data_4MT5
# 
_entry.id   4MT5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.284 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4MT5         
RCSB  RCSB082332   
WWPDB D_1000082332 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3I57 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        4MT5 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-09-19 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Etzold, S.'     1 
'Juge, N.'       2 
'Hemmings, A.M.' 3 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for adaptation of lactobacilli to gastrointestinal mucus.' 
_citation.journal_abbrev            ENVIRON.MICROBIOL. 
_citation.journal_volume            16 
_citation.page_first                888 
_citation.page_last                 903 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           1462-2912 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24373178 
_citation.pdbx_database_id_DOI      10.1111/1462-2920.12377 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Etzold, S.'      1 
primary 'Kober, O.I.'     2 
primary 'Mackenzie, D.A.' 3 
primary 'Tailford, L.E.'  4 
primary 'Gunning, A.P.'   5 
primary 'Walshaw, J.'     6 
primary 'Hemmings, A.M.'  7 
primary 'Juge, N.'        8 
# 
_cell.length_a           31.400 
_cell.length_b           271.730 
_cell.length_c           142.890 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           4MT5 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              16 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.entry_id                         4MT5 
_symmetry.Int_Tables_number                20 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Mucus binding proteinn' 20312.033 2   ? ? 'Mub repeat V (UNP residues 1612-1794' ? 
2 water   nat water                    18.015    146 ? ? ?                                      ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MQTAYVKYVDDTTGETLRQDDLHGYTDETIPYSTAEGIKKYEGDGYVLVSDGFKPGTKFGVGTPTYEVHFKHGMTHTDAT
DKNAEQKTVTETIHYVDENNQTVQPDSTTAVTFKRGYTTDNVTGKVVSYDPWTVDGNQADSKTFAAVPSPAVEGYTPNHQ
QINEFTVTPDSKDIVKTVVYVGDP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MQTAYVKYVDDTTGETLRQDDLHGYTDETIPYSTAEGIKKYEGDGYVLVSDGFKPGTKFGVGTPTYEVHFKHGMTHTDAT
DKNAEQKTVTETIHYVDENNQTVQPDSTTAVTFKRGYTTDNVTGKVVSYDPWTVDGNQADSKTFAAVPSPAVEGYTPNHQ
QINEFTVTPDSKDIVKTVVYVGDP
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLN n 
1 3   THR n 
1 4   ALA n 
1 5   TYR n 
1 6   VAL n 
1 7   LYS n 
1 8   TYR n 
1 9   VAL n 
1 10  ASP n 
1 11  ASP n 
1 12  THR n 
1 13  THR n 
1 14  GLY n 
1 15  GLU n 
1 16  THR n 
1 17  LEU n 
1 18  ARG n 
1 19  GLN n 
1 20  ASP n 
1 21  ASP n 
1 22  LEU n 
1 23  HIS n 
1 24  GLY n 
1 25  TYR n 
1 26  THR n 
1 27  ASP n 
1 28  GLU n 
1 29  THR n 
1 30  ILE n 
1 31  PRO n 
1 32  TYR n 
1 33  SER n 
1 34  THR n 
1 35  ALA n 
1 36  GLU n 
1 37  GLY n 
1 38  ILE n 
1 39  LYS n 
1 40  LYS n 
1 41  TYR n 
1 42  GLU n 
1 43  GLY n 
1 44  ASP n 
1 45  GLY n 
1 46  TYR n 
1 47  VAL n 
1 48  LEU n 
1 49  VAL n 
1 50  SER n 
1 51  ASP n 
1 52  GLY n 
1 53  PHE n 
1 54  LYS n 
1 55  PRO n 
1 56  GLY n 
1 57  THR n 
1 58  LYS n 
1 59  PHE n 
1 60  GLY n 
1 61  VAL n 
1 62  GLY n 
1 63  THR n 
1 64  PRO n 
1 65  THR n 
1 66  TYR n 
1 67  GLU n 
1 68  VAL n 
1 69  HIS n 
1 70  PHE n 
1 71  LYS n 
1 72  HIS n 
1 73  GLY n 
1 74  MET n 
1 75  THR n 
1 76  HIS n 
1 77  THR n 
1 78  ASP n 
1 79  ALA n 
1 80  THR n 
1 81  ASP n 
1 82  LYS n 
1 83  ASN n 
1 84  ALA n 
1 85  GLU n 
1 86  GLN n 
1 87  LYS n 
1 88  THR n 
1 89  VAL n 
1 90  THR n 
1 91  GLU n 
1 92  THR n 
1 93  ILE n 
1 94  HIS n 
1 95  TYR n 
1 96  VAL n 
1 97  ASP n 
1 98  GLU n 
1 99  ASN n 
1 100 ASN n 
1 101 GLN n 
1 102 THR n 
1 103 VAL n 
1 104 GLN n 
1 105 PRO n 
1 106 ASP n 
1 107 SER n 
1 108 THR n 
1 109 THR n 
1 110 ALA n 
1 111 VAL n 
1 112 THR n 
1 113 PHE n 
1 114 LYS n 
1 115 ARG n 
1 116 GLY n 
1 117 TYR n 
1 118 THR n 
1 119 THR n 
1 120 ASP n 
1 121 ASN n 
1 122 VAL n 
1 123 THR n 
1 124 GLY n 
1 125 LYS n 
1 126 VAL n 
1 127 VAL n 
1 128 SER n 
1 129 TYR n 
1 130 ASP n 
1 131 PRO n 
1 132 TRP n 
1 133 THR n 
1 134 VAL n 
1 135 ASP n 
1 136 GLY n 
1 137 ASN n 
1 138 GLN n 
1 139 ALA n 
1 140 ASP n 
1 141 SER n 
1 142 LYS n 
1 143 THR n 
1 144 PHE n 
1 145 ALA n 
1 146 ALA n 
1 147 VAL n 
1 148 PRO n 
1 149 SER n 
1 150 PRO n 
1 151 ALA n 
1 152 VAL n 
1 153 GLU n 
1 154 GLY n 
1 155 TYR n 
1 156 THR n 
1 157 PRO n 
1 158 ASN n 
1 159 HIS n 
1 160 GLN n 
1 161 GLN n 
1 162 ILE n 
1 163 ASN n 
1 164 GLU n 
1 165 PHE n 
1 166 THR n 
1 167 VAL n 
1 168 THR n 
1 169 PRO n 
1 170 ASP n 
1 171 SER n 
1 172 LYS n 
1 173 ASP n 
1 174 ILE n 
1 175 VAL n 
1 176 LYS n 
1 177 THR n 
1 178 VAL n 
1 179 VAL n 
1 180 TYR n 
1 181 VAL n 
1 182 GLY n 
1 183 ASP n 
1 184 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 mub 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'ATCC 53608' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Lactobacillus reuteri' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     927703 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Tuner(DE3)pLacI2' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pETBlue-1 AccepTor' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    F8KCE4_LACRE 
_struct_ref.pdbx_db_accession          F8KCE4 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;QTAYVKYVDDTTGETLRQDDLHGYTDETIPYSTAEGIKKYEGDGYVLVSDGFKPGTKFGVGTPTYEVHFKHGMTHTDATD
KNAEQKTVTETIHYVDENNQTVQPDSTTAVTFKRGYTTDNVTGKVVSYDPWTVDGNQADSKTFAAVPSPAVEGYTPNHQQ
INEFTVTPDSKDIVKTVVYVGDP
;
_struct_ref.pdbx_align_begin           1612 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4MT5 A 2 ? 184 ? F8KCE4 1612 ? 1794 ? 1 183 
2 1 4MT5 B 2 ? 184 ? F8KCE4 1612 ? 1794 ? 1 183 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4MT5 MET A 1 ? UNP F8KCE4 ? ? 'INITIATING METHIONINE' 0 1 
2 4MT5 MET B 1 ? UNP F8KCE4 ? ? 'INITIATING METHIONINE' 0 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4MT5 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.75 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   67.21 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.pdbx_details    '0.2 M ammonium acetate, 24 % (w/v) PEG 3350, VAPOR DIFFUSION, SITTING DROP, temperature 289K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'Pilatus 6M-F' 
_diffrn_detector.pdbx_collection_date   2012-05-27 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Double crystal monochromator' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9205 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.pdbx_wavelength_list        0.9205 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I04 
# 
_reflns.entry_id                     4MT5 
_reflns.d_resolution_high            2.600 
_reflns.d_resolution_low             49.230 
_reflns.number_all                   19616 
_reflns.number_obs                   19616 
_reflns.pdbx_netI_over_sigmaI        16.600 
_reflns.pdbx_Rsym_value              0.080 
_reflns.pdbx_redundancy              6.100 
_reflns.percent_possible_obs         99.800 
_reflns.B_iso_Wilson_estimate        36.120 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.600  2.670  ? 8694 ? 0.360 2.000  0.360 ? 6.200 ? 1413 99.900  1  1 
2.670  2.740  ? 8530 ? 0.307 2.400  0.307 ? 6.300 ? 1352 99.700  2  1 
2.740  2.820  ? 8782 ? 0.265 2.700  0.265 ? 6.300 ? 1392 99.900  3  1 
2.820  2.910  ? 8114 ? 0.204 3.600  0.204 ? 6.300 ? 1296 100.000 4  1 
2.910  3.000  ? 7791 ? 0.165 4.400  0.165 ? 6.200 ? 1250 99.900  5  1 
3.000  3.110  ? 7874 ? 0.141 5.100  0.141 ? 6.200 ? 1268 99.700  6  1 
3.110  3.220  ? 7290 ? 0.117 6.200  0.117 ? 6.200 ? 1173 100.000 7  1 
3.220  3.360  ? 7018 ? 0.091 7.900  0.091 ? 6.200 ? 1138 99.700  8  1 
3.360  3.510  ? 6861 ? 0.080 9.000  0.080 ? 6.100 ? 1132 99.900  9  1 
3.510  3.680  ? 6341 ? 0.079 9.100  0.079 ? 6.100 ? 1040 99.900  10 1 
3.680  3.880  ? 6210 ? 0.067 10.400 0.067 ? 6.000 ? 1036 99.900  11 1 
3.880  4.110  ? 5617 ? 0.059 11.400 0.059 ? 5.900 ? 946  100.000 12 1 
4.110  4.390  ? 5485 ? 0.054 12.100 0.054 ? 5.900 ? 922  100.000 13 1 
4.390  4.750  ? 4971 ? 0.049 12.600 0.049 ? 5.900 ? 836  99.900  14 1 
4.750  5.200  ? 4721 ? 0.048 13.600 0.048 ? 5.800 ? 809  100.000 15 1 
5.200  5.810  ? 4072 ? 0.050 12.100 0.050 ? 5.800 ? 702  99.800  16 1 
5.810  6.710  ? 3714 ? 0.047 14.000 0.047 ? 5.800 ? 638  100.000 17 1 
6.710  8.220  ? 3215 ? 0.045 14.600 0.045 ? 5.600 ? 570  99.800  18 1 
8.220  11.630 ? 2290 ? 0.036 16.700 0.036 ? 5.200 ? 437  99.500  19 1 
11.630 49.230 ? 1163 ? 0.032 18.900 0.032 ? 4.400 ? 266  95.400  20 1 
# 
_refine.entry_id                                 4MT5 
_refine.ls_d_res_high                            2.6000 
_refine.ls_d_res_low                             49.2300 
_refine.pdbx_ls_sigma_F                          1.350 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.8300 
_refine.ls_number_reflns_obs                     19614 
_refine.ls_number_reflns_all                     19614 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2137 
_refine.ls_R_factor_R_work                       0.2107 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2688 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.1800 
_refine.ls_number_reflns_R_free                  1016 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               41.8429 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.3300 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.0000 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.7000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       LS_WUNIT_K1 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.7806 
_refine.B_iso_max                                96.040 
_refine.B_iso_min                                10.730 
_refine.pdbx_overall_phase_error                 27.7000 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2864 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             146 
_refine_hist.number_atoms_total               3010 
_refine_hist.d_res_high                       2.6000 
_refine_hist.d_res_low                        49.2300 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           2934 0.008  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          4012 1.083  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     454  0.074  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      526  0.005  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 1040 14.287 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
2.6001 2.7371  7 100.0000 2572 . 0.3190 0.3525 . 131 . 2703 . . 'X-RAY DIFFRACTION' 
2.7371 2.9086  7 100.0000 2604 . 0.2930 0.3126 . 170 . 2774 . . 'X-RAY DIFFRACTION' 
2.9086 3.1331  7 100.0000 2637 . 0.2552 0.3189 . 146 . 2783 . . 'X-RAY DIFFRACTION' 
3.1331 3.4484  7 100.0000 2594 . 0.2243 0.2697 . 141 . 2735 . . 'X-RAY DIFFRACTION' 
3.4484 3.9472  7 100.0000 2672 . 0.1989 0.2999 . 138 . 2810 . . 'X-RAY DIFFRACTION' 
3.9472 4.9723  7 100.0000 2661 . 0.1628 0.2103 . 148 . 2809 . . 'X-RAY DIFFRACTION' 
4.9723 49.2393 7 100.0000 2858 . 0.1806 0.2355 . 142 . 3000 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4MT5 
_struct.title                     'Crystal structure of Mub-RV' 
_struct.pdbx_descriptor           'Mucus binding proteinn' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4MT5 
_struct_keywords.text            'ubiquitin-like beta-grasp fold, mucin binding, cell-surface, PROTEIN BINDING' 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 34 ? GLY A 43 ? THR A 33 GLY A 42 1 ? 10 
HELX_P HELX_P2 2 THR B 34 ? GLY B 43 ? THR B 33 GLY B 42 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
C ? 6 ? 
D ? 2 ? 
E ? 2 ? 
F ? 4 ? 
G ? 3 ? 
H ? 5 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? parallel      
C 5 6 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? parallel      
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? parallel      
H 4 5 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 16  ? GLY A 24  ? THR A 15  GLY A 23  
A 2 GLN A 2   ? ASP A 10  ? GLN A 1   ASP A 9   
A 3 THR A 65  ? HIS A 72  ? THR A 64  HIS A 71  
A 4 TYR A 46  ? ASP A 51  ? TYR A 45  ASP A 50  
B 1 MET A 74  ? THR A 77  ? MET A 73  THR A 76  
B 2 TYR A 117 ? ASP A 120 ? TYR A 116 ASP A 119 
B 3 VAL A 126 ? TYR A 129 ? VAL A 125 TYR A 128 
C 1 ASN A 137 ? GLN A 138 ? ASN A 136 GLN A 137 
C 2 THR A 133 ? VAL A 134 ? THR A 132 VAL A 133 
C 3 GLN A 104 ? ARG A 115 ? GLN A 103 ARG A 114 
C 4 GLU A 85  ? VAL A 96  ? GLU A 84  VAL A 95  
C 5 ILE A 174 ? GLY A 182 ? ILE A 173 GLY A 181 
C 6 TYR A 155 ? PRO A 157 ? TYR A 154 PRO A 156 
D 1 LYS A 142 ? PHE A 144 ? LYS A 141 PHE A 143 
D 2 PHE A 165 ? VAL A 167 ? PHE A 164 VAL A 166 
E 1 VAL A 147 ? PRO A 148 ? VAL A 146 PRO A 147 
E 2 GLN A 161 ? ILE A 162 ? GLN A 160 ILE A 161 
F 1 THR B 16  ? GLY B 24  ? THR B 15  GLY B 23  
F 2 GLN B 2   ? ASP B 10  ? GLN B 1   ASP B 9   
F 3 THR B 65  ? HIS B 72  ? THR B 64  HIS B 71  
F 4 TYR B 46  ? ASP B 51  ? TYR B 45  ASP B 50  
G 1 MET B 74  ? THR B 77  ? MET B 73  THR B 76  
G 2 TYR B 117 ? ASP B 120 ? TYR B 116 ASP B 119 
G 3 VAL B 126 ? TYR B 129 ? VAL B 125 TYR B 128 
H 1 THR B 133 ? VAL B 134 ? THR B 132 VAL B 133 
H 2 THR B 102 ? ARG B 115 ? THR B 101 ARG B 114 
H 3 GLU B 85  ? ASP B 97  ? GLU B 84  ASP B 96  
H 4 ILE B 174 ? GLY B 182 ? ILE B 173 GLY B 181 
H 5 TYR B 155 ? PRO B 157 ? TYR B 154 PRO B 156 
I 1 LYS B 142 ? PHE B 144 ? LYS B 141 PHE B 143 
I 2 PHE B 165 ? VAL B 167 ? PHE B 164 VAL B 166 
J 1 VAL B 147 ? PRO B 148 ? VAL B 146 PRO B 147 
J 2 GLN B 161 ? ILE B 162 ? GLN B 160 ILE B 161 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ARG A 18  ? O ARG A 17  N TYR A 8   ? N TYR A 7   
A 2 3 N LYS A 7   ? N LYS A 6   O TYR A 66  ? O TYR A 65  
A 3 4 O LYS A 71  ? O LYS A 70  N VAL A 47  ? N VAL A 46  
B 1 2 N THR A 77  ? N THR A 76  O TYR A 117 ? O TYR A 116 
B 2 3 N THR A 118 ? N THR A 117 O SER A 128 ? O SER A 127 
C 1 2 O ASN A 137 ? O ASN A 136 N VAL A 134 ? N VAL A 133 
C 2 3 O THR A 133 ? O THR A 132 N LYS A 114 ? N LYS A 113 
C 3 4 O PHE A 113 ? O PHE A 112 N LYS A 87  ? N LYS A 86  
C 4 5 N HIS A 94  ? N HIS A 93  O VAL A 178 ? O VAL A 177 
C 5 6 O VAL A 181 ? O VAL A 180 N THR A 156 ? N THR A 155 
D 1 2 N PHE A 144 ? N PHE A 143 O PHE A 165 ? O PHE A 164 
E 1 2 N VAL A 147 ? N VAL A 146 O ILE A 162 ? O ILE A 161 
F 1 2 O LEU B 17  ? O LEU B 16  N TYR B 8   ? N TYR B 7   
F 2 3 N LYS B 7   ? N LYS B 6   O VAL B 68  ? O VAL B 67  
F 3 4 O LYS B 71  ? O LYS B 70  N VAL B 47  ? N VAL B 46  
G 1 2 N THR B 77  ? N THR B 76  O TYR B 117 ? O TYR B 116 
G 2 3 N THR B 118 ? N THR B 117 O SER B 128 ? O SER B 127 
H 1 2 O THR B 133 ? O THR B 132 N LYS B 114 ? N LYS B 113 
H 2 3 O VAL B 111 ? O VAL B 110 N VAL B 89  ? N VAL B 88  
H 3 4 N HIS B 94  ? N HIS B 93  O VAL B 178 ? O VAL B 177 
H 4 5 O VAL B 181 ? O VAL B 180 N THR B 156 ? N THR B 155 
I 1 2 N LYS B 142 ? N LYS B 141 O VAL B 167 ? O VAL B 166 
J 1 2 N VAL B 147 ? N VAL B 146 O ILE B 162 ? O ILE B 161 
# 
_atom_sites.entry_id                    4MT5 
_atom_sites.fract_transf_matrix[1][1]   0.031847 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003680 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006998 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 1   ? 43.458  19.075  -28.313 1.00 35.80 ? 0   MET A N   1 
ATOM   2    C CA  . MET A 1 1   ? 42.331  19.649  -27.577 1.00 37.27 ? 0   MET A CA  1 
ATOM   3    C C   . MET A 1 1   ? 41.660  20.752  -28.393 1.00 32.73 ? 0   MET A C   1 
ATOM   4    O O   . MET A 1 1   ? 42.270  21.763  -28.708 1.00 33.26 ? 0   MET A O   1 
ATOM   5    C CB  . MET A 1 1   ? 42.766  20.195  -26.214 1.00 38.28 ? 0   MET A CB  1 
ATOM   6    C CG  . MET A 1 1   ? 41.588  20.647  -25.335 1.00 40.60 ? 0   MET A CG  1 
ATOM   7    S SD  . MET A 1 1   ? 41.256  19.565  -23.912 1.00 55.81 ? 0   MET A SD  1 
ATOM   8    C CE  . MET A 1 1   ? 42.244  20.372  -22.637 1.00 46.44 ? 0   MET A CE  1 
ATOM   9    N N   . GLN A 1 2   ? 40.399  20.543  -28.732 1.00 31.12 ? 1   GLN A N   1 
ATOM   10   C CA  . GLN A 1 2   ? 39.702  21.450  -29.612 1.00 30.46 ? 1   GLN A CA  1 
ATOM   11   C C   . GLN A 1 2   ? 39.106  22.620  -28.851 1.00 31.73 ? 1   GLN A C   1 
ATOM   12   O O   . GLN A 1 2   ? 39.081  22.639  -27.620 1.00 30.65 ? 1   GLN A O   1 
ATOM   13   C CB  . GLN A 1 2   ? 38.615  20.700  -30.360 1.00 29.72 ? 1   GLN A CB  1 
ATOM   14   C CG  . GLN A 1 2   ? 39.107  19.402  -30.925 1.00 28.80 ? 1   GLN A CG  1 
ATOM   15   C CD  . GLN A 1 2   ? 40.340  19.597  -31.770 1.00 34.53 ? 1   GLN A CD  1 
ATOM   16   O OE1 . GLN A 1 2   ? 40.358  20.439  -32.678 1.00 35.99 ? 1   GLN A OE1 1 
ATOM   17   N NE2 . GLN A 1 2   ? 41.395  18.834  -31.468 1.00 32.45 ? 1   GLN A NE2 1 
ATOM   18   N N   . THR A 1 3   ? 38.638  23.603  -29.605 1.00 31.10 ? 2   THR A N   1 
ATOM   19   C CA  . THR A 1 3   ? 38.013  24.774  -29.029 1.00 30.63 ? 2   THR A CA  1 
ATOM   20   C C   . THR A 1 3   ? 36.677  24.998  -29.713 1.00 29.60 ? 2   THR A C   1 
ATOM   21   O O   . THR A 1 3   ? 36.524  24.729  -30.903 1.00 31.58 ? 2   THR A O   1 
ATOM   22   C CB  . THR A 1 3   ? 38.921  26.013  -29.162 1.00 29.64 ? 2   THR A CB  1 
ATOM   23   O OG1 . THR A 1 3   ? 39.957  25.937  -28.176 1.00 32.70 ? 2   THR A OG1 1 
ATOM   24   C CG2 . THR A 1 3   ? 38.146  27.288  -28.930 1.00 30.15 ? 2   THR A CG2 1 
ATOM   25   N N   . ALA A 1 4   ? 35.694  25.445  -28.946 1.00 25.59 ? 3   ALA A N   1 
ATOM   26   C CA  . ALA A 1 4   ? 34.442  25.864  -29.534 1.00 25.37 ? 3   ALA A CA  1 
ATOM   27   C C   . ALA A 1 4   ? 33.993  27.123  -28.813 1.00 23.72 ? 3   ALA A C   1 
ATOM   28   O O   . ALA A 1 4   ? 34.125  27.219  -27.593 1.00 22.98 ? 3   ALA A O   1 
ATOM   29   C CB  . ALA A 1 4   ? 33.410  24.761  -29.418 1.00 22.40 ? 3   ALA A CB  1 
ATOM   30   N N   . TYR A 1 5   ? 33.491  28.095  -29.570 1.00 21.84 ? 4   TYR A N   1 
ATOM   31   C CA  . TYR A 1 5   ? 33.089  29.380  -29.002 1.00 22.56 ? 4   TYR A CA  1 
ATOM   32   C C   . TYR A 1 5   ? 31.573  29.524  -29.055 1.00 22.21 ? 4   TYR A C   1 
ATOM   33   O O   . TYR A 1 5   ? 30.943  29.163  -30.048 1.00 23.86 ? 4   TYR A O   1 
ATOM   34   C CB  . TYR A 1 5   ? 33.719  30.555  -29.768 1.00 23.09 ? 4   TYR A CB  1 
ATOM   35   C CG  . TYR A 1 5   ? 35.216  30.705  -29.646 1.00 24.96 ? 4   TYR A CG  1 
ATOM   36   C CD1 . TYR A 1 5   ? 35.815  30.982  -28.419 1.00 28.18 ? 4   TYR A CD1 1 
ATOM   37   C CD2 . TYR A 1 5   ? 36.033  30.603  -30.763 1.00 26.02 ? 4   TYR A CD2 1 
ATOM   38   C CE1 . TYR A 1 5   ? 37.200  31.133  -28.307 1.00 27.25 ? 4   TYR A CE1 1 
ATOM   39   C CE2 . TYR A 1 5   ? 37.411  30.755  -30.661 1.00 27.60 ? 4   TYR A CE2 1 
ATOM   40   C CZ  . TYR A 1 5   ? 37.987  31.020  -29.434 1.00 29.86 ? 4   TYR A CZ  1 
ATOM   41   O OH  . TYR A 1 5   ? 39.355  31.166  -29.348 1.00 33.08 ? 4   TYR A OH  1 
ATOM   42   N N   . VAL A 1 6   ? 30.986  30.061  -27.992 1.00 20.64 ? 5   VAL A N   1 
ATOM   43   C CA  . VAL A 1 6   ? 29.562  30.364  -27.986 1.00 20.65 ? 5   VAL A CA  1 
ATOM   44   C C   . VAL A 1 6   ? 29.436  31.861  -27.711 1.00 21.94 ? 5   VAL A C   1 
ATOM   45   O O   . VAL A 1 6   ? 29.836  32.337  -26.647 1.00 23.69 ? 5   VAL A O   1 
ATOM   46   C CB  . VAL A 1 6   ? 28.821  29.525  -26.925 1.00 22.26 ? 5   VAL A CB  1 
ATOM   47   C CG1 . VAL A 1 6   ? 27.354  29.872  -26.900 1.00 22.41 ? 5   VAL A CG1 1 
ATOM   48   C CG2 . VAL A 1 6   ? 29.004  28.042  -27.203 1.00 18.51 ? 5   VAL A CG2 1 
ATOM   49   N N   . LYS A 1 7   ? 28.931  32.609  -28.689 1.00 21.76 ? 6   LYS A N   1 
ATOM   50   C CA  . LYS A 1 7   ? 29.010  34.075  -28.650 1.00 22.90 ? 6   LYS A CA  1 
ATOM   51   C C   . LYS A 1 7   ? 27.611  34.683  -28.583 1.00 24.05 ? 6   LYS A C   1 
ATOM   52   O O   . LYS A 1 7   ? 26.801  34.498  -29.494 1.00 25.90 ? 6   LYS A O   1 
ATOM   53   C CB  . LYS A 1 7   ? 29.786  34.598  -29.874 1.00 21.56 ? 6   LYS A CB  1 
ATOM   54   C CG  . LYS A 1 7   ? 29.852  36.105  -30.013 1.00 26.10 ? 6   LYS A CG  1 
ATOM   55   C CD  . LYS A 1 7   ? 30.925  36.578  -31.028 1.00 32.44 ? 6   LYS A CD  1 
ATOM   56   C CE  . LYS A 1 7   ? 30.477  36.397  -32.481 1.00 38.16 ? 6   LYS A CE  1 
ATOM   57   N NZ  . LYS A 1 7   ? 31.450  36.947  -33.480 1.00 42.28 ? 6   LYS A NZ  1 
ATOM   58   N N   . TYR A 1 8   ? 27.328  35.388  -27.490 1.00 21.79 ? 7   TYR A N   1 
ATOM   59   C CA  . TYR A 1 8   ? 26.032  36.020  -27.278 1.00 20.31 ? 7   TYR A CA  1 
ATOM   60   C C   . TYR A 1 8   ? 26.109  37.473  -27.706 1.00 21.73 ? 7   TYR A C   1 
ATOM   61   O O   . TYR A 1 8   ? 26.870  38.248  -27.128 1.00 22.42 ? 7   TYR A O   1 
ATOM   62   C CB  . TYR A 1 8   ? 25.641  35.970  -25.800 1.00 21.22 ? 7   TYR A CB  1 
ATOM   63   C CG  . TYR A 1 8   ? 25.510  34.591  -25.206 1.00 22.12 ? 7   TYR A CG  1 
ATOM   64   C CD1 . TYR A 1 8   ? 24.268  33.997  -25.055 1.00 21.54 ? 7   TYR A CD1 1 
ATOM   65   C CD2 . TYR A 1 8   ? 26.637  33.881  -24.786 1.00 23.27 ? 7   TYR A CD2 1 
ATOM   66   C CE1 . TYR A 1 8   ? 24.149  32.715  -24.500 1.00 24.35 ? 7   TYR A CE1 1 
ATOM   67   C CE2 . TYR A 1 8   ? 26.529  32.606  -24.237 1.00 22.39 ? 7   TYR A CE2 1 
ATOM   68   C CZ  . TYR A 1 8   ? 25.282  32.031  -24.095 1.00 22.58 ? 7   TYR A CZ  1 
ATOM   69   O OH  . TYR A 1 8   ? 25.170  30.776  -23.550 1.00 22.32 ? 7   TYR A OH  1 
ATOM   70   N N   . VAL A 1 9   ? 25.293  37.844  -28.690 1.00 23.20 ? 8   VAL A N   1 
ATOM   71   C CA  . VAL A 1 9   ? 25.366  39.157  -29.322 1.00 23.64 ? 8   VAL A CA  1 
ATOM   72   C C   . VAL A 1 9   ? 24.110  40.011  -29.138 1.00 21.95 ? 8   VAL A C   1 
ATOM   73   O O   . VAL A 1 9   ? 23.007  39.575  -29.397 1.00 23.70 ? 8   VAL A O   1 
ATOM   74   C CB  . VAL A 1 9   ? 25.603  38.999  -30.827 1.00 22.55 ? 8   VAL A CB  1 
ATOM   75   C CG1 . VAL A 1 9   ? 25.644  40.331  -31.479 1.00 24.32 ? 8   VAL A CG1 1 
ATOM   76   C CG2 . VAL A 1 9   ? 26.885  38.266  -31.079 1.00 23.36 ? 8   VAL A CG2 1 
ATOM   77   N N   . ASP A 1 10  ? 24.301  41.244  -28.701 1.00 25.98 ? 9   ASP A N   1 
ATOM   78   C CA  . ASP A 1 10  ? 23.244  42.255  -28.680 1.00 27.50 ? 9   ASP A CA  1 
ATOM   79   C C   . ASP A 1 10  ? 23.146  42.959  -30.038 1.00 26.05 ? 9   ASP A C   1 
ATOM   80   O O   . ASP A 1 10  ? 23.947  43.842  -30.344 1.00 25.63 ? 9   ASP A O   1 
ATOM   81   C CB  . ASP A 1 10  ? 23.525  43.273  -27.560 1.00 25.40 ? 9   ASP A CB  1 
ATOM   82   C CG  . ASP A 1 10  ? 22.609  44.480  -27.611 1.00 29.10 ? 9   ASP A CG  1 
ATOM   83   O OD1 . ASP A 1 10  ? 21.564  44.417  -28.300 1.00 29.29 ? 9   ASP A OD1 1 
ATOM   84   O OD2 . ASP A 1 10  ? 22.931  45.496  -26.947 1.00 28.25 ? 9   ASP A OD2 1 
ATOM   85   N N   . ASP A 1 11  ? 22.146  42.578  -30.831 1.00 26.59 ? 10  ASP A N   1 
ATOM   86   C CA  . ASP A 1 11  ? 22.000  43.089  -32.186 1.00 24.61 ? 10  ASP A CA  1 
ATOM   87   C C   . ASP A 1 11  ? 21.721  44.574  -32.181 1.00 27.99 ? 10  ASP A C   1 
ATOM   88   O O   . ASP A 1 11  ? 22.079  45.270  -33.124 1.00 30.68 ? 10  ASP A O   1 
ATOM   89   C CB  . ASP A 1 11  ? 20.912  42.343  -32.970 1.00 25.82 ? 10  ASP A CB  1 
ATOM   90   C CG  . ASP A 1 11  ? 21.319  40.894  -33.332 1.00 34.61 ? 10  ASP A CG  1 
ATOM   91   O OD1 . ASP A 1 11  ? 22.455  40.492  -32.984 1.00 36.22 ? 10  ASP A OD1 1 
ATOM   92   O OD2 . ASP A 1 11  ? 20.517  40.159  -33.976 1.00 29.57 ? 10  ASP A OD2 1 
ATOM   93   N N   . THR A 1 12  ? 21.108  45.070  -31.111 1.00 29.66 ? 11  THR A N   1 
ATOM   94   C CA  . THR A 1 12  ? 20.757  46.496  -31.028 1.00 28.47 ? 11  THR A CA  1 
ATOM   95   C C   . THR A 1 12  ? 21.994  47.409  -31.067 1.00 29.79 ? 11  THR A C   1 
ATOM   96   O O   . THR A 1 12  ? 22.126  48.259  -31.958 1.00 32.26 ? 11  THR A O   1 
ATOM   97   C CB  . THR A 1 12  ? 19.888  46.813  -29.777 1.00 28.91 ? 11  THR A CB  1 
ATOM   98   O OG1 . THR A 1 12  ? 18.585  46.233  -29.921 1.00 28.72 ? 11  THR A OG1 1 
ATOM   99   C CG2 . THR A 1 12  ? 19.721  48.292  -29.609 1.00 29.09 ? 11  THR A CG2 1 
ATOM   100  N N   . THR A 1 13  ? 22.901  47.222  -30.111 1.00 28.51 ? 12  THR A N   1 
ATOM   101  C CA  . THR A 1 13  ? 24.138  48.000  -30.060 1.00 27.35 ? 12  THR A CA  1 
ATOM   102  C C   . THR A 1 13  ? 25.240  47.442  -30.968 1.00 28.56 ? 12  THR A C   1 
ATOM   103  O O   . THR A 1 13  ? 26.102  48.188  -31.433 1.00 28.77 ? 12  THR A O   1 
ATOM   104  C CB  . THR A 1 13  ? 24.701  48.077  -28.635 1.00 26.77 ? 12  THR A CB  1 
ATOM   105  O OG1 . THR A 1 13  ? 25.011  46.757  -28.163 1.00 25.97 ? 12  THR A OG1 1 
ATOM   106  C CG2 . THR A 1 13  ? 23.712  48.745  -27.696 1.00 23.70 ? 12  THR A CG2 1 
ATOM   107  N N   . GLY A 1 14  ? 25.212  46.135  -31.211 1.00 28.20 ? 13  GLY A N   1 
ATOM   108  C CA  . GLY A 1 14  ? 26.239  45.488  -32.008 1.00 27.40 ? 13  GLY A CA  1 
ATOM   109  C C   . GLY A 1 14  ? 27.322  44.812  -31.181 1.00 26.76 ? 13  GLY A C   1 
ATOM   110  O O   . GLY A 1 14  ? 28.119  44.030  -31.696 1.00 28.68 ? 13  GLY A O   1 
ATOM   111  N N   . GLU A 1 15  ? 27.338  45.107  -29.889 1.00 26.25 ? 14  GLU A N   1 
ATOM   112  C CA  . GLU A 1 15  ? 28.347  44.596  -28.976 1.00 24.41 ? 14  GLU A CA  1 
ATOM   113  C C   . GLU A 1 15  ? 28.210  43.111  -28.694 1.00 27.15 ? 14  GLU A C   1 
ATOM   114  O O   . GLU A 1 15  ? 27.122  42.557  -28.791 1.00 30.38 ? 14  GLU A O   1 
ATOM   115  C CB  . GLU A 1 15  ? 28.218  45.326  -27.649 1.00 28.93 ? 14  GLU A CB  1 
ATOM   116  C CG  . GLU A 1 15  ? 28.518  46.807  -27.722 1.00 33.59 ? 14  GLU A CG  1 
ATOM   117  C CD  . GLU A 1 15  ? 29.998  47.112  -27.572 1.00 37.11 ? 14  GLU A CD  1 
ATOM   118  O OE1 . GLU A 1 15  ? 30.324  48.253  -27.184 1.00 38.42 ? 14  GLU A OE1 1 
ATOM   119  O OE2 . GLU A 1 15  ? 30.833  46.212  -27.834 1.00 43.20 ? 14  GLU A OE2 1 
ATOM   120  N N   . THR A 1 16  ? 29.314  42.469  -28.321 1.00 26.35 ? 15  THR A N   1 
ATOM   121  C CA  . THR A 1 16  ? 29.266  41.128  -27.751 1.00 20.93 ? 15  THR A CA  1 
ATOM   122  C C   . THR A 1 16  ? 29.006  41.239  -26.246 1.00 21.38 ? 15  THR A C   1 
ATOM   123  O O   . THR A 1 16  ? 29.661  42.016  -25.556 1.00 19.36 ? 15  THR A O   1 
ATOM   124  C CB  . THR A 1 16  ? 30.583  40.380  -27.988 1.00 19.37 ? 15  THR A CB  1 
ATOM   125  O OG1 . THR A 1 16  ? 30.758  40.171  -29.390 1.00 24.35 ? 15  THR A OG1 1 
ATOM   126  C CG2 . THR A 1 16  ? 30.577  39.032  -27.298 1.00 21.11 ? 15  THR A CG2 1 
ATOM   127  N N   . LEU A 1 17  ? 28.040  40.476  -25.738 1.00 23.77 ? 16  LEU A N   1 
ATOM   128  C CA  . LEU A 1 17  ? 27.730  40.489  -24.302 1.00 23.52 ? 16  LEU A CA  1 
ATOM   129  C C   . LEU A 1 17  ? 28.578  39.482  -23.535 1.00 22.91 ? 16  LEU A C   1 
ATOM   130  O O   . LEU A 1 17  ? 29.049  39.754  -22.425 1.00 21.72 ? 16  LEU A O   1 
ATOM   131  C CB  . LEU A 1 17  ? 26.253  40.170  -24.061 1.00 24.44 ? 16  LEU A CB  1 
ATOM   132  C CG  . LEU A 1 17  ? 25.195  41.082  -24.687 1.00 24.90 ? 16  LEU A CG  1 
ATOM   133  C CD1 . LEU A 1 17  ? 23.828  40.424  -24.600 1.00 23.76 ? 16  LEU A CD1 1 
ATOM   134  C CD2 . LEU A 1 17  ? 25.182  42.446  -24.015 1.00 24.19 ? 16  LEU A CD2 1 
ATOM   135  N N   . ARG A 1 18  ? 28.767  38.318  -24.146 1.00 21.23 ? 17  ARG A N   1 
ATOM   136  C CA  . ARG A 1 18  ? 29.400  37.199  -23.477 1.00 22.77 ? 17  ARG A CA  1 
ATOM   137  C C   . ARG A 1 18  ? 29.973  36.240  -24.501 1.00 23.27 ? 17  ARG A C   1 
ATOM   138  O O   . ARG A 1 18  ? 29.355  36.001  -25.540 1.00 23.13 ? 17  ARG A O   1 
ATOM   139  C CB  . ARG A 1 18  ? 28.366  36.479  -22.613 1.00 22.44 ? 17  ARG A CB  1 
ATOM   140  C CG  . ARG A 1 18  ? 28.786  35.132  -22.060 1.00 23.01 ? 17  ARG A CG  1 
ATOM   141  C CD  . ARG A 1 18  ? 27.804  34.710  -20.988 1.00 24.79 ? 17  ARG A CD  1 
ATOM   142  N NE  . ARG A 1 18  ? 27.966  33.319  -20.588 1.00 28.46 ? 17  ARG A NE  1 
ATOM   143  C CZ  . ARG A 1 18  ? 27.199  32.714  -19.689 1.00 27.99 ? 17  ARG A CZ  1 
ATOM   144  N NH1 . ARG A 1 18  ? 26.214  33.383  -19.089 1.00 27.86 ? 17  ARG A NH1 1 
ATOM   145  N NH2 . ARG A 1 18  ? 27.419  31.441  -19.391 1.00 28.13 ? 17  ARG A NH2 1 
ATOM   146  N N   . GLN A 1 19  ? 31.164  35.709  -24.227 1.00 22.02 ? 18  GLN A N   1 
ATOM   147  C CA  . GLN A 1 19  ? 31.700  34.651  -25.067 1.00 21.51 ? 18  GLN A CA  1 
ATOM   148  C C   . GLN A 1 19  ? 32.272  33.521  -24.237 1.00 22.46 ? 18  GLN A C   1 
ATOM   149  O O   . GLN A 1 19  ? 33.130  33.733  -23.384 1.00 23.88 ? 18  GLN A O   1 
ATOM   150  C CB  . GLN A 1 19  ? 32.726  35.168  -26.066 1.00 20.40 ? 18  GLN A CB  1 
ATOM   151  C CG  . GLN A 1 19  ? 33.222  34.064  -26.969 1.00 24.44 ? 18  GLN A CG  1 
ATOM   152  C CD  . GLN A 1 19  ? 33.960  34.561  -28.187 1.00 27.92 ? 18  GLN A CD  1 
ATOM   153  O OE1 . GLN A 1 19  ? 33.408  35.310  -29.004 1.00 29.64 ? 18  GLN A OE1 1 
ATOM   154  N NE2 . GLN A 1 19  ? 35.219  34.139  -28.327 1.00 27.19 ? 18  GLN A NE2 1 
ATOM   155  N N   . ASP A 1 20  ? 31.771  32.317  -24.486 1.00 21.62 ? 19  ASP A N   1 
ATOM   156  C CA  . ASP A 1 20  ? 32.224  31.143  -23.764 1.00 24.65 ? 19  ASP A CA  1 
ATOM   157  C C   . ASP A 1 20  ? 33.230  30.312  -24.563 1.00 27.17 ? 19  ASP A C   1 
ATOM   158  O O   . ASP A 1 20  ? 32.959  29.858  -25.677 1.00 24.31 ? 19  ASP A O   1 
ATOM   159  C CB  . ASP A 1 20  ? 31.039  30.284  -23.333 1.00 22.70 ? 19  ASP A CB  1 
ATOM   160  C CG  . ASP A 1 20  ? 30.171  30.972  -22.301 1.00 26.76 ? 19  ASP A CG  1 
ATOM   161  O OD1 . ASP A 1 20  ? 30.528  32.092  -21.874 1.00 26.16 ? 19  ASP A OD1 1 
ATOM   162  O OD2 . ASP A 1 20  ? 29.131  30.391  -21.906 1.00 29.21 ? 19  ASP A OD2 1 
ATOM   163  N N   . ASP A 1 21  ? 34.397  30.119  -23.966 1.00 27.81 ? 20  ASP A N   1 
ATOM   164  C CA  . ASP A 1 21  ? 35.462  29.343  -24.571 1.00 29.17 ? 20  ASP A CA  1 
ATOM   165  C C   . ASP A 1 21  ? 35.425  27.912  -24.019 1.00 26.52 ? 20  ASP A C   1 
ATOM   166  O O   . ASP A 1 21  ? 35.761  27.678  -22.862 1.00 28.16 ? 20  ASP A O   1 
ATOM   167  C CB  . ASP A 1 21  ? 36.792  30.026  -24.239 1.00 31.66 ? 20  ASP A CB  1 
ATOM   168  C CG  . ASP A 1 21  ? 37.939  29.547  -25.107 1.00 38.03 ? 20  ASP A CG  1 
ATOM   169  O OD1 . ASP A 1 21  ? 37.788  28.486  -25.765 1.00 34.19 ? 20  ASP A OD1 1 
ATOM   170  O OD2 . ASP A 1 21  ? 38.993  30.235  -25.118 1.00 38.06 ? 20  ASP A OD2 1 
ATOM   171  N N   . LEU A 1 22  ? 35.003  26.955  -24.832 1.00 24.59 ? 21  LEU A N   1 
ATOM   172  C CA  . LEU A 1 22  ? 34.927  25.572  -24.372 1.00 25.24 ? 21  LEU A CA  1 
ATOM   173  C C   . LEU A 1 22  ? 36.009  24.695  -24.984 1.00 27.36 ? 21  LEU A C   1 
ATOM   174  O O   . LEU A 1 22  ? 36.345  24.840  -26.161 1.00 27.46 ? 21  LEU A O   1 
ATOM   175  C CB  . LEU A 1 22  ? 33.559  24.982  -24.677 1.00 24.05 ? 21  LEU A CB  1 
ATOM   176  C CG  . LEU A 1 22  ? 32.440  25.649  -23.888 1.00 25.26 ? 21  LEU A CG  1 
ATOM   177  C CD1 . LEU A 1 22  ? 31.432  26.268  -24.824 1.00 23.71 ? 21  LEU A CD1 1 
ATOM   178  C CD2 . LEU A 1 22  ? 31.776  24.620  -23.000 1.00 27.95 ? 21  LEU A CD2 1 
ATOM   179  N N   . HIS A 1 23  ? 36.536  23.775  -24.181 1.00 26.83 ? 22  HIS A N   1 
ATOM   180  C CA  . HIS A 1 23  ? 37.633  22.913  -24.597 1.00 28.12 ? 22  HIS A CA  1 
ATOM   181  C C   . HIS A 1 23  ? 37.308  21.455  -24.380 1.00 28.15 ? 22  HIS A C   1 
ATOM   182  O O   . HIS A 1 23  ? 36.696  21.094  -23.379 1.00 28.57 ? 22  HIS A O   1 
ATOM   183  C CB  . HIS A 1 23  ? 38.884  23.251  -23.801 1.00 27.05 ? 22  HIS A CB  1 
ATOM   184  C CG  . HIS A 1 23  ? 39.270  24.683  -23.896 1.00 28.13 ? 22  HIS A CG  1 
ATOM   185  N ND1 . HIS A 1 23  ? 39.967  25.191  -24.971 1.00 31.46 ? 22  HIS A ND1 1 
ATOM   186  C CD2 . HIS A 1 23  ? 39.038  25.727  -23.067 1.00 30.69 ? 22  HIS A CD2 1 
ATOM   187  C CE1 . HIS A 1 23  ? 40.161  26.486  -24.792 1.00 35.25 ? 22  HIS A CE1 1 
ATOM   188  N NE2 . HIS A 1 23  ? 39.605  26.838  -23.646 1.00 33.93 ? 22  HIS A NE2 1 
ATOM   189  N N   . GLY A 1 24  ? 37.747  20.610  -25.306 1.00 30.41 ? 23  GLY A N   1 
ATOM   190  C CA  . GLY A 1 24  ? 37.488  19.183  -25.211 1.00 31.76 ? 23  GLY A CA  1 
ATOM   191  C C   . GLY A 1 24  ? 38.106  18.411  -26.354 1.00 32.89 ? 23  GLY A C   1 
ATOM   192  O O   . GLY A 1 24  ? 38.707  19.001  -27.246 1.00 33.04 ? 23  GLY A O   1 
ATOM   193  N N   . TYR A 1 25  ? 37.968  17.090  -26.329 1.00 32.38 ? 24  TYR A N   1 
ATOM   194  C CA  . TYR A 1 25  ? 38.589  16.256  -27.345 1.00 31.80 ? 24  TYR A CA  1 
ATOM   195  C C   . TYR A 1 25  ? 37.656  16.040  -28.512 1.00 33.31 ? 24  TYR A C   1 
ATOM   196  O O   . TYR A 1 25  ? 36.438  16.076  -28.366 1.00 37.17 ? 24  TYR A O   1 
ATOM   197  C CB  . TYR A 1 25  ? 39.047  14.916  -26.755 1.00 33.84 ? 24  TYR A CB  1 
ATOM   198  C CG  . TYR A 1 25  ? 40.004  15.094  -25.595 1.00 37.72 ? 24  TYR A CG  1 
ATOM   199  C CD1 . TYR A 1 25  ? 41.308  15.539  -25.803 1.00 35.03 ? 24  TYR A CD1 1 
ATOM   200  C CD2 . TYR A 1 25  ? 39.594  14.843  -24.285 1.00 38.85 ? 24  TYR A CD2 1 
ATOM   201  C CE1 . TYR A 1 25  ? 42.176  15.722  -24.734 1.00 38.82 ? 24  TYR A CE1 1 
ATOM   202  C CE2 . TYR A 1 25  ? 40.455  15.017  -23.212 1.00 34.78 ? 24  TYR A CE2 1 
ATOM   203  C CZ  . TYR A 1 25  ? 41.738  15.456  -23.441 1.00 40.31 ? 24  TYR A CZ  1 
ATOM   204  O OH  . TYR A 1 25  ? 42.584  15.626  -22.372 1.00 41.80 ? 24  TYR A OH  1 
ATOM   205  N N   . THR A 1 26  ? 38.234  15.837  -29.683 1.00 32.64 ? 25  THR A N   1 
ATOM   206  C CA  . THR A 1 26  ? 37.439  15.580  -30.862 1.00 32.16 ? 25  THR A CA  1 
ATOM   207  C C   . THR A 1 26  ? 36.544  14.376  -30.589 1.00 38.42 ? 25  THR A C   1 
ATOM   208  O O   . THR A 1 26  ? 36.989  13.387  -29.981 1.00 36.18 ? 25  THR A O   1 
ATOM   209  C CB  . THR A 1 26  ? 38.335  15.303  -32.060 1.00 33.97 ? 25  THR A CB  1 
ATOM   210  O OG1 . THR A 1 26  ? 39.525  16.104  -31.956 1.00 39.12 ? 25  THR A OG1 1 
ATOM   211  C CG2 . THR A 1 26  ? 37.606  15.617  -33.355 1.00 33.63 ? 25  THR A CG2 1 
ATOM   212  N N   . ASP A 1 27  ? 35.276  14.514  -30.995 1.00 38.00 ? 26  ASP A N   1 
ATOM   213  C CA  . ASP A 1 27  ? 34.241  13.466  -30.937 1.00 36.83 ? 26  ASP A CA  1 
ATOM   214  C C   . ASP A 1 27  ? 33.438  13.381  -29.642 1.00 36.79 ? 26  ASP A C   1 
ATOM   215  O O   . ASP A 1 27  ? 32.642  12.462  -29.475 1.00 41.12 ? 26  ASP A O   1 
ATOM   216  C CB  . ASP A 1 27  ? 34.787  12.070  -31.280 1.00 39.97 ? 26  ASP A CB  1 
ATOM   217  C CG  . ASP A 1 27  ? 35.293  11.973  -32.705 1.00 47.14 ? 26  ASP A CG  1 
ATOM   218  O OD1 . ASP A 1 27  ? 34.723  12.658  -33.588 1.00 50.04 ? 26  ASP A OD1 1 
ATOM   219  O OD2 . ASP A 1 27  ? 36.264  11.211  -32.941 1.00 49.46 ? 26  ASP A OD2 1 
ATOM   220  N N   . GLU A 1 28  ? 33.638  14.306  -28.715 1.00 36.90 ? 27  GLU A N   1 
ATOM   221  C CA  . GLU A 1 28  ? 32.817  14.269  -27.511 1.00 35.21 ? 27  GLU A CA  1 
ATOM   222  C C   . GLU A 1 28  ? 31.797  15.411  -27.471 1.00 33.78 ? 27  GLU A C   1 
ATOM   223  O O   . GLU A 1 28  ? 31.924  16.416  -28.182 1.00 30.92 ? 27  GLU A O   1 
ATOM   224  C CB  . GLU A 1 28  ? 33.664  14.167  -26.232 1.00 34.29 ? 27  GLU A CB  1 
ATOM   225  C CG  . GLU A 1 28  ? 34.651  15.301  -26.001 1.00 42.25 ? 27  GLU A CG  1 
ATOM   226  C CD  . GLU A 1 28  ? 35.657  14.997  -24.877 1.00 49.51 ? 27  GLU A CD  1 
ATOM   227  O OE1 . GLU A 1 28  ? 35.941  13.787  -24.672 1.00 49.90 ? 27  GLU A OE1 1 
ATOM   228  O OE2 . GLU A 1 28  ? 36.150  15.957  -24.208 1.00 41.48 ? 27  GLU A OE2 1 
ATOM   229  N N   . THR A 1 29  ? 30.759  15.231  -26.669 1.00 30.64 ? 28  THR A N   1 
ATOM   230  C CA  . THR A 1 29  ? 29.688  16.208  -26.634 1.00 32.59 ? 28  THR A CA  1 
ATOM   231  C C   . THR A 1 29  ? 30.094  17.413  -25.793 1.00 31.17 ? 28  THR A C   1 
ATOM   232  O O   . THR A 1 29  ? 30.603  17.262  -24.682 1.00 30.49 ? 28  THR A O   1 
ATOM   233  C CB  . THR A 1 29  ? 28.384  15.581  -26.119 1.00 30.34 ? 28  THR A CB  1 
ATOM   234  O OG1 . THR A 1 29  ? 28.063  14.447  -26.932 1.00 28.37 ? 28  THR A OG1 1 
ATOM   235  C CG2 . THR A 1 29  ? 27.236  16.582  -26.192 1.00 32.74 ? 28  THR A CG2 1 
ATOM   236  N N   . ILE A 1 30  ? 29.898  18.607  -26.338 1.00 28.48 ? 29  ILE A N   1 
ATOM   237  C CA  . ILE A 1 30  ? 30.270  19.812  -25.617 1.00 29.73 ? 29  ILE A CA  1 
ATOM   238  C C   . ILE A 1 30  ? 29.341  19.928  -24.427 1.00 29.11 ? 29  ILE A C   1 
ATOM   239  O O   . ILE A 1 30  ? 28.131  20.013  -24.621 1.00 31.39 ? 29  ILE A O   1 
ATOM   240  C CB  . ILE A 1 30  ? 30.151  21.056  -26.502 1.00 26.78 ? 29  ILE A CB  1 
ATOM   241  C CG1 . ILE A 1 30  ? 30.862  20.803  -27.830 1.00 27.23 ? 29  ILE A CG1 1 
ATOM   242  C CG2 . ILE A 1 30  ? 30.763  22.239  -25.807 1.00 25.96 ? 29  ILE A CG2 1 
ATOM   243  C CD1 . ILE A 1 30  ? 30.868  21.952  -28.746 1.00 25.69 ? 29  ILE A CD1 1 
ATOM   244  N N   . PRO A 1 31  ? 29.903  19.894  -23.195 1.00 28.46 ? 30  PRO A N   1 
ATOM   245  C CA  . PRO A 1 31  ? 29.172  19.913  -21.916 1.00 26.08 ? 30  PRO A CA  1 
ATOM   246  C C   . PRO A 1 31  ? 28.612  21.298  -21.596 1.00 25.30 ? 30  PRO A C   1 
ATOM   247  O O   . PRO A 1 31  ? 29.065  21.960  -20.662 1.00 23.52 ? 30  PRO A O   1 
ATOM   248  C CB  . PRO A 1 31  ? 30.245  19.535  -20.901 1.00 24.26 ? 30  PRO A CB  1 
ATOM   249  C CG  . PRO A 1 31  ? 31.497  20.060  -21.488 1.00 26.04 ? 30  PRO A CG  1 
ATOM   250  C CD  . PRO A 1 31  ? 31.362  19.885  -22.981 1.00 27.45 ? 30  PRO A CD  1 
ATOM   251  N N   . TYR A 1 32  ? 27.607  21.708  -22.361 1.00 24.60 ? 31  TYR A N   1 
ATOM   252  C CA  . TYR A 1 32  ? 27.180  23.086  -22.365 1.00 22.83 ? 31  TYR A CA  1 
ATOM   253  C C   . TYR A 1 32  ? 25.773  23.218  -22.909 1.00 23.79 ? 31  TYR A C   1 
ATOM   254  O O   . TYR A 1 32  ? 25.330  22.414  -23.731 1.00 23.79 ? 31  TYR A O   1 
ATOM   255  C CB  . TYR A 1 32  ? 28.129  23.870  -23.252 1.00 23.53 ? 31  TYR A CB  1 
ATOM   256  C CG  . TYR A 1 32  ? 27.918  25.360  -23.267 1.00 21.80 ? 31  TYR A CG  1 
ATOM   257  C CD1 . TYR A 1 32  ? 28.447  26.161  -22.269 1.00 22.33 ? 31  TYR A CD1 1 
ATOM   258  C CD2 . TYR A 1 32  ? 27.219  25.969  -24.291 1.00 20.46 ? 31  TYR A CD2 1 
ATOM   259  C CE1 . TYR A 1 32  ? 28.274  27.524  -22.282 1.00 23.45 ? 31  TYR A CE1 1 
ATOM   260  C CE2 . TYR A 1 32  ? 27.043  27.338  -24.313 1.00 21.99 ? 31  TYR A CE2 1 
ATOM   261  C CZ  . TYR A 1 32  ? 27.573  28.111  -23.309 1.00 22.41 ? 31  TYR A CZ  1 
ATOM   262  O OH  . TYR A 1 32  ? 27.399  29.477  -23.328 1.00 22.43 ? 31  TYR A OH  1 
ATOM   263  N N   . SER A 1 33  ? 25.077  24.246  -22.441 1.00 23.41 ? 32  SER A N   1 
ATOM   264  C CA  . SER A 1 33  ? 23.763  24.599  -22.959 1.00 27.42 ? 32  SER A CA  1 
ATOM   265  C C   . SER A 1 33  ? 23.635  26.121  -22.959 1.00 24.46 ? 32  SER A C   1 
ATOM   266  O O   . SER A 1 33  ? 24.259  26.790  -22.133 1.00 25.16 ? 32  SER A O   1 
ATOM   267  C CB  . SER A 1 33  ? 22.659  23.972  -22.099 1.00 26.41 ? 32  SER A CB  1 
ATOM   268  O OG  . SER A 1 33  ? 21.397  24.542  -22.402 1.00 27.46 ? 32  SER A OG  1 
ATOM   269  N N   . THR A 1 34  ? 22.836  26.668  -23.873 1.00 23.93 ? 33  THR A N   1 
ATOM   270  C CA  . THR A 1 34  ? 22.618  28.116  -23.908 1.00 24.55 ? 33  THR A CA  1 
ATOM   271  C C   . THR A 1 34  ? 21.456  28.556  -23.022 1.00 25.60 ? 33  THR A C   1 
ATOM   272  O O   . THR A 1 34  ? 21.139  29.742  -22.946 1.00 29.10 ? 33  THR A O   1 
ATOM   273  C CB  . THR A 1 34  ? 22.358  28.639  -25.334 1.00 25.38 ? 33  THR A CB  1 
ATOM   274  O OG1 . THR A 1 34  ? 21.172  28.033  -25.865 1.00 24.46 ? 33  THR A OG1 1 
ATOM   275  C CG2 . THR A 1 34  ? 23.538  28.341  -26.241 1.00 23.54 ? 33  THR A CG2 1 
ATOM   276  N N   . ALA A 1 35  ? 20.821  27.593  -22.367 1.00 27.38 ? 34  ALA A N   1 
ATOM   277  C CA  . ALA A 1 35  ? 19.717  27.856  -21.456 1.00 27.31 ? 34  ALA A CA  1 
ATOM   278  C C   . ALA A 1 35  ? 20.030  28.979  -20.470 1.00 27.91 ? 34  ALA A C   1 
ATOM   279  O O   . ALA A 1 35  ? 19.455  30.072  -20.554 1.00 27.70 ? 34  ALA A O   1 
ATOM   280  C CB  . ALA A 1 35  ? 19.348  26.576  -20.707 1.00 26.98 ? 34  ALA A CB  1 
ATOM   281  N N   . GLU A 1 36  ? 20.952  28.705  -19.552 1.00 28.07 ? 35  GLU A N   1 
ATOM   282  C CA  . GLU A 1 36  ? 21.280  29.643  -18.488 1.00 30.47 ? 35  GLU A CA  1 
ATOM   283  C C   . GLU A 1 36  ? 21.614  31.049  -18.984 1.00 31.71 ? 35  GLU A C   1 
ATOM   284  O O   . GLU A 1 36  ? 21.152  32.043  -18.420 1.00 34.30 ? 35  GLU A O   1 
ATOM   285  C CB  . GLU A 1 36  ? 22.427  29.109  -17.633 1.00 35.18 ? 35  GLU A CB  1 
ATOM   286  C CG  . GLU A 1 36  ? 22.448  29.720  -16.245 1.00 42.11 ? 35  GLU A CG  1 
ATOM   287  C CD  . GLU A 1 36  ? 21.118  29.518  -15.500 1.00 50.95 ? 35  GLU A CD  1 
ATOM   288  O OE1 . GLU A 1 36  ? 20.464  28.447  -15.675 1.00 42.87 ? 35  GLU A OE1 1 
ATOM   289  O OE2 . GLU A 1 36  ? 20.731  30.444  -14.742 1.00 53.15 ? 35  GLU A OE2 1 
ATOM   290  N N   . GLY A 1 37  ? 22.421  31.135  -20.032 1.00 28.70 ? 36  GLY A N   1 
ATOM   291  C CA  . GLY A 1 37  ? 22.773  32.425  -20.585 1.00 26.85 ? 36  GLY A CA  1 
ATOM   292  C C   . GLY A 1 37  ? 21.551  33.188  -21.066 1.00 29.62 ? 36  GLY A C   1 
ATOM   293  O O   . GLY A 1 37  ? 21.354  34.368  -20.715 1.00 28.73 ? 36  GLY A O   1 
ATOM   294  N N   . ILE A 1 38  ? 20.730  32.522  -21.876 1.00 26.78 ? 37  ILE A N   1 
ATOM   295  C CA  . ILE A 1 38  ? 19.533  33.159  -22.421 1.00 28.86 ? 37  ILE A CA  1 
ATOM   296  C C   . ILE A 1 38  ? 18.590  33.615  -21.301 1.00 31.65 ? 37  ILE A C   1 
ATOM   297  O O   . ILE A 1 38  ? 18.022  34.713  -21.360 1.00 29.50 ? 37  ILE A O   1 
ATOM   298  C CB  . ILE A 1 38  ? 18.798  32.237  -23.403 1.00 28.28 ? 37  ILE A CB  1 
ATOM   299  C CG1 . ILE A 1 38  ? 19.644  32.024  -24.651 1.00 27.39 ? 37  ILE A CG1 1 
ATOM   300  C CG2 . ILE A 1 38  ? 17.493  32.842  -23.826 1.00 25.68 ? 37  ILE A CG2 1 
ATOM   301  C CD1 . ILE A 1 38  ? 19.049  31.026  -25.605 1.00 28.13 ? 37  ILE A CD1 1 
ATOM   302  N N   . LYS A 1 39  ? 18.445  32.778  -20.274 1.00 31.20 ? 38  LYS A N   1 
ATOM   303  C CA  . LYS A 1 39  ? 17.676  33.152  -19.094 1.00 29.19 ? 38  LYS A CA  1 
ATOM   304  C C   . LYS A 1 39  ? 18.213  34.451  -18.471 1.00 28.56 ? 38  LYS A C   1 
ATOM   305  O O   . LYS A 1 39  ? 17.447  35.348  -18.147 1.00 28.78 ? 38  LYS A O   1 
ATOM   306  C CB  . LYS A 1 39  ? 17.691  32.016  -18.073 1.00 30.87 ? 38  LYS A CB  1 
ATOM   307  C CG  . LYS A 1 39  ? 16.534  32.034  -17.095 1.00 35.47 ? 38  LYS A CG  1 
ATOM   308  C CD  . LYS A 1 39  ? 17.017  32.202  -15.663 1.00 40.37 ? 38  LYS A CD  1 
ATOM   309  C CE  . LYS A 1 39  ? 16.075  31.496  -14.700 1.00 44.65 ? 38  LYS A CE  1 
ATOM   310  N NZ  . LYS A 1 39  ? 16.118  30.009  -14.914 1.00 47.47 ? 38  LYS A NZ  1 
ATOM   311  N N   . LYS A 1 40  ? 19.532  34.552  -18.332 1.00 30.04 ? 39  LYS A N   1 
ATOM   312  C CA  . LYS A 1 40  ? 20.157  35.693  -17.664 1.00 28.27 ? 39  LYS A CA  1 
ATOM   313  C C   . LYS A 1 40  ? 19.944  36.985  -18.429 1.00 30.75 ? 39  LYS A C   1 
ATOM   314  O O   . LYS A 1 40  ? 19.731  38.035  -17.827 1.00 30.19 ? 39  LYS A O   1 
ATOM   315  C CB  . LYS A 1 40  ? 21.659  35.465  -17.450 1.00 28.09 ? 39  LYS A CB  1 
ATOM   316  C CG  . LYS A 1 40  ? 22.017  34.487  -16.333 1.00 28.82 ? 39  LYS A CG  1 
ATOM   317  C CD  . LYS A 1 40  ? 21.837  35.099  -14.943 1.00 26.25 ? 39  LYS A CD  1 
ATOM   318  C CE  . LYS A 1 40  ? 22.317  34.142  -13.849 1.00 28.86 ? 39  LYS A CE  1 
ATOM   319  N NZ  . LYS A 1 40  ? 21.759  32.760  -14.041 1.00 32.85 ? 39  LYS A NZ  1 
ATOM   320  N N   . TYR A 1 41  ? 19.994  36.919  -19.755 1.00 29.61 ? 40  TYR A N   1 
ATOM   321  C CA  . TYR A 1 41  ? 19.844  38.137  -20.543 1.00 26.85 ? 40  TYR A CA  1 
ATOM   322  C C   . TYR A 1 41  ? 18.401  38.572  -20.731 1.00 28.40 ? 40  TYR A C   1 
ATOM   323  O O   . TYR A 1 41  ? 18.128  39.761  -20.909 1.00 26.59 ? 40  TYR A O   1 
ATOM   324  C CB  . TYR A 1 41  ? 20.600  38.052  -21.870 1.00 24.74 ? 40  TYR A CB  1 
ATOM   325  C CG  . TYR A 1 41  ? 22.081  38.123  -21.637 1.00 25.92 ? 40  TYR A CG  1 
ATOM   326  C CD1 . TYR A 1 41  ? 22.683  39.311  -21.212 1.00 21.44 ? 40  TYR A CD1 1 
ATOM   327  C CD2 . TYR A 1 41  ? 22.877  36.992  -21.785 1.00 25.02 ? 40  TYR A CD2 1 
ATOM   328  C CE1 . TYR A 1 41  ? 24.038  39.369  -20.956 1.00 20.74 ? 40  TYR A CE1 1 
ATOM   329  C CE2 . TYR A 1 41  ? 24.236  37.040  -21.531 1.00 23.65 ? 40  TYR A CE2 1 
ATOM   330  C CZ  . TYR A 1 41  ? 24.810  38.227  -21.121 1.00 24.04 ? 40  TYR A CZ  1 
ATOM   331  O OH  . TYR A 1 41  ? 26.159  38.246  -20.879 1.00 23.58 ? 40  TYR A OH  1 
ATOM   332  N N   . GLU A 1 42  ? 17.479  37.617  -20.674 1.00 29.38 ? 41  GLU A N   1 
ATOM   333  C CA  . GLU A 1 42  ? 16.060  37.948  -20.747 1.00 27.86 ? 41  GLU A CA  1 
ATOM   334  C C   . GLU A 1 42  ? 15.621  38.713  -19.496 1.00 30.82 ? 41  GLU A C   1 
ATOM   335  O O   . GLU A 1 42  ? 14.949  39.752  -19.598 1.00 31.97 ? 41  GLU A O   1 
ATOM   336  C CB  . GLU A 1 42  ? 15.224  36.700  -21.002 1.00 26.51 ? 41  GLU A CB  1 
ATOM   337  C CG  . GLU A 1 42  ? 15.334  36.229  -22.440 1.00 27.47 ? 41  GLU A CG  1 
ATOM   338  C CD  . GLU A 1 42  ? 14.732  34.849  -22.671 1.00 35.16 ? 41  GLU A CD  1 
ATOM   339  O OE1 . GLU A 1 42  ? 14.700  34.026  -21.726 1.00 34.98 ? 41  GLU A OE1 1 
ATOM   340  O OE2 . GLU A 1 42  ? 14.289  34.583  -23.812 1.00 35.56 ? 41  GLU A OE2 1 
ATOM   341  N N   . GLY A 1 43  ? 16.052  38.238  -18.327 1.00 27.47 ? 42  GLY A N   1 
ATOM   342  C CA  . GLY A 1 43  ? 15.945  39.006  -17.095 1.00 26.75 ? 42  GLY A CA  1 
ATOM   343  C C   . GLY A 1 43  ? 16.572  40.405  -17.143 1.00 36.35 ? 42  GLY A C   1 
ATOM   344  O O   . GLY A 1 43  ? 16.316  41.223  -16.257 1.00 42.56 ? 42  GLY A O   1 
ATOM   345  N N   . ASP A 1 44  ? 17.391  40.689  -18.162 1.00 33.89 ? 43  ASP A N   1 
ATOM   346  C CA  . ASP A 1 44  ? 18.057  41.991  -18.318 1.00 33.15 ? 43  ASP A CA  1 
ATOM   347  C C   . ASP A 1 44  ? 17.235  42.903  -19.223 1.00 29.18 ? 43  ASP A C   1 
ATOM   348  O O   . ASP A 1 44  ? 17.588  44.062  -19.443 1.00 27.53 ? 43  ASP A O   1 
ATOM   349  C CB  . ASP A 1 44  ? 19.458  41.832  -18.972 1.00 42.44 ? 43  ASP A CB  1 
ATOM   350  C CG  . ASP A 1 44  ? 20.591  41.405  -17.980 1.00 45.05 ? 43  ASP A CG  1 
ATOM   351  O OD1 . ASP A 1 44  ? 20.385  40.490  -17.140 1.00 46.46 ? 43  ASP A OD1 1 
ATOM   352  O OD2 . ASP A 1 44  ? 21.713  41.978  -18.078 1.00 40.68 ? 43  ASP A OD2 1 
ATOM   353  N N   . GLY A 1 45  ? 16.173  42.356  -19.801 1.00 28.47 ? 44  GLY A N   1 
ATOM   354  C CA  . GLY A 1 45  ? 15.375  43.106  -20.752 1.00 29.97 ? 44  GLY A CA  1 
ATOM   355  C C   . GLY A 1 45  ? 15.671  42.824  -22.219 1.00 28.78 ? 44  GLY A C   1 
ATOM   356  O O   . GLY A 1 45  ? 15.205  43.543  -23.105 1.00 29.18 ? 44  GLY A O   1 
ATOM   357  N N   . TYR A 1 46  ? 16.436  41.770  -22.485 1.00 31.31 ? 45  TYR A N   1 
ATOM   358  C CA  . TYR A 1 46  ? 16.820  41.414  -23.856 1.00 29.57 ? 45  TYR A CA  1 
ATOM   359  C C   . TYR A 1 46  ? 15.840  40.380  -24.464 1.00 28.64 ? 45  TYR A C   1 
ATOM   360  O O   . TYR A 1 46  ? 15.213  39.596  -23.739 1.00 30.51 ? 45  TYR A O   1 
ATOM   361  C CB  . TYR A 1 46  ? 18.268  40.870  -23.893 1.00 26.93 ? 45  TYR A CB  1 
ATOM   362  C CG  . TYR A 1 46  ? 19.409  41.874  -23.712 1.00 22.63 ? 45  TYR A CG  1 
ATOM   363  C CD1 . TYR A 1 46  ? 19.961  42.533  -24.801 1.00 25.13 ? 45  TYR A CD1 1 
ATOM   364  C CD2 . TYR A 1 46  ? 19.984  42.101  -22.468 1.00 26.18 ? 45  TYR A CD2 1 
ATOM   365  C CE1 . TYR A 1 46  ? 21.023  43.426  -24.657 1.00 24.10 ? 45  TYR A CE1 1 
ATOM   366  C CE2 . TYR A 1 46  ? 21.055  43.002  -22.313 1.00 24.46 ? 45  TYR A CE2 1 
ATOM   367  C CZ  . TYR A 1 46  ? 21.561  43.657  -23.414 1.00 23.69 ? 45  TYR A CZ  1 
ATOM   368  O OH  . TYR A 1 46  ? 22.605  44.553  -23.288 1.00 29.22 ? 45  TYR A OH  1 
ATOM   369  N N   . VAL A 1 47  ? 15.715  40.374  -25.791 1.00 26.25 ? 46  VAL A N   1 
ATOM   370  C CA  . VAL A 1 47  ? 14.852  39.413  -26.477 1.00 25.53 ? 46  VAL A CA  1 
ATOM   371  C C   . VAL A 1 47  ? 15.648  38.520  -27.423 1.00 25.53 ? 46  VAL A C   1 
ATOM   372  O O   . VAL A 1 47  ? 16.356  39.011  -28.298 1.00 27.08 ? 46  VAL A O   1 
ATOM   373  C CB  . VAL A 1 47  ? 13.761  40.134  -27.288 1.00 24.73 ? 46  VAL A CB  1 
ATOM   374  C CG1 . VAL A 1 47  ? 13.096  39.193  -28.293 1.00 23.94 ? 46  VAL A CG1 1 
ATOM   375  C CG2 . VAL A 1 47  ? 12.748  40.709  -26.361 1.00 22.32 ? 46  VAL A CG2 1 
ATOM   376  N N   . LEU A 1 48  ? 15.515  37.211  -27.248 1.00 25.05 ? 47  LEU A N   1 
ATOM   377  C CA  . LEU A 1 48  ? 16.135  36.232  -28.134 1.00 25.19 ? 47  LEU A CA  1 
ATOM   378  C C   . LEU A 1 48  ? 15.726  36.424  -29.589 1.00 27.42 ? 47  LEU A C   1 
ATOM   379  O O   . LEU A 1 48  ? 14.566  36.696  -29.890 1.00 28.92 ? 47  LEU A O   1 
ATOM   380  C CB  . LEU A 1 48  ? 15.769  34.818  -27.696 1.00 21.98 ? 47  LEU A CB  1 
ATOM   381  C CG  . LEU A 1 48  ? 16.577  33.704  -28.352 1.00 25.35 ? 47  LEU A CG  1 
ATOM   382  C CD1 . LEU A 1 48  ? 18.065  33.993  -28.249 1.00 25.53 ? 47  LEU A CD1 1 
ATOM   383  C CD2 . LEU A 1 48  ? 16.268  32.386  -27.679 1.00 27.67 ? 47  LEU A CD2 1 
ATOM   384  N N   . VAL A 1 49  ? 16.682  36.275  -30.496 1.00 27.50 ? 48  VAL A N   1 
ATOM   385  C CA  . VAL A 1 49  ? 16.395  36.419  -31.908 1.00 26.62 ? 48  VAL A CA  1 
ATOM   386  C C   . VAL A 1 49  ? 16.752  35.133  -32.637 1.00 26.14 ? 48  VAL A C   1 
ATOM   387  O O   . VAL A 1 49  ? 16.032  34.693  -33.532 1.00 29.43 ? 48  VAL A O   1 
ATOM   388  C CB  . VAL A 1 49  ? 17.154  37.605  -32.500 1.00 25.23 ? 48  VAL A CB  1 
ATOM   389  C CG1 . VAL A 1 49  ? 16.817  37.756  -33.975 1.00 27.07 ? 48  VAL A CG1 1 
ATOM   390  C CG2 . VAL A 1 49  ? 16.813  38.873  -31.735 1.00 22.46 ? 48  VAL A CG2 1 
ATOM   391  N N   . SER A 1 50  ? 17.862  34.526  -32.242 1.00 24.10 ? 49  SER A N   1 
ATOM   392  C CA  . SER A 1 50  ? 18.271  33.251  -32.815 1.00 24.78 ? 49  SER A CA  1 
ATOM   393  C C   . SER A 1 50  ? 19.287  32.601  -31.910 1.00 22.62 ? 49  SER A C   1 
ATOM   394  O O   . SER A 1 50  ? 19.980  33.278  -31.165 1.00 24.50 ? 49  SER A O   1 
ATOM   395  C CB  . SER A 1 50  ? 18.837  33.413  -34.232 1.00 23.33 ? 49  SER A CB  1 
ATOM   396  O OG  . SER A 1 50  ? 19.891  34.362  -34.268 1.00 31.43 ? 49  SER A OG  1 
ATOM   397  N N   . ASP A 1 51  ? 19.349  31.280  -31.964 1.00 23.70 ? 50  ASP A N   1 
ATOM   398  C CA  . ASP A 1 51  ? 20.286  30.523  -31.163 1.00 24.16 ? 50  ASP A CA  1 
ATOM   399  C C   . ASP A 1 51  ? 20.922  29.451  -32.050 1.00 27.37 ? 50  ASP A C   1 
ATOM   400  O O   . ASP A 1 51  ? 20.309  28.415  -32.330 1.00 28.50 ? 50  ASP A O   1 
ATOM   401  C CB  . ASP A 1 51  ? 19.567  29.903  -29.959 1.00 25.79 ? 50  ASP A CB  1 
ATOM   402  C CG  . ASP A 1 51  ? 20.463  28.962  -29.150 1.00 31.41 ? 50  ASP A CG  1 
ATOM   403  O OD1 . ASP A 1 51  ? 21.694  29.017  -29.332 1.00 34.93 ? 50  ASP A OD1 1 
ATOM   404  O OD2 . ASP A 1 51  ? 19.952  28.160  -28.329 1.00 32.80 ? 50  ASP A OD2 1 
ATOM   405  N N   . GLY A 1 52  ? 22.159  29.706  -32.478 1.00 24.82 ? 51  GLY A N   1 
ATOM   406  C CA  . GLY A 1 52  ? 22.860  28.810  -33.384 1.00 26.88 ? 51  GLY A CA  1 
ATOM   407  C C   . GLY A 1 52  ? 23.390  27.509  -32.790 1.00 25.94 ? 51  GLY A C   1 
ATOM   408  O O   . GLY A 1 52  ? 23.825  26.624  -33.520 1.00 24.64 ? 51  GLY A O   1 
ATOM   409  N N   . PHE A 1 53  ? 23.368  27.396  -31.469 1.00 24.06 ? 52  PHE A N   1 
ATOM   410  C CA  . PHE A 1 53  ? 23.907  26.231  -30.796 1.00 23.89 ? 52  PHE A CA  1 
ATOM   411  C C   . PHE A 1 53  ? 22.788  25.218  -30.683 1.00 28.06 ? 52  PHE A C   1 
ATOM   412  O O   . PHE A 1 53  ? 21.622  25.595  -30.642 1.00 35.00 ? 52  PHE A O   1 
ATOM   413  C CB  . PHE A 1 53  ? 24.402  26.613  -29.406 1.00 22.41 ? 52  PHE A CB  1 
ATOM   414  C CG  . PHE A 1 53  ? 25.103  25.512  -28.700 1.00 22.58 ? 52  PHE A CG  1 
ATOM   415  C CD1 . PHE A 1 53  ? 26.426  25.230  -28.985 1.00 23.31 ? 52  PHE A CD1 1 
ATOM   416  C CD2 . PHE A 1 53  ? 24.446  24.747  -27.757 1.00 23.53 ? 52  PHE A CD2 1 
ATOM   417  C CE1 . PHE A 1 53  ? 27.087  24.189  -28.339 1.00 24.73 ? 52  PHE A CE1 1 
ATOM   418  C CE2 . PHE A 1 53  ? 25.098  23.709  -27.103 1.00 25.72 ? 52  PHE A CE2 1 
ATOM   419  C CZ  . PHE A 1 53  ? 26.421  23.426  -27.393 1.00 24.30 ? 52  PHE A CZ  1 
ATOM   420  N N   . LYS A 1 54  ? 23.128  23.939  -30.652 1.00 25.80 ? 53  LYS A N   1 
ATOM   421  C CA  . LYS A 1 54  ? 22.123  22.899  -30.483 1.00 30.98 ? 53  LYS A CA  1 
ATOM   422  C C   . LYS A 1 54  ? 22.689  21.793  -29.600 1.00 30.88 ? 53  LYS A C   1 
ATOM   423  O O   . LYS A 1 54  ? 23.831  21.379  -29.783 1.00 30.25 ? 53  LYS A O   1 
ATOM   424  C CB  . LYS A 1 54  ? 21.639  22.343  -31.840 1.00 31.25 ? 53  LYS A CB  1 
ATOM   425  C CG  . LYS A 1 54  ? 20.466  23.134  -32.474 1.00 32.71 ? 53  LYS A CG  1 
ATOM   426  C CD  . LYS A 1 54  ? 19.893  22.456  -33.723 1.00 38.15 ? 53  LYS A CD  1 
ATOM   427  C CE  . LYS A 1 54  ? 19.230  21.103  -33.398 1.00 44.51 ? 53  LYS A CE  1 
ATOM   428  N NZ  . LYS A 1 54  ? 19.289  20.083  -34.516 1.00 40.20 ? 53  LYS A NZ  1 
ATOM   429  N N   . PRO A 1 55  ? 21.896  21.327  -28.621 1.00 33.88 ? 54  PRO A N   1 
ATOM   430  C CA  . PRO A 1 55  ? 22.315  20.231  -27.739 1.00 35.29 ? 54  PRO A CA  1 
ATOM   431  C C   . PRO A 1 55  ? 22.626  18.982  -28.565 1.00 32.92 ? 54  PRO A C   1 
ATOM   432  O O   . PRO A 1 55  ? 21.922  18.666  -29.536 1.00 29.22 ? 54  PRO A O   1 
ATOM   433  C CB  . PRO A 1 55  ? 21.067  19.988  -26.883 1.00 38.82 ? 54  PRO A CB  1 
ATOM   434  C CG  . PRO A 1 55  ? 19.926  20.436  -27.761 1.00 33.05 ? 54  PRO A CG  1 
ATOM   435  C CD  . PRO A 1 55  ? 20.477  21.673  -28.419 1.00 34.00 ? 54  PRO A CD  1 
ATOM   436  N N   . GLY A 1 56  ? 23.680  18.277  -28.180 1.00 31.03 ? 55  GLY A N   1 
ATOM   437  C CA  . GLY A 1 56  ? 24.150  17.155  -28.968 1.00 28.74 ? 55  GLY A CA  1 
ATOM   438  C C   . GLY A 1 56  ? 25.314  17.536  -29.866 1.00 28.43 ? 55  GLY A C   1 
ATOM   439  O O   . GLY A 1 56  ? 25.882  16.684  -30.545 1.00 29.01 ? 55  GLY A O   1 
ATOM   440  N N   . THR A 1 57  ? 25.655  18.822  -29.883 1.00 28.34 ? 56  THR A N   1 
ATOM   441  C CA  . THR A 1 57  ? 26.810  19.310  -30.624 1.00 30.17 ? 56  THR A CA  1 
ATOM   442  C C   . THR A 1 57  ? 28.122  18.784  -30.060 1.00 31.08 ? 56  THR A C   1 
ATOM   443  O O   . THR A 1 57  ? 28.400  18.948  -28.872 1.00 33.31 ? 56  THR A O   1 
ATOM   444  C CB  . THR A 1 57  ? 26.889  20.835  -30.607 1.00 27.94 ? 56  THR A CB  1 
ATOM   445  O OG1 . THR A 1 57  ? 25.855  21.381  -31.443 1.00 30.53 ? 56  THR A OG1 1 
ATOM   446  C CG2 . THR A 1 57  ? 28.251  21.280  -31.115 1.00 24.20 ? 56  THR A CG2 1 
ATOM   447  N N   . LYS A 1 58  ? 28.931  18.164  -30.916 1.00 30.21 ? 57  LYS A N   1 
ATOM   448  C CA  . LYS A 1 58  ? 30.226  17.641  -30.498 1.00 30.62 ? 57  LYS A CA  1 
ATOM   449  C C   . LYS A 1 58  ? 31.383  18.568  -30.918 1.00 33.04 ? 57  LYS A C   1 
ATOM   450  O O   . LYS A 1 58  ? 31.181  19.530  -31.661 1.00 31.97 ? 57  LYS A O   1 
ATOM   451  C CB  . LYS A 1 58  ? 30.414  16.238  -31.067 1.00 29.98 ? 57  LYS A CB  1 
ATOM   452  C CG  . LYS A 1 58  ? 29.264  15.311  -30.707 1.00 33.79 ? 57  LYS A CG  1 
ATOM   453  C CD  . LYS A 1 58  ? 29.391  13.902  -31.289 1.00 29.63 ? 57  LYS A CD  1 
ATOM   454  C CE  . LYS A 1 58  ? 29.139  13.915  -32.792 1.00 39.07 ? 57  LYS A CE  1 
ATOM   455  N NZ  . LYS A 1 58  ? 28.900  12.559  -33.387 1.00 42.60 ? 57  LYS A NZ  1 
ATOM   456  N N   . PHE A 1 59  ? 32.584  18.284  -30.416 1.00 31.71 ? 58  PHE A N   1 
ATOM   457  C CA  . PHE A 1 59  ? 33.794  18.941  -30.893 1.00 28.77 ? 58  PHE A CA  1 
ATOM   458  C C   . PHE A 1 59  ? 34.218  18.292  -32.204 1.00 32.07 ? 58  PHE A C   1 
ATOM   459  O O   . PHE A 1 59  ? 34.267  17.067  -32.310 1.00 34.18 ? 58  PHE A O   1 
ATOM   460  C CB  . PHE A 1 59  ? 34.950  18.793  -29.894 1.00 31.50 ? 58  PHE A CB  1 
ATOM   461  C CG  . PHE A 1 59  ? 34.747  19.514  -28.583 1.00 31.89 ? 58  PHE A CG  1 
ATOM   462  C CD1 . PHE A 1 59  ? 34.905  20.894  -28.491 1.00 28.22 ? 58  PHE A CD1 1 
ATOM   463  C CD2 . PHE A 1 59  ? 34.435  18.804  -27.427 1.00 30.61 ? 58  PHE A CD2 1 
ATOM   464  C CE1 . PHE A 1 59  ? 34.728  21.559  -27.276 1.00 25.91 ? 58  PHE A CE1 1 
ATOM   465  C CE2 . PHE A 1 59  ? 34.250  19.465  -26.212 1.00 30.23 ? 58  PHE A CE2 1 
ATOM   466  C CZ  . PHE A 1 59  ? 34.398  20.847  -26.137 1.00 26.25 ? 58  PHE A CZ  1 
ATOM   467  N N   . GLY A 1 60  ? 34.525  19.121  -33.199 1.00 39.73 ? 59  GLY A N   1 
ATOM   468  C CA  . GLY A 1 60  ? 35.129  18.679  -34.452 1.00 36.67 ? 59  GLY A CA  1 
ATOM   469  C C   . GLY A 1 60  ? 36.601  19.059  -34.488 1.00 35.28 ? 59  GLY A C   1 
ATOM   470  O O   . GLY A 1 60  ? 37.331  18.763  -33.550 1.00 38.15 ? 59  GLY A O   1 
ATOM   471  N N   . VAL A 1 61  ? 37.046  19.732  -35.543 1.00 32.99 ? 60  VAL A N   1 
ATOM   472  C CA  . VAL A 1 61  ? 38.467  20.007  -35.658 1.00 31.66 ? 60  VAL A CA  1 
ATOM   473  C C   . VAL A 1 61  ? 38.783  21.448  -35.938 1.00 36.75 ? 60  VAL A C   1 
ATOM   474  O O   . VAL A 1 61  ? 39.928  21.885  -35.760 1.00 44.42 ? 60  VAL A O   1 
ATOM   475  C CB  . VAL A 1 61  ? 39.125  19.160  -36.728 1.00 29.70 ? 60  VAL A CB  1 
ATOM   476  C CG1 . VAL A 1 61  ? 39.353  17.775  -36.214 1.00 31.50 ? 60  VAL A CG1 1 
ATOM   477  C CG2 . VAL A 1 61  ? 38.257  19.140  -37.969 1.00 31.76 ? 60  VAL A CG2 1 
ATOM   478  N N   . GLY A 1 62  ? 37.798  22.202  -36.389 1.00 30.33 ? 61  GLY A N   1 
ATOM   479  C CA  . GLY A 1 62  ? 38.071  23.600  -36.626 1.00 29.56 ? 61  GLY A CA  1 
ATOM   480  C C   . GLY A 1 62  ? 38.113  24.361  -35.315 1.00 29.36 ? 61  GLY A C   1 
ATOM   481  O O   . GLY A 1 62  ? 38.297  23.795  -34.240 1.00 30.38 ? 61  GLY A O   1 
ATOM   482  N N   . THR A 1 63  ? 37.945  25.670  -35.415 1.00 28.19 ? 62  THR A N   1 
ATOM   483  C CA  . THR A 1 63  ? 37.663  26.479  -34.259 1.00 24.61 ? 62  THR A CA  1 
ATOM   484  C C   . THR A 1 63  ? 36.365  27.216  -34.556 1.00 23.32 ? 62  THR A C   1 
ATOM   485  O O   . THR A 1 63  ? 36.370  28.339  -35.039 1.00 24.75 ? 62  THR A O   1 
ATOM   486  C CB  . THR A 1 63  ? 38.839  27.422  -33.959 1.00 30.06 ? 62  THR A CB  1 
ATOM   487  O OG1 . THR A 1 63  ? 39.917  26.643  -33.424 1.00 37.38 ? 62  THR A OG1 1 
ATOM   488  C CG2 . THR A 1 63  ? 38.458  28.475  -32.938 1.00 27.52 ? 62  THR A CG2 1 
ATOM   489  N N   . PRO A 1 64  ? 35.232  26.556  -34.303 1.00 24.11 ? 63  PRO A N   1 
ATOM   490  C CA  . PRO A 1 64  ? 33.928  27.131  -34.633 1.00 21.35 ? 63  PRO A CA  1 
ATOM   491  C C   . PRO A 1 64  ? 33.395  28.086  -33.581 1.00 21.39 ? 63  PRO A C   1 
ATOM   492  O O   . PRO A 1 64  ? 33.586  27.865  -32.389 1.00 22.80 ? 63  PRO A O   1 
ATOM   493  C CB  . PRO A 1 64  ? 33.028  25.906  -34.697 1.00 22.07 ? 63  PRO A CB  1 
ATOM   494  C CG  . PRO A 1 64  ? 33.656  24.930  -33.778 1.00 22.70 ? 63  PRO A CG  1 
ATOM   495  C CD  . PRO A 1 64  ? 35.127  25.164  -33.835 1.00 24.92 ? 63  PRO A CD  1 
ATOM   496  N N   . THR A 1 65  ? 32.730  29.138  -34.043 1.00 20.01 ? 64  THR A N   1 
ATOM   497  C CA  . THR A 1 65  ? 31.896  29.973  -33.190 1.00 19.67 ? 64  THR A CA  1 
ATOM   498  C C   . THR A 1 65  ? 30.406  29.769  -33.497 1.00 20.36 ? 64  THR A C   1 
ATOM   499  O O   . THR A 1 65  ? 29.970  29.837  -34.655 1.00 20.51 ? 64  THR A O   1 
ATOM   500  C CB  . THR A 1 65  ? 32.241  31.462  -33.354 1.00 20.01 ? 64  THR A CB  1 
ATOM   501  O OG1 . THR A 1 65  ? 33.547  31.703  -32.815 1.00 24.99 ? 64  THR A OG1 1 
ATOM   502  C CG2 . THR A 1 65  ? 31.232  32.337  -32.623 1.00 19.08 ? 64  THR A CG2 1 
ATOM   503  N N   . TYR A 1 66  ? 29.628  29.505  -32.454 1.00 19.52 ? 65  TYR A N   1 
ATOM   504  C CA  . TYR A 1 66  ? 28.180  29.488  -32.564 1.00 19.05 ? 65  TYR A CA  1 
ATOM   505  C C   . TYR A 1 66  ? 27.623  30.781  -31.948 1.00 19.75 ? 65  TYR A C   1 
ATOM   506  O O   . TYR A 1 66  ? 28.122  31.253  -30.923 1.00 17.67 ? 65  TYR A O   1 
ATOM   507  C CB  . TYR A 1 66  ? 27.632  28.261  -31.854 1.00 20.51 ? 65  TYR A CB  1 
ATOM   508  C CG  . TYR A 1 66  ? 28.164  26.944  -32.371 1.00 19.48 ? 65  TYR A CG  1 
ATOM   509  C CD1 . TYR A 1 66  ? 27.507  26.251  -33.384 1.00 22.58 ? 65  TYR A CD1 1 
ATOM   510  C CD2 . TYR A 1 66  ? 29.317  26.382  -31.846 1.00 19.24 ? 65  TYR A CD2 1 
ATOM   511  C CE1 . TYR A 1 66  ? 27.986  25.026  -33.858 1.00 21.00 ? 65  TYR A CE1 1 
ATOM   512  C CE2 . TYR A 1 66  ? 29.796  25.153  -32.317 1.00 19.48 ? 65  TYR A CE2 1 
ATOM   513  C CZ  . TYR A 1 66  ? 29.124  24.496  -33.315 1.00 18.35 ? 65  TYR A CZ  1 
ATOM   514  O OH  . TYR A 1 66  ? 29.595  23.310  -33.779 1.00 23.63 ? 65  TYR A OH  1 
ATOM   515  N N   . GLU A 1 67  ? 26.614  31.369  -32.584 1.00 20.13 ? 66  GLU A N   1 
ATOM   516  C CA  . GLU A 1 67  ? 26.107  32.674  -32.151 1.00 22.40 ? 66  GLU A CA  1 
ATOM   517  C C   . GLU A 1 67  ? 24.692  32.628  -31.555 1.00 20.70 ? 66  GLU A C   1 
ATOM   518  O O   . GLU A 1 67  ? 23.800  31.941  -32.042 1.00 21.06 ? 66  GLU A O   1 
ATOM   519  C CB  . GLU A 1 67  ? 26.180  33.701  -33.297 1.00 25.74 ? 66  GLU A CB  1 
ATOM   520  C CG  . GLU A 1 67  ? 27.610  34.128  -33.707 1.00 28.45 ? 66  GLU A CG  1 
ATOM   521  C CD  . GLU A 1 67  ? 27.632  35.158  -34.852 1.00 40.08 ? 66  GLU A CD  1 
ATOM   522  O OE1 . GLU A 1 67  ? 26.645  35.198  -35.623 1.00 44.72 ? 66  GLU A OE1 1 
ATOM   523  O OE2 . GLU A 1 67  ? 28.622  35.928  -34.983 1.00 38.75 ? 66  GLU A OE2 1 
ATOM   524  N N   . VAL A 1 68  ? 24.495  33.359  -30.473 1.00 21.74 ? 67  VAL A N   1 
ATOM   525  C CA  . VAL A 1 68  ? 23.158  33.527  -29.918 1.00 25.05 ? 67  VAL A CA  1 
ATOM   526  C C   . VAL A 1 68  ? 22.823  35.005  -30.036 1.00 23.07 ? 67  VAL A C   1 
ATOM   527  O O   . VAL A 1 68  ? 23.472  35.826  -29.395 1.00 24.60 ? 67  VAL A O   1 
ATOM   528  C CB  . VAL A 1 68  ? 23.087  33.083  -28.423 1.00 25.13 ? 67  VAL A CB  1 
ATOM   529  C CG1 . VAL A 1 68  ? 21.695  33.296  -27.867 1.00 23.55 ? 67  VAL A CG1 1 
ATOM   530  C CG2 . VAL A 1 68  ? 23.485  31.622  -28.267 1.00 21.17 ? 67  VAL A CG2 1 
ATOM   531  N N   . HIS A 1 69  ? 21.848  35.367  -30.866 1.00 22.54 ? 68  HIS A N   1 
ATOM   532  C CA  . HIS A 1 69  ? 21.551  36.794  -31.056 1.00 26.18 ? 68  HIS A CA  1 
ATOM   533  C C   . HIS A 1 69  ? 20.370  37.295  -30.189 1.00 25.65 ? 68  HIS A C   1 
ATOM   534  O O   . HIS A 1 69  ? 19.379  36.595  -29.988 1.00 25.59 ? 68  HIS A O   1 
ATOM   535  C CB  . HIS A 1 69  ? 21.351  37.137  -32.551 1.00 26.95 ? 68  HIS A CB  1 
ATOM   536  C CG  . HIS A 1 69  ? 22.602  37.034  -33.375 1.00 29.48 ? 68  HIS A CG  1 
ATOM   537  N ND1 . HIS A 1 69  ? 23.516  38.064  -33.478 1.00 27.64 ? 68  HIS A ND1 1 
ATOM   538  C CD2 . HIS A 1 69  ? 23.091  36.023  -34.135 1.00 29.23 ? 68  HIS A CD2 1 
ATOM   539  C CE1 . HIS A 1 69  ? 24.513  37.691  -34.263 1.00 27.97 ? 68  HIS A CE1 1 
ATOM   540  N NE2 . HIS A 1 69  ? 24.282  36.457  -34.672 1.00 28.28 ? 68  HIS A NE2 1 
ATOM   541  N N   . PHE A 1 70  ? 20.500  38.503  -29.660 1.00 24.21 ? 69  PHE A N   1 
ATOM   542  C CA  . PHE A 1 70  ? 19.432  39.126  -28.897 1.00 23.80 ? 69  PHE A CA  1 
ATOM   543  C C   . PHE A 1 70  ? 19.165  40.491  -29.466 1.00 24.70 ? 69  PHE A C   1 
ATOM   544  O O   . PHE A 1 70  ? 20.005  41.021  -30.188 1.00 25.03 ? 69  PHE A O   1 
ATOM   545  C CB  . PHE A 1 70  ? 19.852  39.333  -27.456 1.00 23.76 ? 69  PHE A CB  1 
ATOM   546  C CG  . PHE A 1 70  ? 20.077  38.066  -26.699 1.00 26.16 ? 69  PHE A CG  1 
ATOM   547  C CD1 . PHE A 1 70  ? 19.095  37.561  -25.864 1.00 25.37 ? 69  PHE A CD1 1 
ATOM   548  C CD2 . PHE A 1 70  ? 21.275  37.390  -26.796 1.00 23.01 ? 69  PHE A CD2 1 
ATOM   549  C CE1 . PHE A 1 70  ? 19.308  36.411  -25.148 1.00 22.83 ? 69  PHE A CE1 1 
ATOM   550  C CE2 . PHE A 1 70  ? 21.484  36.239  -26.083 1.00 23.23 ? 69  PHE A CE2 1 
ATOM   551  C CZ  . PHE A 1 70  ? 20.501  35.748  -25.261 1.00 23.84 ? 69  PHE A CZ  1 
ATOM   552  N N   . LYS A 1 71  ? 18.000  41.054  -29.142 1.00 24.68 ? 70  LYS A N   1 
ATOM   553  C CA  . LYS A 1 71  ? 17.725  42.484  -29.361 1.00 25.26 ? 70  LYS A CA  1 
ATOM   554  C C   . LYS A 1 71  ? 17.142  43.061  -28.085 1.00 24.99 ? 70  LYS A C   1 
ATOM   555  O O   . LYS A 1 71  ? 16.710  42.315  -27.203 1.00 25.19 ? 70  LYS A O   1 
ATOM   556  C CB  . LYS A 1 71  ? 16.757  42.716  -30.518 1.00 22.77 ? 70  LYS A CB  1 
ATOM   557  C CG  . LYS A 1 71  ? 15.403  42.050  -30.325 1.00 26.13 ? 70  LYS A CG  1 
ATOM   558  C CD  . LYS A 1 71  ? 14.446  42.390  -31.456 1.00 26.89 ? 70  LYS A CD  1 
ATOM   559  C CE  . LYS A 1 71  ? 13.340  41.336  -31.593 1.00 27.32 ? 70  LYS A CE  1 
ATOM   560  N NZ  . LYS A 1 71  ? 12.486  41.666  -32.779 1.00 25.88 ? 70  LYS A NZ  1 
ATOM   561  N N   . HIS A 1 72  ? 17.140  44.383  -27.976 1.00 26.33 ? 71  HIS A N   1 
ATOM   562  C CA  . HIS A 1 72  ? 16.566  45.039  -26.804 1.00 26.32 ? 71  HIS A CA  1 
ATOM   563  C C   . HIS A 1 72  ? 15.053  44.879  -26.751 1.00 25.71 ? 71  HIS A C   1 
ATOM   564  O O   . HIS A 1 72  ? 14.363  44.991  -27.763 1.00 25.27 ? 71  HIS A O   1 
ATOM   565  C CB  . HIS A 1 72  ? 16.916  46.524  -26.785 1.00 25.92 ? 71  HIS A CB  1 
ATOM   566  C CG  . HIS A 1 72  ? 18.332  46.807  -26.394 1.00 29.89 ? 71  HIS A CG  1 
ATOM   567  N ND1 . HIS A 1 72  ? 18.772  48.070  -26.051 1.00 28.81 ? 71  HIS A ND1 1 
ATOM   568  C CD2 . HIS A 1 72  ? 19.408  45.993  -26.284 1.00 27.76 ? 71  HIS A CD2 1 
ATOM   569  C CE1 . HIS A 1 72  ? 20.056  48.020  -25.749 1.00 27.03 ? 71  HIS A CE1 1 
ATOM   570  N NE2 . HIS A 1 72  ? 20.468  46.772  -25.885 1.00 29.31 ? 71  HIS A NE2 1 
ATOM   571  N N   . GLY A 1 73  ? 14.543  44.615  -25.555 1.00 26.85 ? 72  GLY A N   1 
ATOM   572  C CA  . GLY A 1 73  ? 13.113  44.562  -25.348 1.00 25.14 ? 72  GLY A CA  1 
ATOM   573  C C   . GLY A 1 73  ? 12.523  45.947  -25.421 1.00 25.37 ? 72  GLY A C   1 
ATOM   574  O O   . GLY A 1 73  ? 13.136  46.923  -24.996 1.00 27.50 ? 72  GLY A O   1 
ATOM   575  N N   . MET A 1 74  ? 11.325  46.048  -25.976 1.00 28.54 ? 73  MET A N   1 
ATOM   576  C CA  . MET A 1 74  ? 10.629  47.333  -26.007 1.00 28.94 ? 73  MET A CA  1 
ATOM   577  C C   . MET A 1 74  ? 9.300   47.272  -25.260 1.00 28.79 ? 73  MET A C   1 
ATOM   578  O O   . MET A 1 74  ? 8.523   46.314  -25.405 1.00 31.78 ? 73  MET A O   1 
ATOM   579  C CB  . MET A 1 74  ? 10.411  47.809  -27.446 1.00 27.08 ? 73  MET A CB  1 
ATOM   580  C CG  . MET A 1 74  ? 11.698  48.060  -28.234 1.00 28.92 ? 73  MET A CG  1 
ATOM   581  S SD  . MET A 1 74  ? 12.765  49.370  -27.579 1.00 39.06 ? 73  MET A SD  1 
ATOM   582  C CE  . MET A 1 74  ? 14.127  49.281  -28.744 1.00 35.69 ? 73  MET A CE  1 
ATOM   583  N N   . THR A 1 75  ? 9.058   48.290  -24.445 1.00 26.10 ? 74  THR A N   1 
ATOM   584  C CA  . THR A 1 75  ? 7.795   48.418  -23.739 1.00 26.18 ? 74  THR A CA  1 
ATOM   585  C C   . THR A 1 75  ? 7.045   49.641  -24.225 1.00 26.66 ? 74  THR A C   1 
ATOM   586  O O   . THR A 1 75  ? 7.544   50.762  -24.138 1.00 26.85 ? 74  THR A O   1 
ATOM   587  C CB  . THR A 1 75  ? 7.999   48.555  -22.232 1.00 27.87 ? 74  THR A CB  1 
ATOM   588  O OG1 . THR A 1 75  ? 8.402   47.293  -21.684 1.00 32.59 ? 74  THR A OG1 1 
ATOM   589  C CG2 . THR A 1 75  ? 6.704   48.984  -21.577 1.00 29.25 ? 74  THR A CG2 1 
ATOM   590  N N   . HIS A 1 76  ? 5.840   49.429  -24.736 1.00 26.39 ? 75  HIS A N   1 
ATOM   591  C CA  . HIS A 1 76  ? 5.031   50.545  -25.214 1.00 26.52 ? 75  HIS A CA  1 
ATOM   592  C C   . HIS A 1 76  ? 3.986   51.036  -24.201 1.00 26.54 ? 75  HIS A C   1 
ATOM   593  O O   . HIS A 1 76  ? 3.129   50.285  -23.745 1.00 31.90 ? 75  HIS A O   1 
ATOM   594  C CB  . HIS A 1 76  ? 4.356   50.185  -26.528 1.00 24.00 ? 75  HIS A CB  1 
ATOM   595  C CG  . HIS A 1 76  ? 3.451   51.250  -27.046 1.00 24.69 ? 75  HIS A CG  1 
ATOM   596  N ND1 . HIS A 1 76  ? 2.081   51.130  -27.027 1.00 29.09 ? 75  HIS A ND1 1 
ATOM   597  C CD2 . HIS A 1 76  ? 3.719   52.459  -27.590 1.00 28.17 ? 75  HIS A CD2 1 
ATOM   598  C CE1 . HIS A 1 76  ? 1.543   52.221  -27.543 1.00 31.11 ? 75  HIS A CE1 1 
ATOM   599  N NE2 . HIS A 1 76  ? 2.514   53.044  -27.891 1.00 26.94 ? 75  HIS A NE2 1 
ATOM   600  N N   . THR A 1 77  ? 4.079   52.301  -23.835 1.00 25.22 ? 76  THR A N   1 
ATOM   601  C CA  . THR A 1 77  ? 3.075   52.910  -22.995 1.00 27.35 ? 76  THR A CA  1 
ATOM   602  C C   . THR A 1 77  ? 2.258   53.803  -23.908 1.00 30.13 ? 76  THR A C   1 
ATOM   603  O O   . THR A 1 77  ? 2.827   54.644  -24.602 1.00 29.75 ? 76  THR A O   1 
ATOM   604  C CB  . THR A 1 77  ? 3.726   53.773  -21.907 1.00 27.74 ? 76  THR A CB  1 
ATOM   605  O OG1 . THR A 1 77  ? 4.603   52.967  -21.107 1.00 32.85 ? 76  THR A OG1 1 
ATOM   606  C CG2 . THR A 1 77  ? 2.664   54.382  -21.022 1.00 29.05 ? 76  THR A CG2 1 
ATOM   607  N N   . ASP A 1 78  ? 0.939   53.634  -23.948 1.00 29.39 ? 77  ASP A N   1 
ATOM   608  C CA  . ASP A 1 78  ? 0.143   54.516  -24.815 1.00 33.50 ? 77  ASP A CA  1 
ATOM   609  C C   . ASP A 1 78  ? -0.650  55.574  -24.075 1.00 27.55 ? 77  ASP A C   1 
ATOM   610  O O   . ASP A 1 78  ? -0.726  55.564  -22.849 1.00 28.26 ? 77  ASP A O   1 
ATOM   611  C CB  . ASP A 1 78  ? -0.773  53.728  -25.746 1.00 37.27 ? 77  ASP A CB  1 
ATOM   612  C CG  . ASP A 1 78  ? -1.626  52.759  -25.004 1.00 41.26 ? 77  ASP A CG  1 
ATOM   613  O OD1 . ASP A 1 78  ? -2.380  53.228  -24.115 1.00 40.26 ? 77  ASP A OD1 1 
ATOM   614  O OD2 . ASP A 1 78  ? -1.514  51.539  -25.284 1.00 42.28 ? 77  ASP A OD2 1 
ATOM   615  N N   . ALA A 1 79  ? -1.255  56.461  -24.857 1.00 29.30 ? 78  ALA A N   1 
ATOM   616  C CA  . ALA A 1 79  ? -1.833  57.712  -24.371 1.00 26.44 ? 78  ALA A CA  1 
ATOM   617  C C   . ALA A 1 79  ? -2.946  57.554  -23.330 1.00 28.82 ? 78  ALA A C   1 
ATOM   618  O O   . ALA A 1 79  ? -3.169  58.452  -22.521 1.00 31.00 ? 78  ALA A O   1 
ATOM   619  C CB  . ALA A 1 79  ? -2.314  58.528  -25.536 1.00 23.37 ? 78  ALA A CB  1 
ATOM   620  N N   . THR A 1 80  ? -3.627  56.411  -23.340 1.00 29.38 ? 79  THR A N   1 
ATOM   621  C CA  . THR A 1 80  ? -4.678  56.122  -22.359 1.00 28.70 ? 79  THR A CA  1 
ATOM   622  C C   . THR A 1 80  ? -4.171  55.523  -21.037 1.00 26.98 ? 79  THR A C   1 
ATOM   623  O O   . THR A 1 80  ? -4.951  55.302  -20.116 1.00 30.77 ? 79  THR A O   1 
ATOM   624  C CB  . THR A 1 80  ? -5.741  55.158  -22.931 1.00 28.31 ? 79  THR A CB  1 
ATOM   625  O OG1 . THR A 1 80  ? -5.187  53.840  -23.028 1.00 28.54 ? 79  THR A OG1 1 
ATOM   626  C CG2 . THR A 1 80  ? -6.231  55.624  -24.304 1.00 26.92 ? 79  THR A CG2 1 
ATOM   627  N N   . ASP A 1 81  ? -2.876  55.253  -20.943 1.00 29.05 ? 80  ASP A N   1 
ATOM   628  C CA  . ASP A 1 81  ? -2.311  54.653  -19.739 1.00 28.96 ? 80  ASP A CA  1 
ATOM   629  C C   . ASP A 1 81  ? -2.086  55.745  -18.704 1.00 30.03 ? 80  ASP A C   1 
ATOM   630  O O   . ASP A 1 81  ? -1.966  56.915  -19.066 1.00 31.93 ? 80  ASP A O   1 
ATOM   631  C CB  . ASP A 1 81  ? -0.994  53.949  -20.073 1.00 29.51 ? 80  ASP A CB  1 
ATOM   632  C CG  . ASP A 1 81  ? -0.462  53.115  -18.916 1.00 32.23 ? 80  ASP A CG  1 
ATOM   633  O OD1 . ASP A 1 81  ? -0.815  51.912  -18.830 1.00 31.73 ? 80  ASP A OD1 1 
ATOM   634  O OD2 . ASP A 1 81  ? 0.320   53.661  -18.098 1.00 31.68 ? 80  ASP A OD2 1 
ATOM   635  N N   . LYS A 1 82  ? -2.044  55.379  -17.425 1.00 28.52 ? 81  LYS A N   1 
ATOM   636  C CA  . LYS A 1 82  ? -1.780  56.356  -16.369 1.00 29.36 ? 81  LYS A CA  1 
ATOM   637  C C   . LYS A 1 82  ? -0.421  56.990  -16.543 1.00 30.31 ? 81  LYS A C   1 
ATOM   638  O O   . LYS A 1 82  ? -0.207  58.152  -16.171 1.00 34.36 ? 81  LYS A O   1 
ATOM   639  C CB  . LYS A 1 82  ? -1.812  55.698  -15.004 1.00 30.89 ? 81  LYS A CB  1 
ATOM   640  C CG  . LYS A 1 82  ? -3.121  55.030  -14.672 1.00 38.71 ? 81  LYS A CG  1 
ATOM   641  C CD  . LYS A 1 82  ? -3.183  54.662  -13.188 1.00 42.95 ? 81  LYS A CD  1 
ATOM   642  C CE  . LYS A 1 82  ? -1.829  54.164  -12.670 1.00 40.74 ? 81  LYS A CE  1 
ATOM   643  N NZ  . LYS A 1 82  ? -1.047  55.202  -11.934 1.00 39.42 ? 81  LYS A NZ  1 
ATOM   644  N N   . ASN A 1 83  ? 0.493   56.212  -17.113 1.00 27.84 ? 82  ASN A N   1 
ATOM   645  C CA  . ASN A 1 83  ? 1.865   56.649  -17.320 1.00 28.72 ? 82  ASN A CA  1 
ATOM   646  C C   . ASN A 1 83  ? 2.113   57.492  -18.574 1.00 27.23 ? 82  ASN A C   1 
ATOM   647  O O   . ASN A 1 83  ? 3.233   57.941  -18.826 1.00 26.20 ? 82  ASN A O   1 
ATOM   648  C CB  . ASN A 1 83  ? 2.801   55.448  -17.269 1.00 28.14 ? 82  ASN A CB  1 
ATOM   649  C CG  . ASN A 1 83  ? 3.121   55.052  -15.861 1.00 29.68 ? 82  ASN A CG  1 
ATOM   650  O OD1 . ASN A 1 83  ? 2.560   55.608  -14.921 1.00 31.16 ? 82  ASN A OD1 1 
ATOM   651  N ND2 . ASN A 1 83  ? 4.035   54.105  -15.695 1.00 30.90 ? 82  ASN A ND2 1 
ATOM   652  N N   . ALA A 1 84  ? 1.067   57.724  -19.350 1.00 25.58 ? 83  ALA A N   1 
ATOM   653  C CA  . ALA A 1 84  ? 1.205   58.541  -20.537 1.00 24.64 ? 83  ALA A CA  1 
ATOM   654  C C   . ALA A 1 84  ? 1.728   59.886  -20.135 1.00 26.62 ? 83  ALA A C   1 
ATOM   655  O O   . ALA A 1 84  ? 1.525   60.326  -18.999 1.00 31.23 ? 83  ALA A O   1 
ATOM   656  C CB  . ALA A 1 84  ? -0.125  58.691  -21.231 1.00 28.37 ? 83  ALA A CB  1 
ATOM   657  N N   . GLU A 1 85  ? 2.421   60.538  -21.057 1.00 27.44 ? 84  GLU A N   1 
ATOM   658  C CA  . GLU A 1 85  ? 2.821   61.913  -20.823 1.00 30.74 ? 84  GLU A CA  1 
ATOM   659  C C   . GLU A 1 85  ? 1.617   62.830  -21.046 1.00 30.87 ? 84  GLU A C   1 
ATOM   660  O O   . GLU A 1 85  ? 0.923   62.721  -22.060 1.00 25.78 ? 84  GLU A O   1 
ATOM   661  C CB  . GLU A 1 85  ? 3.990   62.318  -21.718 1.00 28.53 ? 84  GLU A CB  1 
ATOM   662  C CG  . GLU A 1 85  ? 4.503   63.709  -21.379 1.00 34.48 ? 84  GLU A CG  1 
ATOM   663  C CD  . GLU A 1 85  ? 5.604   64.193  -22.312 1.00 39.05 ? 84  GLU A CD  1 
ATOM   664  O OE1 . GLU A 1 85  ? 5.894   63.493  -23.315 1.00 35.34 ? 84  GLU A OE1 1 
ATOM   665  O OE2 . GLU A 1 85  ? 6.174   65.281  -22.037 1.00 40.26 ? 84  GLU A OE2 1 
ATOM   666  N N   . GLN A 1 86  ? 1.367   63.712  -20.078 1.00 31.85 ? 85  GLN A N   1 
ATOM   667  C CA  . GLN A 1 86  ? 0.223   64.612  -20.116 1.00 29.34 ? 85  GLN A CA  1 
ATOM   668  C C   . GLN A 1 86  ? 0.688   66.035  -19.897 1.00 32.78 ? 85  GLN A C   1 
ATOM   669  O O   . GLN A 1 86  ? 1.474   66.288  -18.993 1.00 36.23 ? 85  GLN A O   1 
ATOM   670  C CB  . GLN A 1 86  ? -0.783  64.245  -19.027 1.00 30.58 ? 85  GLN A CB  1 
ATOM   671  C CG  . GLN A 1 86  ? -1.193  62.791  -19.038 1.00 36.43 ? 85  GLN A CG  1 
ATOM   672  C CD  . GLN A 1 86  ? -2.242  62.477  -18.000 1.00 40.71 ? 85  GLN A CD  1 
ATOM   673  O OE1 . GLN A 1 86  ? -2.976  63.370  -17.559 1.00 39.04 ? 85  GLN A OE1 1 
ATOM   674  N NE2 . GLN A 1 86  ? -2.320  61.202  -17.598 1.00 35.47 ? 85  GLN A NE2 1 
ATOM   675  N N   . LYS A 1 87  ? 0.207   66.958  -20.728 1.00 33.33 ? 86  LYS A N   1 
ATOM   676  C CA  . LYS A 1 87  ? 0.461   68.394  -20.552 1.00 35.89 ? 86  LYS A CA  1 
ATOM   677  C C   . LYS A 1 87  ? -0.848  69.188  -20.629 1.00 34.88 ? 86  LYS A C   1 
ATOM   678  O O   . LYS A 1 87  ? -1.559  69.119  -21.626 1.00 37.22 ? 86  LYS A O   1 
ATOM   679  C CB  . LYS A 1 87  ? 1.442   68.911  -21.611 1.00 36.58 ? 86  LYS A CB  1 
ATOM   680  C CG  . LYS A 1 87  ? 2.851   68.301  -21.545 1.00 37.80 ? 86  LYS A CG  1 
ATOM   681  C CD  . LYS A 1 87  ? 3.936   69.386  -21.409 1.00 39.49 ? 86  LYS A CD  1 
ATOM   682  C CE  . LYS A 1 87  ? 5.323   68.768  -21.383 1.00 42.14 ? 86  LYS A CE  1 
ATOM   683  N NZ  . LYS A 1 87  ? 5.342   67.459  -20.643 1.00 37.71 ? 86  LYS A NZ  1 
ATOM   684  N N   . THR A 1 88  ? -1.168  69.941  -19.585 1.00 33.51 ? 87  THR A N   1 
ATOM   685  C CA  . THR A 1 88  ? -2.436  70.666  -19.559 1.00 35.16 ? 87  THR A CA  1 
ATOM   686  C C   . THR A 1 88  ? -2.296  72.188  -19.698 1.00 36.04 ? 87  THR A C   1 
ATOM   687  O O   . THR A 1 88  ? -1.597  72.840  -18.927 1.00 38.59 ? 87  THR A O   1 
ATOM   688  C CB  . THR A 1 88  ? -3.244  70.328  -18.303 1.00 34.08 ? 87  THR A CB  1 
ATOM   689  O OG1 . THR A 1 88  ? -3.669  68.967  -18.381 1.00 36.06 ? 87  THR A OG1 1 
ATOM   690  C CG2 . THR A 1 88  ? -4.468  71.222  -18.198 1.00 37.48 ? 87  THR A CG2 1 
ATOM   691  N N   . VAL A 1 89  ? -2.966  72.747  -20.695 1.00 34.05 ? 88  VAL A N   1 
ATOM   692  C CA  . VAL A 1 89  ? -2.963  74.185  -20.880 1.00 39.19 ? 88  VAL A CA  1 
ATOM   693  C C   . VAL A 1 89  ? -4.364  74.728  -20.646 1.00 42.15 ? 88  VAL A C   1 
ATOM   694  O O   . VAL A 1 89  ? -5.327  74.332  -21.311 1.00 39.47 ? 88  VAL A O   1 
ATOM   695  C CB  . VAL A 1 89  ? -2.460  74.578  -22.271 1.00 36.60 ? 88  VAL A CB  1 
ATOM   696  C CG1 . VAL A 1 89  ? -2.428  76.070  -22.409 1.00 38.54 ? 88  VAL A CG1 1 
ATOM   697  C CG2 . VAL A 1 89  ? -1.081  74.012  -22.497 1.00 39.07 ? 88  VAL A CG2 1 
ATOM   698  N N   . THR A 1 90  ? -4.478  75.623  -19.675 1.00 43.06 ? 89  THR A N   1 
ATOM   699  C CA  . THR A 1 90  ? -5.778  76.164  -19.314 1.00 44.95 ? 89  THR A CA  1 
ATOM   700  C C   . THR A 1 90  ? -5.872  77.646  -19.665 1.00 44.86 ? 89  THR A C   1 
ATOM   701  O O   . THR A 1 90  ? -4.860  78.333  -19.832 1.00 45.99 ? 89  THR A O   1 
ATOM   702  C CB  . THR A 1 90  ? -6.118  75.926  -17.811 1.00 45.35 ? 89  THR A CB  1 
ATOM   703  O OG1 . THR A 1 90  ? -5.120  76.529  -16.977 1.00 49.66 ? 89  THR A OG1 1 
ATOM   704  C CG2 . THR A 1 90  ? -6.191  74.444  -17.495 1.00 36.93 ? 89  THR A CG2 1 
ATOM   705  N N   . GLU A 1 91  ? -7.101  78.123  -19.803 1.00 44.70 ? 90  GLU A N   1 
ATOM   706  C CA  . GLU A 1 91  ? -7.355  79.536  -20.038 1.00 47.36 ? 90  GLU A CA  1 
ATOM   707  C C   . GLU A 1 91  ? -8.345  80.055  -19.010 1.00 47.54 ? 90  GLU A C   1 
ATOM   708  O O   . GLU A 1 91  ? -9.377  79.425  -18.745 1.00 46.31 ? 90  GLU A O   1 
ATOM   709  C CB  . GLU A 1 91  ? -7.918  79.749  -21.436 1.00 47.91 ? 90  GLU A CB  1 
ATOM   710  C CG  . GLU A 1 91  ? -8.354  81.172  -21.725 1.00 44.86 ? 90  GLU A CG  1 
ATOM   711  C CD  . GLU A 1 91  ? -9.157  81.273  -23.005 1.00 43.64 ? 90  GLU A CD  1 
ATOM   712  O OE1 . GLU A 1 91  ? -10.272 80.714  -23.037 1.00 45.73 ? 90  GLU A OE1 1 
ATOM   713  O OE2 . GLU A 1 91  ? -8.670  81.890  -23.983 1.00 41.17 ? 90  GLU A OE2 1 
ATOM   714  N N   . THR A 1 92  ? -8.025  81.208  -18.435 1.00 47.89 ? 91  THR A N   1 
ATOM   715  C CA  . THR A 1 92  ? -8.879  81.825  -17.432 1.00 49.32 ? 91  THR A CA  1 
ATOM   716  C C   . THR A 1 92  ? -9.229  83.266  -17.800 1.00 50.18 ? 91  THR A C   1 
ATOM   717  O O   . THR A 1 92  ? -8.347  84.087  -18.090 1.00 47.69 ? 91  THR A O   1 
ATOM   718  C CB  . THR A 1 92  ? -8.220  81.796  -16.039 1.00 49.15 ? 91  THR A CB  1 
ATOM   719  O OG1 . THR A 1 92  ? -7.881  80.446  -15.693 1.00 46.90 ? 91  THR A OG1 1 
ATOM   720  C CG2 . THR A 1 92  ? -9.165  82.353  -14.993 1.00 51.41 ? 91  THR A CG2 1 
ATOM   721  N N   . ILE A 1 93  ? -10.526 83.558  -17.799 1.00 52.66 ? 92  ILE A N   1 
ATOM   722  C CA  . ILE A 1 93  ? -11.000 84.922  -17.978 1.00 49.98 ? 92  ILE A CA  1 
ATOM   723  C C   . ILE A 1 93  ? -11.522 85.469  -16.661 1.00 48.60 ? 92  ILE A C   1 
ATOM   724  O O   . ILE A 1 93  ? -12.409 84.878  -16.053 1.00 47.88 ? 92  ILE A O   1 
ATOM   725  C CB  . ILE A 1 93  ? -12.133 85.002  -19.003 1.00 50.63 ? 92  ILE A CB  1 
ATOM   726  C CG1 . ILE A 1 93  ? -11.713 84.337  -20.305 1.00 48.32 ? 92  ILE A CG1 1 
ATOM   727  C CG2 . ILE A 1 93  ? -12.463 86.455  -19.280 1.00 55.65 ? 92  ILE A CG2 1 
ATOM   728  C CD1 . ILE A 1 93  ? -10.462 84.961  -20.891 1.00 50.66 ? 92  ILE A CD1 1 
ATOM   729  N N   . HIS A 1 94  ? -10.956 86.589  -16.219 1.00 53.80 ? 93  HIS A N   1 
ATOM   730  C CA  . HIS A 1 94  ? -11.475 87.315  -15.055 1.00 55.29 ? 93  HIS A CA  1 
ATOM   731  C C   . HIS A 1 94  ? -12.372 88.485  -15.489 1.00 52.29 ? 93  HIS A C   1 
ATOM   732  O O   . HIS A 1 94  ? -12.023 89.253  -16.390 1.00 50.64 ? 93  HIS A O   1 
ATOM   733  C CB  . HIS A 1 94  ? -10.337 87.834  -14.162 1.00 51.80 ? 93  HIS A CB  1 
ATOM   734  C CG  . HIS A 1 94  ? -9.481  86.754  -13.572 1.00 54.10 ? 93  HIS A CG  1 
ATOM   735  N ND1 . HIS A 1 94  ? -9.990  85.754  -12.771 1.00 49.36 ? 93  HIS A ND1 1 
ATOM   736  C CD2 . HIS A 1 94  ? -8.146  86.527  -13.658 1.00 54.86 ? 93  HIS A CD2 1 
ATOM   737  C CE1 . HIS A 1 94  ? -9.007  84.954  -12.395 1.00 53.88 ? 93  HIS A CE1 1 
ATOM   738  N NE2 . HIS A 1 94  ? -7.879  85.397  -12.924 1.00 55.85 ? 93  HIS A NE2 1 
ATOM   739  N N   . TYR A 1 95  ? -13.526 88.612  -14.846 1.00 48.10 ? 94  TYR A N   1 
ATOM   740  C CA  . TYR A 1 95  ? -14.428 89.722  -15.118 1.00 53.10 ? 94  TYR A CA  1 
ATOM   741  C C   . TYR A 1 95  ? -14.553 90.645  -13.889 1.00 54.32 ? 94  TYR A C   1 
ATOM   742  O O   . TYR A 1 95  ? -15.177 90.280  -12.895 1.00 53.21 ? 94  TYR A O   1 
ATOM   743  C CB  . TYR A 1 95  ? -15.807 89.194  -15.538 1.00 52.91 ? 94  TYR A CB  1 
ATOM   744  C CG  . TYR A 1 95  ? -15.811 88.271  -16.747 1.00 56.20 ? 94  TYR A CG  1 
ATOM   745  C CD1 . TYR A 1 95  ? -15.695 88.775  -18.038 1.00 58.73 ? 94  TYR A CD1 1 
ATOM   746  C CD2 . TYR A 1 95  ? -15.955 86.893  -16.596 1.00 59.15 ? 94  TYR A CD2 1 
ATOM   747  C CE1 . TYR A 1 95  ? -15.712 87.929  -19.148 1.00 59.51 ? 94  TYR A CE1 1 
ATOM   748  C CE2 . TYR A 1 95  ? -15.973 86.038  -17.699 1.00 58.22 ? 94  TYR A CE2 1 
ATOM   749  C CZ  . TYR A 1 95  ? -15.852 86.564  -18.971 1.00 59.61 ? 94  TYR A CZ  1 
ATOM   750  O OH  . TYR A 1 95  ? -15.868 85.721  -20.062 1.00 58.76 ? 94  TYR A OH  1 
ATOM   751  N N   . VAL A 1 96  ? -13.969 91.842  -13.958 1.00 55.96 ? 95  VAL A N   1 
ATOM   752  C CA  . VAL A 1 96  ? -13.926 92.737  -12.795 1.00 56.60 ? 95  VAL A CA  1 
ATOM   753  C C   . VAL A 1 96  ? -14.523 94.126  -13.034 1.00 58.01 ? 95  VAL A C   1 
ATOM   754  O O   . VAL A 1 96  ? -15.273 94.330  -13.986 1.00 60.51 ? 95  VAL A O   1 
ATOM   755  C CB  . VAL A 1 96  ? -12.485 92.908  -12.278 1.00 55.72 ? 95  VAL A CB  1 
ATOM   756  C CG1 . VAL A 1 96  ? -11.939 91.580  -11.802 1.00 54.59 ? 95  VAL A CG1 1 
ATOM   757  C CG2 . VAL A 1 96  ? -11.596 93.490  -13.362 1.00 56.40 ? 95  VAL A CG2 1 
ATOM   758  N N   . ASP A 1 97  ? -14.191 95.069  -12.149 1.00 63.06 ? 96  ASP A N   1 
ATOM   759  C CA  . ASP A 1 97  ? -14.554 96.488  -12.313 1.00 60.31 ? 96  ASP A CA  1 
ATOM   760  C C   . ASP A 1 97  ? -13.376 97.446  -12.050 1.00 59.58 ? 96  ASP A C   1 
ATOM   761  O O   . ASP A 1 97  ? -12.213 97.072  -12.204 1.00 64.17 ? 96  ASP A O   1 
ATOM   762  C CB  . ASP A 1 97  ? -15.772 96.857  -11.452 1.00 57.03 ? 96  ASP A CB  1 
ATOM   763  C CG  . ASP A 1 97  ? -15.526 96.683  -9.952  1.00 59.94 ? 96  ASP A CG  1 
ATOM   764  O OD1 . ASP A 1 97  ? -14.387 96.909  -9.479  1.00 59.96 ? 96  ASP A OD1 1 
ATOM   765  O OD2 . ASP A 1 97  ? -16.495 96.336  -9.237  1.00 55.00 ? 96  ASP A OD2 1 
ATOM   766  N N   . GLU A 1 98  ? -13.679 98.675  -11.642 1.00 60.86 ? 97  GLU A N   1 
ATOM   767  C CA  . GLU A 1 98  ? -12.644 99.680  -11.398 1.00 61.06 ? 97  GLU A CA  1 
ATOM   768  C C   . GLU A 1 98  ? -11.831 99.340  -10.157 1.00 60.73 ? 97  GLU A C   1 
ATOM   769  O O   . GLU A 1 98  ? -10.625 99.609  -10.089 1.00 57.59 ? 97  GLU A O   1 
ATOM   770  C CB  . GLU A 1 98  ? -13.274 101.062 -11.227 1.00 64.17 ? 97  GLU A CB  1 
ATOM   771  C CG  . GLU A 1 98  ? -14.322 101.403 -12.272 1.00 63.88 ? 97  GLU A CG  1 
ATOM   772  C CD  . GLU A 1 98  ? -13.725 101.665 -13.641 1.00 65.98 ? 97  GLU A CD  1 
ATOM   773  O OE1 . GLU A 1 98  ? -12.479 101.705 -13.764 1.00 64.86 ? 97  GLU A OE1 1 
ATOM   774  O OE2 . GLU A 1 98  ? -14.510 101.840 -14.596 1.00 68.36 ? 97  GLU A OE2 1 
ATOM   775  N N   . ASN A 1 99  ? -12.511 98.751  -9.177  1.00 61.58 ? 98  ASN A N   1 
ATOM   776  C CA  . ASN A 1 99  ? -11.885 98.359  -7.918  1.00 64.45 ? 98  ASN A CA  1 
ATOM   777  C C   . ASN A 1 99  ? -11.360 96.926  -7.961  1.00 61.62 ? 98  ASN A C   1 
ATOM   778  O O   . ASN A 1 99  ? -11.060 96.346  -6.915  1.00 60.15 ? 98  ASN A O   1 
ATOM   779  C CB  . ASN A 1 99  ? -12.874 98.492  -6.752  1.00 62.16 ? 98  ASN A CB  1 
ATOM   780  C CG  . ASN A 1 99  ? -13.708 99.764  -6.824  1.00 65.45 ? 98  ASN A CG  1 
ATOM   781  O OD1 . ASN A 1 99  ? -13.407 100.689 -7.595  1.00 59.37 ? 98  ASN A OD1 1 
ATOM   782  N ND2 . ASN A 1 99  ? -14.767 99.817  -6.012  1.00 64.12 ? 98  ASN A ND2 1 
ATOM   783  N N   . ASN A 1 100 ? -11.256 96.369  -9.168  1.00 59.76 ? 99  ASN A N   1 
ATOM   784  C CA  . ASN A 1 100 ? -10.855 94.978  -9.360  1.00 61.29 ? 99  ASN A CA  1 
ATOM   785  C C   . ASN A 1 100 ? -11.650 94.037  -8.443  1.00 60.02 ? 99  ASN A C   1 
ATOM   786  O O   . ASN A 1 100 ? -11.083 93.298  -7.635  1.00 54.76 ? 99  ASN A O   1 
ATOM   787  C CB  . ASN A 1 100 ? -9.340  94.814  -9.162  1.00 64.23 ? 99  ASN A CB  1 
ATOM   788  C CG  . ASN A 1 100 ? -8.819  93.445  -9.619  1.00 61.90 ? 99  ASN A CG  1 
ATOM   789  O OD1 . ASN A 1 100 ? -9.577  92.493  -9.770  1.00 62.02 ? 99  ASN A OD1 1 
ATOM   790  N ND2 . ASN A 1 100 ? -7.509  93.351  -9.825  1.00 67.31 ? 99  ASN A ND2 1 
ATOM   791  N N   . GLN A 1 101 ? -12.972 94.092  -8.571  1.00 59.24 ? 100 GLN A N   1 
ATOM   792  C CA  . GLN A 1 101 ? -13.872 93.251  -7.792  1.00 57.88 ? 100 GLN A CA  1 
ATOM   793  C C   . GLN A 1 101 ? -14.710 92.379  -8.735  1.00 59.10 ? 100 GLN A C   1 
ATOM   794  O O   . GLN A 1 101 ? -15.011 92.790  -9.858  1.00 58.35 ? 100 GLN A O   1 
ATOM   795  C CB  . GLN A 1 101 ? -14.778 94.124  -6.914  1.00 56.55 ? 100 GLN A CB  1 
ATOM   796  C CG  . GLN A 1 101 ? -14.055 94.904  -5.816  1.00 53.40 ? 100 GLN A CG  1 
ATOM   797  C CD  . GLN A 1 101 ? -14.122 94.216  -4.457  1.00 55.76 ? 100 GLN A CD  1 
ATOM   798  O OE1 . GLN A 1 101 ? -15.195 93.814  -3.995  1.00 56.24 ? 100 GLN A OE1 1 
ATOM   799  N NE2 . GLN A 1 101 ? -12.969 94.073  -3.815  1.00 54.06 ? 100 GLN A NE2 1 
ATOM   800  N N   . THR A 1 102 ? -15.091 91.186  -8.275  1.00 59.47 ? 101 THR A N   1 
ATOM   801  C CA  . THR A 1 102 ? -15.788 90.195  -9.117  1.00 60.87 ? 101 THR A CA  1 
ATOM   802  C C   . THR A 1 102 ? -17.185 90.637  -9.589  1.00 58.75 ? 101 THR A C   1 
ATOM   803  O O   . THR A 1 102 ? -18.102 90.755  -8.772  1.00 59.85 ? 101 THR A O   1 
ATOM   804  C CB  . THR A 1 102 ? -15.918 88.805  -8.394  1.00 58.02 ? 101 THR A CB  1 
ATOM   805  O OG1 . THR A 1 102 ? -14.620 88.287  -8.072  1.00 55.56 ? 101 THR A OG1 1 
ATOM   806  C CG2 . THR A 1 102 ? -16.655 87.797  -9.270  1.00 51.87 ? 101 THR A CG2 1 
ATOM   807  N N   . VAL A 1 103 ? -17.352 90.852  -10.899 1.00 56.11 ? 102 VAL A N   1 
ATOM   808  C CA  . VAL A 1 103 ? -18.664 91.225  -11.461 1.00 58.21 ? 102 VAL A CA  1 
ATOM   809  C C   . VAL A 1 103 ? -19.369 90.083  -12.205 1.00 55.89 ? 102 VAL A C   1 
ATOM   810  O O   . VAL A 1 103 ? -20.595 90.091  -12.345 1.00 52.89 ? 102 VAL A O   1 
ATOM   811  C CB  . VAL A 1 103 ? -18.598 92.495  -12.364 1.00 55.11 ? 102 VAL A CB  1 
ATOM   812  C CG1 . VAL A 1 103 ? -18.047 93.669  -11.582 1.00 54.23 ? 102 VAL A CG1 1 
ATOM   813  C CG2 . VAL A 1 103 ? -17.755 92.250  -13.613 1.00 54.64 ? 102 VAL A CG2 1 
ATOM   814  N N   . GLN A 1 104 ? -18.585 89.111  -12.675 1.00 58.60 ? 103 GLN A N   1 
ATOM   815  C CA  . GLN A 1 104 ? -19.099 87.905  -13.341 1.00 59.61 ? 103 GLN A CA  1 
ATOM   816  C C   . GLN A 1 104 ? -18.171 86.728  -13.019 1.00 55.94 ? 103 GLN A C   1 
ATOM   817  O O   . GLN A 1 104 ? -16.952 86.923  -12.918 1.00 53.80 ? 103 GLN A O   1 
ATOM   818  C CB  . GLN A 1 104 ? -19.178 88.113  -14.864 1.00 58.60 ? 103 GLN A CB  1 
ATOM   819  C CG  . GLN A 1 104 ? -20.349 88.976  -15.356 1.00 56.56 ? 103 GLN A CG  1 
ATOM   820  C CD  . GLN A 1 104 ? -21.641 88.190  -15.503 1.00 60.04 ? 103 GLN A CD  1 
ATOM   821  O OE1 . GLN A 1 104 ? -21.925 87.648  -16.568 1.00 61.42 ? 103 GLN A OE1 1 
ATOM   822  N NE2 . GLN A 1 104 ? -22.424 88.119  -14.431 1.00 62.15 ? 103 GLN A NE2 1 
ATOM   823  N N   . PRO A 1 105 ? -18.734 85.509  -12.853 1.00 56.91 ? 104 PRO A N   1 
ATOM   824  C CA  . PRO A 1 105 ? -17.898 84.330  -12.562 1.00 51.63 ? 104 PRO A CA  1 
ATOM   825  C C   . PRO A 1 105 ? -16.879 84.070  -13.668 1.00 49.14 ? 104 PRO A C   1 
ATOM   826  O O   . PRO A 1 105 ? -17.155 84.365  -14.829 1.00 49.79 ? 104 PRO A O   1 
ATOM   827  C CB  . PRO A 1 105 ? -18.913 83.187  -12.473 1.00 47.78 ? 104 PRO A CB  1 
ATOM   828  C CG  . PRO A 1 105 ? -20.121 83.675  -13.196 1.00 50.28 ? 104 PRO A CG  1 
ATOM   829  C CD  . PRO A 1 105 ? -20.160 85.157  -12.953 1.00 56.58 ? 104 PRO A CD  1 
ATOM   830  N N   . ASP A 1 106 ? -15.709 83.554  -13.306 1.00 51.66 ? 105 ASP A N   1 
ATOM   831  C CA  . ASP A 1 106 ? -14.647 83.289  -14.284 1.00 53.39 ? 105 ASP A CA  1 
ATOM   832  C C   . ASP A 1 106 ? -15.060 82.304  -15.387 1.00 51.34 ? 105 ASP A C   1 
ATOM   833  O O   . ASP A 1 106 ? -15.791 81.337  -15.143 1.00 45.16 ? 105 ASP A O   1 
ATOM   834  C CB  . ASP A 1 106 ? -13.385 82.752  -13.596 1.00 48.57 ? 105 ASP A CB  1 
ATOM   835  C CG  . ASP A 1 106 ? -12.564 83.837  -12.928 1.00 55.86 ? 105 ASP A CG  1 
ATOM   836  O OD1 . ASP A 1 106 ? -12.706 85.021  -13.308 1.00 55.20 ? 105 ASP A OD1 1 
ATOM   837  O OD2 . ASP A 1 106 ? -11.759 83.499  -12.027 1.00 56.71 ? 105 ASP A OD2 1 
ATOM   838  N N   . SER A 1 107 ? -14.595 82.567  -16.604 1.00 50.08 ? 106 SER A N   1 
ATOM   839  C CA  . SER A 1 107 ? -14.655 81.573  -17.661 1.00 50.52 ? 106 SER A CA  1 
ATOM   840  C C   . SER A 1 107 ? -13.357 80.792  -17.612 1.00 51.56 ? 106 SER A C   1 
ATOM   841  O O   . SER A 1 107 ? -12.260 81.368  -17.647 1.00 47.87 ? 106 SER A O   1 
ATOM   842  C CB  . SER A 1 107 ? -14.809 82.210  -19.040 1.00 54.04 ? 106 SER A CB  1 
ATOM   843  O OG  . SER A 1 107 ? -14.715 81.224  -20.061 1.00 47.82 ? 106 SER A OG  1 
ATOM   844  N N   . THR A 1 108 ? -13.484 79.478  -17.516 1.00 52.69 ? 107 THR A N   1 
ATOM   845  C CA  . THR A 1 108 ? -12.310 78.629  -17.475 1.00 51.38 ? 107 THR A CA  1 
ATOM   846  C C   . THR A 1 108 ? -12.474 77.438  -18.427 1.00 49.98 ? 107 THR A C   1 
ATOM   847  O O   . THR A 1 108 ? -13.489 76.733  -18.416 1.00 48.69 ? 107 THR A O   1 
ATOM   848  C CB  . THR A 1 108 ? -11.947 78.238  -16.009 1.00 50.38 ? 107 THR A CB  1 
ATOM   849  O OG1 . THR A 1 108 ? -10.531 78.072  -15.893 1.00 52.37 ? 107 THR A OG1 1 
ATOM   850  C CG2 . THR A 1 108 ? -12.673 76.973  -15.532 1.00 53.23 ? 107 THR A CG2 1 
ATOM   851  N N   . THR A 1 109 ? -11.492 77.260  -19.303 1.00 50.86 ? 108 THR A N   1 
ATOM   852  C CA  . THR A 1 109 ? -11.512 76.142  -20.243 1.00 53.29 ? 108 THR A CA  1 
ATOM   853  C C   . THR A 1 109 ? -10.139 75.455  -20.297 1.00 48.65 ? 108 THR A C   1 
ATOM   854  O O   . THR A 1 109 ? -9.104  76.114  -20.381 1.00 47.94 ? 108 THR A O   1 
ATOM   855  C CB  . THR A 1 109 ? -11.972 76.600  -21.649 1.00 51.66 ? 108 THR A CB  1 
ATOM   856  O OG1 . THR A 1 109 ? -11.083 77.609  -22.139 1.00 51.22 ? 108 THR A OG1 1 
ATOM   857  C CG2 . THR A 1 109 ? -13.385 77.184  -21.590 1.00 51.71 ? 108 THR A CG2 1 
ATOM   858  N N   . ALA A 1 110 ? -10.131 74.130  -20.230 1.00 46.62 ? 109 ALA A N   1 
ATOM   859  C CA  . ALA A 1 110 ? -8.874  73.398  -20.177 1.00 43.50 ? 109 ALA A CA  1 
ATOM   860  C C   . ALA A 1 110 ? -8.676  72.506  -21.400 1.00 48.43 ? 109 ALA A C   1 
ATOM   861  O O   . ALA A 1 110 ? -9.642  71.985  -21.966 1.00 50.59 ? 109 ALA A O   1 
ATOM   862  C CB  . ALA A 1 110 ? -8.814  72.565  -18.909 1.00 42.64 ? 109 ALA A CB  1 
ATOM   863  N N   . VAL A 1 111 ? -7.422  72.335  -21.810 1.00 45.75 ? 110 VAL A N   1 
ATOM   864  C CA  . VAL A 1 111 ? -7.083  71.307  -22.791 1.00 39.68 ? 110 VAL A CA  1 
ATOM   865  C C   . VAL A 1 111 ? -5.925  70.465  -22.269 1.00 36.68 ? 110 VAL A C   1 
ATOM   866  O O   . VAL A 1 111 ? -4.925  70.998  -21.801 1.00 35.40 ? 110 VAL A O   1 
ATOM   867  C CB  . VAL A 1 111 ? -6.768  71.884  -24.195 1.00 34.83 ? 110 VAL A CB  1 
ATOM   868  C CG1 . VAL A 1 111 ? -5.671  72.909  -24.121 1.00 39.81 ? 110 VAL A CG1 1 
ATOM   869  C CG2 . VAL A 1 111 ? -6.392  70.774  -25.159 1.00 32.56 ? 110 VAL A CG2 1 
ATOM   870  N N   . THR A 1 112 ? -6.092  69.146  -22.316 1.00 35.41 ? 111 THR A N   1 
ATOM   871  C CA  . THR A 1 112 ? -5.051  68.218  -21.900 1.00 35.37 ? 111 THR A CA  1 
ATOM   872  C C   . THR A 1 112 ? -4.494  67.488  -23.113 1.00 33.96 ? 111 THR A C   1 
ATOM   873  O O   . THR A 1 112 ? -5.238  66.818  -23.832 1.00 32.50 ? 111 THR A O   1 
ATOM   874  C CB  . THR A 1 112 ? -5.578  67.174  -20.890 1.00 35.44 ? 111 THR A CB  1 
ATOM   875  O OG1 . THR A 1 112 ? -5.931  67.823  -19.665 1.00 38.73 ? 111 THR A OG1 1 
ATOM   876  C CG2 . THR A 1 112 ? -4.521  66.126  -20.592 1.00 34.96 ? 111 THR A CG2 1 
ATOM   877  N N   . PHE A 1 113 ? -3.190  67.632  -23.340 1.00 30.13 ? 112 PHE A N   1 
ATOM   878  C CA  . PHE A 1 113 ? -2.503  66.908  -24.395 1.00 29.76 ? 112 PHE A CA  1 
ATOM   879  C C   . PHE A 1 113 ? -1.931  65.628  -23.801 1.00 29.71 ? 112 PHE A C   1 
ATOM   880  O O   . PHE A 1 113 ? -1.305  65.672  -22.747 1.00 31.39 ? 112 PHE A O   1 
ATOM   881  C CB  . PHE A 1 113 ? -1.378  67.759  -24.972 1.00 29.07 ? 112 PHE A CB  1 
ATOM   882  C CG  . PHE A 1 113 ? -1.855  68.938  -25.756 1.00 33.02 ? 112 PHE A CG  1 
ATOM   883  C CD1 . PHE A 1 113 ? -2.157  68.814  -27.101 1.00 31.79 ? 112 PHE A CD1 1 
ATOM   884  C CD2 . PHE A 1 113 ? -1.997  70.176  -25.154 1.00 34.38 ? 112 PHE A CD2 1 
ATOM   885  C CE1 . PHE A 1 113 ? -2.595  69.899  -27.832 1.00 32.93 ? 112 PHE A CE1 1 
ATOM   886  C CE2 . PHE A 1 113 ? -2.435  71.268  -25.881 1.00 35.53 ? 112 PHE A CE2 1 
ATOM   887  C CZ  . PHE A 1 113 ? -2.734  71.128  -27.223 1.00 36.32 ? 112 PHE A CZ  1 
ATOM   888  N N   . LYS A 1 114 ? -2.156  64.494  -24.460 1.00 25.67 ? 113 LYS A N   1 
ATOM   889  C CA  . LYS A 1 114 ? -1.656  63.206  -23.982 1.00 27.13 ? 113 LYS A CA  1 
ATOM   890  C C   . LYS A 1 114 ? -0.922  62.510  -25.111 1.00 27.73 ? 113 LYS A C   1 
ATOM   891  O O   . LYS A 1 114 ? -1.338  62.612  -26.264 1.00 28.89 ? 113 LYS A O   1 
ATOM   892  C CB  . LYS A 1 114 ? -2.813  62.319  -23.519 1.00 27.23 ? 113 LYS A CB  1 
ATOM   893  C CG  . LYS A 1 114 ? -3.379  62.672  -22.159 1.00 30.42 ? 113 LYS A CG  1 
ATOM   894  C CD  . LYS A 1 114 ? -4.721  62.001  -21.925 1.00 34.44 ? 113 LYS A CD  1 
ATOM   895  C CE  . LYS A 1 114 ? -4.980  61.794  -20.439 1.00 42.13 ? 113 LYS A CE  1 
ATOM   896  N NZ  . LYS A 1 114 ? -6.398  61.424  -20.161 1.00 47.20 ? 113 LYS A NZ  1 
ATOM   897  N N   . ARG A 1 115 ? 0.176   61.820  -24.803 1.00 28.40 ? 114 ARG A N   1 
ATOM   898  C CA  . ARG A 1 115 ? 0.832   60.967  -25.807 1.00 26.64 ? 114 ARG A CA  1 
ATOM   899  C C   . ARG A 1 115 ? 1.483   59.740  -25.210 1.00 26.47 ? 114 ARG A C   1 
ATOM   900  O O   . ARG A 1 115 ? 1.907   59.734  -24.053 1.00 27.14 ? 114 ARG A O   1 
ATOM   901  C CB  . ARG A 1 115 ? 1.870   61.728  -26.647 1.00 25.73 ? 114 ARG A CB  1 
ATOM   902  C CG  . ARG A 1 115 ? 3.165   62.053  -25.918 1.00 25.55 ? 114 ARG A CG  1 
ATOM   903  C CD  . ARG A 1 115 ? 4.187   62.669  -26.863 1.00 25.16 ? 114 ARG A CD  1 
ATOM   904  N NE  . ARG A 1 115 ? 5.328   63.253  -26.154 1.00 28.58 ? 114 ARG A NE  1 
ATOM   905  C CZ  . ARG A 1 115 ? 6.264   64.008  -26.728 1.00 26.48 ? 114 ARG A CZ  1 
ATOM   906  N NH1 . ARG A 1 115 ? 6.203   64.276  -28.023 1.00 22.77 ? 114 ARG A NH1 1 
ATOM   907  N NH2 . ARG A 1 115 ? 7.265   64.486  -26.006 1.00 25.07 ? 114 ARG A NH2 1 
ATOM   908  N N   . GLY A 1 116 ? 1.567   58.694  -26.014 1.00 27.38 ? 115 GLY A N   1 
ATOM   909  C CA  . GLY A 1 116 ? 2.291   57.509  -25.611 1.00 27.19 ? 115 GLY A CA  1 
ATOM   910  C C   . GLY A 1 116 ? 3.748   57.604  -26.019 1.00 26.41 ? 115 GLY A C   1 
ATOM   911  O O   . GLY A 1 116 ? 4.160   58.552  -26.685 1.00 26.48 ? 115 GLY A O   1 
ATOM   912  N N   . TYR A 1 117 ? 4.528   56.605  -25.628 1.00 27.76 ? 116 TYR A N   1 
ATOM   913  C CA  . TYR A 1 117 ? 5.938   56.541  -25.982 1.00 25.69 ? 116 TYR A CA  1 
ATOM   914  C C   . TYR A 1 117 ? 6.438   55.113  -25.877 1.00 25.49 ? 116 TYR A C   1 
ATOM   915  O O   . TYR A 1 117 ? 5.735   54.243  -25.376 1.00 26.66 ? 116 TYR A O   1 
ATOM   916  C CB  . TYR A 1 117 ? 6.748   57.447  -25.064 1.00 26.47 ? 116 TYR A CB  1 
ATOM   917  C CG  . TYR A 1 117 ? 6.427   57.263  -23.610 1.00 23.78 ? 116 TYR A CG  1 
ATOM   918  C CD1 . TYR A 1 117 ? 5.462   58.041  -22.991 1.00 24.71 ? 116 TYR A CD1 1 
ATOM   919  C CD2 . TYR A 1 117 ? 7.083   56.315  -22.855 1.00 24.83 ? 116 TYR A CD2 1 
ATOM   920  C CE1 . TYR A 1 117 ? 5.160   57.885  -21.651 1.00 24.69 ? 116 TYR A CE1 1 
ATOM   921  C CE2 . TYR A 1 117 ? 6.786   56.146  -21.513 1.00 27.99 ? 116 TYR A CE2 1 
ATOM   922  C CZ  . TYR A 1 117 ? 5.825   56.937  -20.918 1.00 28.41 ? 116 TYR A CZ  1 
ATOM   923  O OH  . TYR A 1 117 ? 5.527   56.766  -19.587 1.00 31.23 ? 116 TYR A OH  1 
ATOM   924  N N   . THR A 1 118 ? 7.650   54.870  -26.355 1.00 25.61 ? 117 THR A N   1 
ATOM   925  C CA  . THR A 1 118 ? 8.254   53.551  -26.236 1.00 24.70 ? 117 THR A CA  1 
ATOM   926  C C   . THR A 1 118 ? 9.550   53.616  -25.439 1.00 26.06 ? 117 THR A C   1 
ATOM   927  O O   . THR A 1 118 ? 10.394  54.473  -25.698 1.00 26.34 ? 117 THR A O   1 
ATOM   928  C CB  . THR A 1 118 ? 8.559   52.963  -27.604 1.00 26.33 ? 117 THR A CB  1 
ATOM   929  O OG1 . THR A 1 118 ? 7.359   52.944  -28.379 1.00 27.66 ? 117 THR A OG1 1 
ATOM   930  C CG2 . THR A 1 118 ? 9.087   51.535  -27.461 1.00 28.08 ? 117 THR A CG2 1 
ATOM   931  N N   . THR A 1 119 ? 9.697   52.716  -24.467 1.00 26.12 ? 118 THR A N   1 
ATOM   932  C CA  . THR A 1 119 ? 10.895  52.658  -23.637 1.00 26.73 ? 118 THR A CA  1 
ATOM   933  C C   . THR A 1 119 ? 11.707  51.420  -24.006 1.00 27.73 ? 118 THR A C   1 
ATOM   934  O O   . THR A 1 119 ? 11.127  50.387  -24.331 1.00 29.17 ? 118 THR A O   1 
ATOM   935  C CB  . THR A 1 119 ? 10.554  52.596  -22.139 1.00 26.31 ? 118 THR A CB  1 
ATOM   936  O OG1 . THR A 1 119 ? 9.675   53.670  -21.802 1.00 25.64 ? 118 THR A OG1 1 
ATOM   937  C CG2 . THR A 1 119 ? 11.808  52.728  -21.304 1.00 28.53 ? 118 THR A CG2 1 
ATOM   938  N N   . ASP A 1 120 ? 13.038  51.547  -23.976 1.00 24.70 ? 119 ASP A N   1 
ATOM   939  C CA  . ASP A 1 120 ? 13.965  50.445  -24.174 1.00 26.55 ? 119 ASP A CA  1 
ATOM   940  C C   . ASP A 1 120 ? 14.051  49.720  -22.839 1.00 26.03 ? 119 ASP A C   1 
ATOM   941  O O   . ASP A 1 120 ? 14.338  50.344  -21.830 1.00 26.35 ? 119 ASP A O   1 
ATOM   942  C CB  . ASP A 1 120 ? 15.323  51.032  -24.561 1.00 29.22 ? 119 ASP A CB  1 
ATOM   943  C CG  . ASP A 1 120 ? 16.374  49.976  -24.905 1.00 30.92 ? 119 ASP A CG  1 
ATOM   944  O OD1 . ASP A 1 120 ? 16.581  49.015  -24.122 1.00 29.97 ? 119 ASP A OD1 1 
ATOM   945  O OD2 . ASP A 1 120 ? 17.024  50.143  -25.962 1.00 27.83 ? 119 ASP A OD2 1 
ATOM   946  N N   . ASN A 1 121 ? 13.790  48.416  -22.829 1.00 23.67 ? 120 ASN A N   1 
ATOM   947  C CA  . ASN A 1 121 ? 13.782  47.640  -21.580 1.00 29.51 ? 120 ASN A CA  1 
ATOM   948  C C   . ASN A 1 121 ? 15.168  47.442  -20.964 1.00 33.71 ? 120 ASN A C   1 
ATOM   949  O O   . ASN A 1 121 ? 15.298  47.193  -19.756 1.00 36.68 ? 120 ASN A O   1 
ATOM   950  C CB  . ASN A 1 121 ? 13.155  46.253  -21.786 1.00 29.83 ? 120 ASN A CB  1 
ATOM   951  C CG  . ASN A 1 121 ? 11.642  46.293  -21.927 1.00 32.28 ? 120 ASN A CG  1 
ATOM   952  O OD1 . ASN A 1 121 ? 11.040  47.345  -22.186 1.00 31.99 ? 120 ASN A OD1 1 
ATOM   953  N ND2 . ASN A 1 121 ? 11.017  45.134  -21.764 1.00 33.02 ? 120 ASN A ND2 1 
ATOM   954  N N   . VAL A 1 122 ? 16.197  47.515  -21.801 1.00 30.41 ? 121 VAL A N   1 
ATOM   955  C CA  . VAL A 1 122 ? 17.558  47.305  -21.343 1.00 31.48 ? 121 VAL A CA  1 
ATOM   956  C C   . VAL A 1 122 ? 18.157  48.614  -20.849 1.00 30.00 ? 121 VAL A C   1 
ATOM   957  O O   . VAL A 1 122 ? 18.655  48.695  -19.732 1.00 32.79 ? 121 VAL A O   1 
ATOM   958  C CB  . VAL A 1 122 ? 18.451  46.703  -22.456 1.00 32.89 ? 121 VAL A CB  1 
ATOM   959  C CG1 . VAL A 1 122 ? 19.908  46.751  -22.049 1.00 30.37 ? 121 VAL A CG1 1 
ATOM   960  C CG2 . VAL A 1 122 ? 18.027  45.269  -22.776 1.00 26.61 ? 121 VAL A CG2 1 
ATOM   961  N N   . THR A 1 123 ? 18.099  49.651  -21.665 1.00 25.58 ? 122 THR A N   1 
ATOM   962  C CA  . THR A 1 123 ? 18.715  50.891  -21.246 1.00 29.31 ? 122 THR A CA  1 
ATOM   963  C C   . THR A 1 123 ? 17.837  51.638  -20.256 1.00 33.08 ? 122 THR A C   1 
ATOM   964  O O   . THR A 1 123 ? 18.340  52.282  -19.336 1.00 35.55 ? 122 THR A O   1 
ATOM   965  C CB  . THR A 1 123 ? 19.031  51.805  -22.431 1.00 31.01 ? 122 THR A CB  1 
ATOM   966  O OG1 . THR A 1 123 ? 17.814  52.336  -22.963 1.00 31.04 ? 122 THR A OG1 1 
ATOM   967  C CG2 . THR A 1 123 ? 19.749  51.031  -23.509 1.00 28.79 ? 122 THR A CG2 1 
ATOM   968  N N   . GLY A 1 124 ? 16.524  51.560  -20.451 1.00 33.94 ? 123 GLY A N   1 
ATOM   969  C CA  . GLY A 1 124 ? 15.585  52.288  -19.613 1.00 30.96 ? 123 GLY A CA  1 
ATOM   970  C C   . GLY A 1 124 ? 15.241  53.676  -20.130 1.00 31.80 ? 123 GLY A C   1 
ATOM   971  O O   . GLY A 1 124 ? 14.385  54.362  -19.564 1.00 35.28 ? 123 GLY A O   1 
ATOM   972  N N   . LYS A 1 125 ? 15.897  54.092  -21.210 1.00 28.47 ? 124 LYS A N   1 
ATOM   973  C CA  . LYS A 1 125 ? 15.618  55.389  -21.828 1.00 29.50 ? 124 LYS A CA  1 
ATOM   974  C C   . LYS A 1 125 ? 14.536  55.292  -22.920 1.00 31.23 ? 124 LYS A C   1 
ATOM   975  O O   . LYS A 1 125 ? 14.300  54.220  -23.471 1.00 28.74 ? 124 LYS A O   1 
ATOM   976  C CB  . LYS A 1 125 ? 16.910  55.970  -22.392 1.00 31.55 ? 124 LYS A CB  1 
ATOM   977  C CG  . LYS A 1 125 ? 18.030  56.010  -21.353 1.00 37.53 ? 124 LYS A CG  1 
ATOM   978  C CD  . LYS A 1 125 ? 19.352  56.464  -21.946 1.00 40.68 ? 124 LYS A CD  1 
ATOM   979  C CE  . LYS A 1 125 ? 20.311  56.917  -20.854 1.00 48.75 ? 124 LYS A CE  1 
ATOM   980  N NZ  . LYS A 1 125 ? 21.642  57.285  -21.433 1.00 56.86 ? 124 LYS A NZ  1 
ATOM   981  N N   . VAL A 1 126 ? 13.864  56.400  -23.227 1.00 30.37 ? 125 VAL A N   1 
ATOM   982  C CA  . VAL A 1 126 ? 12.783  56.330  -24.209 1.00 26.36 ? 125 VAL A CA  1 
ATOM   983  C C   . VAL A 1 126 ? 13.300  56.593  -25.613 1.00 26.04 ? 125 VAL A C   1 
ATOM   984  O O   . VAL A 1 126 ? 14.086  57.511  -25.835 1.00 29.17 ? 125 VAL A O   1 
ATOM   985  C CB  . VAL A 1 126 ? 11.547  57.222  -23.835 1.00 26.15 ? 125 VAL A CB  1 
ATOM   986  C CG1 . VAL A 1 126 ? 11.705  57.806  -22.449 1.00 28.77 ? 125 VAL A CG1 1 
ATOM   987  C CG2 . VAL A 1 126 ? 11.296  58.308  -24.861 1.00 27.13 ? 125 VAL A CG2 1 
ATOM   988  N N   . VAL A 1 127 ? 12.853  55.772  -26.555 1.00 25.64 ? 126 VAL A N   1 
ATOM   989  C CA  . VAL A 1 127 ? 13.403  55.774  -27.903 1.00 23.57 ? 126 VAL A CA  1 
ATOM   990  C C   . VAL A 1 127 ? 12.507  56.446  -28.943 1.00 25.28 ? 126 VAL A C   1 
ATOM   991  O O   . VAL A 1 127 ? 12.999  56.906  -29.975 1.00 28.54 ? 126 VAL A O   1 
ATOM   992  C CB  . VAL A 1 127 ? 13.788  54.341  -28.342 1.00 25.78 ? 126 VAL A CB  1 
ATOM   993  C CG1 . VAL A 1 127 ? 14.539  53.642  -27.214 1.00 28.44 ? 126 VAL A CG1 1 
ATOM   994  C CG2 . VAL A 1 127 ? 12.576  53.521  -28.704 1.00 26.74 ? 126 VAL A CG2 1 
ATOM   995  N N   . SER A 1 128 ? 11.202  56.518  -28.680 1.00 24.44 ? 127 SER A N   1 
ATOM   996  C CA  . SER A 1 128 ? 10.307  57.259  -29.574 1.00 26.73 ? 127 SER A CA  1 
ATOM   997  C C   . SER A 1 128 ? 9.043   57.736  -28.869 1.00 28.11 ? 127 SER A C   1 
ATOM   998  O O   . SER A 1 128 ? 8.765   57.314  -27.750 1.00 28.10 ? 127 SER A O   1 
ATOM   999  C CB  . SER A 1 128 ? 9.940   56.442  -30.810 1.00 24.33 ? 127 SER A CB  1 
ATOM   1000 O OG  . SER A 1 128 ? 9.040   55.409  -30.467 1.00 26.88 ? 127 SER A OG  1 
ATOM   1001 N N   . TYR A 1 129 ? 8.301   58.630  -29.530 1.00 29.57 ? 128 TYR A N   1 
ATOM   1002 C CA  . TYR A 1 129 ? 7.040   59.160  -29.015 1.00 25.98 ? 128 TYR A CA  1 
ATOM   1003 C C   . TYR A 1 129 ? 5.969   59.026  -30.083 1.00 25.78 ? 128 TYR A C   1 
ATOM   1004 O O   . TYR A 1 129 ? 6.242   59.210  -31.269 1.00 25.36 ? 128 TYR A O   1 
ATOM   1005 C CB  . TYR A 1 129 ? 7.178   60.632  -28.633 1.00 27.42 ? 128 TYR A CB  1 
ATOM   1006 C CG  . TYR A 1 129 ? 8.077   60.911  -27.437 1.00 30.65 ? 128 TYR A CG  1 
ATOM   1007 C CD1 . TYR A 1 129 ? 7.560   60.954  -26.137 1.00 31.52 ? 128 TYR A CD1 1 
ATOM   1008 C CD2 . TYR A 1 129 ? 9.433   61.149  -27.604 1.00 28.67 ? 128 TYR A CD2 1 
ATOM   1009 C CE1 . TYR A 1 129 ? 8.376   61.219  -25.034 1.00 27.22 ? 128 TYR A CE1 1 
ATOM   1010 C CE2 . TYR A 1 129 ? 10.255  61.407  -26.513 1.00 30.65 ? 128 TYR A CE2 1 
ATOM   1011 C CZ  . TYR A 1 129 ? 9.722   61.441  -25.233 1.00 30.17 ? 128 TYR A CZ  1 
ATOM   1012 O OH  . TYR A 1 129 ? 10.549  61.695  -24.159 1.00 34.02 ? 128 TYR A OH  1 
ATOM   1013 N N   . ASP A 1 130 ? 4.756   58.691  -29.652 1.00 25.08 ? 129 ASP A N   1 
ATOM   1014 C CA  . ASP A 1 130 ? 3.598   58.610  -30.534 1.00 22.88 ? 129 ASP A CA  1 
ATOM   1015 C C   . ASP A 1 130 ? 3.078   60.011  -30.770 1.00 23.90 ? 129 ASP A C   1 
ATOM   1016 O O   . ASP A 1 130 ? 3.438   60.937  -30.051 1.00 24.26 ? 129 ASP A O   1 
ATOM   1017 C CB  . ASP A 1 130 ? 2.516   57.772  -29.873 1.00 25.78 ? 129 ASP A CB  1 
ATOM   1018 C CG  . ASP A 1 130 ? 2.931   56.316  -29.707 1.00 31.57 ? 129 ASP A CG  1 
ATOM   1019 O OD1 . ASP A 1 130 ? 3.832   55.876  -30.463 1.00 34.55 ? 129 ASP A OD1 1 
ATOM   1020 O OD2 . ASP A 1 130 ? 2.359   55.613  -28.833 1.00 28.29 ? 129 ASP A OD2 1 
ATOM   1021 N N   . PRO A 1 131 ? 2.227   60.188  -31.779 1.00 24.85 ? 130 PRO A N   1 
ATOM   1022 C CA  . PRO A 1 131 ? 1.720   61.552  -31.985 1.00 24.29 ? 130 PRO A CA  1 
ATOM   1023 C C   . PRO A 1 131 ? 0.907   62.076  -30.792 1.00 22.65 ? 130 PRO A C   1 
ATOM   1024 O O   . PRO A 1 131 ? 0.219   61.300  -30.142 1.00 23.45 ? 130 PRO A O   1 
ATOM   1025 C CB  . PRO A 1 131 ? 0.811   61.408  -33.213 1.00 24.00 ? 130 PRO A CB  1 
ATOM   1026 C CG  . PRO A 1 131 ? 1.218   60.115  -33.868 1.00 24.47 ? 130 PRO A CG  1 
ATOM   1027 C CD  . PRO A 1 131 ? 1.708   59.228  -32.769 1.00 23.18 ? 130 PRO A CD  1 
ATOM   1028 N N   . TRP A 1 132 ? 1.004   63.372  -30.508 1.00 25.04 ? 131 TRP A N   1 
ATOM   1029 C CA  . TRP A 1 132 ? 0.170   64.028  -29.501 1.00 23.36 ? 131 TRP A CA  1 
ATOM   1030 C C   . TRP A 1 132 ? -1.316  63.823  -29.770 1.00 24.21 ? 131 TRP A C   1 
ATOM   1031 O O   . TRP A 1 132 ? -1.772  63.920  -30.910 1.00 24.29 ? 131 TRP A O   1 
ATOM   1032 C CB  . TRP A 1 132 ? 0.441   65.529  -29.515 1.00 24.18 ? 131 TRP A CB  1 
ATOM   1033 C CG  . TRP A 1 132 ? 1.675   65.947  -28.804 1.00 26.01 ? 131 TRP A CG  1 
ATOM   1034 C CD1 . TRP A 1 132 ? 2.786   66.528  -29.349 1.00 24.54 ? 131 TRP A CD1 1 
ATOM   1035 C CD2 . TRP A 1 132 ? 1.925   65.835  -27.401 1.00 25.55 ? 131 TRP A CD2 1 
ATOM   1036 N NE1 . TRP A 1 132 ? 3.717   66.779  -28.365 1.00 22.65 ? 131 TRP A NE1 1 
ATOM   1037 C CE2 . TRP A 1 132 ? 3.214   66.360  -27.164 1.00 22.80 ? 131 TRP A CE2 1 
ATOM   1038 C CE3 . TRP A 1 132 ? 1.190   65.329  -26.325 1.00 24.62 ? 131 TRP A CE3 1 
ATOM   1039 C CZ2 . TRP A 1 132 ? 3.779   66.396  -25.899 1.00 23.55 ? 131 TRP A CZ2 1 
ATOM   1040 C CZ3 . TRP A 1 132 ? 1.753   65.366  -25.068 1.00 26.01 ? 131 TRP A CZ3 1 
ATOM   1041 C CH2 . TRP A 1 132 ? 3.035   65.902  -24.863 1.00 26.89 ? 131 TRP A CH2 1 
ATOM   1042 N N   . THR A 1 133 ? -2.081  63.558  -28.719 1.00 24.70 ? 132 THR A N   1 
ATOM   1043 C CA  . THR A 1 133 ? -3.525  63.392  -28.863 1.00 25.75 ? 132 THR A CA  1 
ATOM   1044 C C   . THR A 1 133 ? -4.295  64.292  -27.903 1.00 27.30 ? 132 THR A C   1 
ATOM   1045 O O   . THR A 1 133 ? -3.865  64.514  -26.769 1.00 28.07 ? 132 THR A O   1 
ATOM   1046 C CB  . THR A 1 133 ? -3.980  61.906  -28.662 1.00 29.68 ? 132 THR A CB  1 
ATOM   1047 O OG1 . THR A 1 133 ? -3.667  61.463  -27.333 1.00 28.41 ? 132 THR A OG1 1 
ATOM   1048 C CG2 . THR A 1 133 ? -3.318  60.975  -29.675 1.00 23.20 ? 132 THR A CG2 1 
ATOM   1049 N N   . VAL A 1 134 ? -5.425  64.816  -28.373 1.00 29.22 ? 133 VAL A N   1 
ATOM   1050 C CA  . VAL A 1 134 ? -6.357  65.580  -27.537 1.00 29.55 ? 133 VAL A CA  1 
ATOM   1051 C C   . VAL A 1 134 ? -7.710  64.877  -27.522 1.00 33.02 ? 133 VAL A C   1 
ATOM   1052 O O   . VAL A 1 134 ? -8.348  64.738  -28.568 1.00 33.56 ? 133 VAL A O   1 
ATOM   1053 C CB  . VAL A 1 134 ? -6.580  66.980  -28.098 1.00 28.46 ? 133 VAL A CB  1 
ATOM   1054 C CG1 . VAL A 1 134 ? -7.663  67.687  -27.318 1.00 29.37 ? 133 VAL A CG1 1 
ATOM   1055 C CG2 . VAL A 1 134 ? -5.286  67.765  -28.089 1.00 28.10 ? 133 VAL A CG2 1 
ATOM   1056 N N   . ASP A 1 135 ? -8.147  64.440  -26.346 1.00 33.35 ? 134 ASP A N   1 
ATOM   1057 C CA  . ASP A 1 135 ? -9.336  63.595  -26.234 1.00 35.53 ? 134 ASP A CA  1 
ATOM   1058 C C   . ASP A 1 135 ? -9.336  62.468  -27.261 1.00 34.58 ? 134 ASP A C   1 
ATOM   1059 O O   . ASP A 1 135 ? -10.256 62.372  -28.076 1.00 34.08 ? 134 ASP A O   1 
ATOM   1060 C CB  . ASP A 1 135 ? -10.614 64.422  -26.382 1.00 41.83 ? 134 ASP A CB  1 
ATOM   1061 C CG  . ASP A 1 135 ? -10.867 65.321  -25.184 1.00 48.71 ? 134 ASP A CG  1 
ATOM   1062 O OD1 . ASP A 1 135 ? -10.531 64.903  -24.048 1.00 50.46 ? 134 ASP A OD1 1 
ATOM   1063 O OD2 . ASP A 1 135 ? -11.395 66.442  -25.381 1.00 50.29 ? 134 ASP A OD2 1 
ATOM   1064 N N   . GLY A 1 136 ? -8.287  61.646  -27.230 1.00 31.23 ? 135 GLY A N   1 
ATOM   1065 C CA  . GLY A 1 136 ? -8.162  60.486  -28.094 1.00 27.93 ? 135 GLY A CA  1 
ATOM   1066 C C   . GLY A 1 136 ? -8.031  60.715  -29.593 1.00 29.27 ? 135 GLY A C   1 
ATOM   1067 O O   . GLY A 1 136 ? -8.091  59.767  -30.368 1.00 33.59 ? 135 GLY A O   1 
ATOM   1068 N N   . ASN A 1 137 ? -7.856  61.960  -30.014 1.00 28.44 ? 136 ASN A N   1 
ATOM   1069 C CA  . ASN A 1 137 ? -7.683  62.251  -31.431 1.00 28.70 ? 136 ASN A CA  1 
ATOM   1070 C C   . ASN A 1 137 ? -6.343  62.916  -31.725 1.00 29.88 ? 136 ASN A C   1 
ATOM   1071 O O   . ASN A 1 137 ? -5.908  63.811  -30.991 1.00 27.74 ? 136 ASN A O   1 
ATOM   1072 C CB  . ASN A 1 137 ? -8.822  63.132  -31.948 1.00 32.13 ? 136 ASN A CB  1 
ATOM   1073 C CG  . ASN A 1 137 ? -10.142 62.391  -32.027 1.00 36.41 ? 136 ASN A CG  1 
ATOM   1074 O OD1 . ASN A 1 137 ? -10.183 61.159  -31.934 1.00 34.77 ? 136 ASN A OD1 1 
ATOM   1075 N ND2 . ASN A 1 137 ? -11.232 63.137  -32.213 1.00 34.86 ? 136 ASN A ND2 1 
ATOM   1076 N N   . GLN A 1 138 ? -5.695  62.491  -32.804 1.00 25.88 ? 137 GLN A N   1 
ATOM   1077 C CA  . GLN A 1 138 ? -4.382  63.021  -33.132 1.00 27.48 ? 137 GLN A CA  1 
ATOM   1078 C C   . GLN A 1 138 ? -4.410  64.529  -33.415 1.00 26.68 ? 137 GLN A C   1 
ATOM   1079 O O   . GLN A 1 138 ? -5.090  64.978  -34.326 1.00 26.88 ? 137 GLN A O   1 
ATOM   1080 C CB  . GLN A 1 138 ? -3.771  62.251  -34.302 1.00 25.05 ? 137 GLN A CB  1 
ATOM   1081 C CG  . GLN A 1 138 ? -2.418  62.770  -34.726 1.00 25.85 ? 137 GLN A CG  1 
ATOM   1082 C CD  . GLN A 1 138 ? -2.501  63.784  -35.855 1.00 28.34 ? 137 GLN A CD  1 
ATOM   1083 O OE1 . GLN A 1 138 ? -3.197  63.577  -36.848 1.00 29.10 ? 137 GLN A OE1 1 
ATOM   1084 N NE2 . GLN A 1 138 ? -1.797  64.889  -35.700 1.00 31.87 ? 137 GLN A NE2 1 
ATOM   1085 N N   . ALA A 1 139 ? -3.667  65.298  -32.620 1.00 27.35 ? 138 ALA A N   1 
ATOM   1086 C CA  . ALA A 1 139 ? -3.577  66.748  -32.789 1.00 28.01 ? 138 ALA A CA  1 
ATOM   1087 C C   . ALA A 1 139 ? -2.365  67.315  -32.052 1.00 29.11 ? 138 ALA A C   1 
ATOM   1088 O O   . ALA A 1 139 ? -2.044  66.879  -30.949 1.00 26.24 ? 138 ALA A O   1 
ATOM   1089 C CB  . ALA A 1 139 ? -4.844  67.423  -32.302 1.00 25.15 ? 138 ALA A CB  1 
ATOM   1090 N N   . ASP A 1 140 ? -1.712  68.295  -32.671 1.00 29.75 ? 139 ASP A N   1 
ATOM   1091 C CA  . ASP A 1 140 ? -0.529  68.938  -32.111 1.00 30.04 ? 139 ASP A CA  1 
ATOM   1092 C C   . ASP A 1 140 ? -0.826  70.298  -31.528 1.00 33.30 ? 139 ASP A C   1 
ATOM   1093 O O   . ASP A 1 140 ? 0.046   70.937  -30.941 1.00 37.69 ? 139 ASP A O   1 
ATOM   1094 C CB  . ASP A 1 140 ? 0.541   69.104  -33.177 1.00 30.71 ? 139 ASP A CB  1 
ATOM   1095 C CG  . ASP A 1 140 ? 1.264   67.816  -33.466 1.00 34.54 ? 139 ASP A CG  1 
ATOM   1096 O OD1 . ASP A 1 140 ? 1.173   66.886  -32.628 1.00 34.68 ? 139 ASP A OD1 1 
ATOM   1097 O OD2 . ASP A 1 140 ? 1.926   67.732  -34.522 1.00 34.86 ? 139 ASP A OD2 1 
ATOM   1098 N N   . SER A 1 141 ? -2.056  70.752  -31.710 1.00 37.11 ? 140 SER A N   1 
ATOM   1099 C CA  . SER A 1 141 ? -2.490  72.024  -31.148 1.00 37.25 ? 140 SER A CA  1 
ATOM   1100 C C   . SER A 1 141 ? -3.998  72.035  -30.997 1.00 36.27 ? 140 SER A C   1 
ATOM   1101 O O   . SER A 1 141 ? -4.685  71.087  -31.370 1.00 37.36 ? 140 SER A O   1 
ATOM   1102 C CB  . SER A 1 141 ? -2.041  73.184  -32.025 1.00 32.17 ? 140 SER A CB  1 
ATOM   1103 O OG  . SER A 1 141 ? -2.429  72.964  -33.364 1.00 32.29 ? 140 SER A OG  1 
ATOM   1104 N N   . LYS A 1 142 ? -4.513  73.110  -30.436 1.00 38.07 ? 141 LYS A N   1 
ATOM   1105 C CA  . LYS A 1 142 ? -5.940  73.228  -30.195 1.00 41.85 ? 141 LYS A CA  1 
ATOM   1106 C C   . LYS A 1 142 ? -6.203  74.716  -30.142 1.00 40.24 ? 141 LYS A C   1 
ATOM   1107 O O   . LYS A 1 142 ? -5.395  75.473  -29.606 1.00 40.43 ? 141 LYS A O   1 
ATOM   1108 C CB  . LYS A 1 142 ? -6.323  72.520  -28.880 1.00 39.86 ? 141 LYS A CB  1 
ATOM   1109 C CG  . LYS A 1 142 ? -7.731  72.777  -28.360 1.00 39.04 ? 141 LYS A CG  1 
ATOM   1110 C CD  . LYS A 1 142 ? -8.810  72.395  -29.372 1.00 43.44 ? 141 LYS A CD  1 
ATOM   1111 C CE  . LYS A 1 142 ? -10.208 72.493  -28.742 1.00 45.01 ? 141 LYS A CE  1 
ATOM   1112 N NZ  . LYS A 1 142 ? -10.351 73.729  -27.889 1.00 44.12 ? 141 LYS A NZ  1 
ATOM   1113 N N   . THR A 1 143 ? -7.289  75.157  -30.756 1.00 43.83 ? 142 THR A N   1 
ATOM   1114 C CA  . THR A 1 143 ? -7.633  76.563  -30.666 1.00 45.08 ? 142 THR A CA  1 
ATOM   1115 C C   . THR A 1 143 ? -8.712  76.712  -29.611 1.00 44.78 ? 142 THR A C   1 
ATOM   1116 O O   . THR A 1 143 ? -9.661  75.925  -29.554 1.00 40.55 ? 142 THR A O   1 
ATOM   1117 C CB  . THR A 1 143 ? -8.113  77.147  -32.005 1.00 44.13 ? 142 THR A CB  1 
ATOM   1118 O OG1 . THR A 1 143 ? -9.337  76.513  -32.394 1.00 42.12 ? 142 THR A OG1 1 
ATOM   1119 C CG2 . THR A 1 143 ? -7.060  76.951  -33.087 1.00 43.26 ? 142 THR A CG2 1 
ATOM   1120 N N   . PHE A 1 144 ? -8.543  77.703  -28.746 1.00 45.31 ? 143 PHE A N   1 
ATOM   1121 C CA  . PHE A 1 144 ? -9.577  78.004  -27.786 1.00 46.06 ? 143 PHE A CA  1 
ATOM   1122 C C   . PHE A 1 144 ? -10.638 78.821  -28.493 1.00 48.43 ? 143 PHE A C   1 
ATOM   1123 O O   . PHE A 1 144 ? -10.314 79.783  -29.200 1.00 50.90 ? 143 PHE A O   1 
ATOM   1124 C CB  . PHE A 1 144 ? -9.003  78.782  -26.616 1.00 44.12 ? 143 PHE A CB  1 
ATOM   1125 C CG  . PHE A 1 144 ? -8.356  77.920  -25.584 1.00 44.47 ? 143 PHE A CG  1 
ATOM   1126 C CD1 . PHE A 1 144 ? -9.085  76.928  -24.936 1.00 47.24 ? 143 PHE A CD1 1 
ATOM   1127 C CD2 . PHE A 1 144 ? -7.024  78.102  -25.246 1.00 42.29 ? 143 PHE A CD2 1 
ATOM   1128 C CE1 . PHE A 1 144 ? -8.495  76.126  -23.971 1.00 46.69 ? 143 PHE A CE1 1 
ATOM   1129 C CE2 . PHE A 1 144 ? -6.424  77.307  -24.281 1.00 43.27 ? 143 PHE A CE2 1 
ATOM   1130 C CZ  . PHE A 1 144 ? -7.162  76.314  -23.642 1.00 46.94 ? 143 PHE A CZ  1 
ATOM   1131 N N   . ALA A 1 145 ? -11.898 78.427  -28.327 1.00 46.25 ? 144 ALA A N   1 
ATOM   1132 C CA  . ALA A 1 145 ? -12.994 79.211  -28.872 1.00 50.17 ? 144 ALA A CA  1 
ATOM   1133 C C   . ALA A 1 145 ? -12.933 80.596  -28.243 1.00 54.98 ? 144 ALA A C   1 
ATOM   1134 O O   . ALA A 1 145 ? -12.742 80.714  -27.031 1.00 53.94 ? 144 ALA A O   1 
ATOM   1135 C CB  . ALA A 1 145 ? -14.323 78.547  -28.572 1.00 47.62 ? 144 ALA A CB  1 
ATOM   1136 N N   . ALA A 1 146 ? -13.049 81.639  -29.062 1.00 56.69 ? 145 ALA A N   1 
ATOM   1137 C CA  . ALA A 1 146 ? -13.157 82.995  -28.538 1.00 54.27 ? 145 ALA A CA  1 
ATOM   1138 C C   . ALA A 1 146 ? -14.348 83.068  -27.579 1.00 54.16 ? 145 ALA A C   1 
ATOM   1139 O O   . ALA A 1 146 ? -15.401 82.475  -27.836 1.00 52.65 ? 145 ALA A O   1 
ATOM   1140 C CB  . ALA A 1 146 ? -13.310 83.994  -29.672 1.00 54.72 ? 145 ALA A CB  1 
ATOM   1141 N N   . VAL A 1 147 ? -14.171 83.761  -26.457 1.00 57.64 ? 146 VAL A N   1 
ATOM   1142 C CA  . VAL A 1 147 ? -15.250 83.895  -25.471 1.00 59.18 ? 146 VAL A CA  1 
ATOM   1143 C C   . VAL A 1 147 ? -15.847 85.307  -25.427 1.00 60.79 ? 146 VAL A C   1 
ATOM   1144 O O   . VAL A 1 147 ? -15.129 86.307  -25.257 1.00 56.07 ? 146 VAL A O   1 
ATOM   1145 C CB  . VAL A 1 147 ? -14.832 83.443  -24.039 1.00 56.27 ? 146 VAL A CB  1 
ATOM   1146 C CG1 . VAL A 1 147 ? -15.812 83.965  -23.000 1.00 53.02 ? 146 VAL A CG1 1 
ATOM   1147 C CG2 . VAL A 1 147 ? -14.747 81.931  -23.957 1.00 54.61 ? 146 VAL A CG2 1 
ATOM   1148 N N   . PRO A 1 148 ? -17.175 85.384  -25.607 1.00 64.30 ? 147 PRO A N   1 
ATOM   1149 C CA  . PRO A 1 148 ? -17.931 86.629  -25.492 1.00 62.22 ? 147 PRO A CA  1 
ATOM   1150 C C   . PRO A 1 148 ? -18.043 87.030  -24.030 1.00 62.03 ? 147 PRO A C   1 
ATOM   1151 O O   . PRO A 1 148 ? -18.472 86.212  -23.200 1.00 59.34 ? 147 PRO A O   1 
ATOM   1152 C CB  . PRO A 1 148 ? -19.319 86.246  -26.027 1.00 55.04 ? 147 PRO A CB  1 
ATOM   1153 C CG  . PRO A 1 148 ? -19.115 84.977  -26.784 1.00 56.87 ? 147 PRO A CG  1 
ATOM   1154 C CD  . PRO A 1 148 ? -18.033 84.270  -26.045 1.00 56.26 ? 147 PRO A CD  1 
ATOM   1155 N N   . SER A 1 149 ? -17.640 88.261  -23.724 1.00 60.85 ? 148 SER A N   1 
ATOM   1156 C CA  . SER A 1 149 ? -17.887 88.848  -22.414 1.00 62.28 ? 148 SER A CA  1 
ATOM   1157 C C   . SER A 1 149 ? -19.398 88.929  -22.221 1.00 63.16 ? 148 SER A C   1 
ATOM   1158 O O   . SER A 1 149 ? -20.100 89.429  -23.104 1.00 63.00 ? 148 SER A O   1 
ATOM   1159 C CB  . SER A 1 149 ? -17.295 90.259  -22.343 1.00 62.33 ? 148 SER A CB  1 
ATOM   1160 O OG  . SER A 1 149 ? -15.948 90.294  -22.784 1.00 62.52 ? 148 SER A OG  1 
ATOM   1161 N N   . PRO A 1 150 ? -19.910 88.439  -21.075 1.00 57.47 ? 149 PRO A N   1 
ATOM   1162 C CA  . PRO A 1 150 ? -21.361 88.473  -20.865 1.00 57.14 ? 149 PRO A CA  1 
ATOM   1163 C C   . PRO A 1 150 ? -21.873 89.905  -20.620 1.00 61.72 ? 149 PRO A C   1 
ATOM   1164 O O   . PRO A 1 150 ? -21.092 90.812  -20.314 1.00 56.18 ? 149 PRO A O   1 
ATOM   1165 C CB  . PRO A 1 150 ? -21.561 87.613  -19.614 1.00 52.43 ? 149 PRO A CB  1 
ATOM   1166 C CG  . PRO A 1 150 ? -20.236 86.997  -19.314 1.00 53.19 ? 149 PRO A CG  1 
ATOM   1167 C CD  . PRO A 1 150 ? -19.205 87.883  -19.911 1.00 52.49 ? 149 PRO A CD  1 
ATOM   1168 N N   . ALA A 1 151 ? -23.181 90.098  -20.763 1.00 64.61 ? 150 ALA A N   1 
ATOM   1169 C CA  . ALA A 1 151 ? -23.787 91.414  -20.605 1.00 57.52 ? 150 ALA A CA  1 
ATOM   1170 C C   . ALA A 1 151 ? -24.157 91.659  -19.154 1.00 60.82 ? 150 ALA A C   1 
ATOM   1171 O O   . ALA A 1 151 ? -24.880 90.867  -18.541 1.00 60.22 ? 150 ALA A O   1 
ATOM   1172 C CB  . ALA A 1 151 ? -25.021 91.551  -21.492 1.00 50.81 ? 150 ALA A CB  1 
ATOM   1173 N N   . VAL A 1 152 ? -23.640 92.756  -18.609 1.00 63.58 ? 151 VAL A N   1 
ATOM   1174 C CA  . VAL A 1 152 ? -24.038 93.227  -17.291 1.00 63.24 ? 151 VAL A CA  1 
ATOM   1175 C C   . VAL A 1 152 ? -24.647 94.610  -17.474 1.00 63.04 ? 151 VAL A C   1 
ATOM   1176 O O   . VAL A 1 152 ? -23.959 95.551  -17.875 1.00 65.65 ? 151 VAL A O   1 
ATOM   1177 C CB  . VAL A 1 152 ? -22.841 93.309  -16.323 1.00 63.41 ? 151 VAL A CB  1 
ATOM   1178 C CG1 . VAL A 1 152 ? -23.328 93.484  -14.895 1.00 63.09 ? 151 VAL A CG1 1 
ATOM   1179 C CG2 . VAL A 1 152 ? -21.990 92.062  -16.433 1.00 63.74 ? 151 VAL A CG2 1 
ATOM   1180 N N   . GLU A 1 153 ? -25.945 94.726  -17.218 1.00 62.50 ? 152 GLU A N   1 
ATOM   1181 C CA  . GLU A 1 153 ? -26.614 96.009  -17.369 1.00 67.12 ? 152 GLU A CA  1 
ATOM   1182 C C   . GLU A 1 153 ? -26.064 96.954  -16.324 1.00 62.09 ? 152 GLU A C   1 
ATOM   1183 O O   . GLU A 1 153 ? -25.915 96.590  -15.158 1.00 60.87 ? 152 GLU A O   1 
ATOM   1184 C CB  . GLU A 1 153 ? -28.128 95.865  -17.219 1.00 69.06 ? 152 GLU A CB  1 
ATOM   1185 C CG  . GLU A 1 153 ? -28.542 95.039  -16.014 1.00 68.43 ? 152 GLU A CG  1 
ATOM   1186 C CD  . GLU A 1 153 ? -30.042 95.009  -15.814 1.00 69.83 ? 152 GLU A CD  1 
ATOM   1187 O OE1 . GLU A 1 153 ? -30.508 94.170  -15.008 1.00 67.94 ? 152 GLU A OE1 1 
ATOM   1188 O OE2 . GLU A 1 153 ? -30.748 95.824  -16.458 1.00 71.28 ? 152 GLU A OE2 1 
ATOM   1189 N N   . GLY A 1 154 ? -25.738 98.164  -16.752 1.00 62.88 ? 153 GLY A N   1 
ATOM   1190 C CA  . GLY A 1 154 ? -25.172 99.151  -15.856 1.00 61.16 ? 153 GLY A CA  1 
ATOM   1191 C C   . GLY A 1 154 ? -23.693 99.306  -16.113 1.00 61.62 ? 153 GLY A C   1 
ATOM   1192 O O   . GLY A 1 154 ? -23.067 100.254 -15.634 1.00 61.76 ? 153 GLY A O   1 
ATOM   1193 N N   . TYR A 1 155 ? -23.133 98.370  -16.877 1.00 64.77 ? 154 TYR A N   1 
ATOM   1194 C CA  . TYR A 1 155 ? -21.711 98.416  -17.226 1.00 67.31 ? 154 TYR A CA  1 
ATOM   1195 C C   . TYR A 1 155 ? -21.467 98.107  -18.705 1.00 63.94 ? 154 TYR A C   1 
ATOM   1196 O O   . TYR A 1 155 ? -22.329 97.538  -19.377 1.00 65.44 ? 154 TYR A O   1 
ATOM   1197 C CB  . TYR A 1 155 ? -20.910 97.436  -16.361 1.00 63.33 ? 154 TYR A CB  1 
ATOM   1198 C CG  . TYR A 1 155 ? -21.026 97.663  -14.865 1.00 61.50 ? 154 TYR A CG  1 
ATOM   1199 C CD1 . TYR A 1 155 ? -20.076 98.416  -14.178 1.00 58.80 ? 154 TYR A CD1 1 
ATOM   1200 C CD2 . TYR A 1 155 ? -22.077 97.112  -14.140 1.00 56.56 ? 154 TYR A CD2 1 
ATOM   1201 C CE1 . TYR A 1 155 ? -20.174 98.614  -12.815 1.00 54.18 ? 154 TYR A CE1 1 
ATOM   1202 C CE2 . TYR A 1 155 ? -22.184 97.309  -12.778 1.00 54.01 ? 154 TYR A CE2 1 
ATOM   1203 C CZ  . TYR A 1 155 ? -21.230 98.057  -12.120 1.00 52.31 ? 154 TYR A CZ  1 
ATOM   1204 O OH  . TYR A 1 155 ? -21.343 98.253  -10.762 1.00 54.01 ? 154 TYR A OH  1 
ATOM   1205 N N   . THR A 1 156 ? -20.301 98.512  -19.207 1.00 59.53 ? 155 THR A N   1 
ATOM   1206 C CA  . THR A 1 156 ? -19.819 98.060  -20.509 1.00 60.74 ? 155 THR A CA  1 
ATOM   1207 C C   . THR A 1 156 ? -18.342 97.700  -20.402 1.00 64.03 ? 155 THR A C   1 
ATOM   1208 O O   . THR A 1 156 ? -17.525 98.541  -20.006 1.00 58.52 ? 155 THR A O   1 
ATOM   1209 C CB  . THR A 1 156 ? -19.984 99.109  -21.632 1.00 57.98 ? 155 THR A CB  1 
ATOM   1210 O OG1 . THR A 1 156 ? -19.028 100.165 -21.455 1.00 62.35 ? 155 THR A OG1 1 
ATOM   1211 C CG2 . THR A 1 156 ? -21.411 99.662  -21.679 1.00 57.09 ? 155 THR A CG2 1 
ATOM   1212 N N   . PRO A 1 157 ? -18.003 96.443  -20.760 1.00 64.68 ? 156 PRO A N   1 
ATOM   1213 C CA  . PRO A 1 157 ? -16.651 95.859  -20.738 1.00 60.53 ? 156 PRO A CA  1 
ATOM   1214 C C   . PRO A 1 157 ? -15.694 96.486  -21.754 1.00 61.07 ? 156 PRO A C   1 
ATOM   1215 O O   . PRO A 1 157 ? -16.130 96.915  -22.823 1.00 61.11 ? 156 PRO A O   1 
ATOM   1216 C CB  . PRO A 1 157 ? -16.904 94.391  -21.095 1.00 63.95 ? 156 PRO A CB  1 
ATOM   1217 C CG  . PRO A 1 157 ? -18.199 94.392  -21.839 1.00 62.92 ? 156 PRO A CG  1 
ATOM   1218 C CD  . PRO A 1 157 ? -19.017 95.467  -21.200 1.00 61.41 ? 156 PRO A CD  1 
ATOM   1219 N N   . ASN A 1 158 ? -14.405 96.531  -21.420 1.00 63.32 ? 157 ASN A N   1 
ATOM   1220 C CA  . ASN A 1 158 ? -13.396 97.144  -22.292 1.00 63.83 ? 157 ASN A CA  1 
ATOM   1221 C C   . ASN A 1 158 ? -12.925 96.253  -23.450 1.00 69.72 ? 157 ASN A C   1 
ATOM   1222 O O   . ASN A 1 158 ? -12.151 96.697  -24.306 1.00 70.00 ? 157 ASN A O   1 
ATOM   1223 C CB  . ASN A 1 158 ? -12.194 97.667  -21.483 1.00 65.61 ? 157 ASN A CB  1 
ATOM   1224 C CG  . ASN A 1 158 ? -11.597 96.615  -20.542 1.00 68.82 ? 157 ASN A CG  1 
ATOM   1225 O OD1 . ASN A 1 158 ? -11.940 95.427  -20.600 1.00 62.79 ? 157 ASN A OD1 1 
ATOM   1226 N ND2 . ASN A 1 158 ? -10.688 97.057  -19.671 1.00 66.35 ? 157 ASN A ND2 1 
ATOM   1227 N N   . HIS A 1 159 ? -13.381 94.998  -23.452 1.00 68.28 ? 158 HIS A N   1 
ATOM   1228 C CA  . HIS A 1 159 ? -13.206 94.074  -24.576 1.00 64.70 ? 158 HIS A CA  1 
ATOM   1229 C C   . HIS A 1 159 ? -14.517 93.321  -24.757 1.00 63.90 ? 158 HIS A C   1 
ATOM   1230 O O   . HIS A 1 159 ? -14.963 92.626  -23.843 1.00 62.91 ? 158 HIS A O   1 
ATOM   1231 C CB  . HIS A 1 159 ? -12.083 93.063  -24.309 1.00 60.70 ? 158 HIS A CB  1 
ATOM   1232 C CG  . HIS A 1 159 ? -10.728 93.679  -24.148 1.00 63.24 ? 158 HIS A CG  1 
ATOM   1233 N ND1 . HIS A 1 159 ? -10.217 94.603  -25.036 1.00 68.53 ? 158 HIS A ND1 1 
ATOM   1234 C CD2 . HIS A 1 159 ? -9.771  93.491  -23.209 1.00 61.99 ? 158 HIS A CD2 1 
ATOM   1235 C CE1 . HIS A 1 159 ? -9.007  94.965  -24.645 1.00 65.49 ? 158 HIS A CE1 1 
ATOM   1236 N NE2 . HIS A 1 159 ? -8.713  94.305  -23.538 1.00 64.72 ? 158 HIS A NE2 1 
ATOM   1237 N N   . GLN A 1 160 ? -15.135 93.457  -25.927 1.00 65.37 ? 159 GLN A N   1 
ATOM   1238 C CA  . GLN A 1 160 ? -16.418 92.801  -26.192 1.00 69.44 ? 159 GLN A CA  1 
ATOM   1239 C C   . GLN A 1 160 ? -16.309 91.269  -26.092 1.00 68.74 ? 159 GLN A C   1 
ATOM   1240 O O   . GLN A 1 160 ? -17.250 90.577  -25.677 1.00 66.61 ? 159 GLN A O   1 
ATOM   1241 C CB  . GLN A 1 160 ? -16.963 93.235  -27.560 1.00 72.32 ? 159 GLN A CB  1 
ATOM   1242 C CG  . GLN A 1 160 ? -18.312 92.620  -27.940 1.00 80.35 ? 159 GLN A CG  1 
ATOM   1243 C CD  . GLN A 1 160 ? -19.373 92.795  -26.860 1.00 84.92 ? 159 GLN A CD  1 
ATOM   1244 O OE1 . GLN A 1 160 ? -19.895 93.898  -26.649 1.00 80.97 ? 159 GLN A OE1 1 
ATOM   1245 N NE2 . GLN A 1 160 ? -19.696 91.700  -26.167 1.00 79.17 ? 159 GLN A NE2 1 
ATOM   1246 N N   . GLN A 1 161 ? -15.145 90.755  -26.467 1.00 62.81 ? 160 GLN A N   1 
ATOM   1247 C CA  . GLN A 1 161 ? -14.841 89.345  -26.326 1.00 61.39 ? 160 GLN A CA  1 
ATOM   1248 C C   . GLN A 1 161 ? -13.333 89.215  -26.328 1.00 60.55 ? 160 GLN A C   1 
ATOM   1249 O O   . GLN A 1 161 ? -12.622 90.096  -26.816 1.00 57.46 ? 160 GLN A O   1 
ATOM   1250 C CB  . GLN A 1 161 ? -15.405 88.555  -27.504 1.00 63.70 ? 160 GLN A CB  1 
ATOM   1251 C CG  . GLN A 1 161 ? -14.771 88.944  -28.833 1.00 63.39 ? 160 GLN A CG  1 
ATOM   1252 C CD  . GLN A 1 161 ? -14.991 87.919  -29.928 1.00 66.66 ? 160 GLN A CD  1 
ATOM   1253 O OE1 . GLN A 1 161 ? -16.015 87.226  -29.960 1.00 64.62 ? 160 GLN A OE1 1 
ATOM   1254 N NE2 . GLN A 1 161 ? -14.024 87.818  -30.838 1.00 62.05 ? 160 GLN A NE2 1 
ATOM   1255 N N   . ILE A 1 162 ? -12.826 88.122  -25.787 1.00 59.44 ? 161 ILE A N   1 
ATOM   1256 C CA  . ILE A 1 162 ? -11.419 87.856  -26.000 1.00 62.36 ? 161 ILE A CA  1 
ATOM   1257 C C   . ILE A 1 162 ? -11.266 86.799  -27.102 1.00 61.52 ? 161 ILE A C   1 
ATOM   1258 O O   . ILE A 1 162 ? -12.097 85.889  -27.232 1.00 55.91 ? 161 ILE A O   1 
ATOM   1259 C CB  . ILE A 1 162 ? -10.689 87.500  -24.702 1.00 58.93 ? 161 ILE A CB  1 
ATOM   1260 C CG1 . ILE A 1 162 ? -9.164  87.551  -24.922 1.00 63.05 ? 161 ILE A CG1 1 
ATOM   1261 C CG2 . ILE A 1 162 ? -11.189 86.162  -24.171 1.00 52.83 ? 161 ILE A CG2 1 
ATOM   1262 C CD1 . ILE A 1 162 ? -8.651  88.805  -25.670 1.00 55.88 ? 161 ILE A CD1 1 
ATOM   1263 N N   . ASN A 1 163 ? -10.217 86.960  -27.906 1.00 60.20 ? 162 ASN A N   1 
ATOM   1264 C CA  . ASN A 1 163 ? -10.040 86.226  -29.158 1.00 60.35 ? 162 ASN A CA  1 
ATOM   1265 C C   . ASN A 1 163 ? -9.941  84.712  -29.060 1.00 60.94 ? 162 ASN A C   1 
ATOM   1266 O O   . ASN A 1 163 ? -10.088 84.110  -27.994 1.00 59.13 ? 162 ASN A O   1 
ATOM   1267 C CB  . ASN A 1 163 ? -8.785  86.735  -29.874 1.00 62.58 ? 162 ASN A CB  1 
ATOM   1268 C CG  . ASN A 1 163 ? -8.857  88.211  -30.180 1.00 61.82 ? 162 ASN A CG  1 
ATOM   1269 O OD1 . ASN A 1 163 ? -9.858  88.862  -29.880 1.00 61.09 ? 162 ASN A OD1 1 
ATOM   1270 N ND2 . ASN A 1 163 ? -7.798  88.750  -30.778 1.00 53.38 ? 162 ASN A ND2 1 
ATOM   1271 N N   . GLU A 1 164 ? -9.698  84.101  -30.211 1.00 64.47 ? 163 GLU A N   1 
ATOM   1272 C CA  . GLU A 1 164 ? -9.247  82.728  -30.244 1.00 57.82 ? 163 GLU A CA  1 
ATOM   1273 C C   . GLU A 1 164 ? -7.756  82.768  -30.017 1.00 56.73 ? 163 GLU A C   1 
ATOM   1274 O O   . GLU A 1 164 ? -7.080  83.737  -30.391 1.00 58.32 ? 163 GLU A O   1 
ATOM   1275 C CB  . GLU A 1 164 ? -9.492  82.106  -31.604 1.00 54.79 ? 163 GLU A CB  1 
ATOM   1276 C CG  . GLU A 1 164 ? -10.913 81.763  -31.905 1.00 54.65 ? 163 GLU A CG  1 
ATOM   1277 C CD  . GLU A 1 164 ? -11.019 81.071  -33.243 1.00 60.36 ? 163 GLU A CD  1 
ATOM   1278 O OE1 . GLU A 1 164 ? -10.190 81.379  -34.134 1.00 55.55 ? 163 GLU A OE1 1 
ATOM   1279 O OE2 . GLU A 1 164 ? -11.911 80.207  -33.397 1.00 65.54 ? 163 GLU A OE2 1 
ATOM   1280 N N   . PHE A 1 165 ? -7.254  81.709  -29.401 1.00 51.46 ? 164 PHE A N   1 
ATOM   1281 C CA  . PHE A 1 165 ? -5.830  81.523  -29.215 1.00 51.52 ? 164 PHE A CA  1 
ATOM   1282 C C   . PHE A 1 165 ? -5.514  80.052  -29.486 1.00 49.91 ? 164 PHE A C   1 
ATOM   1283 O O   . PHE A 1 165 ? -6.253  79.155  -29.052 1.00 43.67 ? 164 PHE A O   1 
ATOM   1284 C CB  . PHE A 1 165 ? -5.417  81.934  -27.796 1.00 49.99 ? 164 PHE A CB  1 
ATOM   1285 C CG  . PHE A 1 165 ? -5.112  83.405  -27.649 1.00 56.40 ? 164 PHE A CG  1 
ATOM   1286 C CD1 . PHE A 1 165 ? -4.473  84.106  -28.672 1.00 58.82 ? 164 PHE A CD1 1 
ATOM   1287 C CD2 . PHE A 1 165 ? -5.464  84.090  -26.491 1.00 55.22 ? 164 PHE A CD2 1 
ATOM   1288 C CE1 . PHE A 1 165 ? -4.184  85.462  -28.542 1.00 57.89 ? 164 PHE A CE1 1 
ATOM   1289 C CE2 . PHE A 1 165 ? -5.183  85.450  -26.350 1.00 55.46 ? 164 PHE A CE2 1 
ATOM   1290 C CZ  . PHE A 1 165 ? -4.541  86.135  -27.378 1.00 61.99 ? 164 PHE A CZ  1 
ATOM   1291 N N   . THR A 1 166 ? -4.443  79.809  -30.236 1.00 45.81 ? 165 THR A N   1 
ATOM   1292 C CA  . THR A 1 166 ? -4.010  78.448  -30.505 1.00 44.87 ? 165 THR A CA  1 
ATOM   1293 C C   . THR A 1 166 ? -2.909  78.087  -29.517 1.00 46.92 ? 165 THR A C   1 
ATOM   1294 O O   . THR A 1 166 ? -2.047  78.914  -29.215 1.00 43.11 ? 165 THR A O   1 
ATOM   1295 C CB  . THR A 1 166 ? -3.494  78.269  -31.950 1.00 44.58 ? 165 THR A CB  1 
ATOM   1296 O OG1 . THR A 1 166 ? -4.544  78.563  -32.880 1.00 42.85 ? 165 THR A OG1 1 
ATOM   1297 C CG2 . THR A 1 166 ? -3.035  76.833  -32.177 1.00 42.91 ? 165 THR A CG2 1 
ATOM   1298 N N   . VAL A 1 167 ? -2.946  76.858  -29.002 1.00 44.29 ? 166 VAL A N   1 
ATOM   1299 C CA  . VAL A 1 167 ? -1.942  76.412  -28.046 1.00 41.57 ? 166 VAL A CA  1 
ATOM   1300 C C   . VAL A 1 167 ? -1.362  75.039  -28.416 1.00 43.52 ? 166 VAL A C   1 
ATOM   1301 O O   . VAL A 1 167 ? -2.054  74.191  -28.979 1.00 42.28 ? 166 VAL A O   1 
ATOM   1302 C CB  . VAL A 1 167 ? -2.518  76.386  -26.614 1.00 40.47 ? 166 VAL A CB  1 
ATOM   1303 C CG1 . VAL A 1 167 ? -2.815  77.794  -26.143 1.00 39.40 ? 166 VAL A CG1 1 
ATOM   1304 C CG2 . VAL A 1 167 ? -3.772  75.541  -26.564 1.00 38.04 ? 166 VAL A CG2 1 
ATOM   1305 N N   . THR A 1 168 ? -0.081  74.840  -28.111 1.00 44.02 ? 167 THR A N   1 
ATOM   1306 C CA  . THR A 1 168 ? 0.580   73.552  -28.290 1.00 39.71 ? 167 THR A CA  1 
ATOM   1307 C C   . THR A 1 168 ? 0.806   72.956  -26.902 1.00 40.84 ? 167 THR A C   1 
ATOM   1308 O O   . THR A 1 168 ? 0.534   73.618  -25.901 1.00 38.02 ? 167 THR A O   1 
ATOM   1309 C CB  . THR A 1 168 ? 1.938   73.720  -28.991 1.00 43.74 ? 167 THR A CB  1 
ATOM   1310 O OG1 . THR A 1 168 ? 2.851   74.381  -28.105 1.00 45.91 ? 167 THR A OG1 1 
ATOM   1311 C CG2 . THR A 1 168 ? 1.789   74.500  -30.287 1.00 40.15 ? 167 THR A CG2 1 
ATOM   1312 N N   . PRO A 1 169 ? 1.294   71.702  -26.826 1.00 40.94 ? 168 PRO A N   1 
ATOM   1313 C CA  . PRO A 1 169 ? 1.589   71.144  -25.496 1.00 40.21 ? 168 PRO A CA  1 
ATOM   1314 C C   . PRO A 1 169 ? 2.578   71.991  -24.679 1.00 41.58 ? 168 PRO A C   1 
ATOM   1315 O O   . PRO A 1 169 ? 2.589   71.964  -23.442 1.00 35.43 ? 168 PRO A O   1 
ATOM   1316 C CB  . PRO A 1 169 ? 2.217   69.790  -25.827 1.00 33.56 ? 168 PRO A CB  1 
ATOM   1317 C CG  . PRO A 1 169 ? 1.619   69.419  -27.129 1.00 33.20 ? 168 PRO A CG  1 
ATOM   1318 C CD  . PRO A 1 169 ? 1.399   70.680  -27.887 1.00 32.54 ? 168 PRO A CD  1 
ATOM   1319 N N   . ASP A 1 170 ? 3.401   72.750  -25.387 1.00 43.65 ? 169 ASP A N   1 
ATOM   1320 C CA  . ASP A 1 170 ? 4.477   73.492  -24.756 1.00 49.45 ? 169 ASP A CA  1 
ATOM   1321 C C   . ASP A 1 170 ? 3.977   74.801  -24.133 1.00 50.64 ? 169 ASP A C   1 
ATOM   1322 O O   . ASP A 1 170 ? 4.530   75.273  -23.135 1.00 51.34 ? 169 ASP A O   1 
ATOM   1323 C CB  . ASP A 1 170 ? 5.592   73.744  -25.782 1.00 54.94 ? 169 ASP A CB  1 
ATOM   1324 C CG  . ASP A 1 170 ? 6.051   72.452  -26.480 1.00 62.98 ? 169 ASP A CG  1 
ATOM   1325 O OD1 . ASP A 1 170 ? 6.302   71.436  -25.775 1.00 56.70 ? 169 ASP A OD1 1 
ATOM   1326 O OD2 . ASP A 1 170 ? 6.145   72.449  -27.734 1.00 65.03 ? 169 ASP A OD2 1 
ATOM   1327 N N   . SER A 1 171 ? 2.907   75.345  -24.713 1.00 47.41 ? 170 SER A N   1 
ATOM   1328 C CA  . SER A 1 171 ? 2.368   76.665  -24.373 1.00 43.91 ? 170 SER A CA  1 
ATOM   1329 C C   . SER A 1 171 ? 2.162   76.936  -22.875 1.00 44.58 ? 170 SER A C   1 
ATOM   1330 O O   . SER A 1 171 ? 1.965   76.005  -22.083 1.00 39.27 ? 170 SER A O   1 
ATOM   1331 C CB  . SER A 1 171 ? 1.047   76.905  -25.127 1.00 40.71 ? 170 SER A CB  1 
ATOM   1332 O OG  . SER A 1 171 ? 1.222   76.875  -26.537 1.00 37.00 ? 170 SER A OG  1 
ATOM   1333 N N   . LYS A 1 172 ? 2.214   78.225  -22.514 1.00 48.11 ? 171 LYS A N   1 
ATOM   1334 C CA  . LYS A 1 172 ? 1.918   78.707  -21.155 1.00 45.64 ? 171 LYS A CA  1 
ATOM   1335 C C   . LYS A 1 172 ? 0.441   79.058  -20.988 1.00 42.67 ? 171 LYS A C   1 
ATOM   1336 O O   . LYS A 1 172 ? -0.192  79.565  -21.919 1.00 40.11 ? 171 LYS A O   1 
ATOM   1337 C CB  . LYS A 1 172 ? 2.735   79.954  -20.824 1.00 47.04 ? 171 LYS A CB  1 
ATOM   1338 C CG  . LYS A 1 172 ? 4.237   79.796  -20.922 1.00 53.69 ? 171 LYS A CG  1 
ATOM   1339 C CD  . LYS A 1 172 ? 4.908   81.119  -20.600 1.00 54.49 ? 171 LYS A CD  1 
ATOM   1340 C CE  . LYS A 1 172 ? 6.343   81.149  -21.092 1.00 65.47 ? 171 LYS A CE  1 
ATOM   1341 N NZ  . LYS A 1 172 ? 6.922   82.524  -21.005 1.00 70.17 ? 171 LYS A NZ  1 
ATOM   1342 N N   . ASP A 1 173 ? -0.091  78.811  -19.791 1.00 43.61 ? 172 ASP A N   1 
ATOM   1343 C CA  . ASP A 1 173 ? -1.512  79.027  -19.505 1.00 47.10 ? 172 ASP A CA  1 
ATOM   1344 C C   . ASP A 1 173 ? -1.968  80.429  -19.876 1.00 46.26 ? 172 ASP A C   1 
ATOM   1345 O O   . ASP A 1 173 ? -1.164  81.357  -19.954 1.00 45.68 ? 172 ASP A O   1 
ATOM   1346 C CB  . ASP A 1 173 ? -1.835  78.758  -18.029 1.00 46.07 ? 172 ASP A CB  1 
ATOM   1347 C CG  . ASP A 1 173 ? -1.989  77.274  -17.715 1.00 51.71 ? 172 ASP A CG  1 
ATOM   1348 O OD1 . ASP A 1 173 ? -2.309  76.482  -18.640 1.00 49.25 ? 172 ASP A OD1 1 
ATOM   1349 O OD2 . ASP A 1 173 ? -1.801  76.902  -16.531 1.00 55.89 ? 172 ASP A OD2 1 
ATOM   1350 N N   . ILE A 1 174 ? -3.264  80.585  -20.102 1.00 46.47 ? 173 ILE A N   1 
ATOM   1351 C CA  . ILE A 1 174 ? -3.763  81.878  -20.536 1.00 50.68 ? 173 ILE A CA  1 
ATOM   1352 C C   . ILE A 1 174 ? -4.566  82.609  -19.461 1.00 49.74 ? 173 ILE A C   1 
ATOM   1353 O O   . ILE A 1 174 ? -5.590  82.117  -18.986 1.00 47.58 ? 173 ILE A O   1 
ATOM   1354 C CB  . ILE A 1 174 ? -4.554  81.753  -21.840 1.00 49.07 ? 173 ILE A CB  1 
ATOM   1355 C CG1 . ILE A 1 174 ? -3.599  81.344  -22.967 1.00 45.09 ? 173 ILE A CG1 1 
ATOM   1356 C CG2 . ILE A 1 174 ? -5.261  83.068  -22.158 1.00 46.67 ? 173 ILE A CG2 1 
ATOM   1357 C CD1 . ILE A 1 174 ? -4.230  81.349  -24.344 1.00 48.69 ? 173 ILE A CD1 1 
ATOM   1358 N N   . VAL A 1 175 ? -4.069  83.779  -19.066 1.00 46.74 ? 174 VAL A N   1 
ATOM   1359 C CA  . VAL A 1 175 ? -4.767  84.608  -18.093 1.00 49.87 ? 174 VAL A CA  1 
ATOM   1360 C C   . VAL A 1 175 ? -5.082  85.976  -18.689 1.00 48.17 ? 174 VAL A C   1 
ATOM   1361 O O   . VAL A 1 175 ? -4.187  86.762  -19.023 1.00 45.50 ? 174 VAL A O   1 
ATOM   1362 C CB  . VAL A 1 175 ? -3.971  84.776  -16.788 1.00 53.93 ? 174 VAL A CB  1 
ATOM   1363 C CG1 . VAL A 1 175 ? -4.916  85.131  -15.644 1.00 52.27 ? 174 VAL A CG1 1 
ATOM   1364 C CG2 . VAL A 1 175 ? -3.204  83.501  -16.465 1.00 50.19 ? 174 VAL A CG2 1 
ATOM   1365 N N   . LYS A 1 176 ? -6.373  86.237  -18.826 1.00 47.92 ? 175 LYS A N   1 
ATOM   1366 C CA  . LYS A 1 176 ? -6.862  87.433  -19.482 1.00 44.00 ? 175 LYS A CA  1 
ATOM   1367 C C   . LYS A 1 176 ? -7.971  88.023  -18.620 1.00 49.10 ? 175 LYS A C   1 
ATOM   1368 O O   . LYS A 1 176 ? -8.888  87.311  -18.196 1.00 49.33 ? 175 LYS A O   1 
ATOM   1369 C CB  . LYS A 1 176 ? -7.412  87.074  -20.861 1.00 43.26 ? 175 LYS A CB  1 
ATOM   1370 C CG  . LYS A 1 176 ? -6.768  87.794  -22.022 1.00 38.21 ? 175 LYS A CG  1 
ATOM   1371 C CD  . LYS A 1 176 ? -5.275  87.590  -22.093 1.00 38.55 ? 175 LYS A CD  1 
ATOM   1372 C CE  . LYS A 1 176 ? -4.772  88.056  -23.462 1.00 47.91 ? 175 LYS A CE  1 
ATOM   1373 N NZ  . LYS A 1 176 ? -3.285  88.176  -23.567 1.00 48.87 ? 175 LYS A NZ  1 
ATOM   1374 N N   . THR A 1 177 ? -7.888  89.330  -18.375 1.00 56.83 ? 176 THR A N   1 
ATOM   1375 C CA  . THR A 1 177 ? -8.831  90.027  -17.503 1.00 55.13 ? 176 THR A CA  1 
ATOM   1376 C C   . THR A 1 177 ? -9.730  91.011  -18.264 1.00 55.54 ? 176 THR A C   1 
ATOM   1377 O O   . THR A 1 177 ? -9.244  91.809  -19.066 1.00 58.39 ? 176 THR A O   1 
ATOM   1378 C CB  . THR A 1 177 ? -8.069  90.769  -16.398 1.00 53.22 ? 176 THR A CB  1 
ATOM   1379 O OG1 . THR A 1 177 ? -7.260  89.828  -15.677 1.00 58.96 ? 176 THR A OG1 1 
ATOM   1380 C CG2 . THR A 1 177 ? -9.031  91.441  -15.444 1.00 54.73 ? 176 THR A CG2 1 
ATOM   1381 N N   . VAL A 1 178 ? -11.039 90.938  -18.018 1.00 54.29 ? 177 VAL A N   1 
ATOM   1382 C CA  . VAL A 1 178 ? -11.994 91.889  -18.594 1.00 58.59 ? 177 VAL A CA  1 
ATOM   1383 C C   . VAL A 1 178 ? -12.500 92.882  -17.538 1.00 59.02 ? 177 VAL A C   1 
ATOM   1384 O O   . VAL A 1 178 ? -13.001 92.474  -16.485 1.00 54.65 ? 177 VAL A O   1 
ATOM   1385 C CB  . VAL A 1 178 ? -13.216 91.175  -19.199 1.00 58.36 ? 177 VAL A CB  1 
ATOM   1386 C CG1 . VAL A 1 178 ? -13.980 92.115  -20.116 1.00 61.93 ? 177 VAL A CG1 1 
ATOM   1387 C CG2 . VAL A 1 178 ? -12.787 89.965  -19.958 1.00 61.58 ? 177 VAL A CG2 1 
ATOM   1388 N N   . VAL A 1 179 ? -12.376 94.180  -17.824 1.00 63.66 ? 178 VAL A N   1 
ATOM   1389 C CA  . VAL A 1 179 ? -12.803 95.222  -16.883 1.00 62.35 ? 178 VAL A CA  1 
ATOM   1390 C C   . VAL A 1 179 ? -14.077 95.921  -17.348 1.00 60.18 ? 178 VAL A C   1 
ATOM   1391 O O   . VAL A 1 179 ? -14.148 96.443  -18.460 1.00 56.96 ? 178 VAL A O   1 
ATOM   1392 C CB  . VAL A 1 179 ? -11.713 96.289  -16.639 1.00 56.13 ? 178 VAL A CB  1 
ATOM   1393 C CG1 . VAL A 1 179 ? -12.170 97.257  -15.574 1.00 59.81 ? 178 VAL A CG1 1 
ATOM   1394 C CG2 . VAL A 1 179 ? -10.413 95.644  -16.219 1.00 54.74 ? 178 VAL A CG2 1 
ATOM   1395 N N   . TYR A 1 180 ? -15.078 95.921  -16.477 1.00 59.78 ? 179 TYR A N   1 
ATOM   1396 C CA  . TYR A 1 180 ? -16.357 96.552  -16.762 1.00 60.77 ? 179 TYR A CA  1 
ATOM   1397 C C   . TYR A 1 180 ? -16.401 97.982  -16.224 1.00 65.53 ? 179 TYR A C   1 
ATOM   1398 O O   . TYR A 1 180 ? -16.164 98.214  -15.034 1.00 67.01 ? 179 TYR A O   1 
ATOM   1399 C CB  . TYR A 1 180 ? -17.489 95.730  -16.145 1.00 58.79 ? 179 TYR A CB  1 
ATOM   1400 C CG  . TYR A 1 180 ? -17.907 94.528  -16.968 1.00 64.52 ? 179 TYR A CG  1 
ATOM   1401 C CD1 . TYR A 1 180 ? -19.100 94.537  -17.694 1.00 64.13 ? 179 TYR A CD1 1 
ATOM   1402 C CD2 . TYR A 1 180 ? -17.114 93.382  -17.017 1.00 62.81 ? 179 TYR A CD2 1 
ATOM   1403 C CE1 . TYR A 1 180 ? -19.491 93.441  -18.446 1.00 66.01 ? 179 TYR A CE1 1 
ATOM   1404 C CE2 . TYR A 1 180 ? -17.496 92.276  -17.774 1.00 62.42 ? 179 TYR A CE2 1 
ATOM   1405 C CZ  . TYR A 1 180 ? -18.685 92.313  -18.484 1.00 65.04 ? 179 TYR A CZ  1 
ATOM   1406 O OH  . TYR A 1 180 ? -19.071 91.225  -19.232 1.00 60.74 ? 179 TYR A OH  1 
ATOM   1407 N N   . VAL A 1 181 ? -16.700 98.938  -17.103 1.00 68.10 ? 180 VAL A N   1 
ATOM   1408 C CA  . VAL A 1 181 ? -16.814 100.344 -16.709 1.00 63.69 ? 180 VAL A CA  1 
ATOM   1409 C C   . VAL A 1 181 ? -18.270 100.708 -16.428 1.00 59.28 ? 180 VAL A C   1 
ATOM   1410 O O   . VAL A 1 181 ? -19.158 100.399 -17.218 1.00 59.12 ? 180 VAL A O   1 
ATOM   1411 C CB  . VAL A 1 181 ? -16.233 101.289 -17.789 1.00 60.68 ? 180 VAL A CB  1 
ATOM   1412 C CG1 . VAL A 1 181 ? -16.592 102.728 -17.487 1.00 58.99 ? 180 VAL A CG1 1 
ATOM   1413 C CG2 . VAL A 1 181 ? -14.715 101.114 -17.897 1.00 55.46 ? 180 VAL A CG2 1 
ATOM   1414 N N   . GLY A 1 182 ? -18.512 101.349 -15.291 1.00 64.01 ? 181 GLY A N   1 
ATOM   1415 C CA  . GLY A 1 182 ? -19.853 101.786 -14.939 1.00 66.25 ? 181 GLY A CA  1 
ATOM   1416 C C   . GLY A 1 182 ? -20.429 102.824 -15.891 1.00 64.82 ? 181 GLY A C   1 
ATOM   1417 O O   . GLY A 1 182 ? -19.724 103.728 -16.347 1.00 66.42 ? 181 GLY A O   1 
ATOM   1418 N N   . ASP A 1 183 ? -21.719 102.699 -16.188 1.00 63.43 ? 182 ASP A N   1 
ATOM   1419 C CA  . ASP A 1 183 ? -22.384 103.621 -17.109 1.00 70.21 ? 182 ASP A CA  1 
ATOM   1420 C C   . ASP A 1 183 ? -22.548 105.033 -16.521 1.00 67.29 ? 182 ASP A C   1 
ATOM   1421 O O   . ASP A 1 183 ? -23.263 105.225 -15.533 1.00 63.73 ? 182 ASP A O   1 
ATOM   1422 C CB  . ASP A 1 183 ? -23.728 103.043 -17.592 1.00 69.05 ? 182 ASP A CB  1 
ATOM   1423 C CG  . ASP A 1 183 ? -23.550 101.897 -18.602 1.00 70.01 ? 182 ASP A CG  1 
ATOM   1424 O OD1 . ASP A 1 183 ? -22.468 101.818 -19.238 1.00 67.24 ? 182 ASP A OD1 1 
ATOM   1425 O OD2 . ASP A 1 183 ? -24.492 101.080 -18.765 1.00 67.78 ? 182 ASP A OD2 1 
ATOM   1426 N N   . PRO A 1 184 ? -21.874 106.024 -17.136 1.00 70.02 ? 183 PRO A N   1 
ATOM   1427 C CA  . PRO A 1 184 ? -21.817 107.418 -16.663 1.00 73.57 ? 183 PRO A CA  1 
ATOM   1428 C C   . PRO A 1 184 ? -23.161 108.143 -16.740 1.00 65.82 ? 183 PRO A C   1 
ATOM   1429 O O   . PRO A 1 184 ? -23.959 107.841 -17.628 1.00 63.88 ? 183 PRO A O   1 
ATOM   1430 C CB  . PRO A 1 184 ? -20.808 108.078 -17.620 1.00 71.77 ? 183 PRO A CB  1 
ATOM   1431 C CG  . PRO A 1 184 ? -20.078 106.937 -18.286 1.00 71.88 ? 183 PRO A CG  1 
ATOM   1432 C CD  . PRO A 1 184 ? -21.085 105.834 -18.366 1.00 70.72 ? 183 PRO A CD  1 
ATOM   1433 N N   . MET B 1 1   ? 2.009   48.076  -23.858 1.00 22.74 ? 0   MET B N   1 
ATOM   1434 C CA  . MET B 1 1   ? 1.385   47.800  -22.571 1.00 25.27 ? 0   MET B CA  1 
ATOM   1435 C C   . MET B 1 1   ? 2.393   47.163  -21.640 1.00 27.21 ? 0   MET B C   1 
ATOM   1436 O O   . MET B 1 1   ? 3.444   46.712  -22.081 1.00 32.79 ? 0   MET B O   1 
ATOM   1437 C CB  . MET B 1 1   ? 0.197   46.850  -22.732 1.00 27.27 ? 0   MET B CB  1 
ATOM   1438 C CG  . MET B 1 1   ? -1.047  47.494  -23.315 1.00 35.50 ? 0   MET B CG  1 
ATOM   1439 S SD  . MET B 1 1   ? -2.403  46.325  -23.528 1.00 41.20 ? 0   MET B SD  1 
ATOM   1440 C CE  . MET B 1 1   ? -1.580  45.056  -24.483 1.00 26.59 ? 0   MET B CE  1 
ATOM   1441 N N   . GLN B 1 2   ? 2.057   47.098  -20.358 1.00 25.45 ? 1   GLN B N   1 
ATOM   1442 C CA  . GLN B 1 2   ? 2.919   46.470  -19.376 1.00 24.21 ? 1   GLN B CA  1 
ATOM   1443 C C   . GLN B 1 2   ? 2.883   44.965  -19.525 1.00 23.47 ? 1   GLN B C   1 
ATOM   1444 O O   . GLN B 1 2   ? 1.950   44.422  -20.115 1.00 23.99 ? 1   GLN B O   1 
ATOM   1445 C CB  . GLN B 1 2   ? 2.497   46.883  -17.972 1.00 26.67 ? 1   GLN B CB  1 
ATOM   1446 C CG  . GLN B 1 2   ? 2.298   48.386  -17.812 1.00 28.62 ? 1   GLN B CG  1 
ATOM   1447 C CD  . GLN B 1 2   ? 3.607   49.160  -17.821 1.00 32.28 ? 1   GLN B CD  1 
ATOM   1448 O OE1 . GLN B 1 2   ? 4.654   48.634  -18.226 1.00 32.30 ? 1   GLN B OE1 1 
ATOM   1449 N NE2 . GLN B 1 2   ? 3.560   50.412  -17.355 1.00 28.40 ? 1   GLN B NE2 1 
ATOM   1450 N N   . THR B 1 3   ? 3.899   44.299  -18.988 1.00 23.62 ? 2   THR B N   1 
ATOM   1451 C CA  . THR B 1 3   ? 4.057   42.855  -19.158 1.00 25.97 ? 2   THR B CA  1 
ATOM   1452 C C   . THR B 1 3   ? 4.478   42.158  -17.861 1.00 27.16 ? 2   THR B C   1 
ATOM   1453 O O   . THR B 1 3   ? 5.211   42.739  -17.053 1.00 27.13 ? 2   THR B O   1 
ATOM   1454 C CB  . THR B 1 3   ? 5.062   42.550  -20.287 1.00 26.36 ? 2   THR B CB  1 
ATOM   1455 O OG1 . THR B 1 3   ? 4.609   43.184  -21.490 1.00 28.60 ? 2   THR B OG1 1 
ATOM   1456 C CG2 . THR B 1 3   ? 5.210   41.039  -20.532 1.00 26.08 ? 2   THR B CG2 1 
ATOM   1457 N N   . ALA B 1 4   ? 3.976   40.934  -17.661 1.00 25.58 ? 3   ALA B N   1 
ATOM   1458 C CA  . ALA B 1 4   ? 4.316   40.091  -16.509 1.00 25.66 ? 3   ALA B CA  1 
ATOM   1459 C C   . ALA B 1 4   ? 4.373   38.640  -16.978 1.00 25.46 ? 3   ALA B C   1 
ATOM   1460 O O   . ALA B 1 4   ? 3.668   38.281  -17.914 1.00 26.88 ? 3   ALA B O   1 
ATOM   1461 C CB  . ALA B 1 4   ? 3.272   40.251  -15.404 1.00 24.11 ? 3   ALA B CB  1 
ATOM   1462 N N   . TYR B 1 5   ? 5.201   37.801  -16.358 1.00 24.88 ? 4   TYR B N   1 
ATOM   1463 C CA  . TYR B 1 5   ? 5.286   36.407  -16.799 1.00 26.56 ? 4   TYR B CA  1 
ATOM   1464 C C   . TYR B 1 5   ? 4.845   35.439  -15.714 1.00 28.91 ? 4   TYR B C   1 
ATOM   1465 O O   . TYR B 1 5   ? 5.090   35.673  -14.531 1.00 30.29 ? 4   TYR B O   1 
ATOM   1466 C CB  . TYR B 1 5   ? 6.702   36.044  -17.266 1.00 27.35 ? 4   TYR B CB  1 
ATOM   1467 C CG  . TYR B 1 5   ? 7.285   37.003  -18.278 1.00 26.28 ? 4   TYR B CG  1 
ATOM   1468 C CD1 . TYR B 1 5   ? 6.941   36.931  -19.621 1.00 27.05 ? 4   TYR B CD1 1 
ATOM   1469 C CD2 . TYR B 1 5   ? 8.189   37.972  -17.891 1.00 29.16 ? 4   TYR B CD2 1 
ATOM   1470 C CE1 . TYR B 1 5   ? 7.478   37.814  -20.551 1.00 27.40 ? 4   TYR B CE1 1 
ATOM   1471 C CE2 . TYR B 1 5   ? 8.732   38.857  -18.809 1.00 33.59 ? 4   TYR B CE2 1 
ATOM   1472 C CZ  . TYR B 1 5   ? 8.372   38.780  -20.138 1.00 34.04 ? 4   TYR B CZ  1 
ATOM   1473 O OH  . TYR B 1 5   ? 8.917   39.683  -21.036 1.00 34.92 ? 4   TYR B OH  1 
ATOM   1474 N N   . VAL B 1 6   ? 4.184   34.359  -16.121 1.00 25.49 ? 5   VAL B N   1 
ATOM   1475 C CA  . VAL B 1 6   ? 3.916   33.253  -15.218 1.00 25.20 ? 5   VAL B CA  1 
ATOM   1476 C C   . VAL B 1 6   ? 4.498   31.981  -15.829 1.00 26.18 ? 5   VAL B C   1 
ATOM   1477 O O   . VAL B 1 6   ? 4.106   31.563  -16.909 1.00 26.68 ? 5   VAL B O   1 
ATOM   1478 C CB  . VAL B 1 6   ? 2.424   33.097  -14.947 1.00 24.58 ? 5   VAL B CB  1 
ATOM   1479 C CG1 . VAL B 1 6   ? 2.167   31.838  -14.188 1.00 26.54 ? 5   VAL B CG1 1 
ATOM   1480 C CG2 . VAL B 1 6   ? 1.926   34.267  -14.149 1.00 25.96 ? 5   VAL B CG2 1 
ATOM   1481 N N   . LYS B 1 7   ? 5.437   31.366  -15.129 1.00 27.31 ? 6   LYS B N   1 
ATOM   1482 C CA  . LYS B 1 7   ? 6.257   30.312  -15.707 1.00 29.66 ? 6   LYS B CA  1 
ATOM   1483 C C   . LYS B 1 7   ? 6.036   29.001  -14.975 1.00 28.84 ? 6   LYS B C   1 
ATOM   1484 O O   . LYS B 1 7   ? 6.234   28.930  -13.773 1.00 33.35 ? 6   LYS B O   1 
ATOM   1485 C CB  . LYS B 1 7   ? 7.707   30.737  -15.548 1.00 31.56 ? 6   LYS B CB  1 
ATOM   1486 C CG  . LYS B 1 7   ? 8.740   30.009  -16.350 1.00 29.70 ? 6   LYS B CG  1 
ATOM   1487 C CD  . LYS B 1 7   ? 10.010  30.869  -16.259 1.00 40.63 ? 6   LYS B CD  1 
ATOM   1488 C CE  . LYS B 1 7   ? 11.277  30.199  -16.779 1.00 39.42 ? 6   LYS B CE  1 
ATOM   1489 N NZ  . LYS B 1 7   ? 12.337  31.255  -16.834 1.00 48.74 ? 6   LYS B NZ  1 
ATOM   1490 N N   . TYR B 1 8   ? 5.628   27.966  -15.697 1.00 26.74 ? 7   TYR B N   1 
ATOM   1491 C CA  . TYR B 1 8   ? 5.458   26.635  -15.108 1.00 29.51 ? 7   TYR B CA  1 
ATOM   1492 C C   . TYR B 1 8   ? 6.668   25.725  -15.371 1.00 30.54 ? 7   TYR B C   1 
ATOM   1493 O O   . TYR B 1 8   ? 6.917   25.287  -16.505 1.00 26.39 ? 7   TYR B O   1 
ATOM   1494 C CB  . TYR B 1 8   ? 4.199   25.951  -15.637 1.00 28.52 ? 7   TYR B CB  1 
ATOM   1495 C CG  . TYR B 1 8   ? 2.910   26.702  -15.401 1.00 29.88 ? 7   TYR B CG  1 
ATOM   1496 C CD1 . TYR B 1 8   ? 1.957   26.219  -14.517 1.00 29.44 ? 7   TYR B CD1 1 
ATOM   1497 C CD2 . TYR B 1 8   ? 2.637   27.887  -16.081 1.00 26.20 ? 7   TYR B CD2 1 
ATOM   1498 C CE1 . TYR B 1 8   ? 0.771   26.898  -14.312 1.00 30.98 ? 7   TYR B CE1 1 
ATOM   1499 C CE2 . TYR B 1 8   ? 1.467   28.569  -15.879 1.00 23.75 ? 7   TYR B CE2 1 
ATOM   1500 C CZ  . TYR B 1 8   ? 0.537   28.079  -14.995 1.00 28.75 ? 7   TYR B CZ  1 
ATOM   1501 O OH  . TYR B 1 8   ? -0.641  28.768  -14.800 1.00 31.18 ? 7   TYR B OH  1 
ATOM   1502 N N   . VAL B 1 9   ? 7.395   25.432  -14.298 1.00 32.13 ? 8   VAL B N   1 
ATOM   1503 C CA  . VAL B 1 9   ? 8.646   24.693  -14.365 1.00 33.22 ? 8   VAL B CA  1 
ATOM   1504 C C   . VAL B 1 9   ? 8.529   23.250  -13.828 1.00 35.99 ? 8   VAL B C   1 
ATOM   1505 O O   . VAL B 1 9   ? 7.869   22.990  -12.820 1.00 35.98 ? 8   VAL B O   1 
ATOM   1506 C CB  . VAL B 1 9   ? 9.738   25.456  -13.588 1.00 34.09 ? 8   VAL B CB  1 
ATOM   1507 C CG1 . VAL B 1 9   ? 10.970  24.600  -13.394 1.00 37.59 ? 8   VAL B CG1 1 
ATOM   1508 C CG2 . VAL B 1 9   ? 10.086  26.762  -14.298 1.00 32.63 ? 8   VAL B CG2 1 
ATOM   1509 N N   . ASP B 1 10  ? 9.161   22.310  -14.522 1.00 36.95 ? 9   ASP B N   1 
ATOM   1510 C CA  . ASP B 1 10  ? 9.312   20.950  -14.025 1.00 35.84 ? 9   ASP B CA  1 
ATOM   1511 C C   . ASP B 1 10  ? 10.662  20.849  -13.342 1.00 36.87 ? 9   ASP B C   1 
ATOM   1512 O O   . ASP B 1 10  ? 11.675  20.691  -14.009 1.00 38.77 ? 9   ASP B O   1 
ATOM   1513 C CB  . ASP B 1 10  ? 9.278   19.975  -15.195 1.00 35.75 ? 9   ASP B CB  1 
ATOM   1514 C CG  . ASP B 1 10  ? 9.399   18.519  -14.765 1.00 40.20 ? 9   ASP B CG  1 
ATOM   1515 O OD1 . ASP B 1 10  ? 9.712   18.242  -13.586 1.00 40.58 ? 9   ASP B OD1 1 
ATOM   1516 O OD2 . ASP B 1 10  ? 9.189   17.640  -15.632 1.00 39.08 ? 9   ASP B OD2 1 
ATOM   1517 N N   . ASP B 1 11  ? 10.671  20.932  -12.017 1.00 35.63 ? 10  ASP B N   1 
ATOM   1518 C CA  . ASP B 1 11  ? 11.897  20.771  -11.244 1.00 39.07 ? 10  ASP B CA  1 
ATOM   1519 C C   . ASP B 1 11  ? 12.614  19.425  -11.522 1.00 39.09 ? 10  ASP B C   1 
ATOM   1520 O O   . ASP B 1 11  ? 13.843  19.365  -11.600 1.00 36.83 ? 10  ASP B O   1 
ATOM   1521 C CB  . ASP B 1 11  ? 11.594  20.906  -9.748  1.00 35.87 ? 10  ASP B CB  1 
ATOM   1522 C CG  . ASP B 1 11  ? 11.241  22.320  -9.345  1.00 42.30 ? 10  ASP B CG  1 
ATOM   1523 O OD1 . ASP B 1 11  ? 11.874  23.271  -9.856  1.00 46.81 ? 10  ASP B OD1 1 
ATOM   1524 O OD2 . ASP B 1 11  ? 10.337  22.482  -8.499  1.00 44.59 ? 10  ASP B OD2 1 
ATOM   1525 N N   . THR B 1 12  ? 11.845  18.353  -11.665 1.00 34.33 ? 11  THR B N   1 
ATOM   1526 C CA  . THR B 1 12  ? 12.419  17.042  -11.920 1.00 38.57 ? 11  THR B CA  1 
ATOM   1527 C C   . THR B 1 12  ? 13.343  17.051  -13.143 1.00 42.01 ? 11  THR B C   1 
ATOM   1528 O O   . THR B 1 12  ? 14.507  16.665  -13.057 1.00 41.28 ? 11  THR B O   1 
ATOM   1529 C CB  . THR B 1 12  ? 11.318  15.967  -12.110 1.00 43.51 ? 11  THR B CB  1 
ATOM   1530 O OG1 . THR B 1 12  ? 10.616  15.760  -10.874 1.00 44.95 ? 11  THR B OG1 1 
ATOM   1531 C CG2 . THR B 1 12  ? 11.924  14.656  -12.560 1.00 38.23 ? 11  THR B CG2 1 
ATOM   1532 N N   . THR B 1 13  ? 12.830  17.515  -14.277 1.00 43.62 ? 12  THR B N   1 
ATOM   1533 C CA  . THR B 1 13  ? 13.607  17.499  -15.508 1.00 37.38 ? 12  THR B CA  1 
ATOM   1534 C C   . THR B 1 13  ? 14.403  18.788  -15.698 1.00 37.78 ? 12  THR B C   1 
ATOM   1535 O O   . THR B 1 13  ? 15.397  18.815  -16.424 1.00 41.09 ? 12  THR B O   1 
ATOM   1536 C CB  . THR B 1 13  ? 12.711  17.256  -16.732 1.00 38.79 ? 12  THR B CB  1 
ATOM   1537 O OG1 . THR B 1 13  ? 13.530  17.062  -17.884 1.00 41.59 ? 12  THR B OG1 1 
ATOM   1538 C CG2 . THR B 1 13  ? 11.821  18.439  -16.982 1.00 37.47 ? 12  THR B CG2 1 
ATOM   1539 N N   . GLY B 1 14  ? 13.975  19.852  -15.031 1.00 36.89 ? 13  GLY B N   1 
ATOM   1540 C CA  . GLY B 1 14  ? 14.619  21.143  -15.182 1.00 36.14 ? 13  GLY B CA  1 
ATOM   1541 C C   . GLY B 1 14  ? 13.999  22.028  -16.259 1.00 35.91 ? 13  GLY B C   1 
ATOM   1542 O O   . GLY B 1 14  ? 14.253  23.232  -16.297 1.00 34.98 ? 13  GLY B O   1 
ATOM   1543 N N   . GLU B 1 15  ? 13.189  21.441  -17.137 1.00 36.30 ? 14  GLU B N   1 
ATOM   1544 C CA  . GLU B 1 15  ? 12.609  22.181  -18.255 1.00 36.50 ? 14  GLU B CA  1 
ATOM   1545 C C   . GLU B 1 15  ? 11.385  23.018  -17.845 1.00 36.41 ? 14  GLU B C   1 
ATOM   1546 O O   . GLU B 1 15  ? 10.718  22.708  -16.856 1.00 34.83 ? 14  GLU B O   1 
ATOM   1547 C CB  . GLU B 1 15  ? 12.219  21.229  -19.393 1.00 36.37 ? 14  GLU B CB  1 
ATOM   1548 C CG  . GLU B 1 15  ? 13.226  20.132  -19.723 1.00 39.46 ? 14  GLU B CG  1 
ATOM   1549 C CD  . GLU B 1 15  ? 14.426  20.610  -20.533 1.00 46.32 ? 14  GLU B CD  1 
ATOM   1550 O OE1 . GLU B 1 15  ? 14.620  20.112  -21.666 1.00 48.57 ? 14  GLU B OE1 1 
ATOM   1551 O OE2 . GLU B 1 15  ? 15.194  21.456  -20.032 1.00 46.64 ? 14  GLU B OE2 1 
ATOM   1552 N N   . THR B 1 16  ? 11.113  24.077  -18.611 1.00 32.38 ? 15  THR B N   1 
ATOM   1553 C CA  . THR B 1 16  ? 9.880   24.845  -18.509 1.00 29.14 ? 15  THR B CA  1 
ATOM   1554 C C   . THR B 1 16  ? 8.785   24.153  -19.289 1.00 28.49 ? 15  THR B C   1 
ATOM   1555 O O   . THR B 1 16  ? 8.992   23.769  -20.440 1.00 29.48 ? 15  THR B O   1 
ATOM   1556 C CB  . THR B 1 16  ? 10.051  26.205  -19.151 1.00 29.92 ? 15  THR B CB  1 
ATOM   1557 O OG1 . THR B 1 16  ? 11.133  26.892  -18.521 1.00 33.79 ? 15  THR B OG1 1 
ATOM   1558 C CG2 . THR B 1 16  ? 8.777   27.019  -19.010 1.00 30.37 ? 15  THR B CG2 1 
ATOM   1559 N N   . LEU B 1 17  ? 7.618   23.995  -18.674 1.00 28.46 ? 16  LEU B N   1 
ATOM   1560 C CA  . LEU B 1 17  ? 6.505   23.323  -19.343 1.00 28.48 ? 16  LEU B CA  1 
ATOM   1561 C C   . LEU B 1 17  ? 5.624   24.323  -20.065 1.00 27.97 ? 16  LEU B C   1 
ATOM   1562 O O   . LEU B 1 17  ? 4.962   23.984  -21.044 1.00 28.02 ? 16  LEU B O   1 
ATOM   1563 C CB  . LEU B 1 17  ? 5.614   22.574  -18.349 1.00 29.29 ? 16  LEU B CB  1 
ATOM   1564 C CG  . LEU B 1 17  ? 6.198   21.738  -17.219 1.00 30.72 ? 16  LEU B CG  1 
ATOM   1565 C CD1 . LEU B 1 17  ? 5.080   21.291  -16.287 1.00 30.20 ? 16  LEU B CD1 1 
ATOM   1566 C CD2 . LEU B 1 17  ? 6.940   20.556  -17.785 1.00 29.90 ? 16  LEU B CD2 1 
ATOM   1567 N N   . ARG B 1 18  ? 5.600   25.551  -19.567 1.00 26.23 ? 17  ARG B N   1 
ATOM   1568 C CA  . ARG B 1 18  ? 4.614   26.506  -20.020 1.00 24.88 ? 17  ARG B CA  1 
ATOM   1569 C C   . ARG B 1 18  ? 4.999   27.881  -19.524 1.00 25.38 ? 17  ARG B C   1 
ATOM   1570 O O   . ARG B 1 18  ? 5.450   28.033  -18.393 1.00 26.75 ? 17  ARG B O   1 
ATOM   1571 C CB  . ARG B 1 18  ? 3.231   26.105  -19.486 1.00 24.10 ? 17  ARG B CB  1 
ATOM   1572 C CG  . ARG B 1 18  ? 2.172   27.193  -19.553 1.00 25.46 ? 17  ARG B CG  1 
ATOM   1573 C CD  . ARG B 1 18  ? 0.789   26.667  -19.172 1.00 25.99 ? 17  ARG B CD  1 
ATOM   1574 N NE  . ARG B 1 18  ? -0.236  27.707  -19.259 1.00 25.74 ? 17  ARG B NE  1 
ATOM   1575 C CZ  . ARG B 1 18  ? -1.537  27.524  -19.047 1.00 24.36 ? 17  ARG B CZ  1 
ATOM   1576 N NH1 . ARG B 1 18  ? -2.016  26.326  -18.734 1.00 26.26 ? 17  ARG B NH1 1 
ATOM   1577 N NH2 . ARG B 1 18  ? -2.363  28.552  -19.154 1.00 23.19 ? 17  ARG B NH2 1 
ATOM   1578 N N   . GLN B 1 19  ? 4.852   28.886  -20.371 1.00 23.04 ? 18  GLN B N   1 
ATOM   1579 C CA  . GLN B 1 19  ? 5.030   30.241  -19.898 1.00 24.48 ? 18  GLN B CA  1 
ATOM   1580 C C   . GLN B 1 19  ? 3.952   31.155  -20.445 1.00 26.90 ? 18  GLN B C   1 
ATOM   1581 O O   . GLN B 1 19  ? 3.811   31.326  -21.660 1.00 28.13 ? 18  GLN B O   1 
ATOM   1582 C CB  . GLN B 1 19  ? 6.413   30.795  -20.229 1.00 24.25 ? 18  GLN B CB  1 
ATOM   1583 C CG  . GLN B 1 19  ? 6.488   32.314  -20.031 1.00 29.30 ? 18  GLN B CG  1 
ATOM   1584 C CD  . GLN B 1 19  ? 7.898   32.842  -19.865 1.00 27.39 ? 18  GLN B CD  1 
ATOM   1585 O OE1 . GLN B 1 19  ? 8.667   32.343  -19.052 1.00 30.53 ? 18  GLN B OE1 1 
ATOM   1586 N NE2 . GLN B 1 19  ? 8.239   33.864  -20.631 1.00 28.13 ? 18  GLN B NE2 1 
ATOM   1587 N N   . ASP B 1 20  ? 3.192   31.741  -19.530 1.00 23.99 ? 19  ASP B N   1 
ATOM   1588 C CA  . ASP B 1 20  ? 2.160   32.683  -19.897 1.00 22.55 ? 19  ASP B CA  1 
ATOM   1589 C C   . ASP B 1 20  ? 2.669   34.115  -19.816 1.00 25.35 ? 19  ASP B C   1 
ATOM   1590 O O   . ASP B 1 20  ? 3.164   34.561  -18.772 1.00 26.50 ? 19  ASP B O   1 
ATOM   1591 C CB  . ASP B 1 20  ? 0.930   32.470  -19.023 1.00 23.07 ? 19  ASP B CB  1 
ATOM   1592 C CG  . ASP B 1 20  ? 0.312   31.107  -19.233 1.00 26.30 ? 19  ASP B CG  1 
ATOM   1593 O OD1 . ASP B 1 20  ? 0.787   30.371  -20.127 1.00 26.20 ? 19  ASP B OD1 1 
ATOM   1594 O OD2 . ASP B 1 20  ? -0.651  30.765  -18.521 1.00 28.01 ? 19  ASP B OD2 1 
ATOM   1595 N N   . ASP B 1 21  ? 2.568   34.816  -20.944 1.00 24.02 ? 20  ASP B N   1 
ATOM   1596 C CA  . ASP B 1 21  ? 2.952   36.218  -21.044 1.00 24.42 ? 20  ASP B CA  1 
ATOM   1597 C C   . ASP B 1 21  ? 1.686   37.045  -20.964 1.00 24.65 ? 20  ASP B C   1 
ATOM   1598 O O   . ASP B 1 21  ? 0.791   36.897  -21.798 1.00 22.87 ? 20  ASP B O   1 
ATOM   1599 C CB  . ASP B 1 21  ? 3.640   36.501  -22.380 1.00 25.56 ? 20  ASP B CB  1 
ATOM   1600 C CG  . ASP B 1 21  ? 4.991   35.789  -22.525 1.00 35.34 ? 20  ASP B CG  1 
ATOM   1601 O OD1 . ASP B 1 21  ? 5.137   34.595  -22.129 1.00 33.83 ? 20  ASP B OD1 1 
ATOM   1602 O OD2 . ASP B 1 21  ? 5.916   36.437  -23.069 1.00 36.34 ? 20  ASP B OD2 1 
ATOM   1603 N N   . LEU B 1 22  ? 1.613   37.917  -19.965 1.00 24.47 ? 21  LEU B N   1 
ATOM   1604 C CA  . LEU B 1 22  ? 0.392   38.658  -19.663 1.00 23.03 ? 21  LEU B CA  1 
ATOM   1605 C C   . LEU B 1 22  ? 0.579   40.160  -19.878 1.00 24.09 ? 21  LEU B C   1 
ATOM   1606 O O   . LEU B 1 22  ? 1.558   40.753  -19.408 1.00 24.11 ? 21  LEU B O   1 
ATOM   1607 C CB  . LEU B 1 22  ? -0.036  38.366  -18.220 1.00 21.23 ? 21  LEU B CB  1 
ATOM   1608 C CG  . LEU B 1 22  ? -0.102  36.868  -17.915 1.00 23.26 ? 21  LEU B CG  1 
ATOM   1609 C CD1 . LEU B 1 22  ? -0.113  36.593  -16.431 1.00 23.32 ? 21  LEU B CD1 1 
ATOM   1610 C CD2 . LEU B 1 22  ? -1.333  36.291  -18.566 1.00 25.24 ? 21  LEU B CD2 1 
ATOM   1611 N N   . HIS B 1 23  ? -0.363  40.780  -20.579 1.00 21.72 ? 22  HIS B N   1 
ATOM   1612 C CA  . HIS B 1 23  ? -0.251  42.197  -20.861 1.00 22.31 ? 22  HIS B CA  1 
ATOM   1613 C C   . HIS B 1 23  ? -1.439  42.951  -20.312 1.00 26.04 ? 22  HIS B C   1 
ATOM   1614 O O   . HIS B 1 23  ? -2.526  42.400  -20.211 1.00 27.84 ? 22  HIS B O   1 
ATOM   1615 C CB  . HIS B 1 23  ? -0.114  42.422  -22.356 1.00 21.39 ? 22  HIS B CB  1 
ATOM   1616 C CG  . HIS B 1 23  ? 0.975   41.614  -22.971 1.00 23.75 ? 22  HIS B CG  1 
ATOM   1617 N ND1 . HIS B 1 23  ? 2.305   41.936  -22.832 1.00 22.61 ? 22  HIS B ND1 1 
ATOM   1618 C CD2 . HIS B 1 23  ? 0.936   40.467  -23.694 1.00 25.09 ? 22  HIS B CD2 1 
ATOM   1619 C CE1 . HIS B 1 23  ? 3.039   41.033  -23.458 1.00 24.68 ? 22  HIS B CE1 1 
ATOM   1620 N NE2 . HIS B 1 23  ? 2.231   40.134  -23.994 1.00 22.25 ? 22  HIS B NE2 1 
ATOM   1621 N N   . GLY B 1 24  ? -1.218  44.212  -19.950 1.00 27.49 ? 23  GLY B N   1 
ATOM   1622 C CA  . GLY B 1 24  ? -2.254  45.044  -19.371 1.00 27.53 ? 23  GLY B CA  1 
ATOM   1623 C C   . GLY B 1 24  ? -1.722  46.439  -19.102 1.00 26.77 ? 23  GLY B C   1 
ATOM   1624 O O   . GLY B 1 24  ? -0.561  46.717  -19.352 1.00 26.43 ? 23  GLY B O   1 
ATOM   1625 N N   . TYR B 1 25  ? -2.575  47.317  -18.593 1.00 26.80 ? 24  TYR B N   1 
ATOM   1626 C CA  . TYR B 1 25  ? -2.190  48.689  -18.333 1.00 26.56 ? 24  TYR B CA  1 
ATOM   1627 C C   . TYR B 1 25  ? -1.674  48.850  -16.917 1.00 30.03 ? 24  TYR B C   1 
ATOM   1628 O O   . TYR B 1 25  ? -1.957  48.031  -16.044 1.00 29.44 ? 24  TYR B O   1 
ATOM   1629 C CB  . TYR B 1 25  ? -3.372  49.618  -18.562 1.00 26.27 ? 24  TYR B CB  1 
ATOM   1630 C CG  . TYR B 1 25  ? -3.843  49.589  -19.977 1.00 26.71 ? 24  TYR B CG  1 
ATOM   1631 C CD1 . TYR B 1 25  ? -3.328  50.464  -20.909 1.00 31.44 ? 24  TYR B CD1 1 
ATOM   1632 C CD2 . TYR B 1 25  ? -4.792  48.675  -20.391 1.00 30.24 ? 24  TYR B CD2 1 
ATOM   1633 C CE1 . TYR B 1 25  ? -3.746  50.436  -22.217 1.00 32.57 ? 24  TYR B CE1 1 
ATOM   1634 C CE2 . TYR B 1 25  ? -5.213  48.632  -21.701 1.00 30.72 ? 24  TYR B CE2 1 
ATOM   1635 C CZ  . TYR B 1 25  ? -4.683  49.514  -22.608 1.00 34.53 ? 24  TYR B CZ  1 
ATOM   1636 O OH  . TYR B 1 25  ? -5.094  49.476  -23.918 1.00 41.11 ? 24  TYR B OH  1 
ATOM   1637 N N   . THR B 1 26  ? -0.916  49.916  -16.700 1.00 27.99 ? 25  THR B N   1 
ATOM   1638 C CA  . THR B 1 26  ? -0.369  50.194  -15.398 1.00 28.35 ? 25  THR B CA  1 
ATOM   1639 C C   . THR B 1 26  ? -1.457  50.122  -14.340 1.00 32.09 ? 25  THR B C   1 
ATOM   1640 O O   . THR B 1 26  ? -2.519  50.740  -14.475 1.00 31.32 ? 25  THR B O   1 
ATOM   1641 C CB  . THR B 1 26  ? 0.282   51.571  -15.371 1.00 28.99 ? 25  THR B CB  1 
ATOM   1642 O OG1 . THR B 1 26  ? 1.193   51.679  -16.469 1.00 31.25 ? 25  THR B OG1 1 
ATOM   1643 C CG2 . THR B 1 26  ? 1.042   51.778  -14.074 1.00 29.01 ? 25  THR B CG2 1 
ATOM   1644 N N   . ASP B 1 27  ? -1.193  49.308  -13.323 1.00 33.03 ? 26  ASP B N   1 
ATOM   1645 C CA  . ASP B 1 27  ? -2.000  49.250  -12.096 1.00 36.93 ? 26  ASP B CA  1 
ATOM   1646 C C   . ASP B 1 27  ? -3.345  48.572  -12.219 1.00 34.34 ? 26  ASP B C   1 
ATOM   1647 O O   . ASP B 1 27  ? -4.087  48.492  -11.244 1.00 35.19 ? 26  ASP B O   1 
ATOM   1648 C CB  . ASP B 1 27  ? -2.165  50.630  -11.444 1.00 31.09 ? 26  ASP B CB  1 
ATOM   1649 C CG  . ASP B 1 27  ? -0.904  51.079  -10.725 1.00 39.33 ? 26  ASP B CG  1 
ATOM   1650 O OD1 . ASP B 1 27  ? 0.034   50.257  -10.571 1.00 44.56 ? 26  ASP B OD1 1 
ATOM   1651 O OD2 . ASP B 1 27  ? -0.840  52.250  -10.304 1.00 45.34 ? 26  ASP B OD2 1 
ATOM   1652 N N   . GLU B 1 28  ? -3.668  48.080  -13.404 1.00 31.91 ? 27  GLU B N   1 
ATOM   1653 C CA  . GLU B 1 28  ? -4.879  47.300  -13.517 1.00 33.62 ? 27  GLU B CA  1 
ATOM   1654 C C   . GLU B 1 28  ? -4.570  45.863  -13.060 1.00 32.81 ? 27  GLU B C   1 
ATOM   1655 O O   . GLU B 1 28  ? -3.473  45.354  -13.281 1.00 32.91 ? 27  GLU B O   1 
ATOM   1656 C CB  . GLU B 1 28  ? -5.482  47.404  -14.926 1.00 33.15 ? 27  GLU B CB  1 
ATOM   1657 C CG  . GLU B 1 28  ? -4.790  46.582  -16.008 1.00 37.07 ? 27  GLU B CG  1 
ATOM   1658 C CD  . GLU B 1 28  ? -5.462  46.743  -17.377 1.00 39.35 ? 27  GLU B CD  1 
ATOM   1659 O OE1 . GLU B 1 28  ? -6.125  47.795  -17.576 1.00 39.68 ? 27  GLU B OE1 1 
ATOM   1660 O OE2 . GLU B 1 28  ? -5.334  45.827  -18.239 1.00 32.10 ? 27  GLU B OE2 1 
ATOM   1661 N N   . THR B 1 29  ? -5.512  45.235  -12.368 1.00 32.74 ? 28  THR B N   1 
ATOM   1662 C CA  . THR B 1 29  ? -5.276  43.900  -11.833 1.00 34.26 ? 28  THR B CA  1 
ATOM   1663 C C   . THR B 1 29  ? -5.045  42.873  -12.942 1.00 31.23 ? 28  THR B C   1 
ATOM   1664 O O   . THR B 1 29  ? -5.744  42.862  -13.957 1.00 30.88 ? 28  THR B O   1 
ATOM   1665 C CB  . THR B 1 29  ? -6.429  43.455  -10.912 1.00 35.53 ? 28  THR B CB  1 
ATOM   1666 O OG1 . THR B 1 29  ? -6.318  44.136  -9.652  1.00 44.22 ? 28  THR B OG1 1 
ATOM   1667 C CG2 . THR B 1 29  ? -6.363  41.969  -10.656 1.00 34.44 ? 28  THR B CG2 1 
ATOM   1668 N N   . ILE B 1 30  ? -4.037  42.031  -12.757 1.00 28.70 ? 29  ILE B N   1 
ATOM   1669 C CA  . ILE B 1 30  ? -3.747  40.991  -13.726 1.00 27.25 ? 29  ILE B CA  1 
ATOM   1670 C C   . ILE B 1 30  ? -4.845  39.934  -13.692 1.00 28.01 ? 29  ILE B C   1 
ATOM   1671 O O   . ILE B 1 30  ? -5.126  39.359  -12.647 1.00 26.90 ? 29  ILE B O   1 
ATOM   1672 C CB  . ILE B 1 30  ? -2.381  40.355  -13.463 1.00 26.72 ? 29  ILE B CB  1 
ATOM   1673 C CG1 . ILE B 1 30  ? -1.297  41.435  -13.447 1.00 28.90 ? 29  ILE B CG1 1 
ATOM   1674 C CG2 . ILE B 1 30  ? -2.079  39.307  -14.515 1.00 27.72 ? 29  ILE B CG2 1 
ATOM   1675 C CD1 . ILE B 1 30  ? 0.089   40.894  -13.350 1.00 30.12 ? 29  ILE B CD1 1 
ATOM   1676 N N   . PRO B 1 31  ? -5.489  39.694  -14.839 1.00 25.53 ? 30  PRO B N   1 
ATOM   1677 C CA  . PRO B 1 31  ? -6.635  38.784  -14.934 1.00 26.29 ? 30  PRO B CA  1 
ATOM   1678 C C   . PRO B 1 31  ? -6.251  37.320  -15.168 1.00 27.41 ? 30  PRO B C   1 
ATOM   1679 O O   . PRO B 1 31  ? -6.562  36.751  -16.216 1.00 26.57 ? 30  PRO B O   1 
ATOM   1680 C CB  . PRO B 1 31  ? -7.396  39.330  -16.137 1.00 27.93 ? 30  PRO B CB  1 
ATOM   1681 C CG  . PRO B 1 31  ? -6.331  39.913  -16.999 1.00 27.23 ? 30  PRO B CG  1 
ATOM   1682 C CD  . PRO B 1 31  ? -5.276  40.451  -16.081 1.00 24.48 ? 30  PRO B CD  1 
ATOM   1683 N N   . TYR B 1 32  ? -5.624  36.702  -14.174 1.00 28.62 ? 31  TYR B N   1 
ATOM   1684 C CA  . TYR B 1 32  ? -5.034  35.384  -14.356 1.00 30.16 ? 31  TYR B CA  1 
ATOM   1685 C C   . TYR B 1 32  ? -5.204  34.466  -13.139 1.00 30.09 ? 31  TYR B C   1 
ATOM   1686 O O   . TYR B 1 32  ? -5.294  34.937  -12.008 1.00 32.35 ? 31  TYR B O   1 
ATOM   1687 C CB  . TYR B 1 32  ? -3.549  35.568  -14.660 1.00 28.73 ? 31  TYR B CB  1 
ATOM   1688 C CG  . TYR B 1 32  ? -2.819  34.300  -15.031 1.00 28.65 ? 31  TYR B CG  1 
ATOM   1689 C CD1 . TYR B 1 32  ? -2.922  33.770  -16.309 1.00 26.94 ? 31  TYR B CD1 1 
ATOM   1690 C CD2 . TYR B 1 32  ? -2.012  33.650  -14.114 1.00 26.07 ? 31  TYR B CD2 1 
ATOM   1691 C CE1 . TYR B 1 32  ? -2.258  32.637  -16.650 1.00 25.17 ? 31  TYR B CE1 1 
ATOM   1692 C CE2 . TYR B 1 32  ? -1.341  32.512  -14.456 1.00 26.33 ? 31  TYR B CE2 1 
ATOM   1693 C CZ  . TYR B 1 32  ? -1.472  32.014  -15.722 1.00 26.14 ? 31  TYR B CZ  1 
ATOM   1694 O OH  . TYR B 1 32  ? -0.807  30.875  -16.068 1.00 30.15 ? 31  TYR B OH  1 
ATOM   1695 N N   . SER B 1 33  ? -5.233  33.158  -13.382 1.00 27.22 ? 32  SER B N   1 
ATOM   1696 C CA  . SER B 1 33  ? -5.241  32.165  -12.311 1.00 29.81 ? 32  SER B CA  1 
ATOM   1697 C C   . SER B 1 33  ? -4.357  30.974  -12.715 1.00 32.13 ? 32  SER B C   1 
ATOM   1698 O O   . SER B 1 33  ? -4.360  30.549  -13.876 1.00 33.91 ? 32  SER B O   1 
ATOM   1699 C CB  . SER B 1 33  ? -6.684  31.703  -12.009 1.00 35.72 ? 32  SER B CB  1 
ATOM   1700 O OG  . SER B 1 33  ? -6.778  30.824  -10.883 1.00 33.91 ? 32  SER B OG  1 
ATOM   1701 N N   . THR B 1 34  ? -3.605  30.442  -11.758 1.00 30.80 ? 33  THR B N   1 
ATOM   1702 C CA  . THR B 1 34  ? -2.766  29.269  -11.992 1.00 31.45 ? 33  THR B CA  1 
ATOM   1703 C C   . THR B 1 34  ? -3.539  27.963  -11.809 1.00 34.98 ? 33  THR B C   1 
ATOM   1704 O O   . THR B 1 34  ? -3.006  26.871  -12.026 1.00 33.40 ? 33  THR B O   1 
ATOM   1705 C CB  . THR B 1 34  ? -1.643  29.219  -10.981 1.00 30.55 ? 33  THR B CB  1 
ATOM   1706 O OG1 . THR B 1 34  ? -2.219  29.255  -9.675  1.00 32.67 ? 33  THR B OG1 1 
ATOM   1707 C CG2 . THR B 1 34  ? -0.698  30.401  -11.151 1.00 29.72 ? 33  THR B CG2 1 
ATOM   1708 N N   . ALA B 1 35  ? -4.797  28.086  -11.400 1.00 38.33 ? 34  ALA B N   1 
ATOM   1709 C CA  . ALA B 1 35  ? -5.593  26.937  -10.984 1.00 35.19 ? 34  ALA B CA  1 
ATOM   1710 C C   . ALA B 1 35  ? -5.838  25.926  -12.091 1.00 35.10 ? 34  ALA B C   1 
ATOM   1711 O O   . ALA B 1 35  ? -5.836  24.722  -11.834 1.00 40.11 ? 34  ALA B O   1 
ATOM   1712 C CB  . ALA B 1 35  ? -6.911  27.394  -10.385 1.00 32.23 ? 34  ALA B CB  1 
ATOM   1713 N N   . GLU B 1 36  ? -6.061  26.401  -13.312 1.00 33.83 ? 35  GLU B N   1 
ATOM   1714 C CA  . GLU B 1 36  ? -6.299  25.483  -14.425 1.00 37.19 ? 35  GLU B CA  1 
ATOM   1715 C C   . GLU B 1 36  ? -5.009  24.843  -14.897 1.00 37.09 ? 35  GLU B C   1 
ATOM   1716 O O   . GLU B 1 36  ? -4.976  23.640  -15.185 1.00 35.21 ? 35  GLU B O   1 
ATOM   1717 C CB  . GLU B 1 36  ? -7.015  26.160  -15.590 1.00 37.25 ? 35  GLU B CB  1 
ATOM   1718 C CG  . GLU B 1 36  ? -8.486  26.389  -15.316 1.00 45.08 ? 35  GLU B CG  1 
ATOM   1719 C CD  . GLU B 1 36  ? -9.212  25.126  -14.846 1.00 53.01 ? 35  GLU B CD  1 
ATOM   1720 O OE1 . GLU B 1 36  ? -9.998  25.235  -13.872 1.00 52.23 ? 35  GLU B OE1 1 
ATOM   1721 O OE2 . GLU B 1 36  ? -9.006  24.040  -15.455 1.00 47.90 ? 35  GLU B OE2 1 
ATOM   1722 N N   . GLY B 1 37  ? -3.951  25.645  -14.966 1.00 33.26 ? 36  GLY B N   1 
ATOM   1723 C CA  . GLY B 1 37  ? -2.637  25.127  -15.288 1.00 31.93 ? 36  GLY B CA  1 
ATOM   1724 C C   . GLY B 1 37  ? -2.242  24.029  -14.320 1.00 32.61 ? 36  GLY B C   1 
ATOM   1725 O O   . GLY B 1 37  ? -1.859  22.924  -14.719 1.00 31.35 ? 36  GLY B O   1 
ATOM   1726 N N   . ILE B 1 38  ? -2.352  24.333  -13.033 1.00 33.79 ? 37  ILE B N   1 
ATOM   1727 C CA  . ILE B 1 38  ? -1.977  23.383  -12.004 1.00 31.75 ? 37  ILE B CA  1 
ATOM   1728 C C   . ILE B 1 38  ? -2.801  22.118  -12.137 1.00 32.65 ? 37  ILE B C   1 
ATOM   1729 O O   . ILE B 1 38  ? -2.278  21.011  -12.009 1.00 33.05 ? 37  ILE B O   1 
ATOM   1730 C CB  . ILE B 1 38  ? -2.123  23.991  -10.618 1.00 31.32 ? 37  ILE B CB  1 
ATOM   1731 C CG1 . ILE B 1 38  ? -0.876  24.810  -10.297 1.00 32.37 ? 37  ILE B CG1 1 
ATOM   1732 C CG2 . ILE B 1 38  ? -2.291  22.914  -9.582  1.00 34.42 ? 37  ILE B CG2 1 
ATOM   1733 C CD1 . ILE B 1 38  ? -1.106  25.936  -9.297  1.00 33.19 ? 37  ILE B CD1 1 
ATOM   1734 N N   . LYS B 1 39  ? -4.082  22.285  -12.441 1.00 32.52 ? 38  LYS B N   1 
ATOM   1735 C CA  . LYS B 1 39  ? -4.955  21.135  -12.654 1.00 36.14 ? 38  LYS B CA  1 
ATOM   1736 C C   . LYS B 1 39  ? -4.464  20.235  -13.787 1.00 34.19 ? 38  LYS B C   1 
ATOM   1737 O O   . LYS B 1 39  ? -4.376  19.023  -13.623 1.00 34.71 ? 38  LYS B O   1 
ATOM   1738 C CB  . LYS B 1 39  ? -6.397  21.571  -12.903 1.00 35.37 ? 38  LYS B CB  1 
ATOM   1739 C CG  . LYS B 1 39  ? -7.214  21.677  -11.635 1.00 36.72 ? 38  LYS B CG  1 
ATOM   1740 C CD  . LYS B 1 39  ? -8.619  21.122  -11.832 1.00 42.04 ? 38  LYS B CD  1 
ATOM   1741 C CE  . LYS B 1 39  ? -9.530  22.129  -12.527 1.00 45.42 ? 38  LYS B CE  1 
ATOM   1742 N NZ  . LYS B 1 39  ? -10.908 21.579  -12.710 1.00 50.62 ? 38  LYS B NZ  1 
ATOM   1743 N N   . LYS B 1 40  ? -4.125  20.838  -14.921 1.00 34.28 ? 39  LYS B N   1 
ATOM   1744 C CA  . LYS B 1 40  ? -3.686  20.089  -16.091 1.00 31.21 ? 39  LYS B CA  1 
ATOM   1745 C C   . LYS B 1 40  ? -2.379  19.316  -15.877 1.00 32.06 ? 39  LYS B C   1 
ATOM   1746 O O   . LYS B 1 40  ? -2.233  18.203  -16.374 1.00 32.31 ? 39  LYS B O   1 
ATOM   1747 C CB  . LYS B 1 40  ? -3.568  21.013  -17.302 1.00 26.58 ? 39  LYS B CB  1 
ATOM   1748 C CG  . LYS B 1 40  ? -4.878  21.631  -17.708 1.00 28.07 ? 39  LYS B CG  1 
ATOM   1749 C CD  . LYS B 1 40  ? -5.556  20.891  -18.860 1.00 26.39 ? 39  LYS B CD  1 
ATOM   1750 C CE  . LYS B 1 40  ? -6.970  21.449  -19.128 1.00 28.91 ? 39  LYS B CE  1 
ATOM   1751 N NZ  . LYS B 1 40  ? -7.054  22.956  -18.962 1.00 35.02 ? 39  LYS B NZ  1 
ATOM   1752 N N   . TYR B 1 41  ? -1.432  19.886  -15.143 1.00 30.09 ? 40  TYR B N   1 
ATOM   1753 C CA  . TYR B 1 41  ? -0.183  19.170  -14.912 1.00 32.40 ? 40  TYR B CA  1 
ATOM   1754 C C   . TYR B 1 41  ? -0.303  18.054  -13.869 1.00 34.18 ? 40  TYR B C   1 
ATOM   1755 O O   . TYR B 1 41  ? 0.347   17.018  -13.982 1.00 36.54 ? 40  TYR B O   1 
ATOM   1756 C CB  . TYR B 1 41  ? 0.973   20.137  -14.644 1.00 31.59 ? 40  TYR B CB  1 
ATOM   1757 C CG  . TYR B 1 41  ? 1.266   20.942  -15.880 1.00 32.74 ? 40  TYR B CG  1 
ATOM   1758 C CD1 . TYR B 1 41  ? 1.709   20.318  -17.036 1.00 29.21 ? 40  TYR B CD1 1 
ATOM   1759 C CD2 . TYR B 1 41  ? 1.051   22.311  -15.918 1.00 31.73 ? 40  TYR B CD2 1 
ATOM   1760 C CE1 . TYR B 1 41  ? 1.951   21.034  -18.199 1.00 26.25 ? 40  TYR B CE1 1 
ATOM   1761 C CE2 . TYR B 1 41  ? 1.299   23.041  -17.080 1.00 31.04 ? 40  TYR B CE2 1 
ATOM   1762 C CZ  . TYR B 1 41  ? 1.751   22.391  -18.218 1.00 29.41 ? 40  TYR B CZ  1 
ATOM   1763 O OH  . TYR B 1 41  ? 2.003   23.100  -19.379 1.00 28.66 ? 40  TYR B OH  1 
ATOM   1764 N N   . GLU B 1 42  ? -1.155  18.245  -12.873 1.00 33.43 ? 41  GLU B N   1 
ATOM   1765 C CA  . GLU B 1 42  ? -1.538  17.132  -12.019 1.00 34.84 ? 41  GLU B CA  1 
ATOM   1766 C C   . GLU B 1 42  ? -2.261  16.092  -12.879 1.00 36.62 ? 41  GLU B C   1 
ATOM   1767 O O   . GLU B 1 42  ? -2.167  14.891  -12.642 1.00 38.05 ? 41  GLU B O   1 
ATOM   1768 C CB  . GLU B 1 42  ? -2.444  17.624  -10.893 1.00 34.70 ? 41  GLU B CB  1 
ATOM   1769 C CG  . GLU B 1 42  ? -1.711  18.460  -9.846  1.00 38.85 ? 41  GLU B CG  1 
ATOM   1770 C CD  . GLU B 1 42  ? -2.638  19.395  -9.052  1.00 46.30 ? 41  GLU B CD  1 
ATOM   1771 O OE1 . GLU B 1 42  ? -3.831  19.512  -9.426  1.00 44.50 ? 41  GLU B OE1 1 
ATOM   1772 O OE2 . GLU B 1 42  ? -2.172  20.019  -8.059  1.00 43.49 ? 41  GLU B OE2 1 
ATOM   1773 N N   . GLY B 1 43  ? -2.956  16.585  -13.899 1.00 38.91 ? 42  GLY B N   1 
ATOM   1774 C CA  . GLY B 1 43  ? -3.781  15.792  -14.794 1.00 37.40 ? 42  GLY B CA  1 
ATOM   1775 C C   . GLY B 1 43  ? -3.185  14.498  -15.297 1.00 38.21 ? 42  GLY B C   1 
ATOM   1776 O O   . GLY B 1 43  ? -3.919  13.546  -15.565 1.00 48.42 ? 42  GLY B O   1 
ATOM   1777 N N   . ASP B 1 44  ? -1.873  14.465  -15.485 1.00 35.31 ? 43  ASP B N   1 
ATOM   1778 C CA  . ASP B 1 44  ? -1.163  13.181  -15.429 1.00 49.86 ? 43  ASP B CA  1 
ATOM   1779 C C   . ASP B 1 44  ? 0.289   13.416  -15.070 1.00 46.69 ? 43  ASP B C   1 
ATOM   1780 O O   . ASP B 1 44  ? 1.131   13.716  -15.926 1.00 41.21 ? 43  ASP B O   1 
ATOM   1781 C CB  . ASP B 1 44  ? -1.322  12.261  -16.687 1.00 55.62 ? 43  ASP B CB  1 
ATOM   1782 C CG  . ASP B 1 44  ? -0.971  10.729  -16.407 1.00 53.07 ? 43  ASP B CG  1 
ATOM   1783 O OD1 . ASP B 1 44  ? -1.136  10.234  -15.258 1.00 48.09 ? 43  ASP B OD1 1 
ATOM   1784 O OD2 . ASP B 1 44  ? -0.547  10.013  -17.360 1.00 43.22 ? 43  ASP B OD2 1 
ATOM   1785 N N   . GLY B 1 45  ? 0.549   13.315  -13.771 1.00 42.79 ? 44  GLY B N   1 
ATOM   1786 C CA  . GLY B 1 45  ? 1.857   12.932  -13.313 1.00 41.46 ? 44  GLY B CA  1 
ATOM   1787 C C   . GLY B 1 45  ? 2.477   13.879  -12.344 1.00 38.52 ? 44  GLY B C   1 
ATOM   1788 O O   . GLY B 1 45  ? 3.115   13.443  -11.387 1.00 40.91 ? 44  GLY B O   1 
ATOM   1789 N N   . TYR B 1 46  ? 2.301   15.170  -12.596 1.00 37.57 ? 45  TYR B N   1 
ATOM   1790 C CA  . TYR B 1 46  ? 3.074   16.178  -11.879 1.00 38.43 ? 45  TYR B CA  1 
ATOM   1791 C C   . TYR B 1 46  ? 2.554   16.400  -10.480 1.00 36.47 ? 45  TYR B C   1 
ATOM   1792 O O   . TYR B 1 46  ? 1.405   16.073  -10.173 1.00 37.24 ? 45  TYR B O   1 
ATOM   1793 C CB  . TYR B 1 46  ? 3.112   17.496  -12.652 1.00 34.97 ? 45  TYR B CB  1 
ATOM   1794 C CG  . TYR B 1 46  ? 3.848   17.386  -13.965 1.00 33.95 ? 45  TYR B CG  1 
ATOM   1795 C CD1 . TYR B 1 46  ? 5.216   17.603  -14.033 1.00 32.98 ? 45  TYR B CD1 1 
ATOM   1796 C CD2 . TYR B 1 46  ? 3.177   17.051  -15.134 1.00 34.59 ? 45  TYR B CD2 1 
ATOM   1797 C CE1 . TYR B 1 46  ? 5.896   17.507  -15.235 1.00 34.85 ? 45  TYR B CE1 1 
ATOM   1798 C CE2 . TYR B 1 46  ? 3.847   16.949  -16.345 1.00 33.87 ? 45  TYR B CE2 1 
ATOM   1799 C CZ  . TYR B 1 46  ? 5.208   17.179  -16.390 1.00 35.36 ? 45  TYR B CZ  1 
ATOM   1800 O OH  . TYR B 1 46  ? 5.884   17.079  -17.591 1.00 35.89 ? 45  TYR B OH  1 
ATOM   1801 N N   . VAL B 1 47  ? 3.420   16.943  -9.635  1.00 33.85 ? 46  VAL B N   1 
ATOM   1802 C CA  . VAL B 1 47  ? 3.054   17.265  -8.270  1.00 34.23 ? 46  VAL B CA  1 
ATOM   1803 C C   . VAL B 1 47  ? 3.470   18.689  -7.931  1.00 34.77 ? 46  VAL B C   1 
ATOM   1804 O O   . VAL B 1 47  ? 4.633   19.059  -8.081  1.00 37.02 ? 46  VAL B O   1 
ATOM   1805 C CB  . VAL B 1 47  ? 3.717   16.306  -7.285  1.00 34.92 ? 46  VAL B CB  1 
ATOM   1806 C CG1 . VAL B 1 47  ? 3.459   16.755  -5.865  1.00 32.86 ? 46  VAL B CG1 1 
ATOM   1807 C CG2 . VAL B 1 47  ? 3.205   14.887  -7.508  1.00 35.81 ? 46  VAL B CG2 1 
ATOM   1808 N N   . LEU B 1 48  ? 2.516   19.485  -7.467  1.00 32.50 ? 47  LEU B N   1 
ATOM   1809 C CA  . LEU B 1 48  ? 2.776   20.871  -7.139  1.00 30.47 ? 47  LEU B CA  1 
ATOM   1810 C C   . LEU B 1 48  ? 3.784   21.016  -6.006  1.00 31.20 ? 47  LEU B C   1 
ATOM   1811 O O   . LEU B 1 48  ? 3.568   20.531  -4.908  1.00 33.54 ? 47  LEU B O   1 
ATOM   1812 C CB  . LEU B 1 48  ? 1.469   21.567  -6.774  1.00 32.65 ? 47  LEU B CB  1 
ATOM   1813 C CG  . LEU B 1 48  ? 1.567   23.058  -6.454  1.00 34.00 ? 47  LEU B CG  1 
ATOM   1814 C CD1 . LEU B 1 48  ? 2.195   23.824  -7.609  1.00 30.93 ? 47  LEU B CD1 1 
ATOM   1815 C CD2 . LEU B 1 48  ? 0.187   23.596  -6.129  1.00 33.00 ? 47  LEU B CD2 1 
ATOM   1816 N N   . VAL B 1 49  ? 4.890   21.685  -6.287  1.00 32.49 ? 48  VAL B N   1 
ATOM   1817 C CA  . VAL B 1 49  ? 5.875   22.009  -5.270  1.00 33.54 ? 48  VAL B CA  1 
ATOM   1818 C C   . VAL B 1 49  ? 5.657   23.422  -4.714  1.00 40.93 ? 48  VAL B C   1 
ATOM   1819 O O   . VAL B 1 49  ? 5.669   23.617  -3.498  1.00 46.83 ? 48  VAL B O   1 
ATOM   1820 C CB  . VAL B 1 49  ? 7.296   21.914  -5.835  1.00 37.87 ? 48  VAL B CB  1 
ATOM   1821 C CG1 . VAL B 1 49  ? 8.303   22.568  -4.889  1.00 36.44 ? 48  VAL B CG1 1 
ATOM   1822 C CG2 . VAL B 1 49  ? 7.649   20.459  -6.133  1.00 35.19 ? 48  VAL B CG2 1 
ATOM   1823 N N   . SER B 1 50  ? 5.452   24.406  -5.589  1.00 37.40 ? 49  SER B N   1 
ATOM   1824 C CA  . SER B 1 50  ? 5.223   25.777  -5.122  1.00 38.30 ? 49  SER B CA  1 
ATOM   1825 C C   . SER B 1 50  ? 4.444   26.642  -6.117  1.00 39.57 ? 49  SER B C   1 
ATOM   1826 O O   . SER B 1 50  ? 4.327   26.307  -7.296  1.00 40.73 ? 49  SER B O   1 
ATOM   1827 C CB  . SER B 1 50  ? 6.554   26.455  -4.806  1.00 36.14 ? 49  SER B CB  1 
ATOM   1828 O OG  . SER B 1 50  ? 7.075   27.096  -5.958  1.00 35.54 ? 49  SER B OG  1 
ATOM   1829 N N   . ASP B 1 51  ? 3.924   27.767  -5.638  1.00 35.42 ? 50  ASP B N   1 
ATOM   1830 C CA  . ASP B 1 51  ? 3.240   28.724  -6.499  1.00 35.59 ? 50  ASP B CA  1 
ATOM   1831 C C   . ASP B 1 51  ? 3.608   30.133  -6.039  1.00 35.75 ? 50  ASP B C   1 
ATOM   1832 O O   . ASP B 1 51  ? 3.414   30.490  -4.875  1.00 36.44 ? 50  ASP B O   1 
ATOM   1833 C CB  . ASP B 1 51  ? 1.722   28.493  -6.447  1.00 38.75 ? 50  ASP B CB  1 
ATOM   1834 C CG  . ASP B 1 51  ? 0.921   29.437  -7.375  1.00 40.79 ? 50  ASP B CG  1 
ATOM   1835 O OD1 . ASP B 1 51  ? 1.408   30.534  -7.748  1.00 41.33 ? 50  ASP B OD1 1 
ATOM   1836 O OD2 . ASP B 1 51  ? -0.233  29.078  -7.711  1.00 38.06 ? 50  ASP B OD2 1 
ATOM   1837 N N   . GLY B 1 52  ? 4.142   30.924  -6.963  1.00 35.79 ? 51  GLY B N   1 
ATOM   1838 C CA  . GLY B 1 52  ? 4.633   32.258  -6.657  1.00 38.02 ? 51  GLY B CA  1 
ATOM   1839 C C   . GLY B 1 52  ? 3.702   33.379  -7.083  1.00 36.68 ? 51  GLY B C   1 
ATOM   1840 O O   . GLY B 1 52  ? 3.915   34.537  -6.733  1.00 36.97 ? 51  GLY B O   1 
ATOM   1841 N N   . PHE B 1 53  ? 2.663   33.037  -7.836  1.00 34.25 ? 52  PHE B N   1 
ATOM   1842 C CA  . PHE B 1 53  ? 1.703   34.033  -8.274  1.00 33.84 ? 52  PHE B CA  1 
ATOM   1843 C C   . PHE B 1 53  ? 0.636   34.268  -7.214  1.00 36.49 ? 52  PHE B C   1 
ATOM   1844 O O   . PHE B 1 53  ? -0.239  33.431  -6.993  1.00 37.36 ? 52  PHE B O   1 
ATOM   1845 C CB  . PHE B 1 53  ? 1.055   33.631  -9.600  1.00 32.75 ? 52  PHE B CB  1 
ATOM   1846 C CG  . PHE B 1 53  ? 0.036   34.624  -10.103 1.00 33.17 ? 52  PHE B CG  1 
ATOM   1847 C CD1 . PHE B 1 53  ? 0.437   35.783  -10.746 1.00 30.73 ? 52  PHE B CD1 1 
ATOM   1848 C CD2 . PHE B 1 53  ? -1.323  34.397  -9.934  1.00 35.75 ? 52  PHE B CD2 1 
ATOM   1849 C CE1 . PHE B 1 53  ? -0.493  36.695  -11.204 1.00 30.66 ? 52  PHE B CE1 1 
ATOM   1850 C CE2 . PHE B 1 53  ? -2.264  35.312  -10.395 1.00 34.33 ? 52  PHE B CE2 1 
ATOM   1851 C CZ  . PHE B 1 53  ? -1.845  36.461  -11.026 1.00 32.12 ? 52  PHE B CZ  1 
ATOM   1852 N N   . LYS B 1 54  ? 0.730   35.414  -6.555  1.00 39.14 ? 53  LYS B N   1 
ATOM   1853 C CA  . LYS B 1 54  ? -0.250  35.831  -5.566  1.00 41.77 ? 53  LYS B CA  1 
ATOM   1854 C C   . LYS B 1 54  ? -1.299  36.670  -6.297  1.00 41.87 ? 53  LYS B C   1 
ATOM   1855 O O   . LYS B 1 54  ? -0.989  37.756  -6.796  1.00 41.62 ? 53  LYS B O   1 
ATOM   1856 C CB  . LYS B 1 54  ? 0.445   36.637  -4.453  1.00 42.08 ? 53  LYS B CB  1 
ATOM   1857 C CG  . LYS B 1 54  ? -0.463  37.071  -3.288  1.00 57.94 ? 53  LYS B CG  1 
ATOM   1858 C CD  . LYS B 1 54  ? -0.543  36.062  -2.102  1.00 64.65 ? 53  LYS B CD  1 
ATOM   1859 C CE  . LYS B 1 54  ? -1.386  36.647  -0.930  1.00 62.15 ? 53  LYS B CE  1 
ATOM   1860 N NZ  . LYS B 1 54  ? -1.349  35.924  0.387   1.00 54.96 ? 53  LYS B NZ  1 
ATOM   1861 N N   . PRO B 1 55  ? -2.540  36.156  -6.384  1.00 42.91 ? 54  PRO B N   1 
ATOM   1862 C CA  . PRO B 1 55  ? -3.636  36.830  -7.097  1.00 38.63 ? 54  PRO B CA  1 
ATOM   1863 C C   . PRO B 1 55  ? -3.875  38.232  -6.560  1.00 44.68 ? 54  PRO B C   1 
ATOM   1864 O O   . PRO B 1 55  ? -3.614  38.491  -5.388  1.00 49.33 ? 54  PRO B O   1 
ATOM   1865 C CB  . PRO B 1 55  ? -4.849  35.941  -6.796  1.00 41.53 ? 54  PRO B CB  1 
ATOM   1866 C CG  . PRO B 1 55  ? -4.272  34.593  -6.513  1.00 40.63 ? 54  PRO B CG  1 
ATOM   1867 C CD  . PRO B 1 55  ? -2.970  34.874  -5.799  1.00 42.45 ? 54  PRO B CD  1 
ATOM   1868 N N   . GLY B 1 56  ? -4.366  39.132  -7.403  1.00 45.71 ? 55  GLY B N   1 
ATOM   1869 C CA  . GLY B 1 56  ? -4.532  40.519  -7.002  1.00 42.11 ? 55  GLY B CA  1 
ATOM   1870 C C   . GLY B 1 56  ? -3.339  41.367  -7.405  1.00 40.33 ? 55  GLY B C   1 
ATOM   1871 O O   . GLY B 1 56  ? -3.359  42.587  -7.255  1.00 45.11 ? 55  GLY B O   1 
ATOM   1872 N N   . THR B 1 57  ? -2.298  40.712  -7.913  1.00 39.57 ? 56  THR B N   1 
ATOM   1873 C CA  . THR B 1 57  ? -1.116  41.388  -8.441  1.00 37.67 ? 56  THR B CA  1 
ATOM   1874 C C   . THR B 1 57  ? -1.528  42.332  -9.559  1.00 35.31 ? 56  THR B C   1 
ATOM   1875 O O   . THR B 1 57  ? -2.441  42.038  -10.330 1.00 35.67 ? 56  THR B O   1 
ATOM   1876 C CB  . THR B 1 57  ? -0.095  40.373  -9.030  1.00 38.30 ? 56  THR B CB  1 
ATOM   1877 O OG1 . THR B 1 57  ? 0.102   39.265  -8.131  1.00 35.36 ? 56  THR B OG1 1 
ATOM   1878 C CG2 . THR B 1 57  ? 1.232   41.057  -9.311  1.00 37.72 ? 56  THR B CG2 1 
ATOM   1879 N N   . LYS B 1 58  ? -0.866  43.473  -9.657  1.00 37.85 ? 57  LYS B N   1 
ATOM   1880 C CA  . LYS B 1 58  ? -1.217  44.427  -10.695 1.00 34.84 ? 57  LYS B CA  1 
ATOM   1881 C C   . LYS B 1 58  ? -0.030  44.625  -11.621 1.00 32.87 ? 57  LYS B C   1 
ATOM   1882 O O   . LYS B 1 58  ? 1.111   44.331  -11.265 1.00 33.72 ? 57  LYS B O   1 
ATOM   1883 C CB  . LYS B 1 58  ? -1.670  45.750  -10.073 1.00 34.66 ? 57  LYS B CB  1 
ATOM   1884 C CG  . LYS B 1 58  ? -2.616  45.566  -8.880  1.00 38.58 ? 57  LYS B CG  1 
ATOM   1885 C CD  . LYS B 1 58  ? -3.693  46.660  -8.787  1.00 39.34 ? 57  LYS B CD  1 
ATOM   1886 C CE  . LYS B 1 58  ? -3.205  47.902  -8.051  1.00 38.46 ? 57  LYS B CE  1 
ATOM   1887 N NZ  . LYS B 1 58  ? -3.114  47.719  -6.567  1.00 36.79 ? 57  LYS B NZ  1 
ATOM   1888 N N   . PHE B 1 59  ? -0.296  45.106  -12.821 1.00 29.87 ? 58  PHE B N   1 
ATOM   1889 C CA  . PHE B 1 59  ? 0.789   45.408  -13.727 1.00 29.89 ? 58  PHE B CA  1 
ATOM   1890 C C   . PHE B 1 59  ? 1.577   46.613  -13.236 1.00 32.81 ? 58  PHE B C   1 
ATOM   1891 O O   . PHE B 1 59  ? 1.009   47.678  -12.967 1.00 34.01 ? 58  PHE B O   1 
ATOM   1892 C CB  . PHE B 1 59  ? 0.256   45.675  -15.124 1.00 28.21 ? 58  PHE B CB  1 
ATOM   1893 C CG  . PHE B 1 59  ? -0.353  44.482  -15.768 1.00 27.44 ? 58  PHE B CG  1 
ATOM   1894 C CD1 . PHE B 1 59  ? 0.450   43.500  -16.319 1.00 25.46 ? 58  PHE B CD1 1 
ATOM   1895 C CD2 . PHE B 1 59  ? -1.724  44.343  -15.830 1.00 26.71 ? 58  PHE B CD2 1 
ATOM   1896 C CE1 . PHE B 1 59  ? -0.100  42.405  -16.917 1.00 24.10 ? 58  PHE B CE1 1 
ATOM   1897 C CE2 . PHE B 1 59  ? -2.283  43.248  -16.425 1.00 27.52 ? 58  PHE B CE2 1 
ATOM   1898 C CZ  . PHE B 1 59  ? -1.467  42.268  -16.973 1.00 24.77 ? 58  PHE B CZ  1 
ATOM   1899 N N   . GLY B 1 60  ? 2.889   46.432  -13.118 1.00 34.52 ? 59  GLY B N   1 
ATOM   1900 C CA  . GLY B 1 60  ? 3.794   47.516  -12.784 1.00 35.06 ? 59  GLY B CA  1 
ATOM   1901 C C   . GLY B 1 60  ? 4.588   47.965  -13.999 1.00 34.50 ? 59  GLY B C   1 
ATOM   1902 O O   . GLY B 1 60  ? 4.215   47.670  -15.135 1.00 34.53 ? 59  GLY B O   1 
ATOM   1903 N N   . VAL B 1 61  ? 5.684   48.679  -13.766 1.00 33.04 ? 60  VAL B N   1 
ATOM   1904 C CA  . VAL B 1 61  ? 6.543   49.112  -14.860 1.00 32.15 ? 60  VAL B CA  1 
ATOM   1905 C C   . VAL B 1 61  ? 7.668   48.112  -15.130 1.00 32.51 ? 60  VAL B C   1 
ATOM   1906 O O   . VAL B 1 61  ? 8.220   48.066  -16.231 1.00 33.28 ? 60  VAL B O   1 
ATOM   1907 C CB  . VAL B 1 61  ? 7.100   50.516  -14.614 1.00 33.45 ? 60  VAL B CB  1 
ATOM   1908 C CG1 . VAL B 1 61  ? 6.130   51.546  -15.158 1.00 32.92 ? 60  VAL B CG1 1 
ATOM   1909 C CG2 . VAL B 1 61  ? 7.340   50.737  -13.121 1.00 33.01 ? 60  VAL B CG2 1 
ATOM   1910 N N   . GLY B 1 62  ? 7.991   47.296  -14.134 1.00 28.26 ? 61  GLY B N   1 
ATOM   1911 C CA  . GLY B 1 62  ? 8.933   46.216  -14.343 1.00 29.95 ? 61  GLY B CA  1 
ATOM   1912 C C   . GLY B 1 62  ? 8.267   45.068  -15.082 1.00 33.96 ? 61  GLY B C   1 
ATOM   1913 O O   . GLY B 1 62  ? 7.114   45.177  -15.493 1.00 34.21 ? 61  GLY B O   1 
ATOM   1914 N N   . THR B 1 63  ? 8.981   43.963  -15.260 1.00 31.46 ? 62  THR B N   1 
ATOM   1915 C CA  . THR B 1 63  ? 8.409   42.816  -15.952 1.00 29.19 ? 62  THR B CA  1 
ATOM   1916 C C   . THR B 1 63  ? 8.703   41.516  -15.207 1.00 27.84 ? 62  THR B C   1 
ATOM   1917 O O   . THR B 1 63  ? 9.486   40.695  -15.664 1.00 27.67 ? 62  THR B O   1 
ATOM   1918 C CB  . THR B 1 63  ? 8.926   42.712  -17.405 1.00 32.33 ? 62  THR B CB  1 
ATOM   1919 O OG1 . THR B 1 63  ? 10.357  42.730  -17.403 1.00 34.15 ? 62  THR B OG1 1 
ATOM   1920 C CG2 . THR B 1 63  ? 8.420   43.879  -18.258 1.00 29.34 ? 62  THR B CG2 1 
ATOM   1921 N N   . PRO B 1 64  ? 8.059   41.323  -14.056 1.00 26.95 ? 63  PRO B N   1 
ATOM   1922 C CA  . PRO B 1 64  ? 8.309   40.179  -13.181 1.00 26.97 ? 63  PRO B CA  1 
ATOM   1923 C C   . PRO B 1 64  ? 7.931   38.810  -13.766 1.00 32.49 ? 63  PRO B C   1 
ATOM   1924 O O   . PRO B 1 64  ? 7.060   38.700  -14.634 1.00 30.75 ? 63  PRO B O   1 
ATOM   1925 C CB  . PRO B 1 64  ? 7.419   40.476  -11.971 1.00 27.88 ? 63  PRO B CB  1 
ATOM   1926 C CG  . PRO B 1 64  ? 6.353   41.348  -12.495 1.00 29.66 ? 63  PRO B CG  1 
ATOM   1927 C CD  . PRO B 1 64  ? 7.027   42.215  -13.504 1.00 30.82 ? 63  PRO B CD  1 
ATOM   1928 N N   . THR B 1 65  ? 8.604   37.770  -13.274 1.00 31.92 ? 64  THR B N   1 
ATOM   1929 C CA  . THR B 1 65  ? 8.212   36.390  -13.524 1.00 31.26 ? 64  THR B CA  1 
ATOM   1930 C C   . THR B 1 65  ? 7.771   35.749  -12.214 1.00 33.09 ? 64  THR B C   1 
ATOM   1931 O O   . THR B 1 65  ? 8.494   35.783  -11.219 1.00 35.96 ? 64  THR B O   1 
ATOM   1932 C CB  . THR B 1 65  ? 9.372   35.554  -14.094 1.00 30.49 ? 64  THR B CB  1 
ATOM   1933 O OG1 . THR B 1 65  ? 9.846   36.144  -15.316 1.00 29.41 ? 64  THR B OG1 1 
ATOM   1934 C CG2 . THR B 1 65  ? 8.916   34.105  -14.336 1.00 31.48 ? 64  THR B CG2 1 
ATOM   1935 N N   . TYR B 1 66  ? 6.578   35.176  -12.208 1.00 32.27 ? 65  TYR B N   1 
ATOM   1936 C CA  . TYR B 1 66  ? 6.129   34.411  -11.059 1.00 34.47 ? 65  TYR B CA  1 
ATOM   1937 C C   . TYR B 1 66  ? 6.164   32.954  -11.467 1.00 35.82 ? 65  TYR B C   1 
ATOM   1938 O O   . TYR B 1 66  ? 5.640   32.590  -12.523 1.00 35.95 ? 65  TYR B O   1 
ATOM   1939 C CB  . TYR B 1 66  ? 4.728   34.854  -10.629 1.00 34.81 ? 65  TYR B CB  1 
ATOM   1940 C CG  . TYR B 1 66  ? 4.627   36.360  -10.512 1.00 32.36 ? 65  TYR B CG  1 
ATOM   1941 C CD1 . TYR B 1 66  ? 5.204   37.035  -9.439  1.00 32.09 ? 65  TYR B CD1 1 
ATOM   1942 C CD2 . TYR B 1 66  ? 3.991   37.108  -11.489 1.00 31.59 ? 65  TYR B CD2 1 
ATOM   1943 C CE1 . TYR B 1 66  ? 5.141   38.414  -9.335  1.00 34.04 ? 65  TYR B CE1 1 
ATOM   1944 C CE2 . TYR B 1 66  ? 3.917   38.492  -11.399 1.00 37.68 ? 65  TYR B CE2 1 
ATOM   1945 C CZ  . TYR B 1 66  ? 4.495   39.149  -10.318 1.00 39.80 ? 65  TYR B CZ  1 
ATOM   1946 O OH  . TYR B 1 66  ? 4.419   40.539  -10.229 1.00 38.40 ? 65  TYR B OH  1 
ATOM   1947 N N   . GLU B 1 67  ? 6.809   32.127  -10.648 1.00 39.60 ? 66  GLU B N   1 
ATOM   1948 C CA  . GLU B 1 67  ? 7.030   30.732  -11.005 1.00 34.07 ? 66  GLU B CA  1 
ATOM   1949 C C   . GLU B 1 67  ? 6.088   29.792  -10.284 1.00 33.89 ? 66  GLU B C   1 
ATOM   1950 O O   . GLU B 1 67  ? 5.801   29.948  -9.103  1.00 36.40 ? 66  GLU B O   1 
ATOM   1951 C CB  . GLU B 1 67  ? 8.474   30.325  -10.715 1.00 38.19 ? 66  GLU B CB  1 
ATOM   1952 C CG  . GLU B 1 67  ? 9.511   31.352  -11.170 1.00 45.71 ? 66  GLU B CG  1 
ATOM   1953 C CD  . GLU B 1 67  ? 10.764  30.714  -11.775 1.00 51.05 ? 66  GLU B CD  1 
ATOM   1954 O OE1 . GLU B 1 67  ? 10.845  29.463  -11.795 1.00 54.73 ? 66  GLU B OE1 1 
ATOM   1955 O OE2 . GLU B 1 67  ? 11.659  31.463  -12.241 1.00 48.93 ? 66  GLU B OE2 1 
ATOM   1956 N N   . VAL B 1 68  ? 5.598   28.812  -11.018 1.00 36.30 ? 67  VAL B N   1 
ATOM   1957 C CA  . VAL B 1 68  ? 4.907   27.689  -10.424 1.00 34.35 ? 67  VAL B CA  1 
ATOM   1958 C C   . VAL B 1 68  ? 5.804   26.483  -10.683 1.00 35.58 ? 67  VAL B C   1 
ATOM   1959 O O   . VAL B 1 68  ? 6.173   26.215  -11.826 1.00 32.27 ? 67  VAL B O   1 
ATOM   1960 C CB  . VAL B 1 68  ? 3.528   27.493  -11.064 1.00 31.85 ? 67  VAL B CB  1 
ATOM   1961 C CG1 . VAL B 1 68  ? 2.811   26.337  -10.431 1.00 32.60 ? 67  VAL B CG1 1 
ATOM   1962 C CG2 . VAL B 1 68  ? 2.703   28.768  -10.929 1.00 33.60 ? 67  VAL B CG2 1 
ATOM   1963 N N   . HIS B 1 69  ? 6.188   25.783  -9.619  1.00 38.79 ? 68  HIS B N   1 
ATOM   1964 C CA  . HIS B 1 69  ? 7.054   24.614  -9.743  1.00 34.79 ? 68  HIS B CA  1 
ATOM   1965 C C   . HIS B 1 69  ? 6.303   23.316  -9.575  1.00 36.00 ? 68  HIS B C   1 
ATOM   1966 O O   . HIS B 1 69  ? 5.297   23.242  -8.862  1.00 35.99 ? 68  HIS B O   1 
ATOM   1967 C CB  . HIS B 1 69  ? 8.211   24.674  -8.752  1.00 36.26 ? 68  HIS B CB  1 
ATOM   1968 C CG  . HIS B 1 69  ? 9.238   25.702  -9.106  1.00 40.52 ? 68  HIS B CG  1 
ATOM   1969 N ND1 . HIS B 1 69  ? 10.336  25.415  -9.886  1.00 37.93 ? 68  HIS B ND1 1 
ATOM   1970 C CD2 . HIS B 1 69  ? 9.314   27.022  -8.817  1.00 40.58 ? 68  HIS B CD2 1 
ATOM   1971 C CE1 . HIS B 1 69  ? 11.051  26.514  -10.053 1.00 37.40 ? 68  HIS B CE1 1 
ATOM   1972 N NE2 . HIS B 1 69  ? 10.457  27.501  -9.409  1.00 38.08 ? 68  HIS B NE2 1 
ATOM   1973 N N   . PHE B 1 70  ? 6.808   22.298  -10.258 1.00 36.10 ? 69  PHE B N   1 
ATOM   1974 C CA  . PHE B 1 70  ? 6.263   20.959  -10.210 1.00 32.48 ? 69  PHE B CA  1 
ATOM   1975 C C   . PHE B 1 70  ? 7.412   19.961  -10.062 1.00 36.13 ? 69  PHE B C   1 
ATOM   1976 O O   . PHE B 1 70  ? 8.583   20.314  -10.211 1.00 38.89 ? 69  PHE B O   1 
ATOM   1977 C CB  . PHE B 1 70  ? 5.519   20.661  -11.508 1.00 32.72 ? 69  PHE B CB  1 
ATOM   1978 C CG  . PHE B 1 70  ? 4.287   21.481  -11.710 1.00 31.29 ? 69  PHE B CG  1 
ATOM   1979 C CD1 . PHE B 1 70  ? 3.052   21.014  -11.290 1.00 33.83 ? 69  PHE B CD1 1 
ATOM   1980 C CD2 . PHE B 1 70  ? 4.350   22.700  -12.341 1.00 31.20 ? 69  PHE B CD2 1 
ATOM   1981 C CE1 . PHE B 1 70  ? 1.904   21.758  -11.478 1.00 31.24 ? 69  PHE B CE1 1 
ATOM   1982 C CE2 . PHE B 1 70  ? 3.209   23.451  -12.529 1.00 35.02 ? 69  PHE B CE2 1 
ATOM   1983 C CZ  . PHE B 1 70  ? 1.981   22.978  -12.093 1.00 35.10 ? 69  PHE B CZ  1 
ATOM   1984 N N   . LYS B 1 71  ? 7.071   18.713  -9.773  1.00 36.38 ? 70  LYS B N   1 
ATOM   1985 C CA  . LYS B 1 71  ? 8.025   17.615  -9.824  1.00 36.78 ? 70  LYS B CA  1 
ATOM   1986 C C   . LYS B 1 71  ? 7.264   16.394  -10.308 1.00 35.62 ? 70  LYS B C   1 
ATOM   1987 O O   . LYS B 1 71  ? 6.036   16.414  -10.409 1.00 32.82 ? 70  LYS B O   1 
ATOM   1988 C CB  . LYS B 1 71  ? 8.624   17.350  -8.446  1.00 36.98 ? 70  LYS B CB  1 
ATOM   1989 C CG  . LYS B 1 71  ? 7.592   16.915  -7.423  1.00 37.14 ? 70  LYS B CG  1 
ATOM   1990 C CD  . LYS B 1 71  ? 8.239   16.569  -6.097  1.00 40.79 ? 70  LYS B CD  1 
ATOM   1991 C CE  . LYS B 1 71  ? 7.242   15.877  -5.171  1.00 44.09 ? 70  LYS B CE  1 
ATOM   1992 N NZ  . LYS B 1 71  ? 7.878   14.865  -4.251  1.00 54.81 ? 70  LYS B NZ  1 
ATOM   1993 N N   . HIS B 1 72  ? 7.981   15.328  -10.622 1.00 37.45 ? 71  HIS B N   1 
ATOM   1994 C CA  . HIS B 1 72  ? 7.302   14.141  -11.109 1.00 39.61 ? 71  HIS B CA  1 
ATOM   1995 C C   . HIS B 1 72  ? 6.752   13.347  -9.933  1.00 40.57 ? 71  HIS B C   1 
ATOM   1996 O O   . HIS B 1 72  ? 7.363   13.289  -8.859  1.00 38.47 ? 71  HIS B O   1 
ATOM   1997 C CB  . HIS B 1 72  ? 8.226   13.274  -11.962 1.00 42.21 ? 71  HIS B CB  1 
ATOM   1998 C CG  . HIS B 1 72  ? 8.586   13.879  -13.284 1.00 44.59 ? 71  HIS B CG  1 
ATOM   1999 N ND1 . HIS B 1 72  ? 9.321   13.205  -14.235 1.00 49.57 ? 71  HIS B ND1 1 
ATOM   2000 C CD2 . HIS B 1 72  ? 8.314   15.095  -13.817 1.00 45.03 ? 71  HIS B CD2 1 
ATOM   2001 C CE1 . HIS B 1 72  ? 9.489   13.976  -15.295 1.00 44.79 ? 71  HIS B CE1 1 
ATOM   2002 N NE2 . HIS B 1 72  ? 8.890   15.130  -15.066 1.00 44.19 ? 71  HIS B NE2 1 
ATOM   2003 N N   . GLY B 1 73  ? 5.576   12.767  -10.137 1.00 40.25 ? 72  GLY B N   1 
ATOM   2004 C CA  . GLY B 1 73  ? 4.958   11.929  -9.135  1.00 43.33 ? 72  GLY B CA  1 
ATOM   2005 C C   . GLY B 1 73  ? 5.559   10.542  -9.207  1.00 45.38 ? 72  GLY B C   1 
ATOM   2006 O O   . GLY B 1 73  ? 5.654   9.958   -10.283 1.00 45.45 ? 72  GLY B O   1 
ATOM   2007 N N   . MET B 1 74  ? 5.982   10.019  -8.063  1.00 45.30 ? 73  MET B N   1 
ATOM   2008 C CA  . MET B 1 74  ? 6.514   8.671   -8.012  1.00 47.43 ? 73  MET B CA  1 
ATOM   2009 C C   . MET B 1 74  ? 5.469   7.703   -7.474  1.00 50.13 ? 73  MET B C   1 
ATOM   2010 O O   . MET B 1 74  ? 4.564   8.091   -6.735  1.00 53.71 ? 73  MET B O   1 
ATOM   2011 C CB  . MET B 1 74  ? 7.773   8.631   -7.158  1.00 46.41 ? 73  MET B CB  1 
ATOM   2012 C CG  . MET B 1 74  ? 8.837   9.626   -7.590  1.00 50.76 ? 73  MET B CG  1 
ATOM   2013 S SD  . MET B 1 74  ? 9.490   9.369   -9.261  1.00 59.92 ? 73  MET B SD  1 
ATOM   2014 C CE  . MET B 1 74  ? 10.958  10.401  -9.169  1.00 48.82 ? 73  MET B CE  1 
ATOM   2015 N N   . THR B 1 75  ? 5.588   6.445   -7.877  1.00 52.41 ? 74  THR B N   1 
ATOM   2016 C CA  . THR B 1 75  ? 4.749   5.373   -7.355  1.00 50.94 ? 74  THR B CA  1 
ATOM   2017 C C   . THR B 1 75  ? 5.630   4.178   -7.035  1.00 52.20 ? 74  THR B C   1 
ATOM   2018 O O   . THR B 1 75  ? 5.932   3.355   -7.901  1.00 53.26 ? 74  THR B O   1 
ATOM   2019 C CB  . THR B 1 75  ? 3.658   4.974   -8.341  1.00 48.02 ? 74  THR B CB  1 
ATOM   2020 O OG1 . THR B 1 75  ? 2.754   6.073   -8.499  1.00 52.59 ? 74  THR B OG1 1 
ATOM   2021 C CG2 . THR B 1 75  ? 2.894   3.765   -7.827  1.00 44.75 ? 74  THR B CG2 1 
ATOM   2022 N N   . HIS B 1 76  ? 6.059   4.119   -5.780  1.00 54.04 ? 75  HIS B N   1 
ATOM   2023 C CA  . HIS B 1 76  ? 6.956   3.082   -5.296  1.00 55.22 ? 75  HIS B CA  1 
ATOM   2024 C C   . HIS B 1 76  ? 6.185   1.779   -5.061  1.00 50.93 ? 75  HIS B C   1 
ATOM   2025 O O   . HIS B 1 76  ? 5.199   1.764   -4.337  1.00 45.31 ? 75  HIS B O   1 
ATOM   2026 C CB  . HIS B 1 76  ? 7.623   3.571   -4.008  1.00 54.59 ? 75  HIS B CB  1 
ATOM   2027 C CG  . HIS B 1 76  ? 8.519   2.563   -3.361  1.00 61.30 ? 75  HIS B CG  1 
ATOM   2028 N ND1 . HIS B 1 76  ? 8.036   1.496   -2.633  1.00 59.19 ? 75  HIS B ND1 1 
ATOM   2029 C CD2 . HIS B 1 76  ? 9.870   2.473   -3.314  1.00 62.67 ? 75  HIS B CD2 1 
ATOM   2030 C CE1 . HIS B 1 76  ? 9.053   0.786   -2.174  1.00 59.38 ? 75  HIS B CE1 1 
ATOM   2031 N NE2 . HIS B 1 76  ? 10.177  1.357   -2.572  1.00 59.99 ? 75  HIS B NE2 1 
ATOM   2032 N N   . THR B 1 77  ? 6.613   0.698   -5.712  1.00 56.94 ? 76  THR B N   1 
ATOM   2033 C CA  . THR B 1 77  ? 6.044   -0.634  -5.456  1.00 58.99 ? 76  THR B CA  1 
ATOM   2034 C C   . THR B 1 77  ? 7.048   -1.457  -4.662  1.00 58.46 ? 76  THR B C   1 
ATOM   2035 O O   . THR B 1 77  ? 8.178   -1.648  -5.102  1.00 57.87 ? 76  THR B O   1 
ATOM   2036 C CB  . THR B 1 77  ? 5.690   -1.412  -6.742  1.00 50.84 ? 76  THR B CB  1 
ATOM   2037 O OG1 . THR B 1 77  ? 4.896   -0.592  -7.609  1.00 50.38 ? 76  THR B OG1 1 
ATOM   2038 C CG2 . THR B 1 77  ? 4.915   -2.676  -6.394  1.00 48.22 ? 76  THR B CG2 1 
ATOM   2039 N N   . ASP B 1 78  ? 6.626   -1.942  -3.498  1.00 60.14 ? 77  ASP B N   1 
ATOM   2040 C CA  . ASP B 1 78  ? 7.522   -2.586  -2.532  1.00 59.18 ? 77  ASP B CA  1 
ATOM   2041 C C   . ASP B 1 78  ? 7.691   -4.076  -2.792  1.00 53.26 ? 77  ASP B C   1 
ATOM   2042 O O   . ASP B 1 78  ? 6.842   -4.701  -3.432  1.00 53.42 ? 77  ASP B O   1 
ATOM   2043 C CB  . ASP B 1 78  ? 6.958   -2.396  -1.124  1.00 60.40 ? 77  ASP B CB  1 
ATOM   2044 C CG  . ASP B 1 78  ? 5.453   -2.659  -1.065  1.00 62.12 ? 77  ASP B CG  1 
ATOM   2045 O OD1 . ASP B 1 78  ? 4.726   -2.208  -1.989  1.00 54.32 ? 77  ASP B OD1 1 
ATOM   2046 O OD2 . ASP B 1 78  ? 5.006   -3.332  -0.105  1.00 64.40 ? 77  ASP B OD2 1 
ATOM   2047 N N   . ALA B 1 79  ? 8.778   -4.641  -2.268  1.00 52.15 ? 78  ALA B N   1 
ATOM   2048 C CA  . ALA B 1 79  ? 9.045   -6.071  -2.384  1.00 48.89 ? 78  ALA B CA  1 
ATOM   2049 C C   . ALA B 1 79  ? 7.832   -6.891  -1.939  1.00 51.57 ? 78  ALA B C   1 
ATOM   2050 O O   . ALA B 1 79  ? 7.491   -7.908  -2.541  1.00 49.72 ? 78  ALA B O   1 
ATOM   2051 C CB  . ALA B 1 79  ? 10.265  -6.439  -1.568  1.00 44.12 ? 78  ALA B CB  1 
ATOM   2052 N N   . THR B 1 80  ? 7.157   -6.402  -0.908  1.00 53.95 ? 79  THR B N   1 
ATOM   2053 C CA  . THR B 1 80  ? 6.060   -7.120  -0.276  1.00 53.49 ? 79  THR B CA  1 
ATOM   2054 C C   . THR B 1 80  ? 4.702   -6.916  -0.960  1.00 55.95 ? 79  THR B C   1 
ATOM   2055 O O   . THR B 1 80  ? 3.661   -7.119  -0.335  1.00 55.38 ? 79  THR B O   1 
ATOM   2056 C CB  . THR B 1 80  ? 5.940   -6.719  1.220   1.00 55.16 ? 79  THR B CB  1 
ATOM   2057 O OG1 . THR B 1 80  ? 5.270   -5.453  1.338   1.00 60.02 ? 79  THR B OG1 1 
ATOM   2058 C CG2 . THR B 1 80  ? 7.325   -6.614  1.863   1.00 49.35 ? 79  THR B CG2 1 
ATOM   2059 N N   . ASP B 1 81  ? 4.697   -6.535  -2.235  1.00 57.18 ? 80  ASP B N   1 
ATOM   2060 C CA  . ASP B 1 81  ? 3.423   -6.224  -2.894  1.00 59.06 ? 80  ASP B CA  1 
ATOM   2061 C C   . ASP B 1 81  ? 3.118   -7.073  -4.131  1.00 60.72 ? 80  ASP B C   1 
ATOM   2062 O O   . ASP B 1 81  ? 4.030   -7.530  -4.822  1.00 62.63 ? 80  ASP B O   1 
ATOM   2063 C CB  . ASP B 1 81  ? 3.361   -4.740  -3.250  1.00 63.42 ? 80  ASP B CB  1 
ATOM   2064 C CG  . ASP B 1 81  ? 1.973   -4.145  -3.048  1.00 69.26 ? 80  ASP B CG  1 
ATOM   2065 O OD1 . ASP B 1 81  ? 0.975   -4.900  -3.140  1.00 67.24 ? 80  ASP B OD1 1 
ATOM   2066 O OD2 . ASP B 1 81  ? 1.888   -2.917  -2.800  1.00 69.27 ? 80  ASP B OD2 1 
ATOM   2067 N N   . LYS B 1 82  ? 1.825   -7.235  -4.421  1.00 62.14 ? 81  LYS B N   1 
ATOM   2068 C CA  . LYS B 1 82  ? 1.329   -8.146  -5.462  1.00 64.79 ? 81  LYS B CA  1 
ATOM   2069 C C   . LYS B 1 82  ? 1.904   -7.926  -6.861  1.00 62.46 ? 81  LYS B C   1 
ATOM   2070 O O   . LYS B 1 82  ? 1.540   -8.640  -7.797  1.00 64.56 ? 81  LYS B O   1 
ATOM   2071 C CB  . LYS B 1 82  ? -0.204  -8.092  -5.546  1.00 66.99 ? 81  LYS B CB  1 
ATOM   2072 C CG  . LYS B 1 82  ? -0.932  -8.535  -4.288  1.00 70.19 ? 81  LYS B CG  1 
ATOM   2073 C CD  . LYS B 1 82  ? -2.416  -8.236  -4.408  1.00 74.71 ? 81  LYS B CD  1 
ATOM   2074 C CE  . LYS B 1 82  ? -3.089  -8.223  -3.049  1.00 78.38 ? 81  LYS B CE  1 
ATOM   2075 N NZ  . LYS B 1 82  ? -4.457  -7.635  -3.139  1.00 80.26 ? 81  LYS B NZ  1 
ATOM   2076 N N   . ASN B 1 83  ? 2.785   -6.941  -7.009  1.00 58.03 ? 82  ASN B N   1 
ATOM   2077 C CA  . ASN B 1 83  ? 3.405   -6.666  -8.298  1.00 55.64 ? 82  ASN B CA  1 
ATOM   2078 C C   . ASN B 1 83  ? 4.897   -6.397  -8.223  1.00 52.21 ? 82  ASN B C   1 
ATOM   2079 O O   . ASN B 1 83  ? 5.460   -5.799  -9.135  1.00 53.99 ? 82  ASN B O   1 
ATOM   2080 C CB  . ASN B 1 83  ? 2.712   -5.502  -9.006  1.00 60.46 ? 82  ASN B CB  1 
ATOM   2081 C CG  . ASN B 1 83  ? 1.350   -5.878  -9.542  1.00 66.03 ? 82  ASN B CG  1 
ATOM   2082 O OD1 . ASN B 1 83  ? 1.218   -6.342  -10.680 1.00 65.69 ? 82  ASN B OD1 1 
ATOM   2083 N ND2 . ASN B 1 83  ? 0.322   -5.682  -8.721  1.00 68.28 ? 82  ASN B ND2 1 
ATOM   2084 N N   . ALA B 1 84  ? 5.539   -6.833  -7.146  1.00 49.35 ? 83  ALA B N   1 
ATOM   2085 C CA  . ALA B 1 84  ? 6.989   -6.725  -7.054  1.00 46.76 ? 83  ALA B CA  1 
ATOM   2086 C C   . ALA B 1 84  ? 7.632   -7.682  -8.047  1.00 48.75 ? 83  ALA B C   1 
ATOM   2087 O O   . ALA B 1 84  ? 7.051   -8.721  -8.387  1.00 53.59 ? 83  ALA B O   1 
ATOM   2088 C CB  . ALA B 1 84  ? 7.445   -7.037  -5.657  1.00 47.91 ? 83  ALA B CB  1 
ATOM   2089 N N   . GLU B 1 85  ? 8.823   -7.348  -8.527  1.00 46.45 ? 84  GLU B N   1 
ATOM   2090 C CA  . GLU B 1 85  ? 9.528   -8.288  -9.392  1.00 49.47 ? 84  GLU B CA  1 
ATOM   2091 C C   . GLU B 1 85  ? 9.910   -9.508  -8.560  1.00 48.81 ? 84  GLU B C   1 
ATOM   2092 O O   . GLU B 1 85  ? 10.397  -9.365  -7.432  1.00 46.43 ? 84  GLU B O   1 
ATOM   2093 C CB  . GLU B 1 85  ? 10.768  -7.649  -10.028 1.00 49.29 ? 84  GLU B CB  1 
ATOM   2094 C CG  . GLU B 1 85  ? 11.392  -8.517  -11.128 1.00 54.19 ? 84  GLU B CG  1 
ATOM   2095 C CD  . GLU B 1 85  ? 12.502  -7.817  -11.908 1.00 57.53 ? 84  GLU B CD  1 
ATOM   2096 O OE1 . GLU B 1 85  ? 12.756  -6.613  -11.653 1.00 50.56 ? 84  GLU B OE1 1 
ATOM   2097 O OE2 . GLU B 1 85  ? 13.116  -8.483  -12.781 1.00 58.86 ? 84  GLU B OE2 1 
ATOM   2098 N N   . GLN B 1 86  ? 9.671   -10.704 -9.094  1.00 50.48 ? 85  GLN B N   1 
ATOM   2099 C CA  . GLN B 1 86  ? 10.002  -11.922 -8.351  1.00 48.17 ? 85  GLN B CA  1 
ATOM   2100 C C   . GLN B 1 86  ? 10.588  -13.040 -9.195  1.00 46.95 ? 85  GLN B C   1 
ATOM   2101 O O   . GLN B 1 86  ? 9.904   -13.626 -10.031 1.00 50.58 ? 85  GLN B O   1 
ATOM   2102 C CB  . GLN B 1 86  ? 8.796   -12.437 -7.554  1.00 47.97 ? 85  GLN B CB  1 
ATOM   2103 C CG  . GLN B 1 86  ? 7.536   -12.698 -8.368  1.00 53.90 ? 85  GLN B CG  1 
ATOM   2104 C CD  . GLN B 1 86  ? 6.307   -12.897 -7.486  1.00 65.80 ? 85  GLN B CD  1 
ATOM   2105 O OE1 . GLN B 1 86  ? 6.429   -13.144 -6.281  1.00 61.59 ? 85  GLN B OE1 1 
ATOM   2106 N NE2 . GLN B 1 86  ? 5.114   -12.778 -8.080  1.00 64.55 ? 85  GLN B NE2 1 
ATOM   2107 N N   . LYS B 1 87  ? 11.860  -13.339 -8.953  1.00 46.40 ? 86  LYS B N   1 
ATOM   2108 C CA  . LYS B 1 87  ? 12.518  -14.496 -9.556  1.00 49.21 ? 86  LYS B CA  1 
ATOM   2109 C C   . LYS B 1 87  ? 12.491  -15.709 -8.608  1.00 49.55 ? 86  LYS B C   1 
ATOM   2110 O O   . LYS B 1 87  ? 12.893  -15.603 -7.443  1.00 45.91 ? 86  LYS B O   1 
ATOM   2111 C CB  . LYS B 1 87  ? 13.972  -14.158 -9.902  1.00 47.55 ? 86  LYS B CB  1 
ATOM   2112 C CG  . LYS B 1 87  ? 14.179  -12.838 -10.642 1.00 51.27 ? 86  LYS B CG  1 
ATOM   2113 C CD  . LYS B 1 87  ? 13.691  -12.909 -12.085 1.00 55.91 ? 86  LYS B CD  1 
ATOM   2114 C CE  . LYS B 1 87  ? 14.453  -11.940 -12.993 1.00 58.73 ? 86  LYS B CE  1 
ATOM   2115 N NZ  . LYS B 1 87  ? 15.830  -12.421 -13.333 1.00 51.07 ? 86  LYS B NZ  1 
ATOM   2116 N N   . THR B 1 88  ? 12.018  -16.855 -9.100  1.00 47.81 ? 87  THR B N   1 
ATOM   2117 C CA  . THR B 1 88  ? 12.078  -18.097 -8.326  1.00 46.00 ? 87  THR B CA  1 
ATOM   2118 C C   . THR B 1 88  ? 13.190  -19.007 -8.839  1.00 46.44 ? 87  THR B C   1 
ATOM   2119 O O   . THR B 1 88  ? 13.244  -19.327 -10.026 1.00 48.42 ? 87  THR B O   1 
ATOM   2120 C CB  . THR B 1 88  ? 10.749  -18.874 -8.364  1.00 45.48 ? 87  THR B CB  1 
ATOM   2121 O OG1 . THR B 1 88  ? 9.728   -18.107 -7.720  1.00 48.86 ? 87  THR B OG1 1 
ATOM   2122 C CG2 . THR B 1 88  ? 10.884  -20.208 -7.652  1.00 39.79 ? 87  THR B CG2 1 
ATOM   2123 N N   . VAL B 1 89  ? 14.077  -19.417 -7.938  1.00 46.44 ? 88  VAL B N   1 
ATOM   2124 C CA  . VAL B 1 89  ? 15.148  -20.347 -8.278  1.00 45.20 ? 88  VAL B CA  1 
ATOM   2125 C C   . VAL B 1 89  ? 15.026  -21.646 -7.484  1.00 46.13 ? 88  VAL B C   1 
ATOM   2126 O O   . VAL B 1 89  ? 14.938  -21.628 -6.256  1.00 47.11 ? 88  VAL B O   1 
ATOM   2127 C CB  . VAL B 1 89  ? 16.509  -19.734 -8.005  1.00 43.74 ? 88  VAL B CB  1 
ATOM   2128 C CG1 . VAL B 1 89  ? 17.596  -20.639 -8.536  1.00 47.67 ? 88  VAL B CG1 1 
ATOM   2129 C CG2 . VAL B 1 89  ? 16.592  -18.371 -8.641  1.00 42.80 ? 88  VAL B CG2 1 
ATOM   2130 N N   . THR B 1 90  ? 15.026  -22.772 -8.191  1.00 48.31 ? 89  THR B N   1 
ATOM   2131 C CA  . THR B 1 90  ? 14.787  -24.074 -7.571  1.00 45.36 ? 89  THR B CA  1 
ATOM   2132 C C   . THR B 1 90  ? 15.975  -25.015 -7.715  1.00 44.64 ? 89  THR B C   1 
ATOM   2133 O O   . THR B 1 90  ? 16.720  -24.942 -8.685  1.00 42.47 ? 89  THR B O   1 
ATOM   2134 C CB  . THR B 1 90  ? 13.559  -24.762 -8.198  1.00 42.75 ? 89  THR B CB  1 
ATOM   2135 O OG1 . THR B 1 90  ? 12.510  -23.804 -8.368  1.00 47.58 ? 89  THR B OG1 1 
ATOM   2136 C CG2 . THR B 1 90  ? 13.058  -25.890 -7.314  1.00 44.07 ? 89  THR B CG2 1 
ATOM   2137 N N   . GLU B 1 91  ? 16.141  -25.893 -6.729  1.00 51.68 ? 90  GLU B N   1 
ATOM   2138 C CA  . GLU B 1 91  ? 17.061  -27.029 -6.806  1.00 46.90 ? 90  GLU B CA  1 
ATOM   2139 C C   . GLU B 1 91  ? 16.280  -28.337 -6.694  1.00 46.42 ? 90  GLU B C   1 
ATOM   2140 O O   . GLU B 1 91  ? 15.524  -28.535 -5.737  1.00 48.73 ? 90  GLU B O   1 
ATOM   2141 C CB  . GLU B 1 91  ? 18.093  -26.961 -5.683  1.00 43.16 ? 90  GLU B CB  1 
ATOM   2142 C CG  . GLU B 1 91  ? 18.678  -28.304 -5.296  1.00 44.99 ? 90  GLU B CG  1 
ATOM   2143 C CD  . GLU B 1 91  ? 19.367  -28.272 -3.947  1.00 44.52 ? 90  GLU B CD  1 
ATOM   2144 O OE1 . GLU B 1 91  ? 18.697  -28.567 -2.926  1.00 44.54 ? 90  GLU B OE1 1 
ATOM   2145 O OE2 . GLU B 1 91  ? 20.574  -27.942 -3.916  1.00 41.03 ? 90  GLU B OE2 1 
ATOM   2146 N N   . THR B 1 92  ? 16.450  -29.217 -7.679  1.00 46.92 ? 91  THR B N   1 
ATOM   2147 C CA  . THR B 1 92  ? 15.882  -30.562 -7.617  1.00 48.23 ? 91  THR B CA  1 
ATOM   2148 C C   . THR B 1 92  ? 16.993  -31.595 -7.728  1.00 47.33 ? 91  THR B C   1 
ATOM   2149 O O   . THR B 1 92  ? 17.893  -31.471 -8.565  1.00 44.42 ? 91  THR B O   1 
ATOM   2150 C CB  . THR B 1 92  ? 14.839  -30.817 -8.728  1.00 46.82 ? 91  THR B CB  1 
ATOM   2151 O OG1 . THR B 1 92  ? 13.737  -29.910 -8.577  1.00 46.64 ? 91  THR B OG1 1 
ATOM   2152 C CG2 . THR B 1 92  ? 14.322  -32.254 -8.662  1.00 46.83 ? 91  THR B CG2 1 
ATOM   2153 N N   . ILE B 1 93  ? 16.930  -32.602 -6.866  1.00 47.59 ? 92  ILE B N   1 
ATOM   2154 C CA  . ILE B 1 93  ? 17.878  -33.710 -6.887  1.00 49.72 ? 92  ILE B CA  1 
ATOM   2155 C C   . ILE B 1 93  ? 17.140  -35.005 -7.204  1.00 46.56 ? 92  ILE B C   1 
ATOM   2156 O O   . ILE B 1 93  ? 16.233  -35.384 -6.466  1.00 47.56 ? 92  ILE B O   1 
ATOM   2157 C CB  . ILE B 1 93  ? 18.562  -33.870 -5.516  1.00 47.91 ? 92  ILE B CB  1 
ATOM   2158 C CG1 . ILE B 1 93  ? 19.475  -32.682 -5.224  1.00 45.60 ? 92  ILE B CG1 1 
ATOM   2159 C CG2 . ILE B 1 93  ? 19.354  -35.151 -5.468  1.00 50.02 ? 92  ILE B CG2 1 
ATOM   2160 C CD1 . ILE B 1 93  ? 20.046  -32.691 -3.822  1.00 46.74 ? 92  ILE B CD1 1 
ATOM   2161 N N   . HIS B 1 94  ? 17.511  -35.674 -8.298  1.00 48.04 ? 93  HIS B N   1 
ATOM   2162 C CA  . HIS B 1 94  ? 16.911  -36.975 -8.638  1.00 51.60 ? 93  HIS B CA  1 
ATOM   2163 C C   . HIS B 1 94  ? 17.733  -38.131 -8.071  1.00 51.07 ? 93  HIS B C   1 
ATOM   2164 O O   . HIS B 1 94  ? 18.968  -38.116 -8.109  1.00 48.26 ? 93  HIS B O   1 
ATOM   2165 C CB  . HIS B 1 94  ? 16.749  -37.150 -10.153 1.00 46.60 ? 93  HIS B CB  1 
ATOM   2166 C CG  . HIS B 1 94  ? 15.875  -36.118 -10.798 1.00 51.55 ? 93  HIS B CG  1 
ATOM   2167 N ND1 . HIS B 1 94  ? 14.533  -35.985 -10.503 1.00 49.16 ? 93  HIS B ND1 1 
ATOM   2168 C CD2 . HIS B 1 94  ? 16.150  -35.173 -11.731 1.00 49.03 ? 93  HIS B CD2 1 
ATOM   2169 C CE1 . HIS B 1 94  ? 14.020  -35.005 -11.226 1.00 46.95 ? 93  HIS B CE1 1 
ATOM   2170 N NE2 . HIS B 1 94  ? 14.980  -34.496 -11.979 1.00 48.46 ? 93  HIS B NE2 1 
ATOM   2171 N N   . TYR B 1 95  ? 17.041  -39.133 -7.540  1.00 54.68 ? 94  TYR B N   1 
ATOM   2172 C CA  . TYR B 1 95  ? 17.709  -40.326 -7.013  1.00 57.49 ? 94  TYR B CA  1 
ATOM   2173 C C   . TYR B 1 95  ? 17.354  -41.591 -7.813  1.00 57.80 ? 94  TYR B C   1 
ATOM   2174 O O   . TYR B 1 95  ? 16.216  -42.067 -7.768  1.00 57.88 ? 94  TYR B O   1 
ATOM   2175 C CB  . TYR B 1 95  ? 17.359  -40.532 -5.538  1.00 55.35 ? 94  TYR B CB  1 
ATOM   2176 C CG  . TYR B 1 95  ? 17.667  -39.352 -4.627  1.00 60.84 ? 94  TYR B CG  1 
ATOM   2177 C CD1 . TYR B 1 95  ? 18.977  -39.047 -4.271  1.00 58.82 ? 94  TYR B CD1 1 
ATOM   2178 C CD2 . TYR B 1 95  ? 16.640  -38.560 -4.095  1.00 58.04 ? 94  TYR B CD2 1 
ATOM   2179 C CE1 . TYR B 1 95  ? 19.261  -37.981 -3.422  1.00 55.77 ? 94  TYR B CE1 1 
ATOM   2180 C CE2 . TYR B 1 95  ? 16.917  -37.497 -3.241  1.00 51.41 ? 94  TYR B CE2 1 
ATOM   2181 C CZ  . TYR B 1 95  ? 18.231  -37.216 -2.913  1.00 50.63 ? 94  TYR B CZ  1 
ATOM   2182 O OH  . TYR B 1 95  ? 18.532  -36.176 -2.074  1.00 47.78 ? 94  TYR B OH  1 
ATOM   2183 N N   . VAL B 1 96  ? 18.330  -42.133 -8.542  1.00 58.02 ? 95  VAL B N   1 
ATOM   2184 C CA  . VAL B 1 96  ? 18.099  -43.318 -9.372  1.00 59.14 ? 95  VAL B CA  1 
ATOM   2185 C C   . VAL B 1 96  ? 19.099  -44.458 -9.145  1.00 62.46 ? 95  VAL B C   1 
ATOM   2186 O O   . VAL B 1 96  ? 20.038  -44.329 -8.351  1.00 60.76 ? 95  VAL B O   1 
ATOM   2187 C CB  . VAL B 1 96  ? 18.075  -42.982 -10.888 1.00 58.77 ? 95  VAL B CB  1 
ATOM   2188 C CG1 . VAL B 1 96  ? 16.907  -42.064 -11.221 1.00 58.55 ? 95  VAL B CG1 1 
ATOM   2189 C CG2 . VAL B 1 96  ? 19.414  -42.399 -11.349 1.00 54.44 ? 95  VAL B CG2 1 
ATOM   2190 N N   . ASP B 1 97  ? 18.872  -45.573 -9.849  1.00 62.93 ? 96  ASP B N   1 
ATOM   2191 C CA  . ASP B 1 97  ? 19.784  -46.721 -9.837  1.00 62.09 ? 96  ASP B CA  1 
ATOM   2192 C C   . ASP B 1 97  ? 20.578  -46.899 -11.144 1.00 62.71 ? 96  ASP B C   1 
ATOM   2193 O O   . ASP B 1 97  ? 20.608  -46.006 -12.001 1.00 60.03 ? 96  ASP B O   1 
ATOM   2194 C CB  . ASP B 1 97  ? 19.070  -48.033 -9.431  1.00 65.05 ? 96  ASP B CB  1 
ATOM   2195 C CG  . ASP B 1 97  ? 17.920  -48.424 -10.367 1.00 63.76 ? 96  ASP B CG  1 
ATOM   2196 O OD1 . ASP B 1 97  ? 17.767  -47.826 -11.453 1.00 62.58 ? 96  ASP B OD1 1 
ATOM   2197 O OD2 . ASP B 1 97  ? 17.169  -49.362 -10.006 1.00 65.38 ? 96  ASP B OD2 1 
ATOM   2198 N N   . GLU B 1 98  ? 21.222  -48.057 -11.275 1.00 60.73 ? 97  GLU B N   1 
ATOM   2199 C CA  . GLU B 1 98  ? 22.087  -48.351 -12.412 1.00 59.24 ? 97  GLU B CA  1 
ATOM   2200 C C   . GLU B 1 98  ? 21.322  -48.333 -13.734 1.00 60.93 ? 97  GLU B C   1 
ATOM   2201 O O   . GLU B 1 98  ? 21.912  -48.100 -14.787 1.00 63.47 ? 97  GLU B O   1 
ATOM   2202 C CB  . GLU B 1 98  ? 22.772  -49.706 -12.216 1.00 65.78 ? 97  GLU B CB  1 
ATOM   2203 C CG  . GLU B 1 98  ? 23.042  -50.057 -10.748 1.00 68.24 ? 97  GLU B CG  1 
ATOM   2204 C CD  . GLU B 1 98  ? 23.421  -51.521 -10.538 1.00 70.12 ? 97  GLU B CD  1 
ATOM   2205 O OE1 . GLU B 1 98  ? 23.641  -52.242 -11.538 1.00 68.29 ? 97  GLU B OE1 1 
ATOM   2206 O OE2 . GLU B 1 98  ? 23.494  -51.952 -9.364  1.00 73.65 ? 97  GLU B OE2 1 
ATOM   2207 N N   . ASN B 1 99  ? 20.014  -48.578 -13.677 1.00 61.83 ? 98  ASN B N   1 
ATOM   2208 C CA  . ASN B 1 99  ? 19.171  -48.549 -14.878 1.00 66.58 ? 98  ASN B CA  1 
ATOM   2209 C C   . ASN B 1 99  ? 18.133  -47.406 -14.921 1.00 67.95 ? 98  ASN B C   1 
ATOM   2210 O O   . ASN B 1 99  ? 17.064  -47.534 -15.533 1.00 66.81 ? 98  ASN B O   1 
ATOM   2211 C CB  . ASN B 1 99  ? 18.535  -49.923 -15.144 1.00 67.62 ? 98  ASN B CB  1 
ATOM   2212 C CG  . ASN B 1 99  ? 19.370  -50.778 -16.107 1.00 72.66 ? 98  ASN B CG  1 
ATOM   2213 O OD1 . ASN B 1 99  ? 19.014  -50.943 -17.280 1.00 71.67 ? 98  ASN B OD1 1 
ATOM   2214 N ND2 . ASN B 1 99  ? 20.493  -51.306 -15.617 1.00 68.13 ? 98  ASN B ND2 1 
ATOM   2215 N N   . ASN B 1 100 ? 18.478  -46.298 -14.259 1.00 66.12 ? 99  ASN B N   1 
ATOM   2216 C CA  . ASN B 1 100 ? 17.765  -45.020 -14.362 1.00 61.89 ? 99  ASN B CA  1 
ATOM   2217 C C   . ASN B 1 100 ? 16.340  -45.003 -13.825 1.00 63.70 ? 99  ASN B C   1 
ATOM   2218 O O   . ASN B 1 100 ? 15.515  -44.205 -14.270 1.00 67.40 ? 99  ASN B O   1 
ATOM   2219 C CB  . ASN B 1 100 ? 17.791  -44.513 -15.803 1.00 65.21 ? 99  ASN B CB  1 
ATOM   2220 C CG  . ASN B 1 100 ? 19.202  -44.413 -16.358 1.00 70.09 ? 99  ASN B CG  1 
ATOM   2221 O OD1 . ASN B 1 100 ? 20.158  -44.130 -15.624 1.00 69.94 ? 99  ASN B OD1 1 
ATOM   2222 N ND2 . ASN B 1 100 ? 19.343  -44.652 -17.662 1.00 66.93 ? 99  ASN B ND2 1 
ATOM   2223 N N   . GLN B 1 101 ? 16.068  -45.871 -12.856 1.00 63.18 ? 100 GLN B N   1 
ATOM   2224 C CA  . GLN B 1 101 ? 14.744  -45.995 -12.246 1.00 63.82 ? 100 GLN B CA  1 
ATOM   2225 C C   . GLN B 1 101 ? 14.642  -45.189 -10.949 1.00 62.93 ? 100 GLN B C   1 
ATOM   2226 O O   . GLN B 1 101 ? 15.617  -45.076 -10.214 1.00 64.06 ? 100 GLN B O   1 
ATOM   2227 C CB  . GLN B 1 101 ? 14.454  -47.470 -11.954 1.00 65.20 ? 100 GLN B CB  1 
ATOM   2228 C CG  . GLN B 1 101 ? 14.445  -48.339 -13.187 1.00 63.48 ? 100 GLN B CG  1 
ATOM   2229 C CD  . GLN B 1 101 ? 13.230  -48.080 -14.041 1.00 61.17 ? 100 GLN B CD  1 
ATOM   2230 O OE1 . GLN B 1 101 ? 12.126  -48.507 -13.697 1.00 61.40 ? 100 GLN B OE1 1 
ATOM   2231 N NE2 . GLN B 1 101 ? 13.416  -47.364 -15.154 1.00 54.59 ? 100 GLN B NE2 1 
ATOM   2232 N N   . THR B 1 102 ? 13.463  -44.643 -10.659 1.00 65.25 ? 101 THR B N   1 
ATOM   2233 C CA  . THR B 1 102 ? 13.265  -43.844 -9.441  1.00 64.35 ? 101 THR B CA  1 
ATOM   2234 C C   . THR B 1 102 ? 13.326  -44.715 -8.182  1.00 61.61 ? 101 THR B C   1 
ATOM   2235 O O   . THR B 1 102 ? 12.452  -45.554 -7.955  1.00 60.82 ? 101 THR B O   1 
ATOM   2236 C CB  . THR B 1 102 ? 11.931  -43.046 -9.485  1.00 60.53 ? 101 THR B CB  1 
ATOM   2237 O OG1 . THR B 1 102 ? 12.074  -41.914 -10.356 1.00 57.77 ? 101 THR B OG1 1 
ATOM   2238 C CG2 . THR B 1 102 ? 11.539  -42.564 -8.095  1.00 55.71 ? 101 THR B CG2 1 
ATOM   2239 N N   . VAL B 1 103 ? 14.365  -44.522 -7.373  1.00 58.35 ? 102 VAL B N   1 
ATOM   2240 C CA  . VAL B 1 103 ? 14.555  -45.345 -6.181  1.00 57.32 ? 102 VAL B CA  1 
ATOM   2241 C C   . VAL B 1 103 ? 14.156  -44.596 -4.920  1.00 57.26 ? 102 VAL B C   1 
ATOM   2242 O O   . VAL B 1 103 ? 13.849  -45.205 -3.896  1.00 61.04 ? 102 VAL B O   1 
ATOM   2243 C CB  . VAL B 1 103 ? 16.011  -45.862 -6.049  1.00 58.26 ? 102 VAL B CB  1 
ATOM   2244 C CG1 . VAL B 1 103 ? 16.468  -46.485 -7.355  1.00 57.83 ? 102 VAL B CG1 1 
ATOM   2245 C CG2 . VAL B 1 103 ? 16.960  -44.743 -5.633  1.00 62.20 ? 102 VAL B CG2 1 
ATOM   2246 N N   . GLN B 1 104 ? 14.162  -43.272 -5.006  1.00 58.89 ? 103 GLN B N   1 
ATOM   2247 C CA  . GLN B 1 104 ? 13.738  -42.420 -3.902  1.00 59.04 ? 103 GLN B CA  1 
ATOM   2248 C C   . GLN B 1 104 ? 13.253  -41.068 -4.425  1.00 60.11 ? 103 GLN B C   1 
ATOM   2249 O O   . GLN B 1 104 ? 13.745  -40.582 -5.453  1.00 58.61 ? 103 GLN B O   1 
ATOM   2250 C CB  . GLN B 1 104 ? 14.872  -42.237 -2.895  1.00 56.13 ? 103 GLN B CB  1 
ATOM   2251 C CG  . GLN B 1 104 ? 14.491  -42.650 -1.489  1.00 56.99 ? 103 GLN B CG  1 
ATOM   2252 C CD  . GLN B 1 104 ? 15.695  -42.838 -0.604  1.00 60.96 ? 103 GLN B CD  1 
ATOM   2253 O OE1 . GLN B 1 104 ? 16.820  -42.931 -1.091  1.00 62.30 ? 103 GLN B OE1 1 
ATOM   2254 N NE2 . GLN B 1 104 ? 15.471  -42.895 0.704   1.00 61.50 ? 103 GLN B NE2 1 
ATOM   2255 N N   . PRO B 1 105 ? 12.271  -40.469 -3.727  1.00 59.29 ? 104 PRO B N   1 
ATOM   2256 C CA  . PRO B 1 105 ? 11.684  -39.158 -4.036  1.00 57.56 ? 104 PRO B CA  1 
ATOM   2257 C C   . PRO B 1 105 ? 12.699  -38.037 -4.255  1.00 55.78 ? 104 PRO B C   1 
ATOM   2258 O O   . PRO B 1 105 ? 13.716  -37.952 -3.560  1.00 54.48 ? 104 PRO B O   1 
ATOM   2259 C CB  . PRO B 1 105 ? 10.842  -38.853 -2.789  1.00 56.58 ? 104 PRO B CB  1 
ATOM   2260 C CG  . PRO B 1 105 ? 11.250  -39.879 -1.756  1.00 55.81 ? 104 PRO B CG  1 
ATOM   2261 C CD  . PRO B 1 105 ? 11.619  -41.074 -2.555  1.00 58.28 ? 104 PRO B CD  1 
ATOM   2262 N N   . ASP B 1 106 ? 12.406  -37.175 -5.221  1.00 55.36 ? 105 ASP B N   1 
ATOM   2263 C CA  . ASP B 1 106 ? 13.244  -36.010 -5.484  1.00 57.85 ? 105 ASP B CA  1 
ATOM   2264 C C   . ASP B 1 106 ? 13.405  -35.125 -4.242  1.00 53.06 ? 105 ASP B C   1 
ATOM   2265 O O   . ASP B 1 106 ? 12.513  -35.052 -3.396  1.00 50.53 ? 105 ASP B O   1 
ATOM   2266 C CB  . ASP B 1 106 ? 12.669  -35.173 -6.638  1.00 56.23 ? 105 ASP B CB  1 
ATOM   2267 C CG  . ASP B 1 106 ? 12.386  -36.001 -7.886  1.00 63.00 ? 105 ASP B CG  1 
ATOM   2268 O OD1 . ASP B 1 106 ? 12.664  -37.228 -7.872  1.00 65.92 ? 105 ASP B OD1 1 
ATOM   2269 O OD2 . ASP B 1 106 ? 11.893  -35.418 -8.882  1.00 58.84 ? 105 ASP B OD2 1 
ATOM   2270 N N   . SER B 1 107 ? 14.558  -34.474 -4.132  1.00 48.86 ? 106 SER B N   1 
ATOM   2271 C CA  . SER B 1 107 ? 14.762  -33.450 -3.117  1.00 49.88 ? 106 SER B CA  1 
ATOM   2272 C C   . SER B 1 107 ? 14.577  -32.069 -3.760  1.00 51.67 ? 106 SER B C   1 
ATOM   2273 O O   . SER B 1 107 ? 15.432  -31.596 -4.517  1.00 47.41 ? 106 SER B O   1 
ATOM   2274 C CB  . SER B 1 107 ? 16.152  -33.576 -2.481  1.00 47.49 ? 106 SER B CB  1 
ATOM   2275 O OG  . SER B 1 107 ? 16.348  -32.598 -1.468  1.00 53.64 ? 106 SER B OG  1 
ATOM   2276 N N   . THR B 1 108 ? 13.444  -31.435 -3.478  1.00 50.18 ? 107 THR B N   1 
ATOM   2277 C CA  . THR B 1 108 ? 13.177  -30.112 -4.016  1.00 49.06 ? 107 THR B CA  1 
ATOM   2278 C C   . THR B 1 108 ? 13.179  -29.073 -2.912  1.00 49.83 ? 107 THR B C   1 
ATOM   2279 O O   . THR B 1 108 ? 12.476  -29.208 -1.911  1.00 52.80 ? 107 THR B O   1 
ATOM   2280 C CB  . THR B 1 108 ? 11.834  -30.046 -4.756  1.00 47.86 ? 107 THR B CB  1 
ATOM   2281 O OG1 . THR B 1 108 ? 11.799  -31.047 -5.779  1.00 51.96 ? 107 THR B OG1 1 
ATOM   2282 C CG2 . THR B 1 108 ? 11.657  -28.680 -5.393  1.00 50.08 ? 107 THR B CG2 1 
ATOM   2283 N N   . THR B 1 109 ? 13.994  -28.047 -3.092  1.00 46.23 ? 108 THR B N   1 
ATOM   2284 C CA  . THR B 1 109 ? 14.010  -26.913 -2.184  1.00 52.40 ? 108 THR B CA  1 
ATOM   2285 C C   . THR B 1 109 ? 14.085  -25.653 -3.046  1.00 52.39 ? 108 THR B C   1 
ATOM   2286 O O   . THR B 1 109 ? 14.743  -25.650 -4.086  1.00 51.10 ? 108 THR B O   1 
ATOM   2287 C CB  . THR B 1 109 ? 15.198  -26.983 -1.176  1.00 58.92 ? 108 THR B CB  1 
ATOM   2288 O OG1 . THR B 1 109 ? 16.446  -26.811 -1.865  1.00 58.35 ? 108 THR B OG1 1 
ATOM   2289 C CG2 . THR B 1 109 ? 15.210  -28.330 -0.407  1.00 58.51 ? 108 THR B CG2 1 
ATOM   2290 N N   . ALA B 1 110 ? 13.406  -24.586 -2.632  1.00 52.98 ? 109 ALA B N   1 
ATOM   2291 C CA  . ALA B 1 110 ? 13.282  -23.406 -3.490  1.00 49.38 ? 109 ALA B CA  1 
ATOM   2292 C C   . ALA B 1 110 ? 13.557  -22.096 -2.771  1.00 47.98 ? 109 ALA B C   1 
ATOM   2293 O O   . ALA B 1 110 ? 13.310  -21.970 -1.571  1.00 49.60 ? 109 ALA B O   1 
ATOM   2294 C CB  . ALA B 1 110 ? 11.891  -23.364 -4.137  1.00 46.80 ? 109 ALA B CB  1 
ATOM   2295 N N   . VAL B 1 111 ? 14.060  -21.117 -3.517  1.00 46.94 ? 110 VAL B N   1 
ATOM   2296 C CA  . VAL B 1 111 ? 14.166  -19.756 -3.003  1.00 48.78 ? 110 VAL B CA  1 
ATOM   2297 C C   . VAL B 1 111 ? 13.533  -18.749 -3.967  1.00 47.40 ? 110 VAL B C   1 
ATOM   2298 O O   . VAL B 1 111 ? 13.604  -18.906 -5.185  1.00 48.54 ? 110 VAL B O   1 
ATOM   2299 C CB  . VAL B 1 111 ? 15.626  -19.365 -2.687  1.00 49.01 ? 110 VAL B CB  1 
ATOM   2300 C CG1 . VAL B 1 111 ? 16.427  -19.198 -3.958  1.00 48.48 ? 110 VAL B CG1 1 
ATOM   2301 C CG2 . VAL B 1 111 ? 15.662  -18.084 -1.877  1.00 45.90 ? 110 VAL B CG2 1 
ATOM   2302 N N   . THR B 1 112 ? 12.892  -17.724 -3.419  1.00 46.58 ? 111 THR B N   1 
ATOM   2303 C CA  . THR B 1 112 ? 12.269  -16.698 -4.252  1.00 48.63 ? 111 THR B CA  1 
ATOM   2304 C C   . THR B 1 112 ? 12.706  -15.268 -3.899  1.00 48.45 ? 111 THR B C   1 
ATOM   2305 O O   . THR B 1 112 ? 12.465  -14.777 -2.790  1.00 46.18 ? 111 THR B O   1 
ATOM   2306 C CB  . THR B 1 112 ? 10.736  -16.803 -4.223  1.00 42.86 ? 111 THR B CB  1 
ATOM   2307 O OG1 . THR B 1 112 ? 10.340  -18.005 -4.885  1.00 44.66 ? 111 THR B OG1 1 
ATOM   2308 C CG2 . THR B 1 112 ? 10.112  -15.624 -4.937  1.00 44.50 ? 111 THR B CG2 1 
ATOM   2309 N N   . PHE B 1 113 ? 13.353  -14.607 -4.854  1.00 45.51 ? 112 PHE B N   1 
ATOM   2310 C CA  . PHE B 1 113 ? 13.777  -13.231 -4.664  1.00 42.56 ? 112 PHE B CA  1 
ATOM   2311 C C   . PHE B 1 113 ? 12.646  -12.272 -4.972  1.00 43.79 ? 112 PHE B C   1 
ATOM   2312 O O   . PHE B 1 113 ? 11.900  -12.451 -5.935  1.00 42.93 ? 112 PHE B O   1 
ATOM   2313 C CB  . PHE B 1 113 ? 14.975  -12.927 -5.539  1.00 40.54 ? 112 PHE B CB  1 
ATOM   2314 C CG  . PHE B 1 113 ? 16.148  -13.782 -5.238  1.00 46.10 ? 112 PHE B CG  1 
ATOM   2315 C CD1 . PHE B 1 113 ? 17.045  -13.420 -4.250  1.00 48.31 ? 112 PHE B CD1 1 
ATOM   2316 C CD2 . PHE B 1 113 ? 16.348  -14.970 -5.924  1.00 48.93 ? 112 PHE B CD2 1 
ATOM   2317 C CE1 . PHE B 1 113 ? 18.135  -14.222 -3.961  1.00 50.42 ? 112 PHE B CE1 1 
ATOM   2318 C CE2 . PHE B 1 113 ? 17.436  -15.781 -5.642  1.00 45.25 ? 112 PHE B CE2 1 
ATOM   2319 C CZ  . PHE B 1 113 ? 18.327  -15.409 -4.661  1.00 48.59 ? 112 PHE B CZ  1 
ATOM   2320 N N   . LYS B 1 114 ? 12.513  -11.262 -4.125  1.00 43.79 ? 113 LYS B N   1 
ATOM   2321 C CA  . LYS B 1 114 ? 11.526  -10.223 -4.328  1.00 43.17 ? 113 LYS B CA  1 
ATOM   2322 C C   . LYS B 1 114 ? 12.200  -8.861  -4.246  1.00 45.27 ? 113 LYS B C   1 
ATOM   2323 O O   . LYS B 1 114 ? 12.957  -8.583  -3.311  1.00 46.31 ? 113 LYS B O   1 
ATOM   2324 C CB  . LYS B 1 114 ? 10.424  -10.341 -3.281  1.00 43.12 ? 113 LYS B CB  1 
ATOM   2325 C CG  . LYS B 1 114 ? 9.432   -11.452 -3.557  1.00 41.56 ? 113 LYS B CG  1 
ATOM   2326 C CD  . LYS B 1 114 ? 8.420   -11.581 -2.432  1.00 41.58 ? 113 LYS B CD  1 
ATOM   2327 C CE  . LYS B 1 114 ? 7.496   -12.778 -2.660  1.00 55.90 ? 113 LYS B CE  1 
ATOM   2328 N NZ  . LYS B 1 114 ? 6.728   -13.190 -1.438  1.00 59.44 ? 113 LYS B NZ  1 
ATOM   2329 N N   . ARG B 1 115 ? 11.953  -8.018  -5.240  1.00 44.53 ? 114 ARG B N   1 
ATOM   2330 C CA  . ARG B 1 115 ? 12.418  -6.643  -5.166  1.00 41.74 ? 114 ARG B CA  1 
ATOM   2331 C C   . ARG B 1 115 ? 11.317  -5.740  -5.657  1.00 45.52 ? 114 ARG B C   1 
ATOM   2332 O O   . ARG B 1 115 ? 10.425  -6.161  -6.398  1.00 44.50 ? 114 ARG B O   1 
ATOM   2333 C CB  . ARG B 1 115 ? 13.706  -6.408  -5.966  1.00 40.12 ? 114 ARG B CB  1 
ATOM   2334 C CG  . ARG B 1 115 ? 13.518  -6.333  -7.471  1.00 41.23 ? 114 ARG B CG  1 
ATOM   2335 C CD  . ARG B 1 115 ? 14.769  -5.791  -8.165  1.00 43.06 ? 114 ARG B CD  1 
ATOM   2336 N NE  . ARG B 1 115 ? 14.754  -6.030  -9.613  1.00 44.40 ? 114 ARG B NE  1 
ATOM   2337 C CZ  . ARG B 1 115 ? 15.778  -5.779  -10.430 1.00 44.70 ? 114 ARG B CZ  1 
ATOM   2338 N NH1 . ARG B 1 115 ? 16.907  -5.271  -9.947  1.00 42.11 ? 114 ARG B NH1 1 
ATOM   2339 N NH2 . ARG B 1 115 ? 15.679  -6.039  -11.730 1.00 45.21 ? 114 ARG B NH2 1 
ATOM   2340 N N   . GLY B 1 116 ? 11.378  -4.493  -5.218  1.00 50.47 ? 115 GLY B N   1 
ATOM   2341 C CA  . GLY B 1 116 ? 10.399  -3.508  -5.607  1.00 46.99 ? 115 GLY B CA  1 
ATOM   2342 C C   . GLY B 1 116 ? 11.063  -2.395  -6.376  1.00 49.17 ? 115 GLY B C   1 
ATOM   2343 O O   . GLY B 1 116 ? 12.293  -2.369  -6.497  1.00 45.64 ? 115 GLY B O   1 
ATOM   2344 N N   . TYR B 1 117 ? 10.251  -1.459  -6.863  1.00 50.49 ? 116 TYR B N   1 
ATOM   2345 C CA  . TYR B 1 117 ? 10.712  -0.460  -7.819  1.00 49.89 ? 116 TYR B CA  1 
ATOM   2346 C C   . TYR B 1 117 ? 9.843   0.801   -7.833  1.00 54.73 ? 116 TYR B C   1 
ATOM   2347 O O   . TYR B 1 117 ? 8.631   0.736   -7.589  1.00 52.29 ? 116 TYR B O   1 
ATOM   2348 C CB  . TYR B 1 117 ? 10.708  -1.086  -9.207  1.00 46.42 ? 116 TYR B CB  1 
ATOM   2349 C CG  . TYR B 1 117 ? 9.434   -1.839  -9.502  1.00 43.22 ? 116 TYR B CG  1 
ATOM   2350 C CD1 . TYR B 1 117 ? 8.375   -1.212  -10.125 1.00 41.83 ? 116 TYR B CD1 1 
ATOM   2351 C CD2 . TYR B 1 117 ? 9.292   -3.178  -9.153  1.00 45.38 ? 116 TYR B CD2 1 
ATOM   2352 C CE1 . TYR B 1 117 ? 7.214   -1.884  -10.399 1.00 41.56 ? 116 TYR B CE1 1 
ATOM   2353 C CE2 . TYR B 1 117 ? 8.130   -3.861  -9.423  1.00 43.65 ? 116 TYR B CE2 1 
ATOM   2354 C CZ  . TYR B 1 117 ? 7.092   -3.203  -10.047 1.00 45.81 ? 116 TYR B CZ  1 
ATOM   2355 O OH  . TYR B 1 117 ? 5.915   -3.856  -10.327 1.00 53.29 ? 116 TYR B OH  1 
ATOM   2356 N N   . THR B 1 118 ? 10.464  1.940   -8.145  1.00 53.63 ? 117 THR B N   1 
ATOM   2357 C CA  . THR B 1 118 ? 9.757   3.220   -8.228  1.00 52.41 ? 117 THR B CA  1 
ATOM   2358 C C   . THR B 1 118 ? 9.433   3.610   -9.672  1.00 49.74 ? 117 THR B C   1 
ATOM   2359 O O   . THR B 1 118 ? 10.324  3.665   -10.512 1.00 50.63 ? 117 THR B O   1 
ATOM   2360 C CB  . THR B 1 118 ? 10.600  4.343   -7.621  1.00 48.86 ? 117 THR B CB  1 
ATOM   2361 O OG1 . THR B 1 118 ? 11.314  3.845   -6.486  1.00 51.36 ? 117 THR B OG1 1 
ATOM   2362 C CG2 . THR B 1 118 ? 9.712   5.490   -7.193  1.00 53.01 ? 117 THR B CG2 1 
ATOM   2363 N N   . THR B 1 119 ? 8.165   3.895   -9.953  1.00 47.12 ? 118 THR B N   1 
ATOM   2364 C CA  . THR B 1 119 ? 7.744   4.300   -11.297 1.00 47.54 ? 118 THR B CA  1 
ATOM   2365 C C   . THR B 1 119 ? 7.395   5.795   -11.382 1.00 53.52 ? 118 THR B C   1 
ATOM   2366 O O   . THR B 1 119 ? 6.667   6.324   -10.541 1.00 54.30 ? 118 THR B O   1 
ATOM   2367 C CB  . THR B 1 119 ? 6.513   3.504   -11.756 1.00 51.58 ? 118 THR B CB  1 
ATOM   2368 O OG1 . THR B 1 119 ? 6.676   2.130   -11.401 1.00 56.51 ? 118 THR B OG1 1 
ATOM   2369 C CG2 . THR B 1 119 ? 6.317   3.613   -13.261 1.00 52.16 ? 118 THR B CG2 1 
ATOM   2370 N N   . ASP B 1 120 ? 7.914   6.463   -12.410 1.00 52.74 ? 119 ASP B N   1 
ATOM   2371 C CA  . ASP B 1 120 ? 7.633   7.875   -12.690 1.00 47.47 ? 119 ASP B CA  1 
ATOM   2372 C C   . ASP B 1 120 ? 6.205   8.011   -13.232 1.00 48.55 ? 119 ASP B C   1 
ATOM   2373 O O   . ASP B 1 120 ? 5.868   7.381   -14.232 1.00 50.59 ? 119 ASP B O   1 
ATOM   2374 C CB  . ASP B 1 120 ? 8.635   8.346   -13.741 1.00 47.71 ? 119 ASP B CB  1 
ATOM   2375 C CG  . ASP B 1 120 ? 8.686   9.845   -13.894 1.00 50.45 ? 119 ASP B CG  1 
ATOM   2376 O OD1 . ASP B 1 120 ? 7.620   10.463  -14.120 1.00 47.73 ? 119 ASP B OD1 1 
ATOM   2377 O OD2 . ASP B 1 120 ? 9.812   10.396  -13.813 1.00 46.60 ? 119 ASP B OD2 1 
ATOM   2378 N N   . ASN B 1 121 ? 5.358   8.811   -12.586 1.00 45.08 ? 120 ASN B N   1 
ATOM   2379 C CA  . ASN B 1 121 ? 3.957   8.901   -13.015 1.00 46.59 ? 120 ASN B CA  1 
ATOM   2380 C C   . ASN B 1 121 ? 3.774   9.756   -14.254 1.00 46.57 ? 120 ASN B C   1 
ATOM   2381 O O   . ASN B 1 121 ? 2.684   9.784   -14.840 1.00 45.48 ? 120 ASN B O   1 
ATOM   2382 C CB  . ASN B 1 121 ? 3.060   9.448   -11.907 1.00 47.15 ? 120 ASN B CB  1 
ATOM   2383 C CG  . ASN B 1 121 ? 2.828   8.458   -10.815 1.00 46.83 ? 120 ASN B CG  1 
ATOM   2384 O OD1 . ASN B 1 121 ? 2.765   7.259   -11.063 1.00 49.72 ? 120 ASN B OD1 1 
ATOM   2385 N ND2 . ASN B 1 121 ? 2.702   8.946   -9.590  1.00 48.39 ? 120 ASN B ND2 1 
ATOM   2386 N N   . VAL B 1 122 ? 4.836   10.468  -14.629 1.00 43.69 ? 121 VAL B N   1 
ATOM   2387 C CA  . VAL B 1 122 ? 4.826   11.313  -15.820 1.00 44.81 ? 121 VAL B CA  1 
ATOM   2388 C C   . VAL B 1 122 ? 5.344   10.529  -17.031 1.00 47.33 ? 121 VAL B C   1 
ATOM   2389 O O   . VAL B 1 122 ? 4.624   10.359  -18.020 1.00 44.57 ? 121 VAL B O   1 
ATOM   2390 C CB  . VAL B 1 122 ? 5.669   12.610  -15.619 1.00 45.97 ? 121 VAL B CB  1 
ATOM   2391 C CG1 . VAL B 1 122 ? 5.669   13.458  -16.870 1.00 42.50 ? 121 VAL B CG1 1 
ATOM   2392 C CG2 . VAL B 1 122 ? 5.159   13.430  -14.439 1.00 42.73 ? 121 VAL B CG2 1 
ATOM   2393 N N   . THR B 1 123 ? 6.584   10.037  -16.941 1.00 46.83 ? 122 THR B N   1 
ATOM   2394 C CA  . THR B 1 123 ? 7.223   9.334   -18.053 1.00 43.57 ? 122 THR B CA  1 
ATOM   2395 C C   . THR B 1 123 ? 6.656   7.936   -18.241 1.00 44.28 ? 122 THR B C   1 
ATOM   2396 O O   . THR B 1 123 ? 6.740   7.364   -19.325 1.00 46.34 ? 122 THR B O   1 
ATOM   2397 C CB  . THR B 1 123 ? 8.736   9.201   -17.851 1.00 44.63 ? 122 THR B CB  1 
ATOM   2398 O OG1 . THR B 1 123 ? 9.003   8.092   -16.986 1.00 47.07 ? 122 THR B OG1 1 
ATOM   2399 C CG2 . THR B 1 123 ? 9.314   10.468  -17.248 1.00 44.76 ? 122 THR B CG2 1 
ATOM   2400 N N   . GLY B 1 124 ? 6.091   7.389   -17.172 1.00 46.09 ? 123 GLY B N   1 
ATOM   2401 C CA  . GLY B 1 124 ? 5.530   6.049   -17.190 1.00 47.71 ? 123 GLY B CA  1 
ATOM   2402 C C   . GLY B 1 124 ? 6.552   4.957   -16.921 1.00 48.03 ? 123 GLY B C   1 
ATOM   2403 O O   . GLY B 1 124 ? 6.189   3.820   -16.611 1.00 49.83 ? 123 GLY B O   1 
ATOM   2404 N N   . LYS B 1 125 ? 7.829   5.315   -17.025 1.00 48.32 ? 124 LYS B N   1 
ATOM   2405 C CA  . LYS B 1 125 ? 8.925   4.353   -17.010 1.00 48.03 ? 124 LYS B CA  1 
ATOM   2406 C C   . LYS B 1 125 ? 9.455   4.159   -15.595 1.00 49.02 ? 124 LYS B C   1 
ATOM   2407 O O   . LYS B 1 125 ? 9.418   5.084   -14.787 1.00 48.41 ? 124 LYS B O   1 
ATOM   2408 C CB  . LYS B 1 125 ? 10.070  4.839   -17.921 1.00 50.83 ? 124 LYS B CB  1 
ATOM   2409 C CG  . LYS B 1 125 ? 9.666   5.263   -19.357 1.00 53.12 ? 124 LYS B CG  1 
ATOM   2410 C CD  . LYS B 1 125 ? 9.109   4.092   -20.187 1.00 54.82 ? 124 LYS B CD  1 
ATOM   2411 C CE  . LYS B 1 125 ? 9.022   4.423   -21.691 1.00 63.00 ? 124 LYS B CE  1 
ATOM   2412 N NZ  . LYS B 1 125 ? 7.807   5.203   -22.094 1.00 64.15 ? 124 LYS B NZ  1 
ATOM   2413 N N   . VAL B 1 126 ? 9.956   2.959   -15.310 1.00 45.42 ? 125 VAL B N   1 
ATOM   2414 C CA  . VAL B 1 126 ? 10.625  2.652   -14.044 1.00 45.90 ? 125 VAL B CA  1 
ATOM   2415 C C   . VAL B 1 126 ? 11.934  3.430   -13.864 1.00 43.11 ? 125 VAL B C   1 
ATOM   2416 O O   . VAL B 1 126 ? 12.769  3.419   -14.754 1.00 48.96 ? 125 VAL B O   1 
ATOM   2417 C CB  . VAL B 1 126 ? 10.979  1.165   -13.998 1.00 47.05 ? 125 VAL B CB  1 
ATOM   2418 C CG1 . VAL B 1 126 ? 11.948  0.886   -12.868 1.00 45.57 ? 125 VAL B CG1 1 
ATOM   2419 C CG2 . VAL B 1 126 ? 9.719   0.318   -13.882 1.00 44.25 ? 125 VAL B CG2 1 
ATOM   2420 N N   . VAL B 1 127 ? 12.137  4.082   -12.720 1.00 41.52 ? 126 VAL B N   1 
ATOM   2421 C CA  . VAL B 1 127 ? 13.343  4.907   -12.548 1.00 45.57 ? 126 VAL B CA  1 
ATOM   2422 C C   . VAL B 1 127 ? 14.370  4.390   -11.543 1.00 44.03 ? 126 VAL B C   1 
ATOM   2423 O O   . VAL B 1 127 ? 15.521  4.815   -11.575 1.00 47.85 ? 126 VAL B O   1 
ATOM   2424 C CB  . VAL B 1 127 ? 13.039  6.410   -12.225 1.00 47.18 ? 126 VAL B CB  1 
ATOM   2425 C CG1 . VAL B 1 127 ? 11.856  6.915   -13.032 1.00 47.47 ? 126 VAL B CG1 1 
ATOM   2426 C CG2 . VAL B 1 127 ? 12.809  6.619   -10.743 1.00 44.88 ? 126 VAL B CG2 1 
ATOM   2427 N N   . SER B 1 128 ? 13.958  3.508   -10.638 1.00 45.47 ? 127 SER B N   1 
ATOM   2428 C CA  . SER B 1 128 ? 14.918  2.795   -9.793  1.00 46.59 ? 127 SER B CA  1 
ATOM   2429 C C   . SER B 1 128 ? 14.306  1.564   -9.129  1.00 49.67 ? 127 SER B C   1 
ATOM   2430 O O   . SER B 1 128 ? 13.095  1.494   -8.882  1.00 49.60 ? 127 SER B O   1 
ATOM   2431 C CB  . SER B 1 128 ? 15.547  3.699   -8.732  1.00 43.67 ? 127 SER B CB  1 
ATOM   2432 O OG  . SER B 1 128 ? 14.743  3.723   -7.569  1.00 51.69 ? 127 SER B OG  1 
ATOM   2433 N N   . TYR B 1 129 ? 15.166  0.595   -8.842  1.00 49.16 ? 128 TYR B N   1 
ATOM   2434 C CA  . TYR B 1 129 ? 14.757  -0.635  -8.191  1.00 47.17 ? 128 TYR B CA  1 
ATOM   2435 C C   . TYR B 1 129 ? 15.255  -0.632  -6.745  1.00 46.33 ? 128 TYR B C   1 
ATOM   2436 O O   . TYR B 1 129 ? 16.262  0.007   -6.421  1.00 43.14 ? 128 TYR B O   1 
ATOM   2437 C CB  . TYR B 1 129 ? 15.335  -1.845  -8.939  1.00 47.46 ? 128 TYR B CB  1 
ATOM   2438 C CG  . TYR B 1 129 ? 14.775  -2.100  -10.333 1.00 46.25 ? 128 TYR B CG  1 
ATOM   2439 C CD1 . TYR B 1 129 ? 13.559  -2.758  -10.502 1.00 45.28 ? 128 TYR B CD1 1 
ATOM   2440 C CD2 . TYR B 1 129 ? 15.478  -1.717  -11.478 1.00 44.84 ? 128 TYR B CD2 1 
ATOM   2441 C CE1 . TYR B 1 129 ? 13.041  -3.014  -11.762 1.00 44.74 ? 128 TYR B CE1 1 
ATOM   2442 C CE2 . TYR B 1 129 ? 14.967  -1.970  -12.751 1.00 48.02 ? 128 TYR B CE2 1 
ATOM   2443 C CZ  . TYR B 1 129 ? 13.744  -2.625  -12.882 1.00 48.89 ? 128 TYR B CZ  1 
ATOM   2444 O OH  . TYR B 1 129 ? 13.210  -2.893  -14.126 1.00 50.56 ? 128 TYR B OH  1 
ATOM   2445 N N   . ASP B 1 130 ? 14.540  -1.340  -5.878  1.00 49.44 ? 129 ASP B N   1 
ATOM   2446 C CA  . ASP B 1 130 ? 14.985  -1.551  -4.504  1.00 49.25 ? 129 ASP B CA  1 
ATOM   2447 C C   . ASP B 1 130 ? 15.797  -2.843  -4.488  1.00 48.63 ? 129 ASP B C   1 
ATOM   2448 O O   . ASP B 1 130 ? 15.593  -3.701  -5.349  1.00 49.60 ? 129 ASP B O   1 
ATOM   2449 C CB  . ASP B 1 130 ? 13.779  -1.662  -3.567  1.00 53.84 ? 129 ASP B CB  1 
ATOM   2450 C CG  . ASP B 1 130 ? 12.885  -0.414  -3.588  1.00 59.57 ? 129 ASP B CG  1 
ATOM   2451 O OD1 . ASP B 1 130 ? 13.399  0.728   -3.743  1.00 56.81 ? 129 ASP B OD1 1 
ATOM   2452 O OD2 . ASP B 1 130 ? 11.652  -0.590  -3.441  1.00 59.05 ? 129 ASP B OD2 1 
ATOM   2453 N N   . PRO B 1 131 ? 16.721  -2.992  -3.521  1.00 48.53 ? 130 PRO B N   1 
ATOM   2454 C CA  . PRO B 1 131 ? 17.606  -4.168  -3.534  1.00 49.58 ? 130 PRO B CA  1 
ATOM   2455 C C   . PRO B 1 131 ? 16.824  -5.470  -3.356  1.00 49.40 ? 130 PRO B C   1 
ATOM   2456 O O   . PRO B 1 131 ? 15.727  -5.457  -2.791  1.00 47.39 ? 130 PRO B O   1 
ATOM   2457 C CB  . PRO B 1 131 ? 18.526  -3.936  -2.324  1.00 50.14 ? 130 PRO B CB  1 
ATOM   2458 C CG  . PRO B 1 131 ? 18.360  -2.492  -1.964  1.00 49.02 ? 130 PRO B CG  1 
ATOM   2459 C CD  . PRO B 1 131 ? 16.953  -2.147  -2.339  1.00 46.85 ? 130 PRO B CD  1 
ATOM   2460 N N   . TRP B 1 132 ? 17.375  -6.581  -3.836  1.00 49.30 ? 131 TRP B N   1 
ATOM   2461 C CA  . TRP B 1 132 ? 16.673  -7.857  -3.731  1.00 49.34 ? 131 TRP B CA  1 
ATOM   2462 C C   . TRP B 1 132 ? 16.482  -8.273  -2.283  1.00 49.83 ? 131 TRP B C   1 
ATOM   2463 O O   . TRP B 1 132 ? 17.285  -7.914  -1.419  1.00 50.60 ? 131 TRP B O   1 
ATOM   2464 C CB  . TRP B 1 132 ? 17.412  -8.952  -4.487  1.00 45.19 ? 131 TRP B CB  1 
ATOM   2465 C CG  . TRP B 1 132 ? 17.331  -8.815  -5.972  1.00 44.73 ? 131 TRP B CG  1 
ATOM   2466 C CD1 . TRP B 1 132 ? 18.294  -8.323  -6.806  1.00 45.59 ? 131 TRP B CD1 1 
ATOM   2467 C CD2 . TRP B 1 132 ? 16.222  -9.164  -6.801  1.00 38.14 ? 131 TRP B CD2 1 
ATOM   2468 N NE1 . TRP B 1 132 ? 17.853  -8.357  -8.105  1.00 43.22 ? 131 TRP B NE1 1 
ATOM   2469 C CE2 . TRP B 1 132 ? 16.584  -8.872  -8.128  1.00 37.41 ? 131 TRP B CE2 1 
ATOM   2470 C CE3 . TRP B 1 132 ? 14.958  -9.688  -6.549  1.00 39.86 ? 131 TRP B CE3 1 
ATOM   2471 C CZ2 . TRP B 1 132 ? 15.733  -9.092  -9.196  1.00 38.63 ? 131 TRP B CZ2 1 
ATOM   2472 C CZ3 . TRP B 1 132 ? 14.116  -9.913  -7.613  1.00 44.05 ? 131 TRP B CZ3 1 
ATOM   2473 C CH2 . TRP B 1 132 ? 14.505  -9.611  -8.921  1.00 42.78 ? 131 TRP B CH2 1 
ATOM   2474 N N   . THR B 1 133 ? 15.405  -9.013  -2.024  1.00 48.32 ? 132 THR B N   1 
ATOM   2475 C CA  . THR B 1 133 ? 15.098  -9.489  -0.675  1.00 49.69 ? 132 THR B CA  1 
ATOM   2476 C C   . THR B 1 133 ? 14.578  -10.918 -0.665  1.00 49.05 ? 132 THR B C   1 
ATOM   2477 O O   . THR B 1 133 ? 13.837  -11.324 -1.559  1.00 47.19 ? 132 THR B O   1 
ATOM   2478 C CB  . THR B 1 133 ? 14.026  -8.635  0.016   1.00 51.25 ? 132 THR B CB  1 
ATOM   2479 O OG1 . THR B 1 133 ? 12.766  -8.820  -0.648  1.00 47.09 ? 132 THR B OG1 1 
ATOM   2480 C CG2 . THR B 1 133 ? 14.421  -7.160  0.024   1.00 48.56 ? 132 THR B CG2 1 
ATOM   2481 N N   . VAL B 1 134 ? 14.957  -11.663 0.373   1.00 51.23 ? 133 VAL B N   1 
ATOM   2482 C CA  . VAL B 1 134 ? 14.517  -13.037 0.556   1.00 47.31 ? 133 VAL B CA  1 
ATOM   2483 C C   . VAL B 1 134 ? 13.767  -13.204 1.879   1.00 49.50 ? 133 VAL B C   1 
ATOM   2484 O O   . VAL B 1 134 ? 14.358  -13.085 2.958   1.00 47.88 ? 133 VAL B O   1 
ATOM   2485 C CB  . VAL B 1 134 ? 15.702  -13.994 0.576   1.00 42.61 ? 133 VAL B CB  1 
ATOM   2486 C CG1 . VAL B 1 134 ? 15.207  -15.391 0.369   1.00 46.99 ? 133 VAL B CG1 1 
ATOM   2487 C CG2 . VAL B 1 134 ? 16.716  -13.624 -0.483  1.00 42.44 ? 133 VAL B CG2 1 
ATOM   2488 N N   . ASP B 1 135 ? 12.470  -13.491 1.786   1.00 50.44 ? 134 ASP B N   1 
ATOM   2489 C CA  . ASP B 1 135 ? 11.605  -13.667 2.961   1.00 52.36 ? 134 ASP B CA  1 
ATOM   2490 C C   . ASP B 1 135 ? 11.614  -12.422 3.857   1.00 55.98 ? 134 ASP B C   1 
ATOM   2491 O O   . ASP B 1 135 ? 11.578  -12.526 5.085   1.00 53.14 ? 134 ASP B O   1 
ATOM   2492 C CB  . ASP B 1 135 ? 11.973  -14.940 3.761   1.00 58.99 ? 134 ASP B CB  1 
ATOM   2493 C CG  . ASP B 1 135 ? 11.253  -16.216 3.248   1.00 61.59 ? 134 ASP B CG  1 
ATOM   2494 O OD1 . ASP B 1 135 ? 10.650  -16.949 4.073   1.00 56.60 ? 134 ASP B OD1 1 
ATOM   2495 O OD2 . ASP B 1 135 ? 11.301  -16.503 2.030   1.00 62.08 ? 134 ASP B OD2 1 
ATOM   2496 N N   . GLY B 1 136 ? 11.671  -11.249 3.218   1.00 60.48 ? 135 GLY B N   1 
ATOM   2497 C CA  . GLY B 1 136 ? 11.586  -9.960  3.889   1.00 48.35 ? 135 GLY B CA  1 
ATOM   2498 C C   . GLY B 1 136 ? 12.880  -9.527  4.550   1.00 54.22 ? 135 GLY B C   1 
ATOM   2499 O O   . GLY B 1 136 ? 12.863  -8.914  5.612   1.00 63.61 ? 135 GLY B O   1 
ATOM   2500 N N   . ASN B 1 137 ? 14.007  -9.848  3.927   1.00 50.95 ? 136 ASN B N   1 
ATOM   2501 C CA  . ASN B 1 137 ? 15.320  -9.561  4.499   1.00 54.56 ? 136 ASN B CA  1 
ATOM   2502 C C   . ASN B 1 137 ? 16.310  -9.253  3.383   1.00 53.25 ? 136 ASN B C   1 
ATOM   2503 O O   . ASN B 1 137 ? 16.278  -9.875  2.329   1.00 53.55 ? 136 ASN B O   1 
ATOM   2504 C CB  . ASN B 1 137 ? 15.820  -10.748 5.342   1.00 59.94 ? 136 ASN B CB  1 
ATOM   2505 C CG  . ASN B 1 137 ? 15.276  -10.738 6.774   1.00 62.75 ? 136 ASN B CG  1 
ATOM   2506 O OD1 . ASN B 1 137 ? 14.126  -11.129 7.029   1.00 55.38 ? 136 ASN B OD1 1 
ATOM   2507 N ND2 . ASN B 1 137 ? 16.115  -10.305 7.720   1.00 64.54 ? 136 ASN B ND2 1 
ATOM   2508 N N   . GLN B 1 138 ? 17.184  -8.284  3.595   1.00 56.48 ? 137 GLN B N   1 
ATOM   2509 C CA  . GLN B 1 138 ? 18.079  -7.888  2.521   1.00 58.95 ? 137 GLN B CA  1 
ATOM   2510 C C   . GLN B 1 138 ? 19.068  -9.024  2.184   1.00 59.87 ? 137 GLN B C   1 
ATOM   2511 O O   . GLN B 1 138 ? 19.786  -9.515  3.055   1.00 57.17 ? 137 GLN B O   1 
ATOM   2512 C CB  . GLN B 1 138 ? 18.787  -6.572  2.869   1.00 55.77 ? 137 GLN B CB  1 
ATOM   2513 C CG  . GLN B 1 138 ? 19.133  -5.717  1.657   1.00 60.54 ? 137 GLN B CG  1 
ATOM   2514 C CD  . GLN B 1 138 ? 20.342  -6.252  0.900   1.00 66.47 ? 137 GLN B CD  1 
ATOM   2515 O OE1 . GLN B 1 138 ? 21.457  -6.253  1.425   1.00 68.36 ? 137 GLN B OE1 1 
ATOM   2516 N NE2 . GLN B 1 138 ? 20.124  -6.723  -0.334  1.00 59.82 ? 137 GLN B NE2 1 
ATOM   2517 N N   . ALA B 1 139 ? 19.065  -9.448  0.919   1.00 59.77 ? 138 ALA B N   1 
ATOM   2518 C CA  . ALA B 1 139 ? 19.970  -10.486 0.410   1.00 58.00 ? 138 ALA B CA  1 
ATOM   2519 C C   . ALA B 1 139 ? 19.906  -10.555 -1.119  1.00 57.77 ? 138 ALA B C   1 
ATOM   2520 O O   . ALA B 1 139 ? 18.817  -10.545 -1.697  1.00 57.34 ? 138 ALA B O   1 
ATOM   2521 C CB  . ALA B 1 139 ? 19.620  -11.850 1.007   1.00 55.92 ? 138 ALA B CB  1 
ATOM   2522 N N   . ASP B 1 140 ? 21.064  -10.626 -1.773  1.00 57.46 ? 139 ASP B N   1 
ATOM   2523 C CA  . ASP B 1 140 ? 21.112  -10.791 -3.231  1.00 59.82 ? 139 ASP B CA  1 
ATOM   2524 C C   . ASP B 1 140 ? 21.764  -12.115 -3.648  1.00 59.11 ? 139 ASP B C   1 
ATOM   2525 O O   . ASP B 1 140 ? 22.373  -12.216 -4.725  1.00 55.30 ? 139 ASP B O   1 
ATOM   2526 C CB  . ASP B 1 140 ? 21.798  -9.596  -3.913  1.00 61.62 ? 139 ASP B CB  1 
ATOM   2527 C CG  . ASP B 1 140 ? 23.089  -9.185  -3.225  1.00 67.07 ? 139 ASP B CG  1 
ATOM   2528 O OD1 . ASP B 1 140 ? 23.375  -7.964  -3.179  1.00 70.45 ? 139 ASP B OD1 1 
ATOM   2529 O OD2 . ASP B 1 140 ? 23.814  -10.080 -2.735  1.00 65.82 ? 139 ASP B OD2 1 
ATOM   2530 N N   . SER B 1 141 ? 21.616  -13.114 -2.773  1.00 57.39 ? 140 SER B N   1 
ATOM   2531 C CA  . SER B 1 141 ? 22.149  -14.464 -2.964  1.00 52.27 ? 140 SER B CA  1 
ATOM   2532 C C   . SER B 1 141 ? 21.610  -15.372 -1.865  1.00 50.04 ? 140 SER B C   1 
ATOM   2533 O O   . SER B 1 141 ? 21.397  -14.920 -0.741  1.00 50.29 ? 140 SER B O   1 
ATOM   2534 C CB  . SER B 1 141 ? 23.680  -14.470 -2.917  1.00 51.80 ? 140 SER B CB  1 
ATOM   2535 O OG  . SER B 1 141 ? 24.146  -14.520 -1.581  1.00 48.72 ? 140 SER B OG  1 
ATOM   2536 N N   . LYS B 1 142 ? 21.386  -16.645 -2.194  1.00 49.16 ? 141 LYS B N   1 
ATOM   2537 C CA  . LYS B 1 142 ? 20.912  -17.640 -1.226  1.00 47.97 ? 141 LYS B CA  1 
ATOM   2538 C C   . LYS B 1 142 ? 21.771  -18.902 -1.306  1.00 51.57 ? 141 LYS B C   1 
ATOM   2539 O O   . LYS B 1 142 ? 22.134  -19.336 -2.402  1.00 51.54 ? 141 LYS B O   1 
ATOM   2540 C CB  . LYS B 1 142 ? 19.446  -17.988 -1.491  1.00 44.14 ? 141 LYS B CB  1 
ATOM   2541 C CG  . LYS B 1 142 ? 18.918  -19.180 -0.704  1.00 45.56 ? 141 LYS B CG  1 
ATOM   2542 C CD  . LYS B 1 142 ? 18.913  -18.904 0.788   1.00 48.59 ? 141 LYS B CD  1 
ATOM   2543 C CE  . LYS B 1 142 ? 18.153  -19.981 1.543   1.00 50.29 ? 141 LYS B CE  1 
ATOM   2544 N NZ  . LYS B 1 142 ? 18.719  -21.335 1.270   1.00 54.47 ? 141 LYS B NZ  1 
ATOM   2545 N N   . THR B 1 143 ? 22.113  -19.485 -0.157  1.00 49.78 ? 142 THR B N   1 
ATOM   2546 C CA  . THR B 1 143 ? 22.872  -20.736 -0.165  1.00 49.45 ? 142 THR B CA  1 
ATOM   2547 C C   . THR B 1 143 ? 22.063  -21.938 0.322   1.00 48.89 ? 142 THR B C   1 
ATOM   2548 O O   . THR B 1 143 ? 21.852  -22.122 1.525   1.00 47.37 ? 142 THR B O   1 
ATOM   2549 C CB  . THR B 1 143 ? 24.204  -20.634 0.608   1.00 48.16 ? 142 THR B CB  1 
ATOM   2550 O OG1 . THR B 1 143 ? 25.109  -19.790 -0.114  1.00 42.12 ? 142 THR B OG1 1 
ATOM   2551 C CG2 . THR B 1 143 ? 24.841  -22.021 0.766   1.00 49.47 ? 142 THR B CG2 1 
ATOM   2552 N N   . PHE B 1 144 ? 21.607  -22.742 -0.635  1.00 49.70 ? 143 PHE B N   1 
ATOM   2553 C CA  . PHE B 1 144 ? 20.957  -24.010 -0.344  1.00 48.59 ? 143 PHE B CA  1 
ATOM   2554 C C   . PHE B 1 144 ? 21.891  -24.891 0.475   1.00 48.23 ? 143 PHE B C   1 
ATOM   2555 O O   . PHE B 1 144 ? 23.047  -25.115 0.086   1.00 45.43 ? 143 PHE B O   1 
ATOM   2556 C CB  . PHE B 1 144 ? 20.609  -24.747 -1.640  1.00 49.92 ? 143 PHE B CB  1 
ATOM   2557 C CG  . PHE B 1 144 ? 19.589  -24.046 -2.504  1.00 48.35 ? 143 PHE B CG  1 
ATOM   2558 C CD1 . PHE B 1 144 ? 18.261  -23.962 -2.110  1.00 47.79 ? 143 PHE B CD1 1 
ATOM   2559 C CD2 . PHE B 1 144 ? 19.952  -23.515 -3.735  1.00 44.22 ? 143 PHE B CD2 1 
ATOM   2560 C CE1 . PHE B 1 144 ? 17.326  -23.336 -2.915  1.00 47.26 ? 143 PHE B CE1 1 
ATOM   2561 C CE2 . PHE B 1 144 ? 19.021  -22.897 -4.540  1.00 42.45 ? 143 PHE B CE2 1 
ATOM   2562 C CZ  . PHE B 1 144 ? 17.706  -22.806 -4.129  1.00 44.39 ? 143 PHE B CZ  1 
ATOM   2563 N N   . ALA B 1 145 ? 21.384  -25.384 1.605   1.00 48.48 ? 144 ALA B N   1 
ATOM   2564 C CA  . ALA B 1 145 ? 22.141  -26.286 2.466   1.00 45.55 ? 144 ALA B CA  1 
ATOM   2565 C C   . ALA B 1 145 ? 22.308  -27.594 1.740   1.00 48.86 ? 144 ALA B C   1 
ATOM   2566 O O   . ALA B 1 145 ? 21.383  -28.041 1.053   1.00 48.68 ? 144 ALA B O   1 
ATOM   2567 C CB  . ALA B 1 145 ? 21.417  -26.519 3.774   1.00 38.73 ? 144 ALA B CB  1 
ATOM   2568 N N   . ALA B 1 146 ? 23.490  -28.192 1.889   1.00 51.77 ? 145 ALA B N   1 
ATOM   2569 C CA  . ALA B 1 146 ? 23.793  -29.496 1.314   1.00 46.06 ? 145 ALA B CA  1 
ATOM   2570 C C   . ALA B 1 146 ? 22.689  -30.477 1.639   1.00 46.07 ? 145 ALA B C   1 
ATOM   2571 O O   . ALA B 1 146 ? 22.185  -30.504 2.766   1.00 42.88 ? 145 ALA B O   1 
ATOM   2572 C CB  . ALA B 1 146 ? 25.127  -30.019 1.835   1.00 43.33 ? 145 ALA B CB  1 
ATOM   2573 N N   . VAL B 1 147 ? 22.292  -31.254 0.636   1.00 48.54 ? 146 VAL B N   1 
ATOM   2574 C CA  . VAL B 1 147 ? 21.338  -32.336 0.847   1.00 51.97 ? 146 VAL B CA  1 
ATOM   2575 C C   . VAL B 1 147 ? 22.059  -33.684 0.854   1.00 55.82 ? 146 VAL B C   1 
ATOM   2576 O O   . VAL B 1 147 ? 22.741  -34.040 -0.112  1.00 55.69 ? 146 VAL B O   1 
ATOM   2577 C CB  . VAL B 1 147 ? 20.208  -32.353 -0.206  1.00 48.12 ? 146 VAL B CB  1 
ATOM   2578 C CG1 . VAL B 1 147 ? 19.374  -33.620 -0.058  1.00 47.83 ? 146 VAL B CG1 1 
ATOM   2579 C CG2 . VAL B 1 147 ? 19.330  -31.120 -0.068  1.00 47.04 ? 146 VAL B CG2 1 
ATOM   2580 N N   . PRO B 1 148 ? 21.941  -34.418 1.972   1.00 58.79 ? 147 PRO B N   1 
ATOM   2581 C CA  . PRO B 1 148 ? 22.458  -35.786 2.096   1.00 58.19 ? 147 PRO B CA  1 
ATOM   2582 C C   . PRO B 1 148 ? 21.673  -36.783 1.240   1.00 57.01 ? 147 PRO B C   1 
ATOM   2583 O O   . PRO B 1 148 ? 20.440  -36.743 1.218   1.00 55.28 ? 147 PRO B O   1 
ATOM   2584 C CB  . PRO B 1 148 ? 22.250  -36.101 3.583   1.00 54.00 ? 147 PRO B CB  1 
ATOM   2585 C CG  . PRO B 1 148 ? 22.196  -34.762 4.247   1.00 57.85 ? 147 PRO B CG  1 
ATOM   2586 C CD  . PRO B 1 148 ? 21.485  -33.885 3.268   1.00 52.97 ? 147 PRO B CD  1 
ATOM   2587 N N   . SER B 1 149 ? 22.388  -37.662 0.541   1.00 56.43 ? 148 SER B N   1 
ATOM   2588 C CA  . SER B 1 149 ? 21.763  -38.749 -0.207  1.00 57.49 ? 148 SER B CA  1 
ATOM   2589 C C   . SER B 1 149 ? 21.243  -39.804 0.758   1.00 58.42 ? 148 SER B C   1 
ATOM   2590 O O   . SER B 1 149 ? 22.039  -40.476 1.422   1.00 55.86 ? 148 SER B O   1 
ATOM   2591 C CB  . SER B 1 149 ? 22.772  -39.394 -1.154  1.00 55.87 ? 148 SER B CB  1 
ATOM   2592 O OG  . SER B 1 149 ? 23.399  -38.422 -1.964  1.00 54.51 ? 148 SER B OG  1 
ATOM   2593 N N   . PRO B 1 150 ? 19.907  -39.964 0.826   1.00 57.62 ? 149 PRO B N   1 
ATOM   2594 C CA  . PRO B 1 150 ? 19.268  -40.857 1.799   1.00 58.13 ? 149 PRO B CA  1 
ATOM   2595 C C   . PRO B 1 150 ? 19.758  -42.287 1.616   1.00 62.95 ? 149 PRO B C   1 
ATOM   2596 O O   . PRO B 1 150 ? 19.962  -42.732 0.484   1.00 63.49 ? 149 PRO B O   1 
ATOM   2597 C CB  . PRO B 1 150 ? 17.778  -40.760 1.447   1.00 55.80 ? 149 PRO B CB  1 
ATOM   2598 C CG  . PRO B 1 150 ? 17.641  -39.526 0.632   1.00 56.95 ? 149 PRO B CG  1 
ATOM   2599 C CD  . PRO B 1 150 ? 18.928  -39.405 -0.119  1.00 56.55 ? 149 PRO B CD  1 
ATOM   2600 N N   . ALA B 1 151 ? 19.963  -42.997 2.717   1.00 61.23 ? 150 ALA B N   1 
ATOM   2601 C CA  . ALA B 1 151 ? 20.488  -44.349 2.628   1.00 64.72 ? 150 ALA B CA  1 
ATOM   2602 C C   . ALA B 1 151 ? 19.478  -45.289 1.980   1.00 65.20 ? 150 ALA B C   1 
ATOM   2603 O O   . ALA B 1 151 ? 18.284  -45.249 2.291   1.00 63.80 ? 150 ALA B O   1 
ATOM   2604 C CB  . ALA B 1 151 ? 20.896  -44.857 4.004   1.00 63.99 ? 150 ALA B CB  1 
ATOM   2605 N N   . VAL B 1 152 ? 19.966  -46.104 1.048   1.00 67.00 ? 151 VAL B N   1 
ATOM   2606 C CA  . VAL B 1 152 ? 19.212  -47.243 0.529   1.00 70.29 ? 151 VAL B CA  1 
ATOM   2607 C C   . VAL B 1 152 ? 20.050  -48.509 0.697   1.00 72.37 ? 151 VAL B C   1 
ATOM   2608 O O   . VAL B 1 152 ? 21.152  -48.619 0.151   1.00 70.77 ? 151 VAL B O   1 
ATOM   2609 C CB  . VAL B 1 152 ? 18.832  -47.075 -0.952  1.00 68.71 ? 151 VAL B CB  1 
ATOM   2610 C CG1 . VAL B 1 152 ? 18.104  -48.324 -1.455  1.00 69.41 ? 151 VAL B CG1 1 
ATOM   2611 C CG2 . VAL B 1 152 ? 17.966  -45.854 -1.134  1.00 68.24 ? 151 VAL B CG2 1 
ATOM   2612 N N   . GLU B 1 153 ? 19.525  -49.461 1.458   1.00 74.19 ? 152 GLU B N   1 
ATOM   2613 C CA  . GLU B 1 153 ? 20.282  -50.660 1.799   1.00 78.97 ? 152 GLU B CA  1 
ATOM   2614 C C   . GLU B 1 153 ? 20.618  -51.554 0.601   1.00 76.67 ? 152 GLU B C   1 
ATOM   2615 O O   . GLU B 1 153 ? 19.745  -51.888 -0.207  1.00 73.32 ? 152 GLU B O   1 
ATOM   2616 C CB  . GLU B 1 153 ? 19.533  -51.474 2.845   1.00 80.70 ? 152 GLU B CB  1 
ATOM   2617 C CG  . GLU B 1 153 ? 20.320  -52.666 3.333   1.00 83.79 ? 152 GLU B CG  1 
ATOM   2618 C CD  . GLU B 1 153 ? 19.423  -53.816 3.723   1.00 93.56 ? 152 GLU B CD  1 
ATOM   2619 O OE1 . GLU B 1 153 ? 18.185  -53.643 3.640   1.00 91.11 ? 152 GLU B OE1 1 
ATOM   2620 O OE2 . GLU B 1 153 ? 19.953  -54.887 4.102   1.00 96.04 ? 152 GLU B OE2 1 
ATOM   2621 N N   . GLY B 1 154 ? 21.888  -51.943 0.508   1.00 72.93 ? 153 GLY B N   1 
ATOM   2622 C CA  . GLY B 1 154 ? 22.359  -52.807 -0.559  1.00 69.84 ? 153 GLY B CA  1 
ATOM   2623 C C   . GLY B 1 154 ? 23.018  -52.029 -1.679  1.00 71.96 ? 153 GLY B C   1 
ATOM   2624 O O   . GLY B 1 154 ? 23.466  -52.598 -2.674  1.00 70.32 ? 153 GLY B O   1 
ATOM   2625 N N   . TYR B 1 155 ? 23.069  -50.714 -1.513  1.00 74.11 ? 154 TYR B N   1 
ATOM   2626 C CA  . TYR B 1 155 ? 23.591  -49.837 -2.547  1.00 69.95 ? 154 TYR B CA  1 
ATOM   2627 C C   . TYR B 1 155 ? 24.519  -48.804 -1.938  1.00 68.24 ? 154 TYR B C   1 
ATOM   2628 O O   . TYR B 1 155 ? 24.726  -48.774 -0.722  1.00 69.74 ? 154 TYR B O   1 
ATOM   2629 C CB  . TYR B 1 155 ? 22.444  -49.138 -3.277  1.00 68.93 ? 154 TYR B CB  1 
ATOM   2630 C CG  . TYR B 1 155 ? 21.559  -50.063 -4.091  1.00 71.92 ? 154 TYR B CG  1 
ATOM   2631 C CD1 . TYR B 1 155 ? 21.662  -50.110 -5.475  1.00 69.62 ? 154 TYR B CD1 1 
ATOM   2632 C CD2 . TYR B 1 155 ? 20.614  -50.879 -3.476  1.00 73.01 ? 154 TYR B CD2 1 
ATOM   2633 C CE1 . TYR B 1 155 ? 20.861  -50.944 -6.222  1.00 71.36 ? 154 TYR B CE1 1 
ATOM   2634 C CE2 . TYR B 1 155 ? 19.809  -51.721 -4.215  1.00 73.56 ? 154 TYR B CE2 1 
ATOM   2635 C CZ  . TYR B 1 155 ? 19.936  -51.748 -5.590  1.00 77.31 ? 154 TYR B CZ  1 
ATOM   2636 O OH  . TYR B 1 155 ? 19.134  -52.582 -6.338  1.00 80.16 ? 154 TYR B OH  1 
ATOM   2637 N N   . THR B 1 156 ? 25.081  -47.965 -2.798  1.00 65.72 ? 155 THR B N   1 
ATOM   2638 C CA  . THR B 1 156 ? 25.957  -46.882 -2.377  1.00 65.83 ? 155 THR B CA  1 
ATOM   2639 C C   . THR B 1 156 ? 25.939  -45.794 -3.443  1.00 66.03 ? 155 THR B C   1 
ATOM   2640 O O   . THR B 1 156 ? 26.398  -46.013 -4.568  1.00 62.36 ? 155 THR B O   1 
ATOM   2641 C CB  . THR B 1 156 ? 27.408  -47.369 -2.151  1.00 69.03 ? 155 THR B CB  1 
ATOM   2642 O OG1 . THR B 1 156 ? 27.449  -48.259 -1.024  1.00 74.78 ? 155 THR B OG1 1 
ATOM   2643 C CG2 . THR B 1 156 ? 28.351  -46.187 -1.906  1.00 58.16 ? 155 THR B CG2 1 
ATOM   2644 N N   . PRO B 1 157 ? 25.385  -44.619 -3.097  1.00 66.56 ? 156 PRO B N   1 
ATOM   2645 C CA  . PRO B 1 157 ? 25.284  -43.478 -4.013  1.00 58.86 ? 156 PRO B CA  1 
ATOM   2646 C C   . PRO B 1 157 ? 26.649  -42.922 -4.421  1.00 53.48 ? 156 PRO B C   1 
ATOM   2647 O O   . PRO B 1 157 ? 27.567  -42.865 -3.596  1.00 53.45 ? 156 PRO B O   1 
ATOM   2648 C CB  . PRO B 1 157 ? 24.529  -42.438 -3.184  1.00 55.89 ? 156 PRO B CB  1 
ATOM   2649 C CG  . PRO B 1 157 ? 23.834  -43.202 -2.144  1.00 56.69 ? 156 PRO B CG  1 
ATOM   2650 C CD  . PRO B 1 157 ? 24.726  -44.344 -1.811  1.00 62.81 ? 156 PRO B CD  1 
ATOM   2651 N N   . ASN B 1 158 ? 26.775  -42.522 -5.686  1.00 54.00 ? 157 ASN B N   1 
ATOM   2652 C CA  . ASN B 1 158 ? 27.993  -41.869 -6.164  1.00 55.13 ? 157 ASN B CA  1 
ATOM   2653 C C   . ASN B 1 158 ? 28.280  -40.608 -5.358  1.00 55.37 ? 157 ASN B C   1 
ATOM   2654 O O   . ASN B 1 158 ? 29.373  -40.446 -4.817  1.00 55.84 ? 157 ASN B O   1 
ATOM   2655 C CB  . ASN B 1 158 ? 27.946  -41.574 -7.678  1.00 54.97 ? 157 ASN B CB  1 
ATOM   2656 C CG  . ASN B 1 158 ? 26.912  -40.506 -8.063  1.00 53.99 ? 157 ASN B CG  1 
ATOM   2657 O OD1 . ASN B 1 158 ? 25.788  -40.498 -7.564  1.00 53.08 ? 157 ASN B OD1 1 
ATOM   2658 N ND2 . ASN B 1 158 ? 27.300  -39.605 -8.964  1.00 49.66 ? 157 ASN B ND2 1 
ATOM   2659 N N   . HIS B 1 159 ? 27.281  -39.733 -5.273  1.00 59.02 ? 158 HIS B N   1 
ATOM   2660 C CA  . HIS B 1 159 ? 27.314  -38.582 -4.381  1.00 56.68 ? 158 HIS B CA  1 
ATOM   2661 C C   . HIS B 1 159 ? 26.726  -38.989 -3.031  1.00 58.00 ? 158 HIS B C   1 
ATOM   2662 O O   . HIS B 1 159 ? 25.546  -39.342 -2.934  1.00 53.80 ? 158 HIS B O   1 
ATOM   2663 C CB  . HIS B 1 159 ? 26.503  -37.427 -4.961  1.00 52.49 ? 158 HIS B CB  1 
ATOM   2664 C CG  . HIS B 1 159 ? 27.094  -36.830 -6.197  1.00 52.26 ? 158 HIS B CG  1 
ATOM   2665 N ND1 . HIS B 1 159 ? 26.657  -37.157 -7.462  1.00 51.87 ? 158 HIS B ND1 1 
ATOM   2666 C CD2 . HIS B 1 159 ? 28.080  -35.917 -6.362  1.00 54.12 ? 158 HIS B CD2 1 
ATOM   2667 C CE1 . HIS B 1 159 ? 27.350  -36.472 -8.355  1.00 53.77 ? 158 HIS B CE1 1 
ATOM   2668 N NE2 . HIS B 1 159 ? 28.221  -35.713 -7.714  1.00 55.32 ? 158 HIS B NE2 1 
ATOM   2669 N N   . GLN B 1 160 ? 27.551  -38.948 -1.991  1.00 60.70 ? 159 GLN B N   1 
ATOM   2670 C CA  . GLN B 1 160 ? 27.092  -39.309 -0.659  1.00 60.21 ? 159 GLN B CA  1 
ATOM   2671 C C   . GLN B 1 160 ? 26.240  -38.176 -0.090  1.00 60.95 ? 159 GLN B C   1 
ATOM   2672 O O   . GLN B 1 160 ? 25.383  -38.402 0.767   1.00 61.70 ? 159 GLN B O   1 
ATOM   2673 C CB  . GLN B 1 160 ? 28.278  -39.617 0.240   1.00 61.23 ? 159 GLN B CB  1 
ATOM   2674 C CG  . GLN B 1 160 ? 27.949  -40.474 1.434   1.00 61.39 ? 159 GLN B CG  1 
ATOM   2675 C CD  . GLN B 1 160 ? 29.093  -40.497 2.415   1.00 67.05 ? 159 GLN B CD  1 
ATOM   2676 O OE1 . GLN B 1 160 ? 30.190  -40.015 2.110   1.00 67.36 ? 159 GLN B OE1 1 
ATOM   2677 N NE2 . GLN B 1 160 ? 28.850  -41.043 3.606   1.00 62.58 ? 159 GLN B NE2 1 
ATOM   2678 N N   . GLN B 1 161 ? 26.486  -36.962 -0.578  1.00 54.45 ? 160 GLN B N   1 
ATOM   2679 C CA  . GLN B 1 161 ? 25.554  -35.856 -0.405  1.00 53.21 ? 160 GLN B CA  1 
ATOM   2680 C C   . GLN B 1 161 ? 25.766  -34.902 -1.559  1.00 55.19 ? 160 GLN B C   1 
ATOM   2681 O O   . GLN B 1 161 ? 26.778  -34.986 -2.259  1.00 55.04 ? 160 GLN B O   1 
ATOM   2682 C CB  . GLN B 1 161 ? 25.825  -35.103 0.887   1.00 54.73 ? 160 GLN B CB  1 
ATOM   2683 C CG  . GLN B 1 161 ? 27.125  -34.315 0.845   1.00 54.83 ? 160 GLN B CG  1 
ATOM   2684 C CD  . GLN B 1 161 ? 27.288  -33.412 2.040   1.00 53.21 ? 160 GLN B CD  1 
ATOM   2685 O OE1 . GLN B 1 161 ? 26.383  -33.305 2.876   1.00 52.40 ? 160 GLN B OE1 1 
ATOM   2686 N NE2 . GLN B 1 161 ? 28.442  -32.754 2.134   1.00 48.08 ? 160 GLN B NE2 1 
ATOM   2687 N N   . ILE B 1 162 ? 24.820  -33.987 -1.752  1.00 53.17 ? 161 ILE B N   1 
ATOM   2688 C CA  . ILE B 1 162 ? 25.016  -32.900 -2.698  1.00 49.21 ? 161 ILE B CA  1 
ATOM   2689 C C   . ILE B 1 162 ? 25.392  -31.663 -1.926  1.00 46.56 ? 161 ILE B C   1 
ATOM   2690 O O   . ILE B 1 162 ? 24.743  -31.325 -0.943  1.00 43.14 ? 161 ILE B O   1 
ATOM   2691 C CB  . ILE B 1 162 ? 23.780  -32.630 -3.547  1.00 50.00 ? 161 ILE B CB  1 
ATOM   2692 C CG1 . ILE B 1 162 ? 23.551  -33.806 -4.496  1.00 50.48 ? 161 ILE B CG1 1 
ATOM   2693 C CG2 . ILE B 1 162 ? 23.973  -31.358 -4.363  1.00 46.17 ? 161 ILE B CG2 1 
ATOM   2694 C CD1 . ILE B 1 162 ? 24.705  -34.022 -5.473  1.00 47.95 ? 161 ILE B CD1 1 
ATOM   2695 N N   . ASN B 1 163 ? 26.455  -31.007 -2.377  1.00 45.82 ? 162 ASN B N   1 
ATOM   2696 C CA  . ASN B 1 163 ? 27.062  -29.910 -1.642  1.00 48.24 ? 162 ASN B CA  1 
ATOM   2697 C C   . ASN B 1 163 ? 26.190  -28.669 -1.588  1.00 52.17 ? 162 ASN B C   1 
ATOM   2698 O O   . ASN B 1 163 ? 25.128  -28.617 -2.205  1.00 54.91 ? 162 ASN B O   1 
ATOM   2699 C CB  . ASN B 1 163 ? 28.414  -29.558 -2.256  1.00 49.90 ? 162 ASN B CB  1 
ATOM   2700 C CG  . ASN B 1 163 ? 29.442  -30.645 -2.050  1.00 55.58 ? 162 ASN B CG  1 
ATOM   2701 O OD1 . ASN B 1 163 ? 29.285  -31.510 -1.182  1.00 56.20 ? 162 ASN B OD1 1 
ATOM   2702 N ND2 . ASN B 1 163 ? 30.512  -30.603 -2.839  1.00 55.72 ? 162 ASN B ND2 1 
ATOM   2703 N N   . GLU B 1 164 ? 26.640  -27.670 -0.837  1.00 49.96 ? 163 GLU B N   1 
ATOM   2704 C CA  . GLU B 1 164 ? 25.960  -26.386 -0.806  1.00 53.15 ? 163 GLU B CA  1 
ATOM   2705 C C   . GLU B 1 164 ? 26.162  -25.683 -2.138  1.00 57.37 ? 163 GLU B C   1 
ATOM   2706 O O   . GLU B 1 164 ? 27.262  -25.716 -2.693  1.00 57.87 ? 163 GLU B O   1 
ATOM   2707 C CB  . GLU B 1 164 ? 26.544  -25.503 0.289   1.00 54.67 ? 163 GLU B CB  1 
ATOM   2708 C CG  . GLU B 1 164 ? 26.267  -25.955 1.703   1.00 55.67 ? 163 GLU B CG  1 
ATOM   2709 C CD  . GLU B 1 164 ? 26.965  -25.063 2.709   1.00 59.93 ? 163 GLU B CD  1 
ATOM   2710 O OE1 . GLU B 1 164 ? 28.047  -24.517 2.373   1.00 55.40 ? 163 GLU B OE1 1 
ATOM   2711 O OE2 . GLU B 1 164 ? 26.423  -24.893 3.821   1.00 63.62 ? 163 GLU B OE2 1 
ATOM   2712 N N   . PHE B 1 165 ? 25.110  -25.044 -2.647  1.00 56.03 ? 164 PHE B N   1 
ATOM   2713 C CA  . PHE B 1 165 ? 25.242  -24.188 -3.825  1.00 52.45 ? 164 PHE B CA  1 
ATOM   2714 C C   . PHE B 1 165 ? 24.663  -22.832 -3.529  1.00 49.82 ? 164 PHE B C   1 
ATOM   2715 O O   . PHE B 1 165 ? 23.714  -22.714 -2.764  1.00 49.95 ? 164 PHE B O   1 
ATOM   2716 C CB  . PHE B 1 165 ? 24.533  -24.790 -5.033  1.00 53.62 ? 164 PHE B CB  1 
ATOM   2717 C CG  . PHE B 1 165 ? 25.243  -25.975 -5.618  1.00 56.96 ? 164 PHE B CG  1 
ATOM   2718 C CD1 . PHE B 1 165 ? 26.600  -25.920 -5.891  1.00 60.17 ? 164 PHE B CD1 1 
ATOM   2719 C CD2 . PHE B 1 165 ? 24.560  -27.148 -5.882  1.00 52.17 ? 164 PHE B CD2 1 
ATOM   2720 C CE1 . PHE B 1 165 ? 27.259  -27.010 -6.423  1.00 53.53 ? 164 PHE B CE1 1 
ATOM   2721 C CE2 . PHE B 1 165 ? 25.217  -28.237 -6.415  1.00 51.06 ? 164 PHE B CE2 1 
ATOM   2722 C CZ  . PHE B 1 165 ? 26.564  -28.166 -6.687  1.00 48.36 ? 164 PHE B CZ  1 
ATOM   2723 N N   . THR B 1 166 ? 25.239  -21.806 -4.137  1.00 53.42 ? 165 THR B N   1 
ATOM   2724 C CA  . THR B 1 166 ? 24.770  -20.443 -3.927  1.00 50.41 ? 165 THR B CA  1 
ATOM   2725 C C   . THR B 1 166 ? 24.201  -19.843 -5.215  1.00 51.55 ? 165 THR B C   1 
ATOM   2726 O O   . THR B 1 166 ? 24.919  -19.703 -6.210  1.00 53.01 ? 165 THR B O   1 
ATOM   2727 C CB  . THR B 1 166 ? 25.897  -19.550 -3.377  1.00 47.36 ? 165 THR B CB  1 
ATOM   2728 O OG1 . THR B 1 166 ? 26.227  -19.968 -2.046  1.00 45.15 ? 165 THR B OG1 1 
ATOM   2729 C CG2 . THR B 1 166 ? 25.466  -18.089 -3.355  1.00 50.60 ? 165 THR B CG2 1 
ATOM   2730 N N   . VAL B 1 167 ? 22.911  -19.503 -5.194  1.00 50.36 ? 166 VAL B N   1 
ATOM   2731 C CA  . VAL B 1 167 ? 22.252  -18.871 -6.342  1.00 51.69 ? 166 VAL B CA  1 
ATOM   2732 C C   . VAL B 1 167 ? 22.060  -17.362 -6.178  1.00 50.93 ? 166 VAL B C   1 
ATOM   2733 O O   . VAL B 1 167 ? 22.250  -16.812 -5.092  1.00 46.83 ? 166 VAL B O   1 
ATOM   2734 C CB  . VAL B 1 167 ? 20.873  -19.492 -6.632  1.00 47.23 ? 166 VAL B CB  1 
ATOM   2735 C CG1 . VAL B 1 167 ? 21.034  -20.838 -7.283  1.00 48.86 ? 166 VAL B CG1 1 
ATOM   2736 C CG2 . VAL B 1 167 ? 20.057  -19.596 -5.357  1.00 44.78 ? 166 VAL B CG2 1 
ATOM   2737 N N   . THR B 1 168 ? 21.686  -16.716 -7.282  1.00 52.90 ? 167 THR B N   1 
ATOM   2738 C CA  . THR B 1 168 ? 21.369  -15.289 -7.340  1.00 50.67 ? 167 THR B CA  1 
ATOM   2739 C C   . THR B 1 168 ? 20.013  -15.191 -8.041  1.00 52.13 ? 167 THR B C   1 
ATOM   2740 O O   . THR B 1 168 ? 19.517  -16.214 -8.522  1.00 51.68 ? 167 THR B O   1 
ATOM   2741 C CB  . THR B 1 168 ? 22.439  -14.522 -8.137  1.00 51.41 ? 167 THR B CB  1 
ATOM   2742 O OG1 . THR B 1 168 ? 22.562  -15.098 -9.445  1.00 57.16 ? 167 THR B OG1 1 
ATOM   2743 C CG2 . THR B 1 168 ? 23.778  -14.585 -7.424  1.00 49.15 ? 167 THR B CG2 1 
ATOM   2744 N N   . PRO B 1 169 ? 19.392  -13.984 -8.094  1.00 54.37 ? 168 PRO B N   1 
ATOM   2745 C CA  . PRO B 1 169 ? 18.075  -13.890 -8.749  1.00 48.59 ? 168 PRO B CA  1 
ATOM   2746 C C   . PRO B 1 169 ? 18.072  -14.274 -10.232 1.00 50.78 ? 168 PRO B C   1 
ATOM   2747 O O   . PRO B 1 169 ? 17.051  -14.738 -10.737 1.00 51.18 ? 168 PRO B O   1 
ATOM   2748 C CB  . PRO B 1 169 ? 17.706  -12.420 -8.577  1.00 44.69 ? 168 PRO B CB  1 
ATOM   2749 C CG  . PRO B 1 169 ? 18.415  -12.010 -7.345  1.00 45.93 ? 168 PRO B CG  1 
ATOM   2750 C CD  . PRO B 1 169 ? 19.724  -12.735 -7.380  1.00 50.44 ? 168 PRO B CD  1 
ATOM   2751 N N   . ASP B 1 170 ? 19.198  -14.098 -10.914 1.00 56.65 ? 169 ASP B N   1 
ATOM   2752 C CA  . ASP B 1 170 ? 19.318  -14.515 -12.313 1.00 60.85 ? 169 ASP B CA  1 
ATOM   2753 C C   . ASP B 1 170 ? 20.080  -15.846 -12.499 1.00 61.41 ? 169 ASP B C   1 
ATOM   2754 O O   . ASP B 1 170 ? 20.560  -16.156 -13.590 1.00 61.20 ? 169 ASP B O   1 
ATOM   2755 C CB  . ASP B 1 170 ? 19.927  -13.392 -13.171 1.00 63.76 ? 169 ASP B CB  1 
ATOM   2756 C CG  . ASP B 1 170 ? 20.952  -12.553 -12.410 1.00 70.33 ? 169 ASP B CG  1 
ATOM   2757 O OD1 . ASP B 1 170 ? 21.044  -11.331 -12.685 1.00 73.15 ? 169 ASP B OD1 1 
ATOM   2758 O OD2 . ASP B 1 170 ? 21.660  -13.113 -11.540 1.00 65.11 ? 169 ASP B OD2 1 
ATOM   2759 N N   . SER B 1 171 ? 20.174  -16.635 -11.436 1.00 55.10 ? 170 SER B N   1 
ATOM   2760 C CA  . SER B 1 171 ? 20.833  -17.922 -11.522 1.00 51.52 ? 170 SER B CA  1 
ATOM   2761 C C   . SER B 1 171 ? 19.914  -18.882 -12.255 1.00 50.94 ? 170 SER B C   1 
ATOM   2762 O O   . SER B 1 171 ? 18.696  -18.817 -12.109 1.00 51.97 ? 170 SER B O   1 
ATOM   2763 C CB  . SER B 1 171 ? 21.141  -18.449 -10.122 1.00 53.45 ? 170 SER B CB  1 
ATOM   2764 O OG  . SER B 1 171 ? 22.308  -19.251 -10.114 1.00 56.14 ? 170 SER B OG  1 
ATOM   2765 N N   . LYS B 1 172 ? 20.493  -19.764 -13.060 1.00 50.65 ? 171 LYS B N   1 
ATOM   2766 C CA  . LYS B 1 172 ? 19.701  -20.784 -13.727 1.00 53.93 ? 171 LYS B CA  1 
ATOM   2767 C C   . LYS B 1 172 ? 19.388  -21.880 -12.710 1.00 56.11 ? 171 LYS B C   1 
ATOM   2768 O O   . LYS B 1 172 ? 20.146  -22.070 -11.754 1.00 52.36 ? 171 LYS B O   1 
ATOM   2769 C CB  . LYS B 1 172 ? 20.449  -21.348 -14.940 1.00 53.33 ? 171 LYS B CB  1 
ATOM   2770 C CG  . LYS B 1 172 ? 19.604  -21.368 -16.219 1.00 57.46 ? 171 LYS B CG  1 
ATOM   2771 C CD  . LYS B 1 172 ? 20.398  -21.838 -17.436 1.00 66.55 ? 171 LYS B CD  1 
ATOM   2772 C CE  . LYS B 1 172 ? 19.521  -21.966 -18.693 1.00 61.74 ? 171 LYS B CE  1 
ATOM   2773 N NZ  . LYS B 1 172 ? 19.183  -20.664 -19.336 1.00 58.31 ? 171 LYS B NZ  1 
ATOM   2774 N N   . ASP B 1 173 ? 18.272  -22.587 -12.904 1.00 54.27 ? 172 ASP B N   1 
ATOM   2775 C CA  . ASP B 1 173 ? 17.855  -23.654 -11.980 1.00 51.53 ? 172 ASP B CA  1 
ATOM   2776 C C   . ASP B 1 173 ? 18.909  -24.767 -11.832 1.00 53.28 ? 172 ASP B C   1 
ATOM   2777 O O   . ASP B 1 173 ? 19.802  -24.920 -12.673 1.00 51.29 ? 172 ASP B O   1 
ATOM   2778 C CB  . ASP B 1 173 ? 16.496  -24.247 -12.383 1.00 46.43 ? 172 ASP B CB  1 
ATOM   2779 C CG  . ASP B 1 173 ? 15.309  -23.378 -11.939 1.00 54.24 ? 172 ASP B CG  1 
ATOM   2780 O OD1 . ASP B 1 173 ? 15.517  -22.225 -11.483 1.00 55.71 ? 172 ASP B OD1 1 
ATOM   2781 O OD2 . ASP B 1 173 ? 14.156  -23.853 -12.061 1.00 51.27 ? 172 ASP B OD2 1 
ATOM   2782 N N   . ILE B 1 174 ? 18.808  -25.532 -10.749 1.00 48.85 ? 173 ILE B N   1 
ATOM   2783 C CA  . ILE B 1 174 ? 19.824  -26.523 -10.422 1.00 47.88 ? 173 ILE B CA  1 
ATOM   2784 C C   . ILE B 1 174 ? 19.239  -27.925 -10.419 1.00 45.68 ? 173 ILE B C   1 
ATOM   2785 O O   . ILE B 1 174 ? 18.345  -28.225 -9.632  1.00 46.30 ? 173 ILE B O   1 
ATOM   2786 C CB  . ILE B 1 174 ? 20.495  -26.216 -9.057  1.00 46.70 ? 173 ILE B CB  1 
ATOM   2787 C CG1 . ILE B 1 174 ? 21.390  -24.974 -9.175  1.00 46.58 ? 173 ILE B CG1 1 
ATOM   2788 C CG2 . ILE B 1 174 ? 21.314  -27.401 -8.583  1.00 44.89 ? 173 ILE B CG2 1 
ATOM   2789 C CD1 . ILE B 1 174 ? 22.052  -24.537 -7.875  1.00 42.81 ? 173 ILE B CD1 1 
ATOM   2790 N N   . VAL B 1 175 ? 19.728  -28.775 -11.319 1.00 48.20 ? 174 VAL B N   1 
ATOM   2791 C CA  . VAL B 1 175 ? 19.331  -30.187 -11.323 1.00 51.18 ? 174 VAL B CA  1 
ATOM   2792 C C   . VAL B 1 175 ? 20.535  -31.130 -11.246 1.00 48.19 ? 174 VAL B C   1 
ATOM   2793 O O   . VAL B 1 175 ? 21.474  -31.037 -12.043 1.00 48.12 ? 174 VAL B O   1 
ATOM   2794 C CB  . VAL B 1 175 ? 18.450  -30.550 -12.532 1.00 48.06 ? 174 VAL B CB  1 
ATOM   2795 C CG1 . VAL B 1 175 ? 18.079  -32.034 -12.485 1.00 46.21 ? 174 VAL B CG1 1 
ATOM   2796 C CG2 . VAL B 1 175 ? 17.201  -29.672 -12.551 1.00 46.10 ? 174 VAL B CG2 1 
ATOM   2797 N N   . LYS B 1 176 ? 20.503  -32.012 -10.254 1.00 45.79 ? 175 LYS B N   1 
ATOM   2798 C CA  . LYS B 1 176 ? 21.543  -33.002 -10.058 1.00 44.94 ? 175 LYS B CA  1 
ATOM   2799 C C   . LYS B 1 176 ? 20.887  -34.353 -10.118 1.00 47.18 ? 175 LYS B C   1 
ATOM   2800 O O   . LYS B 1 176 ? 19.704  -34.495 -9.798  1.00 47.71 ? 175 LYS B O   1 
ATOM   2801 C CB  . LYS B 1 176 ? 22.205  -32.838 -8.694  1.00 44.45 ? 175 LYS B CB  1 
ATOM   2802 C CG  . LYS B 1 176 ? 22.981  -31.552 -8.518  1.00 44.72 ? 175 LYS B CG  1 
ATOM   2803 C CD  . LYS B 1 176 ? 24.208  -31.502 -9.399  1.00 43.54 ? 175 LYS B CD  1 
ATOM   2804 C CE  . LYS B 1 176 ? 24.784  -30.099 -9.421  1.00 47.05 ? 175 LYS B CE  1 
ATOM   2805 N NZ  . LYS B 1 176 ? 26.010  -30.006 -10.259 1.00 52.02 ? 175 LYS B NZ  1 
ATOM   2806 N N   . THR B 1 177 ? 21.652  -35.352 -10.532 1.00 49.02 ? 176 THR B N   1 
ATOM   2807 C CA  . THR B 1 177 ? 21.145  -36.714 -10.525 1.00 53.83 ? 176 THR B CA  1 
ATOM   2808 C C   . THR B 1 177 ? 22.106  -37.619 -9.766  1.00 52.85 ? 176 THR B C   1 
ATOM   2809 O O   . THR B 1 177 ? 23.285  -37.721 -10.106 1.00 50.74 ? 176 THR B O   1 
ATOM   2810 C CB  . THR B 1 177 ? 20.882  -37.251 -11.951 1.00 55.14 ? 176 THR B CB  1 
ATOM   2811 O OG1 . THR B 1 177 ? 19.989  -36.363 -12.641 1.00 52.92 ? 176 THR B OG1 1 
ATOM   2812 C CG2 . THR B 1 177 ? 20.259  -38.642 -11.887 1.00 47.78 ? 176 THR B CG2 1 
ATOM   2813 N N   . VAL B 1 178 ? 21.590  -38.255 -8.721  1.00 52.10 ? 177 VAL B N   1 
ATOM   2814 C CA  . VAL B 1 178 ? 22.394  -39.121 -7.877  1.00 53.82 ? 177 VAL B CA  1 
ATOM   2815 C C   . VAL B 1 178 ? 22.153  -40.579 -8.241  1.00 52.83 ? 177 VAL B C   1 
ATOM   2816 O O   . VAL B 1 178 ? 21.016  -41.037 -8.229  1.00 55.76 ? 177 VAL B O   1 
ATOM   2817 C CB  . VAL B 1 178 ? 22.048  -38.904 -6.399  1.00 54.41 ? 177 VAL B CB  1 
ATOM   2818 C CG1 . VAL B 1 178 ? 22.671  -39.990 -5.544  1.00 54.05 ? 177 VAL B CG1 1 
ATOM   2819 C CG2 . VAL B 1 178 ? 22.508  -37.536 -5.952  1.00 50.06 ? 177 VAL B CG2 1 
ATOM   2820 N N   . VAL B 1 179 ? 23.221  -41.307 -8.564  1.00 56.05 ? 178 VAL B N   1 
ATOM   2821 C CA  . VAL B 1 179 ? 23.088  -42.698 -9.008  1.00 57.36 ? 178 VAL B CA  1 
ATOM   2822 C C   . VAL B 1 179 ? 23.546  -43.712 -7.960  1.00 55.98 ? 178 VAL B C   1 
ATOM   2823 O O   . VAL B 1 179 ? 24.687  -43.685 -7.502  1.00 53.67 ? 178 VAL B O   1 
ATOM   2824 C CB  . VAL B 1 179 ? 23.844  -42.970 -10.335 1.00 56.37 ? 178 VAL B CB  1 
ATOM   2825 C CG1 . VAL B 1 179 ? 23.291  -44.215 -11.000 1.00 57.14 ? 178 VAL B CG1 1 
ATOM   2826 C CG2 . VAL B 1 179 ? 23.736  -41.781 -11.285 1.00 54.18 ? 178 VAL B CG2 1 
ATOM   2827 N N   . TYR B 1 180 ? 22.639  -44.612 -7.598  1.00 59.48 ? 179 TYR B N   1 
ATOM   2828 C CA  . TYR B 1 180 ? 22.918  -45.669 -6.633  1.00 62.80 ? 179 TYR B CA  1 
ATOM   2829 C C   . TYR B 1 180 ? 23.414  -46.943 -7.325  1.00 65.24 ? 179 TYR B C   1 
ATOM   2830 O O   . TYR B 1 180 ? 22.726  -47.501 -8.182  1.00 62.10 ? 179 TYR B O   1 
ATOM   2831 C CB  . TYR B 1 180 ? 21.651  -45.996 -5.840  1.00 62.59 ? 179 TYR B CB  1 
ATOM   2832 C CG  . TYR B 1 180 ? 21.248  -44.958 -4.816  1.00 65.58 ? 179 TYR B CG  1 
ATOM   2833 C CD1 . TYR B 1 180 ? 21.108  -45.298 -3.476  1.00 66.07 ? 179 TYR B CD1 1 
ATOM   2834 C CD2 . TYR B 1 180 ? 20.998  -43.643 -5.187  1.00 62.50 ? 179 TYR B CD2 1 
ATOM   2835 C CE1 . TYR B 1 180 ? 20.730  -44.356 -2.535  1.00 67.91 ? 179 TYR B CE1 1 
ATOM   2836 C CE2 . TYR B 1 180 ? 20.626  -42.694 -4.253  1.00 62.64 ? 179 TYR B CE2 1 
ATOM   2837 C CZ  . TYR B 1 180 ? 20.493  -43.052 -2.928  1.00 63.59 ? 179 TYR B CZ  1 
ATOM   2838 O OH  . TYR B 1 180 ? 20.123  -42.104 -1.997  1.00 58.54 ? 179 TYR B OH  1 
ATOM   2839 N N   . VAL B 1 181 ? 24.602  -47.407 -6.946  1.00 66.81 ? 180 VAL B N   1 
ATOM   2840 C CA  . VAL B 1 181 ? 25.122  -48.670 -7.464  1.00 64.01 ? 180 VAL B CA  1 
ATOM   2841 C C   . VAL B 1 181 ? 25.096  -49.769 -6.413  1.00 69.03 ? 180 VAL B C   1 
ATOM   2842 O O   . VAL B 1 181 ? 25.615  -49.599 -5.304  1.00 66.75 ? 180 VAL B O   1 
ATOM   2843 C CB  . VAL B 1 181 ? 26.550  -48.527 -7.983  1.00 59.36 ? 180 VAL B CB  1 
ATOM   2844 C CG1 . VAL B 1 181 ? 27.151  -49.893 -8.253  1.00 58.13 ? 180 VAL B CG1 1 
ATOM   2845 C CG2 . VAL B 1 181 ? 26.563  -47.668 -9.235  1.00 59.37 ? 180 VAL B CG2 1 
ATOM   2846 N N   . GLY B 1 182 ? 24.478  -50.892 -6.775  1.00 72.62 ? 181 GLY B N   1 
ATOM   2847 C CA  . GLY B 1 182 ? 24.446  -52.070 -5.928  1.00 71.98 ? 181 GLY B CA  1 
ATOM   2848 C C   . GLY B 1 182 ? 25.836  -52.508 -5.511  1.00 75.27 ? 181 GLY B C   1 
ATOM   2849 O O   . GLY B 1 182 ? 26.722  -52.694 -6.350  1.00 75.22 ? 181 GLY B O   1 
ATOM   2850 N N   . ASP B 1 183 ? 26.020  -52.663 -4.204  1.00 77.66 ? 182 ASP B N   1 
ATOM   2851 C CA  . ASP B 1 183 ? 27.307  -53.032 -3.629  1.00 78.54 ? 182 ASP B CA  1 
ATOM   2852 C C   . ASP B 1 183 ? 27.805  -54.401 -4.112  1.00 83.20 ? 182 ASP B C   1 
ATOM   2853 O O   . ASP B 1 183 ? 27.009  -55.255 -4.531  1.00 74.19 ? 182 ASP B O   1 
ATOM   2854 C CB  . ASP B 1 183 ? 27.233  -52.978 -2.095  1.00 77.24 ? 182 ASP B CB  1 
ATOM   2855 C CG  . ASP B 1 183 ? 27.412  -51.572 -1.556  1.00 78.42 ? 182 ASP B CG  1 
ATOM   2856 O OD1 . ASP B 1 183 ? 28.087  -50.772 -2.238  1.00 78.03 ? 182 ASP B OD1 1 
ATOM   2857 O OD2 . ASP B 1 183 ? 26.881  -51.268 -0.462  1.00 76.14 ? 182 ASP B OD2 1 
ATOM   2858 N N   . PRO B 1 184 ? 29.137  -54.599 -4.077  1.00 88.85 ? 183 PRO B N   1 
ATOM   2859 C CA  . PRO B 1 184 ? 29.775  -55.877 -4.430  1.00 90.20 ? 183 PRO B CA  1 
ATOM   2860 C C   . PRO B 1 184 ? 29.243  -57.083 -3.639  1.00 82.97 ? 183 PRO B C   1 
ATOM   2861 O O   . PRO B 1 184 ? 28.899  -56.965 -2.459  1.00 78.27 ? 183 PRO B O   1 
ATOM   2862 C CB  . PRO B 1 184 ? 31.266  -55.632 -4.114  1.00 88.38 ? 183 PRO B CB  1 
ATOM   2863 C CG  . PRO B 1 184 ? 31.318  -54.319 -3.337  1.00 84.90 ? 183 PRO B CG  1 
ATOM   2864 C CD  . PRO B 1 184 ? 30.135  -53.543 -3.813  1.00 82.43 ? 183 PRO B CD  1 
HETATM 2865 O O   . HOH C 2 .   ? -0.663  64.824  -32.960 1.00 29.42 ? 201 HOH A O   1 
HETATM 2866 O O   . HOH C 2 .   ? 6.305   55.245  -28.960 1.00 23.44 ? 202 HOH A O   1 
HETATM 2867 O O   . HOH C 2 .   ? 22.046  32.526  -34.375 1.00 22.89 ? 203 HOH A O   1 
HETATM 2868 O O   . HOH C 2 .   ? 39.572  23.527  -32.267 1.00 30.94 ? 204 HOH A O   1 
HETATM 2869 O O   . HOH C 2 .   ? 7.216   52.401  -22.045 1.00 27.72 ? 205 HOH A O   1 
HETATM 2870 O O   . HOH C 2 .   ? 18.723  27.034  -24.864 1.00 26.09 ? 206 HOH A O   1 
HETATM 2871 O O   . HOH C 2 .   ? 28.432  21.878  -35.549 1.00 31.31 ? 207 HOH A O   1 
HETATM 2872 O O   . HOH C 2 .   ? -2.965  64.787  -39.422 1.00 24.00 ? 208 HOH A O   1 
HETATM 2873 O O   . HOH C 2 .   ? 34.122  34.200  -31.791 1.00 23.16 ? 209 HOH A O   1 
HETATM 2874 O O   . HOH C 2 .   ? 1.937   69.190  -36.366 1.00 37.88 ? 210 HOH A O   1 
HETATM 2875 O O   . HOH C 2 .   ? 13.192  36.260  -25.382 1.00 23.35 ? 211 HOH A O   1 
HETATM 2876 O O   . HOH C 2 .   ? 35.010  31.248  -35.437 1.00 27.41 ? 212 HOH A O   1 
HETATM 2877 O O   . HOH C 2 .   ? 5.092   52.936  -18.058 1.00 34.64 ? 213 HOH A O   1 
HETATM 2878 O O   . HOH C 2 .   ? -14.350 87.157  -13.039 1.00 46.65 ? 214 HOH A O   1 
HETATM 2879 O O   . HOH C 2 .   ? 36.473  22.469  -32.588 1.00 28.57 ? 215 HOH A O   1 
HETATM 2880 O O   . HOH C 2 .   ? 0.029   59.278  -28.240 1.00 24.68 ? 216 HOH A O   1 
HETATM 2881 O O   . HOH C 2 .   ? -12.034 79.441  -24.953 1.00 44.10 ? 217 HOH A O   1 
HETATM 2882 O O   . HOH C 2 .   ? -1.865  85.180  -20.207 1.00 38.63 ? 218 HOH A O   1 
HETATM 2883 O O   . HOH C 2 .   ? 18.106  51.889  -27.424 1.00 27.75 ? 219 HOH A O   1 
HETATM 2884 O O   . HOH C 2 .   ? 30.649  24.051  -19.680 1.00 26.12 ? 220 HOH A O   1 
HETATM 2885 O O   . HOH C 2 .   ? 2.091   60.660  -16.296 1.00 29.49 ? 221 HOH A O   1 
HETATM 2886 O O   . HOH C 2 .   ? -20.283 102.689 -19.969 1.00 57.57 ? 222 HOH A O   1 
HETATM 2887 O O   . HOH C 2 .   ? -5.766  61.894  -25.912 1.00 33.66 ? 223 HOH A O   1 
HETATM 2888 O O   . HOH C 2 .   ? 34.211  21.758  -32.832 1.00 26.02 ? 224 HOH A O   1 
HETATM 2889 O O   . HOH C 2 .   ? 1.310   78.179  -17.666 1.00 40.06 ? 225 HOH A O   1 
HETATM 2890 O O   . HOH C 2 .   ? 13.429  35.981  -34.238 1.00 32.00 ? 226 HOH A O   1 
HETATM 2891 O O   . HOH C 2 .   ? 34.026  14.861  -35.050 1.00 41.04 ? 227 HOH A O   1 
HETATM 2892 O O   . HOH C 2 .   ? 9.538   65.407  -28.146 1.00 24.83 ? 228 HOH A O   1 
HETATM 2893 O O   . HOH C 2 .   ? 30.362  12.680  -25.331 1.00 42.84 ? 229 HOH A O   1 
HETATM 2894 O O   . HOH C 2 .   ? 13.050  62.053  -23.378 1.00 27.24 ? 230 HOH A O   1 
HETATM 2895 O O   . HOH C 2 .   ? 37.608  30.365  -36.345 1.00 23.55 ? 231 HOH A O   1 
HETATM 2896 O O   . HOH C 2 .   ? 4.518   63.523  -29.947 1.00 27.34 ? 232 HOH A O   1 
HETATM 2897 O O   . HOH C 2 .   ? 22.587  25.950  -19.567 1.00 30.30 ? 233 HOH A O   1 
HETATM 2898 O O   . HOH C 2 .   ? 0.972   75.524  -19.475 1.00 39.51 ? 234 HOH A O   1 
HETATM 2899 O O   . HOH C 2 .   ? 18.420  53.672  -25.286 1.00 31.43 ? 235 HOH A O   1 
HETATM 2900 O O   . HOH C 2 .   ? 0.095   49.842  -25.199 1.00 30.38 ? 236 HOH A O   1 
HETATM 2901 O O   . HOH C 2 .   ? -7.624  70.267  -31.918 1.00 29.25 ? 237 HOH A O   1 
HETATM 2902 O O   . HOH C 2 .   ? 27.638  43.030  -34.382 1.00 30.54 ? 238 HOH A O   1 
HETATM 2903 O O   . HOH C 2 .   ? 2.984   63.187  -17.482 1.00 38.11 ? 239 HOH A O   1 
HETATM 2904 O O   . HOH C 2 .   ? 25.452  46.618  -25.184 1.00 35.31 ? 240 HOH A O   1 
HETATM 2905 O O   . HOH C 2 .   ? 20.176  38.315  -35.741 1.00 38.67 ? 241 HOH A O   1 
HETATM 2906 O O   . HOH C 2 .   ? 24.811  29.182  -20.725 1.00 28.19 ? 242 HOH A O   1 
HETATM 2907 O O   . HOH C 2 .   ? -3.285  59.118  -19.830 1.00 33.37 ? 243 HOH A O   1 
HETATM 2908 O O   . HOH C 2 .   ? 16.346  49.340  -16.189 1.00 24.37 ? 244 HOH A O   1 
HETATM 2909 O O   . HOH C 2 .   ? 2.289   79.902  -24.431 1.00 40.12 ? 245 HOH A O   1 
HETATM 2910 O O   . HOH C 2 .   ? 12.963  56.720  -19.123 1.00 35.54 ? 246 HOH A O   1 
HETATM 2911 O O   . HOH C 2 .   ? 8.404   44.182  -22.674 1.00 32.00 ? 247 HOH A O   1 
HETATM 2912 O O   . HOH C 2 .   ? 12.763  37.410  -31.779 1.00 33.74 ? 248 HOH A O   1 
HETATM 2913 O O   . HOH C 2 .   ? -5.014  80.722  -16.995 1.00 46.68 ? 249 HOH A O   1 
HETATM 2914 O O   . HOH C 2 .   ? 14.876  44.766  -16.929 1.00 26.36 ? 250 HOH A O   1 
HETATM 2915 O O   . HOH C 2 .   ? 25.675  19.418  -26.365 1.00 33.82 ? 251 HOH A O   1 
HETATM 2916 O O   . HOH C 2 .   ? 7.503   74.450  -28.952 1.00 46.66 ? 252 HOH A O   1 
HETATM 2917 O O   . HOH C 2 .   ? 14.579  58.730  -21.158 1.00 14.96 ? 253 HOH A O   1 
HETATM 2918 O O   . HOH C 2 .   ? 13.407  39.160  -33.913 1.00 29.18 ? 254 HOH A O   1 
HETATM 2919 O O   . HOH C 2 .   ? 4.922   47.045  -25.566 1.00 23.79 ? 255 HOH A O   1 
HETATM 2920 O O   . HOH C 2 .   ? 9.888   59.148  -32.574 1.00 31.19 ? 256 HOH A O   1 
HETATM 2921 O O   . HOH C 2 .   ? 16.700  44.723  -34.240 1.00 26.03 ? 257 HOH A O   1 
HETATM 2922 O O   . HOH C 2 .   ? 12.914  45.274  -17.851 1.00 31.41 ? 258 HOH A O   1 
HETATM 2923 O O   . HOH C 2 .   ? 21.547  54.062  -21.494 1.00 33.29 ? 259 HOH A O   1 
HETATM 2924 O O   . HOH C 2 .   ? 23.703  48.258  -35.293 1.00 33.05 ? 260 HOH A O   1 
HETATM 2925 O O   . HOH C 2 .   ? 25.030  49.854  -34.452 1.00 29.11 ? 261 HOH A O   1 
HETATM 2926 O O   . HOH C 2 .   ? 21.704  54.572  -24.098 1.00 37.43 ? 262 HOH A O   1 
HETATM 2927 O O   . HOH C 2 .   ? 19.336  38.422  -15.348 1.00 29.96 ? 263 HOH A O   1 
HETATM 2928 O O   . HOH C 2 .   ? 16.621  28.457  -23.887 1.00 28.61 ? 264 HOH A O   1 
HETATM 2929 O O   . HOH C 2 .   ? 17.032  28.851  -27.902 1.00 29.93 ? 265 HOH A O   1 
HETATM 2930 O O   . HOH C 2 .   ? 2.520   73.241  -20.547 1.00 37.51 ? 266 HOH A O   1 
HETATM 2931 O O   . HOH C 2 .   ? -6.268  59.618  -24.684 1.00 28.93 ? 267 HOH A O   1 
HETATM 2932 O O   . HOH C 2 .   ? 16.809  46.183  -31.777 1.00 27.35 ? 268 HOH A O   1 
HETATM 2933 O O   . HOH C 2 .   ? 21.100  25.278  -35.626 1.00 38.01 ? 269 HOH A O   1 
HETATM 2934 O O   . HOH C 2 .   ? 16.637  29.754  -21.021 1.00 30.77 ? 270 HOH A O   1 
HETATM 2935 O O   . HOH C 2 .   ? 19.711  27.453  -35.850 1.00 25.30 ? 271 HOH A O   1 
HETATM 2936 O O   . HOH C 2 .   ? 16.040  29.519  -30.590 1.00 37.78 ? 272 HOH A O   1 
HETATM 2937 O O   . HOH C 2 .   ? 10.314  43.716  -27.688 1.00 23.94 ? 273 HOH A O   1 
HETATM 2938 O O   . HOH C 2 .   ? 26.155  29.881  -17.359 1.00 27.70 ? 274 HOH A O   1 
HETATM 2939 O O   . HOH C 2 .   ? 14.795  45.743  -30.017 1.00 31.63 ? 275 HOH A O   1 
HETATM 2940 O O   . HOH C 2 .   ? 6.362   44.561  -24.880 1.00 32.75 ? 276 HOH A O   1 
HETATM 2941 O O   . HOH C 2 .   ? 11.169  47.052  -18.409 1.00 35.83 ? 277 HOH A O   1 
HETATM 2942 O O   . HOH C 2 .   ? 11.989  35.403  -27.617 1.00 36.02 ? 278 HOH A O   1 
HETATM 2943 O O   . HOH C 2 .   ? 38.844  32.499  -23.556 1.00 38.09 ? 279 HOH A O   1 
HETATM 2944 O O   . HOH C 2 .   ? 42.075  23.891  -31.727 1.00 37.08 ? 280 HOH A O   1 
HETATM 2945 O O   . HOH C 2 .   ? -18.613 90.619  -6.085  1.00 55.67 ? 281 HOH A O   1 
HETATM 2946 O O   . HOH C 2 .   ? -6.763  64.631  -23.518 1.00 40.00 ? 282 HOH A O   1 
HETATM 2947 O O   . HOH C 2 .   ? 20.335  18.572  -31.599 1.00 37.72 ? 283 HOH A O   1 
HETATM 2948 O O   . HOH C 2 .   ? -11.445 80.403  -20.613 1.00 52.63 ? 284 HOH A O   1 
HETATM 2949 O O   . HOH C 2 .   ? -11.083 95.003  -27.598 1.00 51.29 ? 285 HOH A O   1 
HETATM 2950 O O   . HOH C 2 .   ? 14.470  31.082  -25.154 1.00 38.67 ? 286 HOH A O   1 
HETATM 2951 O O   . HOH C 2 .   ? 14.034  48.059  -17.309 1.00 19.25 ? 287 HOH A O   1 
HETATM 2952 O O   . HOH C 2 .   ? 41.556  16.353  -29.584 1.00 10.73 ? 288 HOH A O   1 
HETATM 2953 O O   . HOH C 2 .   ? 25.865  25.494  -19.195 1.00 15.18 ? 289 HOH A O   1 
HETATM 2954 O O   . HOH C 2 .   ? 8.678   59.868  -18.970 1.00 32.34 ? 290 HOH A O   1 
HETATM 2955 O O   . HOH C 2 .   ? 8.752   61.222  -17.062 1.00 32.49 ? 291 HOH A O   1 
HETATM 2956 O O   . HOH D 2 .   ? -3.829  28.222  -15.227 1.00 30.65 ? 201 HOH B O   1 
HETATM 2957 O O   . HOH D 2 .   ? -3.780  39.713  -10.360 1.00 37.89 ? 202 HOH B O   1 
HETATM 2958 O O   . HOH D 2 .   ? -4.104  28.077  -8.154  1.00 37.47 ? 203 HOH B O   1 
HETATM 2959 O O   . HOH D 2 .   ? 2.950   21.835  -21.655 1.00 28.33 ? 204 HOH B O   1 
HETATM 2960 O O   . HOH D 2 .   ? 3.462   42.941  -11.817 1.00 33.50 ? 205 HOH B O   1 
HETATM 2961 O O   . HOH D 2 .   ? 5.944   45.437  -17.328 1.00 33.61 ? 206 HOH B O   1 
HETATM 2962 O O   . HOH D 2 .   ? 7.338   29.566  -6.529  1.00 36.86 ? 207 HOH B O   1 
HETATM 2963 O O   . HOH D 2 .   ? -1.665  26.931  -5.640  1.00 37.37 ? 208 HOH B O   1 
HETATM 2964 O O   . HOH D 2 .   ? -5.467  21.279  -8.392  1.00 36.12 ? 209 HOH B O   1 
HETATM 2965 O O   . HOH D 2 .   ? -3.857  31.999  -9.347  1.00 34.43 ? 210 HOH B O   1 
HETATM 2966 O O   . HOH D 2 .   ? 2.889   38.385  -26.282 1.00 27.47 ? 211 HOH B O   1 
HETATM 2967 O O   . HOH D 2 .   ? 18.510  -30.224 2.954   1.00 38.87 ? 212 HOH B O   1 
HETATM 2968 O O   . HOH D 2 .   ? -5.251  36.243  -18.819 1.00 29.14 ? 213 HOH B O   1 
HETATM 2969 O O   . HOH D 2 .   ? 0.618   44.014  -7.476  1.00 35.16 ? 214 HOH B O   1 
HETATM 2970 O O   . HOH D 2 .   ? 22.511  -27.786 -1.834  1.00 47.87 ? 215 HOH B O   1 
HETATM 2971 O O   . HOH D 2 .   ? 3.408   45.531  -10.238 1.00 38.60 ? 216 HOH B O   1 
HETATM 2972 O O   . HOH D 2 .   ? 17.569  -4.545  -7.106  1.00 45.53 ? 217 HOH B O   1 
HETATM 2973 O O   . HOH D 2 .   ? 5.966   45.377  -21.863 1.00 26.86 ? 218 HOH B O   1 
HETATM 2974 O O   . HOH D 2 .   ? -1.927  31.792  -7.257  1.00 32.77 ? 219 HOH B O   1 
HETATM 2975 O O   . HOH D 2 .   ? 10.305  -20.467 -3.175  1.00 44.60 ? 220 HOH B O   1 
HETATM 2976 O O   . HOH D 2 .   ? 11.073  37.800  -11.504 1.00 31.45 ? 221 HOH B O   1 
HETATM 2977 O O   . HOH D 2 .   ? -5.930  42.948  -18.953 1.00 29.38 ? 222 HOH B O   1 
HETATM 2978 O O   . HOH D 2 .   ? 19.276  -27.822 0.053   1.00 43.49 ? 223 HOH B O   1 
HETATM 2979 O O   . HOH D 2 .   ? -3.327  52.469  -16.865 1.00 27.39 ? 224 HOH B O   1 
HETATM 2980 O O   . HOH D 2 .   ? 2.351   37.560  -7.737  1.00 29.60 ? 225 HOH B O   1 
HETATM 2981 O O   . HOH D 2 .   ? 18.474  -24.601 1.581   1.00 44.05 ? 226 HOH B O   1 
HETATM 2982 O O   . HOH D 2 .   ? -5.052  51.251  -14.136 1.00 34.84 ? 227 HOH B O   1 
HETATM 2983 O O   . HOH D 2 .   ? 10.708  35.649  -20.699 1.00 29.86 ? 228 HOH B O   1 
HETATM 2984 O O   . HOH D 2 .   ? -8.123  46.251  -12.818 1.00 39.55 ? 229 HOH B O   1 
HETATM 2985 O O   . HOH D 2 .   ? 7.129   49.625  -18.275 1.00 30.83 ? 230 HOH B O   1 
HETATM 2986 O O   . HOH D 2 .   ? 20.780  -33.758 -13.819 1.00 48.32 ? 231 HOH B O   1 
HETATM 2987 O O   . HOH D 2 .   ? 17.263  -37.519 -13.912 1.00 48.05 ? 232 HOH B O   1 
HETATM 2988 O O   . HOH D 2 .   ? -6.251  32.159  -16.028 1.00 21.80 ? 233 HOH B O   1 
HETATM 2989 O O   . HOH D 2 .   ? 4.696   33.259  -24.790 1.00 29.02 ? 234 HOH B O   1 
HETATM 2990 O O   . HOH D 2 .   ? 4.660   11.739  -5.568  1.00 37.03 ? 235 HOH B O   1 
HETATM 2991 O O   . HOH D 2 .   ? -0.153  18.492  -7.004  1.00 37.99 ? 236 HOH B O   1 
HETATM 2992 O O   . HOH D 2 .   ? 27.963  -24.595 5.992   1.00 41.15 ? 237 HOH B O   1 
HETATM 2993 O O   . HOH D 2 .   ? 11.845  24.202  -20.787 1.00 44.98 ? 238 HOH B O   1 
HETATM 2994 O O   . HOH D 2 .   ? 4.088   3.213   -16.954 1.00 41.65 ? 239 HOH B O   1 
HETATM 2995 O O   . HOH D 2 .   ? 8.064   51.545  -19.364 1.00 33.55 ? 240 HOH B O   1 
HETATM 2996 O O   . HOH D 2 .   ? 5.200   0.833   -1.693  1.00 49.66 ? 241 HOH B O   1 
HETATM 2997 O O   . HOH D 2 .   ? 15.124  -22.367 0.933   1.00 42.09 ? 242 HOH B O   1 
HETATM 2998 O O   . HOH D 2 .   ? 8.043   12.641  -5.219  1.00 42.95 ? 243 HOH B O   1 
HETATM 2999 O O   . HOH D 2 .   ? 16.838  -22.010 -15.017 1.00 50.11 ? 244 HOH B O   1 
HETATM 3000 O O   . HOH D 2 .   ? -1.220  14.477  -9.992  1.00 36.51 ? 245 HOH B O   1 
HETATM 3001 O O   . HOH D 2 .   ? 4.431   44.372  -13.820 1.00 28.89 ? 246 HOH B O   1 
HETATM 3002 O O   . HOH D 2 .   ? 5.517   35.743  -25.547 1.00 34.25 ? 247 HOH B O   1 
HETATM 3003 O O   . HOH D 2 .   ? 20.100  -6.012  -4.758  1.00 43.57 ? 248 HOH B O   1 
HETATM 3004 O O   . HOH D 2 .   ? -5.890  44.583  -21.130 1.00 32.74 ? 249 HOH B O   1 
HETATM 3005 O O   . HOH D 2 .   ? 26.088  -25.287 8.044   1.00 36.28 ? 250 HOH B O   1 
HETATM 3006 O O   . HOH D 2 .   ? 10.154  30.375  -7.573  1.00 47.78 ? 251 HOH B O   1 
HETATM 3007 O O   . HOH D 2 .   ? 11.765  44.406  -14.018 1.00 32.37 ? 252 HOH B O   1 
HETATM 3008 O O   . HOH D 2 .   ? 12.478  15.906  -8.852  1.00 38.69 ? 253 HOH B O   1 
HETATM 3009 O O   . HOH D 2 .   ? 7.862   33.223  -7.987  1.00 32.04 ? 254 HOH B O   1 
HETATM 3010 O O   . HOH D 2 .   ? 27.472  -31.688 -5.922  1.00 29.84 ? 255 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   0   0   MET MET A . n 
A 1 2   GLN 2   1   1   GLN GLN A . n 
A 1 3   THR 3   2   2   THR THR A . n 
A 1 4   ALA 4   3   3   ALA ALA A . n 
A 1 5   TYR 5   4   4   TYR TYR A . n 
A 1 6   VAL 6   5   5   VAL VAL A . n 
A 1 7   LYS 7   6   6   LYS LYS A . n 
A 1 8   TYR 8   7   7   TYR TYR A . n 
A 1 9   VAL 9   8   8   VAL VAL A . n 
A 1 10  ASP 10  9   9   ASP ASP A . n 
A 1 11  ASP 11  10  10  ASP ASP A . n 
A 1 12  THR 12  11  11  THR THR A . n 
A 1 13  THR 13  12  12  THR THR A . n 
A 1 14  GLY 14  13  13  GLY GLY A . n 
A 1 15  GLU 15  14  14  GLU GLU A . n 
A 1 16  THR 16  15  15  THR THR A . n 
A 1 17  LEU 17  16  16  LEU LEU A . n 
A 1 18  ARG 18  17  17  ARG ARG A . n 
A 1 19  GLN 19  18  18  GLN GLN A . n 
A 1 20  ASP 20  19  19  ASP ASP A . n 
A 1 21  ASP 21  20  20  ASP ASP A . n 
A 1 22  LEU 22  21  21  LEU LEU A . n 
A 1 23  HIS 23  22  22  HIS HIS A . n 
A 1 24  GLY 24  23  23  GLY GLY A . n 
A 1 25  TYR 25  24  24  TYR TYR A . n 
A 1 26  THR 26  25  25  THR THR A . n 
A 1 27  ASP 27  26  26  ASP ASP A . n 
A 1 28  GLU 28  27  27  GLU GLU A . n 
A 1 29  THR 29  28  28  THR THR A . n 
A 1 30  ILE 30  29  29  ILE ILE A . n 
A 1 31  PRO 31  30  30  PRO PRO A . n 
A 1 32  TYR 32  31  31  TYR TYR A . n 
A 1 33  SER 33  32  32  SER SER A . n 
A 1 34  THR 34  33  33  THR THR A . n 
A 1 35  ALA 35  34  34  ALA ALA A . n 
A 1 36  GLU 36  35  35  GLU GLU A . n 
A 1 37  GLY 37  36  36  GLY GLY A . n 
A 1 38  ILE 38  37  37  ILE ILE A . n 
A 1 39  LYS 39  38  38  LYS LYS A . n 
A 1 40  LYS 40  39  39  LYS LYS A . n 
A 1 41  TYR 41  40  40  TYR TYR A . n 
A 1 42  GLU 42  41  41  GLU GLU A . n 
A 1 43  GLY 43  42  42  GLY GLY A . n 
A 1 44  ASP 44  43  43  ASP ASP A . n 
A 1 45  GLY 45  44  44  GLY GLY A . n 
A 1 46  TYR 46  45  45  TYR TYR A . n 
A 1 47  VAL 47  46  46  VAL VAL A . n 
A 1 48  LEU 48  47  47  LEU LEU A . n 
A 1 49  VAL 49  48  48  VAL VAL A . n 
A 1 50  SER 50  49  49  SER SER A . n 
A 1 51  ASP 51  50  50  ASP ASP A . n 
A 1 52  GLY 52  51  51  GLY GLY A . n 
A 1 53  PHE 53  52  52  PHE PHE A . n 
A 1 54  LYS 54  53  53  LYS LYS A . n 
A 1 55  PRO 55  54  54  PRO PRO A . n 
A 1 56  GLY 56  55  55  GLY GLY A . n 
A 1 57  THR 57  56  56  THR THR A . n 
A 1 58  LYS 58  57  57  LYS LYS A . n 
A 1 59  PHE 59  58  58  PHE PHE A . n 
A 1 60  GLY 60  59  59  GLY GLY A . n 
A 1 61  VAL 61  60  60  VAL VAL A . n 
A 1 62  GLY 62  61  61  GLY GLY A . n 
A 1 63  THR 63  62  62  THR THR A . n 
A 1 64  PRO 64  63  63  PRO PRO A . n 
A 1 65  THR 65  64  64  THR THR A . n 
A 1 66  TYR 66  65  65  TYR TYR A . n 
A 1 67  GLU 67  66  66  GLU GLU A . n 
A 1 68  VAL 68  67  67  VAL VAL A . n 
A 1 69  HIS 69  68  68  HIS HIS A . n 
A 1 70  PHE 70  69  69  PHE PHE A . n 
A 1 71  LYS 71  70  70  LYS LYS A . n 
A 1 72  HIS 72  71  71  HIS HIS A . n 
A 1 73  GLY 73  72  72  GLY GLY A . n 
A 1 74  MET 74  73  73  MET MET A . n 
A 1 75  THR 75  74  74  THR THR A . n 
A 1 76  HIS 76  75  75  HIS HIS A . n 
A 1 77  THR 77  76  76  THR THR A . n 
A 1 78  ASP 78  77  77  ASP ASP A . n 
A 1 79  ALA 79  78  78  ALA ALA A . n 
A 1 80  THR 80  79  79  THR THR A . n 
A 1 81  ASP 81  80  80  ASP ASP A . n 
A 1 82  LYS 82  81  81  LYS LYS A . n 
A 1 83  ASN 83  82  82  ASN ASN A . n 
A 1 84  ALA 84  83  83  ALA ALA A . n 
A 1 85  GLU 85  84  84  GLU GLU A . n 
A 1 86  GLN 86  85  85  GLN GLN A . n 
A 1 87  LYS 87  86  86  LYS LYS A . n 
A 1 88  THR 88  87  87  THR THR A . n 
A 1 89  VAL 89  88  88  VAL VAL A . n 
A 1 90  THR 90  89  89  THR THR A . n 
A 1 91  GLU 91  90  90  GLU GLU A . n 
A 1 92  THR 92  91  91  THR THR A . n 
A 1 93  ILE 93  92  92  ILE ILE A . n 
A 1 94  HIS 94  93  93  HIS HIS A . n 
A 1 95  TYR 95  94  94  TYR TYR A . n 
A 1 96  VAL 96  95  95  VAL VAL A . n 
A 1 97  ASP 97  96  96  ASP ASP A . n 
A 1 98  GLU 98  97  97  GLU GLU A . n 
A 1 99  ASN 99  98  98  ASN ASN A . n 
A 1 100 ASN 100 99  99  ASN ASN A . n 
A 1 101 GLN 101 100 100 GLN GLN A . n 
A 1 102 THR 102 101 101 THR THR A . n 
A 1 103 VAL 103 102 102 VAL VAL A . n 
A 1 104 GLN 104 103 103 GLN GLN A . n 
A 1 105 PRO 105 104 104 PRO PRO A . n 
A 1 106 ASP 106 105 105 ASP ASP A . n 
A 1 107 SER 107 106 106 SER SER A . n 
A 1 108 THR 108 107 107 THR THR A . n 
A 1 109 THR 109 108 108 THR THR A . n 
A 1 110 ALA 110 109 109 ALA ALA A . n 
A 1 111 VAL 111 110 110 VAL VAL A . n 
A 1 112 THR 112 111 111 THR THR A . n 
A 1 113 PHE 113 112 112 PHE PHE A . n 
A 1 114 LYS 114 113 113 LYS LYS A . n 
A 1 115 ARG 115 114 114 ARG ARG A . n 
A 1 116 GLY 116 115 115 GLY GLY A . n 
A 1 117 TYR 117 116 116 TYR TYR A . n 
A 1 118 THR 118 117 117 THR THR A . n 
A 1 119 THR 119 118 118 THR THR A . n 
A 1 120 ASP 120 119 119 ASP ASP A . n 
A 1 121 ASN 121 120 120 ASN ASN A . n 
A 1 122 VAL 122 121 121 VAL VAL A . n 
A 1 123 THR 123 122 122 THR THR A . n 
A 1 124 GLY 124 123 123 GLY GLY A . n 
A 1 125 LYS 125 124 124 LYS LYS A . n 
A 1 126 VAL 126 125 125 VAL VAL A . n 
A 1 127 VAL 127 126 126 VAL VAL A . n 
A 1 128 SER 128 127 127 SER SER A . n 
A 1 129 TYR 129 128 128 TYR TYR A . n 
A 1 130 ASP 130 129 129 ASP ASP A . n 
A 1 131 PRO 131 130 130 PRO PRO A . n 
A 1 132 TRP 132 131 131 TRP TRP A . n 
A 1 133 THR 133 132 132 THR THR A . n 
A 1 134 VAL 134 133 133 VAL VAL A . n 
A 1 135 ASP 135 134 134 ASP ASP A . n 
A 1 136 GLY 136 135 135 GLY GLY A . n 
A 1 137 ASN 137 136 136 ASN ASN A . n 
A 1 138 GLN 138 137 137 GLN GLN A . n 
A 1 139 ALA 139 138 138 ALA ALA A . n 
A 1 140 ASP 140 139 139 ASP ASP A . n 
A 1 141 SER 141 140 140 SER SER A . n 
A 1 142 LYS 142 141 141 LYS LYS A . n 
A 1 143 THR 143 142 142 THR THR A . n 
A 1 144 PHE 144 143 143 PHE PHE A . n 
A 1 145 ALA 145 144 144 ALA ALA A . n 
A 1 146 ALA 146 145 145 ALA ALA A . n 
A 1 147 VAL 147 146 146 VAL VAL A . n 
A 1 148 PRO 148 147 147 PRO PRO A . n 
A 1 149 SER 149 148 148 SER SER A . n 
A 1 150 PRO 150 149 149 PRO PRO A . n 
A 1 151 ALA 151 150 150 ALA ALA A . n 
A 1 152 VAL 152 151 151 VAL VAL A . n 
A 1 153 GLU 153 152 152 GLU GLU A . n 
A 1 154 GLY 154 153 153 GLY GLY A . n 
A 1 155 TYR 155 154 154 TYR TYR A . n 
A 1 156 THR 156 155 155 THR THR A . n 
A 1 157 PRO 157 156 156 PRO PRO A . n 
A 1 158 ASN 158 157 157 ASN ASN A . n 
A 1 159 HIS 159 158 158 HIS HIS A . n 
A 1 160 GLN 160 159 159 GLN GLN A . n 
A 1 161 GLN 161 160 160 GLN GLN A . n 
A 1 162 ILE 162 161 161 ILE ILE A . n 
A 1 163 ASN 163 162 162 ASN ASN A . n 
A 1 164 GLU 164 163 163 GLU GLU A . n 
A 1 165 PHE 165 164 164 PHE PHE A . n 
A 1 166 THR 166 165 165 THR THR A . n 
A 1 167 VAL 167 166 166 VAL VAL A . n 
A 1 168 THR 168 167 167 THR THR A . n 
A 1 169 PRO 169 168 168 PRO PRO A . n 
A 1 170 ASP 170 169 169 ASP ASP A . n 
A 1 171 SER 171 170 170 SER SER A . n 
A 1 172 LYS 172 171 171 LYS LYS A . n 
A 1 173 ASP 173 172 172 ASP ASP A . n 
A 1 174 ILE 174 173 173 ILE ILE A . n 
A 1 175 VAL 175 174 174 VAL VAL A . n 
A 1 176 LYS 176 175 175 LYS LYS A . n 
A 1 177 THR 177 176 176 THR THR A . n 
A 1 178 VAL 178 177 177 VAL VAL A . n 
A 1 179 VAL 179 178 178 VAL VAL A . n 
A 1 180 TYR 180 179 179 TYR TYR A . n 
A 1 181 VAL 181 180 180 VAL VAL A . n 
A 1 182 GLY 182 181 181 GLY GLY A . n 
A 1 183 ASP 183 182 182 ASP ASP A . n 
A 1 184 PRO 184 183 183 PRO PRO A . n 
B 1 1   MET 1   0   0   MET MET B . n 
B 1 2   GLN 2   1   1   GLN GLN B . n 
B 1 3   THR 3   2   2   THR THR B . n 
B 1 4   ALA 4   3   3   ALA ALA B . n 
B 1 5   TYR 5   4   4   TYR TYR B . n 
B 1 6   VAL 6   5   5   VAL VAL B . n 
B 1 7   LYS 7   6   6   LYS LYS B . n 
B 1 8   TYR 8   7   7   TYR TYR B . n 
B 1 9   VAL 9   8   8   VAL VAL B . n 
B 1 10  ASP 10  9   9   ASP ASP B . n 
B 1 11  ASP 11  10  10  ASP ASP B . n 
B 1 12  THR 12  11  11  THR THR B . n 
B 1 13  THR 13  12  12  THR THR B . n 
B 1 14  GLY 14  13  13  GLY GLY B . n 
B 1 15  GLU 15  14  14  GLU GLU B . n 
B 1 16  THR 16  15  15  THR THR B . n 
B 1 17  LEU 17  16  16  LEU LEU B . n 
B 1 18  ARG 18  17  17  ARG ARG B . n 
B 1 19  GLN 19  18  18  GLN GLN B . n 
B 1 20  ASP 20  19  19  ASP ASP B . n 
B 1 21  ASP 21  20  20  ASP ASP B . n 
B 1 22  LEU 22  21  21  LEU LEU B . n 
B 1 23  HIS 23  22  22  HIS HIS B . n 
B 1 24  GLY 24  23  23  GLY GLY B . n 
B 1 25  TYR 25  24  24  TYR TYR B . n 
B 1 26  THR 26  25  25  THR THR B . n 
B 1 27  ASP 27  26  26  ASP ASP B . n 
B 1 28  GLU 28  27  27  GLU GLU B . n 
B 1 29  THR 29  28  28  THR THR B . n 
B 1 30  ILE 30  29  29  ILE ILE B . n 
B 1 31  PRO 31  30  30  PRO PRO B . n 
B 1 32  TYR 32  31  31  TYR TYR B . n 
B 1 33  SER 33  32  32  SER SER B . n 
B 1 34  THR 34  33  33  THR THR B . n 
B 1 35  ALA 35  34  34  ALA ALA B . n 
B 1 36  GLU 36  35  35  GLU GLU B . n 
B 1 37  GLY 37  36  36  GLY GLY B . n 
B 1 38  ILE 38  37  37  ILE ILE B . n 
B 1 39  LYS 39  38  38  LYS LYS B . n 
B 1 40  LYS 40  39  39  LYS LYS B . n 
B 1 41  TYR 41  40  40  TYR TYR B . n 
B 1 42  GLU 42  41  41  GLU GLU B . n 
B 1 43  GLY 43  42  42  GLY GLY B . n 
B 1 44  ASP 44  43  43  ASP ASP B . n 
B 1 45  GLY 45  44  44  GLY GLY B . n 
B 1 46  TYR 46  45  45  TYR TYR B . n 
B 1 47  VAL 47  46  46  VAL VAL B . n 
B 1 48  LEU 48  47  47  LEU LEU B . n 
B 1 49  VAL 49  48  48  VAL VAL B . n 
B 1 50  SER 50  49  49  SER SER B . n 
B 1 51  ASP 51  50  50  ASP ASP B . n 
B 1 52  GLY 52  51  51  GLY GLY B . n 
B 1 53  PHE 53  52  52  PHE PHE B . n 
B 1 54  LYS 54  53  53  LYS LYS B . n 
B 1 55  PRO 55  54  54  PRO PRO B . n 
B 1 56  GLY 56  55  55  GLY GLY B . n 
B 1 57  THR 57  56  56  THR THR B . n 
B 1 58  LYS 58  57  57  LYS LYS B . n 
B 1 59  PHE 59  58  58  PHE PHE B . n 
B 1 60  GLY 60  59  59  GLY GLY B . n 
B 1 61  VAL 61  60  60  VAL VAL B . n 
B 1 62  GLY 62  61  61  GLY GLY B . n 
B 1 63  THR 63  62  62  THR THR B . n 
B 1 64  PRO 64  63  63  PRO PRO B . n 
B 1 65  THR 65  64  64  THR THR B . n 
B 1 66  TYR 66  65  65  TYR TYR B . n 
B 1 67  GLU 67  66  66  GLU GLU B . n 
B 1 68  VAL 68  67  67  VAL VAL B . n 
B 1 69  HIS 69  68  68  HIS HIS B . n 
B 1 70  PHE 70  69  69  PHE PHE B . n 
B 1 71  LYS 71  70  70  LYS LYS B . n 
B 1 72  HIS 72  71  71  HIS HIS B . n 
B 1 73  GLY 73  72  72  GLY GLY B . n 
B 1 74  MET 74  73  73  MET MET B . n 
B 1 75  THR 75  74  74  THR THR B . n 
B 1 76  HIS 76  75  75  HIS HIS B . n 
B 1 77  THR 77  76  76  THR THR B . n 
B 1 78  ASP 78  77  77  ASP ASP B . n 
B 1 79  ALA 79  78  78  ALA ALA B . n 
B 1 80  THR 80  79  79  THR THR B . n 
B 1 81  ASP 81  80  80  ASP ASP B . n 
B 1 82  LYS 82  81  81  LYS LYS B . n 
B 1 83  ASN 83  82  82  ASN ASN B . n 
B 1 84  ALA 84  83  83  ALA ALA B . n 
B 1 85  GLU 85  84  84  GLU GLU B . n 
B 1 86  GLN 86  85  85  GLN GLN B . n 
B 1 87  LYS 87  86  86  LYS LYS B . n 
B 1 88  THR 88  87  87  THR THR B . n 
B 1 89  VAL 89  88  88  VAL VAL B . n 
B 1 90  THR 90  89  89  THR THR B . n 
B 1 91  GLU 91  90  90  GLU GLU B . n 
B 1 92  THR 92  91  91  THR THR B . n 
B 1 93  ILE 93  92  92  ILE ILE B . n 
B 1 94  HIS 94  93  93  HIS HIS B . n 
B 1 95  TYR 95  94  94  TYR TYR B . n 
B 1 96  VAL 96  95  95  VAL VAL B . n 
B 1 97  ASP 97  96  96  ASP ASP B . n 
B 1 98  GLU 98  97  97  GLU GLU B . n 
B 1 99  ASN 99  98  98  ASN ASN B . n 
B 1 100 ASN 100 99  99  ASN ASN B . n 
B 1 101 GLN 101 100 100 GLN GLN B . n 
B 1 102 THR 102 101 101 THR THR B . n 
B 1 103 VAL 103 102 102 VAL VAL B . n 
B 1 104 GLN 104 103 103 GLN GLN B . n 
B 1 105 PRO 105 104 104 PRO PRO B . n 
B 1 106 ASP 106 105 105 ASP ASP B . n 
B 1 107 SER 107 106 106 SER SER B . n 
B 1 108 THR 108 107 107 THR THR B . n 
B 1 109 THR 109 108 108 THR THR B . n 
B 1 110 ALA 110 109 109 ALA ALA B . n 
B 1 111 VAL 111 110 110 VAL VAL B . n 
B 1 112 THR 112 111 111 THR THR B . n 
B 1 113 PHE 113 112 112 PHE PHE B . n 
B 1 114 LYS 114 113 113 LYS LYS B . n 
B 1 115 ARG 115 114 114 ARG ARG B . n 
B 1 116 GLY 116 115 115 GLY GLY B . n 
B 1 117 TYR 117 116 116 TYR TYR B . n 
B 1 118 THR 118 117 117 THR THR B . n 
B 1 119 THR 119 118 118 THR THR B . n 
B 1 120 ASP 120 119 119 ASP ASP B . n 
B 1 121 ASN 121 120 120 ASN ASN B . n 
B 1 122 VAL 122 121 121 VAL VAL B . n 
B 1 123 THR 123 122 122 THR THR B . n 
B 1 124 GLY 124 123 123 GLY GLY B . n 
B 1 125 LYS 125 124 124 LYS LYS B . n 
B 1 126 VAL 126 125 125 VAL VAL B . n 
B 1 127 VAL 127 126 126 VAL VAL B . n 
B 1 128 SER 128 127 127 SER SER B . n 
B 1 129 TYR 129 128 128 TYR TYR B . n 
B 1 130 ASP 130 129 129 ASP ASP B . n 
B 1 131 PRO 131 130 130 PRO PRO B . n 
B 1 132 TRP 132 131 131 TRP TRP B . n 
B 1 133 THR 133 132 132 THR THR B . n 
B 1 134 VAL 134 133 133 VAL VAL B . n 
B 1 135 ASP 135 134 134 ASP ASP B . n 
B 1 136 GLY 136 135 135 GLY GLY B . n 
B 1 137 ASN 137 136 136 ASN ASN B . n 
B 1 138 GLN 138 137 137 GLN GLN B . n 
B 1 139 ALA 139 138 138 ALA ALA B . n 
B 1 140 ASP 140 139 139 ASP ASP B . n 
B 1 141 SER 141 140 140 SER SER B . n 
B 1 142 LYS 142 141 141 LYS LYS B . n 
B 1 143 THR 143 142 142 THR THR B . n 
B 1 144 PHE 144 143 143 PHE PHE B . n 
B 1 145 ALA 145 144 144 ALA ALA B . n 
B 1 146 ALA 146 145 145 ALA ALA B . n 
B 1 147 VAL 147 146 146 VAL VAL B . n 
B 1 148 PRO 148 147 147 PRO PRO B . n 
B 1 149 SER 149 148 148 SER SER B . n 
B 1 150 PRO 150 149 149 PRO PRO B . n 
B 1 151 ALA 151 150 150 ALA ALA B . n 
B 1 152 VAL 152 151 151 VAL VAL B . n 
B 1 153 GLU 153 152 152 GLU GLU B . n 
B 1 154 GLY 154 153 153 GLY GLY B . n 
B 1 155 TYR 155 154 154 TYR TYR B . n 
B 1 156 THR 156 155 155 THR THR B . n 
B 1 157 PRO 157 156 156 PRO PRO B . n 
B 1 158 ASN 158 157 157 ASN ASN B . n 
B 1 159 HIS 159 158 158 HIS HIS B . n 
B 1 160 GLN 160 159 159 GLN GLN B . n 
B 1 161 GLN 161 160 160 GLN GLN B . n 
B 1 162 ILE 162 161 161 ILE ILE B . n 
B 1 163 ASN 163 162 162 ASN ASN B . n 
B 1 164 GLU 164 163 163 GLU GLU B . n 
B 1 165 PHE 165 164 164 PHE PHE B . n 
B 1 166 THR 166 165 165 THR THR B . n 
B 1 167 VAL 167 166 166 VAL VAL B . n 
B 1 168 THR 168 167 167 THR THR B . n 
B 1 169 PRO 169 168 168 PRO PRO B . n 
B 1 170 ASP 170 169 169 ASP ASP B . n 
B 1 171 SER 171 170 170 SER SER B . n 
B 1 172 LYS 172 171 171 LYS LYS B . n 
B 1 173 ASP 173 172 172 ASP ASP B . n 
B 1 174 ILE 174 173 173 ILE ILE B . n 
B 1 175 VAL 175 174 174 VAL VAL B . n 
B 1 176 LYS 176 175 175 LYS LYS B . n 
B 1 177 THR 177 176 176 THR THR B . n 
B 1 178 VAL 178 177 177 VAL VAL B . n 
B 1 179 VAL 179 178 178 VAL VAL B . n 
B 1 180 TYR 180 179 179 TYR TYR B . n 
B 1 181 VAL 181 180 180 VAL VAL B . n 
B 1 182 GLY 182 181 181 GLY GLY B . n 
B 1 183 ASP 183 182 182 ASP ASP B . n 
B 1 184 PRO 184 183 183 PRO PRO B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  201 1   HOH HOH A . 
C 2 HOH 2  202 3   HOH HOH A . 
C 2 HOH 3  203 5   HOH HOH A . 
C 2 HOH 4  204 6   HOH HOH A . 
C 2 HOH 5  205 7   HOH HOH A . 
C 2 HOH 6  206 10  HOH HOH A . 
C 2 HOH 7  207 11  HOH HOH A . 
C 2 HOH 8  208 12  HOH HOH A . 
C 2 HOH 9  209 14  HOH HOH A . 
C 2 HOH 10 210 15  HOH HOH A . 
C 2 HOH 11 211 18  HOH HOH A . 
C 2 HOH 12 212 20  HOH HOH A . 
C 2 HOH 13 213 21  HOH HOH A . 
C 2 HOH 14 214 22  HOH HOH A . 
C 2 HOH 15 215 23  HOH HOH A . 
C 2 HOH 16 216 25  HOH HOH A . 
C 2 HOH 17 217 27  HOH HOH A . 
C 2 HOH 18 218 28  HOH HOH A . 
C 2 HOH 19 219 29  HOH HOH A . 
C 2 HOH 20 220 32  HOH HOH A . 
C 2 HOH 21 221 36  HOH HOH A . 
C 2 HOH 22 222 38  HOH HOH A . 
C 2 HOH 23 223 40  HOH HOH A . 
C 2 HOH 24 224 41  HOH HOH A . 
C 2 HOH 25 225 42  HOH HOH A . 
C 2 HOH 26 226 43  HOH HOH A . 
C 2 HOH 27 227 45  HOH HOH A . 
C 2 HOH 28 228 46  HOH HOH A . 
C 2 HOH 29 229 47  HOH HOH A . 
C 2 HOH 30 230 48  HOH HOH A . 
C 2 HOH 31 231 49  HOH HOH A . 
C 2 HOH 32 232 50  HOH HOH A . 
C 2 HOH 33 233 51  HOH HOH A . 
C 2 HOH 34 234 52  HOH HOH A . 
C 2 HOH 35 235 54  HOH HOH A . 
C 2 HOH 36 236 56  HOH HOH A . 
C 2 HOH 37 237 57  HOH HOH A . 
C 2 HOH 38 238 60  HOH HOH A . 
C 2 HOH 39 239 65  HOH HOH A . 
C 2 HOH 40 240 66  HOH HOH A . 
C 2 HOH 41 241 67  HOH HOH A . 
C 2 HOH 42 242 68  HOH HOH A . 
C 2 HOH 43 243 70  HOH HOH A . 
C 2 HOH 44 244 71  HOH HOH A . 
C 2 HOH 45 245 77  HOH HOH A . 
C 2 HOH 46 246 79  HOH HOH A . 
C 2 HOH 47 247 80  HOH HOH A . 
C 2 HOH 48 248 81  HOH HOH A . 
C 2 HOH 49 249 82  HOH HOH A . 
C 2 HOH 50 250 83  HOH HOH A . 
C 2 HOH 51 251 85  HOH HOH A . 
C 2 HOH 52 252 88  HOH HOH A . 
C 2 HOH 53 253 91  HOH HOH A . 
C 2 HOH 54 254 94  HOH HOH A . 
C 2 HOH 55 255 95  HOH HOH A . 
C 2 HOH 56 256 96  HOH HOH A . 
C 2 HOH 57 257 99  HOH HOH A . 
C 2 HOH 58 258 100 HOH HOH A . 
C 2 HOH 59 259 101 HOH HOH A . 
C 2 HOH 60 260 104 HOH HOH A . 
C 2 HOH 61 261 105 HOH HOH A . 
C 2 HOH 62 262 111 HOH HOH A . 
C 2 HOH 63 263 112 HOH HOH A . 
C 2 HOH 64 264 113 HOH HOH A . 
C 2 HOH 65 265 115 HOH HOH A . 
C 2 HOH 66 266 116 HOH HOH A . 
C 2 HOH 67 267 117 HOH HOH A . 
C 2 HOH 68 268 121 HOH HOH A . 
C 2 HOH 69 269 122 HOH HOH A . 
C 2 HOH 70 270 123 HOH HOH A . 
C 2 HOH 71 271 126 HOH HOH A . 
C 2 HOH 72 272 128 HOH HOH A . 
C 2 HOH 73 273 132 HOH HOH A . 
C 2 HOH 74 274 134 HOH HOH A . 
C 2 HOH 75 275 136 HOH HOH A . 
C 2 HOH 76 276 138 HOH HOH A . 
C 2 HOH 77 277 141 HOH HOH A . 
C 2 HOH 78 278 143 HOH HOH A . 
C 2 HOH 79 279 145 HOH HOH A . 
C 2 HOH 80 280 146 HOH HOH A . 
C 2 HOH 81 281 149 HOH HOH A . 
C 2 HOH 82 282 150 HOH HOH A . 
C 2 HOH 83 283 151 HOH HOH A . 
C 2 HOH 84 284 152 HOH HOH A . 
C 2 HOH 85 285 154 HOH HOH A . 
C 2 HOH 86 286 155 HOH HOH A . 
C 2 HOH 87 287 156 HOH HOH A . 
C 2 HOH 88 288 157 HOH HOH A . 
C 2 HOH 89 289 158 HOH HOH A . 
C 2 HOH 90 290 159 HOH HOH A . 
C 2 HOH 91 291 162 HOH HOH A . 
D 2 HOH 1  201 2   HOH HOH B . 
D 2 HOH 2  202 4   HOH HOH B . 
D 2 HOH 3  203 8   HOH HOH B . 
D 2 HOH 4  204 9   HOH HOH B . 
D 2 HOH 5  205 13  HOH HOH B . 
D 2 HOH 6  206 17  HOH HOH B . 
D 2 HOH 7  207 19  HOH HOH B . 
D 2 HOH 8  208 24  HOH HOH B . 
D 2 HOH 9  209 26  HOH HOH B . 
D 2 HOH 10 210 30  HOH HOH B . 
D 2 HOH 11 211 31  HOH HOH B . 
D 2 HOH 12 212 33  HOH HOH B . 
D 2 HOH 13 213 34  HOH HOH B . 
D 2 HOH 14 214 37  HOH HOH B . 
D 2 HOH 15 215 39  HOH HOH B . 
D 2 HOH 16 216 44  HOH HOH B . 
D 2 HOH 17 217 53  HOH HOH B . 
D 2 HOH 18 218 55  HOH HOH B . 
D 2 HOH 19 219 58  HOH HOH B . 
D 2 HOH 20 220 62  HOH HOH B . 
D 2 HOH 21 221 63  HOH HOH B . 
D 2 HOH 22 222 64  HOH HOH B . 
D 2 HOH 23 223 69  HOH HOH B . 
D 2 HOH 24 224 72  HOH HOH B . 
D 2 HOH 25 225 73  HOH HOH B . 
D 2 HOH 26 226 74  HOH HOH B . 
D 2 HOH 27 227 75  HOH HOH B . 
D 2 HOH 28 228 76  HOH HOH B . 
D 2 HOH 29 229 78  HOH HOH B . 
D 2 HOH 30 230 84  HOH HOH B . 
D 2 HOH 31 231 86  HOH HOH B . 
D 2 HOH 32 232 87  HOH HOH B . 
D 2 HOH 33 233 89  HOH HOH B . 
D 2 HOH 34 234 97  HOH HOH B . 
D 2 HOH 35 235 98  HOH HOH B . 
D 2 HOH 36 236 102 HOH HOH B . 
D 2 HOH 37 237 103 HOH HOH B . 
D 2 HOH 38 238 107 HOH HOH B . 
D 2 HOH 39 239 108 HOH HOH B . 
D 2 HOH 40 240 110 HOH HOH B . 
D 2 HOH 41 241 114 HOH HOH B . 
D 2 HOH 42 242 119 HOH HOH B . 
D 2 HOH 43 243 124 HOH HOH B . 
D 2 HOH 44 244 125 HOH HOH B . 
D 2 HOH 45 245 127 HOH HOH B . 
D 2 HOH 46 246 131 HOH HOH B . 
D 2 HOH 47 247 135 HOH HOH B . 
D 2 HOH 48 248 137 HOH HOH B . 
D 2 HOH 49 249 139 HOH HOH B . 
D 2 HOH 50 250 142 HOH HOH B . 
D 2 HOH 51 251 144 HOH HOH B . 
D 2 HOH 52 252 147 HOH HOH B . 
D 2 HOH 53 253 148 HOH HOH B . 
D 2 HOH 54 254 160 HOH HOH B . 
D 2 HOH 55 255 161 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C 
2 1 B,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-08-06 
2 'Structure model' 1 1 2017-08-23 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Data collection' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    2 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            diffrn_detector 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    2 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_diffrn_detector.detector' 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 SCALA       3.3.20   2011/05/18       other   'Phil R. Evans' pre@mrc-lmb.cam.ac.uk    'data scaling'    
http://www.ccp4.ac.uk/dist/html/scala.html Fortran_77 ? 
2 PHENIX      1.8_1069 ?                package 'Paul D. Adams' PDAdams@lbl.gov          refinement        
http://www.phenix-online.org/              C++        ? 
3 PDB_EXTRACT 3.11     'April 22, 2011' package PDB             deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/  C++        ? 
4 DNA         .        ?                ?       ?               ?                        'data collection' ? ?          ? 
5 XDS         .        ?                ?       ?               ?                        'data reduction'  ? ?          ? 
6 PHASER      .        ?                ?       ?               ?                        phasing           ? ?          ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   GLY 
_pdbx_validate_close_contact.auth_seq_id_1    61 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    206 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 26  ? ? 88.33   5.56    
2 1 VAL A 95  ? ? -124.05 -162.73 
3 1 ASP A 96  ? ? -133.29 -153.53 
4 1 ASN A 162 ? ? -61.24  -176.00 
5 1 SER A 170 ? ? -49.03  153.55  
6 1 LYS B 81  ? ? -55.62  -0.24   
7 1 ASP B 96  ? ? -107.90 -167.84 
8 1 SER B 140 ? ? -171.78 146.55  
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#