3293 0.2270  0.3220  556 THR A CB  
3862 O OG1 . THR A 512 ? 2.0742 1.9725 0.7903 -0.3287 0.2372  0.2934  556 THR A OG1 
3863 C CG2 . THR A 512 ? 2.0157 1.8756 0.8025 -0.2994 0.1668  0.3233  556 THR A CG2 
3864 N N   . GLU A 513 ? 2.5027 2.3695 1.3310 -0.4037 0.3442  0.3301  557 GLU A N   
3865 C CA  . GLU A 513 ? 2.5338 2.4277 1.3684 -0.4267 0.3969  0.3254  557 GLU A CA  
3866 C C   . GLU A 513 ? 2.6127 2.5227 1.3666 -0.4122 0.4071  0.3213  557 GLU A C   
3867 O O   . GLU A 513 ? 2.6907 2.5600 1.3617 -0.3917 0.3843  0.3467  557 GLU A O   
3868 C CB  . GLU A 513 ? 2.5908 2.4304 1.4287 -0.4455 0.4222  0.3634  557 GLU A CB  
3869 C CG  . GLU A 513 ? 2.5500 2.3414 1.4368 -0.4527 0.4063  0.3790  557 GLU A CG  
3870 C CD  . GLU A 513 ? 2.6053 2.3210 1.4274 -0.4241 0.3696  0.4176  557 GLU A CD  
3871 O OE1 . GLU A 513 ? 2.5960 2.3235 1.3778 -0.3975 0.3321  0.4129  557 GLU A OE1 
3872 O OE2 . GLU A 513 ? 2.6632 2.3103 1.4759 -0.4268 0.3771  0.4515  557 GLU A OE2 
3873 N N   . SER A 514 ? 2.6002 2.5724 1.3799 -0.4198 0.4415  0.2898  558 SER A N   
3874 C CA  . SER A 514 ? 2.6812 2.6717 1.3892 -0.4066 0.4585  0.2826  558 SER A CA  
3875 C C   . SER A 514 ? 2.7583 2.7447 1.4564 -0.4250 0.5050  0.3085  558 SER A C   
3876 O O   . SER A 514 ? 2.7247 2.7614 1.4909 -0.4446 0.5410  0.2924  558 SER A O   
3877 C CB  . SER A 514 ? 2.6277 2.6883 1.3677 -0.3977 0.4694  0.2304  558 SER A CB  
3878 O OG  . SER A 514 ? 2.5578 2.6715 1.3953 -0.4158 0.5012  0.2132  558 SER A OG  
3879 N N   . THR A 517 ? 3.0049 3.1591 1.6984 -0.3280 0.4424  0.0782  561 THR A N   
3880 C CA  . THR A 517 ? 3.0119 3.1220 1.6594 -0.3201 0.3867  0.0784  561 THR A CA  
3881 C C   . THR A 517 ? 2.9153 3.0127 1.6546 -0.3224 0.3515  0.0918  561 THR A C   
3882 O O   . THR A 517 ? 2.8368 2.9452 1.6453 -0.3091 0.3293  0.0607  561 THR A O   
3883 C CB  . THR A 517 ? 3.1087 3.1778 1.6668 -0.3219 0.3728  0.1205  561 THR A CB  
3884 O OG1 . THR A 517 ? 3.1369 3.2062 1.7100 -0.3365 0.4125  0.1580  561 THR A OG1 
3885 C CG2 . THR A 517 ? 3.2049 3.2702 1.6724 -0.3026 0.3695  0.0993  561 THR A CG2 
3886 N N   . SER A 518 ? 2.9128 2.9827 1.6478 -0.3389 0.3509  0.1392  562 SER A N   
3887 C CA  . SER A 518 ? 2.8409 2.8921 1.6527 -0.3420 0.3226  0.1580  562 SER A CA  
3888 C C   . SER A 518 ? 2.8181 2.8636 1.6601 -0.3205 0.2676  0.1341  562 SER A C   
3889 O O   . SER A 518 ? 2.7544 2.8121 1.6878 -0.3173 0.2543  0.1200  562 SER A O   
3890 C CB  . SER A 518 ? 2.7635 2.8509 1.6752 -0.3577 0.3552  0.1500  562 SER A CB  
3891 O OG  . SER A 518 ? 2.7302 2.8643 1.6951 -0.3426 0.3610  0.1032  562 SER A OG  
3892 N N   . GLN A 519 ? 2.4310 2.4617 1.1951 -0.3079 0.2368  0.1278  563 GLN A N   
3893 C CA  . GLN A 519 ? 2.4264 2.4588 1.2135 -0.2935 0.1885  0.0976  563 GLN A CA  
3894 C C   . GLN A 519 ? 2.3836 2.4076 1.2516 -0.2907 0.1546  0.1151  563 GLN A C   
3895 O O   . GLN A 519 ? 2.3921 2.3930 1.2526 -0.2925 0.1471  0.1579  563 GLN A O   
3896 C CB  . GLN A 519 ? 2.4929 2.5130 1.1797 -0.2863 0.1557  0.0961  563 GLN A CB  
3897 C CG  . GLN A 519 ? 2.5760 2.5919 1.1572 -0.2903 0.1888  0.1049  563 GLN A CG  
3898 C CD  . GLN A 519 ? 2.6525 2.6620 1.1340 -0.2829 0.1527  0.0968  563 GLN A CD  
3899 O OE1 . GLN A 519 ? 2.6802 2.6973 1.1314 -0.2805 0.1472  0.0508  563 GLN A OE1 
3900 N NE2 . GLN A 519 ? 2.7025 2.6965 1.1294 -0.2784 0.1273  0.1411  563 GLN A NE2 
3901 N N   . TRP A 520 ? 1.9466 1.9851 0.8889 -0.2849 0.1372  0.0822  564 TRP A N   
3902 C CA  . TRP A 520 ? 1.9015 1.9373 0.9263 -0.2819 0.1094  0.0939  564 TRP A CA  
3903 C C   . TRP A 520 ? 1.9288 1.9522 0.9234 -0.2737 0.0611  0.1170  564 TRP A C   
3904 O O   . TRP A 520 ? 1.9687 1.9962 0.9001 -0.2701 0.0355  0.1049  564 TRP A O   
3905 C CB  . TRP A 520 ? 1.8630 1.9151 0.9604 -0.2765 0.1011  0.0530  564 TRP A CB  
3906 C CG  . TRP A 520 ? 1.8512 1.9222 0.9677 -0.2761 0.1446  0.0254  564 TRP A CG  
3907 C CD1 . TRP A 520 ? 1.8906 1.9664 0.9460 -0.2728 0.1689  0.0002  564 TRP A CD1 
3908 C CD2 . TRP A 520 ? 1.7950 1.8888 0.9974 -0.2760 0.1690  0.0197  564 TRP A CD2 
3909 N NE1 . TRP A 520 ? 1.8614 1.9639 0.9620 -0.2675 0.2080  -0.0198 564 TRP A NE1 
3910 C CE2 . TRP A 520 ? 1.8002 1.9175 0.9922 -0.2699 0.2073  -0.0080 564 TRP A CE2 
3911 C CE3 . TRP A 520 ? 1.7402 1.8398 1.0257 -0.2789 0.1618  0.0343  564 TRP A CE3 
3912 C CZ2 . TRP A 520 ? 1.7476 1.9014 1.0128 -0.2654 0.2363  -0.0198 564 TRP A CZ2 
3913 C CZ3 . TRP A 520 ? 1.6894 1.8216 1.0437 -0.2779 0.1899  0.0209  564 TRP A CZ3 
3914 C CH2 . TRP A 520 ? 1.6909 1.8533 1.0365 -0.2706 0.2256  -0.0050 564 TRP A CH2 
3915 N N   . VAL A 521 ? 1.6765 1.6880 0.7162 -0.2699 0.0486  0.1494  565 VAL A N   
3916 C CA  . VAL A 521 ? 1.6921 1.7003 0.7171 -0.2560 0.0027  0.1734  565 VAL A CA  
3917 C C   . VAL A 521 ? 1.6120 1.6287 0.7356 -0.2504 -0.0176 0.1711  565 VAL A C   
3918 O O   . VAL A 521 ? 1.5689 1.5830 0.7581 -0.2576 0.0079  0.1632  565 VAL A O   
3919 C CB  . VAL A 521 ? 1.7559 1.7308 0.7145 -0.2496 0.0105  0.2251  565 VAL A CB  
3920 C CG1 . VAL A 521 ? 1.7223 1.6663 0.7339 -0.2531 0.0342  0.2529  565 VAL A CG1 
3921 C CG2 . VAL A 521 ? 1.7955 1.7779 0.7100 -0.2289 -0.0381 0.2473  565 VAL A CG2 
3922 N N   . SER A 522 ? 1.7231 1.7571 0.8584 -0.2380 -0.0632 0.1756  566 SER A N   
3923 C CA  . SER A 522 ? 1.6694 1.7134 0.8937 -0.2309 -0.0816 0.1772  566 SER A CA  
3924 C C   . SER A 522 ? 1.6760 1.7255 0.8906 -0.2093 -0.1177 0.2133  566 SER A C   
3925 O O   . SER A 522 ? 1.6987 1.7744 0.8663 -0.2022 -0.1510 0.2150  566 SER A O   
3926 C CB  . SER A 522 ? 1.6350 1.7079 0.9124 -0.2394 -0.0981 0.1330  566 SER A CB  
3927 O OG  . SER A 522 ? 1.6488 1.7501 0.8947 -0.2396 -0.1385 0.1208  566 SER A OG  
3928 N N   . TYR A 523 ? 1.5334 1.5598 0.7903 -0.1974 -0.1109 0.2415  567 TYR A N   
3929 C CA  . TYR A 523 ? 1.5406 1.5696 0.7931 -0.1695 -0.1418 0.2776  567 TYR A CA  
3930 C C   . TYR A 523 ? 1.4787 1.5427 0.8222 -0.1615 -0.1668 0.2650  567 TYR A C   
3931 O O   . TYR A 523 ? 1.4473 1.4914 0.8515 -0.1628 -0.1482 0.2644  567 TYR A O   
3932 C CB  . TYR A 523 ? 1.5752 1.5413 0.7974 -0.1580 -0.1147 0.3215  567 TYR A CB  
3933 C CG  . TYR A 523 ? 1.6421 1.5712 0.7668 -0.1640 -0.0906 0.3430  567 TYR A CG  
3934 C CD1 . TYR A 523 ? 1.6448 1.5637 0.7523 -0.1932 -0.0517 0.3218  567 TYR A CD1 
3935 C CD2 . TYR A 523 ? 1.7226 1.6294 0.7711 -0.1379 -0.1054 0.3862  567 TYR A CD2 
3936 C CE1 . TYR A 523 ? 1.7258 1.6142 0.7439 -0.2003 -0.0266 0.3419  567 TYR A CE1 
3937 C CE2 . TYR A 523 ? 1.8234 1.6929 0.7768 -0.1439 -0.0813 0.4084  567 TYR A CE2 
3938 C CZ  . TYR A 523 ? 1.8235 1.6842 0.7627 -0.1772 -0.0408 0.3856  567 TYR A CZ  
3939 O OH  . TYR A 523 ? 1.9254 1.7527 0.7705 -0.1852 -0.0132 0.4074  567 TYR A OH  
3940 N N   . THR A 524 ? 1.3803 1.4998 0.7333 -0.1552 -0.2086 0.2546  568 THR A N   
3941 C CA  . THR A 524 ? 1.3029 1.4601 0.7424 -0.1508 -0.2292 0.2427  568 THR A CA  
3942 C C   . THR A 524 ? 1.3140 1.4875 0.7682 -0.1150 -0.2537 0.2808  568 THR A C   
3943 O O   . THR A 524 ? 1.3780 1.5799 0.7849 -0.0955 -0.2825 0.3020  568 THR A O   
3944 C CB  . THR A 524 ? 1.2751 1.4854 0.7359 -0.1728 -0.2549 0.2019  568 THR A CB  
3945 O OG1 . THR A 524 ? 1.2795 1.4640 0.7254 -0.1994 -0.2275 0.1675  568 THR A OG1 
3946 C CG2 . THR A 524 ? 1.1987 1.4432 0.7502 -0.1720 -0.2691 0.1914  568 THR A CG2 
3947 N N   . ILE A 525 ? 1.4322 1.5883 0.9492 -0.1034 -0.2416 0.2893  569 ILE A N   
3948 C CA  . ILE A 525 ? 1.4303 1.5889 0.9597 -0.0640 -0.2567 0.3264  569 ILE A CA  
3949 C C   . ILE A 525 ? 1.3577 1.5842 0.9686 -0.0552 -0.2843 0.3146  569 ILE A C   
3950 O O   . ILE A 525 ? 1.3078 1.5410 0.9829 -0.0751 -0.2732 0.2869  569 ILE A O   
3951 C CB  . ILE A 525 ? 1.4571 1.5352 0.9852 -0.0528 -0.2200 0.3499  569 ILE A CB  
3952 C CG1 . ILE A 525 ? 1.5260 1.5383 0.9738 -0.0658 -0.1893 0.3640  569 ILE A CG1 
3953 C CG2 . ILE A 525 ? 1.4656 1.5367 0.9983 -0.0068 -0.2338 0.3878  569 ILE A CG2 
3954 C CD1 . ILE A 525 ? 1.5539 1.4825 0.9941 -0.0642 -0.1510 0.3849  569 ILE A CD1 
3955 N N   . ASP A 526 ? 1.4132 1.6946 1.0204 -0.0242 -0.3198 0.3370  570 ASP A N   
3956 C CA  . ASP A 526 ? 1.3395 1.6973 1.0238 -0.0128 -0.3465 0.3307  570 ASP A CA  
3957 C C   . ASP A 526 ? 1.3396 1.6791 1.0459 0.0355  -0.3420 0.3673  570 ASP A C   
3958 O O   . ASP A 526 ? 1.3873 1.7160 1.0444 0.0755  -0.3522 0.4052  570 ASP A O   
3959 C CB  . ASP A 526 ? 1.3230 1.7752 0.9966 -0.0140 -0.3924 0.3256  570 ASP A CB  
3960 C CG  . ASP A 526 ? 1.2340 1.7753 0.9937 -0.0261 -0.4164 0.3029  570 ASP A CG  
3961 O OD1 . ASP A 526 ? 1.1859 1.7217 1.0116 -0.0163 -0.4014 0.3038  570 ASP A OD1 
3962 O OD2 . ASP A 526 ? 1.2138 1.8305 0.9725 -0.0482 -0.4494 0.2832  570 ASP A OD2 
3963 N N   . PHE A 527 ? 1.2829 1.6166 1.0592 0.0343  -0.3262 0.3558  571 PHE A N   
3964 C CA  . PHE A 527 ? 1.2853 1.5923 1.0834 0.0787  -0.3166 0.3845  571 PHE A CA  
3965 C C   . PHE A 527 ? 1.2276 1.6319 1.0786 0.1126  -0.3502 0.3952  571 PHE A C   
3966 O O   . PHE A 527 ? 1.2190 1.6142 1.0996 0.1518  -0.3430 0.4143  571 PHE A O   
3967 C CB  . PHE A 527 ? 1.2659 1.5158 1.1069 0.0624  -0.2808 0.3669  571 PHE A CB  
3968 C CG  . PHE A 527 ? 1.3331 1.4822 1.1213 0.0444  -0.2443 0.3692  571 PHE A CG  
3969 C CD1 . PHE A 527 ? 1.3363 1.4736 1.1104 -0.0006 -0.2309 0.3412  571 PHE A CD1 
3970 C CD2 . PHE A 527 ? 1.3950 1.4611 1.1461 0.0721  -0.2219 0.3991  571 PHE A CD2 
3971 C CE1 . PHE A 527 ? 1.3898 1.4480 1.1207 -0.0186 -0.1967 0.3433  571 PHE A CE1 
3972 C CE2 . PHE A 527 ? 1.4517 1.4296 1.1558 0.0488  -0.1872 0.4003  571 PHE A CE2 
3973 C CZ  . PHE A 527 ? 1.4437 1.4246 1.1410 0.0029  -0.1750 0.3726  571 PHE A CZ  
3974 N N   . LYS A 528 ? 1.3840 1.8838 1.2477 0.0958  -0.3858 0.3807  572 LYS A N   
3975 C CA  . LYS A 528 ? 1.3177 1.9319 1.2413 0.1184  -0.4199 0.3855  572 LYS A CA  
3976 C C   . LYS A 528 ? 1.3465 1.9678 1.2571 0.1882  -0.4287 0.4311  572 LYS A C   
3977 O O   . LYS A 528 ? 1.2993 1.9864 1.2734 0.2184  -0.4384 0.4385  572 LYS A O   
3978 C CB  . LYS A 528 ? 1.2961 2.0065 1.2146 0.0886  -0.4594 0.3665  572 LYS A CB  
3979 C CG  . LYS A 528 ? 1.3735 2.0808 1.2040 0.1062  -0.4800 0.3895  572 LYS A CG  
3980 C CD  . LYS A 528 ? 1.3681 2.1647 1.1967 0.0744  -0.5158 0.3606  572 LYS A CD  
3981 C CE  . LYS A 528 ? 1.4593 2.2320 1.1910 0.0842  -0.5284 0.3742  572 LYS A CE  
3982 N NZ  . LYS A 528 ? 1.5346 2.3120 1.2392 0.1475  -0.5405 0.4111  572 LYS A NZ  
3983 N N   . ASP A 529 ? 1.5563 2.1074 1.3820 0.2156  -0.4233 0.4627  573 ASP A N   
3984 C CA  . ASP A 529 ? 1.6054 2.1419 1.4049 0.2868  -0.4277 0.5095  573 ASP A CA  
3985 C C   . ASP A 529 ? 1.6323 2.0590 1.4340 0.3116  -0.3857 0.5227  573 ASP A C   
3986 O O   . ASP A 529 ? 1.6369 2.0677 1.4602 0.3656  -0.3847 0.5436  573 ASP A O   
3987 C CB  . ASP A 529 ? 1.7033 2.2001 1.4063 0.3048  -0.4372 0.5332  573 ASP A CB  
3988 C CG  . ASP A 529 ? 1.7056 2.3031 1.4092 0.2836  -0.4765 0.5100  573 ASP A CG  
3989 O OD1 . ASP A 529 ? 1.6570 2.3555 1.4369 0.2784  -0.4982 0.4854  573 ASP A OD1 
3990 O OD2 . ASP A 529 ? 1.7650 2.3381 1.3911 0.2695  -0.4834 0.5150  573 ASP A OD2 
3991 N N   . ILE A 530 ? 1.3922 1.7187 1.1716 0.2697  -0.3493 0.5043  574 ILE A N   
3992 C CA  . ILE A 530 ? 1.4233 1.6459 1.2047 0.2817  -0.3093 0.5093  574 ILE A CA  
3993 C C   . ILE A 530 ? 1.3521 1.6251 1.2190 0.3024  -0.3087 0.4986  574 ILE A C   
3994 O O   . ILE A 530 ? 1.3839 1.6134 1.2461 0.3533  -0.2959 0.5227  574 ILE A O   
3995 C CB  . ILE A 530 ? 1.4440 1.5830 1.2092 0.2236  -0.2742 0.4818  574 ILE A CB  
3996 C CG1 . ILE A 530 ? 1.5312 1.5951 1.2019 0.2131  -0.2630 0.5009  574 ILE A CG1 
3997 C CG2 . ILE A 530 ? 1.4607 1.5149 1.2432 0.2291  -0.2378 0.4786  574 ILE A CG2 
3998 C CD1 . ILE A 530 ? 1.6259 1.5995 1.2265 0.2643  -0.2498 0.5477  574 ILE A CD1 
3999 N N   . LEU A 531 ? 1.2827 1.6417 1.2231 0.2640  -0.3201 0.4630  575 LEU A N   
4000 C CA  . LEU A 531 ? 1.2083 1.6431 1.2290 0.2881  -0.3269 0.4579  575 LEU A CA  
4001 C C   . LEU A 531 ? 1.1490 1.7246 1.2049 0.2977  -0.3709 0.4612  575 LEU A C   
4002 O O   . LEU A 531 ? 1.0880 1.7359 1.1813 0.2480  -0.3872 0.4307  575 LEU A O   
4003 C CB  . LEU A 531 ? 1.1425 1.5838 1.2238 0.2380  -0.3093 0.4177  575 LEU A CB  
4004 C CG  . LEU A 531 ? 1.1876 1.5132 1.2386 0.2043  -0.2717 0.4016  575 LEU A CG  
4005 C CD1 . LEU A 531 ? 1.1190 1.4752 1.2200 0.1492  -0.2662 0.3617  575 LEU A CD1 
4006 C CD2 . LEU A 531 ? 1.2237 1.4724 1.2717 0.2404  -0.2430 0.4144  575 LEU A CD2 
4007 N N   . GLU A 532 ? 1.5819 2.1834 1.6273 0.3559  -0.3842 0.4869  576 GLU A N   
4008 C CA  . GLU A 532 ? 1.5809 2.2955 1.6583 0.3589  -0.4170 0.4741  576 GLU A CA  
4009 C C   . GLU A 532 ? 1.5144 2.3132 1.6854 0.3569  -0.4153 0.4511  576 GLU A C   
4010 O O   . GLU A 532 ? 1.4840 2.3860 1.7022 0.3298  -0.4376 0.4275  576 GLU A O   
4011 C CB  . GLU A 532 ? 1.6867 2.3825 1.7131 0.4173  -0.4273 0.5050  576 GLU A CB  
4012 C CG  . GLU A 532 ? 1.7282 2.3752 1.7634 0.4780  -0.4047 0.5252  576 GLU A CG  
4013 C CD  . GLU A 532 ? 1.8075 2.5049 1.8400 0.5302  -0.4240 0.5432  576 GLU A CD  
4014 O OE1 . GLU A 532 ? 1.8023 2.6113 1.8639 0.5158  -0.4563 0.5309  576 GLU A OE1 
4015 O OE2 . GLU A 532 ? 1.8865 2.5099 1.8867 0.5847  -0.4060 0.5694  576 GLU A OE2 
4016 N N   . ARG A 533 ? 1.0977 1.8451 1.2901 0.3844  -0.3860 0.4579  577 ARG A N   
4017 C CA  . ARG A 533 ? 1.0537 1.8667 1.3252 0.3930  -0.3778 0.4413  577 ARG A CA  
4018 C C   . ARG A 533 ? 0.9510 1.7966 1.2763 0.3320  -0.3708 0.4094  577 ARG A C   
4019 O O   . ARG A 533 ? 0.9149 1.6930 1.2203 0.3058  -0.3560 0.4085  577 ARG A O   
4020 C CB  . ARG A 533 ? 1.0922 1.8242 1.3529 0.4483  -0.3470 0.4601  577 ARG A CB  
4021 C CG  . ARG A 533 ? 1.0824 1.8832 1.4101 0.4760  -0.3397 0.4508  577 ARG A CG  
4022 C CD  . ARG A 533 ? 1.1371 1.8461 1.4418 0.5326  -0.3084 0.4678  577 ARG A CD  
4023 N NE  . ARG A 533 ? 1.0983 1.7121 1.3890 0.5153  -0.2789 0.4621  577 ARG A NE  
4024 C CZ  . ARG A 533 ? 1.0263 1.6624 1.3725 0.4968  -0.2608 0.4403  577 ARG A CZ  
4025 N NH1 . ARG A 533 ? 0.9893 1.7343 1.4043 0.4922  -0.2673 0.4231  577 ARG A NH1 
4026 N NH2 . ARG A 533 ? 0.9965 1.5464 1.3281 0.4812  -0.2352 0.4362  577 ARG A NH2 
4027 N N   . ASN A 534 ? 0.9483 1.8949 1.3393 0.3067  -0.3812 0.3843  578 ASN A N   
4028 C CA  . ASN A 534 ? 0.8657 1.8349 1.3082 0.2524  -0.3693 0.3543  578 ASN A CA  
4029 C C   . ASN A 534 ? 0.8382 1.7803 1.3161 0.2781  -0.3382 0.3557  578 ASN A C   
4030 O O   . ASN A 534 ? 0.8702 1.8349 1.3651 0.3259  -0.3325 0.3664  578 ASN A O   
4031 C CB  . ASN A 534 ? 0.8436 1.9183 1.3359 0.2130  -0.3877 0.3274  578 ASN A CB  
4032 C CG  . ASN A 534 ? 0.8632 1.9589 1.3213 0.1729  -0.4157 0.3161  578 ASN A CG  
4033 O OD1 . ASN A 534 ? 0.8930 1.9299 1.2888 0.1762  -0.4223 0.3297  578 ASN A OD1 
4034 N ND2 . ASN A 534 ? 0.8541 2.0309 1.3491 0.1338  -0.4311 0.2911  578 ASN A ND2 
4035 N N   . CYS A 535 ? 0.7863 1.6789 1.2729 0.2473  -0.3179 0.3447  579 CYS A N   
4036 C CA  . CYS A 535 ? 0.7598 1.6271 1.2784 0.2658  -0.2878 0.3421  579 CYS A CA  
4037 C C   . CYS A 535 ? 0.7372 1.6940 1.3171 0.2665  -0.2851 0.3261  579 CYS A C   
4038 O O   . CYS A 535 ? 0.7127 1.7409 1.3233 0.2237  -0.2995 0.3064  579 CYS A O   
4039 C CB  . CYS A 535 ? 0.7096 1.5283 1.2358 0.2209  -0.2712 0.3281  579 CYS A CB  
4040 S SG  . CYS A 535 ? 0.8021 1.4608 1.2418 0.2209  -0.2503 0.3325  579 CYS A SG  
4041 N N   . GLU A 536 ? 0.9439 1.8911 1.5384 0.3134  -0.2646 0.3342  580 GLU A N   
4042 C CA  . GLU A 536 ? 0.9233 1.9502 1.5764 0.3124  -0.2565 0.3202  580 GLU A CA  
4043 C C   . GLU A 536 ? 0.8968 1.8822 1.5659 0.3233  -0.2225 0.3140  580 GLU A C   
4044 O O   . GLU A 536 ? 0.9028 1.7975 1.5374 0.3386  -0.2061 0.3217  580 GLU A O   
4045 C CB  . GLU A 536 ? 0.9849 2.0726 1.6477 0.3615  -0.2688 0.3349  580 GLU A CB  
4046 C CG  . GLU A 536 ? 1.0456 2.0702 1.6788 0.4316  -0.2507 0.3564  580 GLU A CG  
4047 C CD  . GLU A 536 ? 1.1245 2.1977 1.7525 0.4815  -0.2680 0.3757  580 GLU A CD  
4048 O OE1 . GLU A 536 ? 1.1307 2.2841 1.7735 0.4602  -0.2971 0.3737  580 GLU A OE1 
4049 O OE2 . GLU A 536 ? 1.1880 2.2194 1.7953 0.5422  -0.2528 0.3925  580 GLU A OE2 
4050 N N   . GLU A 537 ? 0.8883 1.9411 1.6083 0.3136  -0.2117 0.3000  581 GLU A N   
4051 C CA  . GLU A 537 ? 0.8558 1.8844 1.5949 0.3108  -0.1805 0.2888  581 GLU A CA  
4052 C C   . GLU A 537 ? 0.8899 1.8275 1.5932 0.3631  -0.1570 0.3012  581 GLU A C   
4053 O O   . GLU A 537 ? 0.8622 1.7356 1.5533 0.3495  -0.1375 0.2941  581 GLU A O   
4054 C CB  . GLU A 537 ? 0.8547 1.9758 1.6479 0.3094  -0.1735 0.2797  581 GLU A CB  
4055 C CG  . GLU A 537 ? 0.8209 1.9328 1.6362 0.2972  -0.1427 0.2663  581 GLU A CG  
4056 C CD  . GLU A 537 ? 0.8383 2.0394 1.7027 0.3079  -0.1331 0.2629  581 GLU A CD  
4057 O OE1 . GLU A 537 ? 0.8521 2.1399 1.7488 0.2918  -0.1526 0.2621  581 GLU A OE1 
4058 O OE2 . GLU A 537 ? 0.8429 2.0290 1.7134 0.3327  -0.1054 0.2611  581 GLU A OE2 
4059 N N   . LYS A 538 ? 0.7265 1.6536 1.4092 0.4220  -0.1589 0.3192  582 LYS A N   
4060 C CA  . LYS A 538 ? 0.7806 1.6045 1.4159 0.4745  -0.1371 0.3314  582 LYS A CA  
4061 C C   . LYS A 538 ? 0.7759 1.4920 1.3590 0.4621  -0.1345 0.3381  582 LYS A C   
4062 O O   . LYS A 538 ? 0.8002 1.4220 1.3506 0.4841  -0.1092 0.3388  582 LYS A O   
4063 C CB  . LYS A 538 ? 0.8729 1.6971 1.4866 0.5382  -0.1421 0.3516  582 LYS A CB  
4064 C CG  . LYS A 538 ? 0.9197 1.7355 1.4961 0.5495  -0.1708 0.3722  582 LYS A CG  
4065 C CD  . LYS A 538 ? 1.0279 1.7867 1.5590 0.6202  -0.1637 0.3946  582 LYS A CD  
4066 C CE  . LYS A 538 ? 1.0860 1.8371 1.5756 0.6353  -0.1913 0.4177  582 LYS A CE  
4067 N NZ  . LYS A 538 ? 1.1645 1.9766 1.6643 0.6898  -0.2000 0.4334  582 LYS A NZ  
4068 N N   . ASP A 539 ? 0.9754 1.7035 1.5492 0.4255  -0.1592 0.3421  583 ASP A N   
4069 C CA  . ASP A 539 ? 1.0023 1.6338 1.5273 0.4129  -0.1575 0.3523  583 ASP A CA  
4070 C C   . ASP A 539 ? 0.9806 1.5610 1.5089 0.3655  -0.1363 0.3269  583 ASP A C   
4071 O O   . ASP A 539 ? 1.0458 1.5173 1.5186 0.3427  -0.1248 0.3180  583 ASP A O   
4072 C CB  . ASP A 539 ? 0.9980 1.6562 1.5065 0.3834  -0.1891 0.3606  583 ASP A CB  
4073 C CG  . ASP A 539 ? 1.0606 1.7235 1.5340 0.4270  -0.2063 0.3815  583 ASP A CG  
4074 O OD1 . ASP A 539 ? 1.1395 1.7132 1.5622 0.4758  -0.1914 0.3997  583 ASP A OD1 
4075 O OD2 . ASP A 539 ? 1.0478 1.7986 1.5411 0.4117  -0.2336 0.3787  583 ASP A OD2 
4076 N N   . TYR A 540 ? 0.8115 1.4673 1.3990 0.3464  -0.1297 0.3120  584 TYR A N   
4077 C CA  . TYR A 540 ? 0.7940 1.4020 1.3788 0.3015  -0.1099 0.2856  584 TYR A CA  
4078 C C   . TYR A 540 ? 0.8164 1.3918 1.4028 0.3325  -0.0795 0.2785  584 TYR A C   
4079 O O   . TYR A 540 ? 0.8027 1.4363 1.4211 0.3792  -0.0734 0.2896  584 TYR A O   
4080 C CB  . TYR A 540 ? 0.6955 1.3916 1.3328 0.2500  -0.1210 0.2725  584 TYR A CB  
4081 C CG  . TYR A 540 ? 0.6840 1.4044 1.3134 0.2156  -0.1497 0.2745  584 TYR A CG  
4082 C CD1 . TYR A 540 ? 0.6754 1.4801 1.3251 0.2265  -0.1744 0.2852  584 TYR A CD1 
4083 C CD2 . TYR A 540 ? 0.7003 1.3501 1.2904 0.1710  -0.1501 0.2597  584 TYR A CD2 
4084 C CE1 . TYR A 540 ? 0.6736 1.4981 1.3096 0.1944  -0.2009 0.2846  584 TYR A CE1 
4085 C CE2 . TYR A 540 ? 0.6967 1.3636 1.2736 0.1412  -0.1741 0.2595  584 TYR A CE2 
4086 C CZ  . TYR A 540 ? 0.6802 1.4378 1.2822 0.1528  -0.2009 0.2736  584 TYR A CZ  
4087 O OH  . TYR A 540 ? 0.6853 1.4581 1.2680 0.1212  -0.2254 0.2707  584 TYR A OH  
4088 N N   . THR A 541 ? 0.7750 1.2604 1.3253 0.3072  -0.0603 0.2587  585 THR A N   
4089 C CA  . THR A 541 ? 0.8043 1.2525 1.3481 0.3293  -0.0316 0.2468  585 THR A CA  
4090 C C   . THR A 541 ? 0.7466 1.2073 1.3083 0.2811  -0.0227 0.2241  585 THR A C   
4091 O O   . THR A 541 ? 0.7093 1.1689 1.2695 0.2329  -0.0351 0.2162  585 THR A O   
4092 C CB  . THR A 541 ? 0.9273 1.2439 1.4001 0.3479  -0.0149 0.2429  585 THR A CB  
4093 O OG1 . THR A 541 ? 0.9655 1.2483 1.4294 0.3731  0.0128  0.2294  585 THR A OG1 
4094 C CG2 . THR A 541 ? 0.9598 1.2055 1.3944 0.2934  -0.0175 0.2273  585 THR A CG2 
4095 N N   . ILE A 542 ? 0.7063 1.1794 1.2822 0.2980  -0.0002 0.2147  586 ILE A N   
4096 C CA  . ILE A 542 ? 0.6592 1.1418 1.2463 0.2602  0.0112  0.1959  586 ILE A CA  
4097 C C   . ILE A 542 ? 0.7285 1.1084 1.2599 0.2374  0.0211  0.1755  586 ILE A C   
4098 O O   . ILE A 542 ? 0.8238 1.1273 1.3124 0.2624  0.0350  0.1694  586 ILE A O   
4099 C CB  . ILE A 542 ? 0.6344 1.1703 1.2524 0.2884  0.0333  0.1943  586 ILE A CB  
4100 C CG1 . ILE A 542 ? 0.5898 1.2266 1.2608 0.3226  0.0258  0.2153  586 ILE A CG1 
4101 C CG2 . ILE A 542 ? 0.5685 1.1411 1.2084 0.2473  0.0403  0.1830  586 ILE A CG2 
4102 C CD1 . ILE A 542 ? 0.5687 1.2698 1.2713 0.3465  0.0483  0.2123  586 ILE A CD1 
4103 N N   . TRP A 543 ? 0.5497 0.9293 1.0813 0.1898  0.0138  0.1647  587 TRP A N   
4104 C CA  . TRP A 543 ? 0.6034 0.9058 1.0904 0.1634  0.0201  0.1448  587 TRP A CA  
4105 C C   . TRP A 543 ? 0.5370 0.8653 1.0364 0.1318  0.0243  0.1321  587 TRP A C   
4106 O O   . TRP A 543 ? 0.4598 0.8294 0.9835 0.1041  0.0120  0.1367  587 TRP A O   
4107 C CB  . TRP A 543 ? 0.6323 0.8943 1.0946 0.1394  0.0038  0.1472  587 TRP A CB  
4108 C CG  . TRP A 543 ? 0.6822 0.8819 1.1068 0.1081  0.0083  0.1277  587 TRP A CG  
4109 C CD1 . TRP A 543 ? 0.7988 0.9219 1.1791 0.1112  0.0212  0.1147  587 TRP A CD1 
4110 C CD2 . TRP A 543 ? 0.6205 0.8327 1.0489 0.0687  -0.0002 0.1187  587 TRP A CD2 
4111 N NE1 . TRP A 543 ? 0.8105 0.9094 1.1724 0.0740  0.0201  0.0978  587 TRP A NE1 
4112 C CE2 . TRP A 543 ? 0.6932 0.8466 1.0842 0.0513  0.0073  0.1009  587 TRP A CE2 
4113 C CE3 . TRP A 543 ? 0.5169 0.7821 0.9748 0.0468  -0.0123 0.1231  587 TRP A CE3 
4114 C CZ2 . TRP A 543 ? 0.6456 0.8023 1.0326 0.0181  0.0024  0.0892  587 TRP A CZ2 
4115 C CZ3 . TRP A 543 ? 0.4833 0.7374 0.9304 0.0157  -0.0155 0.1113  587 TRP A CZ3 
4116 C CH2 . TRP A 543 ? 0.5390 0.7444 0.9532 0.0043  -0.0084 0.0953  587 TRP A CH2 
4117 N N   . LEU A 544 ? 0.5317 0.8311 1.0091 0.1366  0.0417  0.1159  588 LEU A N   
4118 C CA  . LEU A 544 ? 0.4845 0.8000 0.9630 0.1111  0.0459  0.1048  588 LEU A CA  
4119 C C   . LEU A 544 ? 0.4964 0.7698 0.9478 0.0792  0.0356  0.0929  588 LEU A C   
4120 O O   . LEU A 544 ? 0.5827 0.7980 0.9989 0.0786  0.0379  0.0811  588 LEU A O   
4121 C CB  . LEU A 544 ? 0.5366 0.8376 0.9947 0.1300  0.0670  0.0907  588 LEU A CB  
4122 C CG  . LEU A 544 ? 0.5153 0.8253 0.9618 0.1110  0.0730  0.0787  588 LEU A CG  
4123 C CD1 . LEU A 544 ? 0.4182 0.7883 0.9013 0.0942  0.0690  0.0941  588 LEU A CD1 
4124 C CD2 . LEU A 544 ? 0.5764 0.8775 1.0004 0.1343  0.0940  0.0658  588 LEU A CD2 
4125 N N   . ALA A 545 ? 0.5240 0.8248 0.9902 0.0524  0.0257  0.0957  589 ALA A N   
4126 C CA  . ALA A 545 ? 0.5250 0.7959 0.9682 0.0262  0.0182  0.0836  589 ALA A CA  
4127 C C   . ALA A 545 ? 0.5486 0.8095 0.9702 0.0235  0.0280  0.0667  589 ALA A C   
4128 O O   . ALA A 545 ? 0.5435 0.8278 0.9706 0.0361  0.0389  0.0675  589 ALA A O   
4129 C CB  . ALA A 545 ? 0.4463 0.7444 0.9077 0.0041  0.0065  0.0915  589 ALA A CB  
4130 N N   . HIS A 546 ? 0.5801 0.8118 0.9769 0.0063  0.0239  0.0514  590 HIS A N   
4131 C CA  . HIS A 546 ? 0.5998 0.8328 0.9767 -0.0003 0.0280  0.0340  590 HIS A CA  
4132 C C   . HIS A 546 ? 0.6876 0.9010 1.0417 0.0158  0.0415  0.0203  590 HIS A C   
4133 O O   . HIS A 546 ? 0.7015 0.9304 1.0422 0.0176  0.0461  0.0098  590 HIS A O   
4134 C CB  . HIS A 546 ? 0.5270 0.8007 0.9179 -0.0024 0.0262  0.0424  590 HIS A CB  
4135 C CG  . HIS A 546 ? 0.4697 0.7511 0.8687 -0.0198 0.0145  0.0472  590 HIS A CG  
4136 N ND1 . HIS A 546 ? 0.4749 0.7527 0.8592 -0.0333 0.0085  0.0334  590 HIS A ND1 
4137 C CD2 . HIS A 546 ? 0.4147 0.7085 0.8336 -0.0257 0.0090  0.0624  590 HIS A CD2 
4138 C CE1 . HIS A 546 ? 0.4251 0.7110 0.8191 -0.0422 0.0012  0.0409  590 HIS A CE1 
4139 N NE2 . HIS A 546 ? 0.3948 0.6853 0.8068 -0.0391 0.0012  0.0575  590 HIS A NE2 
4140 N N   . SER A 547 ? 0.5227 0.6984 0.8670 0.0296  0.0482  0.0200  591 SER A N   
4141 C CA  . SER A 547 ? 0.6230 0.7684 0.9388 0.0467  0.0634  0.0041  591 SER A CA  
4142 C C   . SER A 547 ? 0.7199 0.8229 0.9958 0.0247  0.0642  -0.0240 591 SER A C   
4143 O O   . SER A 547 ? 0.7529 0.8240 1.0188 0.0026  0.0581  -0.0287 591 SER A O   
4144 C CB  . SER A 547 ? 0.6810 0.7959 0.9962 0.0759  0.0730  0.0140  591 SER A CB  
4145 O OG  . SER A 547 ? 0.7698 0.8565 1.0563 0.0974  0.0907  -0.0017 591 SER A OG  
4146 N N   . THR A 548 ? 0.8478 0.9530 1.0995 0.0286  0.0723  -0.0433 592 THR A N   
4147 C CA  . THR A 548 ? 0.9360 1.0112 1.1491 0.0044  0.0721  -0.0744 592 THR A CA  
4148 C C   . THR A 548 ? 1.0629 1.0880 1.2353 0.0205  0.0895  -0.0948 592 THR A C   
4149 O O   . THR A 548 ? 1.1794 1.1360 1.3181 0.0087  0.0961  -0.1123 592 THR A O   
4150 C CB  . THR A 548 ? 0.8757 1.0078 1.0899 -0.0093 0.0619  -0.0836 592 THR A CB  
4151 O OG1 . THR A 548 ? 0.7729 0.9419 1.0180 -0.0244 0.0472  -0.0687 592 THR A OG1 
4152 C CG2 . THR A 548 ? 0.9630 1.0755 1.1383 -0.0348 0.0605  -0.1187 592 THR A CG2 
4153 N N   . ASP A 549 ? 1.2633 1.3195 1.4334 0.0450  0.0986  -0.0944 593 ASP A N   
4154 C CA  . ASP A 549 ? 1.3578 1.3712 1.4913 0.0700  0.1188  -0.1107 593 ASP A CA  
4155 C C   . ASP A 549 ? 1.2997 1.3405 1.4605 0.1126  0.1328  -0.0858 593 ASP A C   
4156 O O   . ASP A 549 ? 1.2316 1.3327 1.4100 0.1231  0.1354  -0.0751 593 ASP A O   
4157 C CB  . ASP A 549 ? 1.3985 1.4262 1.4940 0.0591  0.1196  -0.1395 593 ASP A CB  
4158 C CG  . ASP A 549 ? 1.4781 1.4663 1.5317 0.0867  0.1422  -0.1581 593 ASP A CG  
4159 O OD1 . ASP A 549 ? 1.5392 1.4612 1.5774 0.1058  0.1571  -0.1601 593 ASP A OD1 
4160 O OD2 . ASP A 549 ? 1.4772 1.4992 1.5095 0.0921  0.1457  -0.1701 593 ASP A OD2 
4161 N N   . PRO A 550 ? 1.1319 1.1298 1.2943 0.1383  0.1434  -0.0765 594 PRO A N   
4162 C CA  . PRO A 550 ? 1.0611 1.0999 1.2595 0.1788  0.1548  -0.0510 594 PRO A CA  
4163 C C   . PRO A 550 ? 1.0753 1.1337 1.2573 0.2086  0.1770  -0.0605 594 PRO A C   
4164 O O   . PRO A 550 ? 0.9998 1.1167 1.2187 0.2354  0.1867  -0.0393 594 PRO A O   
4165 C CB  . PRO A 550 ? 1.1161 1.0949 1.3080 0.2020  0.1601  -0.0429 594 PRO A CB  
4166 C CG  . PRO A 550 ? 1.1957 1.1082 1.3576 0.1645  0.1482  -0.0566 594 PRO A CG  
4167 C CD  . PRO A 550 ? 1.2344 1.1468 1.3665 0.1298  0.1445  -0.0864 594 PRO A CD  
4168 N N   . GLU A 551 ? 1.4330 1.4468 1.5592 0.2021  0.1857  -0.0931 595 GLU A N   
4169 C CA  . GLU A 551 ? 1.4502 1.4833 1.5539 0.2287  0.2071  -0.1039 595 GLU A CA  
4170 C C   . GLU A 551 ? 1.3729 1.4875 1.4965 0.2153  0.2010  -0.0927 595 GLU A C   
4171 O O   . GLU A 551 ? 1.3586 1.5102 1.4777 0.2385  0.2195  -0.0899 595 GLU A O   
4172 C CB  . GLU A 551 ? 1.5779 1.5335 1.6081 0.2248  0.2182  -0.1456 595 GLU A CB  
4173 C CG  . GLU A 551 ? 1.6646 1.5227 1.6631 0.2436  0.2312  -0.1569 595 GLU A CG  
4174 C CD  . GLU A 551 ? 1.6356 1.5037 1.6599 0.3005  0.2517  -0.1338 595 GLU A CD  
4175 O OE1 . GLU A 551 ? 1.6045 1.5260 1.6379 0.3309  0.2694  -0.1296 595 GLU A OE1 
4176 O OE2 . GLU A 551 ? 1.6438 1.4708 1.6792 0.3159  0.2505  -0.1187 595 GLU A OE2 
4177 N N   . ASP A 552 ? 1.2556 1.3954 1.3983 0.1799  0.1771  -0.0851 596 ASP A N   
4178 C CA  . ASP A 552 ? 1.1932 1.3975 1.3465 0.1689  0.1712  -0.0732 596 ASP A CA  
4179 C C   . ASP A 552 ? 1.0725 1.3385 1.2824 0.1782  0.1746  -0.0361 596 ASP A C   
4180 O O   . ASP A 552 ? 1.0055 1.2798 1.2572 0.1692  0.1625  -0.0174 596 ASP A O   
4181 C CB  . ASP A 552 ? 1.1854 1.3933 1.3301 0.1322  0.1463  -0.0821 596 ASP A CB  
4182 C CG  . ASP A 552 ? 1.1329 1.3986 1.2786 0.1279  0.1415  -0.0691 596 ASP A CG  
4183 O OD1 . ASP A 552 ? 1.1464 1.4318 1.2693 0.1468  0.1581  -0.0696 596 ASP A OD1 
4184 O OD2 . ASP A 552 ? 1.0800 1.3689 1.2456 0.1080  0.1229  -0.0572 596 ASP A OD2 
4185 N N   . TYR A 553 ? 0.9604 1.2693 1.1673 0.1932  0.1918  -0.0270 597 TYR A N   
4186 C CA  . TYR A 553 ? 0.8623 1.2322 1.1167 0.1957  0.1989  0.0060  597 TYR A CA  
4187 C C   . TYR A 553 ? 0.7885 1.1730 1.0720 0.1654  0.1762  0.0238  597 TYR A C   
4188 O O   . TYR A 553 ? 0.7098 1.1283 1.0406 0.1598  0.1756  0.0485  597 TYR A O   
4189 C CB  . TYR A 553 ? 0.8757 1.2792 1.1042 0.2056  0.2184  0.0096  597 TYR A CB  
4190 C CG  . TYR A 553 ? 0.8013 1.2658 1.0719 0.2078  0.2345  0.0420  597 TYR A CG  
4191 C CD1 . TYR A 553 ? 0.7611 1.2591 1.0782 0.2259  0.2496  0.0549  597 TYR A CD1 
4192 C CD2 . TYR A 553 ? 0.7825 1.2722 1.0437 0.1924  0.2362  0.0597  597 TYR A CD2 
4193 C CE1 . TYR A 553 ? 0.7007 1.2619 1.0590 0.2220  0.2654  0.0824  597 TYR A CE1 
4194 C CE2 . TYR A 553 ? 0.7327 1.2716 1.0282 0.1886  0.2540  0.0887  597 TYR A CE2 
4195 C CZ  . TYR A 553 ? 0.6900 1.2679 1.0364 0.2003  0.2686  0.0988  597 TYR A CZ  
4196 O OH  . TYR A 553 ? 0.6447 1.2800 1.0296 0.1908  0.2873  0.1261  597 TYR A OH  
4197 N N   . GLU A 554 ? 0.7703 1.1328 1.0249 0.1455  0.1581  0.0102  598 GLU A N   
4198 C CA  . GLU A 554 ? 0.7036 1.0778 0.9809 0.1216  0.1388  0.0258  598 GLU A CA  
4199 C C   . GLU A 554 ? 0.6882 1.0333 0.9820 0.1055  0.1195  0.0194  598 GLU A C   
4200 O O   . GLU A 554 ? 0.6376 0.9874 0.9449 0.0863  0.1033  0.0276  598 GLU A O   
4201 C CB  . GLU A 554 ? 0.7230 1.1078 0.9663 0.1142  0.1320  0.0234  598 GLU A CB  
4202 C CG  . GLU A 554 ? 0.7350 1.1490 0.9629 0.1294  0.1530  0.0378  598 GLU A CG  
4203 C CD  . GLU A 554 ? 0.7829 1.2039 0.9624 0.1309  0.1478  0.0317  598 GLU A CD  
4204 O OE1 . GLU A 554 ? 0.7760 1.1938 0.9504 0.1179  0.1262  0.0285  598 GLU A OE1 
4205 O OE2 . GLU A 554 ? 0.8273 1.2611 0.9731 0.1473  0.1654  0.0303  598 GLU A OE2 
4206 N N   . ASP A 555 ? 0.6219 0.9329 0.9108 0.1153  0.1234  0.0055  599 ASP A N   
4207 C CA  . ASP A 555 ? 0.6266 0.9030 0.9229 0.1000  0.1078  -0.0001 599 ASP A CA  
4208 C C   . ASP A 555 ? 0.5242 0.8253 0.8649 0.0889  0.0965  0.0247  599 ASP A C   
4209 O O   . ASP A 555 ? 0.4727 0.8028 0.8473 0.1008  0.1035  0.0442  599 ASP A O   
4210 C CB  . ASP A 555 ? 0.6991 0.9306 0.9852 0.1179  0.1172  -0.0099 599 ASP A CB  
4211 C CG  . ASP A 555 ? 0.7279 0.9140 1.0101 0.0996  0.1033  -0.0160 599 ASP A CG  
4212 O OD1 . ASP A 555 ? 0.7409 0.9192 1.0083 0.0719  0.0904  -0.0290 599 ASP A OD1 
4213 O OD2 . ASP A 555 ? 0.7387 0.9012 1.0325 0.1136  0.1054  -0.0064 599 ASP A OD2 
4214 N N   . GLY A 556 ? 0.5738 0.8673 0.9145 0.0651  0.0791  0.0223  600 GLY A N   
4215 C CA  . GLY A 556 ? 0.4904 0.7983 0.8648 0.0524  0.0676  0.0412  600 GLY A CA  
4216 C C   . GLY A 556 ? 0.4304 0.7723 0.8174 0.0453  0.0672  0.0572  600 GLY A C   
4217 O O   . GLY A 556 ? 0.3729 0.7232 0.7839 0.0326  0.0588  0.0709  600 GLY A O   
4218 N N   . CYS A 557 ? 0.6721 1.0286 1.0386 0.0530  0.0768  0.0562  601 CYS A N   
4219 C CA  . CYS A 557 ? 0.6380 1.0126 1.0078 0.0457  0.0765  0.0732  601 CYS A CA  
4220 C C   . CYS A 557 ? 0.6259 0.9885 0.9845 0.0327  0.0592  0.0667  601 CYS A C   
4221 O O   . CYS A 557 ? 0.6618 1.0217 0.9946 0.0338  0.0527  0.0491  601 CYS A O   
4222 C CB  . CYS A 557 ? 0.6807 1.0716 1.0250 0.0593  0.0916  0.0774  601 CYS A CB  
4223 S SG  . CYS A 557 ? 0.6940 1.1091 1.0507 0.0773  0.1171  0.0853  601 CYS A SG  
4224 N N   . ILE A 558 ? 0.4661 0.8258 0.8447 0.0200  0.0525  0.0800  602 ILE A N   
4225 C CA  . ILE A 558 ? 0.4533 0.8049 0.8235 0.0121  0.0402  0.0778  602 ILE A CA  
4226 C C   . ILE A 558 ? 0.4531 0.8014 0.8246 0.0099  0.0457  0.0986  602 ILE A C   
4227 O O   . ILE A 558 ? 0.4309 0.7762 0.8253 -0.0020 0.0490  0.1106  602 ILE A O   
4228 C CB  . ILE A 558 ? 0.4159 0.7536 0.8036 -0.0030 0.0279  0.0718  602 ILE A CB  
4229 C CG1 . ILE A 558 ? 0.4408 0.7695 0.8193 -0.0049 0.0234  0.0512  602 ILE A CG1 
4230 C CG2 . ILE A 558 ? 0.3998 0.7319 0.7826 -0.0095 0.0190  0.0732  602 ILE A CG2 
4231 C CD1 . ILE A 558 ? 0.4715 0.8107 0.8257 -0.0043 0.0184  0.0338  602 ILE A CD1 
4232 N N   . LEU A 559 ? 0.5117 0.8594 0.8565 0.0210  0.0464  0.1027  603 LEU A N   
4233 C CA  . LEU A 559 ? 0.5456 0.8760 0.8808 0.0214  0.0549  0.1240  603 LEU A CA  
4234 C C   . LEU A 559 ? 0.5633 0.8987 0.9068 0.0167  0.0732  0.1403  603 LEU A C   
4235 O O   . LEU A 559 ? 0.5699 0.8913 0.9261 0.0006  0.0805  0.1549  603 LEU A O   
4236 C CB  . LEU A 559 ? 0.5298 0.8351 0.8757 0.0074  0.0472  0.1264  603 LEU A CB  
4237 C CG  . LEU A 559 ? 0.5474 0.8443 0.8719 0.0208  0.0378  0.1215  603 LEU A CG  
4238 C CD1 . LEU A 559 ? 0.5143 0.8428 0.8382 0.0279  0.0255  0.1004  603 LEU A CD1 
4239 C CD2 . LEU A 559 ? 0.5439 0.8122 0.8748 0.0089  0.0330  0.1216  603 LEU A CD2 
4240 N N   . GLY A 560 ? 0.4695 0.8269 0.8044 0.0293  0.0818  0.1362  604 GLY A N   
4241 C CA  . GLY A 560 ? 0.4893 0.8593 0.8289 0.0284  0.1027  0.1523  604 GLY A CA  
4242 C C   . GLY A 560 ? 0.4391 0.8331 0.8207 0.0180  0.1083  0.1515  604 GLY A C   
4243 O O   . GLY A 560 ? 0.4480 0.8658 0.8382 0.0200  0.1271  0.1619  604 GLY A O   
4244 N N   . TYR A 561 ? 0.5637 0.9558 0.9707 0.0093  0.0926  0.1402  605 TYR A N   
4245 C CA  . TYR A 561 ? 0.5220 0.9412 0.9690 0.0033  0.0954  0.1426  605 TYR A CA  
4246 C C   . TYR A 561 ? 0.4912 0.9064 0.9512 0.0077  0.0799  0.1270  605 TYR A C   
4247 O O   . TYR A 561 ? 0.4920 0.8808 0.9351 0.0057  0.0654  0.1146  605 TYR A O   
4248 C CB  . TYR A 561 ? 0.5056 0.9328 0.9788 -0.0224 0.0984  0.1593  605 TYR A CB  
4249 C CG  . TYR A 561 ? 0.4908 0.8900 0.9662 -0.0423 0.0812  0.1569  605 TYR A CG  
4250 C CD1 . TYR A 561 ? 0.5334 0.8918 0.9769 -0.0459 0.0795  0.1595  605 TYR A CD1 
4251 C CD2 . TYR A 561 ? 0.4448 0.8597 0.9519 -0.0552 0.0678  0.1534  605 TYR A CD2 
4252 C CE1 . TYR A 561 ? 0.5307 0.8611 0.9732 -0.0621 0.0666  0.1560  605 TYR A CE1 
4253 C CE2 . TYR A 561 ? 0.4390 0.8285 0.9436 -0.0740 0.0533  0.1500  605 TYR A CE2 
4254 C CZ  . TYR A 561 ? 0.4822 0.8279 0.9545 -0.0779 0.0538  0.1502  605 TYR A CZ  
4255 O OH  . TYR A 561 ? 0.4860 0.8045 0.9533 -0.0946 0.0416  0.1450  605 TYR A OH  
4256 N N   . LYS A 562 ? 0.5008 0.9437 0.9893 0.0154  0.0847  0.1290  606 LYS A N   
4257 C CA  . LYS A 562 ? 0.4934 0.9279 0.9900 0.0247  0.0734  0.1185  606 LYS A CA  
4258 C C   . LYS A 562 ? 0.4484 0.9070 0.9826 0.0110  0.0630  0.1296  606 LYS A C   
4259 O O   . LYS A 562 ? 0.4267 0.9202 0.9869 -0.0029 0.0691  0.1431  606 LYS A O   
4260 C CB  . LYS A 562 ? 0.5264 0.9729 1.0232 0.0528  0.0870  0.1132  606 LYS A CB  
4261 C CG  . LYS A 562 ? 0.5702 1.0191 1.0403 0.0669  0.1056  0.1083  606 LYS A CG  
4262 C CD  . LYS A 562 ? 0.6086 1.0628 1.0771 0.0965  0.1194  0.1004  606 LYS A CD  
4263 C CE  . LYS A 562 ? 0.6728 1.1139 1.0995 0.1113  0.1346  0.0866  606 LYS A CE  
4264 N NZ  . LYS A 562 ? 0.7335 1.1570 1.1459 0.1405  0.1462  0.0717  606 LYS A NZ  
4265 N N   . GLU A 563 ? 0.4277 0.8686 0.9622 0.0128  0.0477  0.1236  607 GLU A N   
4266 C CA  . GLU A 563 ? 0.3961 0.8656 0.9628 0.0063  0.0359  0.1332  607 GLU A CA  
4267 C C   . GLU A 563 ? 0.4225 0.8888 0.9911 0.0332  0.0329  0.1317  607 GLU A C   
4268 O O   . GLU A 563 ? 0.4689 0.8861 1.0054 0.0430  0.0315  0.1200  607 GLU A O   
4269 C CB  . GLU A 563 ? 0.3767 0.8254 0.9372 -0.0203 0.0185  0.1319  607 GLU A CB  
4270 C CG  . GLU A 563 ? 0.3704 0.8162 0.9274 -0.0436 0.0236  0.1355  607 GLU A CG  
4271 C CD  . GLU A 563 ? 0.3659 0.7831 0.9100 -0.0663 0.0095  0.1315  607 GLU A CD  
4272 O OE1 . GLU A 563 ? 0.3731 0.7578 0.8941 -0.0618 0.0012  0.1213  607 GLU A OE1 
4273 O OE2 . GLU A 563 ? 0.3640 0.7891 0.9185 -0.0902 0.0083  0.1372  607 GLU A OE2 
4274 N N   . GLN A 564 ? 0.5618 1.0816 1.1673 0.0455  0.0334  0.1440  608 GLN A N   
4275 C CA  . GLN A 564 ? 0.5931 1.1135 1.2023 0.0754  0.0284  0.1478  608 GLN A CA  
4276 C C   . GLN A 564 ? 0.5633 1.1172 1.1969 0.0640  0.0073  0.1588  608 GLN A C   
4277 O O   . GLN A 564 ? 0.5167 1.1312 1.1872 0.0453  0.0028  0.1670  608 GLN A O   
4278 C CB  . GLN A 564 ? 0.6056 1.1671 1.2359 0.1101  0.0463  0.1533  608 GLN A CB  
4279 C CG  . GLN A 564 ? 0.6572 1.1767 1.2528 0.1262  0.0667  0.1394  608 GLN A CG  
4280 C CD  . GLN A 564 ? 0.7000 1.2304 1.2986 0.1713  0.0833  0.1404  608 GLN A CD  
4281 O OE1 . GLN A 564 ? 0.6816 1.2630 1.3154 0.1938  0.0800  0.1545  608 GLN A OE1 
4282 N NE2 . GLN A 564 ? 0.7618 1.2468 1.3219 0.1871  0.1012  0.1245  608 GLN A NE2 
4283 N N   . PHE A 565 ? 0.4427 0.9547 1.0517 0.0743  -0.0049 0.1583  609 PHE A N   
4284 C CA  . PHE A 565 ? 0.4317 0.9574 1.0464 0.0623  -0.0276 0.1663  609 PHE A CA  
4285 C C   . PHE A 565 ? 0.4628 1.0156 1.0897 0.1008  -0.0336 0.1807  609 PHE A C   
4286 O O   . PHE A 565 ? 0.5107 1.0437 1.1278 0.1382  -0.0186 0.1817  609 PHE A O   
4287 C CB  . PHE A 565 ? 0.4696 0.9220 1.0391 0.0466  -0.0347 0.1568  609 PHE A CB  
4288 C CG  . PHE A 565 ? 0.4329 0.8692 0.9933 0.0113  -0.0342 0.1454  609 PHE A CG  
4289 C CD1 . PHE A 565 ? 0.4380 0.8445 0.9814 0.0092  -0.0189 0.1336  609 PHE A CD1 
4290 C CD2 . PHE A 565 ? 0.4014 0.8534 0.9679 -0.0175 -0.0491 0.1461  609 PHE A CD2 
4291 C CE1 . PHE A 565 ? 0.4095 0.8036 0.9435 -0.0164 -0.0184 0.1258  609 PHE A CE1 
4292 C CE2 . PHE A 565 ? 0.3792 0.8103 0.9339 -0.0445 -0.0464 0.1364  609 PHE A CE2 
4293 C CZ  . PHE A 565 ? 0.3820 0.7852 0.9213 -0.0416 -0.0311 0.1278  609 PHE A CZ  
4294 N N   . LEU A 566 ? 0.4772 1.0790 1.1248 0.0938  -0.0551 0.1917  610 LEU A N   
4295 C CA  . LEU A 566 ? 0.5193 1.1312 1.1631 0.1307  -0.0668 0.2073  610 LEU A CA  
4296 C C   . LEU A 566 ? 0.5639 1.1130 1.1624 0.1137  -0.0815 0.2058  610 LEU A C   
4297 O O   . LEU A 566 ? 0.5307 1.0950 1.1314 0.0765  -0.0963 0.2010  610 LEU A O   
4298 C CB  . LEU A 566 ? 0.4733 1.1954 1.1712 0.1365  -0.0828 0.2212  610 LEU A CB  
4299 C CG  . LEU A 566 ? 0.4568 1.2396 1.1899 0.1578  -0.0658 0.2207  610 LEU A CG  
4300 C CD1 . LEU A 566 ? 0.4598 1.3254 1.2199 0.1477  -0.0805 0.2191  610 LEU A CD1 
4301 C CD2 . LEU A 566 ? 0.5049 1.2607 1.2277 0.2184  -0.0492 0.2304  610 LEU A CD2 
4302 N N   . ARG A 567 ? 0.4647 0.9379 1.0188 0.1397  -0.0741 0.2087  611 ARG A N   
4303 C CA  . ARG A 567 ? 0.5190 0.9250 1.0245 0.1271  -0.0823 0.2092  611 ARG A CA  
4304 C C   . ARG A 567 ? 0.5804 0.9808 1.0678 0.1665  -0.0924 0.2315  611 ARG A C   
4305 O O   . ARG A 567 ? 0.6054 1.0116 1.0997 0.2112  -0.0837 0.2423  611 ARG A O   
4306 C CB  . ARG A 567 ? 0.5922 0.9055 1.0545 0.1229  -0.0618 0.1953  611 ARG A CB  
4307 C CG  . ARG A 567 ? 0.5466 0.8515 1.0127 0.0857  -0.0531 0.1738  611 ARG A CG  
4308 C CD  . ARG A 567 ? 0.6313 0.8545 1.0550 0.0802  -0.0363 0.1594  611 ARG A CD  
4309 N NE  . ARG A 567 ? 0.6979 0.8723 1.0842 0.0615  -0.0420 0.1603  611 ARG A NE  
4310 C CZ  . ARG A 567 ? 0.7547 0.8766 1.1114 0.0378  -0.0317 0.1446  611 ARG A CZ  
4311 N NH1 . ARG A 567 ? 0.7455 0.8591 1.1049 0.0319  -0.0183 0.1266  611 ARG A NH1 
4312 N NH2 . ARG A 567 ? 0.8209 0.9054 1.1459 0.0193  -0.0346 0.1465  611 ARG A NH2 
4313 N N   . LEU A 568 ? 0.6970 1.0810 1.1558 0.1531  -0.1091 0.2389  612 LEU A N   
4314 C CA  . LEU A 568 ? 0.7629 1.1309 1.1921 0.1900  -0.1196 0.2629  612 LEU A CA  
4315 C C   . LEU A 568 ? 0.8687 1.1292 1.2451 0.2150  -0.0973 0.2666  612 LEU A C   
4316 O O   . LEU A 568 ? 0.9186 1.1054 1.2607 0.1850  -0.0837 0.2517  612 LEU A O   
4317 C CB  . LEU A 568 ? 0.7786 1.1453 1.1804 0.1625  -0.1400 0.2670  612 LEU A CB  
4318 C CG  . LEU A 568 ? 0.8368 1.1972 1.2044 0.1980  -0.1554 0.2947  612 LEU A CG  
4319 C CD1 . LEU A 568 ? 0.7933 1.2417 1.2049 0.2438  -0.1678 0.3122  612 LEU A CD1 
4320 C CD2 . LEU A 568 ? 0.8334 1.2147 1.1814 0.1656  -0.1777 0.2948  612 LEU A CD2 
4321 N N   . ARG A 569 ? 1.0462 1.2981 1.4153 0.2698  -0.0930 0.2858  613 ARG A N   
4322 C CA  . ARG A 569 ? 1.1559 1.2933 1.4675 0.2960  -0.0700 0.2899  613 ARG A CA  
4323 C C   . ARG A 569 ? 1.2385 1.2897 1.4860 0.2744  -0.0702 0.2969  613 ARG A C   
4324 O O   . ARG A 569 ? 1.2249 1.3085 1.4654 0.2650  -0.0916 0.3106  613 ARG A O   
4325 C CB  . ARG A 569 ? 1.1817 1.3253 1.4920 0.3660  -0.0672 0.3137  613 ARG A CB  
4326 C CG  . ARG A 569 ? 1.1119 1.3360 1.4822 0.3911  -0.0605 0.3066  613 ARG A CG  
4327 C CD  . ARG A 569 ? 1.1361 1.3773 1.5071 0.4668  -0.0589 0.3324  613 ARG A CD  
4328 N NE  . ARG A 569 ? 1.0573 1.4012 1.4948 0.4921  -0.0546 0.3286  613 ARG A NE  
4329 C CZ  . ARG A 569 ? 1.0684 1.3840 1.5094 0.5052  -0.0268 0.3115  613 ARG A CZ  
4330 N NH1 . ARG A 569 ? 1.1564 1.3444 1.5384 0.4929  -0.0033 0.2946  613 ARG A NH1 
4331 N NH2 . ARG A 569 ? 0.9957 1.4122 1.4969 0.5257  -0.0220 0.3089  613 ARG A NH2 
4332 N N   . LYS A 570 ? 1.1098 1.0531 1.3095 0.2629  -0.0455 0.2859  614 LYS A N   
4333 C CA  . LYS A 570 ? 1.1944 1.0491 1.3300 0.2441  -0.0401 0.2948  614 LYS A CA  
4334 C C   . LYS A 570 ? 1.2374 1.0721 1.3377 0.2956  -0.0491 0.3314  614 LYS A C   
4335 O O   . LYS A 570 ? 1.2465 1.0884 1.3227 0.2865  -0.0646 0.3481  614 LYS A O   
4336 C CB  . LYS A 570 ? 1.2822 1.0224 1.3716 0.2264  -0.0098 0.2777  614 LYS A CB  
4337 C CG  . LYS A 570 ? 1.2565 1.0001 1.3589 0.1657  -0.0028 0.2458  614 LYS A CG  
4338 C CD  . LYS A 570 ? 1.1960 1.0135 1.3573 0.1614  -0.0046 0.2235  614 LYS A CD  
4339 C CE  . LYS A 570 ? 1.1698 1.0026 1.3453 0.1054  -0.0016 0.1949  614 LYS A CE  
4340 N NZ  . LYS A 570 ? 1.1126 1.0231 1.3435 0.1040  -0.0055 0.1785  614 LYS A NZ  
4341 N N   . SER A 571 ? 1.5169 1.3272 1.6112 0.3528  -0.0390 0.3441  615 SER A N   
4342 C CA  . SER A 571 ? 1.5688 1.3502 1.6232 0.4121  -0.0450 0.3817  615 SER A CA  
4343 C C   . SER A 571 ? 1.4989 1.3980 1.5866 0.4268  -0.0811 0.4031  615 SER A C   
4344 O O   . SER A 571 ? 1.5425 1.4167 1.5835 0.4378  -0.0928 0.4292  615 SER A O   
4345 C CB  . SER A 571 ? 1.6015 1.3512 1.6527 0.4780  -0.0278 0.3896  615 SER A CB  
4346 O OG  . SER A 571 ? 1.5054 1.3719 1.6346 0.4924  -0.0356 0.3772  615 SER A OG  
4347 N N   . SER A 572 ? 1.3595 1.3861 1.5249 0.4237  -0.0981 0.3913  616 SER A N   
4348 C CA  . SER A 572 ? 1.2869 1.4372 1.4913 0.4328  -0.1332 0.4065  616 SER A CA  
4349 C C   . SER A 572 ? 1.2839 1.4407 1.4660 0.3805  -0.1509 0.4031  616 SER A C   
4350 O O   . SER A 572 ? 1.2553 1.4091 1.4505 0.3224  -0.1458 0.3755  616 SER A O   
4351 C CB  . SER A 572 ? 1.1707 1.4478 1.4633 0.4233  -0.1422 0.3881  616 SER A CB  
4352 O OG  . SER A 572 ? 1.1687 1.4609 1.4861 0.4788  -0.1278 0.3942  616 SER A OG  
4353 N N   . MET A 573 ? 1.3723 1.5417 1.5192 0.4044  -0.1721 0.4315  617 MET A N   
4354 C CA  . MET A 573 ? 1.3691 1.5574 1.4943 0.3592  -0.1910 0.4284  617 MET A CA  
4355 C C   . MET A 573 ? 1.2921 1.6211 1.4635 0.3659  -0.2296 0.4345  617 MET A C   
4356 O O   . MET A 573 ? 1.3027 1.6806 1.4727 0.4200  -0.2482 0.4631  617 MET A O   
4357 C CB  . MET A 573 ? 1.4791 1.5589 1.5135 0.3681  -0.1825 0.4531  617 MET A CB  
4358 C CG  . MET A 573 ? 1.5011 1.6259 1.5045 0.4039  -0.2121 0.4864  617 MET A CG  
4359 S SD  . MET A 573 ? 1.6161 1.6072 1.5054 0.4083  -0.1985 0.5168  617 MET A SD  
4360 C CE  . MET A 573 ? 1.6844 1.5131 1.5300 0.4196  -0.1502 0.5174  617 MET A CE  
4361 N N   . CYS A 574 ? 1.0399 1.4378 1.2568 0.3112  -0.2407 0.4057  618 CYS A N   
4362 C CA  . CYS A 574 ? 0.9665 1.4938 1.2258 0.3013  -0.2763 0.4040  618 CYS A CA  
4363 C C   . CYS A 574 ? 0.9177 1.4634 1.1945 0.2304  -0.2793 0.3700  618 CYS A C   
4364 O O   . CYS A 574 ? 0.9197 1.3997 1.1949 0.1977  -0.2536 0.3483  618 CYS A O   
4365 C CB  . CYS A 574 ? 0.8948 1.5257 1.2297 0.3337  -0.2832 0.4064  618 CYS A CB  
4366 S SG  . CYS A 574 ? 0.8363 1.4494 1.2255 0.3105  -0.2501 0.3768  618 CYS A SG  
4367 N N   . GLN A 575 ? 0.9307 1.5665 1.2228 0.2079  -0.3108 0.3647  619 GLN A N   
4368 C CA  . GLN A 575 ? 0.8886 1.5415 1.1946 0.1434  -0.3143 0.3319  619 GLN A CA  
4369 C C   . GLN A 575 ? 0.7973 1.5114 1.1795 0.1220  -0.3080 0.3107  619 GLN A C   
4370 O O   . GLN A 575 ? 0.7501 1.5621 1.1864 0.1426  -0.3228 0.3183  619 GLN A O   
4371 C CB  . GLN A 575 ? 0.8878 1.6097 1.1764 0.1251  -0.3499 0.3315  619 GLN A CB  
4372 C CG  . GLN A 575 ? 0.8441 1.5928 1.1483 0.0608  -0.3566 0.2964  619 GLN A CG  
4373 C CD  . GLN A 575 ? 0.8467 1.6811 1.1412 0.0435  -0.3955 0.2932  619 GLN A CD  
4374 O OE1 . GLN A 575 ? 0.8657 1.7597 1.1582 0.0808  -0.4177 0.3135  619 GLN A OE1 
4375 N NE2 . GLN A 575 ? 0.8396 1.6692 1.1218 -0.0122 -0.3997 0.2625  619 GLN A NE2 
4376 N N   . ASN A 576 ? 0.7955 1.4543 1.1811 0.0828  -0.2850 0.2857  620 ASN A N   
4377 C CA  . ASN A 576 ? 0.7113 1.4183 1.1584 0.0536  -0.2783 0.2643  620 ASN A CA  
4378 C C   . ASN A 576 ? 0.6676 1.4677 1.1434 0.0160  -0.3062 0.2510  620 ASN A C   
4379 O O   . ASN A 576 ? 0.6191 1.4958 1.1498 0.0109  -0.3094 0.2446  620 ASN A O   
4380 C CB  . ASN A 576 ? 0.7091 1.3352 1.1428 0.0196  -0.2512 0.2415  620 ASN A CB  
4381 C CG  . ASN A 576 ? 0.7337 1.2916 1.1625 0.0473  -0.2218 0.2468  620 ASN A CG  
4382 O OD1 . ASN A 576 ? 0.7116 1.2991 1.1746 0.0798  -0.2152 0.2567  620 ASN A OD1 
4383 N ND2 . ASN A 576 ? 0.7841 1.2536 1.1702 0.0331  -0.2034 0.2381  620 ASN A ND2 
4384 N N   . GLY A 577 ? 0.6797 1.4619 1.1100 -0.0124 -0.3214 0.2418  621 GLY A N   
4385 C CA  . GLY A 577 ? 0.6592 1.5177 1.1048 -0.0534 -0.3483 0.2249  621 GLY A CA  
4386 C C   . GLY A 577 ? 0.6448 1.4588 1.0819 -0.1095 -0.3361 0.1928  621 GLY A C   
4387 O O   . GLY A 577 ? 0.6228 1.3774 1.0683 -0.1157 -0.3075 0.1841  621 GLY A O   
4388 N N   . ARG A 578 ? 0.6215 1.4554 1.0350 -0.1471 -0.3552 0.1732  622 ARG A N   
4389 C CA  . ARG A 578 ? 0.6200 1.4063 1.0174 -0.1982 -0.3446 0.1424  622 ARG A CA  
4390 C C   . ARG A 578 ? 0.5828 1.3741 1.0276 -0.2178 -0.3232 0.1245  622 ARG A C   
4391 O O   . ARG A 578 ? 0.5705 1.3041 1.0113 -0.2427 -0.3025 0.1090  622 ARG A O   
4392 C CB  . ARG A 578 ? 0.6704 1.4661 1.0231 -0.2306 -0.3662 0.1214  622 ARG A CB  
4393 C CG  . ARG A 578 ? 0.7247 1.5122 1.0167 -0.2126 -0.3863 0.1369  622 ARG A CG  
4394 C CD  . ARG A 578 ? 0.7739 1.5493 1.0130 -0.2550 -0.4011 0.1089  622 ARG A CD  
4395 N NE  . ARG A 578 ? 0.7757 1.4759 1.0034 -0.2905 -0.3755 0.0803  622 ARG A NE  
4396 C CZ  . ARG A 578 ? 0.8119 1.4211 0.9920 -0.2852 -0.3505 0.0745  622 ARG A CZ  
4397 N NH1 . ARG A 578 ? 0.8604 1.4397 0.9975 -0.2532 -0.3471 0.0941  622 ARG A NH1 
4398 N NH2 . ARG A 578 ? 0.8145 1.3631 0.9889 -0.3114 -0.3277 0.0499  622 ARG A NH2 
4399 N N   . ASP A 579 ? 0.8069 1.6655 1.2946 -0.2036 -0.3268 0.1286  623 ASP A N   
4400 C CA  . ASP A 579 ? 0.7854 1.6528 1.3150 -0.2231 -0.3068 0.1144  623 ASP A CA  
4401 C C   . ASP A 579 ? 0.7393 1.5892 1.2997 -0.1931 -0.2815 0.1298  623 ASP A C   
4402 O O   . ASP A 579 ? 0.7230 1.5844 1.3173 -0.2021 -0.2636 0.1227  623 ASP A O   
4403 C CB  . ASP A 579 ? 0.8097 1.7621 1.3736 -0.2278 -0.3214 0.1094  623 ASP A CB  
4404 C CG  . ASP A 579 ? 0.8145 1.8312 1.3964 -0.1765 -0.3363 0.1352  623 ASP A CG  
4405 O OD1 . ASP A 579 ? 0.7951 1.7835 1.3689 -0.1356 -0.3291 0.1579  623 ASP A OD1 
4406 O OD2 . ASP A 579 ? 0.8440 1.9372 1.4475 -0.1768 -0.3548 0.1329  623 ASP A OD2 
4407 N N   . TYR A 580 ? 0.5563 1.3777 1.1026 -0.1583 -0.2800 0.1513  624 TYR A N   
4408 C CA  . TYR A 580 ? 0.5222 1.3278 1.0949 -0.1262 -0.2578 0.1661  624 TYR A CA  
4409 C C   . TYR A 580 ? 0.4925 1.2535 1.0763 -0.1500 -0.2301 0.1507  624 TYR A C   
4410 O O   . TYR A 580 ? 0.5016 1.2074 1.0585 -0.1808 -0.2242 0.1359  624 TYR A O   
4411 C CB  . TYR A 580 ? 0.5457 1.3063 1.0916 -0.0917 -0.2583 0.1881  624 TYR A CB  
4412 C CG  . TYR A 580 ? 0.5315 1.2448 1.0869 -0.0646 -0.2292 0.1936  624 TYR A CG  
4413 C CD1 . TYR A 580 ? 0.5218 1.2756 1.1102 -0.0225 -0.2247 0.2114  624 TYR A CD1 
4414 C CD2 . TYR A 580 ? 0.5325 1.1622 1.0614 -0.0791 -0.2061 0.1798  624 TYR A CD2 
4415 C CE1 . TYR A 580 ? 0.5189 1.2251 1.1094 0.0011  -0.1978 0.2132  624 TYR A CE1 
4416 C CE2 . TYR A 580 ? 0.5268 1.1177 1.0614 -0.0567 -0.1819 0.1823  624 TYR A CE2 
4417 C CZ  . TYR A 580 ? 0.5224 1.1484 1.0855 -0.0184 -0.1777 0.1980  624 TYR A CZ  
4418 O OH  . TYR A 580 ? 0.5284 1.1127 1.0914 0.0025  -0.1535 0.1975  624 TYR A OH  
4419 N N   . VAL A 581 ? 0.5769 1.3619 1.1966 -0.1329 -0.2125 0.1547  625 VAL A N   
4420 C CA  . VAL A 581 ? 0.5547 1.3043 1.1830 -0.1510 -0.1862 0.1434  625 VAL A CA  
4421 C C   . VAL A 581 ? 0.5291 1.2521 1.1650 -0.1158 -0.1682 0.1575  625 VAL A C   
4422 O O   . VAL A 581 ? 0.5269 1.2871 1.1851 -0.0786 -0.1670 0.1720  625 VAL A O   
4423 C CB  . VAL A 581 ? 0.5605 1.3639 1.2245 -0.1655 -0.1783 0.1352  625 VAL A CB  
4424 C CG1 . VAL A 581 ? 0.5476 1.3074 1.2098 -0.1911 -0.1534 0.1244  625 VAL A CG1 
4425 C CG2 . VAL A 581 ? 0.5951 1.4427 1.2614 -0.1940 -0.1994 0.1236  625 VAL A CG2 
4426 N N   . VAL A 582 ? 0.5569 1.2151 1.1736 -0.1256 -0.1534 0.1522  626 VAL A N   
4427 C CA  . VAL A 582 ? 0.5426 1.1755 1.1673 -0.0968 -0.1353 0.1615  626 VAL A CA  
4428 C C   . VAL A 582 ? 0.5215 1.1829 1.1715 -0.0955 -0.1163 0.1582  626 VAL A C   
4429 O O   . VAL A 582 ? 0.5203 1.1657 1.1653 -0.1250 -0.1055 0.1463  626 VAL A O   
4430 C CB  . VAL A 582 ? 0.5517 1.1023 1.1367 -0.1095 -0.1218 0.1485  626 VAL A CB  
4431 C CG1 . VAL A 582 ? 0.5463 1.0636 1.1274 -0.0847 -0.0999 0.1492  626 VAL A CG1 
4432 C CG2 . VAL A 582 ? 0.5889 1.0957 1.1308 -0.1107 -0.1331 0.1449  626 VAL A CG2 
4433 N N   . THR A 583 ? 0.4442 1.1443 1.1192 -0.0599 -0.1104 0.1698  627 THR A N   
4434 C CA  . THR A 583 ? 0.4376 1.1702 1.1368 -0.0584 -0.0913 0.1672  627 THR A CA  
4435 C C   . THR A 583 ? 0.4245 1.1214 1.1204 -0.0360 -0.0685 0.1705  627 THR A C   
4436 O O   . THR A 583 ? 0.4318 1.1070 1.1232 -0.0040 -0.0678 0.1792  627 THR A O   
4437 C CB  . THR A 583 ? 0.4535 1.2649 1.1858 -0.0365 -0.0975 0.1738  627 THR A CB  
4438 O OG1 . THR A 583 ? 0.4568 1.2733 1.1969 0.0139  -0.0890 0.1870  627 THR A OG1 
4439 C CG2 . THR A 583 ? 0.4735 1.3197 1.2048 -0.0446 -0.1259 0.1744  627 THR A CG2 
4440 N N   . LYS A 584 ? 0.5189 1.2077 1.2156 -0.0533 -0.0496 0.1642  628 LYS A N   
4441 C CA  . LYS A 584 ? 0.5102 1.1687 1.2006 -0.0348 -0.0286 0.1658  628 LYS A CA  
4442 C C   . LYS A 584 ? 0.5116 1.1949 1.2141 -0.0442 -0.0077 0.1650  628 LYS A C   
4443 O O   . LYS A 584 ? 0.5194 1.2197 1.2277 -0.0769 -0.0082 0.1614  628 LYS A O   
4444 C CB  . LYS A 584 ? 0.5110 1.1027 1.1706 -0.0503 -0.0290 0.1590  628 LYS A CB  
4445 C CG  . LYS A 584 ? 0.5123 1.0862 1.1577 -0.0907 -0.0343 0.1515  628 LYS A CG  
4446 C CD  . LYS A 584 ? 0.5205 1.0338 1.1356 -0.1008 -0.0275 0.1449  628 LYS A CD  
4447 C CE  . LYS A 584 ? 0.5354 1.0290 1.1384 -0.1374 -0.0324 0.1396  628 LYS A CE  
4448 N NZ  . LYS A 584 ? 0.5567 1.0023 1.1346 -0.1443 -0.0174 0.1374  628 LYS A NZ  
4449 N N   . GLN A 585 ? 0.5082 1.1910 1.2131 -0.0176 0.0123  0.1684  629 GLN A N   
4450 C CA  . GLN A 585 ? 0.5139 1.2176 1.2261 -0.0274 0.0341  0.1699  629 GLN A CA  
4451 C C   . GLN A 585 ? 0.5154 1.1738 1.2039 -0.0240 0.0499  0.1697  629 GLN A C   
4452 O O   . GLN A 585 ? 0.5296 1.1519 1.1956 0.0029  0.0518  0.1637  629 GLN A O   
4453 C CB  . GLN A 585 ? 0.5244 1.2814 1.2605 0.0047  0.0482  0.1741  629 GLN A CB  
4454 C CG  . GLN A 585 ? 0.5351 1.3511 1.3002 0.0120  0.0355  0.1758  629 GLN A CG  
4455 C CD  . GLN A 585 ? 0.5513 1.4018 1.3312 0.0586  0.0502  0.1798  629 GLN A CD  
4456 O OE1 . GLN A 585 ? 0.5546 1.3697 1.3158 0.0876  0.0654  0.1794  629 GLN A OE1 
4457 N NE2 . GLN A 585 ? 0.5676 1.4867 1.3800 0.0673  0.0473  0.1823  629 GLN A NE2 
4458 N N   . PRO A 586 ? 0.2962 0.9451 0.9767 -0.0512 0.0615  0.1728  630 PRO A N   
4459 C CA  . PRO A 586 ? 0.3005 0.9045 0.9474 -0.0447 0.0761  0.1718  630 PRO A CA  
4460 C C   . PRO A 586 ? 0.3150 0.9467 0.9633 -0.0203 0.1014  0.1760  630 PRO A C   
4461 O O   . PRO A 586 ? 0.3230 1.0130 1.0045 -0.0258 0.1145  0.1856  630 PRO A O   
4462 C CB  . PRO A 586 ? 0.3124 0.8929 0.9488 -0.0817 0.0788  0.1776  630 PRO A CB  
4463 C CG  . PRO A 586 ? 0.3248 0.9566 0.9950 -0.1078 0.0784  0.1818  630 PRO A CG  
4464 C CD  . PRO A 586 ? 0.3137 0.9803 1.0037 -0.0893 0.0605  0.1743  630 PRO A CD  
4465 N N   . SER A 587 ? 0.4284 1.0187 1.0360 0.0034  0.1081  0.1661  631 SER A N   
4466 C CA  . SER A 587 ? 0.4595 1.0670 1.0560 0.0224  0.1334  0.1686  631 SER A CA  
4467 C C   . SER A 587 ? 0.4999 1.0657 1.0529 0.0117  0.1405  0.1705  631 SER A C   
4468 O O   . SER A 587 ? 0.5153 1.0331 1.0357 0.0122  0.1263  0.1600  631 SER A O   
4469 C CB  . SER A 587 ? 0.4880 1.0810 1.0653 0.0602  0.1365  0.1535  631 SER A CB  
4470 O OG  . SER A 587 ? 0.4675 1.0893 1.0771 0.0786  0.1308  0.1536  631 SER A OG  
4471 N N   . ILE A 588 ? 0.5321 1.1177 1.0825 0.0037  0.1630  0.1850  632 ILE A N   
4472 C CA  . ILE A 588 ? 0.5841 1.1258 1.0881 -0.0031 0.1690  0.1910  632 ILE A CA  
4473 C C   . ILE A 588 ? 0.6319 1.1638 1.0926 0.0261  0.1808  0.1837  632 ILE A C   
4474 O O   . ILE A 588 ? 0.6480 1.2130 1.1089 0.0382  0.2043  0.1896  632 ILE A O   
4475 C CB  . ILE A 588 ? 0.6054 1.1547 1.1159 -0.0326 0.1873  0.2135  632 ILE A CB  
4476 C CG1 . ILE A 588 ? 0.5648 1.1352 1.1219 -0.0662 0.1769  0.2176  632 ILE A CG1 
4477 C CG2 . ILE A 588 ? 0.6703 1.1592 1.1279 -0.0361 0.1885  0.2213  632 ILE A CG2 
4478 C CD1 . ILE A 588 ? 0.5606 1.0816 1.1062 -0.0785 0.1505  0.2080  632 ILE A CD1 
4479 N N   . CYS A 589 ? 0.4450 0.9354 0.8676 0.0361  0.1647  0.1698  633 CYS A N   
4480 C CA  . CYS A 589 ? 0.4886 0.9702 0.8664 0.0609  0.1700  0.1573  633 CYS A CA  
4481 C C   . CYS A 589 ? 0.5457 1.0199 0.8843 0.0625  0.1852  0.1742  633 CYS A C   
4482 O O   . CYS A 589 ? 0.5573 1.0128 0.8936 0.0450  0.1861  0.1929  633 CYS A O   
4483 C CB  . CYS A 589 ? 0.4944 0.9449 0.8510 0.0660  0.1457  0.1351  633 CYS A CB  
4484 S SG  . CYS A 589 ? 0.4402 0.8882 0.8364 0.0619  0.1297  0.1209  633 CYS A SG  
4485 N N   . LEU A 590 ? 0.5952 1.0802 0.8987 0.0844  0.1989  0.1679  634 LEU A N   
4486 C CA  . LEU A 590 ? 0.6605 1.1371 0.9129 0.0932  0.2114  0.1820  634 LEU A CA  
4487 C C   . LEU A 590 ? 0.6931 1.1371 0.9115 0.0961  0.1886  0.1792  634 LEU A C   
4488 O O   . LEU A 590 ? 0.6861 1.1256 0.8992 0.1024  0.1671  0.1546  634 LEU A O   
4489 C CB  . LEU A 590 ? 0.7014 1.1940 0.9163 0.1186  0.2228  0.1662  634 LEU A CB  
4490 C CG  . LEU A 590 ? 0.6974 1.2258 0.9250 0.1287  0.2519  0.1682  634 LEU A CG  
4491 C CD1 . LEU A 590 ? 0.7607 1.2915 0.9266 0.1538  0.2630  0.1557  634 LEU A CD1 
4492 C CD2 . LEU A 590 ? 0.6821 1.2319 0.9357 0.1102  0.2762  0.2008  634 LEU A CD2 
4493 N N   . CYS A 591 ? 0.7580 1.1801 0.9512 0.0928  0.1950  0.2045  635 CYS A N   
4494 C CA  . CYS A 591 ? 0.8031 1.2008 0.9586 0.1050  0.1762  0.2052  635 CYS A CA  
4495 C C   . CYS A 591 ? 0.8458 1.2624 0.9551 0.1305  0.1676  0.1883  635 CYS A C   
4496 O O   . CYS A 591 ? 0.8821 1.3131 0.9583 0.1434  0.1855  0.1938  635 CYS A O   
4497 C CB  . CYS A 591 ? 0.8610 1.2243 0.9872 0.1037  0.1901  0.2389  635 CYS A CB  
4498 S SG  . CYS A 591 ? 0.8353 1.1644 1.0044 0.0688  0.1951  0.2546  635 CYS A SG  
4499 N N   . SER A 592 ? 0.7298 1.1501 0.8367 0.1354  0.1407  0.1665  636 SER A N   
4500 C CA  . SER A 592 ? 0.7786 1.2216 0.8399 0.1557  0.1276  0.1501  636 SER A CA  
4501 C C   . SER A 592 ? 0.8120 1.2503 0.8532 0.1687  0.1094  0.1613  636 SER A C   
4502 O O   . SER A 592 ? 0.7983 1.2081 0.8604 0.1614  0.1090  0.1780  636 SER A O   
4503 C CB  . SER A 592 ? 0.7506 1.2102 0.8267 0.1480  0.1123  0.1108  636 SER A CB  
4504 O OG  . SER A 592 ? 0.7004 1.1536 0.8110 0.1336  0.0915  0.0989  636 SER A OG  
4505 N N   . LEU A 593 ? 0.8024 1.2704 0.8024 0.1892  0.0942  0.1513  637 LEU A N   
4506 C CA  . LEU A 593 ? 0.8329 1.3065 0.8166 0.2080  0.0762  0.1624  637 LEU A CA  
4507 C C   . LEU A 593 ? 0.7633 1.2378 0.7953 0.1920  0.0574  0.1452  637 LEU A C   
4508 O O   . LEU A 593 ? 0.7494 1.2107 0.7838 0.2029  0.0508  0.1604  637 LEU A O   
4509 C CB  . LEU A 593 ? 0.8717 1.3924 0.8051 0.2340  0.0599  0.1534  637 LEU A CB  
4510 C CG  . LEU A 593 ? 0.9140 1.4325 0.7868 0.2564  0.0780  0.1766  637 LEU A CG  
4511 C CD1 . LEU A 593 ? 0.9337 1.5083 0.7557 0.2787  0.0584  0.1602  637 LEU A CD1 
4512 C CD2 . LEU A 593 ? 0.9405 1.4127 0.7882 0.2746  0.0952  0.2233  637 LEU A CD2 
4513 N N   . GLU A 594 ? 1.0720 1.5551 1.1390 0.1672  0.0521  0.1156  638 GLU A N   
4514 C CA  . GLU A 594 ? 0.9888 1.4737 1.0972 0.1497  0.0362  0.0984  638 GLU A CA  
4515 C C   . GLU A 594 ? 0.9491 1.3912 1.0871 0.1401  0.0453  0.1196  638 GLU A C   
4516 O O   . GLU A 594 ? 0.8870 1.3256 1.0541 0.1290  0.0342  0.1110  638 GLU A O   
4517 C CB  . GLU A 594 ? 0.9534 1.4440 1.0844 0.1256  0.0326  0.0658  638 GLU A CB  
4518 C CG  . GLU A 594 ? 1.0181 1.5263 1.1159 0.1294  0.0365  0.0467  638 GLU A CG  
4519 C CD  . GLU A 594 ? 1.0602 1.6160 1.1296 0.1344  0.0151  0.0229  638 GLU A CD  
4520 O OE1 . GLU A 594 ? 1.0101 1.5879 1.1015 0.1222  -0.0034 0.0072  638 GLU A OE1 
4521 O OE2 . GLU A 594 ? 1.1354 1.7120 1.1602 0.1493  0.0169  0.0194  638 GLU A OE2 
4522 N N   . ASP A 595 ? 0.7017 1.1122 0.8299 0.1419  0.0666  0.1463  639 ASP A N   
4523 C CA  . ASP A 595 ? 0.6868 1.0545 0.8380 0.1278  0.0770  0.1656  639 ASP A CA  
4524 C C   . ASP A 595 ? 0.7505 1.0888 0.8711 0.1482  0.0784  0.1903  639 ASP A C   
4525 O O   . ASP A 595 ? 0.7726 1.0648 0.8995 0.1379  0.0888  0.2074  639 ASP A O   
4526 C CB  . ASP A 595 ? 0.6981 1.0504 0.8589 0.1128  0.1009  0.1803  639 ASP A CB  
4527 C CG  . ASP A 595 ? 0.6301 1.0040 0.8265 0.0965  0.1010  0.1589  639 ASP A CG  
4528 O OD1 . ASP A 595 ? 0.5650 0.9332 0.7984 0.0793  0.0906  0.1474  639 ASP A OD1 
4529 O OD2 . ASP A 595 ? 0.6496 1.0429 0.8330 0.1033  0.1126  0.1546  639 ASP A OD2 
4530 N N   . PHE A 596 ? 0.8422 1.2060 0.9266 0.1784  0.0680  0.1918  640 PHE A N   
4531 C CA  . PHE A 596 ? 0.8909 1.2253 0.9406 0.2066  0.0700  0.2173  640 PHE A CA  
4532 C C   . PHE A 596 ? 0.8296 1.2015 0.8831 0.2282  0.0461  0.2031  640 PHE A C   
4533 O O   . PHE A 596 ? 0.7789 1.2113 0.8469 0.2253  0.0277  0.1758  640 PHE A O   
4534 C CB  . PHE A 596 ? 0.9781 1.3062 0.9716 0.2321  0.0834  0.2432  640 PHE A CB  
4535 C CG  . PHE A 596 ? 1.0265 1.3191 1.0167 0.2104  0.1112  0.2607  640 PHE A CG  
4536 C CD1 . PHE A 596 ? 1.0593 1.2845 1.0369 0.2023  0.1325  0.2898  640 PHE A CD1 
4537 C CD2 . PHE A 596 ? 1.0088 1.3356 1.0107 0.1955  0.1175  0.2461  640 PHE A CD2 
4538 C CE1 . PHE A 596 ? 1.0669 1.2693 1.0478 0.1764  0.1592  0.3050  640 PHE A CE1 
4539 C CE2 . PHE A 596 ? 1.0053 1.3113 1.0107 0.1763  0.1444  0.2618  640 PHE A CE2 
4540 C CZ  . PHE A 596 ? 1.0331 1.2818 1.0307 0.1648  0.1650  0.2916  640 PHE A CZ  
4541 N N   . LEU A 597 ? 0.8973 1.2334 0.9376 0.2487  0.0478  0.2206  641 LEU A N   
4542 C CA  . LEU A 597 ? 0.8485 1.2277 0.8886 0.2784  0.0278  0.2121  641 LEU A CA  
4543 C C   . LEU A 597 ? 0.9077 1.2794 0.8900 0.3273  0.0307  0.2420  641 LEU A C   
4544 O O   . LEU A 597 ? 0.9841 1.2865 0.9289 0.3342  0.0525  0.2727  641 LEU A O   
4545 C CB  . LEU A 597 ? 0.8145 1.1605 0.8813 0.2716  0.0280  0.2076  641 LEU A CB  
4546 C CG  . LEU A 597 ? 0.8875 1.1401 0.9249 0.2807  0.0492  0.2366  641 LEU A CG  
4547 C CD1 . LEU A 597 ? 0.9129 1.1504 0.9116 0.3347  0.0478  0.2557  641 LEU A CD1 
4548 C CD2 . LEU A 597 ? 0.8738 1.0812 0.9458 0.2413  0.0561  0.2254  641 LEU A CD2 
4549 N N   . CYS A 598 ? 1.0155 1.4608 0.9893 0.3599  0.0090  0.2339  642 CYS A N   
4550 C CA  . CYS A 598 ? 1.0557 1.5039 0.9739 0.4149  0.0075  0.2633  642 CYS A CA  
4551 C C   . CYS A 598 ? 1.0889 1.4619 0.9853 0.4450  0.0212  0.2906  642 CYS A C   
4552 O O   . CYS A 598 ? 1.0496 1.4210 0.9789 0.4427  0.0169  0.2774  642 CYS A O   
4553 C CB  . CYS A 598 ? 0.9976 1.5555 0.9221 0.4415  -0.0224 0.2446  642 CYS A CB  
4554 S SG  . CYS A 598 ? 0.9820 1.6196 0.9147 0.4098  -0.0382 0.2116  642 CYS A SG  
4555 N N   . ASP A 599 ? 1.1056 1.4110 0.9414 0.4735  0.0397  0.3288  643 ASP A N   
4556 C CA  . ASP A 599 ? 1.1576 1.3703 0.9597 0.5018  0.0575  0.3570  643 ASP A CA  
4557 C C   . ASP A 599 ? 1.1419 1.3973 0.9172 0.5714  0.0415  0.3694  643 ASP A C   
4558 O O   . ASP A 599 ? 1.0859 1.4541 0.8814 0.5887  0.0142  0.3509  643 ASP A O   
4559 C CB  . ASP A 599 ? 1.2497 1.3648 0.9944 0.4982  0.0875  0.3940  643 ASP A CB  
4560 C CG  . ASP A 599 ? 1.3177 1.3097 1.0342 0.5009  0.1129  0.4163  643 ASP A CG  
4561 O OD1 . ASP A 599 ? 1.3011 1.2820 1.0298 0.5221  0.1066  0.4076  643 ASP A OD1 
4562 O OD2 . ASP A 599 ? 1.3910 1.2964 1.0702 0.4807  0.1408  0.4419  643 ASP A OD2 
4563 N N   . PHE A 600 ? 1.2131 1.3810 0.9417 0.6124  0.0584  0.4001  644 PHE A N   
4564 C CA  . PHE A 600 ? 1.2500 1.4597 0.9660 0.6660  0.0461  0.3988  644 PHE A CA  
4565 C C   . PHE A 600 ? 1.2895 1.5713 0.9734 0.6956  0.0326  0.4034  644 PHE A C   
4566 O O   . PHE A 600 ? 1.3561 1.5890 0.9854 0.7037  0.0468  0.4310  644 PHE A O   
4567 C CB  . PHE A 600 ? 1.3495 1.4398 1.0201 0.6923  0.0715  0.4197  644 PHE A CB  
4568 C CG  . PHE A 600 ? 1.3988 1.5323 1.0585 0.7427  0.0625  0.4137  644 PHE A CG  
4569 C CD1 . PHE A 600 ? 1.3273 1.5669 1.0452 0.7447  0.0400  0.3806  644 PHE A CD1 
4570 C CD2 . PHE A 600 ? 1.5212 1.5918 1.1130 0.7865  0.0780  0.4417  644 PHE A CD2 
4571 C CE1 . PHE A 600 ? 1.3752 1.6605 1.0847 0.7897  0.0336  0.3765  644 PHE A CE1 
4572 C CE2 . PHE A 600 ? 1.5710 1.6844 1.1529 0.8358  0.0707  0.4383  644 PHE A CE2 
4573 C CZ  . PHE A 600 ? 1.4970 1.7209 1.1385 0.8378  0.0484  0.4061  644 PHE A CZ  
4574 N N   . GLY A 601 ? 1.2694 1.6685 0.9869 0.7091  0.0065  0.3758  645 GLY A N   
4575 C CA  . GLY A 601 ? 1.3077 1.7823 0.9965 0.7384  -0.0080 0.3774  645 GLY A CA  
4576 C C   . GLY A 601 ? 1.2632 1.8055 0.9580 0.7094  -0.0227 0.3654  645 GLY A C   
4577 O O   . GLY A 601 ? 1.3129 1.8889 0.9670 0.7306  -0.0283 0.3746  645 GLY A O   
4578 N N   . TYR A 602 ? 1.2565 1.8174 1.0002 0.6622  -0.0286 0.3443  646 TYR A N   
4579 C CA  . TYR A 602 ? 1.2090 1.8374 0.9641 0.6306  -0.0435 0.3259  646 TYR A CA  
4580 C C   . TYR A 602 ? 1.1082 1.8230 0.9376 0.5915  -0.0653 0.2811  646 TYR A C   
4581 O O   . TYR A 602 ? 1.0685 1.7682 0.9405 0.5818  -0.0625 0.2710  646 TYR A O   
4582 C CB  . TYR A 602 ? 1.2253 1.7680 0.9572 0.6041  -0.0201 0.3479  646 TYR A CB  
4583 C CG  . TYR A 602 ? 1.3192 1.8028 0.9718 0.6345  -0.0016 0.3888  646 TYR A CG  
4584 C CD1 . TYR A 602 ? 1.4034 1.7811 1.0129 0.6615  0.0240  0.4232  646 TYR A CD1 
4585 C CD2 . TYR A 602 ? 1.3363 1.8636 0.9558 0.6300  -0.0066 0.3878  646 TYR A CD2 
4586 C CE1 . TYR A 602 ? 1.4989 1.8171 1.0388 0.6815  0.0442  0.4565  646 TYR A CE1 
4587 C CE2 . TYR A 602 ? 1.4283 1.9005 0.9780 0.6521  0.0136  0.4212  646 TYR A CE2 
4588 C CZ  . TYR A 602 ? 1.5086 1.8766 1.0205 0.6769  0.0391  0.4561  646 TYR A CZ  
4589 O OH  . TYR A 602 ? 1.6056 1.9153 1.0487 0.6954  0.0606  0.4890  646 TYR A OH  
4590 N N   . TYR A 603 ? 1.1387 1.9386 0.9799 0.5667  -0.0851 0.2530  647 TYR A N   
4591 C CA  . TYR A 603 ? 1.0540 1.9328 0.9607 0.5230  -0.1042 0.2074  647 TYR A CA  
4592 C C   . TYR A 603 ? 1.0402 1.9533 0.9460 0.4815  -0.1120 0.1805  647 TYR A C   
4593 O O   . TYR A 603 ? 1.0971 2.0079 0.9495 0.4963  -0.1105 0.1938  647 TYR A O   
4594 C CB  . TYR A 603 ? 1.0566 2.0203 0.9826 0.5331  -0.1210 0.1840  647 TYR A CB  
4595 C CG  . TYR A 603 ? 1.1036 2.1413 0.9949 0.5491  -0.1370 0.1765  647 TYR A CG  
4596 C CD1 . TYR A 603 ? 1.1881 2.1963 1.0175 0.5985  -0.1292 0.2110  647 TYR A CD1 
4597 C CD2 . TYR A 603 ? 1.0709 2.2046 0.9901 0.5128  -0.1586 0.1341  647 TYR A CD2 
4598 C CE1 . TYR A 603 ? 1.2371 2.3165 1.0358 0.6141  -0.1443 0.2038  647 TYR A CE1 
4599 C CE2 . TYR A 603 ? 1.1208 2.3241 1.0091 0.5256  -0.1736 0.1251  647 TYR A CE2 
4600 C CZ  . TYR A 603 ? 1.2021 2.3815 1.0315 0.5776  -0.1673 0.1602  647 TYR A CZ  
4601 O OH  . TYR A 603 ? 1.2560 2.5081 1.0558 0.5912  -0.1830 0.1512  647 TYR A OH  
4602 N N   . ARG A 604 ? 1.1524 2.0864 1.1116 0.4275  -0.1166 0.1412  648 ARG A N   
4603 C CA  . ARG A 604 ? 1.1692 2.1315 1.1257 0.3864  -0.1230 0.1085  648 ARG A CA  
4604 C C   . ARG A 604 ? 1.1155 2.1994 1.0908 0.3771  -0.1549 0.0722  648 ARG A C   
4605 O O   . ARG A 604 ? 1.0539 2.1753 1.0825 0.3456  -0.1633 0.0442  648 ARG A O   
4606 C CB  . ARG A 604 ? 1.1657 2.0642 1.1610 0.3313  -0.1057 0.0884  648 ARG A CB  
4607 C CG  . ARG A 604 ? 1.2323 2.0276 1.2069 0.3286  -0.0758 0.1158  648 ARG A CG  
4608 C CD  . ARG A 604 ? 1.2273 1.9789 1.2386 0.2776  -0.0631 0.0930  648 ARG A CD  
4609 N NE  . ARG A 604 ? 1.2820 1.9478 1.2826 0.2732  -0.0351 0.1188  648 ARG A NE  
4610 C CZ  . ARG A 604 ? 1.2679 1.8729 1.2890 0.2707  -0.0205 0.1389  648 ARG A CZ  
4611 N NH1 . ARG A 604 ? 1.2052 1.8200 1.2548 0.2760  -0.0299 0.1365  648 ARG A NH1 
4612 N NH2 . ARG A 604 ? 1.3202 1.8581 1.3331 0.2613  0.0040  0.1598  648 ARG A NH2 
4613 N N   . PRO A 605 ? 1.3661 2.5109 1.2959 0.3996  -0.1713 0.0711  649 PRO A N   
4614 C CA  . PRO A 605 ? 1.3656 2.5992 1.3119 0.3711  -0.1915 0.0280  649 PRO A CA  
4615 C C   . PRO A 605 ? 1.3468 2.5924 1.2984 0.3170  -0.1988 -0.0126 649 PRO A C   
4616 O O   . PRO A 605 ? 1.3917 2.5551 1.3187 0.3053  -0.1780 -0.0059 649 PRO A O   
4617 C CB  . PRO A 605 ? 1.4416 2.7107 1.3324 0.4116  -0.1986 0.0426  649 PRO A CB  
4618 C CG  . PRO A 605 ? 1.4780 2.6734 1.3123 0.4396  -0.1827 0.0795  649 PRO A CG  
4619 C CD  . PRO A 605 ? 1.4378 2.5519 1.2972 0.4432  -0.1634 0.1067  649 PRO A CD  
4620 N N   . GLU A 606 ? 2.1466 3.4511 2.1309 0.2739  -0.2117 -0.0558 650 GLU A N   
4621 C CA  . GLU A 606 ? 2.1584 3.4797 2.1341 0.2219  -0.2203 -0.1016 650 GLU A CA  
4622 C C   . GLU A 606 ? 2.1935 3.4143 2.1663 0.1891  -0.1972 -0.1094 650 GLU A C   
4623 O O   . GLU A 606 ? 2.1829 3.3321 2.1906 0.1822  -0.1770 -0.0933 650 GLU A O   
4624 C CB  . GLU A 606 ? 2.2312 3.5964 2.1498 0.2351  -0.2322 -0.1112 650 GLU A CB  
4625 C CG  . GLU A 606 ? 2.2780 3.5978 2.1291 0.2767  -0.2231 -0.0784 650 GLU A CG  
4626 C CD  . GLU A 606 ? 2.3449 3.6993 2.1559 0.3269  -0.2282 -0.0515 650 GLU A CD  
4627 O OE1 . GLU A 606 ? 2.3510 3.7665 2.1891 0.3382  -0.2392 -0.0532 650 GLU A OE1 
4628 O OE2 . GLU A 606 ? 2.3967 3.7159 2.1462 0.3558  -0.2191 -0.0276 650 GLU A OE2 
4629 N N   . ASN A 607 ? 2.1327 3.3361 2.0607 0.1700  -0.1950 -0.1334 651 ASN A N   
4630 C CA  . ASN A 607 ? 2.1954 3.2951 2.1122 0.1448  -0.1670 -0.1406 651 ASN A CA  
4631 C C   . ASN A 607 ? 2.2354 3.2504 2.1481 0.1768  -0.1389 -0.0936 651 ASN A C   
4632 O O   . ASN A 607 ? 2.2350 3.1872 2.1883 0.1628  -0.1214 -0.0837 651 ASN A O   
4633 C CB  . ASN A 607 ? 2.2589 3.3614 2.1136 0.1360  -0.1687 -0.1678 651 ASN A CB  
4634 C CG  . ASN A 607 ? 2.2592 3.4240 2.1122 0.0899  -0.1919 -0.2231 651 ASN A CG  
4635 O OD1 . ASN A 607 ? 2.2358 3.4551 2.1362 0.0646  -0.2083 -0.2399 651 ASN A OD1 
4636 N ND2 . ASN A 607 ? 2.2871 3.4443 2.0832 0.0766  -0.1920 -0.2532 651 ASN A ND2 
4637 N N   . ASP A 608 ? 1.8546 2.8713 1.7159 0.2181  -0.1350 -0.0649 652 ASP A N   
4638 C CA  . ASP A 608 ? 1.9068 2.8407 1.7514 0.2402  -0.1045 -0.0253 652 ASP A CA  
4639 C C   . ASP A 608 ? 1.8671 2.7540 1.7572 0.2491  -0.0919 0.0075  652 ASP A C   
4640 O O   . ASP A 608 ? 1.8015 2.7276 1.7187 0.2620  -0.1076 0.0146  652 ASP A O   
4641 C CB  . ASP A 608 ? 1.9525 2.9023 1.7295 0.2840  -0.1032 0.0033  652 ASP A CB  
4642 C CG  . ASP A 608 ? 2.0203 2.8923 1.7672 0.2895  -0.0686 0.0262  652 ASP A CG  
4643 O OD1 . ASP A 608 ? 2.0243 2.8319 1.8105 0.2678  -0.0465 0.0299  652 ASP A OD1 
4644 O OD2 . ASP A 608 ? 2.0642 2.9445 1.7484 0.3154  -0.0634 0.0409  652 ASP A OD2 
4645 N N   . SER A 609 ? 1.3930 1.9917 1.5339 0.7057  -0.2639 -0.2964 653 SER A N   
4646 C CA  . SER A 609 ? 1.3486 1.9603 1.5360 0.6286  -0.1960 -0.2407 653 SER A CA  
4647 C C   . SER A 609 ? 1.3523 1.9926 1.4816 0.6492  -0.1284 -0.1923 653 SER A C   
4648 O O   . SER A 609 ? 1.3235 1.9734 1.4805 0.5973  -0.0724 -0.1434 653 SER A O   
4649 C CB  . SER A 609 ? 1.3278 1.9494 1.5390 0.6012  -0.1767 -0.2303 653 SER A CB  
4650 O OG  . SER A 609 ? 1.3184 1.9154 1.5906 0.5798  -0.2393 -0.2719 653 SER A OG  
4651 N N   . LYS A 610 ? 1.4533 2.1057 1.5040 0.7289  -0.1385 -0.2064 654 LYS A N   
4652 C CA  . LYS A 610 ? 1.4590 2.1431 1.4561 0.7578  -0.0794 -0.1594 654 LYS A CA  
4653 C C   . LYS A 610 ? 1.4449 2.1116 1.4808 0.7049  -0.0659 -0.1397 654 LYS A C   
4654 O O   . LYS A 610 ? 1.4604 2.0990 1.5156 0.7005  -0.1141 -0.1750 654 LYS A O   
4655 C CB  . LYS A 610 ? 1.5376 2.2284 1.4303 0.8507  -0.0988 -0.1818 654 LYS A CB  
4656 C CG  . LYS A 610 ? 1.5685 2.2957 1.3926 0.8836  -0.0339 -0.1233 654 LYS A CG  
4657 C CD  . LYS A 610 ? 1.5711 2.3381 1.3791 0.8902  0.0211  -0.0698 654 LYS A CD  
4658 C CE  . LYS A 610 ? 1.6198 2.4236 1.3704 0.9222  0.0779  -0.0039 654 LYS A CE  
4659 N NZ  . LYS A 610 ? 1.5752 2.4169 1.3733 0.8891  0.1431  0.0728  654 LYS A NZ  
4660 N N   . CYS A 611 ? 1.0329 1.7152 1.0850 0.6657  -0.0035 -0.0819 655 CYS A N   
4661 C CA  . CYS A 611 ? 1.0209 1.6888 1.0978 0.6246  0.0137  -0.0597 655 CYS A CA  
4662 C C   . CYS A 611 ? 1.0450 1.7317 1.0540 0.6884  0.0239  -0.0527 655 CYS A C   
4663 O O   . CYS A 611 ? 1.0637 1.7890 1.0259 0.7351  0.0646  -0.0165 655 CYS A O   
4664 C CB  . CYS A 611 ? 0.9925 1.6642 1.1102 0.5660  0.0682  -0.0034 655 CYS A CB  
4665 S SG  . CYS A 611 ? 0.9621 1.6015 1.1652 0.4787  0.0571  -0.0094 655 CYS A SG  
4666 N N   . VAL A 612 ? 1.3000 1.9631 1.3084 0.6916  -0.0123 -0.0830 656 VAL A N   
4667 C CA  . VAL A 612 ? 1.3252 2.0016 1.2688 0.7525  -0.0089 -0.0826 656 VAL A CA  
4668 C C   . VAL A 612 ? 1.3118 1.9750 1.2794 0.7100  0.0114  -0.0577 656 VAL A C   
4669 O O   . VAL A 612 ? 1.2913 1.9272 1.3216 0.6444  0.0007  -0.0600 656 VAL A O   
4670 C CB  . VAL A 612 ? 1.3726 2.0323 1.2776 0.8160  -0.0787 -0.1468 656 VAL A CB  
4671 C CG1 . VAL A 612 ? 1.3991 2.0575 1.2888 0.8455  -0.1106 -0.1791 656 VAL A CG1 
4672 C CG2 . VAL A 612 ? 1.3630 1.9820 1.3292 0.7716  -0.1306 -0.1789 656 VAL A CG2 
4673 N N   . GLU A 613 ? 1.1866 1.8730 1.1019 0.7524  0.0424  -0.0310 657 GLU A N   
4674 C CA  . GLU A 613 ? 1.1760 1.8533 1.1056 0.7193  0.0667  -0.0023 657 GLU A CA  
4675 C C   . GLU A 613 ? 1.1839 1.8276 1.1304 0.7055  0.0194  -0.0428 657 GLU A C   
4676 O O   . GLU A 613 ? 1.2107 1.8473 1.1271 0.7545  -0.0279 -0.0874 657 GLU A O   
4677 C CB  . GLU A 613 ? 1.1899 1.9052 1.0607 0.7757  0.1082  0.0367  657 GLU A CB  
4678 C CG  . GLU A 613 ? 1.1835 1.8901 1.0629 0.7500  0.1304  0.0648  657 GLU A CG  
4679 C CD  . GLU A 613 ? 1.2124 1.9613 1.0382 0.8103  0.1691  0.1052  657 GLU A CD  
4680 O OE1 . GLU A 613 ? 1.2620 2.0355 1.0462 0.8455  0.1846  0.1274  657 GLU A OE1 
4681 O OE2 . GLU A 613 ? 1.2137 1.9562 1.0323 0.8055  0.1787  0.1183  657 GLU A OE2 
4682 N N   . GLN A 614 ? 1.4572 2.0799 1.4538 0.6424  0.0290  -0.0260 658 GLN A N   
4683 C CA  . GLN A 614 ? 1.4606 2.0594 1.4800 0.6287  -0.0081 -0.0513 658 GLN A CA  
4684 C C   . GLN A 614 ? 1.4852 2.0915 1.4447 0.6822  -0.0087 -0.0555 658 GLN A C   
4685 O O   . GLN A 614 ? 1.4877 2.1147 1.4073 0.7012  0.0367  -0.0194 658 GLN A O   
4686 C CB  . GLN A 614 ? 1.4356 2.0179 1.5086 0.5607  0.0115  -0.0245 658 GLN A CB  
4687 C CG  . GLN A 614 ? 1.4127 1.9854 1.5486 0.5095  0.0043  -0.0251 658 GLN A CG  
4688 C CD  . GLN A 614 ? 1.4046 1.9650 1.5992 0.4905  -0.0455 -0.0527 658 GLN A CD  
4689 O OE1 . GLN A 614 ? 1.4207 1.9774 1.6114 0.5215  -0.0862 -0.0800 658 GLN A OE1 
4690 N NE2 . GLN A 614 ? 1.3800 1.9356 1.6350 0.4414  -0.0446 -0.0424 658 GLN A NE2 
4691 N N   . PRO A 615 ? 1.6187 2.2087 1.5772 0.7085  -0.0633 -0.0978 659 PRO A N   
4692 C CA  . PRO A 615 ? 1.6440 2.2369 1.5469 0.7588  -0.0686 -0.1055 659 PRO A CA  
4693 C C   . PRO A 615 ? 1.6253 2.2170 1.5373 0.7208  -0.0281 -0.0666 659 PRO A C   
4694 O O   . PRO A 615 ? 1.6350 2.2439 1.4955 0.7512  0.0068  -0.0426 659 PRO A O   
4695 C CB  . PRO A 615 ? 1.6633 2.2285 1.5960 0.7718  -0.1442 -0.1561 659 PRO A CB  
4696 C CG  . PRO A 615 ? 1.6568 2.2125 1.6394 0.7539  -0.1805 -0.1795 659 PRO A CG  
4697 C CD  . PRO A 615 ? 1.6206 2.1884 1.6373 0.6936  -0.1267 -0.1381 659 PRO A CD  
4698 N N   . GLU A 616 ? 1.7414 2.3147 1.7195 0.6583  -0.0336 -0.0589 660 GLU A N   
4699 C CA  . GLU A 616 ? 1.7258 2.2946 1.7139 0.6197  0.0042  -0.0221 660 GLU A CA  
4700 C C   . GLU A 616 ? 1.6994 2.2558 1.7549 0.5566  0.0066  -0.0093 660 GLU A C   
4701 O O   . GLU A 616 ? 1.6905 2.2419 1.7968 0.5406  -0.0296 -0.0305 660 GLU A O   
4702 C CB  . GLU A 616 ? 1.7369 2.2975 1.7121 0.6356  -0.0136 -0.0314 660 GLU A CB  
4703 C CG  . GLU A 616 ? 1.7300 2.2884 1.6910 0.6148  0.0280  0.0055  660 GLU A CG  
4704 C CD  . GLU A 616 ? 1.7388 2.3150 1.6480 0.6397  0.0740  0.0365  660 GLU A CD  
4705 O OE1 . GLU A 616 ? 1.7570 2.3491 1.6129 0.6937  0.0749  0.0305  660 GLU A OE1 
4706 O OE2 . GLU A 616 ? 1.7291 2.3045 1.6558 0.6072  0.1073  0.0700  660 GLU A OE2 
4707 N N   . LEU A 617 ? 1.1708 1.7222 1.2276 0.5249  0.0467  0.0262  661 LEU A N   
4708 C CA  . LEU A 617 ? 1.1524 1.6910 1.2592 0.4743  0.0520  0.0399  661 LEU A CA  
4709 C C   . LEU A 617 ? 1.1448 1.6763 1.2786 0.4583  0.0382  0.0422  661 LEU A C   
4710 O O   . LEU A 617 ? 1.1556 1.6831 1.2597 0.4695  0.0495  0.0525  661 LEU A O   
4711 C CB  . LEU A 617 ? 1.1578 1.6880 1.2509 0.4552  0.0928  0.0744  661 LEU A CB  
4712 C CG  . LEU A 617 ? 1.1697 1.7173 1.2339 0.4821  0.1119  0.0843  661 LEU A CG  
4713 C CD1 . LEU A 617 ? 1.1801 1.7226 1.2365 0.4718  0.1482  0.1264  661 LEU A CD1 
4714 C CD2 . LEU A 617 ? 1.1624 1.7162 1.2542 0.4722  0.1007  0.0704  661 LEU A CD2 
4715 N N   . LYS A 618 ? 1.5982 2.1323 1.7917 0.4333  0.0160  0.0376  662 LYS A N   
4716 C CA  . LYS A 618 ? 1.5862 2.1238 1.8151 0.4209  0.0060  0.0496  662 LYS A CA  
4717 C C   . LYS A 618 ? 1.5674 2.1055 1.8320 0.3879  0.0212  0.0718  662 LYS A C   
4718 O O   . LYS A 618 ? 1.5640 2.0967 1.8336 0.3716  0.0318  0.0718  662 LYS A O   
4719 C CB  . LYS A 618 ? 1.5810 2.1305 1.8625 0.4318  -0.0428 0.0306  662 LYS A CB  
4720 C CG  . LYS A 618 ? 1.5623 2.1187 1.9045 0.4191  -0.0744 0.0154  662 LYS A CG  
4721 C CD  . LYS A 618 ? 1.5581 2.1222 1.9703 0.4276  -0.1325 0.0010  662 LYS A CD  
4722 C CE  . LYS A 618 ? 1.5380 2.1084 2.0243 0.4112  -0.1684 -0.0100 662 LYS A CE  
4723 N NZ  . LYS A 618 ? 1.5567 2.1140 1.9989 0.4306  -0.1765 -0.0442 662 LYS A NZ  
4724 N N   . GLY A 619 ? 0.9287 1.4746 1.2133 0.3831  0.0235  0.0922  663 GLY A N   
4725 C CA  . GLY A 619 ? 0.9138 1.4642 1.2228 0.3641  0.0384  0.1155  663 GLY A CA  
4726 C C   . GLY A 619 ? 0.9362 1.4585 1.1963 0.3564  0.0672  0.1209  663 GLY A C   
4727 O O   . GLY A 619 ? 0.9639 1.4643 1.1698 0.3666  0.0830  0.1225  663 GLY A O   
4728 N N   . HIS A 620 ? 0.9108 1.4328 1.1970 0.3380  0.0705  0.1250  664 HIS A N   
4729 C CA  . HIS A 620 ? 0.9375 1.4285 1.1885 0.3301  0.0896  0.1305  664 HIS A CA  
4730 C C   . HIS A 620 ? 0.9560 1.4294 1.1835 0.3262  0.0960  0.1199  664 HIS A C   
4731 O O   . HIS A 620 ? 0.9871 1.4314 1.1874 0.3220  0.1088  0.1283  664 HIS A O   
4732 C CB  . HIS A 620 ? 0.9233 1.4197 1.2080 0.3158  0.0898  0.1382  664 HIS A CB  
4733 C CG  . HIS A 620 ? 0.8939 1.4093 1.2307 0.2977  0.0767  0.1267  664 HIS A CG  
4734 N ND1 . HIS A 620 ? 0.9031 1.4008 1.2358 0.2821  0.0810  0.1160  664 HIS A ND1 
4735 C CD2 . HIS A 620 ? 0.8578 1.4075 1.2574 0.2932  0.0560  0.1258  664 HIS A CD2 
4736 C CE1 . HIS A 620 ? 0.8736 1.3932 1.2557 0.2705  0.0653  0.1056  664 HIS A CE1 
4737 N NE2 . HIS A 620 ? 0.8476 1.3971 1.2733 0.2764  0.0474  0.1106  664 HIS A NE2 
4738 N N   . ASP A 621 ? 1.0417 1.5339 1.2824 0.3321  0.0841  0.1038  665 ASP A N   
4739 C CA  . ASP A 621 ? 1.0574 1.5439 1.2693 0.3409  0.0942  0.1000  665 ASP A CA  
4740 C C   . ASP A 621 ? 1.0821 1.5586 1.2485 0.3597  0.1081  0.1117  665 ASP A C   
4741 O O   . ASP A 621 ? 1.1047 1.5661 1.2509 0.3592  0.1259  0.1284  665 ASP A O   
4742 C CB  . ASP A 621 ? 1.0432 1.5520 1.2668 0.3563  0.0746  0.0769  665 ASP A CB  
4743 C CG  . ASP A 621 ? 1.0248 1.5401 1.2906 0.3371  0.0630  0.0665  665 ASP A CG  
4744 O OD1 . ASP A 621 ? 1.0308 1.5386 1.2896 0.3276  0.0796  0.0735  665 ASP A OD1 
4745 O OD2 . ASP A 621 ? 1.0039 1.5329 1.3167 0.3309  0.0363  0.0549  665 ASP A OD2 
4746 N N   . LEU A 622 ? 0.7778 1.2636 0.9359 0.3755  0.0983  0.1066  666 LEU A N   
4747 C CA  . LEU A 622 ? 0.8065 1.2834 0.9214 0.3936  0.1109  0.1172  666 LEU A CA  
4748 C C   . LEU A 622 ? 0.8109 1.2587 0.9108 0.3825  0.1235  0.1367  666 LEU A C   
4749 O O   . LEU A 622 ? 0.8356 1.2669 0.9076 0.3893  0.1360  0.1513  666 LEU A O   
4750 C CB  . LEU A 622 ? 0.8153 1.3080 0.9263 0.4138  0.0948  0.1058  666 LEU A CB  
4751 C CG  . LEU A 622 ? 0.8423 1.3260 0.9093 0.4316  0.1075  0.1169  666 LEU A CG  
4752 C CD1 . LEU A 622 ? 0.8723 1.3584 0.9031 0.4516  0.1235  0.1224  666 LEU A CD1 
4753 C CD2 . LEU A 622 ? 0.8457 1.3436 0.9192 0.4468  0.0885  0.1073  666 LEU A CD2 
4754 N N   . GLU A 623 ? 0.9359 1.3776 1.0551 0.3699  0.1175  0.1384  667 GLU A N   
4755 C CA  . GLU A 623 ? 0.9713 1.3791 1.0687 0.3675  0.1227  0.1513  667 GLU A CA  
4756 C C   . GLU A 623 ? 1.0028 1.3829 1.1001 0.3545  0.1281  0.1596  667 GLU A C   
4757 O O   . GLU A 623 ? 1.0413 1.3939 1.1178 0.3592  0.1307  0.1728  667 GLU A O   
4758 C CB  . GLU A 623 ? 0.9599 1.3698 1.0754 0.3630  0.1165  0.1525  667 GLU A CB  
4759 C CG  . GLU A 623 ? 0.9289 1.3719 1.0582 0.3766  0.1124  0.1573  667 GLU A CG  
4760 C CD  . GLU A 623 ? 0.9186 1.3715 1.0651 0.3798  0.1118  0.1684  667 GLU A CD  
4761 O OE1 . GLU A 623 ? 0.9027 1.3626 1.0835 0.3634  0.1089  0.1653  667 GLU A OE1 
4762 O OE2 . GLU A 623 ? 0.9274 1.3829 1.0499 0.4028  0.1155  0.1820  667 GLU A OE2 
4763 N N   . PHE A 624 ? 1.1533 1.5415 1.2815 0.3379  0.1275  0.1548  668 PHE A N   
4764 C CA  . PHE A 624 ? 1.1805 1.5441 1.3204 0.3235  0.1311  0.1679  668 PHE A CA  
4765 C C   . PHE A 624 ? 1.1933 1.5636 1.3234 0.3343  0.1440  0.1865  668 PHE A C   
4766 O O   . PHE A 624 ? 1.2292 1.5714 1.3636 0.3302  0.1441  0.2088  668 PHE A O   
4767 C CB  . PHE A 624 ? 1.1556 1.5324 1.3302 0.3055  0.1304  0.1603  668 PHE A CB  
4768 C CG  . PHE A 624 ? 1.1809 1.5344 1.3759 0.2895  0.1334  0.1782  668 PHE A CG  
4769 C CD1 . PHE A 624 ? 1.2203 1.5270 1.4190 0.2795  0.1205  0.1857  668 PHE A CD1 
4770 C CD2 . PHE A 624 ? 1.1649 1.5434 1.3775 0.2887  0.1459  0.1889  668 PHE A CD2 
4771 C CE1 . PHE A 624 ? 1.2408 1.5231 1.4716 0.2629  0.1169  0.2053  668 PHE A CE1 
4772 C CE2 . PHE A 624 ? 1.1832 1.5457 1.4263 0.2735  0.1495  0.2136  668 PHE A CE2 
4773 C CZ  . PHE A 624 ? 1.2199 1.5331 1.4777 0.2576  0.1334  0.2226  668 PHE A CZ  
4774 N N   . CYS A 625 ? 1.1321 1.5398 1.2516 0.3522  0.1512  0.1789  669 CYS A N   
4775 C CA  . CYS A 625 ? 1.1381 1.5645 1.2453 0.3716  0.1675  0.1990  669 CYS A CA  
4776 C C   . CYS A 625 ? 1.1715 1.5777 1.2605 0.3794  0.1719  0.2203  669 CYS A C   
4777 O O   . CYS A 625 ? 1.1892 1.5981 1.2887 0.3842  0.1846  0.2529  669 CYS A O   
4778 C CB  . CYS A 625 ? 1.1081 1.5732 1.1944 0.4001  0.1677  0.1797  669 CYS A CB  
4779 S SG  . CYS A 625 ? 1.1154 1.6123 1.1789 0.4362  0.1922  0.2090  669 CYS A SG  
4780 N N   . LEU A 626 ? 1.2061 1.5950 1.2731 0.3819  0.1611  0.2060  670 LEU A N   
4781 C CA  . LEU A 626 ? 1.2420 1.6043 1.2910 0.3882  0.1602  0.2228  670 LEU A CA  
4782 C C   . LEU A 626 ? 1.2799 1.5953 1.3524 0.3686  0.1465  0.2375  670 LEU A C   
4783 O O   . LEU A 626 ? 1.3048 1.6033 1.3950 0.3668  0.1462  0.2667  670 LEU A O   
4784 C CB  . LEU A 626 ? 1.2379 1.5957 1.2545 0.4001  0.1520  0.2043  670 LEU A CB  
4785 C CG  . LEU A 626 ? 1.1979 1.5936 1.2023 0.4160  0.1530  0.1843  670 LEU A CG  
4786 C CD1 . LEU A 626 ? 1.1959 1.5841 1.1780 0.4256  0.1456  0.1779  670 LEU A CD1 
4787 C CD2 . LEU A 626 ? 1.1938 1.6176 1.1827 0.4381  0.1653  0.1896  670 LEU A CD2 
4788 N N   . TYR A 627 ? 1.9352 2.2301 2.0129 0.3563  0.1320  0.2191  671 TYR A N   
4789 C CA  . TYR A 627 ? 1.9740 2.2145 2.0607 0.3468  0.1092  0.2229  671 TYR A CA  
4790 C C   . TYR A 627 ? 1.9792 2.2026 2.1116 0.3239  0.1017  0.2336  671 TYR A C   
4791 O O   . TYR A 627 ? 2.0096 2.1824 2.1511 0.3179  0.0756  0.2324  671 TYR A O   
4792 C CB  . TYR A 627 ? 1.9801 2.2039 2.0332 0.3589  0.0955  0.1989  671 TYR A CB  
4793 C CG  . TYR A 627 ? 1.9733 2.2146 1.9871 0.3816  0.1024  0.1937  671 TYR A CG  
4794 C CD1 . TYR A 627 ? 2.0071 2.2152 1.9924 0.3972  0.0913  0.2002  671 TYR A CD1 
4795 C CD2 . TYR A 627 ? 1.9300 2.2193 1.9413 0.3871  0.1161  0.1832  671 TYR A CD2 
4796 C CE1 . TYR A 627 ? 1.9990 2.2243 1.9486 0.4179  0.0987  0.1965  671 TYR A CE1 
4797 C CE2 . TYR A 627 ? 1.9216 2.2273 1.9047 0.4067  0.1205  0.1813  671 TYR A CE2 
4798 C CZ  . TYR A 627 ? 1.9565 2.2315 1.9057 0.4222  0.1144  0.1881  671 TYR A CZ  
4799 O OH  . TYR A 627 ? 1.9469 2.2390 1.8674 0.4420  0.1198  0.1872  671 TYR A OH  
4800 N N   . GLY A 628 ? 2.0670 2.3304 2.2261 0.3151  0.1213  0.2431  672 GLY A N   
4801 C CA  . GLY A 628 ? 2.0671 2.3198 2.2735 0.2937  0.1173  0.2584  672 GLY A CA  
4802 C C   . GLY A 628 ? 2.0892 2.3176 2.3389 0.2867  0.1093  0.3002  672 GLY A C   
4803 O O   . GLY A 628 ? 2.1109 2.3159 2.3527 0.2964  0.0986  0.3126  672 GLY A O   
4804 N N   . ARG A 629 ? 1.8262 2.0618 2.1290 0.2695  0.1130  0.3255  673 ARG A N   
4805 C CA  . ARG A 629 ? 1.8313 2.0531 2.1984 0.2600  0.1055  0.3769  673 ARG A CA  
4806 C C   . ARG A 629 ? 1.7991 2.0798 2.2100 0.2603  0.1378  0.4193  673 ARG A C   
4807 O O   . ARG A 629 ? 1.7765 2.0999 2.1666 0.2664  0.1606  0.4028  673 ARG A O   
4808 C CB  . ARG A 629 ? 1.8486 2.0013 2.2565 0.2386  0.0628  0.3762  673 ARG A CB  
4809 C CG  . ARG A 629 ? 1.8357 1.9943 2.2790 0.2178  0.0648  0.3753  673 ARG A CG  
4810 C CD  . ARG A 629 ? 1.8266 1.9143 2.2760 0.2048  0.0209  0.3478  673 ARG A CD  
4811 N NE  . ARG A 629 ? 1.8472 1.8863 2.2423 0.2237  -0.0079 0.3147  673 ARG A NE  
4812 C CZ  . ARG A 629 ? 1.7943 1.8496 2.1168 0.2431  0.0047  0.2758  673 ARG A CZ  
4813 N NH1 . ARG A 629 ? 1.7174 1.8320 2.0181 0.2431  0.0406  0.2621  673 ARG A NH1 
4814 N NH2 . ARG A 629 ? 1.8155 1.8279 2.0913 0.2652  -0.0214 0.2532  673 ARG A NH2 
4815 N N   . GLU A 630 ? 1.8645 2.1470 2.3416 0.2563  0.1364  0.4779  674 GLU A N   
4816 C CA  . GLU A 630 ? 1.8352 2.1855 2.3528 0.2691  0.1729  0.5334  674 GLU A CA  
4817 C C   . GLU A 630 ? 1.8125 2.1979 2.3395 0.2646  0.1918  0.5301  674 GLU A C   
4818 O O   . GLU A 630 ? 1.7950 2.2449 2.2918 0.2930  0.2272  0.5351  674 GLU A O   
4819 C CB  . GLU A 630 ? 1.8249 2.1657 2.4370 0.2589  0.1606  0.6061  674 GLU A CB  
4820 C CG  . GLU A 630 ? 1.8115 2.2337 2.4715 0.2794  0.2033  0.6773  674 GLU A CG  
4821 C CD  . GLU A 630 ? 1.8460 2.2666 2.6110 0.2709  0.1915  0.7586  674 GLU A CD  
4822 O OE1 . GLU A 630 ? 1.8456 2.1901 2.6568 0.2428  0.1405  0.7556  674 GLU A OE1 
4823 O OE2 . GLU A 630 ? 1.8731 2.3695 2.6782 0.2960  0.2305  0.8282  674 GLU A OE2 
4824 N N   . GLU A 631 ? 1.8546 2.1946 2.4181 0.2331  0.1649  0.5183  675 GLU A N   
4825 C CA  . GLU A 631 ? 1.8323 2.1997 2.4127 0.2247  0.1794  0.5177  675 GLU A CA  
4826 C C   . GLU A 631 ? 1.8235 2.2282 2.3250 0.2451  0.2004  0.4648  675 GLU A C   
4827 O O   . GLU A 631 ? 1.8000 2.2665 2.2895 0.2709  0.2317  0.4802  675 GLU A O   
4828 C CB  . GLU A 631 ? 1.8328 2.1386 2.4553 0.1881  0.1431  0.5029  675 GLU A CB  
4829 C CG  . GLU A 631 ? 1.8108 2.1471 2.4607 0.1772  0.1594  0.5097  675 GLU A CG  
4830 C CD  . GLU A 631 ? 1.7549 2.0373 2.3994 0.1495  0.1295  0.4615  675 GLU A CD  
4831 O OE1 . GLU A 631 ? 1.7339 1.9508 2.3675 0.1394  0.0922  0.4331  675 GLU A OE1 
4832 O OE2 . GLU A 631 ? 1.7271 2.0341 2.3743 0.1424  0.1433  0.4513  675 GLU A OE2 
4833 N N   . HIS A 632 ? 1.3397 1.7079 1.7908 0.2378  0.1802  0.4052  676 HIS A N   
4834 C CA  . HIS A 632 ? 1.3194 1.7142 1.7149 0.2498  0.1887  0.3549  676 HIS A CA  
4835 C C   . HIS A 632 ? 1.3049 1.7461 1.6482 0.2878  0.2086  0.3459  676 HIS A C   
4836 O O   . HIS A 632 ? 1.2769 1.7553 1.5933 0.3062  0.2183  0.3231  676 HIS A O   
4837 C CB  . HIS A 632 ? 1.3317 1.6819 1.7014 0.2331  0.1624  0.3048  676 HIS A CB  
4838 C CG  . HIS A 632 ? 1.3629 1.6494 1.7609 0.2108  0.1330  0.3103  676 HIS A CG  
4839 N ND1 . HIS A 632 ? 1.3625 1.6265 1.8214 0.1895  0.1224  0.3411  676 HIS A ND1 
4840 C CD2 . HIS A 632 ? 1.3917 1.6302 1.7640 0.2116  0.1076  0.2877  676 HIS A CD2 
4841 C CE1 . HIS A 632 ? 1.3866 1.5857 1.8559 0.1784  0.0866  0.3335  676 HIS A CE1 
4842 N NE2 . HIS A 632 ? 1.4067 1.5900 1.8188 0.1942  0.0781  0.3000  676 HIS A NE2 
4843 N N   . LEU A 633 ? 1.7545 2.1906 2.0829 0.3018  0.2101  0.3610  677 LEU A N   
4844 C CA  . LEU A 633 ? 1.7411 2.2177 2.0184 0.3401  0.2263  0.3516  677 LEU A CA  
4845 C C   . LEU A 633 ? 1.7184 2.2566 1.9967 0.3748  0.2560  0.3855  677 LEU A C   
4846 O O   . LEU A 633 ? 1.6975 2.2718 1.9267 0.4114  0.2637  0.3611  677 LEU A O   
4847 C CB  . LEU A 633 ? 1.7673 2.2252 2.0304 0.3475  0.2226  0.3638  677 LEU A CB  
4848 C CG  . LEU A 633 ? 1.7898 2.2375 2.0990 0.3435  0.2258  0.4214  677 LEU A CG  
4849 C CD1 . LEU A 633 ? 1.7740 2.2858 2.1050 0.3754  0.2605  0.4812  677 LEU A CD1 
4850 C CD2 . LEU A 633 ? 1.8140 2.2302 2.0863 0.3478  0.2113  0.4012  677 LEU A CD2 
4851 N N   . THR A 634 ? 1.7129 2.2633 2.0496 0.3673  0.2697  0.4436  678 THR A N   
4852 C CA  . THR A 634 ? 1.6892 2.3051 2.0333 0.4033  0.3016  0.4851  678 THR A CA  
4853 C C   . THR A 634 ? 1.6683 2.2887 2.0180 0.3921  0.2979  0.4611  678 THR A C   
4854 O O   . THR A 634 ? 1.6766 2.2511 2.0612 0.3474  0.2767  0.4456  678 THR A O   
4855 C CB  . THR A 634 ? 1.6955 2.3326 2.1147 0.4020  0.3199  0.5710  678 THR A CB  
4856 O OG1 . THR A 634 ? 1.6758 2.3909 2.0778 0.4588  0.3583  0.6154  678 THR A OG1 
4857 C CG2 . THR A 634 ? 1.6918 2.3106 2.1915 0.3631  0.3116  0.6028  678 THR A CG2 
4858 N N   . THR A 635 ? 1.3295 2.0025 1.6402 0.4362  0.3156  0.4543  679 THR A N   
4859 C CA  . THR A 635 ? 1.3093 1.9821 1.6169 0.4272  0.3064  0.4204  679 THR A CA  
4860 C C   . THR A 635 ? 1.2879 2.0243 1.5689 0.4807  0.3297  0.4353  679 THR A C   
4861 O O   . THR A 635 ? 1.2881 2.0739 1.5306 0.5385  0.3516  0.4588  679 THR A O   
4862 C CB  . THR A 635 ? 1.3058 1.9449 1.5704 0.4162  0.2746  0.3435  679 THR A CB  
4863 O OG1 . THR A 635 ? 1.2833 1.9280 1.5490 0.4117  0.2651  0.3142  679 THR A OG1 
4864 C CG2 . THR A 635 ? 1.3083 1.9697 1.5073 0.4654  0.2721  0.3164  679 THR A CG2 
4865 N N   . ASN A 636 ? 1.4581 2.1933 1.7560 0.4652  0.3240  0.4208  680 ASN A N   
4866 C CA  . ASN A 636 ? 1.4427 2.2311 1.7060 0.5175  0.3383  0.4208  680 ASN A CA  
4867 C C   . ASN A 636 ? 1.4401 2.2148 1.6417 0.5372  0.3052  0.3398  680 ASN A C   
4868 O O   . ASN A 636 ? 1.4336 2.2433 1.5962 0.5859  0.3062  0.3257  680 ASN A O   
4869 C CB  . ASN A 636 ? 1.4319 2.2324 1.7547 0.4935  0.3524  0.4595  680 ASN A CB  
4870 C CG  . ASN A 636 ? 1.4904 2.3675 1.7900 0.5612  0.3857  0.5006  680 ASN A CG  
4871 O OD1 . ASN A 636 ? 1.5668 2.4768 1.7956 0.6245  0.3938  0.4993  680 ASN A OD1 
4872 N ND2 . ASN A 636 ? 1.4644 2.3580 1.8141 0.5451  0.3993  0.5358  680 ASN A ND2 
4873 N N   . GLY A 637 ? 1.0333 1.7580 1.2308 0.5023  0.2732  0.2896  681 GLY A N   
4874 C CA  . GLY A 637 ? 1.0351 1.7453 1.1932 0.5167  0.2355  0.2193  681 GLY A CA  
4875 C C   . GLY A 637 ? 1.0239 1.7141 1.2126 0.4814  0.2138  0.1875  681 GLY A C   
4876 O O   . GLY A 637 ? 1.0265 1.6966 1.2085 0.4760  0.1765  0.1331  681 GLY A O   
4877 N N   . TYR A 638 ? 0.8377 1.5355 1.0681 0.4570  0.2365  0.2264  682 TYR A N   
4878 C CA  . TYR A 638 ? 0.8042 1.4880 1.0670 0.4239  0.2235  0.2068  682 TYR A CA  
4879 C C   . TYR A 638 ? 0.7680 1.4271 1.0946 0.3669  0.2385  0.2464  682 TYR A C   
4880 O O   . TYR A 638 ? 0.7819 1.4571 1.1328 0.3697  0.2667  0.3052  682 TYR A O   
4881 C CB  . TYR A 638 ? 0.8361 1.5655 1.0753 0.4717  0.2366  0.2169  682 TYR A CB  
4882 C CG  . TYR A 638 ? 0.8798 1.6263 1.0543 0.5333  0.2097  0.1667  682 TYR A CG  
4883 C CD1 . TYR A 638 ? 0.9392 1.7200 1.0528 0.6033  0.2198  0.1756  682 TYR A CD1 
4884 C CD2 . TYR A 638 ? 0.8670 1.5942 1.0435 0.5252  0.1701  0.1108  682 TYR A CD2 
4885 C CE1 . TYR A 638 ? 0.9897 1.7793 1.0402 0.6664  0.1868  0.1246  682 TYR A CE1 
4886 C CE2 . TYR A 638 ? 0.9145 1.6495 1.0380 0.5834  0.1343  0.0617  682 TYR A CE2 
4887 C CZ  . TYR A 638 ? 0.9787 1.7424 1.0360 0.6559  0.1407  0.0663  682 TYR A CZ  
4888 O OH  . TYR A 638 ? 1.0365 1.8011 1.0366 0.7207  0.0966  0.0120  682 TYR A OH  
4889 N N   . ARG A 639 ? 0.7332 1.3541 1.0915 0.3181  0.2165  0.2162  683 ARG A N   
4890 C CA  . ARG A 639 ? 0.7169 1.3126 1.1323 0.2700  0.2230  0.2437  683 ARG A CA  
4891 C C   . ARG A 639 ? 0.6908 1.2819 1.1242 0.2491  0.2094  0.2142  683 ARG A C   
4892 O O   . ARG A 639 ? 0.6789 1.2653 1.0967 0.2501  0.1844  0.1651  683 ARG A O   
4893 C CB  . ARG A 639 ? 0.7218 1.2667 1.1588 0.2298  0.2093  0.2406  683 ARG A CB  
4894 C CG  . ARG A 639 ? 0.7475 1.2894 1.1822 0.2410  0.2217  0.2782  683 ARG A CG  
4895 C CD  . ARG A 639 ? 0.7733 1.2599 1.2282 0.2051  0.2038  0.2748  683 ARG A CD  
4896 N NE  . ARG A 639 ? 0.7819 1.2360 1.2917 0.1697  0.1981  0.2996  683 ARG A NE  
4897 C CZ  . ARG A 639 ? 0.8040 1.2468 1.3575 0.1626  0.2029  0.3513  683 ARG A CZ  
4898 N NH1 . ARG A 639 ? 0.8167 1.2841 1.3655 0.1886  0.2187  0.3876  683 ARG A NH1 
4899 N NH2 . ARG A 639 ? 0.8116 1.2180 1.4195 0.1301  0.1887  0.3685  683 ARG A NH2 
4900 N N   . LYS A 640 ? 0.6561 1.2481 1.1308 0.2285  0.2236  0.2474  684 LYS A N   
4901 C CA  . LYS A 640 ? 0.6237 1.2046 1.1224 0.2005  0.2112  0.2226  684 LYS A CA  
4902 C C   . LYS A 640 ? 0.5915 1.1278 1.1041 0.1606  0.1845  0.1842  684 LYS A C   
4903 O O   . LYS A 640 ? 0.5996 1.1009 1.1273 0.1376  0.1810  0.1959  684 LYS A O   
4904 C CB  . LYS A 640 ? 0.6170 1.1956 1.1682 0.1766  0.2285  0.2705  684 LYS A CB  
4905 C CG  . LYS A 640 ? 0.5992 1.1922 1.1650 0.1696  0.2288  0.2599  684 LYS A CG  
4906 C CD  . LYS A 640 ? 0.6126 1.2307 1.2206 0.1722  0.2567  0.3251  684 LYS A CD  
4907 C CE  . LYS A 640 ? 0.6161 1.2758 1.2145 0.1960  0.2681  0.3241  684 LYS A CE  
4908 N NZ  . LYS A 640 ? 0.5925 1.2400 1.2557 0.1568  0.2741  0.3558  684 LYS A NZ  
4909 N N   . ILE A 641 ? 0.5668 1.1069 1.0762 0.1569  0.1643  0.1410  685 ILE A N   
4910 C CA  . ILE A 641 ? 0.5304 1.0403 1.0641 0.1209  0.1437  0.1139  685 ILE A CA  
4911 C C   . ILE A 641 ? 0.5154 0.9924 1.0850 0.0845  0.1508  0.1381  685 ILE A C   
4912 O O   . ILE A 641 ? 0.5161 0.9998 1.1070 0.0781  0.1634  0.1611  685 ILE A O   
4913 C CB  . ILE A 641 ? 0.5085 1.0338 1.0533 0.1193  0.1225  0.0760  685 ILE A CB  
4914 C CG1 . ILE A 641 ? 0.5280 1.0737 1.0458 0.1542  0.1011  0.0463  685 ILE A CG1 
4915 C CG2 . ILE A 641 ? 0.4675 0.9699 1.0505 0.0802  0.1085  0.0614  685 ILE A CG2 
4916 C CD1 . ILE A 641 ? 0.5209 1.0818 1.0517 0.1617  0.0734  0.0113  685 ILE A CD1 
4917 N N   . PRO A 642 ? 0.5097 0.9502 1.0851 0.0655  0.1405  0.1348  686 PRO A N   
4918 C CA  . PRO A 642 ? 0.5175 0.9172 1.1227 0.0369  0.1375  0.1516  686 PRO A CA  
4919 C C   . PRO A 642 ? 0.4842 0.8833 1.1178 0.0134  0.1324  0.1368  686 PRO A C   
4920 O O   . PRO A 642 ? 0.4548 0.8703 1.0876 0.0117  0.1230  0.1067  686 PRO A O   
4921 C CB  . PRO A 642 ? 0.5351 0.9010 1.1249 0.0348  0.1225  0.1390  686 PRO A CB  
4922 C CG  . PRO A 642 ? 0.5190 0.9149 1.0841 0.0536  0.1193  0.1152  686 PRO A CG  
4923 C CD  . PRO A 642 ? 0.5152 0.9507 1.0676 0.0756  0.1293  0.1167  686 PRO A CD  
4924 N N   . GLY A 643 ? 0.5448 0.9269 1.2105 -0.0048 0.1368  0.1610  687 GLY A N   
4925 C CA  . GLY A 643 ? 0.5126 0.8921 1.2061 -0.0281 0.1330  0.1493  687 GLY A CA  
4926 C C   . GLY A 643 ? 0.4877 0.9134 1.1824 -0.0173 0.1460  0.1479  687 GLY A C   
4927 O O   . GLY A 643 ? 0.4588 0.8874 1.1767 -0.0351 0.1443  0.1391  687 GLY A O   
4928 N N   . ASP A 644 ? 0.4806 0.9416 1.1459 0.0165  0.1572  0.1548  688 ASP A N   
4929 C CA  . ASP A 644 ? 0.4737 0.9788 1.1260 0.0412  0.1659  0.1500  688 ASP A CA  
4930 C C   . ASP A 644 ? 0.4834 1.0072 1.1557 0.0483  0.1908  0.1994  688 ASP A C   
4931 O O   . ASP A 644 ? 0.5113 1.0420 1.1869 0.0627  0.2070  0.2417  688 ASP A O   
4932 C CB  . ASP A 644 ? 0.4931 1.0277 1.0991 0.0834  0.1612  0.1300  688 ASP A CB  
4933 C CG  . ASP A 644 ? 0.5038 1.0776 1.0875 0.1176  0.1594  0.1138  688 ASP A CG  
4934 O OD1 . ASP A 644 ? 0.5172 1.1140 1.1046 0.1301  0.1802  0.1430  688 ASP A OD1 
4935 O OD2 . ASP A 644 ? 0.5050 1.0862 1.0707 0.1341  0.1336  0.0720  688 ASP A OD2 
4936 N N   . LYS A 645 ? 0.6161 1.1500 1.3094 0.0370  0.1936  0.1979  689 LYS A N   
4937 C CA  . LYS A 645 ? 0.6021 1.1507 1.3313 0.0344  0.2157  0.2496  689 LYS A CA  
4938 C C   . LYS A 645 ? 0.6046 1.2146 1.3081 0.0830  0.2389  0.2701  689 LYS A C   
4939 O O   . LYS A 645 ? 0.5842 1.2167 1.3204 0.0836  0.2590  0.3136  689 LYS A O   
4940 C CB  . LYS A 645 ? 0.5625 1.0773 1.3388 -0.0117 0.2052  0.2448  689 LYS A CB  
4941 C CG  . LYS A 645 ? 0.5655 1.0198 1.3695 -0.0483 0.1855  0.2430  689 LYS A CG  
4942 C CD  . LYS A 645 ? 0.5591 0.9745 1.3974 -0.0843 0.1735  0.2438  689 LYS A CD  
4943 C CE  . LYS A 645 ? 0.5763 0.9237 1.4203 -0.1105 0.1447  0.2251  689 LYS A CE  
4944 N NZ  . LYS A 645 ? 0.5774 0.9252 1.3974 -0.1133 0.1335  0.1746  689 LYS A NZ  
4945 N N   . CYS A 646 ? 0.5406 1.1775 1.1853 0.1271  0.2330  0.2374  690 CYS A N   
4946 C CA  . CYS A 646 ? 0.5640 1.2567 1.1682 0.1855  0.2482  0.2454  690 CYS A CA  
4947 C C   . CYS A 646 ? 0.5992 1.3378 1.2167 0.2177  0.2887  0.3231  690 CYS A C   
4948 O O   . CYS A 646 ? 0.6064 1.3382 1.2504 0.2084  0.3011  0.3655  690 CYS A O   
4949 C CB  . CYS A 646 ? 0.5940 1.2992 1.1311 0.2336  0.2268  0.1962  690 CYS A CB  
4950 S SG  . CYS A 646 ? 0.6284 1.3406 1.1349 0.2637  0.2377  0.2182  690 CYS A SG  
4951 N N   . GLN A 647 ? 0.7973 1.5856 1.4013 0.2575  0.3087  0.3459  691 GLN A N   
4952 C CA  . GLN A 647 ? 0.7947 1.6326 1.4091 0.2946  0.3479  0.4267  691 GLN A CA  
4953 C C   . GLN A 647 ? 0.8236 1.7121 1.3493 0.3788  0.3574  0.4221  691 GLN A C   
4954 O O   . GLN A 647 ? 0.8307 1.7320 1.3112 0.4097  0.3402  0.3682  691 GLN A O   
4955 C CB  . GLN A 647 ? 0.7733 1.5901 1.4417 0.2542  0.3549  0.4735  691 GLN A CB  
4956 C CG  . GLN A 647 ? 0.7926 1.6284 1.4344 0.2712  0.3537  0.4504  691 GLN A CG  
4957 C CD  . GLN A 647 ? 0.7894 1.6122 1.4741 0.2467  0.3639  0.5080  691 GLN A CD  
4958 O OE1 . GLN A 647 ? 0.7617 1.5378 1.5123 0.1946  0.3560  0.5414  691 GLN A OE1 
4959 N NE2 . GLN A 647 ? 0.8280 1.6887 1.4731 0.2894  0.3762  0.5177  691 GLN A NE2 
4960 N N   . GLY A 648 ? 0.8680 1.7812 1.3677 0.4182  0.3801  0.4793  692 GLY A N   
4961 C CA  . GLY A 648 ? 0.9438 1.9006 1.3515 0.5015  0.3897  0.4869  692 GLY A CA  
4962 C C   . GLY A 648 ? 0.9648 1.9230 1.2931 0.5501  0.3623  0.4103  692 GLY A C   
4963 O O   . GLY A 648 ? 0.9249 1.8598 1.2722 0.5255  0.3458  0.3737  692 GLY A O   
4964 N N   . GLY A 649 ? 0.9635 1.9445 1.2020 0.6206  0.3524  0.3859  693 GLY A N   
4965 C CA  . GLY A 649 ? 1.0090 1.9843 1.1618 0.6777  0.3178  0.3173  693 GLY A CA  
4966 C C   . GLY A 649 ? 1.0322 2.0095 1.1671 0.6922  0.3279  0.3395  693 GLY A C   
4967 O O   . GLY A 649 ? 1.0735 2.0778 1.2038 0.7092  0.3630  0.4153  693 GLY A O   
4968 N N   . VAL A 650 ? 1.0019 1.9508 1.1365 0.6820  0.2955  0.2768  694 VAL A N   
4969 C CA  . VAL A 650 ? 1.0254 1.9707 1.1320 0.7005  0.2956  0.2797  694 VAL A CA  
4970 C C   . VAL A 650 ? 0.9608 1.8972 1.1532 0.6371  0.3217  0.3258  694 VAL A C   
4971 O O   . VAL A 650 ? 0.8807 1.7935 1.1494 0.5737  0.3141  0.3091  694 VAL A O   
4972 C CB  . VAL A 650 ? 1.0288 1.9435 1.0968 0.7209  0.2412  0.1894  694 VAL A CB  
4973 C CG1 . VAL A 650 ? 1.0248 1.9286 1.0911 0.7178  0.2409  0.1896  694 VAL A CG1 
4974 C CG2 . VAL A 650 ? 1.1244 2.0409 1.0876 0.7988  0.2077  0.1464  694 VAL A CG2 
4975 N N   . ASN A 651 ? 1.2799 2.2363 1.4594 0.6567  0.3513  0.3890  695 ASN A N   
4976 C CA  . ASN A 651 ? 1.2424 2.1873 1.4822 0.6145  0.3668  0.4250  695 ASN A CA  
4977 C C   . ASN A 651 ? 1.3011 2.2533 1.4615 0.6705  0.3600  0.4098  695 ASN A C   
4978 O O   . ASN A 651 ? 1.3808 2.3642 1.4743 0.7306  0.3738  0.4432  695 ASN A O   
4979 C CB  . ASN A 651 ? 1.2495 2.2134 1.5505 0.5933  0.4040  0.5222  695 ASN A CB  
4980 C CG  . ASN A 651 ? 1.2159 2.1626 1.5909 0.5468  0.4140  0.5627  695 ASN A CG  
4981 O OD1 . ASN A 651 ? 1.2066 2.1371 1.5675 0.5446  0.4016  0.5272  695 ASN A OD1 
4982 N ND2 . ASN A 651 ? 1.2058 2.1535 1.6647 0.5106  0.4326  0.6400  695 ASN A ND2 
4983 N N   . PRO A 652 ? 1.4257 2.3512 1.5875 0.6563  0.3376  0.3616  696 PRO A N   
4984 C CA  . PRO A 652 ? 1.4916 2.4247 1.5738 0.7130  0.3324  0.3541  696 PRO A CA  
4985 C C   . PRO A 652 ? 1.5308 2.4943 1.6186 0.7270  0.3731  0.4423  696 PRO A C   
4986 O O   . PRO A 652 ? 1.4821 2.4409 1.6551 0.6749  0.3938  0.4917  696 PRO A O   
4987 C CB  . PRO A 652 ? 1.4478 2.3477 1.5531 0.6829  0.3077  0.3046  696 PRO A CB  
4988 C CG  . PRO A 652 ? 1.4072 2.2772 1.6060 0.5996  0.3113  0.3169  696 PRO A CG  
4989 C CD  . PRO A 652 ? 1.3854 2.2688 1.6114 0.5889  0.3180  0.3267  696 PRO A CD  
4990 N N   . VAL A 653 ? 1.6780 2.6717 1.6797 0.7979  0.3807  0.4640  697 VAL A N   
4991 C CA  . VAL A 653 ? 1.7226 2.7503 1.7291 0.8186  0.4170  0.5516  697 VAL A CA  
4992 C C   . VAL A 653 ? 1.7634 2.7880 1.7081 0.8551  0.4086  0.5337  697 VAL A C   
4993 O O   . VAL A 653 ? 1.8286 2.8521 1.6724 0.9147  0.3835  0.4835  697 VAL A O   
4994 C CB  . VAL A 653 ? 1.7972 2.8726 1.7720 0.8685  0.4431  0.6214  697 VAL A CB  
4995 C CG1 . VAL A 653 ? 1.9022 2.9980 1.7425 0.9591  0.4283  0.5929  697 VAL A CG1 
4996 C CG2 . VAL A 653 ? 1.8077 2.9148 1.8530 0.8580  0.4826  0.7331  697 VAL A CG2 
4997 N N   . ARG A 654 ? 1.9083 2.9269 1.9183 0.8161  0.4250  0.5720  698 ARG A N   
4998 C CA  . ARG A 654 ? 1.9331 2.9467 1.9035 0.8379  0.4209  0.5627  698 ARG A CA  
4999 C C   . ARG A 654 ? 1.8781 2.8858 1.9476 0.7825  0.4419  0.6172  698 ARG A C   
5000 O O   . ARG A 654 ? 1.8096 2.8008 1.9732 0.7206  0.4454  0.6321  698 ARG A O   
5001 C CB  . ARG A 654 ? 1.9127 2.8854 1.8382 0.8377  0.3779  0.4615  698 ARG A CB  
5002 C CG  . ARG A 654 ? 1.8169 2.7533 1.8202 0.7689  0.3607  0.4179  698 ARG A CG  
5003 C CD  . ARG A 654 ? 1.8014 2.7020 1.7719 0.7712  0.3189  0.3335  698 ARG A CD  
5004 N NE  . ARG A 654 ? 1.8702 2.7679 1.7480 0.8320  0.2844  0.2778  698 ARG A NE  
5005 C CZ  . ARG A 654 ? 1.8836 2.7514 1.7206 0.8505  0.2396  0.2065  698 ARG A CZ  
5006 N NH1 . ARG A 654 ? 1.8303 2.6733 1.7084 0.8140  0.2287  0.1854  698 ARG A NH1 
5007 N NH2 . ARG A 654 ? 1.9556 2.8168 1.7121 0.9071  0.2019  0.1577  698 ARG A NH2 
5008 N N   . GLU A 655 ? 1.8305 2.8478 1.8779 0.8053  0.4512  0.6428  699 GLU A N   
5009 C CA  . GLU A 655 ? 1.7937 2.8106 1.9349 0.7620  0.4708  0.7059  699 GLU A CA  
5010 C C   . GLU A 655 ? 1.7227 2.6951 1.8991 0.7121  0.4502  0.6503  699 GLU A C   
5011 O O   . GLU A 655 ? 1.7259 2.6770 1.8352 0.7298  0.4263  0.5779  699 GLU A O   
5012 C CB  . GLU A 655 ? 1.8625 2.9155 1.9753 0.8095  0.4932  0.7721  699 GLU A CB  
5013 C CG  . GLU A 655 ? 1.8394 2.9038 2.0675 0.7716  0.5155  0.8635  699 GLU A CG  
5014 C CD  . GLU A 655 ? 1.9056 3.0070 2.1109 0.8191  0.5360  0.9297  699 GLU A CD  
5015 O OE1 . GLU A 655 ? 1.9675 3.0815 2.0597 0.8800  0.5320  0.8972  699 GLU A OE1 
5016 O OE2 . GLU A 655 ? 1.8988 3.0156 2.2037 0.7966  0.5524  1.0154  699 GLU A OE2 
5017 N N   . VAL A 656 ? 1.4485 2.4068 1.7344 0.6519  0.4562  0.6877  700 VAL A N   
5018 C CA  . VAL A 656 ? 1.4102 2.3317 1.7416 0.6070  0.4407  0.6555  700 VAL A CA  
5019 C C   . VAL A 656 ? 1.4311 2.3557 1.7097 0.6390  0.4424  0.6504  700 VAL A C   
5020 O O   . VAL A 656 ? 1.4719 2.4282 1.7449 0.6695  0.4640  0.7137  700 VAL A O   
5021 C CB  . VAL A 656 ? 1.4078 2.2955 1.8538 0.5382  0.4355  0.7106  700 VAL A CB  
5022 C CG1 . VAL A 656 ? 1.4964 2.4446 2.0109 0.5585  0.4704  0.8150  700 VAL A CG1 
5023 C CG2 . VAL A 656 ? 1.3928 2.2239 1.8578 0.5000  0.4125  0.7019  700 VAL A CG2 
5024 N N   . LYS A 657 ? 1.5180 2.3971 1.7480 0.6273  0.4124  0.5740  701 LYS A N   
5025 C CA  . LYS A 657 ? 1.5334 2.4156 1.7121 0.6588  0.4121  0.5608  701 LYS A CA  
5026 C C   . LYS A 657 ? 1.5502 2.3668 1.7699 0.5946  0.3896  0.5527  701 LYS A C   
5027 O O   . LYS A 657 ? 1.5535 2.3226 1.8278 0.5349  0.3710  0.5478  701 LYS A O   
5028 C CB  . LYS A 657 ? 1.5396 2.4116 1.6266 0.6959  0.3857  0.4768  701 LYS A CB  
5029 C CG  . LYS A 657 ? 1.5760 2.4692 1.5958 0.7431  0.3809  0.4625  701 LYS A CG  
5030 C CD  . LYS A 657 ? 1.6553 2.5885 1.6280 0.7965  0.4054  0.5223  701 LYS A CD  
5031 C CE  . LYS A 657 ? 1.7252 2.6777 1.6123 0.8553  0.3956  0.5028  701 LYS A CE  
5032 N NZ  . LYS A 657 ? 1.8094 2.8057 1.6477 0.9133  0.4205  0.5684  701 LYS A NZ  
5033 N N   . ASP A 658 ? 1.4277 2.2398 1.6159 0.6107  0.3889  0.5479  702 ASP A N   
5034 C CA  . ASP A 658 ? 1.4479 2.1966 1.6629 0.5576  0.3649  0.5343  702 ASP A CA  
5035 C C   . ASP A 658 ? 1.4545 2.1749 1.5981 0.5667  0.3413  0.4631  702 ASP A C   
5036 O O   . ASP A 658 ? 1.4554 2.2060 1.5452 0.6160  0.3512  0.4582  702 ASP A O   
5037 C CB  . ASP A 658 ? 1.4555 2.2181 1.7227 0.5568  0.3827  0.6073  702 ASP A CB  
5038 C CG  . ASP A 658 ? 1.4840 2.1883 1.7461 0.5256  0.3574  0.5819  702 ASP A CG  
5039 O OD1 . ASP A 658 ? 1.4960 2.1383 1.7968 0.4725  0.3285  0.5664  702 ASP A OD1 
5040 O OD2 . ASP A 658 ? 1.4945 2.2152 1.7097 0.5586  0.3655  0.5767  702 ASP A OD2 
5041 N N   . LEU A 659 ? 1.1564 1.8209 1.3029 0.5214  0.3095  0.4110  703 LEU A N   
5042 C CA  . LEU A 659 ? 1.1529 1.7973 1.2447 0.5295  0.2851  0.3466  703 LEU A CA  
5043 C C   . LEU A 659 ? 1.1711 1.7816 1.2535 0.5143  0.2749  0.3401  703 LEU A C   
5044 O O   . LEU A 659 ? 1.1653 1.7671 1.2060 0.5269  0.2580  0.2969  703 LEU A O   
5045 C CB  . LEU A 659 ? 1.1394 1.7554 1.2391 0.4986  0.2579  0.2965  703 LEU A CB  
5046 C CG  . LEU A 659 ? 1.1184 1.7666 1.2063 0.5246  0.2586  0.2815  703 LEU A CG  
5047 C CD1 . LEU A 659 ? 1.1064 1.7256 1.2042 0.4946  0.2266  0.2287  703 LEU A CD1 
5048 C CD2 . LEU A 659 ? 1.1187 1.8095 1.1448 0.5938  0.2637  0.2708  703 LEU A CD2 
5049 N N   . LYS A 660 ? 1.6040 2.1956 1.7287 0.4899  0.2818  0.3843  704 LYS A N   
5050 C CA  . LYS A 660 ? 1.6262 2.1808 1.7419 0.4759  0.2692  0.3782  704 LYS A CA  
5051 C C   . LYS A 660 ? 1.6208 2.2051 1.6845 0.5201  0.2810  0.3754  704 LYS A C   
5052 O O   . LYS A 660 ? 1.6255 2.1852 1.6589 0.5176  0.2665  0.3464  704 LYS A O   
5053 C CB  . LYS A 660 ? 1.6539 2.1810 1.8299 0.4475  0.2678  0.4287  704 LYS A CB  
5054 C CG  . LYS A 660 ? 1.6519 2.2254 1.8607 0.4733  0.2965  0.4982  704 LYS A CG  
5055 C CD  . LYS A 660 ? 1.6727 2.2101 1.9505 0.4433  0.2832  0.5456  704 LYS A CD  
5056 C CE  . LYS A 660 ? 1.6747 2.1721 2.0169 0.4010  0.2610  0.5541  704 LYS A CE  
5057 N NZ  . LYS A 660 ? 1.6871 2.1315 2.0938 0.3722  0.2315  0.5867  704 LYS A NZ  
5058 N N   . LYS A 661 ? 1.5457 2.1860 1.5980 0.5648  0.3080  0.4079  705 LYS A N   
5059 C CA  . LYS A 661 ? 1.5426 2.2169 1.5421 0.6161  0.3212  0.4088  705 LYS A CA  
5060 C C   . LYS A 661 ? 1.5279 2.1936 1.4686 0.6356  0.2964  0.3395  705 LYS A C   
5061 O O   . LYS A 661 ? 1.5253 2.1795 1.4304 0.6475  0.2858  0.3157  705 LYS A O   
5062 C CB  . LYS A 661 ? 1.5343 2.2774 1.5317 0.6690  0.3567  0.4607  705 LYS A CB  
5063 C CG  . LYS A 661 ? 1.5409 2.3241 1.4924 0.7254  0.3769  0.4801  705 LYS A CG  
5064 C CD  . LYS A 661 ? 1.5526 2.4054 1.5005 0.7796  0.4128  0.5406  705 LYS A CD  
5065 C CE  . LYS A 661 ? 1.5829 2.4404 1.4633 0.8120  0.3965  0.4996  705 LYS A CE  
5066 N NZ  . LYS A 661 ? 1.6080 2.4398 1.4055 0.8387  0.3629  0.4257  705 LYS A NZ  
5067 N N   . LYS A 662 ? 1.4824 2.1513 1.4211 0.6363  0.2830  0.3084  706 LYS A N   
5068 C CA  . LYS A 662 ? 1.4727 2.1327 1.3716 0.6547  0.2511  0.2454  706 LYS A CA  
5069 C C   . LYS A 662 ? 1.4705 2.0848 1.3786 0.6154  0.2221  0.2091  706 LYS A C   
5070 O O   . LYS A 662 ? 1.4692 2.0803 1.3460 0.6380  0.1996  0.1729  706 LYS A O   
5071 C CB  . LYS A 662 ? 1.4638 2.1325 1.3701 0.6584  0.2382  0.2218  706 LYS A CB  
5072 C CG  . LYS A 662 ? 1.4635 2.1225 1.3398 0.6811  0.1968  0.1588  706 LYS A CG  
5073 C CD  . LYS A 662 ? 1.4454 2.1005 1.3456 0.6675  0.1774  0.1341  706 LYS A CD  
5074 C CE  . LYS A 662 ? 1.4496 2.0959 1.3287 0.6964  0.1287  0.0745  706 LYS A CE  
5075 N NZ  . LYS A 662 ? 1.4506 2.1091 1.3305 0.7140  0.1152  0.0562  706 LYS A NZ  
5076 N N   . CYS A 663 ? 1.6839 2.2643 1.6350 0.5620  0.2204  0.2198  707 CYS A N   
5077 C CA  . CYS A 663 ? 1.6835 2.2289 1.6392 0.5338  0.1986  0.1943  707 CYS A CA  
5078 C C   . CYS A 663 ? 1.7015 2.2412 1.6308 0.5464  0.2063  0.2071  707 CYS A C   
5079 O O   . CYS A 663 ? 1.6990 2.2354 1.6055 0.5589  0.1898  0.1802  707 CYS A O   
5080 C CB  . CYS A 663 ? 1.6881 2.1993 1.6858 0.4845  0.1929  0.1996  707 CYS A CB  
5081 S SG  . CYS A 663 ? 1.7130 2.2167 1.7491 0.4635  0.2140  0.2487  707 CYS A SG  
5082 N N   . THR A 664 ? 1.0031 1.5421 0.9423 0.5430  0.2289  0.2507  708 THR A N   
5083 C CA  . THR A 664 ? 1.0225 1.5549 0.9413 0.5532  0.2363  0.2671  708 THR A CA  
5084 C C   . THR A 664 ? 1.0564 1.6254 0.9282 0.6046  0.2450  0.2615  708 THR A C   
5085 O O   . THR A 664 ? 1.0721 1.6381 0.9187 0.6179  0.2475  0.2643  708 THR A O   
5086 C CB  . THR A 664 ? 1.0336 1.5599 0.9866 0.5406  0.2540  0.3211  708 THR A CB  
5087 O OG1 . THR A 664 ? 1.0484 1.6178 1.0186 0.5623  0.2775  0.3571  708 THR A OG1 
5088 C CG2 . THR A 664 ? 1.0122 1.4899 1.0057 0.4946  0.2369  0.3235  708 THR A CG2 
5089 N N   . SER A 665 ? 1.0722 1.6750 0.9291 0.6376  0.2479  0.2525  709 SER A N   
5090 C CA  . SER A 665 ? 1.1159 1.7540 0.9195 0.6988  0.2513  0.2419  709 SER A CA  
5091 C C   . SER A 665 ? 1.1227 1.7417 0.8938 0.7087  0.2257  0.2019  709 SER A C   
5092 O O   . SER A 665 ? 1.1570 1.7928 0.8881 0.7478  0.2340  0.2071  709 SER A O   
5093 C CB  . SER A 665 ? 1.1306 1.7921 0.9209 0.7293  0.2415  0.2188  709 SER A CB  
5094 O OG  . SER A 665 ? 1.1747 1.8520 0.9087 0.7878  0.2227  0.1830  709 SER A OG  
5095 N N   . ASN A 666 ? 1.0898 1.6771 0.8839 0.6736  0.1956  0.1673  710 ASN A N   
5096 C CA  . ASN A 666 ? 1.0933 1.6659 0.8721 0.6807  0.1672  0.1333  710 ASN A CA  
5097 C C   . ASN A 666 ? 1.0847 1.6384 0.8600 0.6619  0.1767  0.1496  710 ASN A C   
5098 O O   . ASN A 666 ? 1.1005 1.6524 0.8520 0.6812  0.1634  0.1329  710 ASN A O   
5099 C CB  . ASN A 666 ? 1.0622 1.6175 0.8803 0.6534  0.1314  0.0995  710 ASN A CB  
5100 C CG  . ASN A 666 ? 1.0768 1.6462 0.8958 0.6767  0.1121  0.0749  710 ASN A CG  
5101 O OD1 . ASN A 666 ? 1.1239 1.7103 0.9007 0.7304  0.1012  0.0568  710 ASN A OD1 
5102 N ND2 . ASN A 666 ? 1.0421 1.6044 0.9042 0.6419  0.1068  0.0732  710 ASN A ND2 
5103 N N   . PHE A 667 ? 1.0627 1.5992 0.8633 0.6254  0.1949  0.1801  711 PHE A N   
5104 C CA  . PHE A 667 ? 1.0589 1.5719 0.8565 0.6076  0.2015  0.1970  711 PHE A CA  
5105 C C   . PHE A 667 ? 1.0925 1.6218 0.8617 0.6363  0.2248  0.2260  711 PHE A C   
5106 O O   . PHE A 667 ? 1.1113 1.6685 0.8812 0.6568  0.2455  0.2530  711 PHE A O   
5107 C CB  . PHE A 667 ? 1.0361 1.5202 0.8694 0.5667  0.2050  0.2170  711 PHE A CB  
5108 C CG  . PHE A 667 ? 1.0036 1.4746 0.8649 0.5402  0.1862  0.1942  711 PHE A CG  
5109 C CD1 . PHE A 667 ? 0.9910 1.4757 0.8746 0.5358  0.1831  0.1860  711 PHE A CD1 
5110 C CD2 . PHE A 667 ? 0.9878 1.4365 0.8533 0.5232  0.1730  0.1847  711 PHE A CD2 
5111 C CE1 . PHE A 667 ? 0.9599 1.4350 0.8741 0.5109  0.1660  0.1677  711 PHE A CE1 
5112 C CE2 . PHE A 667 ? 0.9590 1.4033 0.8541 0.5028  0.1587  0.1708  711 PHE A CE2 
5113 C CZ  . PHE A 667 ? 0.9435 1.4002 0.8651 0.4947  0.1546  0.1620  711 PHE A CZ  
5114 N N   . LEU A 668 ? 1.1007 1.6174 0.8475 0.6403  0.2225  0.2240  712 LEU A N   
5115 C CA  . LEU A 668 ? 1.1266 1.6508 0.8571 0.6564  0.2439  0.2574  712 LEU A CA  
5116 C C   . LEU A 668 ? 1.1172 1.6126 0.8852 0.6212  0.2488  0.2908  712 LEU A C   
5117 O O   . LEU A 668 ? 1.0991 1.5575 0.8778 0.5921  0.2317  0.2774  712 LEU A O   
5118 C CB  . LEU A 668 ? 1.1367 1.6517 0.8326 0.6689  0.2359  0.2410  712 LEU A CB  
5119 C CG  . LEU A 668 ? 1.1634 1.6856 0.8423 0.6857  0.2566  0.2746  712 LEU A CG  
5120 C CD1 . LEU A 668 ? 1.1956 1.7655 0.8547 0.7319  0.2785  0.2934  712 LEU A CD1 
5121 C CD2 . LEU A 668 ? 1.1691 1.6761 0.8162 0.6916  0.2471  0.2572  712 LEU A CD2 
5122 N N   . SER A 669 ? 1.2088 1.7213 0.9997 0.6279  0.2693  0.3367  713 SER A N   
5123 C CA  . SER A 669 ? 1.2319 1.7125 1.0723 0.5947  0.2646  0.3701  713 SER A CA  
5124 C C   . SER A 669 ? 1.2523 1.7239 1.0986 0.5993  0.2693  0.4044  713 SER A C   
5125 O O   . SER A 669 ? 1.2565 1.7646 1.0796 0.6320  0.2894  0.4204  713 SER A O   
5126 C CB  . SER A 669 ? 1.2266 1.7330 1.1148 0.5920  0.2789  0.4066  713 SER A CB  
5127 O OG  . SER A 669 ? 1.2015 1.7211 1.0812 0.5929  0.2757  0.3752  713 SER A OG  
5128 N N   . PRO A 670 ? 1.1598 1.5809 1.0368 0.5699  0.2475  0.4151  714 PRO A N   
5129 C CA  . PRO A 670 ? 1.1864 1.5915 1.0827 0.5705  0.2438  0.4505  714 PRO A CA  
5130 C C   . PRO A 670 ? 1.2016 1.6414 1.1651 0.5749  0.2620  0.5181  714 PRO A C   
5131 O O   . PRO A 670 ? 1.1916 1.6606 1.1891 0.5736  0.2748  0.5378  714 PRO A O   
5132 C CB  . PRO A 670 ? 1.1918 1.5263 1.1015 0.5417  0.2052  0.4344  714 PRO A CB  
5133 C CG  . PRO A 670 ? 1.1697 1.4938 1.0992 0.5221  0.1961  0.4175  714 PRO A CG  
5134 C CD  . PRO A 670 ? 1.1444 1.5181 1.0387 0.5386  0.2203  0.3921  714 PRO A CD  
5135 N N   . GLU A 671 ? 1.5943 2.0355 1.5814 0.5817  0.2638  0.5580  715 GLU A N   
5136 C CA  . GLU A 671 ? 1.5808 2.0672 1.6418 0.5906  0.2846  0.6346  715 GLU A CA  
5137 C C   . GLU A 671 ? 1.5767 2.0294 1.7370 0.5548  0.2572  0.6766  715 GLU A C   
5138 O O   . GLU A 671 ? 1.5595 2.0549 1.7999 0.5585  0.2737  0.7483  715 GLU A O   
5139 C CB  . GLU A 671 ? 1.5770 2.0830 1.6358 0.6122  0.2968  0.6678  715 GLU A CB  
5140 C CG  . GLU A 671 ? 1.5978 2.0357 1.6360 0.5947  0.2606  0.6385  715 GLU A CG  
5141 C CD  . GLU A 671 ? 1.6121 2.0732 1.6589 0.6149  0.2736  0.6787  715 GLU A CD  
5142 O OE1 . GLU A 671 ? 1.6008 2.1350 1.6472 0.6491  0.3150  0.7179  715 GLU A OE1 
5143 O OE2 . GLU A 671 ? 1.6396 2.0475 1.6915 0.6009  0.2419  0.6724  715 GLU A OE2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   45  ?   ?   ?   A . n 
A 1 2   ALA 2   46  ?   ?   ?   A . n 
A 1 3   PRO 3   47  ?   ?   ?   A . n 
A 1 4   GLY 4   48  ?   ?   ?   A . n 
A 1 5   GLU 5   49  ?   ?   ?   A . n 
A 1 6   ASP 6   50  ?   ?   ?   A . n 
A 1 7   GLU 7   51  ?   ?   ?   A . n 
A 1 8   GLU 8   52  ?   ?   ?   A . n 
A 1 9   CYS 9   53  53  CYS CYS A . n 
A 1 10  GLY 10  54  54  GLY GLY A . n 
A 1 11  ARG 11  55  55  ARG ARG A . n 
A 1 12  VAL 12  56  56  VAL VAL A . n 
A 1 13  ARG 13  57  57  ARG ARG A . n 
A 1 14  ASP 14  58  58  ASP ASP A . n 
A 1 15  PHE 15  59  59  PHE PHE A . n 
A 1 16  VAL 16  60  60  VAL VAL A . n 
A 1 17  ALA 17  61  61  ALA ALA A . n 
A 1 18  LYS 18  62  62  LYS LYS A . n 
A 1 19  LEU 19  63  63  LEU LEU A . n 
A 1 20  ALA 20  64  64  ALA ALA A . n 
A 1 21  ASN 21  65  65  ASN ASN A . n 
A 1 22  ASN 22  66  66  ASN ASN A . n 
A 1 23  THR 23  67  67  THR THR A . n 
A 1 24  HIS 24  68  68  HIS HIS A . n 
A 1 25  GLN 25  69  69  GLN GLN A . n 
A 1 26  HIS 26  70  70  HIS HIS A . n 
A 1 27  VAL 27  71  71  VAL VAL A . n 
A 1 28  PHE 28  72  72  PHE PHE A . n 
A 1 29  ASP 29  73  73  ASP ASP A . n 
A 1 30  ASP 30  74  74  ASP ASP A . n 
A 1 31  LEU 31  75  75  LEU LEU A . n 
A 1 32  ARG 32  76  76  ARG ARG A . n 
A 1 33  GLY 33  77  77  GLY GLY A . n 
A 1 34  SER 34  78  78  SER SER A . n 
A 1 35  VAL 35  79  79  VAL VAL A . n 
A 1 36  SER 36  80  80  SER SER A . n 
A 1 37  LEU 37  81  81  LEU LEU A . n 
A 1 38  SER 38  82  82  SER SER A . n 
A 1 39  TRP 39  83  83  TRP TRP A . n 
A 1 40  VAL 40  84  84  VAL VAL A . n 
A 1 41  GLY 41  85  85  GLY GLY A . n 
A 1 42  ASP 42  86  86  ASP ASP A . n 
A 1 43  SER 43  87  87  SER SER A . n 
A 1 44  THR 44  88  88  THR THR A . n 
A 1 45  GLY 45  89  89  GLY GLY A . n 
A 1 46  VAL 46  90  90  VAL VAL A . n 
A 1 47  ILE 47  91  91  ILE ILE A . n 
A 1 48  LEU 48  92  92  LEU LEU A . n 
A 1 49  VAL 49  93  93  VAL VAL A . n 
A 1 50  LEU 50  94  94  LEU LEU A . n 
A 1 51  THR 51  95  95  THR THR A . n 
A 1 52  THR 52  96  96  THR THR A . n 
A 1 53  PHE 53  97  97  PHE PHE A . n 
A 1 54  HIS 54  98  98  HIS HIS A . n 
A 1 55  VAL 55  99  99  VAL VAL A . n 
A 1 56  PRO 56  100 ?   ?   ?   A . n 
A 1 57  LEU 57  101 ?   ?   ?   A . n 
A 1 58  VAL 58  102 ?   ?   ?   A . n 
A 1 59  ILE 59  103 ?   ?   ?   A . n 
A 1 60  MET 60  104 ?   ?   ?   A . n 
A 1 61  THR 61  105 ?   ?   ?   A . n 
A 1 62  PHE 62  106 ?   ?   ?   A . n 
A 1 63  GLY 63  107 107 GLY GLY A . n 
A 1 64  GLN 64  108 108 GLN GLN A . n 
A 1 65  SER 65  109 109 SER SER A . n 
A 1 66  LYS 66  110 110 LYS LYS A . n 
A 1 67  LEU 67  111 111 LEU LEU A . n 
A 1 68  TYR 68  112 112 TYR TYR A . n 
A 1 69  ARG 69  113 113 ARG ARG A . n 
A 1 70  SER 70  114 114 SER SER A . n 
A 1 71  GLU 71  115 115 GLU GLU A . n 
A 1 72  ASP 72  116 116 ASP ASP A . n 
A 1 73  TYR 73  117 117 TYR TYR A . n 
A 1 74  GLY 74  118 118 GLY GLY A . n 
A 1 75  LYS 75  119 119 LYS LYS A . n 
A 1 76  ASN 76  120 120 ASN ASN A . n 
A 1 77  PHE 77  121 121 PHE PHE A . n 
A 1 78  LYS 78  122 122 LYS LYS A . n 
A 1 79  ASP 79  123 123 ASP ASP A . n 
A 1 80  ILE 80  124 124 ILE ILE A . n 
A 1 81  THR 81  125 125 THR THR A . n 
A 1 82  ASP 82  126 126 ASP ASP A . n 
A 1 83  LEU 83  127 127 LEU LEU A . n 
A 1 84  ILE 84  128 128 ILE ILE A . n 
A 1 85  ASN 85  129 129 ASN ASN A . n 
A 1 86  ASN 86  130 130 ASN ASN A . n 
A 1 87  THR 87  131 131 THR THR A . n 
A 1 88  PHE 88  132 132 PHE PHE A . n 
A 1 89  ILE 89  133 133 ILE ILE A . n 
A 1 90  ARG 90  134 134 ARG ARG A . n 
A 1 91  THR 91  135 135 THR THR A . n 
A 1 92  GLU 92  136 136 GLU GLU A . n 
A 1 93  PHE 93  137 137 PHE PHE A . n 
A 1 94  GLY 94  138 138 GLY GLY A . n 
A 1 95  MET 95  139 139 MET MET A . n 
A 1 96  ALA 96  140 140 ALA ALA A . n 
A 1 97  ILE 97  141 141 ILE ILE A . n 
A 1 98  GLY 98  142 142 GLY GLY A . n 
A 1 99  PRO 99  143 143 PRO PRO A . n 
A 1 100 GLU 100 144 144 GLU GLU A . n 
A 1 101 ASN 101 145 145 ASN ASN A . n 
A 1 102 SER 102 146 146 SER SER A . n 
A 1 103 GLY 103 147 147 GLY GLY A . n 
A 1 104 LYS 104 148 148 LYS LYS A . n 
A 1 105 VAL 105 149 149 VAL VAL A . n 
A 1 106 VAL 106 150 150 VAL VAL A . n 
A 1 107 LEU 107 151 151 LEU LEU A . n 
A 1 108 THR 108 152 152 THR THR A . n 
A 1 109 ALA 109 153 153 ALA ALA A . n 
A 1 110 GLU 110 154 154 GLU GLU A . n 
A 1 111 VAL 111 155 155 VAL VAL A . n 
A 1 112 SER 112 156 156 SER SER A . n 
A 1 113 GLY 113 157 157 GLY GLY A . n 
A 1 114 GLY 114 158 158 GLY GLY A . n 
A 1 115 SER 115 159 159 SER SER A . n 
A 1 116 ARG 116 160 160 ARG ARG A . n 
A 1 117 GLY 117 161 161 GLY GLY A . n 
A 1 118 GLY 118 162 162 GLY GLY A . n 
A 1 119 ARG 119 163 163 ARG ARG A . n 
A 1 120 ILE 120 164 164 ILE ILE A . n 
A 1 121 PHE 121 165 165 PHE PHE A . n 
A 1 122 ARG 122 166 166 ARG ARG A . n 
A 1 123 SER 123 167 167 SER SER A . n 
A 1 124 SER 124 168 168 SER SER A . n 
A 1 125 ASP 125 169 169 ASP ASP A . n 
A 1 126 PHE 126 170 170 PHE PHE A . n 
A 1 127 ALA 127 171 171 ALA ALA A . n 
A 1 128 LYS 128 172 172 LYS LYS A . n 
A 1 129 ASN 129 173 173 ASN ASN A . n 
A 1 130 PHE 130 174 174 PHE PHE A . n 
A 1 131 VAL 131 175 175 VAL VAL A . n 
A 1 132 GLN 132 176 176 GLN GLN A . n 
A 1 133 THR 133 177 177 THR THR A . n 
A 1 134 ASP 134 178 178 ASP ASP A . n 
A 1 135 LEU 135 179 179 LEU LEU A . n 
A 1 136 PRO 136 180 180 PRO PRO A . n 
A 1 137 PHE 137 181 181 PHE PHE A . n 
A 1 138 HIS 138 182 182 HIS HIS A . n 
A 1 139 PRO 139 183 183 PRO PRO A . n 
A 1 140 LEU 140 184 184 LEU LEU A . n 
A 1 141 THR 141 185 185 THR THR A . n 
A 1 142 GLN 142 186 186 GLN GLN A . n 
A 1 143 MET 143 187 187 MET MET A . n 
A 1 144 MET 144 188 188 MET MET A . n 
A 1 145 TYR 145 189 189 TYR TYR A . n 
A 1 146 SER 146 190 190 SER SER A . n 
A 1 147 PRO 147 191 191 PRO PRO A . n 
A 1 148 GLN 148 192 192 GLN GLN A . n 
A 1 149 ASN 149 193 193 ASN ASN A . n 
A 1 150 SER 150 194 194 SER SER A . n 
A 1 151 ASP 151 195 195 ASP ASP A . n 
A 1 152 TYR 152 196 196 TYR TYR A . n 
A 1 153 LEU 153 197 197 LEU LEU A . n 
A 1 154 LEU 154 198 198 LEU LEU A . n 
A 1 155 ALA 155 199 199 ALA ALA A . n 
A 1 156 LEU 156 200 200 LEU LEU A . n 
A 1 157 SER 157 201 201 SER SER A . n 
A 1 158 THR 158 202 202 THR THR A . n 
A 1 159 GLU 159 203 203 GLU GLU A . n 
A 1 160 ASN 160 204 204 ASN ASN A . n 
A 1 161 GLY 161 205 205 GLY GLY A . n 
A 1 162 LEU 162 206 206 LEU LEU A . n 
A 1 163 TRP 163 207 207 TRP TRP A . n 
A 1 164 VAL 164 208 208 VAL VAL A . n 
A 1 165 SER 165 209 209 SER SER A . n 
A 1 166 LYS 166 210 210 LYS LYS A . n 
A 1 167 ASN 167 211 211 ASN ASN A . n 
A 1 168 PHE 168 212 212 PHE PHE A . n 
A 1 169 GLY 169 213 213 GLY GLY A . n 
A 1 170 GLY 170 214 214 GLY GLY A . n 
A 1 171 LYS 171 215 215 LYS LYS A . n 
A 1 172 TRP 172 216 216 TRP TRP A . n 
A 1 173 GLU 173 217 217 GLU GLU A . n 
A 1 174 GLU 174 218 218 GLU GLU A . n 
A 1 175 ILE 175 219 219 ILE ILE A . n 
A 1 176 HIS 176 220 220 HIS HIS A . n 
A 1 177 LYS 177 221 221 LYS LYS A . n 
A 1 178 ALA 178 222 222 ALA ALA A . n 
A 1 179 VAL 179 223 223 VAL VAL A . n 
A 1 180 CYS 180 224 224 CYS CYS A . n 
A 1 181 LEU 181 225 225 LEU LEU A . n 
A 1 182 ALA 182 226 226 ALA ALA A . n 
A 1 183 LYS 183 227 227 LYS LYS A . n 
A 1 184 TRP 184 228 228 TRP TRP A . n 
A 1 185 GLY 185 229 229 GLY GLY A . n 
A 1 186 SER 186 230 230 SER SER A . n 
A 1 187 ASP 187 231 231 ASP ASP A . n 
A 1 188 ASN 188 232 232 ASN ASN A . n 
A 1 189 THR 189 233 233 THR THR A . n 
A 1 190 ILE 190 234 234 ILE ILE A . n 
A 1 191 PHE 191 235 235 PHE PHE A . n 
A 1 192 PHE 192 236 236 PHE PHE A . n 
A 1 193 THR 193 237 237 THR THR A . n 
A 1 194 THR 194 238 238 THR THR A . n 
A 1 195 TYR 195 239 239 TYR TYR A . n 
A 1 196 ALA 196 240 240 ALA ALA A . n 
A 1 197 ASN 197 241 241 ASN ASN A . n 
A 1 198 GLY 198 242 242 GLY GLY A . n 
A 1 199 SER 199 243 243 SER SER A . n 
A 1 200 CYS 200 244 244 CYS CYS A . n 
A 1 201 LYS 201 245 245 LYS LYS A . n 
A 1 202 ALA 202 246 246 ALA ALA A . n 
A 1 203 ASP 203 247 247 ASP ASP A . n 
A 1 204 LEU 204 248 248 LEU LEU A . n 
A 1 205 GLY 205 249 249 GLY GLY A . n 
A 1 206 ALA 206 250 250 ALA ALA A . n 
A 1 207 LEU 207 251 251 LEU LEU A . n 
A 1 208 GLU 208 252 252 GLU GLU A . n 
A 1 209 LEU 209 253 253 LEU LEU A . n 
A 1 210 TRP 210 254 254 TRP TRP A . n 
A 1 211 ARG 211 255 255 ARG ARG A . n 
A 1 212 THR 212 256 256 THR THR A . n 
A 1 213 SER 213 257 257 SER SER A . n 
A 1 214 ASP 214 258 258 ASP ASP A . n 
A 1 215 LEU 215 259 259 LEU LEU A . n 
A 1 216 GLY 216 260 260 GLY GLY A . n 
A 1 217 LYS 217 261 261 LYS LYS A . n 
A 1 218 SER 218 262 262 SER SER A . n 
A 1 219 PHE 219 263 263 PHE PHE A . n 
A 1 220 LYS 220 264 264 LYS LYS A . n 
A 1 221 THR 221 265 265 THR THR A . n 
A 1 222 ILE 222 266 266 ILE ILE A . n 
A 1 223 GLY 223 267 267 GLY GLY A . n 
A 1 224 VAL 224 268 268 VAL VAL A . n 
A 1 225 LYS 225 269 269 LYS LYS A . n 
A 1 226 ILE 226 270 270 ILE ILE A . n 
A 1 227 TYR 227 271 271 TYR TYR A . n 
A 1 228 SER 228 272 272 SER SER A . n 
A 1 229 PHE 229 273 273 PHE PHE A . n 
A 1 230 GLY 230 274 274 GLY GLY A . n 
A 1 231 LEU 231 275 275 LEU LEU A . n 
A 1 232 GLY 232 276 276 GLY GLY A . n 
A 1 233 GLY 233 277 277 GLY GLY A . n 
A 1 234 ARG 234 278 278 ARG ARG A . n 
A 1 235 PHE 235 279 279 PHE PHE A . n 
A 1 236 LEU 236 280 280 LEU LEU A . n 
A 1 237 PHE 237 281 281 PHE PHE A . n 
A 1 238 ALA 238 282 282 ALA ALA A . n 
A 1 239 SER 239 283 283 SER SER A . n 
A 1 240 VAL 240 284 284 VAL VAL A . n 
A 1 241 MET 241 285 285 MET MET A . n 
A 1 242 ALA 242 286 286 ALA ALA A . n 
A 1 243 ASP 243 287 287 ASP ASP A . n 
A 1 244 LYS 244 288 288 LYS LYS A . n 
A 1 245 ASP 245 289 289 ASP ASP A . n 
A 1 246 THR 246 290 290 THR THR A . n 
A 1 247 THR 247 291 291 THR THR A . n 
A 1 248 ARG 248 292 292 ARG ARG A . n 
A 1 249 ARG 249 293 293 ARG ARG A . n 
A 1 250 ILE 250 294 294 ILE ILE A . n 
A 1 251 HIS 251 295 295 HIS HIS A . n 
A 1 252 VAL 252 296 296 VAL VAL A . n 
A 1 253 SER 253 297 297 SER SER A . n 
A 1 254 THR 254 298 298 THR THR A . n 
A 1 255 ASP 255 299 299 ASP ASP A . n 
A 1 256 GLN 256 300 300 GLN GLN A . n 
A 1 257 GLY 257 301 301 GLY GLY A . n 
A 1 258 ASP 258 302 302 ASP ASP A . n 
A 1 259 THR 259 303 303 THR THR A . n 
A 1 260 TRP 260 304 304 TRP TRP A . n 
A 1 261 SER 261 305 305 SER SER A . n 
A 1 262 MET 262 306 306 MET MET A . n 
A 1 263 ALA 263 307 307 ALA ALA A . n 
A 1 264 GLN 264 308 308 GLN GLN A . n 
A 1 265 LEU 265 309 309 LEU LEU A . n 
A 1 266 PRO 266 310 310 PRO PRO A . n 
A 1 267 SER 267 311 311 SER SER A . n 
A 1 268 VAL 268 312 312 VAL VAL A . n 
A 1 269 GLY 269 313 313 GLY GLY A . n 
A 1 270 GLN 270 314 314 GLN GLN A . n 
A 1 271 GLU 271 315 315 GLU GLU A . n 
A 1 272 GLN 272 316 316 GLN GLN A . n 
A 1 273 PHE 273 317 317 PHE PHE A . n 
A 1 274 TYR 274 318 318 TYR TYR A . n 
A 1 275 SER 275 319 319 SER SER A . n 
A 1 276 ILE 276 320 320 ILE ILE A . n 
A 1 277 LEU 277 321 321 LEU LEU A . n 
A 1 278 ALA 278 322 322 ALA ALA A . n 
A 1 279 ALA 279 323 323 ALA ALA A . n 
A 1 280 ASN 280 324 324 ASN ASN A . n 
A 1 281 ASP 281 325 325 ASP ASP A . n 
A 1 282 ASP 282 326 326 ASP ASP A . n 
A 1 283 MET 283 327 327 MET MET A . n 
A 1 284 VAL 284 328 328 VAL VAL A . n 
A 1 285 PHE 285 329 329 PHE PHE A . n 
A 1 286 MET 286 330 330 MET MET A . n 
A 1 287 HIS 287 331 331 HIS HIS A . n 
A 1 288 VAL 288 332 332 VAL VAL A . n 
A 1 289 ASP 289 333 333 ASP ASP A . n 
A 1 290 GLU 290 334 334 GLU GLU A . n 
A 1 291 PRO 291 335 335 PRO PRO A . n 
A 1 292 GLY 292 336 336 GLY GLY A . n 
A 1 293 ASP 293 337 337 ASP ASP A . n 
A 1 294 THR 294 338 338 THR THR A . n 
A 1 295 GLY 295 339 339 GLY GLY A . n 
A 1 296 PHE 296 340 340 PHE PHE A . n 
A 1 297 GLY 297 341 341 GLY GLY A . n 
A 1 298 THR 298 342 342 THR THR A . n 
A 1 299 ILE 299 343 343 ILE ILE A . n 
A 1 300 PHE 300 344 344 PHE PHE A . n 
A 1 301 THR 301 345 345 THR THR A . n 
A 1 302 SER 302 346 346 SER SER A . n 
A 1 303 ASP 303 347 347 ASP ASP A . n 
A 1 304 ASP 304 348 348 ASP ASP A . n 
A 1 305 ARG 305 349 349 ARG ARG A . n 
A 1 306 GLY 306 350 350 GLY GLY A . n 
A 1 307 ILE 307 351 351 ILE ILE A . n 
A 1 308 VAL 308 352 352 VAL VAL A . n 
A 1 309 TYR 309 353 353 TYR TYR A . n 
A 1 310 SER 310 354 354 SER SER A . n 
A 1 311 LYS 311 355 355 LYS LYS A . n 
A 1 312 SER 312 356 356 SER SER A . n 
A 1 313 LEU 313 357 357 LEU LEU A . n 
A 1 314 ASP 314 358 358 ASP ASP A . n 
A 1 315 ARG 315 359 359 ARG ARG A . n 
A 1 316 HIS 316 360 360 HIS HIS A . n 
A 1 317 LEU 317 361 361 LEU LEU A . n 
A 1 318 TYR 318 362 362 TYR TYR A . n 
A 1 319 THR 319 363 363 THR THR A . n 
A 1 320 THR 320 364 364 THR THR A . n 
A 1 321 THR 321 365 365 THR THR A . n 
A 1 322 GLY 322 366 366 GLY GLY A . n 
A 1 323 GLY 323 367 367 GLY GLY A . n 
A 1 324 GLU 324 368 368 GLU GLU A . n 
A 1 325 THR 325 369 369 THR THR A . n 
A 1 326 ASP 326 370 370 ASP ASP A . n 
A 1 327 PHE 327 371 371 PHE PHE A . n 
A 1 328 THR 328 372 372 THR THR A . n 
A 1 329 ASN 329 373 373 ASN ASN A . n 
A 1 330 VAL 330 374 374 VAL VAL A . n 
A 1 331 THR 331 375 375 THR THR A . n 
A 1 332 SER 332 376 376 SER SER A . n 
A 1 333 LEU 333 377 377 LEU LEU A . n 
A 1 334 ARG 334 378 378 ARG ARG A . n 
A 1 335 GLY 335 379 379 GLY GLY A . n 
A 1 336 VAL 336 380 380 VAL VAL A . n 
A 1 337 TYR 337 381 381 TYR TYR A . n 
A 1 338 ILE 338 382 382 ILE ILE A . n 
A 1 339 THR 339 383 383 THR THR A . n 
A 1 340 SER 340 384 384 SER SER A . n 
A 1 341 VAL 341 385 385 VAL VAL A . n 
A 1 342 LEU 342 386 386 LEU LEU A . n 
A 1 343 SER 343 387 387 SER SER A . n 
A 1 344 GLU 344 388 388 GLU GLU A . n 
A 1 345 ASP 345 389 389 ASP ASP A . n 
A 1 346 ASN 346 390 390 ASN ASN A . n 
A 1 347 SER 347 391 391 SER SER A . n 
A 1 348 ILE 348 392 392 ILE ILE A . n 
A 1 349 GLN 349 393 393 GLN GLN A . n 
A 1 350 THR 350 394 394 THR THR A . n 
A 1 351 MET 351 395 395 MET MET A . n 
A 1 352 ILE 352 396 396 ILE ILE A . n 
A 1 353 THR 353 397 397 THR THR A . n 
A 1 354 PHE 354 398 398 PHE PHE A . n 
A 1 355 ASP 355 399 399 ASP ASP A . n 
A 1 356 GLN 356 400 400 GLN GLN A . n 
A 1 357 GLY 357 401 401 GLY GLY A . n 
A 1 358 GLY 358 402 402 GLY GLY A . n 
A 1 359 ARG 359 403 403 ARG ARG A . n 
A 1 360 TRP 360 404 404 TRP TRP A . n 
A 1 361 THR 361 405 405 THR THR A . n 
A 1 362 HIS 362 406 406 HIS HIS A . n 
A 1 363 LEU 363 407 407 LEU LEU A . n 
A 1 364 ARG 364 408 408 ARG ARG A . n 
A 1 365 LYS 365 409 409 LYS LYS A . n 
A 1 366 PRO 366 410 410 PRO PRO A . n 
A 1 367 GLU 367 411 411 GLU GLU A . n 
A 1 368 ASN 368 412 412 ASN ASN A . n 
A 1 369 SER 369 413 413 SER SER A . n 
A 1 370 GLU 370 414 414 GLU GLU A . n 
A 1 371 CYS 371 415 415 CYS CYS A . n 
A 1 372 ASP 372 416 416 ASP ASP A . n 
A 1 373 ALA 373 417 417 ALA ALA A . n 
A 1 374 THR 374 418 418 THR THR A . n 
A 1 375 ALA 375 419 419 ALA ALA A . n 
A 1 376 LYS 376 420 420 LYS LYS A . n 
A 1 377 ASN 377 421 421 ASN ASN A . n 
A 1 378 LYS 378 422 422 LYS LYS A . n 
A 1 379 ASN 379 423 423 ASN ASN A . n 
A 1 380 GLU 380 424 424 GLU GLU A . n 
A 1 381 CYS 381 425 425 CYS CYS A . n 
A 1 382 SER 382 426 426 SER SER A . n 
A 1 383 LEU 383 427 427 LEU LEU A . n 
A 1 384 HIS 384 428 428 HIS HIS A . n 
A 1 385 ILE 385 429 429 ILE ILE A . n 
A 1 386 HIS 386 430 430 HIS HIS A . n 
A 1 387 ALA 387 431 431 ALA ALA A . n 
A 1 388 SER 388 432 432 SER SER A . n 
A 1 389 TYR 389 433 433 TYR TYR A . n 
A 1 390 SER 390 434 434 SER SER A . n 
A 1 391 ILE 391 435 435 ILE ILE A . n 
A 1 392 SER 392 436 436 SER SER A . n 
A 1 393 GLN 393 437 437 GLN GLN A . n 
A 1 394 LYS 394 438 438 LYS LYS A . n 
A 1 395 LEU 395 439 439 LEU LEU A . n 
A 1 396 ASN 396 440 440 ASN ASN A . n 
A 1 397 VAL 397 441 441 VAL VAL A . n 
A 1 398 PRO 398 442 442 PRO PRO A . n 
A 1 399 MET 399 443 443 MET MET A . n 
A 1 400 ALA 400 444 444 ALA ALA A . n 
A 1 401 PRO 401 445 445 PRO PRO A . n 
A 1 402 LEU 402 446 446 LEU LEU A . n 
A 1 403 SER 403 447 447 SER SER A . n 
A 1 404 GLU 404 448 448 GLU GLU A . n 
A 1 405 PRO 405 449 449 PRO PRO A . n 
A 1 406 ASN 406 450 450 ASN ASN A . n 
A 1 407 ALA 407 451 451 ALA ALA A . n 
A 1 408 VAL 408 452 452 VAL VAL A . n 
A 1 409 GLY 409 453 453 GLY GLY A . n 
A 1 410 ILE 410 454 454 ILE ILE A . n 
A 1 411 VAL 411 455 455 VAL VAL A . n 
A 1 412 ILE 412 456 456 ILE ILE A . n 
A 1 413 ALA 413 457 457 ALA ALA A . n 
A 1 414 HIS 414 458 458 HIS HIS A . n 
A 1 415 GLY 415 459 459 GLY GLY A . n 
A 1 416 SER 416 460 460 SER SER A . n 
A 1 417 VAL 417 461 461 VAL VAL A . n 
A 1 418 GLY 418 462 462 GLY GLY A . n 
A 1 419 ASP 419 463 463 ASP ASP A . n 
A 1 420 ALA 420 464 464 ALA ALA A . n 
A 1 421 ILE 421 465 465 ILE ILE A . n 
A 1 422 SER 422 466 466 SER SER A . n 
A 1 423 VAL 423 467 467 VAL VAL A . n 
A 1 424 MET 424 468 468 MET MET A . n 
A 1 425 VAL 425 469 469 VAL VAL A . n 
A 1 426 PRO 426 470 470 PRO PRO A . n 
A 1 427 ASP 427 471 471 ASP ASP A . n 
A 1 428 VAL 428 472 472 VAL VAL A . n 
A 1 429 TYR 429 473 473 TYR TYR A . n 
A 1 430 ILE 430 474 474 ILE ILE A . n 
A 1 431 SER 431 475 475 SER SER A . n 
A 1 432 ASP 432 476 476 ASP ASP A . n 
A 1 433 ASP 433 477 477 ASP ASP A . n 
A 1 434 GLY 434 478 478 GLY GLY A . n 
A 1 435 GLY 435 479 479 GLY GLY A . n 
A 1 436 TYR 436 480 480 TYR TYR A . n 
A 1 437 SER 437 481 481 SER SER A . n 
A 1 438 TRP 438 482 482 TRP TRP A . n 
A 1 439 THR 439 483 483 THR THR A . n 
A 1 440 LYS 440 484 484 LYS LYS A . n 
A 1 441 MET 441 485 485 MET MET A . n 
A 1 442 LEU 442 486 486 LEU LEU A . n 
A 1 443 GLU 443 487 487 GLU GLU A . n 
A 1 444 GLY 444 488 488 GLY GLY A . n 
A 1 445 PRO 445 489 489 PRO PRO A . n 
A 1 446 HIS 446 490 490 HIS HIS A . n 
A 1 447 TYR 447 491 491 TYR TYR A . n 
A 1 448 TYR 448 492 492 TYR TYR A . n 
A 1 449 THR 449 493 493 THR THR A . n 
A 1 450 ILE 450 494 494 ILE ILE A . n 
A 1 451 LEU 451 495 495 LEU LEU A . n 
A 1 452 ASP 452 496 496 ASP ASP A . n 
A 1 453 SER 453 497 497 SER SER A . n 
A 1 454 GLY 454 498 498 GLY GLY A . n 
A 1 455 GLY 455 499 499 GLY GLY A . n 
A 1 456 ILE 456 500 500 ILE ILE A . n 
A 1 457 ILE 457 501 501 ILE ILE A . n 
A 1 458 VAL 458 502 502 VAL VAL A . n 
A 1 459 ALA 459 503 503 ALA ALA A . n 
A 1 460 ILE 460 504 504 ILE ILE A . n 
A 1 461 GLU 461 505 505 GLU GLU A . n 
A 1 462 HIS 462 506 506 HIS HIS A . n 
A 1 463 SER 463 507 507 SER SER A . n 
A 1 464 SER 464 508 508 SER SER A . n 
A 1 465 ARG 465 509 509 ARG ARG A . n 
A 1 466 PRO 466 510 510 PRO PRO A . n 
A 1 467 ILE 467 511 511 ILE ILE A . n 
A 1 468 ASN 468 512 512 ASN ASN A . n 
A 1 469 VAL 469 513 513 VAL VAL A . n 
A 1 470 ILE 470 514 514 ILE ILE A . n 
A 1 471 LYS 471 515 515 LYS LYS A . n 
A 1 472 PHE 472 516 516 PHE PHE A . n 
A 1 473 SER 473 517 517 SER SER A . n 
A 1 474 THR 474 518 518 THR THR A . n 
A 1 475 ASP 475 519 519 ASP ASP A . n 
A 1 476 GLU 476 520 520 GLU GLU A . n 
A 1 477 GLY 477 521 521 GLY GLY A . n 
A 1 478 GLN 478 522 522 GLN GLN A . n 
A 1 479 CYS 479 523 523 CYS CYS A . n 
A 1 480 TRP 480 524 524 TRP TRP A . n 
A 1 481 GLN 481 525 525 GLN GLN A . n 
A 1 482 THR 482 526 526 THR THR A . n 
A 1 483 TYR 483 527 527 TYR TYR A . n 
A 1 484 THR 484 528 528 THR THR A . n 
A 1 485 PHE 485 529 529 PHE PHE A . n 
A 1 486 THR 486 530 530 THR THR A . n 
A 1 487 ARG 487 531 531 ARG ARG A . n 
A 1 488 ASP 488 532 532 ASP ASP A . n 
A 1 489 PRO 489 533 533 PRO PRO A . n 
A 1 490 ILE 490 534 534 ILE ILE A . n 
A 1 491 TYR 491 535 535 TYR TYR A . n 
A 1 492 PHE 492 536 536 PHE PHE A . n 
A 1 493 THR 493 537 537 THR THR A . n 
A 1 494 GLY 494 538 538 GLY GLY A . n 
A 1 495 LEU 495 539 539 LEU LEU A . n 
A 1 496 ALA 496 540 540 ALA ALA A . n 
A 1 497 SER 497 541 541 SER SER A . n 
A 1 498 GLU 498 542 542 GLU GLU A . n 
A 1 499 PRO 499 543 543 PRO PRO A . n 
A 1 500 GLY 500 544 544 GLY GLY A . n 
A 1 501 ALA 501 545 545 ALA ALA A . n 
A 1 502 ARG 502 546 546 ARG ARG A . n 
A 1 503 SER 503 547 547 SER SER A . n 
A 1 504 MET 504 548 548 MET MET A . n 
A 1 505 ASN 505 549 549 ASN ASN A . n 
A 1 506 ILE 506 550 550 ILE ILE A . n 
A 1 507 SER 507 551 551 SER SER A . n 
A 1 508 ILE 508 552 552 ILE ILE A . n 
A 1 509 TRP 509 553 553 TRP TRP A . n 
A 1 510 GLY 510 554 554 GLY GLY A . n 
A 1 511 PHE 511 555 555 PHE PHE A . n 
A 1 512 THR 512 556 556 THR THR A . n 
A 1 513 GLU 513 557 557 GLU GLU A . n 
A 1 514 SER 514 558 558 SER SER A . n 
A 1 515 PHE 515 559 ?   ?   ?   A . n 
A 1 516 LEU 516 560 ?   ?   ?   A . n 
A 1 517 THR 517 561 561 THR THR A . n 
A 1 518 SER 518 562 562 SER SER A . n 
A 1 519 GLN 519 563 563 GLN GLN A . n 
A 1 520 TRP 520 564 564 TRP TRP A . n 
A 1 521 VAL 521 565 565 VAL VAL A . n 
A 1 522 SER 522 566 566 SER SER A . n 
A 1 523 TYR 523 567 567 TYR TYR A . n 
A 1 524 THR 524 568 568 THR THR A . n 
A 1 525 ILE 525 569 569 ILE ILE A . n 
A 1 526 ASP 526 570 570 ASP ASP A . n 
A 1 527 PHE 527 571 571 PHE PHE A . n 
A 1 528 LYS 528 572 572 LYS LYS A . n 
A 1 529 ASP 529 573 573 ASP ASP A . n 
A 1 530 ILE 530 574 574 ILE ILE A . n 
A 1 531 LEU 531 575 575 LEU LEU A . n 
A 1 532 GLU 532 576 576 GLU GLU A . n 
A 1 533 ARG 533 577 577 ARG ARG A . n 
A 1 534 ASN 534 578 578 ASN ASN A . n 
A 1 535 CYS 535 579 579 CYS CYS A . n 
A 1 536 GLU 536 580 580 GLU GLU A . n 
A 1 537 GLU 537 581 581 GLU GLU A . n 
A 1 538 LYS 538 582 582 LYS LYS A . n 
A 1 539 ASP 539 583 583 ASP ASP A . n 
A 1 540 TYR 540 584 584 TYR TYR A . n 
A 1 541 THR 541 585 585 THR THR A . n 
A 1 542 ILE 542 586 586 ILE ILE A . n 
A 1 543 TRP 543 587 587 TRP TRP A . n 
A 1 544 LEU 544 588 588 LEU LEU A . n 
A 1 545 ALA 545 589 589 ALA ALA A . n 
A 1 546 HIS 546 590 590 HIS HIS A . n 
A 1 547 SER 547 591 591 SER SER A . n 
A 1 548 THR 548 592 592 THR THR A . n 
A 1 549 ASP 549 593 593 ASP ASP A . n 
A 1 550 PRO 550 594 594 PRO PRO A . n 
A 1 551 GLU 551 595 595 GLU GLU A . n 
A 1 552 ASP 552 596 596 ASP ASP A . n 
A 1 553 TYR 553 597 597 TYR TYR A . n 
A 1 554 GLU 554 598 598 GLU GLU A . n 
A 1 555 ASP 555 599 599 ASP ASP A . n 
A 1 556 GLY 556 600 600 GLY GLY A . n 
A 1 557 CYS 557 601 601 CYS CYS A . n 
A 1 558 ILE 558 602 602 ILE ILE A . n 
A 1 559 LEU 559 603 603 LEU LEU A . n 
A 1 560 GLY 560 604 604 GLY GLY A . n 
A 1 561 TYR 561 605 605 TYR TYR A . n 
A 1 562 LYS 562 606 606 LYS LYS A . n 
A 1 563 GLU 563 607 607 GLU GLU A . n 
A 1 564 GLN 564 608 608 GLN GLN A . n 
A 1 565 PHE 565 609 609 PHE PHE A . n 
A 1 566 LEU 566 610 610 LEU LEU A . n 
A 1 567 ARG 567 611 611 ARG ARG A . n 
A 1 568 LEU 568 612 612 LEU LEU A . n 
A 1 569 ARG 569 613 613 ARG ARG A . n 
A 1 570 LYS 570 614 614 LYS LYS A . n 
A 1 571 SER 571 615 615 SER SER A . n 
A 1 572 SER 572 616 616 SER SER A . n 
A 1 573 MET 573 617 617 MET MET A . n 
A 1 574 CYS 574 618 618 CYS CYS A . n 
A 1 575 GLN 575 619 619 GLN GLN A . n 
A 1 576 ASN 576 620 620 ASN ASN A . n 
A 1 577 GLY 577 621 621 GLY GLY A . n 
A 1 578 ARG 578 622 622 ARG ARG A . n 
A 1 579 ASP 579 623 623 ASP ASP A . n 
A 1 580 TYR 580 624 624 TYR TYR A . n 
A 1 581 VAL 581 625 625 VAL VAL A . n 
A 1 582 VAL 582 626 626 VAL VAL A . n 
A 1 583 THR 583 627 627 THR THR A . n 
A 1 584 LYS 584 628 628 LYS LYS A . n 
A 1 585 GLN 585 629 629 GLN GLN A . n 
A 1 586 PRO 586 630 630 PRO PRO A . n 
A 1 587 SER 587 631 631 SER SER A . n 
A 1 588 ILE 588 632 632 ILE ILE A . n 
A 1 589 CYS 589 633 633 CYS CYS A . n 
A 1 590 LEU 590 634 634 LEU LEU A . n 
A 1 591 CYS 591 635 635 CYS CYS A . n 
A 1 592 SER 592 636 636 SER SER A . n 
A 1 593 LEU 593 637 637 LEU LEU A . n 
A 1 594 GLU 594 638 638 GLU GLU A . n 
A 1 595 ASP 595 639 639 ASP ASP A . n 
A 1 596 PHE 596 640 640 PHE PHE A . n 
A 1 597 LEU 597 641 641 LEU LEU A . n 
A 1 598 CYS 598 642 642 CYS CYS A . n 
A 1 599 ASP 599 643 643 ASP ASP A . n 
A 1 600 PHE 600 644 644 PHE PHE A . n 
A 1 601 GLY 601 645 645 GLY GLY A . n 
A 1 602 TYR 602 646 646 TYR TYR A . n 
A 1 603 TYR 603 647 647 TYR TYR A . n 
A 1 604 ARG 604 648 648 ARG ARG A . n 
A 1 605 PRO 605 649 649 PRO PRO A . n 
A 1 606 GLU 606 650 650 GLU GLU A . n 
A 1 607 ASN 607 651 651 ASN ASN A . n 
A 1 608 ASP 608 652 652 ASP ASP A . n 
A 1 609 SER 609 653 653 SER SER A . n 
A 1 610 LYS 610 654 654 LYS LYS A . n 
A 1 611 CYS 611 655 655 CYS CYS A . n 
A 1 612 VAL 612 656 656 VAL VAL A . n 
A 1 613 GLU 613 657 657 GLU GLU A . n 
A 1 614 GLN 614 658 658 GLN GLN A . n 
A 1 615 PRO 615 659 659 PRO PRO A . n 
A 1 616 GLU 616 660 660 GLU GLU A . n 
A 1 617 LEU 617 661 661 LEU LEU A . n 
A 1 618 LYS 618 662 662 LYS LYS A . n 
A 1 619 GLY 619 663 663 GLY GLY A . n 
A 1 620 HIS 620 664 664 HIS HIS A . n 
A 1 621 ASP 621 665 665 ASP ASP A . n 
A 1 622 LEU 622 666 666 LEU LEU A . n 
A 1 623 GLU 623 667 667 GLU GLU A . n 
A 1 624 PHE 624 668 668 PHE PHE A . n 
A 1 625 CYS 625 669 669 CYS CYS A . n 
A 1 626 LEU 626 670 670 LEU LEU A . n 
A 1 627 TYR 627 671 671 TYR TYR A . n 
A 1 628 GLY 628 672 672 GLY GLY A . n 
A 1 629 ARG 629 673 673 ARG ARG A . n 
A 1 630 GLU 630 674 674 GLU GLU A . n 
A 1 631 GLU 631 675 675 GLU GLU A . n 
A 1 632 HIS 632 676 676 HIS HIS A . n 
A 1 633 LEU 633 677 677 LEU LEU A . n 
A 1 634 THR 634 678 678 THR THR A . n 
A 1 635 THR 635 679 679 THR THR A . n 
A 1 636 ASN 636 680 680 ASN ASN A . n 
A 1 637 GLY 637 681 681 GLY GLY A . n 
A 1 638 TYR 638 682 682 TYR TYR A . n 
A 1 639 ARG 639 683 683 ARG ARG A . n 
A 1 640 LYS 640 684 684 LYS LYS A . n 
A 1 641 ILE 641 685 685 ILE ILE A . n 
A 1 642 PRO 642 686 686 PRO PRO A . n 
A 1 643 GLY 643 687 687 GLY GLY A . n 
A 1 644 ASP 644 688 688 ASP ASP A . n 
A 1 645 LYS 645 689 689 LYS LYS A . n 
A 1 646 CYS 646 690 690 CYS CYS A . n 
A 1 647 GLN 647 691 691 GLN GLN A . n 
A 1 648 GLY 648 692 692 GLY GLY A . n 
A 1 649 GLY 649 693 693 GLY GLY A . n 
A 1 650 VAL 650 694 694 VAL VAL A . n 
A 1 651 ASN 651 695 695 ASN ASN A . n 
A 1 652 PRO 652 696 696 PRO PRO A . n 
A 1 653 VAL 653 697 697 VAL VAL A . n 
A 1 654 ARG 654 698 698 ARG ARG A . n 
A 1 655 GLU 655 699 699 GLU GLU A . n 
A 1 656 VAL 656 700 700 VAL VAL A . n 
A 1 657 LYS 657 701 701 LYS LYS A . n 
A 1 658 ASP 658 702 702 ASP ASP A . n 
A 1 659 LEU 659 703 703 LEU LEU A . n 
A 1 660 LYS 660 704 704 LYS LYS A . n 
A 1 661 LYS 661 705 705 LYS LYS A . n 
A 1 662 LYS 662 706 706 LYS LYS A . n 
A 1 663 CYS 663 707 707 CYS CYS A . n 
A 1 664 THR 664 708 708 THR THR A . n 
A 1 665 SER 665 709 709 SER SER A . n 
A 1 666 ASN 666 710 710 ASN ASN A . n 
A 1 667 PHE 667 711 711 PHE PHE A . n 
A 1 668 LEU 668 712 712 LEU LEU A . n 
A 1 669 SER 669 713 713 SER SER A . n 
A 1 670 PRO 670 714 714 PRO PRO A . n 
A 1 671 GLU 671 715 715 GLU GLU A . n 
A 1 672 LYS 672 716 ?   ?   ?   A . n 
A 1 673 GLN 673 717 ?   ?   ?   A . n 
A 1 674 ASN 674 718 ?   ?   ?   A . n 
A 1 675 SER 675 719 ?   ?   ?   A . n 
A 1 676 LYS 676 720 ?   ?   ?   A . n 
A 1 677 SER 677 721 ?   ?   ?   A . n 
A 1 678 ASN 678 722 ?   ?   ?   A . n 
A 1 679 SER 679 723 ?   ?   ?   A . n 
A 1 680 GLY 680 724 ?   ?   ?   A . n 
A 1 681 SER 681 725 ?   ?   ?   A . n 
A 1 682 ALA 682 726 ?   ?   ?   A . n 
A 1 683 MET 683 727 ?   ?   ?   A . n 
A 1 684 ILE 684 728 ?   ?   ?   A . n 
A 1 685 GLU 685 729 ?   ?   ?   A . n 
A 1 686 GLY 686 730 ?   ?   ?   A . n 
A 1 687 ARG 687 731 ?   ?   ?   A . n 
A 1 688 GLY 688 732 ?   ?   ?   A . n 
A 1 689 VAL 689 733 ?   ?   ?   A . n 
A 1 690 GLY 690 734 ?   ?   ?   A . n 
A 1 691 HIS 691 735 ?   ?   ?   A . n 
A 1 692 HIS 692 736 ?   ?   ?   A . n 
A 1 693 HIS 693 737 ?   ?   ?   A . n 
A 1 694 HIS 694 738 ?   ?   ?   A . n 
A 1 695 HIS 695 739 ?   ?   ?   A . n 
A 1 696 HIS 696 740 ?   ?   ?   A . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 329 A ASN 373 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 505 A ASN 549 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-02-12 
2 'Structure model' 1 1 2014-09-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -17.6457 37.1772 38.3912  0.7747 0.9453 0.5973 -0.2999 -0.1013 -0.0656 3.7044 7.4440 3.9172 
-3.3711 0.3059  -1.2931 -0.0078 -1.0694 0.1679  0.7667  0.3401  -0.3490 -0.5220 0.2646  -0.2868 
'X-RAY DIFFRACTION' 2 ? refined -26.3320 24.5167 15.7043  0.3155 0.5646 0.4337 -0.0753 0.0512  -0.0154 3.3435 4.2535 4.5667 
-0.0046 -0.9034 0.0808  0.2604  0.0700  -0.2043 0.3136  -0.3873 0.2895  -0.1241 -0.6287 0.1335  
'X-RAY DIFFRACTION' 3 ? refined -10.3784 16.9098 16.9985  0.3625 0.6087 0.7506 -0.0860 -0.0793 0.1184  3.4941 3.0636 7.3434 
-0.3457 -1.3560 0.1421  0.0431  -0.3355 -0.2263 0.4278  -0.2758 -0.4771 0.5180  0.6938  0.1522  
'X-RAY DIFFRACTION' 4 ? refined -24.8097 40.0660 -10.9787 0.8557 1.4456 1.0346 0.4236  0.2246  0.2412  5.5092 4.2225 1.7389 
-5.0914 3.4183  -3.0124 0.9641  1.6933  0.4478  -0.8105 -1.2311 -0.6285 -0.2026 0.3388  0.3068  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 53:238)'  
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 239:534)' 
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 535:652)' 
'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 653:715)' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DNA    'data collection' .                             ? 1 
PHASER phasing           .                             ? 2 
PHENIX refinement        '(phenix.refine: 1.8.2_1309)' ? 3 
XDS    'data reduction'  .                             ? 4 
SCALA  'data scaling'    .                             ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 73  ? ? 45.90   -125.34 
2 1 TYR A 117 ? ? 70.81   34.18   
3 1 GLU A 144 ? ? 56.33   -134.61 
4 1 PHE A 170 ? ? 70.95   34.70   
5 1 ALA A 240 ? ? -126.61 -70.63  
6 1 ASP A 389 ? ? -68.70  3.58    
7 1 GLN A 400 ? ? 81.14   38.80   
8 1 THR A 592 ? ? -125.79 -63.12  
9 1 GLU A 650 ? ? 69.66   -161.49 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 45  ? A SER 1   
2  1 Y 1 A ALA 46  ? A ALA 2   
3  1 Y 1 A PRO 47  ? A PRO 3   
4  1 Y 1 A GLY 48  ? A GLY 4   
5  1 Y 1 A GLU 49  ? A GLU 5   
6  1 Y 1 A ASP 50  ? A ASP 6   
7  1 Y 1 A GLU 51  ? A GLU 7   
8  1 Y 1 A GLU 52  ? A GLU 8   
9  1 Y 1 A PRO 100 ? A PRO 56  
10 1 Y 1 A LEU 101 ? A LEU 57  
11 1 Y 1 A VAL 102 ? A VAL 58  
12 1 Y 1 A ILE 103 ? A ILE 59  
13 1 Y 1 A MET 104 ? A MET 60  
14 1 Y 1 A THR 105 ? A THR 61  
15 1 Y 1 A PHE 106 ? A PHE 62  
16 1 Y 1 A PHE 559 ? A PHE 515 
17 1 Y 1 A LEU 560 ? A LEU 516 
18 1 Y 1 A LYS 716 ? A LYS 672 
19 1 Y 1 A GLN 717 ? A GLN 673 
20 1 Y 1 A ASN 718 ? A ASN 674 
21 1 Y 1 A SER 719 ? A SER 675 
22 1 Y 1 A LYS 720 ? A LYS 676 
23 1 Y 1 A SER 721 ? A SER 677 
24 1 Y 1 A ASN 722 ? A ASN 678 
25 1 Y 1 A SER 723 ? A SER 679 
26 1 Y 1 A GLY 724 ? A GLY 680 
27 1 Y 1 A SER 725 ? A SER 681 
28 1 Y 1 A ALA 726 ? A ALA 682 
29 1 Y 1 A MET 727 ? A MET 683 
30 1 Y 1 A ILE 728 ? A ILE 684 
31 1 Y 1 A GLU 729 ? A GLU 685 
32 1 Y 1 A GLY 730 ? A GLY 686 
33 1 Y 1 A ARG 731 ? A ARG 687 
34 1 Y 1 A GLY 732 ? A GLY 688 
35 1 Y 1 A VAL 733 ? A VAL 689 
36 1 Y 1 A GLY 734 ? A GLY 690 
37 1 Y 1 A HIS 735 ? A HIS 691 
38 1 Y 1 A HIS 736 ? A HIS 692 
39 1 Y 1 A HIS 737 ? A HIS 693 
40 1 Y 1 A HIS 738 ? A HIS 694 
41 1 Y 1 A HIS 739 ? A HIS 695 
42 1 Y 1 A HIS 740 ? A HIS 696 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 N-ACETYL-D-GLUCOSAMINE                                           NAG 
3 BETA-D-MANNOSE                                                   BMA 
4 ALPHA-D-MANNOSE                                                  MAN 
5 'TETRAETHYLENE GLYCOL'                                           PG4 
6 'N-[(7-hydroxy-4-methyl-2-oxo-2H-chromen-8-yl)methyl]-L-leucine' 2ET 
7 water                                                            HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NAG 1  801 800  NAG NAG A . 
C 2 NAG 2  802 801  NAG NAG A . 
D 3 BMA 3  803 802  BMA BMA A . 
E 4 MAN 4  804 803  MAN MAN A . 
F 2 NAG 1  805 804  NAG NAG A . 
G 2 NAG 2  806 805  NAG NAG A . 
H 3 BMA 3  807 806  BMA BMA A . 
I 5 PG4 1  808 807  PG4 PG4 A . 
J 6 2ET 1  809 900  2ET LIG A . 
K 7 HOH 1  901 1000 HOH HOH A . 
K 7 HOH 2  902 1001 HOH HOH A . 
K 7 HOH 3  903 1002 HOH HOH A . 
K 7 HOH 4  904 1003 HOH HOH A . 
K 7 HOH 5  905 1004 HOH HOH A . 
K 7 HOH 6  906 1005 HOH HOH A . 
K 7 HOH 7  907 1006 HOH HOH A . 
K 7 HOH 8  908 1007 HOH HOH A . 
K 7 HOH 9  909 1008 HOH HOH A . 
K 7 HOH 10 910 1009 HOH HOH A . 
K 7 HOH 11 911 1010 HOH HOH A . 
K 7 HOH 12 912 1011 HOH HOH A . 
K 7 HOH 13 913 1012 HOH HOH A . 
K 7 HOH 14 914 1013 HOH HOH A . 
K 7 HOH 15 915 1014 HOH HOH A . 
K 7 HOH 16 916 1015 HOH HOH A . 
K 7 HOH 17 917 1016 HOH HOH A . 
K 7 HOH 18 918 1017 HOH HOH A . 
K 7 HOH 19 919 1018 HOH HOH A . 
K 7 HOH 20 920 1019 HOH HOH A . 
K 7 HOH 21 921 1020 HOH HOH A . 
K 7 HOH 22 922 1021 HOH HOH A . 
K 7 HOH 23 923 1022 HOH HOH A . 
K 7 HOH 24 924 1023 HOH HOH A . 
K 7 HOH 25 925 1024 HOH HOH A . 
K 7 HOH 26 926 1025 HOH HOH A . 
K 7 HOH 27 927 1026 HOH HOH A . 
K 7 HOH 28 928 1027 HOH HOH A . 
K 7 HOH 29 929 1028 HOH HOH A . 
K 7 HOH 30 930 1029 HOH HOH A . 
K 7 HOH 31 931 1030 HOH HOH A . 
K 7 HOH 32 932 1031 HOH HOH A . 
K 7 HOH 33 933 1032 HOH HOH A . 
K 7 HOH 34 934 1033 HOH HOH A . 
K 7 HOH 35 935 1034 HOH HOH A . 
K 7 HOH 36 936 1035 HOH HOH A . 
K 7 HOH 37 937 1037 HOH HOH A . 
K 7 HOH 38 938 1038 HOH HOH A . 
K 7 HOH 39 939 1039 HOH HOH A . 
K 7 HOH 40 940 1040 HOH HOH A . 
K 7 HOH 41 941 1041 HOH HOH A . 
K 7 HOH 42 942 1042 HOH HOH A . 
K 7 HOH 43 943 1043 HOH HOH A . 
K 7 HOH 44 944 1044 HOH HOH A . 
K 7 HOH 45 945 1045 HOH HOH A . 
K 7 HOH 46 946 1046 HOH HOH A . 
K 7 HOH 47 947 1047 HOH HOH A . 
K 7 HOH 48 948 1048 HOH HOH A . 
K 7 HOH 49 949 1050 HOH HOH A . 
K 7 HOH 50 950 1051 HOH HOH A . 
K 7 HOH 51 951 1052 HOH HOH A . 
K 7 HOH 52 952 1053 HOH HOH A . 
K 7 HOH 53 953 1054 HOH HOH A . 
K 7 HOH 54 954 1055 HOH HOH A . 
K 7 HOH 55 955 1056 HOH HOH A . 
K 7 HOH 56 956 1057 HOH HOH A . 
K 7 HOH 57 957 1058 HOH HOH A . 
K 7 HOH 58 958 1059 HOH HOH A . 
K 7 HOH 59 959 1060 HOH HOH A . 
K 7 HOH 60 960 1061 HOH HOH A . 
K 7 HOH 61 961 1062 HOH HOH A . 
K 7 HOH 62 962 1063 HOH HOH A . 
K 7 HOH 63 963 1064 HOH HOH A . 
K 7 HOH 64 964 1066 HOH HOH A . 
K 7 HOH 65 965 1067 HOH HOH A . 
K 7 HOH 66 966 1068 HOH HOH A . 
K 7 HOH 67 967 1069 HOH HOH A . 
#