data_4MZ7
# 
_entry.id   4MZ7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4MZ7         
RCSB  RCSB082550   
WWPDB D_1000082550 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4MZ7 
_pdbx_database_status.recvd_initial_deposition_date   2013-09-29 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhu, C.'   1  
'Gao, W.'   2  
'Zhao, K.'  3  
'Qin, X.'   4  
'Zhang, Y.' 5  
'Peng, X.'  6  
'Zhang, L.' 7  
'Dong, Y.'  8  
'Zhang, W.' 9  
'Li, P.'    10 
'Wei, W.'   11 
'Gong, Y.'  12 
'Yu, X.F.'  13 
# 
_citation.id                        primary 
_citation.title                     
'Structural insight into dGTP-dependent activation of tetrameric SAMHD1 deoxynucleoside triphosphate triphosphohydrolase' 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_volume            4 
_citation.page_first                2722 
_citation.page_last                 2722 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24217394 
_citation.pdbx_database_id_DOI      10.1038/ncomms3722 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhu, C.'   1  
primary 'Gao, W.'   2  
primary 'Zhao, K.'  3  
primary 'Qin, X.'   4  
primary 'Zhang, Y.' 5  
primary 'Peng, X.'  6  
primary 'Zhang, L.' 7  
primary 'Dong, Y.'  8  
primary 'Zhang, W.' 9  
primary 'Li, P.'    10 
primary 'Wei, W.'   11 
primary 'Gong, Y.'  12 
primary 'Yu, X.F.'  13 
# 
_cell.entry_id           4MZ7 
_cell.length_a           147.404 
_cell.length_b           103.608 
_cell.length_c           92.134 
_cell.angle_alpha        90.00 
_cell.angle_beta         121.98 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4MZ7 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Deoxynucleoside triphosphate triphosphohydrolase SAMHD1' 62486.184 2   3.1.5.- C266Y 'UNP residues 109-626' ? 
2 non-polymer syn 'ZINC ION'                                                65.409    2   ?       ?     ?                      ? 
3 non-polymer syn "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE"                       507.181   5   ?       ?     ?                      ? 
4 non-polymer syn 'MAGNESIUM ION'                                           24.305    2   ?       ?     ?                      ? 
5 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   1   ?       ?     ?                      ? 
6 water       nat water                                                     18.015    819 ?       ?     ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;dNTPase, Dendritic cell-derived IFNG-induced protein, DCIP, Monocyte protein 5, MOP-5, SAM domain and HD domain-containing protein 1
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGENLYFQGSQIHVDTMKVINDPIHGHIELHPLLVRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEH
SLGVGYLAGCLVHALGEKQPELQISERDVLCVQIAGLCHDLGHGPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINS
NGIKPVMEQYGLIPEEDIYFIKEQIVGPLESPVEDSLWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQN
NFDYKRFIKFARVCEVDNELRICARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGGKKY
RISTAIDDMEAYTKLTDNIFLEILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKREDYESLPKEVASAKPKV
LLDVKLKAEDFIVDVINMDYGMQEKNPIDHVSFYCKTAPNRAIRITKNQVSQLLPEKFAEQLIRVYCKKVDRKSLYAARQ
YFVQWCADRNFTKPQDGDVIAPLITPQKKEWNDSTSVQNPTRLREASKSRVQLFKDDPM
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGENLYFQGSQIHVDTMKVINDPIHGHIELHPLLVRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEH
SLGVGYLAGCLVHALGEKQPELQISERDVLCVQIAGLCHDLGHGPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINS
NGIKPVMEQYGLIPEEDIYFIKEQIVGPLESPVEDSLWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQN
NFDYKRFIKFARVCEVDNELRICARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGGKKY
RISTAIDDMEAYTKLTDNIFLEILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKREDYESLPKEVASAKPKV
LLDVKLKAEDFIVDVINMDYGMQEKNPIDHVSFYCKTAPNRAIRITKNQVSQLLPEKFAEQLIRVYCKKVDRKSLYAARQ
YFVQWCADRNFTKPQDGDVIAPLITPQKKEWNDSTSVQNPTRLREASKSRVQLFKDDPM
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  GLU n 
1 15  ASN n 
1 16  LEU n 
1 17  TYR n 
1 18  PHE n 
1 19  GLN n 
1 20  GLY n 
1 21  SER n 
1 22  GLN n 
1 23  ILE n 
1 24  HIS n 
1 25  VAL n 
1 26  ASP n 
1 27  THR n 
1 28  MET n 
1 29  LYS n 
1 30  VAL n 
1 31  ILE n 
1 32  ASN n 
1 33  ASP n 
1 34  PRO n 
1 35  ILE n 
1 36  HIS n 
1 37  GLY n 
1 38  HIS n 
1 39  ILE n 
1 40  GLU n 
1 41  LEU n 
1 42  HIS n 
1 43  PRO n 
1 44  LEU n 
1 45  LEU n 
1 46  VAL n 
1 47  ARG n 
1 48  ILE n 
1 49  ILE n 
1 50  ASP n 
1 51  THR n 
1 52  PRO n 
1 53  GLN n 
1 54  PHE n 
1 55  GLN n 
1 56  ARG n 
1 57  LEU n 
1 58  ARG n 
1 59  TYR n 
1 60  ILE n 
1 61  LYS n 
1 62  GLN n 
1 63  LEU n 
1 64  GLY n 
1 65  GLY n 
1 66  GLY n 
1 67  TYR n 
1 68  TYR n 
1 69  VAL n 
1 70  PHE n 
1 71  PRO n 
1 72  GLY n 
1 73  ALA n 
1 74  SER n 
1 75  HIS n 
1 76  ASN n 
1 77  ARG n 
1 78  PHE n 
1 79  GLU n 
1 80  HIS n 
1 81  SER n 
1 82  LEU n 
1 83  GLY n 
1 84  VAL n 
1 85  GLY n 
1 86  TYR n 
1 87  LEU n 
1 88  ALA n 
1 89  GLY n 
1 90  CYS n 
1 91  LEU n 
1 92  VAL n 
1 93  HIS n 
1 94  ALA n 
1 95  LEU n 
1 96  GLY n 
1 97  GLU n 
1 98  LYS n 
1 99  GLN n 
1 100 PRO n 
1 101 GLU n 
1 102 LEU n 
1 103 GLN n 
1 104 ILE n 
1 105 SER n 
1 106 GLU n 
1 107 ARG n 
1 108 ASP n 
1 109 VAL n 
1 110 LEU n 
1 111 CYS n 
1 112 VAL n 
1 113 GLN n 
1 114 ILE n 
1 115 ALA n 
1 116 GLY n 
1 117 LEU n 
1 118 CYS n 
1 119 HIS n 
1 120 ASP n 
1 121 LEU n 
1 122 GLY n 
1 123 HIS n 
1 124 GLY n 
1 125 PRO n 
1 126 PHE n 
1 127 SER n 
1 128 HIS n 
1 129 MET n 
1 130 PHE n 
1 131 ASP n 
1 132 GLY n 
1 133 ARG n 
1 134 PHE n 
1 135 ILE n 
1 136 PRO n 
1 137 LEU n 
1 138 ALA n 
1 139 ARG n 
1 140 PRO n 
1 141 GLU n 
1 142 VAL n 
1 143 LYS n 
1 144 TRP n 
1 145 THR n 
1 146 HIS n 
1 147 GLU n 
1 148 GLN n 
1 149 GLY n 
1 150 SER n 
1 151 VAL n 
1 152 MET n 
1 153 MET n 
1 154 PHE n 
1 155 GLU n 
1 156 HIS n 
1 157 LEU n 
1 158 ILE n 
1 159 ASN n 
1 160 SER n 
1 161 ASN n 
1 162 GLY n 
1 163 ILE n 
1 164 LYS n 
1 165 PRO n 
1 166 VAL n 
1 167 MET n 
1 168 GLU n 
1 169 GLN n 
1 170 TYR n 
1 171 GLY n 
1 172 LEU n 
1 173 ILE n 
1 174 PRO n 
1 175 GLU n 
1 176 GLU n 
1 177 ASP n 
1 178 ILE n 
1 179 TYR n 
1 180 PHE n 
1 181 ILE n 
1 182 LYS n 
1 183 GLU n 
1 184 GLN n 
1 185 ILE n 
1 186 VAL n 
1 187 GLY n 
1 188 PRO n 
1 189 LEU n 
1 190 GLU n 
1 191 SER n 
1 192 PRO n 
1 193 VAL n 
1 194 GLU n 
1 195 ASP n 
1 196 SER n 
1 197 LEU n 
1 198 TRP n 
1 199 PRO n 
1 200 TYR n 
1 201 LYS n 
1 202 GLY n 
1 203 ARG n 
1 204 PRO n 
1 205 GLU n 
1 206 ASN n 
1 207 LYS n 
1 208 SER n 
1 209 PHE n 
1 210 LEU n 
1 211 TYR n 
1 212 GLU n 
1 213 ILE n 
1 214 VAL n 
1 215 SER n 
1 216 ASN n 
1 217 LYS n 
1 218 ARG n 
1 219 ASN n 
1 220 GLY n 
1 221 ILE n 
1 222 ASP n 
1 223 VAL n 
1 224 ASP n 
1 225 LYS n 
1 226 TRP n 
1 227 ASP n 
1 228 TYR n 
1 229 PHE n 
1 230 ALA n 
1 231 ARG n 
1 232 ASP n 
1 233 CYS n 
1 234 HIS n 
1 235 HIS n 
1 236 LEU n 
1 237 GLY n 
1 238 ILE n 
1 239 GLN n 
1 240 ASN n 
1 241 ASN n 
1 242 PHE n 
1 243 ASP n 
1 244 TYR n 
1 245 LYS n 
1 246 ARG n 
1 247 PHE n 
1 248 ILE n 
1 249 LYS n 
1 250 PHE n 
1 251 ALA n 
1 252 ARG n 
1 253 VAL n 
1 254 CYS n 
1 255 GLU n 
1 256 VAL n 
1 257 ASP n 
1 258 ASN n 
1 259 GLU n 
1 260 LEU n 
1 261 ARG n 
1 262 ILE n 
1 263 CYS n 
1 264 ALA n 
1 265 ARG n 
1 266 ASP n 
1 267 LYS n 
1 268 GLU n 
1 269 VAL n 
1 270 GLY n 
1 271 ASN n 
1 272 LEU n 
1 273 TYR n 
1 274 ASP n 
1 275 MET n 
1 276 PHE n 
1 277 HIS n 
1 278 THR n 
1 279 ARG n 
1 280 ASN n 
1 281 SER n 
1 282 LEU n 
1 283 HIS n 
1 284 ARG n 
1 285 ARG n 
1 286 ALA n 
1 287 TYR n 
1 288 GLN n 
1 289 HIS n 
1 290 LYS n 
1 291 VAL n 
1 292 GLY n 
1 293 ASN n 
1 294 ILE n 
1 295 ILE n 
1 296 ASP n 
1 297 THR n 
1 298 MET n 
1 299 ILE n 
1 300 THR n 
1 301 ASP n 
1 302 ALA n 
1 303 PHE n 
1 304 LEU n 
1 305 LYS n 
1 306 ALA n 
1 307 ASP n 
1 308 ASP n 
1 309 TYR n 
1 310 ILE n 
1 311 GLU n 
1 312 ILE n 
1 313 THR n 
1 314 GLY n 
1 315 ALA n 
1 316 GLY n 
1 317 GLY n 
1 318 LYS n 
1 319 LYS n 
1 320 TYR n 
1 321 ARG n 
1 322 ILE n 
1 323 SER n 
1 324 THR n 
1 325 ALA n 
1 326 ILE n 
1 327 ASP n 
1 328 ASP n 
1 329 MET n 
1 330 GLU n 
1 331 ALA n 
1 332 TYR n 
1 333 THR n 
1 334 LYS n 
1 335 LEU n 
1 336 THR n 
1 337 ASP n 
1 338 ASN n 
1 339 ILE n 
1 340 PHE n 
1 341 LEU n 
1 342 GLU n 
1 343 ILE n 
1 344 LEU n 
1 345 TYR n 
1 346 SER n 
1 347 THR n 
1 348 ASP n 
1 349 PRO n 
1 350 LYS n 
1 351 LEU n 
1 352 LYS n 
1 353 ASP n 
1 354 ALA n 
1 355 ARG n 
1 356 GLU n 
1 357 ILE n 
1 358 LEU n 
1 359 LYS n 
1 360 GLN n 
1 361 ILE n 
1 362 GLU n 
1 363 TYR n 
1 364 ARG n 
1 365 ASN n 
1 366 LEU n 
1 367 PHE n 
1 368 LYS n 
1 369 TYR n 
1 370 VAL n 
1 371 GLY n 
1 372 GLU n 
1 373 THR n 
1 374 GLN n 
1 375 PRO n 
1 376 THR n 
1 377 GLY n 
1 378 GLN n 
1 379 ILE n 
1 380 LYS n 
1 381 ILE n 
1 382 LYS n 
1 383 ARG n 
1 384 GLU n 
1 385 ASP n 
1 386 TYR n 
1 387 GLU n 
1 388 SER n 
1 389 LEU n 
1 390 PRO n 
1 391 LYS n 
1 392 GLU n 
1 393 VAL n 
1 394 ALA n 
1 395 SER n 
1 396 ALA n 
1 397 LYS n 
1 398 PRO n 
1 399 LYS n 
1 400 VAL n 
1 401 LEU n 
1 402 LEU n 
1 403 ASP n 
1 404 VAL n 
1 405 LYS n 
1 406 LEU n 
1 407 LYS n 
1 408 ALA n 
1 409 GLU n 
1 410 ASP n 
1 411 PHE n 
1 412 ILE n 
1 413 VAL n 
1 414 ASP n 
1 415 VAL n 
1 416 ILE n 
1 417 ASN n 
1 418 MET n 
1 419 ASP n 
1 420 TYR n 
1 421 GLY n 
1 422 MET n 
1 423 GLN n 
1 424 GLU n 
1 425 LYS n 
1 426 ASN n 
1 427 PRO n 
1 428 ILE n 
1 429 ASP n 
1 430 HIS n 
1 431 VAL n 
1 432 SER n 
1 433 PHE n 
1 434 TYR n 
1 435 CYS n 
1 436 LYS n 
1 437 THR n 
1 438 ALA n 
1 439 PRO n 
1 440 ASN n 
1 441 ARG n 
1 442 ALA n 
1 443 ILE n 
1 444 ARG n 
1 445 ILE n 
1 446 THR n 
1 447 LYS n 
1 448 ASN n 
1 449 GLN n 
1 450 VAL n 
1 451 SER n 
1 452 GLN n 
1 453 LEU n 
1 454 LEU n 
1 455 PRO n 
1 456 GLU n 
1 457 LYS n 
1 458 PHE n 
1 459 ALA n 
1 460 GLU n 
1 461 GLN n 
1 462 LEU n 
1 463 ILE n 
1 464 ARG n 
1 465 VAL n 
1 466 TYR n 
1 467 CYS n 
1 468 LYS n 
1 469 LYS n 
1 470 VAL n 
1 471 ASP n 
1 472 ARG n 
1 473 LYS n 
1 474 SER n 
1 475 LEU n 
1 476 TYR n 
1 477 ALA n 
1 478 ALA n 
1 479 ARG n 
1 480 GLN n 
1 481 TYR n 
1 482 PHE n 
1 483 VAL n 
1 484 GLN n 
1 485 TRP n 
1 486 CYS n 
1 487 ALA n 
1 488 ASP n 
1 489 ARG n 
1 490 ASN n 
1 491 PHE n 
1 492 THR n 
1 493 LYS n 
1 494 PRO n 
1 495 GLN n 
1 496 ASP n 
1 497 GLY n 
1 498 ASP n 
1 499 VAL n 
1 500 ILE n 
1 501 ALA n 
1 502 PRO n 
1 503 LEU n 
1 504 ILE n 
1 505 THR n 
1 506 PRO n 
1 507 GLN n 
1 508 LYS n 
1 509 LYS n 
1 510 GLU n 
1 511 TRP n 
1 512 ASN n 
1 513 ASP n 
1 514 SER n 
1 515 THR n 
1 516 SER n 
1 517 VAL n 
1 518 GLN n 
1 519 ASN n 
1 520 PRO n 
1 521 THR n 
1 522 ARG n 
1 523 LEU n 
1 524 ARG n 
1 525 GLU n 
1 526 ALA n 
1 527 SER n 
1 528 LYS n 
1 529 SER n 
1 530 ARG n 
1 531 VAL n 
1 532 GLN n 
1 533 LEU n 
1 534 PHE n 
1 535 LYS n 
1 536 ASP n 
1 537 ASP n 
1 538 PRO n 
1 539 MET n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'SAMHD1, MOP5' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SAMH1_HUMAN 
_struct_ref.pdbx_db_accession          Q9Y3Z3 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;QIHVDTMKVINDPIHGHIELHPLLVRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVHALGEKQPE
LQISERDVLCVQIAGLCHDLGHGPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGIKPVMEQYGLIPEEDICFI
KEQIVGPLESPVEDSLWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKFARVCEVDNELR
ICARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGGKKYRISTAIDDMEAYTKLTDNIFL
EILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKREDYESLPKEVASAKPKVLLDVKLKAEDFIVDVINMDYG
MQEKNPIDHVSFYCKTAPNRAIRITKNQVSQLLPEKFAEQLIRVYCKKVDRKSLYAARQYFVQWCADRNFTKPQDGDVIA
PLITPQKKEWNDSTSVQNPTRLREASKSRVQLFKDDPM
;
_struct_ref.pdbx_align_begin           109 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4MZ7 A 22 ? 539 ? Q9Y3Z3 109 ? 626 ? 109 626 
2 1 4MZ7 B 22 ? 539 ? Q9Y3Z3 109 ? 626 ? 109 626 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4MZ7 MET A 1   ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      88  1  
1 4MZ7 GLY A 2   ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      89  2  
1 4MZ7 SER A 3   ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      90  3  
1 4MZ7 SER A 4   ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      91  4  
1 4MZ7 HIS A 5   ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      92  5  
1 4MZ7 HIS A 6   ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      93  6  
1 4MZ7 HIS A 7   ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      94  7  
1 4MZ7 HIS A 8   ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      95  8  
1 4MZ7 HIS A 9   ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      96  9  
1 4MZ7 HIS A 10  ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      97  10 
1 4MZ7 SER A 11  ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      98  11 
1 4MZ7 SER A 12  ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      99  12 
1 4MZ7 GLY A 13  ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      100 13 
1 4MZ7 GLU A 14  ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      101 14 
1 4MZ7 ASN A 15  ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      102 15 
1 4MZ7 LEU A 16  ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      103 16 
1 4MZ7 TYR A 17  ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      104 17 
1 4MZ7 PHE A 18  ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      105 18 
1 4MZ7 GLN A 19  ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      106 19 
1 4MZ7 GLY A 20  ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      107 20 
1 4MZ7 SER A 21  ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      108 21 
1 4MZ7 TYR A 179 ? UNP Q9Y3Z3 CYS 266 'ENGINEERED MUTATION' 266 22 
2 4MZ7 MET B 1   ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      88  23 
2 4MZ7 GLY B 2   ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      89  24 
2 4MZ7 SER B 3   ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      90  25 
2 4MZ7 SER B 4   ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      91  26 
2 4MZ7 HIS B 5   ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      92  27 
2 4MZ7 HIS B 6   ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      93  28 
2 4MZ7 HIS B 7   ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      94  29 
2 4MZ7 HIS B 8   ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      95  30 
2 4MZ7 HIS B 9   ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      96  31 
2 4MZ7 HIS B 10  ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      97  32 
2 4MZ7 SER B 11  ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      98  33 
2 4MZ7 SER B 12  ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      99  34 
2 4MZ7 GLY B 13  ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      100 35 
2 4MZ7 GLU B 14  ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      101 36 
2 4MZ7 ASN B 15  ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      102 37 
2 4MZ7 LEU B 16  ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      103 38 
2 4MZ7 TYR B 17  ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      104 39 
2 4MZ7 PHE B 18  ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      105 40 
2 4MZ7 GLN B 19  ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      106 41 
2 4MZ7 GLY B 20  ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      107 42 
2 4MZ7 SER B 21  ? UNP Q9Y3Z3 ?   ?   'EXPRESSION TAG'      108 43 
2 4MZ7 TYR B 179 ? UNP Q9Y3Z3 CYS 266 'ENGINEERED MUTATION' 266 44 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                             ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                            ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                          ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                     ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                            ? 'C3 H7 N O2 S'      121.158 
DGT non-polymer         . "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O13 P3' 507.181 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
? 'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                           ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                     ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                             ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                           ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                               ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                          ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                             ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                              ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                          ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                     ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                       ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                             ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                              ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                           ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                          ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                            ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                              ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                          ? 'Zn 2'              65.409  
# 
_exptl.entry_id          4MZ7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.39 
_exptl_crystal.density_percent_sol   48.48 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'0.1M MES (pH 6.5), 25%(w/v) polyethylene glycol monomethyle ether 550, VAPOR DIFFUSION, SITTING DROP, temperature 289K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 270' 
_diffrn_detector.pdbx_collection_date   2013-06-19 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Numerical link type Si(111) double crystal monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE BL-17A' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   BL-17A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.98 
# 
_reflns.entry_id                     4MZ7 
_reflns.observed_criterion_sigma_I   1.5 
_reflns.observed_criterion_sigma_F   1.5 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            1.8 
_reflns.number_obs                   108184 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.047 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        27.2 
_reflns.B_iso_Wilson_estimate        20.1 
_reflns.pdbx_redundancy              6.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  1.80 
_reflns_shell.d_res_low                   1.83 
_reflns_shell.percent_possible_all        100.0 
_reflns_shell.Rmerge_I_obs                0.617 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         2.4 
_reflns_shell.pdbx_redundancy             6.3 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4MZ7 
_refine.ls_number_reflns_obs                     100284 
_refine.ls_number_reflns_all                     103173 
_refine.pdbx_ls_sigma_I                          1.0 
_refine.pdbx_ls_sigma_F                          1.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.00 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    97.20 
_refine.ls_R_factor_obs                          0.19582 
_refine.ls_R_factor_all                          0.196 
_refine.ls_R_factor_R_work                       0.19425 
_refine.ls_R_factor_R_free                       0.22572 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  5289 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.948 
_refine.correlation_coeff_Fo_to_Fc_free          0.930 
_refine.B_iso_mean                               22.609 
_refine.aniso_B[1][1]                            0.09 
_refine.aniso_B[2][2]                            -0.09 
_refine.aniso_B[3][3]                            -0.26 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.24 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3U1N' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.135 
_refine.pdbx_overall_ESU_R_Free                  0.125 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7974 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         189 
_refine_hist.number_atoms_solvent             819 
_refine_hist.number_atoms_total               8982 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        50.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.009  0.020  ? 8403  ? 'X-RAY DIFFRACTION' 
r_bond_other_d               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.285  1.981  ? 11399 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       5.055  5.000  ? 978   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       38.734 23.995 ? 418   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       14.685 15.000 ? 1477  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       14.717 15.000 ? 54    ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.087  0.200  ? 1192  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.006  0.021  ? 6350  ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcbond_other               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcangle_other              ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_scbond_it                  ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_scbond_other               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_scangle_it                 ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_scangle_other              ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_long_range_B_refined       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_long_range_B_other         ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       1.8000 
_refine_ls_shell.d_res_low                        1.8470 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               71.7500 
_refine_ls_shell.number_reflns_R_work             5454 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2620 
_refine_ls_shell.R_factor_R_free                  0.2850 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             275 
_refine_ls_shell.R_factor_R_free_error            0.0000 
_refine_ls_shell.number_reflns_all                5729 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  4MZ7 
_struct.title                     
'Structural insight into dGTP-dependent activation of tetrameric SAMHD1 deoxynucleoside triphosphate triphosphohydrolase' 
_struct.pdbx_descriptor           'Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 (E.C.3.1.5.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4MZ7 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HD-domain, HYDROLASE, dNTP Binding, Phosphorylation' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 3 ? 
I N N 4 ? 
J N N 2 ? 
K N N 3 ? 
L N N 5 ? 
M N N 6 ? 
N N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  HIS A 42  ? ASP A 50  ? HIS A 129 ASP A 137 1 ? 9  
HELX_P HELX_P2  2  THR A 51  ? ARG A 56  ? THR A 138 ARG A 143 1 ? 6  
HELX_P HELX_P3  3  LEU A 57  ? ILE A 60  ? LEU A 144 ILE A 147 5 ? 4  
HELX_P HELX_P4  4  LEU A 63  ? VAL A 69  ? LEU A 150 VAL A 156 5 ? 7  
HELX_P HELX_P5  5  ASN A 76  ? GLN A 99  ? ASN A 163 GLN A 186 1 ? 24 
HELX_P HELX_P6  6  PRO A 100 ? GLN A 103 ? PRO A 187 GLN A 190 5 ? 4  
HELX_P HELX_P7  7  SER A 105 ? HIS A 119 ? SER A 192 HIS A 206 1 ? 15 
HELX_P HELX_P8  8  SER A 127 ? ARG A 133 ? SER A 214 ARG A 220 1 ? 7  
HELX_P HELX_P9  9  ARG A 133 ? ARG A 139 ? ARG A 220 ARG A 226 1 ? 7  
HELX_P HELX_P10 10 THR A 145 ? ASN A 161 ? THR A 232 ASN A 248 1 ? 17 
HELX_P HELX_P11 11 GLY A 162 ? TYR A 170 ? GLY A 249 TYR A 257 1 ? 9  
HELX_P HELX_P12 12 ILE A 173 ? GLY A 187 ? ILE A 260 GLY A 274 1 ? 15 
HELX_P HELX_P13 13 PRO A 204 ? ILE A 213 ? PRO A 291 ILE A 300 5 ? 10 
HELX_P HELX_P14 14 ASP A 222 ? GLY A 237 ? ASP A 309 GLY A 324 1 ? 16 
HELX_P HELX_P15 15 ASP A 243 ? PHE A 250 ? ASP A 330 PHE A 337 1 ? 8  
HELX_P HELX_P16 16 GLU A 268 ? ALA A 286 ? GLU A 355 ALA A 373 1 ? 19 
HELX_P HELX_P17 17 HIS A 289 ? ASP A 307 ? HIS A 376 ASP A 394 1 ? 19 
HELX_P HELX_P18 18 ALA A 315 ? GLY A 317 ? ALA A 402 GLY A 404 5 ? 3  
HELX_P HELX_P19 19 THR A 324 ? ASP A 327 ? THR A 411 ASP A 414 5 ? 4  
HELX_P HELX_P20 20 ASP A 328 ? THR A 333 ? ASP A 415 THR A 420 1 ? 6  
HELX_P HELX_P21 21 LYS A 334 ? THR A 336 ? LYS A 421 THR A 423 5 ? 3  
HELX_P HELX_P22 22 ASP A 337 ? SER A 346 ? ASP A 424 SER A 433 1 ? 10 
HELX_P HELX_P23 23 ASP A 348 ? LYS A 350 ? ASP A 435 LYS A 437 5 ? 3  
HELX_P HELX_P24 24 LEU A 351 ? TYR A 363 ? LEU A 438 TYR A 450 1 ? 13 
HELX_P HELX_P25 25 LYS A 382 ? GLU A 387 ? LYS A 469 GLU A 474 5 ? 6  
HELX_P HELX_P26 26 SER A 388 ? ALA A 396 ? SER A 475 ALA A 483 1 ? 9  
HELX_P HELX_P27 27 LYS A 407 ? GLU A 409 ? LYS A 494 GLU A 496 5 ? 3  
HELX_P HELX_P28 28 ASN A 426 ? VAL A 431 ? ASN A 513 VAL A 518 5 ? 6  
HELX_P HELX_P29 29 THR A 446 ? VAL A 450 ? THR A 533 VAL A 537 5 ? 5  
HELX_P HELX_P30 30 ASP A 471 ? ASN A 490 ? ASP A 558 ASN A 577 1 ? 20 
HELX_P HELX_P31 31 ASP A 496 ? ALA A 501 ? ASP A 583 ALA A 588 1 ? 6  
HELX_P HELX_P32 32 ILE A 504 ? LYS A 508 ? ILE A 591 LYS A 595 5 ? 5  
HELX_P HELX_P33 33 HIS B 42  ? ASP B 50  ? HIS B 129 ASP B 137 1 ? 9  
HELX_P HELX_P34 34 THR B 51  ? ARG B 56  ? THR B 138 ARG B 143 1 ? 6  
HELX_P HELX_P35 35 LEU B 57  ? ILE B 60  ? LEU B 144 ILE B 147 5 ? 4  
HELX_P HELX_P36 36 LEU B 63  ? VAL B 69  ? LEU B 150 VAL B 156 5 ? 7  
HELX_P HELX_P37 37 ASN B 76  ? GLN B 99  ? ASN B 163 GLN B 186 1 ? 24 
HELX_P HELX_P38 38 PRO B 100 ? GLN B 103 ? PRO B 187 GLN B 190 5 ? 4  
HELX_P HELX_P39 39 SER B 105 ? HIS B 119 ? SER B 192 HIS B 206 1 ? 15 
HELX_P HELX_P40 40 SER B 127 ? ARG B 133 ? SER B 214 ARG B 220 1 ? 7  
HELX_P HELX_P41 41 ARG B 133 ? ARG B 139 ? ARG B 220 ARG B 226 1 ? 7  
HELX_P HELX_P42 42 THR B 145 ? ASN B 161 ? THR B 232 ASN B 248 1 ? 17 
HELX_P HELX_P43 43 GLY B 162 ? TYR B 170 ? GLY B 249 TYR B 257 1 ? 9  
HELX_P HELX_P44 44 ILE B 173 ? GLY B 187 ? ILE B 260 GLY B 274 1 ? 15 
HELX_P HELX_P45 45 PRO B 204 ? ILE B 213 ? PRO B 291 ILE B 300 5 ? 10 
HELX_P HELX_P46 46 ASP B 222 ? GLY B 237 ? ASP B 309 GLY B 324 1 ? 16 
HELX_P HELX_P47 47 ASP B 243 ? PHE B 250 ? ASP B 330 PHE B 337 1 ? 8  
HELX_P HELX_P48 48 GLU B 268 ? ALA B 286 ? GLU B 355 ALA B 373 1 ? 19 
HELX_P HELX_P49 49 HIS B 289 ? ASP B 307 ? HIS B 376 ASP B 394 1 ? 19 
HELX_P HELX_P50 50 ALA B 315 ? GLY B 317 ? ALA B 402 GLY B 404 5 ? 3  
HELX_P HELX_P51 51 THR B 324 ? ASP B 327 ? THR B 411 ASP B 414 5 ? 4  
HELX_P HELX_P52 52 ASP B 328 ? THR B 333 ? ASP B 415 THR B 420 1 ? 6  
HELX_P HELX_P53 53 LYS B 334 ? THR B 336 ? LYS B 421 THR B 423 5 ? 3  
HELX_P HELX_P54 54 ASP B 337 ? SER B 346 ? ASP B 424 SER B 433 1 ? 10 
HELX_P HELX_P55 55 ASP B 348 ? LYS B 350 ? ASP B 435 LYS B 437 5 ? 3  
HELX_P HELX_P56 56 LEU B 351 ? TYR B 363 ? LEU B 438 TYR B 450 1 ? 13 
HELX_P HELX_P57 57 LYS B 382 ? GLU B 387 ? LYS B 469 GLU B 474 5 ? 6  
HELX_P HELX_P58 58 SER B 388 ? SER B 395 ? SER B 475 SER B 482 1 ? 8  
HELX_P HELX_P59 59 LYS B 407 ? GLU B 409 ? LYS B 494 GLU B 496 5 ? 3  
HELX_P HELX_P60 60 ASN B 426 ? VAL B 431 ? ASN B 513 VAL B 518 5 ? 6  
HELX_P HELX_P61 61 THR B 446 ? VAL B 450 ? THR B 533 VAL B 537 5 ? 5  
HELX_P HELX_P62 62 ASP B 471 ? ARG B 489 ? ASP B 558 ARG B 576 1 ? 19 
HELX_P HELX_P63 63 ASP B 496 ? ALA B 501 ? ASP B 583 ALA B 588 1 ? 6  
HELX_P HELX_P64 64 ILE B 504 ? ASN B 512 ? ILE B 591 ASN B 599 5 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 254 SG  ? ? ? 1_555 A CYS 263 SG  ? ? A CYS 341 A CYS 350  1_555 ? ? ? ? ? ? ? 2.075 ? 
disulf2  disulf ? ? B CYS 254 SG  ? ? ? 1_555 B CYS 263 SG  ? ? B CYS 341 B CYS 350  1_555 ? ? ? ? ? ? ? 2.070 ? 
metalc1  metalc ? ? H DGT .   O2G ? ? ? 1_555 I MG  .   MG  ? ? B DGT 801 B MG  802  1_555 ? ? ? ? ? ? ? 2.021 ? 
metalc2  metalc ? ? G MG  .   MG  ? ? ? 1_555 L DTP .   O1G ? ? A MG  705 B DTP 805  1_555 ? ? ? ? ? ? ? 2.023 ? 
metalc3  metalc ? ? E DGT .   O2B ? ? ? 1_555 I MG  .   MG  ? ? A DGT 703 B MG  802  1_555 ? ? ? ? ? ? ? 2.051 ? 
metalc4  metalc ? ? E DGT .   O3G ? ? ? 1_555 I MG  .   MG  ? ? A DGT 703 B MG  802  1_555 ? ? ? ? ? ? ? 2.070 ? 
metalc5  metalc ? ? F DGT .   O2G ? ? ? 1_555 G MG  .   MG  ? ? A DGT 704 A MG  705  1_555 ? ? ? ? ? ? ? 2.071 ? 
metalc6  metalc ? ? B HIS 80  NE2 ? ? ? 1_555 J ZN  .   ZN  ? ? B HIS 167 B ZN  803  1_555 ? ? ? ? ? ? ? 2.072 ? 
metalc7  metalc ? ? G MG  .   MG  ? ? ? 1_555 L DTP .   O2B ? ? A MG  705 B DTP 805  1_555 ? ? ? ? ? ? ? 2.072 ? 
metalc8  metalc ? ? H DGT .   O1B ? ? ? 1_555 I MG  .   MG  ? ? B DGT 801 B MG  802  1_555 ? ? ? ? ? ? ? 2.092 ? 
metalc9  metalc ? ? B HIS 119 NE2 ? ? ? 1_555 J ZN  .   ZN  ? ? B HIS 206 B ZN  803  1_555 ? ? ? ? ? ? ? 2.104 ? 
metalc10 metalc ? ? A HIS 80  NE2 ? ? ? 1_555 C ZN  .   ZN  ? ? A HIS 167 A ZN  701  1_555 ? ? ? ? ? ? ? 2.114 ? 
metalc11 metalc ? ? A HIS 119 NE2 ? ? ? 1_555 C ZN  .   ZN  ? ? A HIS 206 A ZN  701  1_555 ? ? ? ? ? ? ? 2.128 ? 
metalc12 metalc ? ? B ASP 224 OD1 ? ? ? 1_555 J ZN  .   ZN  ? ? B ASP 311 B ZN  803  1_555 ? ? ? ? ? ? ? 2.141 ? 
metalc13 metalc ? ? A ASP 224 OD1 ? ? ? 1_555 C ZN  .   ZN  ? ? A ASP 311 A ZN  701  1_555 ? ? ? ? ? ? ? 2.157 ? 
metalc14 metalc ? ? H DGT .   O1A ? ? ? 1_555 I MG  .   MG  ? ? B DGT 801 B MG  802  1_555 ? ? ? ? ? ? ? 2.203 ? 
metalc15 metalc ? ? F DGT .   O1B ? ? ? 1_555 G MG  .   MG  ? ? A DGT 704 A MG  705  1_555 ? ? ? ? ? ? ? 2.212 ? 
metalc16 metalc ? ? F DGT .   O1A ? ? ? 1_555 G MG  .   MG  ? ? A DGT 704 A MG  705  1_555 ? ? ? ? ? ? ? 2.259 ? 
metalc17 metalc ? ? A ASP 120 OD2 ? ? ? 1_555 C ZN  .   ZN  ? ? A ASP 207 A ZN  701  1_555 ? ? ? ? ? ? ? 2.431 ? 
metalc18 metalc ? ? B ASP 120 OD2 ? ? ? 1_555 J ZN  .   ZN  ? ? B ASP 207 B ZN  803  1_555 ? ? ? ? ? ? ? 2.461 ? 
metalc19 metalc ? ? G MG  .   MG  ? ? ? 1_555 M HOH .   O   ? ? A MG  705 A HOH 1038 1_555 ? ? ? ? ? ? ? 2.145 ? 
metalc20 metalc ? ? I MG  .   MG  ? ? ? 1_555 N HOH .   O   ? ? B MG  802 B HOH 1241 1_555 ? ? ? ? ? ? ? 2.233 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 5 ? 
C ? 2 ? 
D ? 3 ? 
E ? 2 ? 
F ? 2 ? 
G ? 5 ? 
H ? 2 ? 
I ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? parallel      
G 3 4 ? anti-parallel 
G 4 5 ? parallel      
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 29  ? ASP A 33  ? LYS A 116 ASP A 120 
A 2 GLY A 37  ? LEU A 41  ? GLY A 124 LEU A 128 
B 1 ALA A 251 ? VAL A 256 ? ALA A 338 VAL A 343 
B 2 GLU A 259 ? ARG A 265 ? GLU A 346 ARG A 352 
B 3 SER A 432 ? CYS A 435 ? SER A 519 CYS A 522 
B 4 ALA A 438 ? ILE A 443 ? ALA A 525 ILE A 530 
B 5 ALA A 251 ? VAL A 256 ? ALA A 338 VAL A 343 
C 1 ILE A 312 ? THR A 313 ? ILE A 399 THR A 400 
C 2 LYS A 319 ? TYR A 320 ? LYS A 406 TYR A 407 
D 1 LYS A 368 ? THR A 373 ? LYS A 455 THR A 460 
D 2 ALA A 459 ? CYS A 467 ? ALA A 546 CYS A 554 
D 3 PHE A 411 ? ASP A 419 ? PHE A 498 ASP A 506 
E 1 TYR B 17  ? PHE B 18  ? TYR B 104 PHE B 105 
E 2 SER B 21  ? GLN B 22  ? SER B 108 GLN B 109 
F 1 LYS B 29  ? ASP B 33  ? LYS B 116 ASP B 120 
F 2 GLY B 37  ? LEU B 41  ? GLY B 124 LEU B 128 
G 1 ALA B 251 ? VAL B 256 ? ALA B 338 VAL B 343 
G 2 GLU B 259 ? ARG B 265 ? GLU B 346 ARG B 352 
G 3 SER B 432 ? CYS B 435 ? SER B 519 CYS B 522 
G 4 ALA B 438 ? ILE B 443 ? ALA B 525 ILE B 530 
G 5 ALA B 251 ? VAL B 256 ? ALA B 338 VAL B 343 
H 1 ILE B 312 ? THR B 313 ? ILE B 399 THR B 400 
H 2 LYS B 319 ? TYR B 320 ? LYS B 406 TYR B 407 
I 1 LYS B 368 ? THR B 373 ? LYS B 455 THR B 460 
I 2 ALA B 459 ? CYS B 467 ? ALA B 546 CYS B 554 
I 3 PHE B 411 ? ASP B 419 ? PHE B 498 ASP B 506 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LYS A 29  ? N LYS A 116 O LEU A 41  ? O LEU A 128 
B 1 2 N ARG A 252 ? N ARG A 339 O CYS A 263 ? O CYS A 350 
B 2 3 N ALA A 264 ? N ALA A 351 O SER A 432 ? O SER A 519 
B 3 4 N PHE A 433 ? N PHE A 520 O ILE A 443 ? O ILE A 530 
B 4 5 O ASN A 440 ? O ASN A 527 N GLU A 255 ? N GLU A 342 
C 1 2 N ILE A 312 ? N ILE A 399 O TYR A 320 ? O TYR A 407 
D 1 2 N VAL A 370 ? N VAL A 457 O VAL A 465 ? O VAL A 552 
D 2 3 O LEU A 462 ? O LEU A 549 N ILE A 416 ? N ILE A 503 
E 1 2 N PHE B 18  ? N PHE B 105 O SER B 21  ? O SER B 108 
F 1 2 N LYS B 29  ? N LYS B 116 O LEU B 41  ? O LEU B 128 
G 1 2 N ARG B 252 ? N ARG B 339 O CYS B 263 ? O CYS B 350 
G 2 3 N ALA B 264 ? N ALA B 351 O SER B 432 ? O SER B 519 
G 3 4 N PHE B 433 ? N PHE B 520 O ILE B 443 ? O ILE B 530 
G 4 5 O ASN B 440 ? O ASN B 527 N GLU B 255 ? N GLU B 342 
H 1 2 N ILE B 312 ? N ILE B 399 O TYR B 320 ? O TYR B 407 
I 1 2 N VAL B 370 ? N VAL B 457 O VAL B 465 ? O VAL B 552 
I 2 3 O LEU B 462 ? O LEU B 549 N ILE B 416 ? N ILE B 503 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 701'  
AC2 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE DGT A 702' 
AC3 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE DGT A 703' 
AC4 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE DGT A 704' 
AC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG A 705'  
AC6 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE DGT B 801' 
AC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG B 802'  
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 803'  
AC9 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE DGT B 804' 
BC1 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE DTP B 805' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 4  HIS A 80  ? HIS A 167  . ? 1_555 ? 
2   AC1 4  HIS A 119 ? HIS A 206  . ? 1_555 ? 
3   AC1 4  ASP A 120 ? ASP A 207  . ? 1_555 ? 
4   AC1 4  ASP A 224 ? ASP A 311  . ? 1_555 ? 
5   AC2 18 GLN A 62  ? GLN A 149  . ? 1_555 ? 
6   AC2 18 LEU A 63  ? LEU A 150  . ? 1_555 ? 
7   AC2 18 ARG A 77  ? ARG A 164  . ? 1_555 ? 
8   AC2 18 HIS A 128 ? HIS A 215  . ? 1_555 ? 
9   AC2 18 ASP A 222 ? ASP A 309  . ? 1_555 ? 
10  AC2 18 ASP A 224 ? ASP A 311  . ? 1_555 ? 
11  AC2 18 LYS A 225 ? LYS A 312  . ? 1_555 ? 
12  AC2 18 TYR A 228 ? TYR A 315  . ? 1_555 ? 
13  AC2 18 ASP A 232 ? ASP A 319  . ? 1_555 ? 
14  AC2 18 ARG A 279 ? ARG A 366  . ? 1_555 ? 
15  AC2 18 HIS A 283 ? HIS A 370  . ? 1_555 ? 
16  AC2 18 TYR A 287 ? TYR A 374  . ? 1_555 ? 
17  AC2 18 GLN A 288 ? GLN A 375  . ? 1_555 ? 
18  AC2 18 HOH M .   ? HOH A 923  . ? 1_555 ? 
19  AC2 18 HOH M .   ? HOH A 1008 . ? 1_555 ? 
20  AC2 18 HOH M .   ? HOH A 1043 . ? 1_555 ? 
21  AC2 18 HOH M .   ? HOH A 1044 . ? 1_555 ? 
22  AC2 18 HOH M .   ? HOH A 1073 . ? 1_555 ? 
23  AC3 21 VAL A 69  ? VAL A 156  . ? 1_555 ? 
24  AC3 21 PHE A 70  ? PHE A 157  . ? 1_555 ? 
25  AC3 21 ILE A 238 ? ILE A 325  . ? 1_555 ? 
26  AC3 21 ARG A 285 ? ARG A 372  . ? 1_555 ? 
27  AC3 21 HIS A 289 ? HIS A 376  . ? 1_555 ? 
28  AC3 21 LYS A 290 ? LYS A 377  . ? 1_555 ? 
29  AC3 21 VAL A 291 ? VAL A 378  . ? 1_555 ? 
30  AC3 21 HOH M .   ? HOH A 830  . ? 1_555 ? 
31  AC3 21 HOH M .   ? HOH A 832  . ? 1_555 ? 
32  AC3 21 HOH M .   ? HOH A 859  . ? 1_555 ? 
33  AC3 21 HOH M .   ? HOH A 889  . ? 1_555 ? 
34  AC3 21 HOH M .   ? HOH A 900  . ? 1_555 ? 
35  AC3 21 HOH M .   ? HOH A 912  . ? 1_555 ? 
36  AC3 21 HOH M .   ? HOH A 974  . ? 1_555 ? 
37  AC3 21 HOH M .   ? HOH A 1025 . ? 1_555 ? 
38  AC3 21 VAL B 30  ? VAL B 117  . ? 1_555 ? 
39  AC3 21 ASN B 32  ? ASN B 119  . ? 1_555 ? 
40  AC3 21 HIS B 38  ? HIS B 125  . ? 1_555 ? 
41  AC3 21 DGT H .   ? DGT B 801  . ? 1_555 ? 
42  AC3 21 MG  I .   ? MG  B 802  . ? 1_555 ? 
43  AC3 21 HOH N .   ? HOH B 1241 . ? 1_555 ? 
44  AC4 24 LYS A 29  ? LYS A 116  . ? 1_555 ? 
45  AC4 24 VAL A 30  ? VAL A 117  . ? 1_555 ? 
46  AC4 24 ILE A 31  ? ILE A 118  . ? 1_555 ? 
47  AC4 24 ASP A 50  ? ASP A 137  . ? 1_555 ? 
48  AC4 24 GLN A 55  ? GLN A 142  . ? 1_555 ? 
49  AC4 24 ARG A 58  ? ARG A 145  . ? 1_555 ? 
50  AC4 24 PHE A 78  ? PHE A 165  . ? 1_555 ? 
51  AC4 24 MG  G .   ? MG  A 705  . ? 1_555 ? 
52  AC4 24 HOH M .   ? HOH A 804  . ? 1_555 ? 
53  AC4 24 HOH M .   ? HOH A 826  . ? 1_555 ? 
54  AC4 24 HOH M .   ? HOH A 843  . ? 1_555 ? 
55  AC4 24 HOH M .   ? HOH A 854  . ? 1_555 ? 
56  AC4 24 HOH M .   ? HOH A 871  . ? 1_555 ? 
57  AC4 24 HOH M .   ? HOH A 886  . ? 1_555 ? 
58  AC4 24 HOH M .   ? HOH A 936  . ? 1_555 ? 
59  AC4 24 HOH M .   ? HOH A 1038 . ? 1_555 ? 
60  AC4 24 HOH M .   ? HOH A 1049 . ? 1_555 ? 
61  AC4 24 HOH M .   ? HOH A 1130 . ? 1_555 ? 
62  AC4 24 TYR B 68  ? TYR B 155  . ? 1_555 ? 
63  AC4 24 VAL B 69  ? VAL B 156  . ? 1_555 ? 
64  AC4 24 VAL B 291 ? VAL B 378  . ? 1_555 ? 
65  AC4 24 ARG B 364 ? ARG B 451  . ? 1_555 ? 
66  AC4 24 LYS B 368 ? LYS B 455  . ? 1_555 ? 
67  AC4 24 DTP L .   ? DTP B 805  . ? 1_555 ? 
68  AC5 3  DGT F .   ? DGT A 704  . ? 1_555 ? 
69  AC5 3  HOH M .   ? HOH A 1038 . ? 1_555 ? 
70  AC5 3  DTP L .   ? DTP B 805  . ? 1_555 ? 
71  AC6 24 TYR A 68  ? TYR A 155  . ? 1_555 ? 
72  AC6 24 VAL A 69  ? VAL A 156  . ? 1_555 ? 
73  AC6 24 VAL A 291 ? VAL A 378  . ? 1_555 ? 
74  AC6 24 ARG A 364 ? ARG A 451  . ? 1_555 ? 
75  AC6 24 LYS A 368 ? LYS A 455  . ? 1_555 ? 
76  AC6 24 DGT E .   ? DGT A 703  . ? 1_555 ? 
77  AC6 24 HOH M .   ? HOH A 1059 . ? 1_555 ? 
78  AC6 24 LYS B 29  ? LYS B 116  . ? 1_555 ? 
79  AC6 24 VAL B 30  ? VAL B 117  . ? 1_555 ? 
80  AC6 24 ILE B 31  ? ILE B 118  . ? 1_555 ? 
81  AC6 24 ASP B 50  ? ASP B 137  . ? 1_555 ? 
82  AC6 24 GLN B 55  ? GLN B 142  . ? 1_555 ? 
83  AC6 24 ARG B 58  ? ARG B 145  . ? 1_555 ? 
84  AC6 24 PHE B 78  ? PHE B 165  . ? 1_555 ? 
85  AC6 24 MG  I .   ? MG  B 802  . ? 1_555 ? 
86  AC6 24 HOH N .   ? HOH B 916  . ? 1_555 ? 
87  AC6 24 HOH N .   ? HOH B 978  . ? 1_555 ? 
88  AC6 24 HOH N .   ? HOH B 1033 . ? 1_555 ? 
89  AC6 24 HOH N .   ? HOH B 1061 . ? 1_555 ? 
90  AC6 24 HOH N .   ? HOH B 1118 . ? 1_555 ? 
91  AC6 24 HOH N .   ? HOH B 1141 . ? 1_555 ? 
92  AC6 24 HOH N .   ? HOH B 1150 . ? 1_555 ? 
93  AC6 24 HOH N .   ? HOH B 1241 . ? 1_555 ? 
94  AC6 24 HOH N .   ? HOH B 1258 . ? 1_555 ? 
95  AC7 3  DGT E .   ? DGT A 703  . ? 1_555 ? 
96  AC7 3  DGT H .   ? DGT B 801  . ? 1_555 ? 
97  AC7 3  HOH N .   ? HOH B 1241 . ? 1_555 ? 
98  AC8 4  HIS B 80  ? HIS B 167  . ? 1_555 ? 
99  AC8 4  HIS B 119 ? HIS B 206  . ? 1_555 ? 
100 AC8 4  ASP B 120 ? ASP B 207  . ? 1_555 ? 
101 AC8 4  ASP B 224 ? ASP B 311  . ? 1_555 ? 
102 AC9 21 GLN B 62  ? GLN B 149  . ? 1_555 ? 
103 AC9 21 LEU B 63  ? LEU B 150  . ? 1_555 ? 
104 AC9 21 ARG B 77  ? ARG B 164  . ? 1_555 ? 
105 AC9 21 HIS B 128 ? HIS B 215  . ? 1_555 ? 
106 AC9 21 ASP B 222 ? ASP B 309  . ? 1_555 ? 
107 AC9 21 ASP B 224 ? ASP B 311  . ? 1_555 ? 
108 AC9 21 LYS B 225 ? LYS B 312  . ? 1_555 ? 
109 AC9 21 TYR B 228 ? TYR B 315  . ? 1_555 ? 
110 AC9 21 ASP B 232 ? ASP B 319  . ? 1_555 ? 
111 AC9 21 ARG B 279 ? ARG B 366  . ? 1_555 ? 
112 AC9 21 HIS B 283 ? HIS B 370  . ? 1_555 ? 
113 AC9 21 TYR B 287 ? TYR B 374  . ? 1_555 ? 
114 AC9 21 GLN B 288 ? GLN B 375  . ? 1_555 ? 
115 AC9 21 HOH N .   ? HOH B 944  . ? 1_555 ? 
116 AC9 21 HOH N .   ? HOH B 1048 . ? 1_555 ? 
117 AC9 21 HOH N .   ? HOH B 1070 . ? 1_555 ? 
118 AC9 21 HOH N .   ? HOH B 1081 . ? 1_555 ? 
119 AC9 21 HOH N .   ? HOH B 1137 . ? 1_555 ? 
120 AC9 21 HOH N .   ? HOH B 1216 . ? 1_555 ? 
121 AC9 21 HOH N .   ? HOH B 1249 . ? 1_555 ? 
122 AC9 21 HOH N .   ? HOH B 1333 . ? 1_555 ? 
123 BC1 16 VAL A 30  ? VAL A 117  . ? 1_555 ? 
124 BC1 16 ASN A 32  ? ASN A 119  . ? 1_555 ? 
125 BC1 16 DGT F .   ? DGT A 704  . ? 1_555 ? 
126 BC1 16 MG  G .   ? MG  A 705  . ? 1_555 ? 
127 BC1 16 HOH M .   ? HOH A 1038 . ? 1_555 ? 
128 BC1 16 VAL B 69  ? VAL B 156  . ? 1_555 ? 
129 BC1 16 PHE B 70  ? PHE B 157  . ? 1_555 ? 
130 BC1 16 ARG B 285 ? ARG B 372  . ? 1_555 ? 
131 BC1 16 HIS B 289 ? HIS B 376  . ? 1_555 ? 
132 BC1 16 LYS B 290 ? LYS B 377  . ? 1_555 ? 
133 BC1 16 VAL B 291 ? VAL B 378  . ? 1_555 ? 
134 BC1 16 HOH N .   ? HOH B 923  . ? 1_555 ? 
135 BC1 16 HOH N .   ? HOH B 942  . ? 1_555 ? 
136 BC1 16 HOH N .   ? HOH B 1071 . ? 1_555 ? 
137 BC1 16 HOH N .   ? HOH B 1206 . ? 1_555 ? 
138 BC1 16 HOH N .   ? HOH B 1254 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4MZ7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4MZ7 
_atom_sites.fract_transf_matrix[1][1]   0.006784 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004235 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009652 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012795 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ASP A 1 26  ? 114.446 -22.863 107.072 1.00 50.99 ? 113  ASP A N     1 
ATOM   2    C  CA    . ASP A 1 26  ? 115.805 -22.246 106.964 1.00 50.67 ? 113  ASP A CA    1 
ATOM   3    C  C     . ASP A 1 26  ? 116.316 -21.741 108.314 1.00 48.67 ? 113  ASP A C     1 
ATOM   4    O  O     . ASP A 1 26  ? 115.602 -21.046 109.045 1.00 49.81 ? 113  ASP A O     1 
ATOM   5    C  CB    . ASP A 1 26  ? 115.822 -21.114 105.922 1.00 52.38 ? 113  ASP A CB    1 
ATOM   6    C  CG    . ASP A 1 26  ? 115.911 -21.630 104.490 1.00 53.92 ? 113  ASP A CG    1 
ATOM   7    O  OD1   . ASP A 1 26  ? 116.631 -22.624 104.242 1.00 54.52 ? 113  ASP A OD1   1 
ATOM   8    O  OD2   . ASP A 1 26  ? 115.267 -21.030 103.601 1.00 55.74 ? 113  ASP A OD2   1 
ATOM   9    N  N     . THR A 1 27  ? 117.559 -22.099 108.628 1.00 44.88 ? 114  THR A N     1 
ATOM   10   C  CA    . THR A 1 27  ? 118.196 -21.729 109.891 1.00 40.00 ? 114  THR A CA    1 
ATOM   11   C  C     . THR A 1 27  ? 119.257 -20.638 109.705 1.00 35.24 ? 114  THR A C     1 
ATOM   12   O  O     . THR A 1 27  ? 119.622 -20.260 108.581 1.00 33.99 ? 114  THR A O     1 
ATOM   13   C  CB    . THR A 1 27  ? 118.855 -22.946 110.582 1.00 42.15 ? 114  THR A CB    1 
ATOM   14   O  OG1   . THR A 1 27  ? 119.747 -23.596 109.666 1.00 44.54 ? 114  THR A OG1   1 
ATOM   15   C  CG2   . THR A 1 27  ? 117.808 -23.942 111.068 1.00 42.45 ? 114  THR A CG2   1 
ATOM   16   N  N     . MET A 1 28  ? 119.750 -20.130 110.824 1.00 29.73 ? 115  MET A N     1 
ATOM   17   C  CA    . MET A 1 28  ? 120.845 -19.183 110.797 1.00 26.63 ? 115  MET A CA    1 
ATOM   18   C  C     . MET A 1 28  ? 122.124 -19.886 110.317 1.00 23.04 ? 115  MET A C     1 
ATOM   19   O  O     . MET A 1 28  ? 122.195 -21.130 110.264 1.00 22.53 ? 115  MET A O     1 
ATOM   20   C  CB    . MET A 1 28  ? 121.034 -18.630 112.196 1.00 29.12 ? 115  MET A CB    1 
ATOM   21   C  CG    . MET A 1 28  ? 121.579 -19.674 113.149 1.00 35.76 ? 115  MET A CG    1 
ATOM   22   S  SD    . MET A 1 28  ? 123.215 -19.189 113.699 1.00 44.52 ? 115  MET A SD    1 
ATOM   23   C  CE    . MET A 1 28  ? 122.654 -18.224 115.117 1.00 40.90 ? 115  MET A CE    1 
ATOM   24   N  N     . LYS A 1 29  ? 123.117 -19.093 109.941 1.00 17.80 ? 116  LYS A N     1 
ATOM   25   C  CA    . LYS A 1 29  ? 124.413 -19.629 109.558 1.00 15.17 ? 116  LYS A CA    1 
ATOM   26   C  C     . LYS A 1 29  ? 125.467 -18.925 110.399 1.00 14.06 ? 116  LYS A C     1 
ATOM   27   O  O     . LYS A 1 29  ? 125.250 -17.807 110.876 1.00 15.80 ? 116  LYS A O     1 
ATOM   28   C  CB    . LYS A 1 29  ? 124.686 -19.444 108.059 1.00 13.72 ? 116  LYS A CB    1 
ATOM   29   C  CG    . LYS A 1 29  ? 123.778 -20.301 107.178 1.00 14.08 ? 116  LYS A CG    1 
ATOM   30   C  CD    . LYS A 1 29  ? 124.241 -20.307 105.735 1.00 13.99 ? 116  LYS A CD    1 
ATOM   31   C  CE    . LYS A 1 29  ? 123.288 -21.123 104.862 1.00 14.77 ? 116  LYS A CE    1 
ATOM   32   N  NZ    . LYS A 1 29  ? 123.098 -22.499 105.395 1.00 14.11 ? 116  LYS A NZ    1 
ATOM   33   N  N     . VAL A 1 30  ? 126.577 -19.611 110.625 1.00 11.76 ? 117  VAL A N     1 
ATOM   34   C  CA    . VAL A 1 30  ? 127.700 -18.988 111.305 1.00 11.11 ? 117  VAL A CA    1 
ATOM   35   C  C     . VAL A 1 30  ? 128.830 -18.848 110.279 1.00 10.19 ? 117  VAL A C     1 
ATOM   36   O  O     . VAL A 1 30  ? 129.117 -19.783 109.534 1.00 9.00  ? 117  VAL A O     1 
ATOM   37   C  CB    . VAL A 1 30  ? 128.135 -19.812 112.523 1.00 13.91 ? 117  VAL A CB    1 
ATOM   38   C  CG1   . VAL A 1 30  ? 129.316 -19.161 113.223 1.00 15.18 ? 117  VAL A CG1   1 
ATOM   39   C  CG2   . VAL A 1 30  ? 126.974 -19.963 113.513 1.00 15.56 ? 117  VAL A CG2   1 
ATOM   40   N  N     . ILE A 1 31  ? 129.464 -17.683 110.248 1.00 9.41  ? 118  ILE A N     1 
ATOM   41   C  CA    . ILE A 1 31  ? 130.587 -17.450 109.328 1.00 9.22  ? 118  ILE A CA    1 
ATOM   42   C  C     . ILE A 1 31  ? 131.807 -17.140 110.179 1.00 9.43  ? 118  ILE A C     1 
ATOM   43   O  O     . ILE A 1 31  ? 131.726 -16.314 111.101 1.00 10.31 ? 118  ILE A O     1 
ATOM   44   C  CB    . ILE A 1 31  ? 130.278 -16.292 108.342 1.00 10.76 ? 118  ILE A CB    1 
ATOM   45   C  CG1   . ILE A 1 31  ? 129.263 -16.765 107.283 1.00 11.47 ? 118  ILE A CG1   1 
ATOM   46   C  CG2   . ILE A 1 31  ? 131.539 -15.803 107.628 1.00 11.92 ? 118  ILE A CG2   1 
ATOM   47   C  CD1   . ILE A 1 31  ? 128.993 -15.763 106.176 1.00 12.68 ? 118  ILE A CD1   1 
ATOM   48   N  N     . ASN A 1 32  ? 132.925 -17.807 109.897 1.00 8.05  ? 119  ASN A N     1 
ATOM   49   C  CA    . ASN A 1 32  ? 134.174 -17.488 110.599 1.00 7.97  ? 119  ASN A CA    1 
ATOM   50   C  C     . ASN A 1 32  ? 134.906 -16.376 109.878 1.00 7.42  ? 119  ASN A C     1 
ATOM   51   O  O     . ASN A 1 32  ? 135.323 -16.540 108.732 1.00 8.45  ? 119  ASN A O     1 
ATOM   52   C  CB    . ASN A 1 32  ? 135.067 -18.733 110.688 1.00 7.93  ? 119  ASN A CB    1 
ATOM   53   C  CG    . ASN A 1 32  ? 136.333 -18.491 111.510 1.00 9.81  ? 119  ASN A CG    1 
ATOM   54   O  OD1   . ASN A 1 32  ? 136.508 -17.427 112.087 1.00 13.24 ? 119  ASN A OD1   1 
ATOM   55   N  ND2   . ASN A 1 32  ? 137.207 -19.489 111.579 1.00 11.99 ? 119  ASN A ND2   1 
ATOM   56   N  N     . ASP A 1 33  ? 135.065 -15.239 110.550 1.00 7.53  ? 120  ASP A N     1 
ATOM   57   C  CA    . ASP A 1 33  ? 135.770 -14.093 109.984 1.00 7.25  ? 120  ASP A CA    1 
ATOM   58   C  C     . ASP A 1 33  ? 137.054 -13.845 110.772 1.00 7.43  ? 120  ASP A C     1 
ATOM   59   O  O     . ASP A 1 33  ? 137.046 -13.937 111.989 1.00 7.06  ? 120  ASP A O     1 
ATOM   60   C  CB    . ASP A 1 33  ? 134.866 -12.859 110.055 1.00 7.87  ? 120  ASP A CB    1 
ATOM   61   C  CG    . ASP A 1 33  ? 135.572 -11.609 109.587 1.00 8.75  ? 120  ASP A CG    1 
ATOM   62   O  OD1   . ASP A 1 33  ? 135.863 -11.507 108.374 1.00 10.15 ? 120  ASP A OD1   1 
ATOM   63   O  OD2   . ASP A 1 33  ? 135.819 -10.733 110.426 1.00 9.87  ? 120  ASP A OD2   1 
ATOM   64   N  N     . PRO A 1 34  ? 138.171 -13.520 110.079 1.00 7.41  ? 121  PRO A N     1 
ATOM   65   C  CA    . PRO A 1 34  ? 139.422 -13.349 110.835 1.00 8.24  ? 121  PRO A CA    1 
ATOM   66   C  C     . PRO A 1 34  ? 139.415 -12.128 111.743 1.00 8.26  ? 121  PRO A C     1 
ATOM   67   O  O     . PRO A 1 34  ? 140.147 -12.101 112.737 1.00 9.67  ? 121  PRO A O     1 
ATOM   68   C  CB    . PRO A 1 34  ? 140.487 -13.167 109.735 1.00 8.33  ? 121  PRO A CB    1 
ATOM   69   C  CG    . PRO A 1 34  ? 139.725 -12.675 108.554 1.00 8.04  ? 121  PRO A CG    1 
ATOM   70   C  CD    . PRO A 1 34  ? 138.376 -13.362 108.630 1.00 8.28  ? 121  PRO A CD    1 
ATOM   71   N  N     . ILE A 1 35  ? 138.584 -11.126 111.447 1.00 6.81  ? 122  ILE A N     1 
ATOM   72   C  CA    . ILE A 1 35  ? 138.548 -9.955  112.294 1.00 7.85  ? 122  ILE A CA    1 
ATOM   73   C  C     . ILE A 1 35  ? 137.646 -10.189 113.501 1.00 7.94  ? 122  ILE A C     1 
ATOM   74   O  O     . ILE A 1 35  ? 138.068 -9.965  114.645 1.00 9.01  ? 122  ILE A O     1 
ATOM   75   C  CB    . ILE A 1 35  ? 138.043 -8.686  111.544 1.00 7.71  ? 122  ILE A CB    1 
ATOM   76   C  CG1   . ILE A 1 35  ? 138.814 -8.483  110.239 1.00 8.57  ? 122  ILE A CG1   1 
ATOM   77   C  CG2   . ILE A 1 35  ? 138.100 -7.457  112.467 1.00 8.84  ? 122  ILE A CG2   1 
ATOM   78   C  CD1   . ILE A 1 35  ? 140.318 -8.550  110.382 1.00 9.46  ? 122  ILE A CD1   1 
ATOM   79   N  N     . HIS A 1 36  ? 136.424 -10.656 113.244 1.00 7.20  ? 123  HIS A N     1 
ATOM   80   C  CA    . HIS A 1 36  ? 135.376 -10.721 114.283 1.00 7.64  ? 123  HIS A CA    1 
ATOM   81   C  C     . HIS A 1 36  ? 135.132 -12.095 114.845 1.00 8.23  ? 123  HIS A C     1 
ATOM   82   O  O     . HIS A 1 36  ? 134.362 -12.242 115.806 1.00 10.19 ? 123  HIS A O     1 
ATOM   83   C  CB    . HIS A 1 36  ? 134.073 -10.146 113.723 1.00 8.15  ? 123  HIS A CB    1 
ATOM   84   C  CG    . HIS A 1 36  ? 134.219 -8.730  113.248 1.00 8.05  ? 123  HIS A CG    1 
ATOM   85   N  ND1   . HIS A 1 36  ? 134.620 -7.728  114.065 1.00 9.14  ? 123  HIS A ND1   1 
ATOM   86   C  CD2   . HIS A 1 36  ? 134.035 -8.171  111.998 1.00 7.37  ? 123  HIS A CD2   1 
ATOM   87   C  CE1   . HIS A 1 36  ? 134.657 -6.580  113.374 1.00 8.96  ? 123  HIS A CE1   1 
ATOM   88   N  NE2   . HIS A 1 36  ? 134.311 -6.854  112.101 1.00 8.00  ? 123  HIS A NE2   1 
ATOM   89   N  N     . GLY A 1 37  ? 135.776 -13.122 114.293 1.00 7.79  ? 124  GLY A N     1 
ATOM   90   C  CA    . GLY A 1 37  ? 135.520 -14.486 114.762 1.00 8.96  ? 124  GLY A CA    1 
ATOM   91   C  C     . GLY A 1 37  ? 134.212 -15.006 114.185 1.00 9.37  ? 124  GLY A C     1 
ATOM   92   O  O     . GLY A 1 37  ? 133.888 -14.723 113.037 1.00 9.02  ? 124  GLY A O     1 
ATOM   93   N  N     . HIS A 1 38  ? 133.444 -15.742 114.992 1.00 11.39 ? 125  HIS A N     1 
ATOM   94   C  CA    . HIS A 1 38  ? 132.238 -16.410 114.487 1.00 12.30 ? 125  HIS A CA    1 
ATOM   95   C  C     . HIS A 1 38  ? 131.030 -15.501 114.528 1.00 14.55 ? 125  HIS A C     1 
ATOM   96   O  O     . HIS A 1 38  ? 130.558 -15.123 115.606 1.00 18.79 ? 125  HIS A O     1 
ATOM   97   C  CB    . HIS A 1 38  ? 132.010 -17.735 115.220 1.00 13.00 ? 125  HIS A CB    1 
ATOM   98   C  CG    . HIS A 1 38  ? 133.018 -18.805 114.851 1.00 13.44 ? 125  HIS A CG    1 
ATOM   99   N  ND1   . HIS A 1 38  ? 134.327 -18.736 115.206 1.00 14.06 ? 125  HIS A ND1   1 
ATOM   100  C  CD2   . HIS A 1 38  ? 132.874 -19.972 114.113 1.00 13.69 ? 125  HIS A CD2   1 
ATOM   101  C  CE1   . HIS A 1 38  ? 134.980 -19.800 114.710 1.00 13.14 ? 125  HIS A CE1   1 
ATOM   102  N  NE2   . HIS A 1 38  ? 134.093 -20.561 114.041 1.00 13.29 ? 125  HIS A NE2   1 
ATOM   103  N  N     . ILE A 1 39  ? 130.566 -15.110 113.347 1.00 14.62 ? 126  ILE A N     1 
ATOM   104  C  CA    . ILE A 1 39  ? 129.463 -14.150 113.179 1.00 15.87 ? 126  ILE A CA    1 
ATOM   105  C  C     . ILE A 1 39  ? 128.190 -14.949 112.923 1.00 16.55 ? 126  ILE A C     1 
ATOM   106  O  O     . ILE A 1 39  ? 128.149 -15.749 111.995 1.00 17.36 ? 126  ILE A O     1 
ATOM   107  C  CB    . ILE A 1 39  ? 129.705 -13.234 111.957 1.00 16.85 ? 126  ILE A CB    1 
ATOM   108  C  CG1   . ILE A 1 39  ? 130.944 -12.355 112.139 1.00 18.46 ? 126  ILE A CG1   1 
ATOM   109  C  CG2   . ILE A 1 39  ? 128.488 -12.342 111.678 1.00 18.62 ? 126  ILE A CG2   1 
ATOM   110  C  CD1   . ILE A 1 39  ? 131.317 -11.593 110.881 1.00 18.58 ? 126  ILE A CD1   1 
ATOM   111  N  N     . GLU A 1 40  ? 127.146 -14.735 113.720 1.00 16.53 ? 127  GLU A N     1 
ATOM   112  C  CA    . GLU A 1 40  ? 125.866 -15.404 113.444 1.00 18.43 ? 127  GLU A CA    1 
ATOM   113  C  C     . GLU A 1 40  ? 124.988 -14.581 112.506 1.00 16.78 ? 127  GLU A C     1 
ATOM   114  O  O     . GLU A 1 40  ? 124.819 -13.375 112.684 1.00 14.97 ? 127  GLU A O     1 
ATOM   115  C  CB    . GLU A 1 40  ? 125.115 -15.711 114.734 1.00 21.88 ? 127  GLU A CB    1 
ATOM   116  C  CG    . GLU A 1 40  ? 125.835 -16.698 115.635 1.00 27.54 ? 127  GLU A CG    1 
ATOM   117  C  CD    . GLU A 1 40  ? 125.037 -17.041 116.882 1.00 31.48 ? 127  GLU A CD    1 
ATOM   118  O  OE1   . GLU A 1 40  ? 125.132 -18.194 117.351 1.00 36.33 ? 127  GLU A OE1   1 
ATOM   119  O  OE2   . GLU A 1 40  ? 124.305 -16.164 117.385 1.00 34.58 ? 127  GLU A OE2   1 
ATOM   120  N  N     . LEU A 1 41  ? 124.441 -15.248 111.500 1.00 15.14 ? 128  LEU A N     1 
ATOM   121  C  CA    . LEU A 1 41  ? 123.609 -14.580 110.507 1.00 15.40 ? 128  LEU A CA    1 
ATOM   122  C  C     . LEU A 1 41  ? 122.203 -15.165 110.516 1.00 16.30 ? 128  LEU A C     1 
ATOM   123  O  O     . LEU A 1 41  ? 121.997 -16.319 110.149 1.00 16.02 ? 128  LEU A O     1 
ATOM   124  C  CB    . LEU A 1 41  ? 124.225 -14.703 109.120 1.00 17.40 ? 128  LEU A CB    1 
ATOM   125  C  CG    . LEU A 1 41  ? 125.546 -13.944 108.954 1.00 19.37 ? 128  LEU A CG    1 
ATOM   126  C  CD1   . LEU A 1 41  ? 126.189 -14.274 107.624 1.00 21.02 ? 128  LEU A CD1   1 
ATOM   127  C  CD2   . LEU A 1 41  ? 125.342 -12.445 109.123 1.00 19.93 ? 128  LEU A CD2   1 
ATOM   128  N  N     . HIS A 1 42  ? 121.254 -14.358 110.974 1.00 15.86 ? 129  HIS A N     1 
ATOM   129  C  CA    . HIS A 1 42  ? 119.813 -14.669 110.887 1.00 16.03 ? 129  HIS A CA    1 
ATOM   130  C  C     . HIS A 1 42  ? 119.432 -15.074 109.475 1.00 15.31 ? 129  HIS A C     1 
ATOM   131  O  O     . HIS A 1 42  ? 119.966 -14.530 108.503 1.00 14.03 ? 129  HIS A O     1 
ATOM   132  C  CB    . HIS A 1 42  ? 119.046 -13.429 111.342 1.00 17.15 ? 129  HIS A CB    1 
ATOM   133  C  CG    . HIS A 1 42  ? 117.539 -13.594 111.387 1.00 18.68 ? 129  HIS A CG    1 
ATOM   134  N  ND1   . HIS A 1 42  ? 116.772 -13.555 110.282 1.00 18.98 ? 129  HIS A ND1   1 
ATOM   135  C  CD2   . HIS A 1 42  ? 116.667 -13.742 112.467 1.00 20.51 ? 129  HIS A CD2   1 
ATOM   136  C  CE1   . HIS A 1 42  ? 115.480 -13.702 110.626 1.00 20.74 ? 129  HIS A CE1   1 
ATOM   137  N  NE2   . HIS A 1 42  ? 115.413 -13.813 111.963 1.00 21.27 ? 129  HIS A NE2   1 
ATOM   138  N  N     . PRO A 1 43  ? 118.488 -16.026 109.316 1.00 15.73 ? 130  PRO A N     1 
ATOM   139  C  CA    . PRO A 1 43  ? 118.204 -16.468 107.947 1.00 15.69 ? 130  PRO A CA    1 
ATOM   140  C  C     . PRO A 1 43  ? 117.726 -15.385 106.959 1.00 14.74 ? 130  PRO A C     1 
ATOM   141  O  O     . PRO A 1 43  ? 117.915 -15.551 105.749 1.00 15.42 ? 130  PRO A O     1 
ATOM   142  C  CB    . PRO A 1 43  ? 117.144 -17.562 108.135 1.00 16.29 ? 130  PRO A CB    1 
ATOM   143  C  CG    . PRO A 1 43  ? 116.579 -17.323 109.493 1.00 16.79 ? 130  PRO A CG    1 
ATOM   144  C  CD    . PRO A 1 43  ? 117.735 -16.815 110.304 1.00 16.35 ? 130  PRO A CD    1 
ATOM   145  N  N     . LEU A 1 44  ? 117.129 -14.297 107.449 1.00 14.78 ? 131  LEU A N     1 
ATOM   146  C  CA    . LEU A 1 44  ? 116.773 -13.189 106.552 1.00 14.81 ? 131  LEU A CA    1 
ATOM   147  C  C     . LEU A 1 44  ? 118.023 -12.520 105.958 1.00 14.82 ? 131  LEU A C     1 
ATOM   148  O  O     . LEU A 1 44  ? 118.066 -12.166 104.773 1.00 14.23 ? 131  LEU A O     1 
ATOM   149  C  CB    . LEU A 1 44  ? 115.893 -12.152 107.271 1.00 15.20 ? 131  LEU A CB    1 
ATOM   150  C  CG    . LEU A 1 44  ? 115.660 -10.828 106.521 1.00 15.91 ? 131  LEU A CG    1 
ATOM   151  C  CD1   . LEU A 1 44  ? 114.949 -11.079 105.197 1.00 17.35 ? 131  LEU A CD1   1 
ATOM   152  C  CD2   . LEU A 1 44  ? 114.884 -9.824  107.369 1.00 15.99 ? 131  LEU A CD2   1 
ATOM   153  N  N     . LEU A 1 45  ? 119.053 -12.372 106.789 1.00 14.13 ? 132  LEU A N     1 
ATOM   154  C  CA    . LEU A 1 45  ? 120.330 -11.845 106.322 1.00 12.81 ? 132  LEU A CA    1 
ATOM   155  C  C     . LEU A 1 45  ? 120.946 -12.788 105.297 1.00 12.08 ? 132  LEU A C     1 
ATOM   156  O  O     . LEU A 1 45  ? 121.478 -12.342 104.286 1.00 12.52 ? 132  LEU A O     1 
ATOM   157  C  CB    . LEU A 1 45  ? 121.294 -11.624 107.509 1.00 12.74 ? 132  LEU A CB    1 
ATOM   158  C  CG    . LEU A 1 45  ? 120.767 -10.788 108.698 1.00 14.34 ? 132  LEU A CG    1 
ATOM   159  C  CD1   . LEU A 1 45  ? 121.836 -10.594 109.758 1.00 15.16 ? 132  LEU A CD1   1 
ATOM   160  C  CD2   . LEU A 1 45  ? 120.227 -9.432  108.267 1.00 13.47 ? 132  LEU A CD2   1 
ATOM   161  N  N     . VAL A 1 46  ? 120.870 -14.093 105.559 1.00 11.74 ? 133  VAL A N     1 
ATOM   162  C  CA    . VAL A 1 46  ? 121.410 -15.086 104.628 1.00 12.44 ? 133  VAL A CA    1 
ATOM   163  C  C     . VAL A 1 46  ? 120.748 -14.975 103.235 1.00 13.24 ? 133  VAL A C     1 
ATOM   164  O  O     . VAL A 1 46  ? 121.422 -15.036 102.190 1.00 12.38 ? 133  VAL A O     1 
ATOM   165  C  CB    . VAL A 1 46  ? 121.280 -16.515 105.198 1.00 12.60 ? 133  VAL A CB    1 
ATOM   166  C  CG1   . VAL A 1 46  ? 121.714 -17.536 104.159 1.00 12.42 ? 133  VAL A CG1   1 
ATOM   167  C  CG2   . VAL A 1 46  ? 122.107 -16.659 106.500 1.00 12.66 ? 133  VAL A CG2   1 
ATOM   168  N  N     . ARG A 1 47  ? 119.435 -14.781 103.219 1.00 15.46 ? 134  ARG A N     1 
ATOM   169  C  CA    . ARG A 1 47  ? 118.721 -14.638 101.956 1.00 17.21 ? 134  ARG A CA    1 
ATOM   170  C  C     . ARG A 1 47  ? 119.208 -13.429 101.156 1.00 16.38 ? 134  ARG A C     1 
ATOM   171  O  O     . ARG A 1 47  ? 119.303 -13.491 99.937  1.00 17.43 ? 134  ARG A O     1 
ATOM   172  C  CB    . ARG A 1 47  ? 117.210 -14.540 102.192 1.00 20.10 ? 134  ARG A CB    1 
ATOM   173  C  CG    . ARG A 1 47  ? 116.398 -14.847 100.946 1.00 23.85 ? 134  ARG A CG    1 
ATOM   174  C  CD    . ARG A 1 47  ? 116.494 -16.324 100.583 1.00 27.93 ? 134  ARG A CD    1 
ATOM   175  N  NE    . ARG A 1 47  ? 115.650 -17.131 101.455 1.00 32.69 ? 134  ARG A NE    1 
ATOM   176  C  CZ    . ARG A 1 47  ? 114.355 -17.352 101.236 1.00 34.66 ? 134  ARG A CZ    1 
ATOM   177  N  NH1   . ARG A 1 47  ? 113.758 -16.837 100.165 1.00 35.90 ? 134  ARG A NH1   1 
ATOM   178  N  NH2   . ARG A 1 47  ? 113.656 -18.090 102.085 1.00 36.41 ? 134  ARG A NH2   1 
ATOM   179  N  N     . ILE A 1 48  ? 119.503 -12.335 101.853 1.00 14.70 ? 135  ILE A N     1 
ATOM   180  C  CA    . ILE A 1 48  ? 119.974 -11.104 101.217 1.00 14.65 ? 135  ILE A CA    1 
ATOM   181  C  C     . ILE A 1 48  ? 121.406 -11.264 100.703 1.00 13.42 ? 135  ILE A C     1 
ATOM   182  O  O     . ILE A 1 48  ? 121.740 -10.833 99.602  1.00 12.81 ? 135  ILE A O     1 
ATOM   183  C  CB    . ILE A 1 48  ? 119.843 -9.909  102.183 1.00 14.55 ? 135  ILE A CB    1 
ATOM   184  C  CG1   . ILE A 1 48  ? 118.366 -9.505  102.295 1.00 14.96 ? 135  ILE A CG1   1 
ATOM   185  C  CG2   . ILE A 1 48  ? 120.722 -8.730  101.746 1.00 14.75 ? 135  ILE A CG2   1 
ATOM   186  C  CD1   . ILE A 1 48  ? 118.023 -8.686  103.524 1.00 14.01 ? 135  ILE A CD1   1 
ATOM   187  N  N     . ILE A 1 49  ? 122.243 -11.913 101.508 1.00 14.09 ? 136  ILE A N     1 
ATOM   188  C  CA    . ILE A 1 49  ? 123.642 -12.176 101.136 1.00 12.82 ? 136  ILE A CA    1 
ATOM   189  C  C     . ILE A 1 49  ? 123.772 -13.090 99.907  1.00 11.67 ? 136  ILE A C     1 
ATOM   190  O  O     . ILE A 1 49  ? 124.609 -12.862 99.026  1.00 11.15 ? 136  ILE A O     1 
ATOM   191  C  CB    . ILE A 1 49  ? 124.390 -12.759 102.364 1.00 13.10 ? 136  ILE A CB    1 
ATOM   192  C  CG1   . ILE A 1 49  ? 124.639 -11.641 103.383 1.00 13.07 ? 136  ILE A CG1   1 
ATOM   193  C  CG2   . ILE A 1 49  ? 125.688 -13.449 101.969 1.00 14.11 ? 136  ILE A CG2   1 
ATOM   194  C  CD1   . ILE A 1 49  ? 124.813 -12.127 104.820 1.00 13.95 ? 136  ILE A CD1   1 
ATOM   195  N  N     . ASP A 1 50  ? 122.931 -14.116 99.840  1.00 11.41 ? 137  ASP A N     1 
ATOM   196  C  CA    . ASP A 1 50  ? 123.025 -15.092 98.751  1.00 11.92 ? 137  ASP A CA    1 
ATOM   197  C  C     . ASP A 1 50  ? 122.264 -14.654 97.491  1.00 13.15 ? 137  ASP A C     1 
ATOM   198  O  O     . ASP A 1 50  ? 121.385 -15.361 97.006  1.00 13.35 ? 137  ASP A O     1 
ATOM   199  C  CB    . ASP A 1 50  ? 122.603 -16.475 99.251  1.00 11.63 ? 137  ASP A CB    1 
ATOM   200  C  CG    . ASP A 1 50  ? 123.623 -17.057 100.229 1.00 11.77 ? 137  ASP A CG    1 
ATOM   201  O  OD1   . ASP A 1 50  ? 124.796 -16.616 100.148 1.00 12.09 ? 137  ASP A OD1   1 
ATOM   202  O  OD2   . ASP A 1 50  ? 123.263 -17.910 101.073 1.00 10.73 ? 137  ASP A OD2   1 
ATOM   203  N  N     . THR A 1 51  ? 122.641 -13.490 96.978  1.00 13.21 ? 138  THR A N     1 
ATOM   204  C  CA    . THR A 1 51  ? 122.078 -12.931 95.752  1.00 14.32 ? 138  THR A CA    1 
ATOM   205  C  C     . THR A 1 51  ? 123.220 -12.438 94.874  1.00 14.59 ? 138  THR A C     1 
ATOM   206  O  O     . THR A 1 51  ? 124.301 -12.112 95.388  1.00 14.07 ? 138  THR A O     1 
ATOM   207  C  CB    . THR A 1 51  ? 121.183 -11.728 96.057  1.00 14.62 ? 138  THR A CB    1 
ATOM   208  O  OG1   . THR A 1 51  ? 121.957 -10.695 96.699  1.00 15.63 ? 138  THR A OG1   1 
ATOM   209  C  CG2   . THR A 1 51  ? 120.018 -12.138 96.950  1.00 14.87 ? 138  THR A CG2   1 
ATOM   210  N  N     . PRO A 1 52  ? 122.994 -12.347 93.551  1.00 14.49 ? 139  PRO A N     1 
ATOM   211  C  CA    . PRO A 1 52  ? 124.074 -11.839 92.714  1.00 13.38 ? 139  PRO A CA    1 
ATOM   212  C  C     . PRO A 1 52  ? 124.449 -10.399 93.049  1.00 13.10 ? 139  PRO A C     1 
ATOM   213  O  O     . PRO A 1 52  ? 125.585 -10.014 92.833  1.00 11.60 ? 139  PRO A O     1 
ATOM   214  C  CB    . PRO A 1 52  ? 123.502 -11.914 91.286  1.00 14.95 ? 139  PRO A CB    1 
ATOM   215  C  CG    . PRO A 1 52  ? 122.386 -12.900 91.369  1.00 15.44 ? 139  PRO A CG    1 
ATOM   216  C  CD    . PRO A 1 52  ? 121.838 -12.811 92.759  1.00 15.08 ? 139  PRO A CD    1 
ATOM   217  N  N     . GLN A 1 53  ? 123.513 -9.610  93.577  1.00 13.70 ? 140  GLN A N     1 
ATOM   218  C  CA    . GLN A 1 53  ? 123.789 -8.200  93.834  1.00 13.52 ? 140  GLN A CA    1 
ATOM   219  C  C     . GLN A 1 53  ? 124.739 -8.022  95.017  1.00 12.93 ? 140  GLN A C     1 
ATOM   220  O  O     . GLN A 1 53  ? 125.525 -7.073  95.044  1.00 13.68 ? 140  GLN A O     1 
ATOM   221  C  CB    . GLN A 1 53  ? 122.502 -7.423  94.080  1.00 13.92 ? 140  GLN A CB    1 
ATOM   222  C  CG    . GLN A 1 53  ? 121.601 -7.341  92.851  1.00 15.14 ? 140  GLN A CG    1 
ATOM   223  C  CD    . GLN A 1 53  ? 120.985 -8.669  92.461  1.00 16.62 ? 140  GLN A CD    1 
ATOM   224  O  OE1   . GLN A 1 53  ? 120.623 -9.485  93.317  1.00 16.85 ? 140  GLN A OE1   1 
ATOM   225  N  NE2   . GLN A 1 53  ? 120.859 -8.897  91.158  1.00 19.17 ? 140  GLN A NE2   1 
ATOM   226  N  N     . PHE A 1 54  ? 124.663 -8.941  95.977  1.00 12.27 ? 141  PHE A N     1 
ATOM   227  C  CA    . PHE A 1 54  ? 125.526 -8.899  97.159  1.00 11.87 ? 141  PHE A CA    1 
ATOM   228  C  C     . PHE A 1 54  ? 126.862 -9.609  96.928  1.00 11.49 ? 141  PHE A C     1 
ATOM   229  O  O     . PHE A 1 54  ? 127.916 -9.066  97.271  1.00 10.53 ? 141  PHE A O     1 
ATOM   230  C  CB    . PHE A 1 54  ? 124.818 -9.518  98.352  1.00 12.99 ? 141  PHE A CB    1 
ATOM   231  C  CG    . PHE A 1 54  ? 125.406 -9.103  99.660  1.00 12.86 ? 141  PHE A CG    1 
ATOM   232  C  CD1   . PHE A 1 54  ? 126.538 -9.739  100.152 1.00 13.16 ? 141  PHE A CD1   1 
ATOM   233  C  CD2   . PHE A 1 54  ? 124.836 -8.064  100.392 1.00 14.15 ? 141  PHE A CD2   1 
ATOM   234  C  CE1   . PHE A 1 54  ? 127.093 -9.350  101.368 1.00 13.42 ? 141  PHE A CE1   1 
ATOM   235  C  CE2   . PHE A 1 54  ? 125.380 -7.682  101.608 1.00 14.29 ? 141  PHE A CE2   1 
ATOM   236  C  CZ    . PHE A 1 54  ? 126.526 -8.317  102.082 1.00 13.29 ? 141  PHE A CZ    1 
ATOM   237  N  N     . GLN A 1 55  ? 126.810 -10.796 96.321  1.00 10.74 ? 142  GLN A N     1 
ATOM   238  C  CA    . GLN A 1 55  ? 128.006 -11.604 96.067  1.00 10.48 ? 142  GLN A CA    1 
ATOM   239  C  C     . GLN A 1 55  ? 128.968 -10.893 95.134  1.00 10.01 ? 142  GLN A C     1 
ATOM   240  O  O     . GLN A 1 55  ? 130.165 -11.161 95.134  1.00 9.06  ? 142  GLN A O     1 
ATOM   241  C  CB    . GLN A 1 55  ? 127.624 -12.983 95.523  1.00 9.98  ? 142  GLN A CB    1 
ATOM   242  C  CG    . GLN A 1 55  ? 126.793 -13.807 96.498  1.00 9.34  ? 142  GLN A CG    1 
ATOM   243  C  CD    . GLN A 1 55  ? 127.629 -14.351 97.646  1.00 9.31  ? 142  GLN A CD    1 
ATOM   244  O  OE1   . GLN A 1 55  ? 128.728 -14.874 97.424  1.00 9.84  ? 142  GLN A OE1   1 
ATOM   245  N  NE2   . GLN A 1 55  ? 127.117 -14.234 98.871  1.00 8.60  ? 142  GLN A NE2   1 
ATOM   246  N  N     . ARG A 1 56  ? 128.429 -9.969  94.338  1.00 10.18 ? 143  ARG A N     1 
ATOM   247  C  CA    . ARG A 1 56  ? 129.210 -9.094  93.489  1.00 9.88  ? 143  ARG A CA    1 
ATOM   248  C  C     . ARG A 1 56  ? 130.389 -8.429  94.241  1.00 9.36  ? 143  ARG A C     1 
ATOM   249  O  O     . ARG A 1 56  ? 131.464 -8.195  93.674  1.00 8.59  ? 143  ARG A O     1 
ATOM   250  C  CB    . ARG A 1 56  ? 128.251 -8.028  92.950  1.00 10.48 ? 143  ARG A CB    1 
ATOM   251  C  CG    . ARG A 1 56  ? 128.880 -6.824  92.309  1.00 11.13 ? 143  ARG A CG    1 
ATOM   252  C  CD    . ARG A 1 56  ? 127.811 -5.816  91.883  1.00 12.12 ? 143  ARG A CD    1 
ATOM   253  N  NE    . ARG A 1 56  ? 128.479 -4.682  91.261  1.00 11.81 ? 143  ARG A NE    1 
ATOM   254  C  CZ    . ARG A 1 56  ? 128.934 -3.614  91.914  1.00 11.99 ? 143  ARG A CZ    1 
ATOM   255  N  NH1   . ARG A 1 56  ? 128.778 -3.485  93.237  1.00 12.79 ? 143  ARG A NH1   1 
ATOM   256  N  NH2   . ARG A 1 56  ? 129.532 -2.657  91.229  1.00 12.73 ? 143  ARG A NH2   1 
ATOM   257  N  N     . LEU A 1 57  ? 130.167 -8.139  95.515  1.00 8.49  ? 144  LEU A N     1 
ATOM   258  C  CA    . LEU A 1 57  ? 131.167 -7.420  96.324  1.00 8.05  ? 144  LEU A CA    1 
ATOM   259  C  C     . LEU A 1 57  ? 132.419 -8.267  96.594  1.00 8.50  ? 144  LEU A C     1 
ATOM   260  O  O     . LEU A 1 57  ? 133.441 -7.735  97.054  1.00 8.67  ? 144  LEU A O     1 
ATOM   261  C  CB    . LEU A 1 57  ? 130.546 -6.926  97.627  1.00 7.76  ? 144  LEU A CB    1 
ATOM   262  C  CG    . LEU A 1 57  ? 129.485 -5.807  97.477  1.00 7.73  ? 144  LEU A CG    1 
ATOM   263  C  CD1   . LEU A 1 57  ? 128.972 -5.405  98.845  1.00 8.01  ? 144  LEU A CD1   1 
ATOM   264  C  CD2   . LEU A 1 57  ? 130.021 -4.602  96.715  1.00 7.23  ? 144  LEU A CD2   1 
ATOM   265  N  N     . ARG A 1 58  ? 132.357 -9.563  96.270  1.00 8.21  ? 145  ARG A N     1 
ATOM   266  C  CA    . ARG A 1 58  ? 133.550 -10.432 96.353  1.00 8.27  ? 145  ARG A CA    1 
ATOM   267  C  C     . ARG A 1 58  ? 134.589 -10.043 95.312  1.00 8.39  ? 145  ARG A C     1 
ATOM   268  O  O     . ARG A 1 58  ? 135.740 -10.463 95.385  1.00 8.42  ? 145  ARG A O     1 
ATOM   269  C  CB    . ARG A 1 58  ? 133.180 -11.908 96.130  1.00 8.27  ? 145  ARG A CB    1 
ATOM   270  C  CG    . ARG A 1 58  ? 132.388 -12.555 97.265  1.00 7.74  ? 145  ARG A CG    1 
ATOM   271  C  CD    . ARG A 1 58  ? 132.190 -14.042 96.963  1.00 8.46  ? 145  ARG A CD    1 
ATOM   272  N  NE    . ARG A 1 58  ? 131.421 -14.752 97.983  1.00 8.98  ? 145  ARG A NE    1 
ATOM   273  C  CZ    . ARG A 1 58  ? 131.963 -15.336 99.052  1.00 9.54  ? 145  ARG A CZ    1 
ATOM   274  N  NH1   . ARG A 1 58  ? 131.195 -15.982 99.918  1.00 9.27  ? 145  ARG A NH1   1 
ATOM   275  N  NH2   . ARG A 1 58  ? 133.276 -15.263 99.256  1.00 8.84  ? 145  ARG A NH2   1 
ATOM   276  N  N     . TYR A 1 59  ? 134.171 -9.253  94.325  1.00 8.41  ? 146  TYR A N     1 
ATOM   277  C  CA    . TYR A 1 59  ? 134.988 -9.004  93.159  1.00 8.35  ? 146  TYR A CA    1 
ATOM   278  C  C     . TYR A 1 59  ? 135.431 -7.546  93.072  1.00 8.47  ? 146  TYR A C     1 
ATOM   279  O  O     . TYR A 1 59  ? 135.902 -7.100  92.033  1.00 8.25  ? 146  TYR A O     1 
ATOM   280  C  CB    . TYR A 1 59  ? 134.243 -9.473  91.877  1.00 8.58  ? 146  TYR A CB    1 
ATOM   281  C  CG    . TYR A 1 59  ? 133.691 -10.878 92.093  1.00 8.97  ? 146  TYR A CG    1 
ATOM   282  C  CD1   . TYR A 1 59  ? 134.562 -11.944 92.316  1.00 9.09  ? 146  TYR A CD1   1 
ATOM   283  C  CD2   . TYR A 1 59  ? 132.323 -11.121 92.145  1.00 9.59  ? 146  TYR A CD2   1 
ATOM   284  C  CE1   . TYR A 1 59  ? 134.088 -13.230 92.563  1.00 9.50  ? 146  TYR A CE1   1 
ATOM   285  C  CE2   . TYR A 1 59  ? 131.836 -12.412 92.380  1.00 9.44  ? 146  TYR A CE2   1 
ATOM   286  C  CZ    . TYR A 1 59  ? 132.734 -13.451 92.607  1.00 9.27  ? 146  TYR A CZ    1 
ATOM   287  O  OH    . TYR A 1 59  ? 132.270 -14.710 92.858  1.00 10.31 ? 146  TYR A OH    1 
ATOM   288  N  N     . ILE A 1 60  ? 135.318 -6.821  94.185  1.00 7.41  ? 147  ILE A N     1 
ATOM   289  C  CA    . ILE A 1 60  ? 135.756 -5.439  94.247  1.00 8.01  ? 147  ILE A CA    1 
ATOM   290  C  C     . ILE A 1 60  ? 136.669 -5.242  95.460  1.00 7.96  ? 147  ILE A C     1 
ATOM   291  O  O     . ILE A 1 60  ? 136.211 -5.342  96.610  1.00 7.83  ? 147  ILE A O     1 
ATOM   292  C  CB    . ILE A 1 60  ? 134.545 -4.489  94.360  1.00 8.17  ? 147  ILE A CB    1 
ATOM   293  C  CG1   . ILE A 1 60  ? 133.682 -4.602  93.084  1.00 8.72  ? 147  ILE A CG1   1 
ATOM   294  C  CG2   . ILE A 1 60  ? 134.976 -3.036  94.577  1.00 8.44  ? 147  ILE A CG2   1 
ATOM   295  C  CD1   . ILE A 1 60  ? 132.433 -3.737  93.119  1.00 9.22  ? 147  ILE A CD1   1 
ATOM   296  N  N     . LYS A 1 61  ? 137.937 -4.934  95.198  1.00 9.13  ? 148  LYS A N     1 
ATOM   297  C  CA    . LYS A 1 61  ? 138.921 -4.805  96.299  1.00 9.33  ? 148  LYS A CA    1 
ATOM   298  C  C     . LYS A 1 61  ? 138.600 -3.595  97.140  1.00 8.80  ? 148  LYS A C     1 
ATOM   299  O  O     . LYS A 1 61  ? 138.319 -2.507  96.612  1.00 8.14  ? 148  LYS A O     1 
ATOM   300  C  CB    . LYS A 1 61  ? 140.350 -4.703  95.751  1.00 11.43 ? 148  LYS A CB    1 
ATOM   301  C  CG    . LYS A 1 61  ? 140.971 -6.052  95.386  1.00 13.31 ? 148  LYS A CG    1 
ATOM   302  C  CD    . LYS A 1 61  ? 142.387 -5.899  94.848  1.00 15.76 ? 148  LYS A CD    1 
ATOM   303  C  CE    . LYS A 1 61  ? 142.433 -5.181  93.495  1.00 16.97 ? 148  LYS A CE    1 
ATOM   304  N  NZ    . LYS A 1 61  ? 141.616 -5.853  92.433  1.00 19.16 ? 148  LYS A NZ    1 
ATOM   305  N  N     . GLN A 1 62  ? 138.642 -3.776  98.460  1.00 7.14  ? 149  GLN A N     1 
ATOM   306  C  CA    . GLN A 1 62  ? 138.354 -2.696  99.405  1.00 7.64  ? 149  GLN A CA    1 
ATOM   307  C  C     . GLN A 1 62  ? 139.248 -1.469  99.160  1.00 7.96  ? 149  GLN A C     1 
ATOM   308  O  O     . GLN A 1 62  ? 138.783 -0.327  99.179  1.00 8.86  ? 149  GLN A O     1 
ATOM   309  C  CB    . GLN A 1 62  ? 138.615 -3.208  100.826 1.00 7.22  ? 149  GLN A CB    1 
ATOM   310  C  CG    . GLN A 1 62  ? 138.349 -2.181  101.930 1.00 7.02  ? 149  GLN A CG    1 
ATOM   311  C  CD    . GLN A 1 62  ? 136.886 -2.162  102.337 1.00 7.28  ? 149  GLN A CD    1 
ATOM   312  O  OE1   . GLN A 1 62  ? 136.095 -3.003  101.889 1.00 7.24  ? 149  GLN A OE1   1 
ATOM   313  N  NE2   . GLN A 1 62  ? 136.532 -1.249  103.237 1.00 6.84  ? 149  GLN A NE2   1 
ATOM   314  N  N     . LEU A 1 63  ? 140.531 -1.716  98.915  1.00 8.58  ? 150  LEU A N     1 
ATOM   315  C  CA    . LEU A 1 63  ? 141.515 -0.640  98.860  1.00 8.79  ? 150  LEU A CA    1 
ATOM   316  C  C     . LEU A 1 63  ? 141.988 -0.333  97.447  1.00 9.94  ? 150  LEU A C     1 
ATOM   317  O  O     . LEU A 1 63  ? 142.941 0.422   97.251  1.00 10.95 ? 150  LEU A O     1 
ATOM   318  C  CB    . LEU A 1 63  ? 142.709 -0.930  99.803  1.00 7.89  ? 150  LEU A CB    1 
ATOM   319  C  CG    . LEU A 1 63  ? 142.356 -1.106  101.294 1.00 8.37  ? 150  LEU A CG    1 
ATOM   320  C  CD1   . LEU A 1 63  ? 143.637 -1.219  102.137 1.00 8.60  ? 150  LEU A CD1   1 
ATOM   321  C  CD2   . LEU A 1 63  ? 141.477 0.037   101.786 1.00 8.29  ? 150  LEU A CD2   1 
ATOM   322  N  N     . GLY A 1 64  ? 141.320 -0.935  96.470  1.00 10.91 ? 151  GLY A N     1 
ATOM   323  C  CA    . GLY A 1 64  ? 141.610 -0.686  95.058  1.00 11.71 ? 151  GLY A CA    1 
ATOM   324  C  C     . GLY A 1 64  ? 143.065 -0.880  94.695  1.00 12.01 ? 151  GLY A C     1 
ATOM   325  O  O     . GLY A 1 64  ? 143.650 -1.948  94.924  1.00 12.79 ? 151  GLY A O     1 
ATOM   326  N  N     . GLY A 1 65  ? 143.671 0.168   94.149  1.00 11.42 ? 152  GLY A N     1 
ATOM   327  C  CA    . GLY A 1 65  ? 145.089 0.117   93.762  1.00 10.72 ? 152  GLY A CA    1 
ATOM   328  C  C     . GLY A 1 65  ? 146.052 -0.114  94.909  1.00 10.83 ? 152  GLY A C     1 
ATOM   329  O  O     . GLY A 1 65  ? 147.221 -0.446  94.684  1.00 10.90 ? 152  GLY A O     1 
ATOM   330  N  N     . GLY A 1 66  ? 145.575 0.060   96.148  1.00 10.70 ? 153  GLY A N     1 
ATOM   331  C  CA    . GLY A 1 66  ? 146.403 -0.192  97.338  1.00 9.76  ? 153  GLY A CA    1 
ATOM   332  C  C     . GLY A 1 66  ? 147.060 -1.570  97.357  1.00 9.12  ? 153  GLY A C     1 
ATOM   333  O  O     . GLY A 1 66  ? 148.144 -1.727  97.893  1.00 8.52  ? 153  GLY A O     1 
ATOM   334  N  N     . TYR A 1 67  ? 146.403 -2.563  96.757  1.00 7.77  ? 154  TYR A N     1 
ATOM   335  C  CA    . TYR A 1 67  ? 146.907 -3.941  96.760  1.00 7.74  ? 154  TYR A CA    1 
ATOM   336  C  C     . TYR A 1 67  ? 148.217 -4.014  95.997  1.00 7.75  ? 154  TYR A C     1 
ATOM   337  O  O     . TYR A 1 67  ? 149.056 -4.883  96.254  1.00 7.80  ? 154  TYR A O     1 
ATOM   338  C  CB    . TYR A 1 67  ? 145.857 -4.871  96.120  1.00 7.60  ? 154  TYR A CB    1 
ATOM   339  C  CG    . TYR A 1 67  ? 146.291 -6.313  95.887  1.00 6.92  ? 154  TYR A CG    1 
ATOM   340  C  CD1   . TYR A 1 67  ? 146.916 -7.065  96.886  1.00 7.24  ? 154  TYR A CD1   1 
ATOM   341  C  CD2   . TYR A 1 67  ? 146.003 -6.945  94.675  1.00 7.20  ? 154  TYR A CD2   1 
ATOM   342  C  CE1   . TYR A 1 67  ? 147.274 -8.393  96.659  1.00 7.04  ? 154  TYR A CE1   1 
ATOM   343  C  CE2   . TYR A 1 67  ? 146.352 -8.276  94.443  1.00 6.36  ? 154  TYR A CE2   1 
ATOM   344  C  CZ    . TYR A 1 67  ? 146.989 -8.992  95.431  1.00 6.93  ? 154  TYR A CZ    1 
ATOM   345  O  OH    . TYR A 1 67  ? 147.335 -10.312 95.219  1.00 6.22  ? 154  TYR A OH    1 
ATOM   346  N  N     . TYR A 1 68  ? 148.394 -3.086  95.049  1.00 8.22  ? 155  TYR A N     1 
ATOM   347  C  CA    . TYR A 1 68  ? 149.615 -3.043  94.230  1.00 7.95  ? 155  TYR A CA    1 
ATOM   348  C  C     . TYR A 1 68  ? 150.817 -2.440  94.982  1.00 8.04  ? 155  TYR A C     1 
ATOM   349  O  O     . TYR A 1 68  ? 151.959 -2.443  94.485  1.00 8.46  ? 155  TYR A O     1 
ATOM   350  C  CB    . TYR A 1 68  ? 149.327 -2.322  92.878  1.00 8.55  ? 155  TYR A CB    1 
ATOM   351  C  CG    . TYR A 1 68  ? 148.385 -3.111  92.018  1.00 8.56  ? 155  TYR A CG    1 
ATOM   352  C  CD1   . TYR A 1 68  ? 147.001 -2.968  92.152  1.00 8.43  ? 155  TYR A CD1   1 
ATOM   353  C  CD2   . TYR A 1 68  ? 148.868 -4.053  91.114  1.00 9.14  ? 155  TYR A CD2   1 
ATOM   354  C  CE1   . TYR A 1 68  ? 146.130 -3.740  91.387  1.00 9.73  ? 155  TYR A CE1   1 
ATOM   355  C  CE2   . TYR A 1 68  ? 147.994 -4.832  90.339  1.00 9.30  ? 155  TYR A CE2   1 
ATOM   356  C  CZ    . TYR A 1 68  ? 146.642 -4.657  90.471  1.00 9.37  ? 155  TYR A CZ    1 
ATOM   357  O  OH    . TYR A 1 68  ? 145.765 -5.418  89.738  1.00 11.09 ? 155  TYR A OH    1 
ATOM   358  N  N     . VAL A 1 69  ? 150.564 -1.961  96.205  1.00 6.86  ? 156  VAL A N     1 
ATOM   359  C  CA    . VAL A 1 69  ? 151.620 -1.415  97.094  1.00 7.40  ? 156  VAL A CA    1 
ATOM   360  C  C     . VAL A 1 69  ? 151.756 -2.232  98.390  1.00 6.96  ? 156  VAL A C     1 
ATOM   361  O  O     . VAL A 1 69  ? 152.880 -2.477  98.882  1.00 6.66  ? 156  VAL A O     1 
ATOM   362  C  CB    . VAL A 1 69  ? 151.373 0.094   97.365  1.00 7.24  ? 156  VAL A CB    1 
ATOM   363  C  CG1   . VAL A 1 69  ? 152.347 0.652   98.410  1.00 6.88  ? 156  VAL A CG1   1 
ATOM   364  C  CG2   . VAL A 1 69  ? 151.515 0.870   96.057  1.00 7.39  ? 156  VAL A CG2   1 
ATOM   365  N  N     . PHE A 1 70  ? 150.606 -2.668  98.903  1.00 7.11  ? 157  PHE A N     1 
ATOM   366  C  CA    . PHE A 1 70  ? 150.493 -3.485  100.113 1.00 7.41  ? 157  PHE A CA    1 
ATOM   367  C  C     . PHE A 1 70  ? 149.936 -4.852  99.748  1.00 7.34  ? 157  PHE A C     1 
ATOM   368  O  O     . PHE A 1 70  ? 148.733 -5.007  99.633  1.00 7.29  ? 157  PHE A O     1 
ATOM   369  C  CB    . PHE A 1 70  ? 149.518 -2.820  101.107 1.00 7.13  ? 157  PHE A CB    1 
ATOM   370  C  CG    . PHE A 1 70  ? 150.044 -1.555  101.764 1.00 7.42  ? 157  PHE A CG    1 
ATOM   371  C  CD1   . PHE A 1 70  ? 149.868 -0.315  101.158 1.00 7.61  ? 157  PHE A CD1   1 
ATOM   372  C  CD2   . PHE A 1 70  ? 150.672 -1.603  103.014 1.00 7.51  ? 157  PHE A CD2   1 
ATOM   373  C  CE1   . PHE A 1 70  ? 150.336 0.858   101.776 1.00 7.36  ? 157  PHE A CE1   1 
ATOM   374  C  CE2   . PHE A 1 70  ? 151.118 -0.441  103.642 1.00 8.09  ? 157  PHE A CE2   1 
ATOM   375  C  CZ    . PHE A 1 70  ? 150.951 0.797   103.017 1.00 7.57  ? 157  PHE A CZ    1 
ATOM   376  N  N     . PRO A 1 71  ? 150.808 -5.856  99.552  1.00 7.48  ? 158  PRO A N     1 
ATOM   377  C  CA    . PRO A 1 71  ? 150.345 -7.139  99.009  1.00 8.05  ? 158  PRO A CA    1 
ATOM   378  C  C     . PRO A 1 71  ? 149.394 -7.913  99.927  1.00 8.00  ? 158  PRO A C     1 
ATOM   379  O  O     . PRO A 1 71  ? 148.714 -8.818  99.463  1.00 7.88  ? 158  PRO A O     1 
ATOM   380  C  CB    . PRO A 1 71  ? 151.657 -7.914  98.777  1.00 9.57  ? 158  PRO A CB    1 
ATOM   381  C  CG    . PRO A 1 71  ? 152.676 -6.848  98.506  1.00 10.08 ? 158  PRO A CG    1 
ATOM   382  C  CD    . PRO A 1 71  ? 152.297 -5.722  99.435  1.00 9.39  ? 158  PRO A CD    1 
ATOM   383  N  N     . GLY A 1 72  ? 149.323 -7.561  101.205 1.00 7.48  ? 159  GLY A N     1 
ATOM   384  C  CA    . GLY A 1 72  ? 148.321 -8.198  102.062 1.00 7.61  ? 159  GLY A CA    1 
ATOM   385  C  C     . GLY A 1 72  ? 146.908 -7.680  101.818 1.00 8.03  ? 159  GLY A C     1 
ATOM   386  O  O     . GLY A 1 72  ? 145.950 -8.325  102.249 1.00 8.37  ? 159  GLY A O     1 
ATOM   387  N  N     . ALA A 1 73  ? 146.772 -6.532  101.132 1.00 7.74  ? 160  ALA A N     1 
ATOM   388  C  CA    . ALA A 1 73  ? 145.468 -5.869  100.978 1.00 7.43  ? 160  ALA A CA    1 
ATOM   389  C  C     . ALA A 1 73  ? 144.687 -6.404  99.769  1.00 7.34  ? 160  ALA A C     1 
ATOM   390  O  O     . ALA A 1 73  ? 144.285 -5.651  98.898  1.00 7.54  ? 160  ALA A O     1 
ATOM   391  C  CB    . ALA A 1 73  ? 145.608 -4.340  100.906 1.00 7.59  ? 160  ALA A CB    1 
ATOM   392  N  N     . SER A 1 74  ? 144.446 -7.714  99.822  1.00 8.73  ? 161  SER A N     1 
ATOM   393  C  CA    . SER A 1 74  ? 143.722 -8.496  98.833  1.00 9.11  ? 161  SER A CA    1 
ATOM   394  C  C     . SER A 1 74  ? 142.232 -8.537  99.173  1.00 8.39  ? 161  SER A C     1 
ATOM   395  O  O     . SER A 1 74  ? 141.413 -9.080  98.415  1.00 8.09  ? 161  SER A O     1 
ATOM   396  C  CB    . SER A 1 74  ? 144.291 -9.948  98.879  1.00 9.86  ? 161  SER A CB    1 
ATOM   397  O  OG    . SER A 1 74  ? 144.117 -10.496 100.216 1.00 13.06 ? 161  SER A OG    1 
ATOM   398  N  N     . HIS A 1 75  ? 141.864 -7.940  100.303 1.00 7.28  ? 162  HIS A N     1 
ATOM   399  C  CA    . HIS A 1 75  ? 140.499 -8.058  100.810 1.00 6.37  ? 162  HIS A CA    1 
ATOM   400  C  C     . HIS A 1 75  ? 139.468 -7.272  100.007 1.00 7.12  ? 162  HIS A C     1 
ATOM   401  O  O     . HIS A 1 75  ? 139.748 -6.191  99.458  1.00 7.66  ? 162  HIS A O     1 
ATOM   402  C  CB    . HIS A 1 75  ? 140.431 -7.737  102.303 1.00 6.45  ? 162  HIS A CB    1 
ATOM   403  C  CG    . HIS A 1 75  ? 140.893 -6.345  102.658 1.00 6.45  ? 162  HIS A CG    1 
ATOM   404  N  ND1   . HIS A 1 75  ? 142.144 -5.888  102.395 1.00 6.53  ? 162  HIS A ND1   1 
ATOM   405  C  CD2   . HIS A 1 75  ? 140.243 -5.331  103.333 1.00 6.23  ? 162  HIS A CD2   1 
ATOM   406  C  CE1   . HIS A 1 75  ? 142.270 -4.636  102.849 1.00 6.30  ? 162  HIS A CE1   1 
ATOM   407  N  NE2   . HIS A 1 75  ? 141.104 -4.288  103.425 1.00 5.80  ? 162  HIS A NE2   1 
ATOM   408  N  N     . ASN A 1 76  ? 138.269 -7.840  99.939  1.00 6.85  ? 163  ASN A N     1 
ATOM   409  C  CA    . ASN A 1 76  ? 137.184 -7.318  99.107  1.00 7.08  ? 163  ASN A CA    1 
ATOM   410  C  C     . ASN A 1 76  ? 136.059 -6.703  99.919  1.00 6.85  ? 163  ASN A C     1 
ATOM   411  O  O     . ASN A 1 76  ? 135.964 -6.872  101.147 1.00 6.87  ? 163  ASN A O     1 
ATOM   412  C  CB    . ASN A 1 76  ? 136.668 -8.436  98.185  1.00 7.16  ? 163  ASN A CB    1 
ATOM   413  C  CG    . ASN A 1 76  ? 137.766 -8.982  97.311  1.00 8.77  ? 163  ASN A CG    1 
ATOM   414  O  OD1   . ASN A 1 76  ? 138.373 -8.241  96.555  1.00 9.52  ? 163  ASN A OD1   1 
ATOM   415  N  ND2   . ASN A 1 76  ? 138.074 -10.262 97.455  1.00 8.86  ? 163  ASN A ND2   1 
ATOM   416  N  N     . ARG A 1 77  ? 135.178 -5.975  99.231  1.00 6.78  ? 164  ARG A N     1 
ATOM   417  C  CA    . ARG A 1 77  ? 134.103 -5.279  99.918  1.00 6.67  ? 164  ARG A CA    1 
ATOM   418  C  C     . ARG A 1 77  ? 133.116 -6.240  100.566 1.00 6.35  ? 164  ARG A C     1 
ATOM   419  O  O     . ARG A 1 77  ? 132.424 -5.871  101.522 1.00 6.51  ? 164  ARG A O     1 
ATOM   420  C  CB    . ARG A 1 77  ? 133.364 -4.342  98.921  1.00 7.01  ? 164  ARG A CB    1 
ATOM   421  C  CG    . ARG A 1 77  ? 134.140 -3.083  98.558  1.00 7.35  ? 164  ARG A CG    1 
ATOM   422  C  CD    . ARG A 1 77  ? 133.939 -1.967  99.590  1.00 7.63  ? 164  ARG A CD    1 
ATOM   423  N  NE    . ARG A 1 77  ? 135.018 -0.976  99.484  1.00 7.54  ? 164  ARG A NE    1 
ATOM   424  C  CZ    . ARG A 1 77  ? 135.200 0.056   100.307 1.00 7.69  ? 164  ARG A CZ    1 
ATOM   425  N  NH1   . ARG A 1 77  ? 134.345 0.299   101.311 1.00 8.90  ? 164  ARG A NH1   1 
ATOM   426  N  NH2   . ARG A 1 77  ? 136.224 0.877   100.110 1.00 8.54  ? 164  ARG A NH2   1 
ATOM   427  N  N     . PHE A 1 78  ? 133.058 -7.468  100.065 1.00 6.98  ? 165  PHE A N     1 
ATOM   428  C  CA    . PHE A 1 78  ? 132.146 -8.483  100.603 1.00 7.10  ? 165  PHE A CA    1 
ATOM   429  C  C     . PHE A 1 78  ? 132.372 -8.742  102.084 1.00 6.83  ? 165  PHE A C     1 
ATOM   430  O  O     . PHE A 1 78  ? 131.472 -8.591  102.912 1.00 6.73  ? 165  PHE A O     1 
ATOM   431  C  CB    . PHE A 1 78  ? 132.327 -9.791  99.816  1.00 8.00  ? 165  PHE A CB    1 
ATOM   432  C  CG    . PHE A 1 78  ? 131.519 -10.946 100.352 1.00 8.12  ? 165  PHE A CG    1 
ATOM   433  C  CD1   . PHE A 1 78  ? 130.167 -11.071 100.063 1.00 8.80  ? 165  PHE A CD1   1 
ATOM   434  C  CD2   . PHE A 1 78  ? 132.132 -11.928 101.127 1.00 7.92  ? 165  PHE A CD2   1 
ATOM   435  C  CE1   . PHE A 1 78  ? 129.433 -12.149 100.548 1.00 9.56  ? 165  PHE A CE1   1 
ATOM   436  C  CE2   . PHE A 1 78  ? 131.405 -13.012 101.606 1.00 8.99  ? 165  PHE A CE2   1 
ATOM   437  C  CZ    . PHE A 1 78  ? 130.052 -13.124 101.323 1.00 9.53  ? 165  PHE A CZ    1 
ATOM   438  N  N     . GLU A 1 79  ? 133.588 -9.152  102.426 1.00 6.57  ? 166  GLU A N     1 
ATOM   439  C  CA    . GLU A 1 79  ? 133.856 -9.489  103.819 1.00 7.05  ? 166  GLU A CA    1 
ATOM   440  C  C     . GLU A 1 79  ? 133.791 -8.246  104.729 1.00 6.66  ? 166  GLU A C     1 
ATOM   441  O  O     . GLU A 1 79  ? 133.371 -8.348  105.870 1.00 6.48  ? 166  GLU A O     1 
ATOM   442  C  CB    . GLU A 1 79  ? 135.172 -10.274 103.924 1.00 7.73  ? 166  GLU A CB    1 
ATOM   443  C  CG    . GLU A 1 79  ? 136.355 -9.660  103.197 1.00 8.20  ? 166  GLU A CG    1 
ATOM   444  C  CD    . GLU A 1 79  ? 136.514 -10.137 101.761 1.00 8.49  ? 166  GLU A CD    1 
ATOM   445  O  OE1   . GLU A 1 79  ? 137.664 -10.209 101.301 1.00 8.65  ? 166  GLU A OE1   1 
ATOM   446  O  OE2   . GLU A 1 79  ? 135.504 -10.467 101.097 1.00 8.18  ? 166  GLU A OE2   1 
ATOM   447  N  N     . HIS A 1 80  ? 134.190 -7.075  104.225 1.00 5.83  ? 167  HIS A N     1 
ATOM   448  C  CA    . HIS A 1 80  ? 133.985 -5.833  104.970 1.00 6.95  ? 167  HIS A CA    1 
ATOM   449  C  C     . HIS A 1 80  ? 132.523 -5.630  105.271 1.00 7.68  ? 167  HIS A C     1 
ATOM   450  O  O     . HIS A 1 80  ? 132.147 -5.273  106.396 1.00 7.84  ? 167  HIS A O     1 
ATOM   451  C  CB    . HIS A 1 80  ? 134.573 -4.651  104.192 1.00 7.02  ? 167  HIS A CB    1 
ATOM   452  C  CG    . HIS A 1 80  ? 134.098 -3.321  104.672 1.00 7.51  ? 167  HIS A CG    1 
ATOM   453  N  ND1   . HIS A 1 80  ? 134.369 -2.856  105.918 1.00 7.58  ? 167  HIS A ND1   1 
ATOM   454  C  CD2   . HIS A 1 80  ? 133.346 -2.340  104.041 1.00 8.30  ? 167  HIS A CD2   1 
ATOM   455  C  CE1   . HIS A 1 80  ? 133.808 -1.642  106.059 1.00 8.26  ? 167  HIS A CE1   1 
ATOM   456  N  NE2   . HIS A 1 80  ? 133.196 -1.333  104.914 1.00 8.30  ? 167  HIS A NE2   1 
ATOM   457  N  N     . SER A 1 81  ? 131.667 -5.871  104.278 1.00 7.90  ? 168  SER A N     1 
ATOM   458  C  CA    . SER A 1 81  ? 130.212 -5.684  104.482 1.00 8.29  ? 168  SER A CA    1 
ATOM   459  C  C     . SER A 1 81  ? 129.609 -6.647  105.518 1.00 8.02  ? 168  SER A C     1 
ATOM   460  O  O     . SER A 1 81  ? 128.782 -6.243  106.346 1.00 8.04  ? 168  SER A O     1 
ATOM   461  C  CB    . SER A 1 81  ? 129.475 -5.772  103.139 1.00 8.89  ? 168  SER A CB    1 
ATOM   462  O  OG    . SER A 1 81  ? 129.956 -4.768  102.238 1.00 9.28  ? 168  SER A OG    1 
ATOM   463  N  N     . LEU A 1 82  ? 130.054 -7.906  105.520 1.00 7.69  ? 169  LEU A N     1 
ATOM   464  C  CA    . LEU A 1 82  ? 129.644 -8.832  106.580 1.00 7.98  ? 169  LEU A CA    1 
ATOM   465  C  C     . LEU A 1 82  ? 130.022 -8.283  107.957 1.00 7.80  ? 169  LEU A C     1 
ATOM   466  O  O     . LEU A 1 82  ? 129.236 -8.370  108.915 1.00 7.90  ? 169  LEU A O     1 
ATOM   467  C  CB    . LEU A 1 82  ? 130.279 -10.216 106.385 1.00 8.34  ? 169  LEU A CB    1 
ATOM   468  C  CG    . LEU A 1 82  ? 129.902 -11.021 105.146 1.00 9.15  ? 169  LEU A CG    1 
ATOM   469  C  CD1   . LEU A 1 82  ? 130.579 -12.385 105.181 1.00 9.08  ? 169  LEU A CD1   1 
ATOM   470  C  CD2   . LEU A 1 82  ? 128.391 -11.182 105.049 1.00 10.01 ? 169  LEU A CD2   1 
ATOM   471  N  N     . GLY A 1 83  ? 131.233 -7.732  108.057 1.00 7.26  ? 170  GLY A N     1 
ATOM   472  C  CA    . GLY A 1 83  ? 131.729 -7.221  109.335 1.00 6.93  ? 170  GLY A CA    1 
ATOM   473  C  C     . GLY A 1 83  ? 130.919 -6.010  109.791 1.00 7.64  ? 170  GLY A C     1 
ATOM   474  O  O     . GLY A 1 83  ? 130.622 -5.872  110.970 1.00 7.91  ? 170  GLY A O     1 
ATOM   475  N  N     . VAL A 1 84  ? 130.580 -5.126  108.860 1.00 7.24  ? 171  VAL A N     1 
ATOM   476  C  CA    . VAL A 1 84  ? 129.771 -3.946  109.222 1.00 7.99  ? 171  VAL A CA    1 
ATOM   477  C  C     . VAL A 1 84  ? 128.364 -4.381  109.680 1.00 8.81  ? 171  VAL A C     1 
ATOM   478  O  O     . VAL A 1 84  ? 127.822 -3.842  110.676 1.00 8.86  ? 171  VAL A O     1 
ATOM   479  C  CB    . VAL A 1 84  ? 129.741 -2.903  108.087 1.00 8.28  ? 171  VAL A CB    1 
ATOM   480  C  CG1   . VAL A 1 84  ? 128.848 -1.700  108.445 1.00 8.48  ? 171  VAL A CG1   1 
ATOM   481  C  CG2   . VAL A 1 84  ? 131.144 -2.392  107.812 1.00 7.82  ? 171  VAL A CG2   1 
ATOM   482  N  N     . GLY A 1 85  ? 127.779 -5.349  108.975 1.00 9.56  ? 172  GLY A N     1 
ATOM   483  C  CA    . GLY A 1 85  ? 126.500 -5.948  109.402 1.00 10.25 ? 172  GLY A CA    1 
ATOM   484  C  C     . GLY A 1 85  ? 126.580 -6.491  110.821 1.00 11.04 ? 172  GLY A C     1 
ATOM   485  O  O     . GLY A 1 85  ? 125.722 -6.229  111.670 1.00 11.26 ? 172  GLY A O     1 
ATOM   486  N  N     . TYR A 1 86  ? 127.623 -7.272  111.075 1.00 9.94  ? 173  TYR A N     1 
ATOM   487  C  CA    . TYR A 1 86  ? 127.856 -7.856  112.380 1.00 10.25 ? 173  TYR A CA    1 
ATOM   488  C  C     . TYR A 1 86  ? 127.948 -6.788  113.476 1.00 9.73  ? 173  TYR A C     1 
ATOM   489  O  O     . TYR A 1 86  ? 127.268 -6.873  114.505 1.00 10.48 ? 173  TYR A O     1 
ATOM   490  C  CB    . TYR A 1 86  ? 129.160 -8.679  112.342 1.00 10.20 ? 173  TYR A CB    1 
ATOM   491  C  CG    . TYR A 1 86  ? 129.639 -9.073  113.710 1.00 10.44 ? 173  TYR A CG    1 
ATOM   492  C  CD1   . TYR A 1 86  ? 128.929 -10.011 114.464 1.00 12.53 ? 173  TYR A CD1   1 
ATOM   493  C  CD2   . TYR A 1 86  ? 130.795 -8.516  114.256 1.00 11.89 ? 173  TYR A CD2   1 
ATOM   494  C  CE1   . TYR A 1 86  ? 129.355 -10.376 115.730 1.00 14.17 ? 173  TYR A CE1   1 
ATOM   495  C  CE2   . TYR A 1 86  ? 131.231 -8.874  115.526 1.00 13.62 ? 173  TYR A CE2   1 
ATOM   496  C  CZ    . TYR A 1 86  ? 130.500 -9.815  116.249 1.00 14.77 ? 173  TYR A CZ    1 
ATOM   497  O  OH    . TYR A 1 86  ? 130.910 -10.168 117.515 1.00 18.17 ? 173  TYR A OH    1 
ATOM   498  N  N     . LEU A 1 87  ? 128.803 -5.794  113.269 1.00 9.29  ? 174  LEU A N     1 
ATOM   499  C  CA    . LEU A 1 87  ? 129.048 -4.773  114.293 1.00 9.47  ? 174  LEU A CA    1 
ATOM   500  C  C     . LEU A 1 87  ? 127.806 -3.905  114.556 1.00 10.38 ? 174  LEU A C     1 
ATOM   501  O  O     . LEU A 1 87  ? 127.555 -3.490  115.695 1.00 10.48 ? 174  LEU A O     1 
ATOM   502  C  CB    . LEU A 1 87  ? 130.205 -3.889  113.871 1.00 9.56  ? 174  LEU A CB    1 
ATOM   503  C  CG    . LEU A 1 87  ? 131.577 -4.557  113.914 1.00 9.17  ? 174  LEU A CG    1 
ATOM   504  C  CD1   . LEU A 1 87  ? 132.646 -3.527  113.565 1.00 9.82  ? 174  LEU A CD1   1 
ATOM   505  C  CD2   . LEU A 1 87  ? 131.840 -5.102  115.310 1.00 9.93  ? 174  LEU A CD2   1 
ATOM   506  N  N     . ALA A 1 88  ? 127.035 -3.646  113.501 1.00 10.67 ? 175  ALA A N     1 
ATOM   507  C  CA    . ALA A 1 88  ? 125.794 -2.870  113.626 1.00 11.39 ? 175  ALA A CA    1 
ATOM   508  C  C     . ALA A 1 88  ? 124.825 -3.593  114.572 1.00 12.31 ? 175  ALA A C     1 
ATOM   509  O  O     . ALA A 1 88  ? 124.283 -2.987  115.502 1.00 12.31 ? 175  ALA A O     1 
ATOM   510  C  CB    . ALA A 1 88  ? 125.162 -2.642  112.257 1.00 10.62 ? 175  ALA A CB    1 
ATOM   511  N  N     . GLY A 1 89  ? 124.643 -4.898  114.352 1.00 11.88 ? 176  GLY A N     1 
ATOM   512  C  CA    . GLY A 1 89  ? 123.882 -5.733  115.261 1.00 14.24 ? 176  GLY A CA    1 
ATOM   513  C  C     . GLY A 1 89  ? 124.464 -5.766  116.670 1.00 15.23 ? 176  GLY A C     1 
ATOM   514  O  O     . GLY A 1 89  ? 123.716 -5.703  117.647 1.00 16.10 ? 176  GLY A O     1 
ATOM   515  N  N     . CYS A 1 90  ? 125.794 -5.869  116.778 1.00 15.43 ? 177  CYS A N     1 
ATOM   516  C  CA    . CYS A 1 90  ? 126.475 -5.861  118.088 1.00 15.27 ? 177  CYS A CA    1 
ATOM   517  C  C     . CYS A 1 90  ? 126.121 -4.629  118.911 1.00 14.45 ? 177  CYS A C     1 
ATOM   518  O  O     . CYS A 1 90  ? 125.736 -4.730  120.087 1.00 15.67 ? 177  CYS A O     1 
ATOM   519  C  CB    . CYS A 1 90  ? 127.980 -5.828  117.900 1.00 17.51 ? 177  CYS A CB    1 
ATOM   520  S  SG    . CYS A 1 90  ? 128.653 -7.435  117.549 1.00 23.94 ? 177  CYS A SG    1 
ATOM   521  N  N     . LEU A 1 91  ? 126.282 -3.467  118.294 1.00 12.91 ? 178  LEU A N     1 
ATOM   522  C  CA    . LEU A 1 91  ? 126.059 -2.213  118.990 1.00 14.17 ? 178  LEU A CA    1 
ATOM   523  C  C     . LEU A 1 91  ? 124.583 -2.036  119.390 1.00 15.24 ? 178  LEU A C     1 
ATOM   524  O  O     . LEU A 1 91  ? 124.290 -1.699  120.541 1.00 14.96 ? 178  LEU A O     1 
ATOM   525  C  CB    . LEU A 1 91  ? 126.538 -1.024  118.163 1.00 12.01 ? 178  LEU A CB    1 
ATOM   526  C  CG    . LEU A 1 91  ? 126.288 0.376   118.764 1.00 11.33 ? 178  LEU A CG    1 
ATOM   527  C  CD1   . LEU A 1 91  ? 126.833 0.545   120.172 1.00 12.41 ? 178  LEU A CD1   1 
ATOM   528  C  CD2   . LEU A 1 91  ? 126.876 1.443   117.849 1.00 12.52 ? 178  LEU A CD2   1 
ATOM   529  N  N     . VAL A 1 92  ? 123.673 -2.265  118.450 1.00 16.84 ? 179  VAL A N     1 
ATOM   530  C  CA    . VAL A 1 92  ? 122.233 -2.151  118.766 1.00 19.13 ? 179  VAL A CA    1 
ATOM   531  C  C     . VAL A 1 92  ? 121.803 -3.129  119.871 1.00 19.81 ? 179  VAL A C     1 
ATOM   532  O  O     . VAL A 1 92  ? 121.061 -2.734  120.781 1.00 20.35 ? 179  VAL A O     1 
ATOM   533  C  CB    . VAL A 1 92  ? 121.316 -2.202  117.508 1.00 19.27 ? 179  VAL A CB    1 
ATOM   534  C  CG1   . VAL A 1 92  ? 121.380 -3.556  116.816 1.00 21.26 ? 179  VAL A CG1   1 
ATOM   535  C  CG2   . VAL A 1 92  ? 119.875 -1.870  117.878 1.00 20.16 ? 179  VAL A CG2   1 
ATOM   536  N  N     . HIS A 1 93  ? 122.295 -4.374  119.831 1.00 18.72 ? 180  HIS A N     1 
ATOM   537  C  CA    A HIS A 1 93  ? 121.992 -5.339  120.890 0.50 19.63 ? 180  HIS A CA    1 
ATOM   538  C  CA    B HIS A 1 93  ? 122.020 -5.355  120.886 0.50 19.81 ? 180  HIS A CA    1 
ATOM   539  C  C     . HIS A 1 93  ? 122.501 -4.892  122.234 1.00 19.79 ? 180  HIS A C     1 
ATOM   540  O  O     . HIS A 1 93  ? 121.779 -4.995  123.234 1.00 21.31 ? 180  HIS A O     1 
ATOM   541  C  CB    A HIS A 1 93  ? 122.516 -6.740  120.555 0.50 20.03 ? 180  HIS A CB    1 
ATOM   542  C  CB    B HIS A 1 93  ? 122.642 -6.717  120.555 0.50 20.48 ? 180  HIS A CB    1 
ATOM   543  C  CG    A HIS A 1 93  ? 121.995 -7.818  121.480 0.50 21.02 ? 180  HIS A CG    1 
ATOM   544  C  CG    B HIS A 1 93  ? 121.681 -7.693  119.918 0.50 21.93 ? 180  HIS A CG    1 
ATOM   545  N  ND1   A HIS A 1 93  ? 120.799 -8.410  121.299 0.50 21.52 ? 180  HIS A ND1   1 
ATOM   546  N  ND1   B HIS A 1 93  ? 121.994 -8.408  118.819 0.50 22.73 ? 180  HIS A ND1   1 
ATOM   547  C  CD2   A HIS A 1 93  ? 122.551 -8.393  122.623 0.50 21.37 ? 180  HIS A CD2   1 
ATOM   548  C  CD2   B HIS A 1 93  ? 120.386 -8.068  120.278 0.50 22.45 ? 180  HIS A CD2   1 
ATOM   549  C  CE1   A HIS A 1 93  ? 120.600 -9.324  122.272 0.50 21.72 ? 180  HIS A CE1   1 
ATOM   550  C  CE1   B HIS A 1 93  ? 120.952 -9.198  118.488 0.50 23.02 ? 180  HIS A CE1   1 
ATOM   551  N  NE2   A HIS A 1 93  ? 121.673 -9.310  123.082 0.50 21.71 ? 180  HIS A NE2   1 
ATOM   552  N  NE2   B HIS A 1 93  ? 119.970 -8.987  119.380 0.50 22.99 ? 180  HIS A NE2   1 
ATOM   553  N  N     . ALA A 1 94  ? 123.731 -4.375  122.276 1.00 17.66 ? 181  ALA A N     1 
ATOM   554  C  CA    . ALA A 1 94  ? 124.349 -3.916  123.524 1.00 18.35 ? 181  ALA A CA    1 
ATOM   555  C  C     . ALA A 1 94  ? 123.547 -2.794  124.169 1.00 19.03 ? 181  ALA A C     1 
ATOM   556  O  O     . ALA A 1 94  ? 123.311 -2.803  125.389 1.00 18.99 ? 181  ALA A O     1 
ATOM   557  C  CB    . ALA A 1 94  ? 125.773 -3.442  123.268 1.00 18.16 ? 181  ALA A CB    1 
ATOM   558  N  N     . LEU A 1 95  ? 123.160 -1.823  123.350 1.00 17.18 ? 182  LEU A N     1 
ATOM   559  C  CA    . LEU A 1 95  ? 122.359 -0.690  123.829 1.00 19.77 ? 182  LEU A CA    1 
ATOM   560  C  C     . LEU A 1 95  ? 121.038 -1.192  124.420 1.00 20.13 ? 182  LEU A C     1 
ATOM   561  O  O     . LEU A 1 95  ? 120.616 -0.726  125.486 1.00 20.68 ? 182  LEU A O     1 
ATOM   562  C  CB    . LEU A 1 95  ? 122.113 0.321   122.700 1.00 19.48 ? 182  LEU A CB    1 
ATOM   563  C  CG    . LEU A 1 95  ? 123.324 1.083   122.143 1.00 18.99 ? 182  LEU A CG    1 
ATOM   564  C  CD1   . LEU A 1 95  ? 122.930 1.930   120.941 1.00 18.56 ? 182  LEU A CD1   1 
ATOM   565  C  CD2   . LEU A 1 95  ? 124.017 1.932   123.201 1.00 18.55 ? 182  LEU A CD2   1 
ATOM   566  N  N     . GLY A 1 96  ? 120.423 -2.165  123.746 1.00 19.50 ? 183  GLY A N     1 
ATOM   567  C  CA    . GLY A 1 96  ? 119.135 -2.728  124.155 1.00 22.75 ? 183  GLY A CA    1 
ATOM   568  C  C     . GLY A 1 96  ? 119.209 -3.491  125.459 1.00 25.00 ? 183  GLY A C     1 
ATOM   569  O  O     . GLY A 1 96  ? 118.321 -3.367  126.314 1.00 24.48 ? 183  GLY A O     1 
ATOM   570  N  N     . GLU A 1 97  ? 120.274 -4.282  125.610 1.00 25.48 ? 184  GLU A N     1 
ATOM   571  C  CA    . GLU A 1 97  ? 120.501 -5.053  126.825 1.00 27.99 ? 184  GLU A CA    1 
ATOM   572  C  C     . GLU A 1 97  ? 120.733 -4.156  128.053 1.00 26.59 ? 184  GLU A C     1 
ATOM   573  O  O     . GLU A 1 97  ? 120.245 -4.457  129.141 1.00 26.20 ? 184  GLU A O     1 
ATOM   574  C  CB    . GLU A 1 97  ? 121.660 -6.041  126.621 1.00 30.89 ? 184  GLU A CB    1 
ATOM   575  C  CG    . GLU A 1 97  ? 121.962 -6.920  127.827 1.00 38.16 ? 184  GLU A CG    1 
ATOM   576  C  CD    . GLU A 1 97  ? 122.433 -8.312  127.442 1.00 43.21 ? 184  GLU A CD    1 
ATOM   577  O  OE1   . GLU A 1 97  ? 123.644 -8.601  127.599 1.00 47.52 ? 184  GLU A OE1   1 
ATOM   578  O  OE2   . GLU A 1 97  ? 121.593 -9.122  126.984 1.00 47.61 ? 184  GLU A OE2   1 
ATOM   579  N  N     . LYS A 1 98  ? 121.467 -3.058  127.872 1.00 25.64 ? 185  LYS A N     1 
ATOM   580  C  CA    . LYS A 1 98  ? 121.751 -2.139  128.976 1.00 26.14 ? 185  LYS A CA    1 
ATOM   581  C  C     . LYS A 1 98  ? 120.561 -1.243  129.305 1.00 25.55 ? 185  LYS A C     1 
ATOM   582  O  O     . LYS A 1 98  ? 120.371 -0.884  130.460 1.00 25.46 ? 185  LYS A O     1 
ATOM   583  C  CB    . LYS A 1 98  ? 122.978 -1.268  128.686 1.00 26.81 ? 185  LYS A CB    1 
ATOM   584  C  CG    . LYS A 1 98  ? 124.321 -1.965  128.868 1.00 32.64 ? 185  LYS A CG    1 
ATOM   585  C  CD    . LYS A 1 98  ? 124.770 -2.010  130.329 1.00 35.58 ? 185  LYS A CD    1 
ATOM   586  C  CE    . LYS A 1 98  ? 124.533 -3.388  130.949 1.00 37.95 ? 185  LYS A CE    1 
ATOM   587  N  NZ    . LYS A 1 98  ? 124.696 -3.352  132.438 1.00 40.16 ? 185  LYS A NZ    1 
ATOM   588  N  N     . GLN A 1 99  ? 119.773 -0.888  128.292 1.00 23.58 ? 186  GLN A N     1 
ATOM   589  C  CA    . GLN A 1 99  ? 118.643 0.026   128.480 1.00 24.09 ? 186  GLN A CA    1 
ATOM   590  C  C     . GLN A 1 99  ? 117.348 -0.541  127.898 1.00 22.97 ? 186  GLN A C     1 
ATOM   591  O  O     . GLN A 1 99  ? 116.921 -0.141  126.812 1.00 23.38 ? 186  GLN A O     1 
ATOM   592  C  CB    . GLN A 1 99  ? 118.977 1.399   127.895 1.00 23.88 ? 186  GLN A CB    1 
ATOM   593  C  CG    . GLN A 1 99  ? 120.066 2.122   128.668 1.00 24.79 ? 186  GLN A CG    1 
ATOM   594  C  CD    . GLN A 1 99  ? 120.496 3.429   128.028 1.00 27.33 ? 186  GLN A CD    1 
ATOM   595  O  OE1   . GLN A 1 99  ? 121.532 3.494   127.368 1.00 27.38 ? 186  GLN A OE1   1 
ATOM   596  N  NE2   . GLN A 1 99  ? 119.705 4.479   128.224 1.00 27.97 ? 186  GLN A NE2   1 
ATOM   597  N  N     . PRO A 1 100 ? 116.723 -1.503  128.610 1.00 23.88 ? 187  PRO A N     1 
ATOM   598  C  CA    . PRO A 1 100 ? 115.494 -2.148  128.138 1.00 25.14 ? 187  PRO A CA    1 
ATOM   599  C  C     . PRO A 1 100 ? 114.389 -1.134  127.852 1.00 26.93 ? 187  PRO A C     1 
ATOM   600  O  O     . PRO A 1 100 ? 113.546 -1.371  126.987 1.00 26.02 ? 187  PRO A O     1 
ATOM   601  C  CB    . PRO A 1 100 ? 115.090 -3.045  129.309 1.00 26.73 ? 187  PRO A CB    1 
ATOM   602  C  CG    . PRO A 1 100 ? 116.352 -3.298  130.053 1.00 26.47 ? 187  PRO A CG    1 
ATOM   603  C  CD    . PRO A 1 100 ? 117.172 -2.055  129.904 1.00 25.25 ? 187  PRO A CD    1 
ATOM   604  N  N     . GLU A 1 101 ? 114.432 0.005   128.544 1.00 27.69 ? 188  GLU A N     1 
ATOM   605  C  CA    . GLU A 1 101 ? 113.429 1.057   128.389 1.00 27.55 ? 188  GLU A CA    1 
ATOM   606  C  C     . GLU A 1 101 ? 113.402 1.656   126.987 1.00 27.02 ? 188  GLU A C     1 
ATOM   607  O  O     . GLU A 1 101 ? 112.450 2.358   126.632 1.00 27.06 ? 188  GLU A O     1 
ATOM   608  C  CB    . GLU A 1 101 ? 113.653 2.171   129.415 1.00 28.67 ? 188  GLU A CB    1 
ATOM   609  C  CG    . GLU A 1 101 ? 114.777 3.136   129.062 1.00 27.98 ? 188  GLU A CG    1 
ATOM   610  C  CD    . GLU A 1 101 ? 116.125 2.722   129.631 1.00 29.27 ? 188  GLU A CD    1 
ATOM   611  O  OE1   . GLU A 1 101 ? 116.295 1.546   130.024 1.00 29.96 ? 188  GLU A OE1   1 
ATOM   612  O  OE2   . GLU A 1 101 ? 117.025 3.584   129.681 1.00 27.51 ? 188  GLU A OE2   1 
ATOM   613  N  N     . LEU A 1 102 ? 114.448 1.389   126.195 1.00 23.64 ? 189  LEU A N     1 
ATOM   614  C  CA    . LEU A 1 102 ? 114.513 1.900   124.823 1.00 23.86 ? 189  LEU A CA    1 
ATOM   615  C  C     . LEU A 1 102 ? 113.569 1.188   123.845 1.00 22.82 ? 189  LEU A C     1 
ATOM   616  O  O     . LEU A 1 102 ? 113.307 1.691   122.749 1.00 22.52 ? 189  LEU A O     1 
ATOM   617  C  CB    . LEU A 1 102 ? 115.961 1.863   124.299 1.00 23.67 ? 189  LEU A CB    1 
ATOM   618  C  CG    . LEU A 1 102 ? 116.981 2.722   125.058 1.00 23.39 ? 189  LEU A CG    1 
ATOM   619  C  CD1   . LEU A 1 102 ? 118.392 2.476   124.520 1.00 24.36 ? 189  LEU A CD1   1 
ATOM   620  C  CD2   . LEU A 1 102 ? 116.626 4.204   124.998 1.00 22.30 ? 189  LEU A CD2   1 
ATOM   621  N  N     . GLN A 1 103 ? 113.072 0.020   124.247 1.00 22.61 ? 190  GLN A N     1 
ATOM   622  C  CA    . GLN A 1 103 ? 112.169 -0.810  123.429 1.00 23.15 ? 190  GLN A CA    1 
ATOM   623  C  C     . GLN A 1 103 ? 112.766 -1.179  122.061 1.00 23.00 ? 190  GLN A C     1 
ATOM   624  O  O     . GLN A 1 103 ? 112.069 -1.176  121.043 1.00 21.85 ? 190  GLN A O     1 
ATOM   625  C  CB    . GLN A 1 103 ? 110.789 -0.140  123.243 1.00 24.97 ? 190  GLN A CB    1 
ATOM   626  C  CG    . GLN A 1 103 ? 110.109 0.279   124.536 1.00 25.28 ? 190  GLN A CG    1 
ATOM   627  C  CD    . GLN A 1 103 ? 108.731 0.877   124.307 1.00 26.52 ? 190  GLN A CD    1 
ATOM   628  O  OE1   . GLN A 1 103 ? 108.314 1.116   123.170 1.00 26.15 ? 190  GLN A OE1   1 
ATOM   629  N  NE2   . GLN A 1 103 ? 108.014 1.122   125.395 1.00 25.94 ? 190  GLN A NE2   1 
ATOM   630  N  N     . ILE A 1 104 ? 114.062 -1.485  122.033 1.00 24.40 ? 191  ILE A N     1 
ATOM   631  C  CA    . ILE A 1 104 ? 114.690 -1.990  120.809 1.00 22.86 ? 191  ILE A CA    1 
ATOM   632  C  C     . ILE A 1 104 ? 114.179 -3.405  120.573 1.00 22.72 ? 191  ILE A C     1 
ATOM   633  O  O     . ILE A 1 104 ? 114.309 -4.266  121.441 1.00 24.10 ? 191  ILE A O     1 
ATOM   634  C  CB    . ILE A 1 104 ? 116.228 -2.004  120.918 1.00 23.11 ? 191  ILE A CB    1 
ATOM   635  C  CG1   . ILE A 1 104 ? 116.779 -0.587  120.842 1.00 22.45 ? 191  ILE A CG1   1 
ATOM   636  C  CG2   . ILE A 1 104 ? 116.840 -2.877  119.816 1.00 23.20 ? 191  ILE A CG2   1 
ATOM   637  C  CD1   . ILE A 1 104 ? 118.068 -0.387  121.608 1.00 22.91 ? 191  ILE A CD1   1 
ATOM   638  N  N     . SER A 1 105 ? 113.593 -3.639  119.404 1.00 22.84 ? 192  SER A N     1 
ATOM   639  C  CA    . SER A 1 105 ? 113.025 -4.948  119.083 1.00 23.55 ? 192  SER A CA    1 
ATOM   640  C  C     . SER A 1 105 ? 113.946 -5.745  118.155 1.00 24.25 ? 192  SER A C     1 
ATOM   641  O  O     . SER A 1 105 ? 114.863 -5.180  117.560 1.00 23.12 ? 192  SER A O     1 
ATOM   642  C  CB    . SER A 1 105 ? 111.669 -4.773  118.414 1.00 23.66 ? 192  SER A CB    1 
ATOM   643  O  OG    . SER A 1 105 ? 111.805 -4.219  117.114 1.00 24.61 ? 192  SER A OG    1 
ATOM   644  N  N     . GLU A 1 106 ? 113.675 -7.045  118.023 1.00 25.86 ? 193  GLU A N     1 
ATOM   645  C  CA    . GLU A 1 106 ? 114.376 -7.904  117.058 1.00 27.51 ? 193  GLU A CA    1 
ATOM   646  C  C     . GLU A 1 106 ? 114.235 -7.337  115.649 1.00 25.56 ? 193  GLU A C     1 
ATOM   647  O  O     . GLU A 1 106 ? 115.164 -7.409  114.850 1.00 23.70 ? 193  GLU A O     1 
ATOM   648  C  CB    . GLU A 1 106 ? 113.855 -9.349  117.115 1.00 31.02 ? 193  GLU A CB    1 
ATOM   649  C  CG    . GLU A 1 106 ? 114.485 -10.279 116.081 1.00 36.40 ? 193  GLU A CG    1 
ATOM   650  C  CD    . GLU A 1 106 ? 113.813 -11.638 116.002 1.00 39.54 ? 193  GLU A CD    1 
ATOM   651  O  OE1   . GLU A 1 106 ? 114.051 -12.474 116.902 1.00 43.50 ? 193  GLU A OE1   1 
ATOM   652  O  OE2   . GLU A 1 106 ? 113.059 -11.877 115.030 1.00 41.64 ? 193  GLU A OE2   1 
ATOM   653  N  N     . ARG A 1 107 ? 113.066 -6.769  115.355 1.00 24.31 ? 194  ARG A N     1 
ATOM   654  C  CA    . ARG A 1 107 ? 112.828 -6.090  114.090 1.00 23.44 ? 194  ARG A CA    1 
ATOM   655  C  C     . ARG A 1 107 ? 113.823 -4.939  113.874 1.00 21.33 ? 194  ARG A C     1 
ATOM   656  O  O     . ARG A 1 107 ? 114.383 -4.796  112.778 1.00 21.83 ? 194  ARG A O     1 
ATOM   657  C  CB    . ARG A 1 107 ? 111.377 -5.587  114.015 1.00 25.00 ? 194  ARG A CB    1 
ATOM   658  C  CG    . ARG A 1 107 ? 111.052 -4.763  112.779 1.00 26.34 ? 194  ARG A CG    1 
ATOM   659  C  CD    . ARG A 1 107 ? 109.650 -4.170  112.871 1.00 27.95 ? 194  ARG A CD    1 
ATOM   660  N  NE    . ARG A 1 107 ? 109.462 -3.082  111.915 1.00 28.46 ? 194  ARG A NE    1 
ATOM   661  C  CZ    . ARG A 1 107 ? 108.526 -2.139  112.014 1.00 29.13 ? 194  ARG A CZ    1 
ATOM   662  N  NH1   . ARG A 1 107 ? 107.673 -2.136  113.035 1.00 30.37 ? 194  ARG A NH1   1 
ATOM   663  N  NH2   . ARG A 1 107 ? 108.449 -1.193  111.092 1.00 27.68 ? 194  ARG A NH2   1 
ATOM   664  N  N     . ASP A 1 108 ? 114.039 -4.127  114.909 1.00 19.80 ? 195  ASP A N     1 
ATOM   665  C  CA    . ASP A 1 108 ? 114.995 -3.022  114.824 1.00 19.25 ? 195  ASP A CA    1 
ATOM   666  C  C     . ASP A 1 108 ? 116.414 -3.545  114.567 1.00 18.52 ? 195  ASP A C     1 
ATOM   667  O  O     . ASP A 1 108 ? 117.130 -2.998  113.723 1.00 18.38 ? 195  ASP A O     1 
ATOM   668  C  CB    . ASP A 1 108 ? 114.994 -2.170  116.095 1.00 19.80 ? 195  ASP A CB    1 
ATOM   669  C  CG    . ASP A 1 108 ? 113.691 -1.418  116.307 1.00 21.29 ? 195  ASP A CG    1 
ATOM   670  O  OD1   . ASP A 1 108 ? 113.057 -0.999  115.306 1.00 21.36 ? 195  ASP A OD1   1 
ATOM   671  O  OD2   . ASP A 1 108 ? 113.316 -1.254  117.486 1.00 22.41 ? 195  ASP A OD2   1 
ATOM   672  N  N     . VAL A 1 109 ? 116.794 -4.600  115.293 1.00 18.18 ? 196  VAL A N     1 
ATOM   673  C  CA    . VAL A 1 109 ? 118.136 -5.197  115.185 1.00 17.53 ? 196  VAL A CA    1 
ATOM   674  C  C     . VAL A 1 109 ? 118.344 -5.670  113.742 1.00 16.84 ? 196  VAL A C     1 
ATOM   675  O  O     . VAL A 1 109 ? 119.354 -5.340  113.114 1.00 16.00 ? 196  VAL A O     1 
ATOM   676  C  CB    . VAL A 1 109 ? 118.332 -6.353  116.208 1.00 18.49 ? 196  VAL A CB    1 
ATOM   677  C  CG1   . VAL A 1 109 ? 119.658 -7.082  115.988 1.00 17.37 ? 196  VAL A CG1   1 
ATOM   678  C  CG2   . VAL A 1 109 ? 118.258 -5.832  117.640 1.00 18.22 ? 196  VAL A CG2   1 
ATOM   679  N  N     . LEU A 1 110 ? 117.361 -6.392  113.196 1.00 16.49 ? 197  LEU A N     1 
ATOM   680  C  CA    . LEU A 1 110 ? 117.465 -6.873  111.809 1.00 16.88 ? 197  LEU A CA    1 
ATOM   681  C  C     . LEU A 1 110 ? 117.609 -5.747  110.801 1.00 16.29 ? 197  LEU A C     1 
ATOM   682  O  O     . LEU A 1 110 ? 118.410 -5.840  109.865 1.00 14.12 ? 197  LEU A O     1 
ATOM   683  C  CB    . LEU A 1 110 ? 116.295 -7.786  111.434 1.00 18.44 ? 197  LEU A CB    1 
ATOM   684  C  CG    . LEU A 1 110 ? 116.353 -9.191  112.033 1.00 20.04 ? 197  LEU A CG    1 
ATOM   685  C  CD1   . LEU A 1 110 ? 115.027 -9.921  111.846 1.00 20.67 ? 197  LEU A CD1   1 
ATOM   686  C  CD2   . LEU A 1 110 ? 117.500 -9.975  111.406 1.00 19.02 ? 197  LEU A CD2   1 
ATOM   687  N  N     . CYS A 1 111 ? 116.840 -4.672  110.979 1.00 16.89 ? 198  CYS A N     1 
ATOM   688  C  CA    . CYS A 1 111 ? 116.903 -3.539  110.055 1.00 16.21 ? 198  CYS A CA    1 
ATOM   689  C  C     . CYS A 1 111 ? 118.265 -2.858  110.084 1.00 15.53 ? 198  CYS A C     1 
ATOM   690  O  O     . CYS A 1 111 ? 118.801 -2.470  109.038 1.00 15.00 ? 198  CYS A O     1 
ATOM   691  C  CB    . CYS A 1 111 ? 115.805 -2.519  110.371 1.00 18.52 ? 198  CYS A CB    1 
ATOM   692  S  SG    . CYS A 1 111 ? 114.185 -3.168  109.917 1.00 23.26 ? 198  CYS A SG    1 
ATOM   693  N  N     . VAL A 1 112 ? 118.823 -2.724  111.278 1.00 16.20 ? 199  VAL A N     1 
ATOM   694  C  CA    . VAL A 1 112 ? 120.157 -2.145  111.438 1.00 16.41 ? 199  VAL A CA    1 
ATOM   695  C  C     . VAL A 1 112 ? 121.245 -3.075  110.829 1.00 15.70 ? 199  VAL A C     1 
ATOM   696  O  O     . VAL A 1 112 ? 122.149 -2.602  110.118 1.00 15.35 ? 199  VAL A O     1 
ATOM   697  C  CB    . VAL A 1 112 ? 120.435 -1.753  112.909 1.00 17.60 ? 199  VAL A CB    1 
ATOM   698  C  CG1   . VAL A 1 112 ? 121.885 -1.350  113.107 1.00 18.85 ? 199  VAL A CG1   1 
ATOM   699  C  CG2   . VAL A 1 112 ? 119.533 -0.578  113.330 1.00 17.13 ? 199  VAL A CG2   1 
ATOM   700  N  N     . GLN A 1 113 ? 121.145 -4.376  111.095 1.00 15.17 ? 200  GLN A N     1 
ATOM   701  C  CA    . GLN A 1 113 ? 122.039 -5.371  110.454 1.00 14.99 ? 200  GLN A CA    1 
ATOM   702  C  C     . GLN A 1 113 ? 121.969 -5.324  108.924 1.00 14.36 ? 200  GLN A C     1 
ATOM   703  O  O     . GLN A 1 113 ? 123.000 -5.358  108.230 1.00 13.19 ? 200  GLN A O     1 
ATOM   704  C  CB    . GLN A 1 113 ? 121.707 -6.784  110.943 1.00 15.73 ? 200  GLN A CB    1 
ATOM   705  C  CG    . GLN A 1 113 ? 122.125 -7.063  112.377 1.00 17.06 ? 200  GLN A CG    1 
ATOM   706  C  CD    . GLN A 1 113 ? 121.736 -8.463  112.822 1.00 19.05 ? 200  GLN A CD    1 
ATOM   707  O  OE1   . GLN A 1 113 ? 120.585 -8.876  112.687 1.00 21.34 ? 200  GLN A OE1   1 
ATOM   708  N  NE2   . GLN A 1 113 ? 122.699 -9.204  113.337 1.00 21.36 ? 200  GLN A NE2   1 
ATOM   709  N  N     . ILE A 1 114 ? 120.750 -5.228  108.386 1.00 13.33 ? 201  ILE A N     1 
ATOM   710  C  CA    . ILE A 1 114 ? 120.589 -5.176  106.936 1.00 12.60 ? 201  ILE A CA    1 
ATOM   711  C  C     . ILE A 1 114 ? 121.234 -3.931  106.344 1.00 11.94 ? 201  ILE A C     1 
ATOM   712  O  O     . ILE A 1 114 ? 121.882 -3.995  105.301 1.00 11.67 ? 201  ILE A O     1 
ATOM   713  C  CB    . ILE A 1 114 ? 119.111 -5.296  106.487 1.00 12.65 ? 201  ILE A CB    1 
ATOM   714  C  CG1   . ILE A 1 114 ? 118.590 -6.706  106.793 1.00 13.93 ? 201  ILE A CG1   1 
ATOM   715  C  CG2   . ILE A 1 114 ? 119.018 -4.999  104.999 1.00 12.44 ? 201  ILE A CG2   1 
ATOM   716  C  CD1   . ILE A 1 114 ? 117.086 -6.881  106.687 1.00 13.88 ? 201  ILE A CD1   1 
ATOM   717  N  N     . ALA A 1 115 ? 121.070 -2.792  107.013 1.00 11.68 ? 202  ALA A N     1 
ATOM   718  C  CA    . ALA A 1 115 ? 121.711 -1.571  106.556 1.00 11.49 ? 202  ALA A CA    1 
ATOM   719  C  C     . ALA A 1 115 ? 123.242 -1.707  106.598 1.00 11.71 ? 202  ALA A C     1 
ATOM   720  O  O     . ALA A 1 115 ? 123.932 -1.289  105.667 1.00 11.49 ? 202  ALA A O     1 
ATOM   721  C  CB    . ALA A 1 115 ? 121.260 -0.386  107.401 1.00 12.53 ? 202  ALA A CB    1 
ATOM   722  N  N     . GLY A 1 116 ? 123.756 -2.307  107.671 1.00 12.43 ? 203  GLY A N     1 
ATOM   723  C  CA    . GLY A 1 116 ? 125.197 -2.558  107.783 1.00 11.75 ? 203  GLY A CA    1 
ATOM   724  C  C     . GLY A 1 116 ? 125.689 -3.456  106.651 1.00 11.29 ? 203  GLY A C     1 
ATOM   725  O  O     . GLY A 1 116 ? 126.682 -3.140  105.985 1.00 10.93 ? 203  GLY A O     1 
ATOM   726  N  N     . LEU A 1 117 ? 124.965 -4.553  106.396 1.00 11.67 ? 204  LEU A N     1 
ATOM   727  C  CA    . LEU A 1 117 ? 125.340 -5.479  105.317 1.00 12.56 ? 204  LEU A CA    1 
ATOM   728  C  C     . LEU A 1 117 ? 125.361 -4.811  103.955 1.00 13.17 ? 204  LEU A C     1 
ATOM   729  O  O     . LEU A 1 117 ? 126.203 -5.122  103.117 1.00 13.47 ? 204  LEU A O     1 
ATOM   730  C  CB    . LEU A 1 117 ? 124.410 -6.692  105.270 1.00 12.67 ? 204  LEU A CB    1 
ATOM   731  C  CG    . LEU A 1 117 ? 124.514 -7.664  106.436 1.00 13.01 ? 204  LEU A CG    1 
ATOM   732  C  CD1   . LEU A 1 117 ? 123.331 -8.619  106.431 1.00 13.65 ? 204  LEU A CD1   1 
ATOM   733  C  CD2   . LEU A 1 117 ? 125.824 -8.441  106.328 1.00 14.00 ? 204  LEU A CD2   1 
ATOM   734  N  N     . CYS A 1 118 ? 124.432 -3.879  103.739 1.00 13.76 ? 205  CYS A N     1 
ATOM   735  C  CA    . CYS A 1 118 ? 124.186 -3.364  102.397 1.00 13.48 ? 205  CYS A CA    1 
ATOM   736  C  C     . CYS A 1 118 ? 124.730 -1.966  102.116 1.00 13.00 ? 205  CYS A C     1 
ATOM   737  O  O     . CYS A 1 118 ? 124.591 -1.463  101.013 1.00 13.88 ? 205  CYS A O     1 
ATOM   738  C  CB    . CYS A 1 118 ? 122.682 -3.408  102.095 1.00 13.36 ? 205  CYS A CB    1 
ATOM   739  S  SG    . CYS A 1 118 ? 122.009 -5.082  102.011 1.00 14.91 ? 205  CYS A SG    1 
ATOM   740  N  N     . HIS A 1 119 ? 125.382 -1.349  103.091 1.00 12.14 ? 206  HIS A N     1 
ATOM   741  C  CA    . HIS A 1 119 ? 125.790 0.050   102.959 1.00 11.82 ? 206  HIS A CA    1 
ATOM   742  C  C     . HIS A 1 119 ? 126.759 0.295   101.819 1.00 12.07 ? 206  HIS A C     1 
ATOM   743  O  O     . HIS A 1 119 ? 126.860 1.416   101.328 1.00 12.45 ? 206  HIS A O     1 
ATOM   744  C  CB    . HIS A 1 119 ? 126.401 0.534   104.266 1.00 11.65 ? 206  HIS A CB    1 
ATOM   745  C  CG    . HIS A 1 119 ? 127.812 0.037   104.465 1.00 11.95 ? 206  HIS A CG    1 
ATOM   746  N  ND1   . HIS A 1 119 ? 128.088 -1.255  104.747 1.00 12.74 ? 206  HIS A ND1   1 
ATOM   747  C  CD2   . HIS A 1 119 ? 129.041 0.692   104.355 1.00 12.56 ? 206  HIS A CD2   1 
ATOM   748  C  CE1   . HIS A 1 119 ? 129.419 -1.421  104.834 1.00 12.39 ? 206  HIS A CE1   1 
ATOM   749  N  NE2   . HIS A 1 119 ? 130.008 -0.227  104.595 1.00 12.59 ? 206  HIS A NE2   1 
ATOM   750  N  N     . ASP A 1 120 ? 127.484 -0.746  101.384 1.00 11.81 ? 207  ASP A N     1 
ATOM   751  C  CA    . ASP A 1 120 ? 128.517 -0.612  100.345 1.00 12.07 ? 207  ASP A CA    1 
ATOM   752  C  C     . ASP A 1 120 ? 128.172 -1.296  99.026  1.00 11.86 ? 207  ASP A C     1 
ATOM   753  O  O     . ASP A 1 120 ? 129.052 -1.486  98.171  1.00 11.73 ? 207  ASP A O     1 
ATOM   754  C  CB    . ASP A 1 120 ? 129.881 -1.153  100.847 1.00 12.54 ? 207  ASP A CB    1 
ATOM   755  C  CG    . ASP A 1 120 ? 130.734 -0.086  101.529 1.00 13.98 ? 207  ASP A CG    1 
ATOM   756  O  OD1   . ASP A 1 120 ? 130.432 1.131   101.443 1.00 13.51 ? 207  ASP A OD1   1 
ATOM   757  O  OD2   . ASP A 1 120 ? 131.750 -0.468  102.152 1.00 14.18 ? 207  ASP A OD2   1 
ATOM   758  N  N     . LEU A 1 121 ? 126.902 -1.665  98.852  1.00 12.92 ? 208  LEU A N     1 
ATOM   759  C  CA    . LEU A 1 121 ? 126.454 -2.321  97.610  1.00 13.24 ? 208  LEU A CA    1 
ATOM   760  C  C     . LEU A 1 121 ? 126.756 -1.486  96.377  1.00 13.50 ? 208  LEU A C     1 
ATOM   761  O  O     . LEU A 1 121 ? 126.932 -2.018  95.277  1.00 14.99 ? 208  LEU A O     1 
ATOM   762  C  CB    . LEU A 1 121 ? 124.960 -2.641  97.670  1.00 13.80 ? 208  LEU A CB    1 
ATOM   763  C  CG    . LEU A 1 121 ? 124.527 -3.835  98.512  1.00 14.69 ? 208  LEU A CG    1 
ATOM   764  C  CD1   . LEU A 1 121 ? 123.004 -3.856  98.586  1.00 14.71 ? 208  LEU A CD1   1 
ATOM   765  C  CD2   . LEU A 1 121 ? 125.056 -5.154  97.952  1.00 14.13 ? 208  LEU A CD2   1 
ATOM   766  N  N     . GLY A 1 122 ? 126.843 -0.171  96.563  1.00 13.06 ? 209  GLY A N     1 
ATOM   767  C  CA    . GLY A 1 122 ? 127.034 0.747   95.443  1.00 12.78 ? 209  GLY A CA    1 
ATOM   768  C  C     . GLY A 1 122 ? 128.456 0.971   94.986  1.00 12.38 ? 209  GLY A C     1 
ATOM   769  O  O     . GLY A 1 122 ? 128.696 1.690   94.010  1.00 12.72 ? 209  GLY A O     1 
ATOM   770  N  N     . HIS A 1 123 ? 129.432 0.385   95.674  1.00 11.47 ? 210  HIS A N     1 
ATOM   771  C  CA    . HIS A 1 123 ? 130.816 0.546   95.213  1.00 10.67 ? 210  HIS A CA    1 
ATOM   772  C  C     . HIS A 1 123 ? 131.047 -0.043  93.839  1.00 10.85 ? 210  HIS A C     1 
ATOM   773  O  O     . HIS A 1 123 ? 130.419 -1.033  93.457  1.00 11.07 ? 210  HIS A O     1 
ATOM   774  C  CB    . HIS A 1 123 ? 131.811 -0.035  96.232  1.00 9.62  ? 210  HIS A CB    1 
ATOM   775  C  CG    . HIS A 1 123 ? 132.280 0.970   97.246  1.00 10.56 ? 210  HIS A CG    1 
ATOM   776  N  ND1   . HIS A 1 123 ? 133.073 2.009   96.922  1.00 11.51 ? 210  HIS A ND1   1 
ATOM   777  C  CD2   . HIS A 1 123 ? 132.017 1.085   98.604  1.00 10.63 ? 210  HIS A CD2   1 
ATOM   778  C  CE1   . HIS A 1 123 ? 133.339 2.734   98.020  1.00 11.38 ? 210  HIS A CE1   1 
ATOM   779  N  NE2   . HIS A 1 123 ? 132.674 2.179   99.048  1.00 10.29 ? 210  HIS A NE2   1 
ATOM   780  N  N     . GLY A 1 124 ? 131.960 0.557   93.084  1.00 11.86 ? 211  GLY A N     1 
ATOM   781  C  CA    . GLY A 1 124 ? 132.298 0.082   91.751  1.00 11.89 ? 211  GLY A CA    1 
ATOM   782  C  C     . GLY A 1 124 ? 133.722 -0.407  91.740  1.00 11.82 ? 211  GLY A C     1 
ATOM   783  O  O     . GLY A 1 124 ? 134.355 -0.471  92.799  1.00 12.14 ? 211  GLY A O     1 
ATOM   784  N  N     . PRO A 1 125 ? 134.245 -0.750  90.546  1.00 11.42 ? 212  PRO A N     1 
ATOM   785  C  CA    . PRO A 1 125 ? 135.596 -1.261  90.368  1.00 11.37 ? 212  PRO A CA    1 
ATOM   786  C  C     . PRO A 1 125 ? 136.640 -0.464  91.147  1.00 11.46 ? 212  PRO A C     1 
ATOM   787  O  O     . PRO A 1 125 ? 136.739 0.771   91.010  1.00 11.14 ? 212  PRO A O     1 
ATOM   788  C  CB    . PRO A 1 125 ? 135.822 -1.115  88.863  1.00 11.82 ? 212  PRO A CB    1 
ATOM   789  C  CG    . PRO A 1 125 ? 134.477 -1.339  88.295  1.00 11.50 ? 212  PRO A CG    1 
ATOM   790  C  CD    . PRO A 1 125 ? 133.488 -0.765  89.274  1.00 11.67 ? 212  PRO A CD    1 
ATOM   791  N  N     . PHE A 1 126 ? 137.402 -1.181  91.971  1.00 11.36 ? 213  PHE A N     1 
ATOM   792  C  CA    . PHE A 1 126 ? 138.494 -0.594  92.778  1.00 11.75 ? 213  PHE A CA    1 
ATOM   793  C  C     . PHE A 1 126 ? 137.993 0.442   93.780  1.00 11.22 ? 213  PHE A C     1 
ATOM   794  O  O     . PHE A 1 126 ? 138.725 1.357   94.164  1.00 12.20 ? 213  PHE A O     1 
ATOM   795  C  CB    . PHE A 1 126 ? 139.620 -0.050  91.874  1.00 12.71 ? 213  PHE A CB    1 
ATOM   796  C  CG    . PHE A 1 126 ? 140.226 -1.101  91.006  1.00 13.74 ? 213  PHE A CG    1 
ATOM   797  C  CD1   . PHE A 1 126 ? 139.664 -1.401  89.764  1.00 13.61 ? 213  PHE A CD1   1 
ATOM   798  C  CD2   . PHE A 1 126 ? 141.321 -1.831  91.436  1.00 14.70 ? 213  PHE A CD2   1 
ATOM   799  C  CE1   . PHE A 1 126 ? 140.199 -2.399  88.975  1.00 14.83 ? 213  PHE A CE1   1 
ATOM   800  C  CE2   . PHE A 1 126 ? 141.862 -2.826  90.649  1.00 15.65 ? 213  PHE A CE2   1 
ATOM   801  C  CZ    . PHE A 1 126 ? 141.294 -3.113  89.415  1.00 15.03 ? 213  PHE A CZ    1 
ATOM   802  N  N     . SER A 1 127 ? 136.734 0.299   94.181  1.00 10.08 ? 214  SER A N     1 
ATOM   803  C  CA    . SER A 1 127 ? 136.144 1.090   95.271  1.00 10.42 ? 214  SER A CA    1 
ATOM   804  C  C     . SER A 1 127 ? 136.266 2.621   95.091  1.00 11.90 ? 214  SER A C     1 
ATOM   805  O  O     . SER A 1 127 ? 135.667 3.175   94.159  1.00 11.13 ? 214  SER A O     1 
ATOM   806  C  CB    . SER A 1 127 ? 136.690 0.604   96.646  1.00 9.47  ? 214  SER A CB    1 
ATOM   807  O  OG    . SER A 1 127 ? 136.248 -0.726  96.909  1.00 8.21  ? 214  SER A OG    1 
ATOM   808  N  N     A HIS A 1 128 ? 137.046 3.278   95.960  0.60 12.25 ? 215  HIS A N     1 
ATOM   809  N  N     B HIS A 1 128 ? 137.046 3.298   95.934  0.40 12.24 ? 215  HIS A N     1 
ATOM   810  C  CA    A HIS A 1 128 ? 137.147 4.747   95.950  0.60 14.19 ? 215  HIS A CA    1 
ATOM   811  C  CA    B HIS A 1 128 ? 137.062 4.770   95.905  0.40 13.68 ? 215  HIS A CA    1 
ATOM   812  C  C     A HIS A 1 128 ? 137.524 5.303   94.602  0.60 14.66 ? 215  HIS A C     1 
ATOM   813  C  C     B HIS A 1 128 ? 137.681 5.398   94.676  0.40 14.32 ? 215  HIS A C     1 
ATOM   814  O  O     A HIS A 1 128 ? 137.020 6.348   94.197  0.60 15.30 ? 215  HIS A O     1 
ATOM   815  O  O     B HIS A 1 128 ? 137.488 6.586   94.420  0.40 14.99 ? 215  HIS A O     1 
ATOM   816  C  CB    A HIS A 1 128 ? 138.107 5.267   97.019  0.60 14.89 ? 215  HIS A CB    1 
ATOM   817  C  CB    B HIS A 1 128 ? 137.618 5.348   97.198  0.40 13.81 ? 215  HIS A CB    1 
ATOM   818  C  CG    A HIS A 1 128 ? 138.436 6.730   96.867  0.60 15.57 ? 215  HIS A CG    1 
ATOM   819  C  CG    B HIS A 1 128 ? 136.663 5.230   98.362  0.40 14.00 ? 215  HIS A CG    1 
ATOM   820  N  ND1   A HIS A 1 128 ? 139.525 7.164   96.189  0.60 16.11 ? 215  HIS A ND1   1 
ATOM   821  N  ND1   B HIS A 1 128 ? 135.822 6.219   98.708  0.40 14.12 ? 215  HIS A ND1   1 
ATOM   822  C  CD2   A HIS A 1 128 ? 137.761 7.871   97.298  0.60 16.09 ? 215  HIS A CD2   1 
ATOM   823  C  CD2   B HIS A 1 128 ? 136.416 4.179   99.238  0.40 13.96 ? 215  HIS A CD2   1 
ATOM   824  C  CE1   A HIS A 1 128 ? 139.549 8.512   96.199  0.60 16.15 ? 215  HIS A CE1   1 
ATOM   825  C  CE1   B HIS A 1 128 ? 135.089 5.831   99.768  0.40 14.12 ? 215  HIS A CE1   1 
ATOM   826  N  NE2   A HIS A 1 128 ? 138.468 8.943   96.878  0.60 16.26 ? 215  HIS A NE2   1 
ATOM   827  N  NE2   B HIS A 1 128 ? 135.452 4.582   100.087 0.40 13.95 ? 215  HIS A NE2   1 
ATOM   828  N  N     . MET A 1 129 ? 138.408 4.607   93.890  1.00 14.62 ? 216  MET A N     1 
ATOM   829  C  CA    . MET A 1 129 ? 138.837 5.031   92.569  1.00 16.02 ? 216  MET A CA    1 
ATOM   830  C  C     . MET A 1 129 ? 137.660 5.323   91.616  1.00 16.28 ? 216  MET A C     1 
ATOM   831  O  O     . MET A 1 129 ? 137.709 6.276   90.827  1.00 16.78 ? 216  MET A O     1 
ATOM   832  C  CB    . MET A 1 129 ? 139.705 3.951   91.956  1.00 17.10 ? 216  MET A CB    1 
ATOM   833  C  CG    . MET A 1 129 ? 140.485 4.413   90.752  1.00 20.11 ? 216  MET A CG    1 
ATOM   834  S  SD    . MET A 1 129 ? 140.702 3.037   89.634  1.00 21.10 ? 216  MET A SD    1 
ATOM   835  C  CE    . MET A 1 129 ? 139.099 2.997   88.840  1.00 20.83 ? 216  MET A CE    1 
ATOM   836  N  N     . PHE A 1 130 ? 136.608 4.516   91.710  1.00 14.17 ? 217  PHE A N     1 
ATOM   837  C  CA    . PHE A 1 130 ? 135.491 4.577   90.751  1.00 15.22 ? 217  PHE A CA    1 
ATOM   838  C  C     . PHE A 1 130 ? 134.600 5.816   90.926  1.00 15.48 ? 217  PHE A C     1 
ATOM   839  O  O     . PHE A 1 130 ? 134.348 6.538   89.952  1.00 17.02 ? 217  PHE A O     1 
ATOM   840  C  CB    . PHE A 1 130 ? 134.662 3.299   90.826  1.00 14.20 ? 217  PHE A CB    1 
ATOM   841  C  CG    . PHE A 1 130 ? 133.714 3.128   89.674  1.00 13.84 ? 217  PHE A CG    1 
ATOM   842  C  CD1   . PHE A 1 130 ? 134.183 2.780   88.415  1.00 13.96 ? 217  PHE A CD1   1 
ATOM   843  C  CD2   . PHE A 1 130 ? 132.358 3.328   89.852  1.00 13.83 ? 217  PHE A CD2   1 
ATOM   844  C  CE1   . PHE A 1 130 ? 133.296 2.633   87.354  1.00 13.85 ? 217  PHE A CE1   1 
ATOM   845  C  CE2   . PHE A 1 130 ? 131.465 3.178   88.791  1.00 13.80 ? 217  PHE A CE2   1 
ATOM   846  C  CZ    . PHE A 1 130 ? 131.943 2.831   87.546  1.00 13.57 ? 217  PHE A CZ    1 
ATOM   847  N  N     . ASP A 1 131 ? 134.141 6.075   92.147  1.00 17.39 ? 218  ASP A N     1 
ATOM   848  C  CA    . ASP A 1 131 ? 133.303 7.252   92.394  1.00 18.27 ? 218  ASP A CA    1 
ATOM   849  C  C     . ASP A 1 131 ? 134.133 8.496   92.723  1.00 19.11 ? 218  ASP A C     1 
ATOM   850  O  O     . ASP A 1 131 ? 133.653 9.622   92.577  1.00 19.29 ? 218  ASP A O     1 
ATOM   851  C  CB    . ASP A 1 131 ? 132.218 6.987   93.452  1.00 18.72 ? 218  ASP A CB    1 
ATOM   852  C  CG    . ASP A 1 131 ? 132.784 6.753   94.844  1.00 18.36 ? 218  ASP A CG    1 
ATOM   853  O  OD1   . ASP A 1 131 ? 133.980 6.413   94.971  1.00 18.79 ? 218  ASP A OD1   1 
ATOM   854  O  OD2   . ASP A 1 131 ? 132.017 6.917   95.816  1.00 20.37 ? 218  ASP A OD2   1 
ATOM   855  N  N     . GLY A 1 132 ? 135.384 8.289   93.132  1.00 19.57 ? 219  GLY A N     1 
ATOM   856  C  CA    . GLY A 1 132 ? 136.262 9.386   93.509  1.00 19.77 ? 219  GLY A CA    1 
ATOM   857  C  C     . GLY A 1 132 ? 137.081 9.971   92.372  1.00 20.11 ? 219  GLY A C     1 
ATOM   858  O  O     . GLY A 1 132 ? 137.412 11.161  92.404  1.00 21.57 ? 219  GLY A O     1 
ATOM   859  N  N     . ARG A 1 133 ? 137.421 9.143   91.379  1.00 17.85 ? 220  ARG A N     1 
ATOM   860  C  CA    . ARG A 1 133 ? 138.288 9.556   90.278  1.00 18.16 ? 220  ARG A CA    1 
ATOM   861  C  C     . ARG A 1 133 ? 137.644 9.342   88.917  1.00 19.28 ? 220  ARG A C     1 
ATOM   862  O  O     . ARG A 1 133 ? 137.551 10.289  88.133  1.00 20.63 ? 220  ARG A O     1 
ATOM   863  C  CB    . ARG A 1 133 ? 139.659 8.858   90.301  1.00 18.73 ? 220  ARG A CB    1 
ATOM   864  C  CG    . ARG A 1 133 ? 140.515 9.149   91.523  1.00 19.62 ? 220  ARG A CG    1 
ATOM   865  C  CD    . ARG A 1 133 ? 141.888 8.487   91.407  1.00 21.01 ? 220  ARG A CD    1 
ATOM   866  N  NE    . ARG A 1 133 ? 142.667 8.702   92.628  1.00 21.26 ? 220  ARG A NE    1 
ATOM   867  C  CZ    . ARG A 1 133 ? 143.489 9.733   92.820  1.00 23.10 ? 220  ARG A CZ    1 
ATOM   868  N  NH1   . ARG A 1 133 ? 143.665 10.639  91.865  1.00 23.06 ? 220  ARG A NH1   1 
ATOM   869  N  NH2   . ARG A 1 133 ? 144.147 9.852   93.964  1.00 24.52 ? 220  ARG A NH2   1 
ATOM   870  N  N     . PHE A 1 134 ? 137.189 8.114   88.640  1.00 16.95 ? 221  PHE A N     1 
ATOM   871  C  CA    . PHE A 1 134 ? 136.706 7.758   87.298  1.00 17.16 ? 221  PHE A CA    1 
ATOM   872  C  C     . PHE A 1 134 ? 135.415 8.453   86.861  1.00 17.89 ? 221  PHE A C     1 
ATOM   873  O  O     . PHE A 1 134 ? 135.394 9.123   85.822  1.00 18.08 ? 221  PHE A O     1 
ATOM   874  C  CB    . PHE A 1 134 ? 136.555 6.236   87.131  1.00 15.17 ? 221  PHE A CB    1 
ATOM   875  C  CG    . PHE A 1 134 ? 135.998 5.831   85.785  1.00 15.44 ? 221  PHE A CG    1 
ATOM   876  C  CD1   . PHE A 1 134 ? 136.755 5.975   84.631  1.00 15.50 ? 221  PHE A CD1   1 
ATOM   877  C  CD2   . PHE A 1 134 ? 134.717 5.304   85.686  1.00 15.09 ? 221  PHE A CD2   1 
ATOM   878  C  CE1   . PHE A 1 134 ? 136.231 5.613   83.392  1.00 14.97 ? 221  PHE A CE1   1 
ATOM   879  C  CE2   . PHE A 1 134 ? 134.190 4.934   84.452  1.00 15.40 ? 221  PHE A CE2   1 
ATOM   880  C  CZ    . PHE A 1 134 ? 134.955 5.087   83.310  1.00 15.31 ? 221  PHE A CZ    1 
ATOM   881  N  N     . ILE A 1 135 ? 134.338 8.264   87.620  1.00 17.04 ? 222  ILE A N     1 
ATOM   882  C  CA    . ILE A 1 135 ? 133.029 8.827   87.236  1.00 19.60 ? 222  ILE A CA    1 
ATOM   883  C  C     . ILE A 1 135 ? 133.077 10.369  87.073  1.00 20.36 ? 222  ILE A C     1 
ATOM   884  O  O     . ILE A 1 135 ? 132.580 10.885  86.062  1.00 20.83 ? 222  ILE A O     1 
ATOM   885  C  CB    . ILE A 1 135 ? 131.870 8.331   88.147  1.00 19.86 ? 222  ILE A CB    1 
ATOM   886  C  CG1   . ILE A 1 135 ? 131.620 6.820   87.967  1.00 20.31 ? 222  ILE A CG1   1 
ATOM   887  C  CG2   . ILE A 1 135 ? 130.566 9.105   87.906  1.00 19.31 ? 222  ILE A CG2   1 
ATOM   888  C  CD1   . ILE A 1 135 ? 131.042 6.394   86.619  1.00 20.22 ? 222  ILE A CD1   1 
ATOM   889  N  N     . PRO A 1 136 ? 133.707 11.100  88.022  1.00 20.81 ? 223  PRO A N     1 
ATOM   890  C  CA    . PRO A 1 136 ? 133.817 12.559  87.845  1.00 21.25 ? 223  PRO A CA    1 
ATOM   891  C  C     . PRO A 1 136 ? 134.539 12.974  86.567  1.00 22.44 ? 223  PRO A C     1 
ATOM   892  O  O     . PRO A 1 136 ? 134.217 14.019  86.007  1.00 24.38 ? 223  PRO A O     1 
ATOM   893  C  CB    . PRO A 1 136 ? 134.634 12.997  89.067  1.00 21.48 ? 223  PRO A CB    1 
ATOM   894  C  CG    . PRO A 1 136 ? 134.307 11.969  90.096  1.00 20.52 ? 223  PRO A CG    1 
ATOM   895  C  CD    . PRO A 1 136 ? 134.311 10.690  89.306  1.00 20.20 ? 223  PRO A CD    1 
ATOM   896  N  N     . LEU A 1 137 ? 135.503 12.172  86.113  1.00 22.04 ? 224  LEU A N     1 
ATOM   897  C  CA    . LEU A 1 137 ? 136.182 12.431  84.833  1.00 22.37 ? 224  LEU A CA    1 
ATOM   898  C  C     . LEU A 1 137 ? 135.383 12.007  83.599  1.00 22.59 ? 224  LEU A C     1 
ATOM   899  O  O     . LEU A 1 137 ? 135.353 12.723  82.593  1.00 20.46 ? 224  LEU A O     1 
ATOM   900  C  CB    . LEU A 1 137 ? 137.580 11.801  84.800  1.00 21.75 ? 224  LEU A CB    1 
ATOM   901  C  CG    . LEU A 1 137 ? 138.624 12.491  85.686  1.00 23.48 ? 224  LEU A CG    1 
ATOM   902  C  CD1   . LEU A 1 137 ? 139.935 11.715  85.689  1.00 23.32 ? 224  LEU A CD1   1 
ATOM   903  C  CD2   . LEU A 1 137 ? 138.860 13.927  85.233  1.00 24.19 ? 224  LEU A CD2   1 
ATOM   904  N  N     . ALA A 1 138 ? 134.742 10.844  83.671  1.00 21.19 ? 225  ALA A N     1 
ATOM   905  C  CA    . ALA A 1 138 ? 134.015 10.301  82.526  1.00 21.98 ? 225  ALA A CA    1 
ATOM   906  C  C     . ALA A 1 138 ? 132.716 11.049  82.266  1.00 22.78 ? 225  ALA A C     1 
ATOM   907  O  O     . ALA A 1 138 ? 132.358 11.290  81.111  1.00 24.49 ? 225  ALA A O     1 
ATOM   908  C  CB    . ALA A 1 138 ? 133.737 8.813   82.722  1.00 20.61 ? 225  ALA A CB    1 
ATOM   909  N  N     . ARG A 1 139 ? 132.007 11.391  83.341  1.00 21.98 ? 226  ARG A N     1 
ATOM   910  C  CA    . ARG A 1 139 ? 130.692 12.019  83.261  1.00 24.26 ? 226  ARG A CA    1 
ATOM   911  C  C     . ARG A 1 139 ? 130.567 13.121  84.319  1.00 25.29 ? 226  ARG A C     1 
ATOM   912  O  O     . ARG A 1 139 ? 129.908 12.928  85.347  1.00 26.28 ? 226  ARG A O     1 
ATOM   913  C  CB    . ARG A 1 139 ? 129.586 10.971  83.433  1.00 24.21 ? 226  ARG A CB    1 
ATOM   914  C  CG    . ARG A 1 139 ? 129.670 9.811   82.446  1.00 22.65 ? 226  ARG A CG    1 
ATOM   915  C  CD    . ARG A 1 139 ? 128.628 8.756   82.768  1.00 24.71 ? 226  ARG A CD    1 
ATOM   916  N  NE    . ARG A 1 139 ? 127.263 9.196   82.481  1.00 24.24 ? 226  ARG A NE    1 
ATOM   917  C  CZ    . ARG A 1 139 ? 126.165 8.569   82.896  1.00 25.01 ? 226  ARG A CZ    1 
ATOM   918  N  NH1   . ARG A 1 139 ? 126.242 7.472   83.655  1.00 23.77 ? 226  ARG A NH1   1 
ATOM   919  N  NH2   . ARG A 1 139 ? 124.978 9.053   82.568  1.00 24.51 ? 226  ARG A NH2   1 
ATOM   920  N  N     . PRO A 1 140 ? 131.187 14.291  84.058  1.00 27.14 ? 227  PRO A N     1 
ATOM   921  C  CA    . PRO A 1 140 ? 131.287 15.392  85.035  1.00 27.47 ? 227  PRO A CA    1 
ATOM   922  C  C     . PRO A 1 140 ? 129.948 15.971  85.488  1.00 29.44 ? 227  PRO A C     1 
ATOM   923  O  O     . PRO A 1 140 ? 129.879 16.593  86.551  1.00 29.60 ? 227  PRO A O     1 
ATOM   924  C  CB    . PRO A 1 140 ? 132.092 16.461  84.282  1.00 28.13 ? 227  PRO A CB    1 
ATOM   925  C  CG    . PRO A 1 140 ? 132.797 15.731  83.190  1.00 27.67 ? 227  PRO A CG    1 
ATOM   926  C  CD    . PRO A 1 140 ? 131.894 14.603  82.801  1.00 26.62 ? 227  PRO A CD    1 
ATOM   927  N  N     . GLU A 1 141 ? 128.896 15.763  84.700  1.00 29.30 ? 228  GLU A N     1 
ATOM   928  C  CA    . GLU A 1 141 ? 127.575 16.288  85.045  1.00 30.60 ? 228  GLU A CA    1 
ATOM   929  C  C     . GLU A 1 141 ? 126.721 15.425  85.977  1.00 31.87 ? 228  GLU A C     1 
ATOM   930  O  O     . GLU A 1 141 ? 125.769 15.938  86.578  1.00 30.66 ? 228  GLU A O     1 
ATOM   931  C  CB    . GLU A 1 141 ? 126.779 16.634  83.781  1.00 31.01 ? 228  GLU A CB    1 
ATOM   932  C  CG    . GLU A 1 141 ? 126.819 18.117  83.433  1.00 32.51 ? 228  GLU A CG    1 
ATOM   933  C  CD    . GLU A 1 141 ? 126.383 18.386  82.006  1.00 30.75 ? 228  GLU A CD    1 
ATOM   934  O  OE1   . GLU A 1 141 ? 125.194 18.180  81.671  1.00 31.40 ? 228  GLU A OE1   1 
ATOM   935  O  OE2   . GLU A 1 141 ? 127.251 18.796  81.214  1.00 32.66 ? 228  GLU A OE2   1 
ATOM   936  N  N     . VAL A 1 142 ? 127.033 14.132  86.105  1.00 31.14 ? 229  VAL A N     1 
ATOM   937  C  CA    . VAL A 1 142 ? 126.200 13.274  86.959  1.00 32.73 ? 229  VAL A CA    1 
ATOM   938  C  C     . VAL A 1 142 ? 126.524 13.493  88.431  1.00 32.68 ? 229  VAL A C     1 
ATOM   939  O  O     . VAL A 1 142 ? 127.643 13.870  88.785  1.00 34.17 ? 229  VAL A O     1 
ATOM   940  C  CB    . VAL A 1 142 ? 126.282 11.768  86.598  1.00 32.61 ? 229  VAL A CB    1 
ATOM   941  C  CG1   . VAL A 1 142 ? 126.028 11.559  85.114  1.00 33.00 ? 229  VAL A CG1   1 
ATOM   942  C  CG2   . VAL A 1 142 ? 127.624 11.172  87.005  1.00 33.49 ? 229  VAL A CG2   1 
ATOM   943  N  N     . LYS A 1 143 ? 125.518 13.315  89.277  1.00 35.02 ? 230  LYS A N     1 
ATOM   944  C  CA    . LYS A 1 143 ? 125.736 13.252  90.709  1.00 35.68 ? 230  LYS A CA    1 
ATOM   945  C  C     . LYS A 1 143 ? 125.800 11.768  91.047  1.00 33.53 ? 230  LYS A C     1 
ATOM   946  O  O     . LYS A 1 143 ? 124.790 11.055  90.977  1.00 35.61 ? 230  LYS A O     1 
ATOM   947  C  CB    . LYS A 1 143 ? 124.622 13.972  91.487  1.00 40.79 ? 230  LYS A CB    1 
ATOM   948  C  CG    . LYS A 1 143 ? 123.197 13.687  91.009  1.00 43.29 ? 230  LYS A CG    1 
ATOM   949  C  CD    . LYS A 1 143 ? 122.160 14.317  91.948  1.00 54.56 ? 230  LYS A CD    1 
ATOM   950  C  CE    . LYS A 1 143 ? 120.776 13.579  91.695  1.00 59.85 ? 230  LYS A CE    1 
ATOM   951  N  NZ    . LYS A 1 143 ? 119.797 13.987  92.763  1.00 59.88 ? 230  LYS A NZ    1 
ATOM   952  N  N     . TRP A 1 144 ? 127.006 11.293  91.341  1.00 29.30 ? 231  TRP A N     1 
ATOM   953  C  CA    . TRP A 1 144 ? 127.197 9.890   91.692  1.00 24.35 ? 231  TRP A CA    1 
ATOM   954  C  C     . TRP A 1 144 ? 128.041 9.761   92.932  1.00 22.53 ? 231  TRP A C     1 
ATOM   955  O  O     . TRP A 1 144 ? 129.104 10.374  93.041  1.00 21.81 ? 231  TRP A O     1 
ATOM   956  C  CB    . TRP A 1 144 ? 127.843 9.110   90.545  1.00 22.25 ? 231  TRP A CB    1 
ATOM   957  C  CG    . TRP A 1 144 ? 128.057 7.656   90.915  1.00 21.88 ? 231  TRP A CG    1 
ATOM   958  C  CD1   . TRP A 1 144 ? 129.247 7.034   91.286  1.00 22.22 ? 231  TRP A CD1   1 
ATOM   959  C  CD2   . TRP A 1 144 ? 127.033 6.618   91.004  1.00 22.67 ? 231  TRP A CD2   1 
ATOM   960  N  NE1   . TRP A 1 144 ? 129.035 5.702   91.583  1.00 22.13 ? 231  TRP A NE1   1 
ATOM   961  C  CE2   . TRP A 1 144 ? 127.722 5.390   91.428  1.00 21.35 ? 231  TRP A CE2   1 
ATOM   962  C  CE3   . TRP A 1 144 ? 125.662 6.578   90.775  1.00 23.50 ? 231  TRP A CE3   1 
ATOM   963  C  CZ2   . TRP A 1 144 ? 127.046 4.193   91.598  1.00 21.28 ? 231  TRP A CZ2   1 
ATOM   964  C  CZ3   . TRP A 1 144 ? 124.990 5.363   90.950  1.00 23.90 ? 231  TRP A CZ3   1 
ATOM   965  C  CH2   . TRP A 1 144 ? 125.670 4.196   91.344  1.00 23.36 ? 231  TRP A CH2   1 
ATOM   966  N  N     . THR A 1 145 ? 127.551 8.983   93.884  1.00 22.75 ? 232  THR A N     1 
ATOM   967  C  CA    . THR A 1 145 ? 128.349 8.577   95.035  1.00 22.03 ? 232  THR A CA    1 
ATOM   968  C  C     . THR A 1 145 ? 128.024 7.104   95.248  1.00 20.33 ? 232  THR A C     1 
ATOM   969  O  O     . THR A 1 145 ? 126.944 6.649   94.877  1.00 18.70 ? 232  THR A O     1 
ATOM   970  C  CB    . THR A 1 145 ? 127.993 9.351   96.322  1.00 22.58 ? 232  THR A CB    1 
ATOM   971  O  OG1   . THR A 1 145 ? 126.637 9.073   96.693  1.00 21.32 ? 232  THR A OG1   1 
ATOM   972  C  CG2   . THR A 1 145 ? 128.196 10.861  96.156  1.00 23.42 ? 232  THR A CG2   1 
ATOM   973  N  N     . HIS A 1 146 ? 128.939 6.352   95.855  1.00 19.35 ? 233  HIS A N     1 
ATOM   974  C  CA    . HIS A 1 146 ? 128.654 4.938   96.075  1.00 18.01 ? 233  HIS A CA    1 
ATOM   975  C  C     . HIS A 1 146 ? 127.462 4.770   96.970  1.00 16.20 ? 233  HIS A C     1 
ATOM   976  O  O     . HIS A 1 146 ? 126.725 3.799   96.830  1.00 17.00 ? 233  HIS A O     1 
ATOM   977  C  CB    . HIS A 1 146 ? 129.890 4.167   96.595  1.00 16.86 ? 233  HIS A CB    1 
ATOM   978  C  CG    . HIS A 1 146 ? 130.388 4.642   97.933  1.00 18.62 ? 233  HIS A CG    1 
ATOM   979  N  ND1   . HIS A 1 146 ? 131.307 5.626   98.062  1.00 18.87 ? 233  HIS A ND1   1 
ATOM   980  C  CD2   . HIS A 1 146 ? 130.063 4.233   99.226  1.00 18.95 ? 233  HIS A CD2   1 
ATOM   981  C  CE1   . HIS A 1 146 ? 131.548 5.837   99.369  1.00 19.43 ? 233  HIS A CE1   1 
ATOM   982  N  NE2   . HIS A 1 146 ? 130.782 4.986   100.077 1.00 18.22 ? 233  HIS A NE2   1 
ATOM   983  N  N     . GLU A 1 147 ? 127.244 5.719   97.891  1.00 18.48 ? 234  GLU A N     1 
ATOM   984  C  CA    . GLU A 1 147 ? 126.117 5.635   98.829  1.00 19.90 ? 234  GLU A CA    1 
ATOM   985  C  C     . GLU A 1 147 ? 124.788 5.660   98.086  1.00 19.81 ? 234  GLU A C     1 
ATOM   986  O  O     . GLU A 1 147 ? 123.868 4.893   98.410  1.00 18.15 ? 234  GLU A O     1 
ATOM   987  C  CB    . GLU A 1 147 ? 126.158 6.751   99.882  1.00 22.37 ? 234  GLU A CB    1 
ATOM   988  C  CG    . GLU A 1 147 ? 127.317 6.652   100.861 1.00 23.19 ? 234  GLU A CG    1 
ATOM   989  C  CD    . GLU A 1 147 ? 128.509 7.514   100.472 1.00 25.06 ? 234  GLU A CD    1 
ATOM   990  O  OE1   . GLU A 1 147 ? 128.765 7.734   99.261  1.00 23.52 ? 234  GLU A OE1   1 
ATOM   991  O  OE2   . GLU A 1 147 ? 129.215 7.967   101.397 1.00 25.74 ? 234  GLU A OE2   1 
ATOM   992  N  N     . GLN A 1 148 ? 124.698 6.537   97.087  1.00 20.47 ? 235  GLN A N     1 
ATOM   993  C  CA    . GLN A 1 148 ? 123.522 6.585   96.210  1.00 21.73 ? 235  GLN A CA    1 
ATOM   994  C  C     . GLN A 1 148 ? 123.355 5.253   95.501  1.00 20.60 ? 235  GLN A C     1 
ATOM   995  O  O     . GLN A 1 148 ? 122.247 4.705   95.433  1.00 21.48 ? 235  GLN A O     1 
ATOM   996  C  CB    . GLN A 1 148 ? 123.675 7.685   95.162  1.00 25.39 ? 235  GLN A CB    1 
ATOM   997  C  CG    . GLN A 1 148 ? 123.589 9.100   95.703  1.00 29.64 ? 235  GLN A CG    1 
ATOM   998  C  CD    . GLN A 1 148 ? 124.021 10.136  94.678  1.00 31.73 ? 235  GLN A CD    1 
ATOM   999  O  OE1   . GLN A 1 148 ? 124.621 11.151  95.024  1.00 35.46 ? 235  GLN A OE1   1 
ATOM   1000 N  NE2   . GLN A 1 148 ? 123.725 9.876   93.407  1.00 33.42 ? 235  GLN A NE2   1 
ATOM   1001 N  N     . GLY A 1 149 ? 124.468 4.743   94.975  1.00 18.53 ? 236  GLY A N     1 
ATOM   1002 C  CA    . GLY A 1 149 ? 124.515 3.422   94.343  1.00 17.80 ? 236  GLY A CA    1 
ATOM   1003 C  C     . GLY A 1 149 ? 124.056 2.303   95.260  1.00 16.36 ? 236  GLY A C     1 
ATOM   1004 O  O     . GLY A 1 149 ? 123.406 1.357   94.812  1.00 15.95 ? 236  GLY A O     1 
ATOM   1005 N  N     . SER A 1 150 ? 124.370 2.416   96.554  1.00 16.38 ? 237  SER A N     1 
ATOM   1006 C  CA    . SER A 1 150 ? 123.970 1.391   97.512  1.00 16.05 ? 237  SER A CA    1 
ATOM   1007 C  C     . SER A 1 150 ? 122.462 1.321   97.643  1.00 16.47 ? 237  SER A C     1 
ATOM   1008 O  O     . SER A 1 150 ? 121.902 0.233   97.673  1.00 14.31 ? 237  SER A O     1 
ATOM   1009 C  CB    . SER A 1 150 ? 124.608 1.623   98.882  1.00 16.31 ? 237  SER A CB    1 
ATOM   1010 O  OG    . SER A 1 150 ? 126.016 1.562   98.767  1.00 15.38 ? 237  SER A OG    1 
ATOM   1011 N  N     . VAL A 1 151 ? 121.815 2.487   97.699  1.00 15.82 ? 238  VAL A N     1 
ATOM   1012 C  CA    . VAL A 1 151 ? 120.351 2.557   97.781  1.00 17.64 ? 238  VAL A CA    1 
ATOM   1013 C  C     . VAL A 1 151 ? 119.706 1.929   96.544  1.00 16.77 ? 238  VAL A C     1 
ATOM   1014 O  O     . VAL A 1 151 ? 118.759 1.129   96.650  1.00 17.89 ? 238  VAL A O     1 
ATOM   1015 C  CB    . VAL A 1 151 ? 119.872 4.018   97.992  1.00 18.37 ? 238  VAL A CB    1 
ATOM   1016 C  CG1   . VAL A 1 151 ? 118.368 4.145   97.770  1.00 18.76 ? 238  VAL A CG1   1 
ATOM   1017 C  CG2   . VAL A 1 151 ? 120.260 4.508   99.381  1.00 19.72 ? 238  VAL A CG2   1 
ATOM   1018 N  N     . MET A 1 152 ? 120.225 2.292   95.378  1.00 17.56 ? 239  MET A N     1 
ATOM   1019 C  CA    . MET A 1 152 ? 119.711 1.796   94.104  1.00 19.57 ? 239  MET A CA    1 
ATOM   1020 C  C     . MET A 1 152 ? 119.949 0.296   93.963  1.00 19.23 ? 239  MET A C     1 
ATOM   1021 O  O     . MET A 1 152 ? 119.079 -0.432  93.499  1.00 19.02 ? 239  MET A O     1 
ATOM   1022 C  CB    . MET A 1 152 ? 120.371 2.517   92.932  1.00 20.73 ? 239  MET A CB    1 
ATOM   1023 C  CG    . MET A 1 152 ? 120.138 4.017   92.892  1.00 25.86 ? 239  MET A CG    1 
ATOM   1024 S  SD    . MET A 1 152 ? 121.076 4.796   91.563  1.00 32.43 ? 239  MET A SD    1 
ATOM   1025 C  CE    . MET A 1 152 ? 120.265 4.112   90.118  1.00 31.22 ? 239  MET A CE    1 
ATOM   1026 N  N     . MET A 1 153 ? 121.133 -0.165  94.362  1.00 18.40 ? 240  MET A N     1 
ATOM   1027 C  CA    . MET A 1 153 ? 121.429 -1.593  94.300  1.00 16.39 ? 240  MET A CA    1 
ATOM   1028 C  C     . MET A 1 153 ? 120.612 -2.383  95.314  1.00 14.63 ? 240  MET A C     1 
ATOM   1029 O  O     . MET A 1 153 ? 120.169 -3.494  95.019  1.00 16.35 ? 240  MET A O     1 
ATOM   1030 C  CB    . MET A 1 153 ? 122.946 -1.853  94.437  1.00 15.79 ? 240  MET A CB    1 
ATOM   1031 C  CG    . MET A 1 153 ? 123.341 -3.316  94.277  1.00 18.18 ? 240  MET A CG    1 
ATOM   1032 S  SD    . MET A 1 153 ? 122.984 -3.997  92.635  1.00 20.05 ? 240  MET A SD    1 
ATOM   1033 C  CE    . MET A 1 153 ? 124.191 -3.127  91.657  1.00 17.62 ? 240  MET A CE    1 
ATOM   1034 N  N     . PHE A 1 154 ? 120.394 -1.815  96.500  1.00 14.69 ? 241  PHE A N     1 
ATOM   1035 C  CA    . PHE A 1 154 ? 119.553 -2.446  97.519  1.00 15.65 ? 241  PHE A CA    1 
ATOM   1036 C  C     . PHE A 1 154 ? 118.111 -2.616  97.019  1.00 16.91 ? 241  PHE A C     1 
ATOM   1037 O  O     . PHE A 1 154 ? 117.502 -3.667  97.193  1.00 17.07 ? 241  PHE A O     1 
ATOM   1038 C  CB    . PHE A 1 154 ? 119.582 -1.632  98.811  1.00 14.67 ? 241  PHE A CB    1 
ATOM   1039 C  CG    . PHE A 1 154 ? 118.731 -2.195  99.916  1.00 17.21 ? 241  PHE A CG    1 
ATOM   1040 C  CD1   . PHE A 1 154 ? 118.987 -3.458  100.447 1.00 17.66 ? 241  PHE A CD1   1 
ATOM   1041 C  CD2   . PHE A 1 154 ? 117.676 -1.451  100.444 1.00 17.91 ? 241  PHE A CD2   1 
ATOM   1042 C  CE1   . PHE A 1 154 ? 118.201 -3.965  101.482 1.00 19.14 ? 241  PHE A CE1   1 
ATOM   1043 C  CE2   . PHE A 1 154 ? 116.881 -1.955  101.467 1.00 18.08 ? 241  PHE A CE2   1 
ATOM   1044 C  CZ    . PHE A 1 154 ? 117.139 -3.215  101.986 1.00 19.67 ? 241  PHE A CZ    1 
ATOM   1045 N  N     . GLU A 1 155 ? 117.579 -1.569  96.400  1.00 17.48 ? 242  GLU A N     1 
ATOM   1046 C  CA    . GLU A 1 155 ? 116.250 -1.648  95.774  1.00 18.32 ? 242  GLU A CA    1 
ATOM   1047 C  C     . GLU A 1 155 ? 116.226 -2.758  94.712  1.00 18.58 ? 242  GLU A C     1 
ATOM   1048 O  O     . GLU A 1 155 ? 115.300 -3.566  94.662  1.00 19.08 ? 242  GLU A O     1 
ATOM   1049 C  CB    . GLU A 1 155 ? 115.887 -0.287  95.178  1.00 20.57 ? 242  GLU A CB    1 
ATOM   1050 C  CG    . GLU A 1 155 ? 114.580 -0.252  94.386  1.00 23.67 ? 242  GLU A CG    1 
ATOM   1051 C  CD    . GLU A 1 155 ? 113.335 -0.366  95.250  1.00 25.84 ? 242  GLU A CD    1 
ATOM   1052 O  OE1   . GLU A 1 155 ? 112.231 -0.495  94.671  1.00 28.86 ? 242  GLU A OE1   1 
ATOM   1053 O  OE2   . GLU A 1 155 ? 113.435 -0.321  96.498  1.00 26.98 ? 242  GLU A OE2   1 
ATOM   1054 N  N     . HIS A 1 156 ? 117.262 -2.803  93.876  1.00 18.51 ? 243  HIS A N     1 
ATOM   1055 C  CA    . HIS A 1 156 ? 117.375 -3.837  92.848  1.00 18.87 ? 243  HIS A CA    1 
ATOM   1056 C  C     . HIS A 1 156 ? 117.484 -5.230  93.444  1.00 18.91 ? 243  HIS A C     1 
ATOM   1057 O  O     . HIS A 1 156 ? 116.873 -6.190  92.946  1.00 18.88 ? 243  HIS A O     1 
ATOM   1058 C  CB    . HIS A 1 156 ? 118.559 -3.516  91.948  1.00 19.31 ? 243  HIS A CB    1 
ATOM   1059 C  CG    . HIS A 1 156 ? 118.743 -4.482  90.807  1.00 21.16 ? 243  HIS A CG    1 
ATOM   1060 N  ND1   . HIS A 1 156 ? 117.759 -4.762  89.922  1.00 22.35 ? 243  HIS A ND1   1 
ATOM   1061 C  CD2   . HIS A 1 156 ? 119.860 -5.200  90.392  1.00 21.61 ? 243  HIS A CD2   1 
ATOM   1062 C  CE1   . HIS A 1 156 ? 118.216 -5.641  89.013  1.00 22.75 ? 243  HIS A CE1   1 
ATOM   1063 N  NE2   . HIS A 1 156 ? 119.504 -5.906  89.300  1.00 21.67 ? 243  HIS A NE2   1 
ATOM   1064 N  N     . LEU A 1 157 ? 118.246 -5.358  94.535  1.00 16.85 ? 244  LEU A N     1 
ATOM   1065 C  CA    . LEU A 1 157 ? 118.366 -6.650  95.218  1.00 17.29 ? 244  LEU A CA    1 
ATOM   1066 C  C     . LEU A 1 157 ? 117.004 -7.129  95.748  1.00 17.68 ? 244  LEU A C     1 
ATOM   1067 O  O     . LEU A 1 157 ? 116.649 -8.302  95.592  1.00 19.51 ? 244  LEU A O     1 
ATOM   1068 C  CB    . LEU A 1 157 ? 119.379 -6.546  96.372  1.00 16.07 ? 244  LEU A CB    1 
ATOM   1069 C  CG    . LEU A 1 157 ? 119.837 -7.827  97.089  1.00 16.49 ? 244  LEU A CG    1 
ATOM   1070 C  CD1   . LEU A 1 157 ? 121.126 -7.529  97.859  1.00 15.74 ? 244  LEU A CD1   1 
ATOM   1071 C  CD2   . LEU A 1 157 ? 118.788 -8.401  98.044  1.00 16.86 ? 244  LEU A CD2   1 
ATOM   1072 N  N     . ILE A 1 158 ? 116.265 -6.224  96.388  1.00 18.67 ? 245  ILE A N     1 
ATOM   1073 C  CA    . ILE A 1 158 ? 114.975 -6.546  97.003  1.00 22.00 ? 245  ILE A CA    1 
ATOM   1074 C  C     . ILE A 1 158 ? 114.018 -7.048  95.926  1.00 22.97 ? 245  ILE A C     1 
ATOM   1075 O  O     . ILE A 1 158 ? 113.431 -8.127  96.049  1.00 22.54 ? 245  ILE A O     1 
ATOM   1076 C  CB    . ILE A 1 158 ? 114.343 -5.314  97.729  1.00 23.28 ? 245  ILE A CB    1 
ATOM   1077 C  CG1   . ILE A 1 158 ? 115.180 -4.862  98.943  1.00 24.58 ? 245  ILE A CG1   1 
ATOM   1078 C  CG2   . ILE A 1 158 ? 112.895 -5.586  98.139  1.00 24.71 ? 245  ILE A CG2   1 
ATOM   1079 C  CD1   . ILE A 1 158 ? 115.531 -5.954  99.942  1.00 24.71 ? 245  ILE A CD1   1 
ATOM   1080 N  N     . ASN A 1 159 ? 113.901 -6.263  94.860  1.00 25.08 ? 246  ASN A N     1 
ATOM   1081 C  CA    . ASN A 1 159 ? 112.926 -6.521  93.804  1.00 26.99 ? 246  ASN A CA    1 
ATOM   1082 C  C     . ASN A 1 159 ? 113.239 -7.749  92.957  1.00 27.25 ? 246  ASN A C     1 
ATOM   1083 O  O     . ASN A 1 159 ? 112.335 -8.511  92.612  1.00 29.95 ? 246  ASN A O     1 
ATOM   1084 C  CB    . ASN A 1 159 ? 112.745 -5.267  92.937  1.00 26.66 ? 246  ASN A CB    1 
ATOM   1085 C  CG    . ASN A 1 159 ? 112.192 -4.103  93.729  1.00 27.84 ? 246  ASN A CG    1 
ATOM   1086 O  OD1   . ASN A 1 159 ? 111.535 -4.295  94.753  1.00 29.54 ? 246  ASN A OD1   1 
ATOM   1087 N  ND2   . ASN A 1 159 ? 112.462 -2.892  93.272  1.00 28.77 ? 246  ASN A ND2   1 
ATOM   1088 N  N     . SER A 1 160 ? 114.519 -7.951  92.654  1.00 25.92 ? 247  SER A N     1 
ATOM   1089 C  CA    . SER A 1 160 ? 114.954 -9.080  91.836  1.00 24.97 ? 247  SER A CA    1 
ATOM   1090 C  C     . SER A 1 160 ? 114.966 -10.419 92.565  1.00 25.31 ? 247  SER A C     1 
ATOM   1091 O  O     . SER A 1 160 ? 115.063 -11.463 91.914  1.00 27.06 ? 247  SER A O     1 
ATOM   1092 C  CB    . SER A 1 160 ? 116.350 -8.837  91.255  1.00 25.88 ? 247  SER A CB    1 
ATOM   1093 O  OG    . SER A 1 160 ? 116.427 -7.600  90.579  1.00 29.42 ? 247  SER A OG    1 
ATOM   1094 N  N     . ASN A 1 161 ? 114.882 -10.404 93.895  1.00 23.53 ? 248  ASN A N     1 
ATOM   1095 C  CA    . ASN A 1 161 ? 115.031 -11.645 94.668  1.00 23.59 ? 248  ASN A CA    1 
ATOM   1096 C  C     . ASN A 1 161 ? 113.873 -11.970 95.606  1.00 24.95 ? 248  ASN A C     1 
ATOM   1097 O  O     . ASN A 1 161 ? 113.988 -12.859 96.450  1.00 25.05 ? 248  ASN A O     1 
ATOM   1098 C  CB    . ASN A 1 161 ? 116.372 -11.654 95.431  1.00 19.98 ? 248  ASN A CB    1 
ATOM   1099 C  CG    . ASN A 1 161 ? 117.564 -11.623 94.503  1.00 19.74 ? 248  ASN A CG    1 
ATOM   1100 O  OD1   . ASN A 1 161 ? 117.939 -12.634 93.897  1.00 21.13 ? 248  ASN A OD1   1 
ATOM   1101 N  ND2   . ASN A 1 161 ? 118.174 -10.465 94.389  1.00 19.30 ? 248  ASN A ND2   1 
ATOM   1102 N  N     . GLY A 1 162 ? 112.765 -11.244 95.458  1.00 26.50 ? 249  GLY A N     1 
ATOM   1103 C  CA    . GLY A 1 162 ? 111.560 -11.478 96.260  1.00 26.34 ? 249  GLY A CA    1 
ATOM   1104 C  C     . GLY A 1 162 ? 111.760 -11.403 97.765  1.00 26.62 ? 249  GLY A C     1 
ATOM   1105 O  O     . GLY A 1 162 ? 111.243 -12.234 98.511  1.00 25.68 ? 249  GLY A O     1 
ATOM   1106 N  N     . ILE A 1 163 ? 112.498 -10.391 98.218  1.00 25.58 ? 250  ILE A N     1 
ATOM   1107 C  CA    . ILE A 1 163 ? 112.866 -10.290 99.633  1.00 25.45 ? 250  ILE A CA    1 
ATOM   1108 C  C     . ILE A 1 163 ? 111.712 -9.819  100.525 1.00 25.38 ? 250  ILE A C     1 
ATOM   1109 O  O     . ILE A 1 163 ? 111.659 -10.161 101.713 1.00 25.37 ? 250  ILE A O     1 
ATOM   1110 C  CB    . ILE A 1 163 ? 114.124 -9.400  99.819  1.00 25.69 ? 250  ILE A CB    1 
ATOM   1111 C  CG1   . ILE A 1 163 ? 115.287 -9.917  98.956  1.00 25.20 ? 250  ILE A CG1   1 
ATOM   1112 C  CG2   . ILE A 1 163 ? 114.530 -9.296  101.285 1.00 25.40 ? 250  ILE A CG2   1 
ATOM   1113 C  CD1   . ILE A 1 163 ? 115.753 -11.319 99.313  1.00 26.27 ? 250  ILE A CD1   1 
ATOM   1114 N  N     . LYS A 1 164 ? 110.780 -9.050  99.961  1.00 25.09 ? 251  LYS A N     1 
ATOM   1115 C  CA    . LYS A 1 164 ? 109.719 -8.456  100.787 1.00 25.52 ? 251  LYS A CA    1 
ATOM   1116 C  C     . LYS A 1 164 ? 108.863 -9.471  101.559 1.00 25.75 ? 251  LYS A C     1 
ATOM   1117 O  O     . LYS A 1 164 ? 108.605 -9.264  102.748 1.00 25.31 ? 251  LYS A O     1 
ATOM   1118 C  CB    . LYS A 1 164 ? 108.843 -7.474  99.985  1.00 27.02 ? 251  LYS A CB    1 
ATOM   1119 C  CG    . LYS A 1 164 ? 109.546 -6.188  99.595  1.00 28.86 ? 251  LYS A CG    1 
ATOM   1120 C  CD    . LYS A 1 164 ? 108.569 -5.190  98.990  1.00 31.47 ? 251  LYS A CD    1 
ATOM   1121 C  CE    . LYS A 1 164 ? 109.307 -4.055  98.301  1.00 33.78 ? 251  LYS A CE    1 
ATOM   1122 N  NZ    . LYS A 1 164 ? 108.375 -3.044  97.719  1.00 35.49 ? 251  LYS A NZ    1 
ATOM   1123 N  N     . PRO A 1 165 ? 108.433 -10.575 100.903 1.00 27.77 ? 252  PRO A N     1 
ATOM   1124 C  CA    . PRO A 1 165 ? 107.716 -11.611 101.657 1.00 28.36 ? 252  PRO A CA    1 
ATOM   1125 C  C     . PRO A 1 165 ? 108.564 -12.256 102.759 1.00 28.13 ? 252  PRO A C     1 
ATOM   1126 O  O     . PRO A 1 165 ? 108.035 -12.602 103.815 1.00 26.86 ? 252  PRO A O     1 
ATOM   1127 C  CB    . PRO A 1 165 ? 107.367 -12.648 100.583 1.00 29.17 ? 252  PRO A CB    1 
ATOM   1128 C  CG    . PRO A 1 165 ? 107.315 -11.868 99.320  1.00 29.24 ? 252  PRO A CG    1 
ATOM   1129 C  CD    . PRO A 1 165 ? 108.423 -10.866 99.456  1.00 28.32 ? 252  PRO A CD    1 
ATOM   1130 N  N     . VAL A 1 166 ? 109.868 -12.401 102.519 1.00 28.12 ? 253  VAL A N     1 
ATOM   1131 C  CA    . VAL A 1 166 ? 110.778 -12.971 103.519 1.00 25.87 ? 253  VAL A CA    1 
ATOM   1132 C  C     . VAL A 1 166 ? 110.901 -12.031 104.716 1.00 23.84 ? 253  VAL A C     1 
ATOM   1133 O  O     . VAL A 1 166 ? 110.860 -12.476 105.858 1.00 23.94 ? 253  VAL A O     1 
ATOM   1134 C  CB    . VAL A 1 166 ? 112.172 -13.313 102.936 1.00 26.35 ? 253  VAL A CB    1 
ATOM   1135 C  CG1   . VAL A 1 166 ? 112.980 -14.130 103.940 1.00 25.56 ? 253  VAL A CG1   1 
ATOM   1136 C  CG2   . VAL A 1 166 ? 112.041 -14.070 101.614 1.00 25.10 ? 253  VAL A CG2   1 
ATOM   1137 N  N     . MET A 1 167 ? 111.021 -10.732 104.449 1.00 24.63 ? 254  MET A N     1 
ATOM   1138 C  CA    . MET A 1 167 ? 110.998 -9.709  105.500 1.00 24.81 ? 254  MET A CA    1 
ATOM   1139 C  C     . MET A 1 167 ? 109.727 -9.818  106.347 1.00 25.74 ? 254  MET A C     1 
ATOM   1140 O  O     . MET A 1 167 ? 109.785 -9.738  107.575 1.00 25.17 ? 254  MET A O     1 
ATOM   1141 C  CB    . MET A 1 167 ? 111.081 -8.309  104.895 1.00 25.00 ? 254  MET A CB    1 
ATOM   1142 C  CG    . MET A 1 167 ? 112.463 -7.907  104.431 1.00 24.94 ? 254  MET A CG    1 
ATOM   1143 S  SD    . MET A 1 167 ? 112.469 -6.311  103.603 1.00 24.26 ? 254  MET A SD    1 
ATOM   1144 C  CE    . MET A 1 167 ? 114.186 -5.834  103.803 1.00 27.03 ? 254  MET A CE    1 
ATOM   1145 N  N     . GLU A 1 168 ? 108.588 -9.997  105.676 1.00 27.27 ? 255  GLU A N     1 
ATOM   1146 C  CA    . GLU A 1 168 ? 107.287 -10.107 106.351 1.00 28.81 ? 255  GLU A CA    1 
ATOM   1147 C  C     . GLU A 1 168 ? 107.234 -11.315 107.268 1.00 27.12 ? 255  GLU A C     1 
ATOM   1148 O  O     . GLU A 1 168 ? 106.780 -11.217 108.406 1.00 28.62 ? 255  GLU A O     1 
ATOM   1149 C  CB    . GLU A 1 168 ? 106.150 -10.188 105.328 1.00 32.03 ? 255  GLU A CB    1 
ATOM   1150 C  CG    . GLU A 1 168 ? 105.684 -8.843  104.801 1.00 35.48 ? 255  GLU A CG    1 
ATOM   1151 C  CD    . GLU A 1 168 ? 104.701 -8.973  103.651 1.00 38.62 ? 255  GLU A CD    1 
ATOM   1152 O  OE1   . GLU A 1 168 ? 104.048 -10.037 103.519 1.00 40.08 ? 255  GLU A OE1   1 
ATOM   1153 O  OE2   . GLU A 1 168 ? 104.588 -8.004  102.872 1.00 41.71 ? 255  GLU A OE2   1 
ATOM   1154 N  N     . GLN A 1 169 ? 107.707 -12.451 106.759 1.00 26.80 ? 256  GLN A N     1 
ATOM   1155 C  CA    . GLN A 1 169 ? 107.773 -13.703 107.512 1.00 28.96 ? 256  GLN A CA    1 
ATOM   1156 C  C     . GLN A 1 169 ? 108.514 -13.527 108.838 1.00 28.95 ? 256  GLN A C     1 
ATOM   1157 O  O     . GLN A 1 169 ? 108.146 -14.127 109.848 1.00 29.50 ? 256  GLN A O     1 
ATOM   1158 C  CB    . GLN A 1 169 ? 108.451 -14.773 106.658 1.00 29.69 ? 256  GLN A CB    1 
ATOM   1159 C  CG    . GLN A 1 169 ? 108.755 -16.086 107.365 1.00 34.03 ? 256  GLN A CG    1 
ATOM   1160 C  CD    . GLN A 1 169 ? 109.503 -17.058 106.469 1.00 37.00 ? 256  GLN A CD    1 
ATOM   1161 O  OE1   . GLN A 1 169 ? 109.826 -16.739 105.317 1.00 38.98 ? 256  GLN A OE1   1 
ATOM   1162 N  NE2   . GLN A 1 169 ? 109.786 -18.252 106.991 1.00 38.17 ? 256  GLN A NE2   1 
ATOM   1163 N  N     . TYR A 1 170 ? 109.545 -12.689 108.831 1.00 29.40 ? 257  TYR A N     1 
ATOM   1164 C  CA    . TYR A 1 170 ? 110.360 -12.473 110.023 1.00 30.97 ? 257  TYR A CA    1 
ATOM   1165 C  C     . TYR A 1 170 ? 110.004 -11.234 110.843 1.00 32.86 ? 257  TYR A C     1 
ATOM   1166 O  O     . TYR A 1 170 ? 110.792 -10.797 111.677 1.00 34.74 ? 257  TYR A O     1 
ATOM   1167 C  CB    . TYR A 1 170 ? 111.855 -12.511 109.661 1.00 29.11 ? 257  TYR A CB    1 
ATOM   1168 C  CG    . TYR A 1 170 ? 112.299 -13.893 109.240 1.00 26.93 ? 257  TYR A CG    1 
ATOM   1169 C  CD1   . TYR A 1 170 ? 112.353 -14.937 110.164 1.00 27.87 ? 257  TYR A CD1   1 
ATOM   1170 C  CD2   . TYR A 1 170 ? 112.641 -14.165 107.922 1.00 25.56 ? 257  TYR A CD2   1 
ATOM   1171 C  CE1   . TYR A 1 170 ? 112.745 -16.210 109.781 1.00 25.55 ? 257  TYR A CE1   1 
ATOM   1172 C  CE2   . TYR A 1 170 ? 113.035 -15.434 107.532 1.00 26.28 ? 257  TYR A CE2   1 
ATOM   1173 C  CZ    . TYR A 1 170 ? 113.094 -16.447 108.472 1.00 26.13 ? 257  TYR A CZ    1 
ATOM   1174 O  OH    . TYR A 1 170 ? 113.484 -17.712 108.098 1.00 29.75 ? 257  TYR A OH    1 
ATOM   1175 N  N     . GLY A 1 171 ? 108.819 -10.672 110.606 1.00 33.92 ? 258  GLY A N     1 
ATOM   1176 C  CA    . GLY A 1 171 ? 108.283 -9.619  111.467 1.00 32.29 ? 258  GLY A CA    1 
ATOM   1177 C  C     . GLY A 1 171 ? 108.529 -8.190  111.025 1.00 31.98 ? 258  GLY A C     1 
ATOM   1178 O  O     . GLY A 1 171 ? 108.143 -7.250  111.719 1.00 34.64 ? 258  GLY A O     1 
ATOM   1179 N  N     . LEU A 1 172 ? 109.166 -8.017  109.872 1.00 29.03 ? 259  LEU A N     1 
ATOM   1180 C  CA    . LEU A 1 172 ? 109.439 -6.682  109.348 1.00 27.87 ? 259  LEU A CA    1 
ATOM   1181 C  C     . LEU A 1 172 ? 108.236 -6.093  108.615 1.00 28.71 ? 259  LEU A C     1 
ATOM   1182 O  O     . LEU A 1 172 ? 107.377 -6.834  108.141 1.00 30.57 ? 259  LEU A O     1 
ATOM   1183 C  CB    . LEU A 1 172 ? 110.663 -6.700  108.425 1.00 25.85 ? 259  LEU A CB    1 
ATOM   1184 C  CG    . LEU A 1 172 ? 112.015 -6.458  109.111 1.00 24.66 ? 259  LEU A CG    1 
ATOM   1185 C  CD1   . LEU A 1 172 ? 112.322 -7.517  110.164 1.00 23.81 ? 259  LEU A CD1   1 
ATOM   1186 C  CD2   . LEU A 1 172 ? 113.114 -6.405  108.061 1.00 24.68 ? 259  LEU A CD2   1 
ATOM   1187 N  N     . ILE A 1 173 ? 108.184 -4.764  108.540 1.00 28.25 ? 260  ILE A N     1 
ATOM   1188 C  CA    . ILE A 1 173 ? 107.185 -4.066  107.711 1.00 29.68 ? 260  ILE A CA    1 
ATOM   1189 C  C     . ILE A 1 173 ? 107.894 -3.421  106.514 1.00 28.61 ? 260  ILE A C     1 
ATOM   1190 O  O     . ILE A 1 173 ? 108.393 -2.298  106.626 1.00 30.07 ? 260  ILE A O     1 
ATOM   1191 C  CB    . ILE A 1 173 ? 106.375 -3.022  108.519 1.00 30.15 ? 260  ILE A CB    1 
ATOM   1192 C  CG1   . ILE A 1 173 ? 105.741 -3.678  109.756 1.00 31.60 ? 260  ILE A CG1   1 
ATOM   1193 C  CG2   . ILE A 1 173 ? 105.308 -2.386  107.637 1.00 31.34 ? 260  ILE A CG2   1 
ATOM   1194 C  CD1   . ILE A 1 173 ? 105.101 -2.707  110.738 1.00 32.62 ? 260  ILE A CD1   1 
ATOM   1195 N  N     . PRO A 1 174 ? 107.956 -4.143  105.371 1.00 28.68 ? 261  PRO A N     1 
ATOM   1196 C  CA    . PRO A 1 174 ? 108.757 -3.802  104.194 1.00 29.39 ? 261  PRO A CA    1 
ATOM   1197 C  C     . PRO A 1 174 ? 108.710 -2.339  103.777 1.00 31.77 ? 261  PRO A C     1 
ATOM   1198 O  O     . PRO A 1 174 ? 109.759 -1.734  103.576 1.00 30.17 ? 261  PRO A O     1 
ATOM   1199 C  CB    . PRO A 1 174 ? 108.167 -4.697  103.106 1.00 28.60 ? 261  PRO A CB    1 
ATOM   1200 C  CG    . PRO A 1 174 ? 107.747 -5.913  103.844 1.00 28.30 ? 261  PRO A CG    1 
ATOM   1201 C  CD    . PRO A 1 174 ? 107.255 -5.429  105.182 1.00 27.95 ? 261  PRO A CD    1 
ATOM   1202 N  N     . GLU A 1 175 ? 107.512 -1.776  103.648 1.00 34.47 ? 262  GLU A N     1 
ATOM   1203 C  CA    . GLU A 1 175 ? 107.356 -0.368  103.278 1.00 37.08 ? 262  GLU A CA    1 
ATOM   1204 C  C     . GLU A 1 175 ? 108.143 0.572   104.209 1.00 35.76 ? 262  GLU A C     1 
ATOM   1205 O  O     . GLU A 1 175 ? 109.002 1.323   103.747 1.00 37.73 ? 262  GLU A O     1 
ATOM   1206 C  CB    . GLU A 1 175 ? 105.871 0.001   103.244 1.00 41.12 ? 262  GLU A CB    1 
ATOM   1207 C  CG    . GLU A 1 175 ? 105.564 1.428   102.830 1.00 45.52 ? 262  GLU A CG    1 
ATOM   1208 C  CD    . GLU A 1 175 ? 104.071 1.686   102.755 1.00 48.88 ? 262  GLU A CD    1 
ATOM   1209 O  OE1   . GLU A 1 175 ? 103.408 1.107   101.848 1.00 50.39 ? 262  GLU A OE1   1 
ATOM   1210 O  OE2   . GLU A 1 175 ? 103.561 2.466   103.605 1.00 50.38 ? 262  GLU A OE2   1 
ATOM   1211 N  N     . GLU A 1 176 ? 107.857 0.510   105.506 1.00 33.31 ? 263  GLU A N     1 
ATOM   1212 C  CA    . GLU A 1 176 ? 108.546 1.325   106.504 1.00 32.39 ? 263  GLU A CA    1 
ATOM   1213 C  C     . GLU A 1 176 ? 110.031 0.959   106.610 1.00 29.40 ? 263  GLU A C     1 
ATOM   1214 O  O     . GLU A 1 176 ? 110.897 1.831   106.619 1.00 27.09 ? 263  GLU A O     1 
ATOM   1215 C  CB    . GLU A 1 176 ? 107.914 1.142   107.885 1.00 35.30 ? 263  GLU A CB    1 
ATOM   1216 C  CG    . GLU A 1 176 ? 106.466 1.577   108.031 1.00 38.48 ? 263  GLU A CG    1 
ATOM   1217 C  CD    . GLU A 1 176 ? 105.953 1.361   109.446 1.00 41.40 ? 263  GLU A CD    1 
ATOM   1218 O  OE1   . GLU A 1 176 ? 106.783 1.207   110.371 1.00 42.51 ? 263  GLU A OE1   1 
ATOM   1219 O  OE2   . GLU A 1 176 ? 104.718 1.348   109.637 1.00 44.76 ? 263  GLU A OE2   1 
ATOM   1220 N  N     . ASP A 1 177 ? 110.305 -0.338  106.687 1.00 27.02 ? 264  ASP A N     1 
ATOM   1221 C  CA    . ASP A 1 177 ? 111.649 -0.835  106.999 1.00 24.74 ? 264  ASP A CA    1 
ATOM   1222 C  C     . ASP A 1 177 ? 112.667 -0.713  105.864 1.00 23.70 ? 264  ASP A C     1 
ATOM   1223 O  O     . ASP A 1 177 ? 113.832 -0.385  106.112 1.00 24.08 ? 264  ASP A O     1 
ATOM   1224 C  CB    . ASP A 1 177 ? 111.553 -2.261  107.535 1.00 23.42 ? 264  ASP A CB    1 
ATOM   1225 C  CG    . ASP A 1 177 ? 110.987 -2.305  108.934 1.00 23.55 ? 264  ASP A CG    1 
ATOM   1226 O  OD1   . ASP A 1 177 ? 111.032 -1.265  109.629 1.00 26.75 ? 264  ASP A OD1   1 
ATOM   1227 O  OD2   . ASP A 1 177 ? 110.508 -3.371  109.359 1.00 24.63 ? 264  ASP A OD2   1 
ATOM   1228 N  N     . ILE A 1 178 ? 112.245 -0.960  104.630 1.00 21.93 ? 265  ILE A N     1 
ATOM   1229 C  CA    . ILE A 1 178 ? 113.084 -0.646  103.470 1.00 21.83 ? 265  ILE A CA    1 
ATOM   1230 C  C     . ILE A 1 178 ? 113.481 0.832   103.430 1.00 22.67 ? 265  ILE A C     1 
ATOM   1231 O  O     . ILE A 1 178 ? 114.649 1.176   103.188 1.00 21.20 ? 265  ILE A O     1 
ATOM   1232 C  CB    . ILE A 1 178 ? 112.428 -1.095  102.145 1.00 22.34 ? 265  ILE A CB    1 
ATOM   1233 C  CG1   . ILE A 1 178 ? 112.438 -2.631  102.056 1.00 24.28 ? 265  ILE A CG1   1 
ATOM   1234 C  CG2   . ILE A 1 178 ? 113.148 -0.492  100.949 1.00 21.51 ? 265  ILE A CG2   1 
ATOM   1235 C  CD1   . ILE A 1 178 ? 111.579 -3.212  100.948 1.00 24.15 ? 265  ILE A CD1   1 
ATOM   1236 N  N     . TYR A 1 179 ? 112.510 1.711   103.667 1.00 23.46 ? 266  TYR A N     1 
ATOM   1237 C  CA    . TYR A 1 179 ? 112.773 3.145   103.739 1.00 23.21 ? 266  TYR A CA    1 
ATOM   1238 C  C     . TYR A 1 179 ? 113.796 3.444   104.839 1.00 21.08 ? 266  TYR A C     1 
ATOM   1239 O  O     . TYR A 1 179 ? 114.741 4.198   104.622 1.00 21.36 ? 266  TYR A O     1 
ATOM   1240 C  CB    . TYR A 1 179 ? 111.463 3.885   104.027 1.00 24.85 ? 266  TYR A CB    1 
ATOM   1241 C  CG    . TYR A 1 179 ? 111.409 5.324   103.568 1.00 25.82 ? 266  TYR A CG    1 
ATOM   1242 C  CD1   . TYR A 1 179 ? 110.989 5.645   102.274 1.00 27.97 ? 266  TYR A CD1   1 
ATOM   1243 C  CD2   . TYR A 1 179 ? 111.734 6.366   104.434 1.00 26.60 ? 266  TYR A CD2   1 
ATOM   1244 C  CE1   . TYR A 1 179 ? 110.917 6.961   101.847 1.00 29.27 ? 266  TYR A CE1   1 
ATOM   1245 C  CE2   . TYR A 1 179 ? 111.666 7.685   104.019 1.00 29.16 ? 266  TYR A CE2   1 
ATOM   1246 C  CZ    . TYR A 1 179 ? 111.257 7.979   102.725 1.00 30.33 ? 266  TYR A CZ    1 
ATOM   1247 O  OH    . TYR A 1 179 ? 111.189 9.285   102.302 1.00 33.02 ? 266  TYR A OH    1 
ATOM   1248 N  N     . PHE A 1 180 ? 113.587 2.843   106.013 1.00 21.58 ? 267  PHE A N     1 
ATOM   1249 C  CA    . PHE A 1 180 ? 114.471 3.004   107.177 1.00 20.47 ? 267  PHE A CA    1 
ATOM   1250 C  C     . PHE A 1 180 ? 115.902 2.582   106.840 1.00 20.07 ? 267  PHE A C     1 
ATOM   1251 O  O     . PHE A 1 180 ? 116.867 3.298   107.146 1.00 19.06 ? 267  PHE A O     1 
ATOM   1252 C  CB    . PHE A 1 180 ? 113.936 2.191   108.365 1.00 20.63 ? 267  PHE A CB    1 
ATOM   1253 C  CG    . PHE A 1 180 ? 114.847 2.186   109.576 1.00 20.46 ? 267  PHE A CG    1 
ATOM   1254 C  CD1   . PHE A 1 180 ? 115.499 3.346   109.991 1.00 21.40 ? 267  PHE A CD1   1 
ATOM   1255 C  CD2   . PHE A 1 180 ? 115.044 1.013   110.307 1.00 21.75 ? 267  PHE A CD2   1 
ATOM   1256 C  CE1   . PHE A 1 180 ? 116.335 3.336   111.100 1.00 21.19 ? 267  PHE A CE1   1 
ATOM   1257 C  CE2   . PHE A 1 180 ? 115.873 1.000   111.419 1.00 21.21 ? 267  PHE A CE2   1 
ATOM   1258 C  CZ    . PHE A 1 180 ? 116.513 2.163   111.817 1.00 21.44 ? 267  PHE A CZ    1 
ATOM   1259 N  N     . ILE A 1 181 ? 116.022 1.416   106.213 1.00 19.50 ? 268  ILE A N     1 
ATOM   1260 C  CA    . ILE A 1 181 ? 117.322 0.899   105.796 1.00 18.90 ? 268  ILE A CA    1 
ATOM   1261 C  C     . ILE A 1 181 ? 117.994 1.879   104.841 1.00 18.91 ? 268  ILE A C     1 
ATOM   1262 O  O     . ILE A 1 181 ? 119.158 2.228   105.007 1.00 17.75 ? 268  ILE A O     1 
ATOM   1263 C  CB    . ILE A 1 181 ? 117.178 -0.501  105.172 1.00 18.16 ? 268  ILE A CB    1 
ATOM   1264 C  CG1   . ILE A 1 181 ? 116.713 -1.499  106.237 1.00 17.04 ? 268  ILE A CG1   1 
ATOM   1265 C  CG2   . ILE A 1 181 ? 118.474 -0.930  104.503 1.00 18.43 ? 268  ILE A CG2   1 
ATOM   1266 C  CD1   . ILE A 1 181 ? 116.160 -2.789  105.663 1.00 18.00 ? 268  ILE A CD1   1 
ATOM   1267 N  N     . LYS A 1 182 ? 117.248 2.360   103.852 1.00 17.89 ? 269  LYS A N     1 
ATOM   1268 C  CA    . LYS A 1 182 ? 117.802 3.318   102.910 1.00 18.21 ? 269  LYS A CA    1 
ATOM   1269 C  C     . LYS A 1 182 ? 118.281 4.605   103.598 1.00 17.72 ? 269  LYS A C     1 
ATOM   1270 O  O     . LYS A 1 182 ? 119.350 5.128   103.261 1.00 17.61 ? 269  LYS A O     1 
ATOM   1271 C  CB    . LYS A 1 182 ? 116.788 3.628   101.801 1.00 19.71 ? 269  LYS A CB    1 
ATOM   1272 C  CG    . LYS A 1 182 ? 116.570 2.467   100.836 1.00 21.74 ? 269  LYS A CG    1 
ATOM   1273 C  CD    . LYS A 1 182 ? 115.411 2.732   99.885  1.00 22.93 ? 269  LYS A CD    1 
ATOM   1274 C  CE    . LYS A 1 182 ? 115.310 1.642   98.831  1.00 25.56 ? 269  LYS A CE    1 
ATOM   1275 N  NZ    . LYS A 1 182 ? 114.051 1.782   98.035  1.00 26.73 ? 269  LYS A NZ    1 
ATOM   1276 N  N     . GLU A 1 183 ? 117.496 5.105   104.555 1.00 18.48 ? 270  GLU A N     1 
ATOM   1277 C  CA    . GLU A 1 183 ? 117.851 6.294   105.330 1.00 18.39 ? 270  GLU A CA    1 
ATOM   1278 C  C     . GLU A 1 183 ? 119.160 6.070   106.114 1.00 18.10 ? 270  GLU A C     1 
ATOM   1279 O  O     . GLU A 1 183 ? 120.010 6.952   106.179 1.00 18.16 ? 270  GLU A O     1 
ATOM   1280 C  CB    . GLU A 1 183 ? 116.726 6.662   106.298 1.00 21.00 ? 270  GLU A CB    1 
ATOM   1281 C  CG    . GLU A 1 183 ? 115.437 7.150   105.635 1.00 21.81 ? 270  GLU A CG    1 
ATOM   1282 C  CD    . GLU A 1 183 ? 114.343 7.458   106.643 1.00 23.78 ? 270  GLU A CD    1 
ATOM   1283 O  OE1   . GLU A 1 183 ? 114.091 6.632   107.547 1.00 22.39 ? 270  GLU A OE1   1 
ATOM   1284 O  OE2   . GLU A 1 183 ? 113.721 8.532   106.526 1.00 26.34 ? 270  GLU A OE2   1 
ATOM   1285 N  N     . GLN A 1 184 ? 119.308 4.891   106.704 1.00 17.94 ? 271  GLN A N     1 
ATOM   1286 C  CA    . GLN A 1 184 ? 120.547 4.557   107.441 1.00 17.85 ? 271  GLN A CA    1 
ATOM   1287 C  C     . GLN A 1 184 ? 121.770 4.614   106.539 1.00 18.40 ? 271  GLN A C     1 
ATOM   1288 O  O     . GLN A 1 184 ? 122.873 4.932   106.997 1.00 19.21 ? 271  GLN A O     1 
ATOM   1289 C  CB    . GLN A 1 184 ? 120.461 3.165   108.043 1.00 16.68 ? 271  GLN A CB    1 
ATOM   1290 C  CG    . GLN A 1 184 ? 119.391 2.950   109.088 1.00 17.85 ? 271  GLN A CG    1 
ATOM   1291 C  CD    . GLN A 1 184 ? 119.420 1.528   109.600 1.00 18.35 ? 271  GLN A CD    1 
ATOM   1292 O  OE1   . GLN A 1 184 ? 120.383 1.124   110.256 1.00 18.23 ? 271  GLN A OE1   1 
ATOM   1293 N  NE2   . GLN A 1 184 ? 118.395 0.748   109.274 1.00 17.36 ? 271  GLN A NE2   1 
ATOM   1294 N  N     . ILE A 1 185 ? 121.575 4.308   105.258 1.00 18.27 ? 272  ILE A N     1 
ATOM   1295 C  CA    . ILE A 1 185 ? 122.692 4.218   104.319 1.00 19.22 ? 272  ILE A CA    1 
ATOM   1296 C  C     . ILE A 1 185 ? 123.077 5.573   103.745 1.00 20.83 ? 272  ILE A C     1 
ATOM   1297 O  O     . ILE A 1 185 ? 124.253 5.943   103.734 1.00 20.82 ? 272  ILE A O     1 
ATOM   1298 C  CB    . ILE A 1 185 ? 122.398 3.231   103.164 1.00 18.17 ? 272  ILE A CB    1 
ATOM   1299 C  CG1   . ILE A 1 185 ? 122.318 1.791   103.686 1.00 18.56 ? 272  ILE A CG1   1 
ATOM   1300 C  CG2   . ILE A 1 185 ? 123.454 3.364   102.079 1.00 18.22 ? 272  ILE A CG2   1 
ATOM   1301 C  CD1   . ILE A 1 185 ? 121.830 0.780   102.671 1.00 19.65 ? 272  ILE A CD1   1 
ATOM   1302 N  N     . VAL A 1 186 ? 122.084 6.321   103.267 1.00 21.40 ? 273  VAL A N     1 
ATOM   1303 C  CA    . VAL A 1 186 ? 122.380 7.545   102.535 1.00 22.09 ? 273  VAL A CA    1 
ATOM   1304 C  C     . VAL A 1 186 ? 122.007 8.832   103.285 1.00 22.95 ? 273  VAL A C     1 
ATOM   1305 O  O     . VAL A 1 186 ? 122.374 9.929   102.874 1.00 25.03 ? 273  VAL A O     1 
ATOM   1306 C  CB    . VAL A 1 186 ? 121.756 7.488   101.118 1.00 24.73 ? 273  VAL A CB    1 
ATOM   1307 C  CG1   . VAL A 1 186 ? 120.295 7.900   101.145 1.00 24.75 ? 273  VAL A CG1   1 
ATOM   1308 C  CG2   . VAL A 1 186 ? 122.567 8.304   100.119 1.00 25.43 ? 273  VAL A CG2   1 
ATOM   1309 N  N     . GLY A 1 187 ? 121.300 8.689   104.395 1.00 22.77 ? 274  GLY A N     1 
ATOM   1310 C  CA    . GLY A 1 187 ? 120.808 9.833   105.131 1.00 23.71 ? 274  GLY A CA    1 
ATOM   1311 C  C     . GLY A 1 187 ? 119.386 10.154  104.720 1.00 24.63 ? 274  GLY A C     1 
ATOM   1312 O  O     . GLY A 1 187 ? 118.732 9.348   104.058 1.00 21.58 ? 274  GLY A O     1 
ATOM   1313 N  N     . PRO A 1 188 ? 118.891 11.339  105.120 1.00 27.48 ? 275  PRO A N     1 
ATOM   1314 C  CA    . PRO A 1 188 ? 117.527 11.745  104.788 1.00 29.40 ? 275  PRO A CA    1 
ATOM   1315 C  C     . PRO A 1 188 ? 117.274 11.658  103.288 1.00 29.87 ? 275  PRO A C     1 
ATOM   1316 O  O     . PRO A 1 188 ? 118.105 12.090  102.488 1.00 29.81 ? 275  PRO A O     1 
ATOM   1317 C  CB    . PRO A 1 188 ? 117.473 13.197  105.267 1.00 29.50 ? 275  PRO A CB    1 
ATOM   1318 C  CG    . PRO A 1 188 ? 118.461 13.252  106.385 1.00 29.77 ? 275  PRO A CG    1 
ATOM   1319 C  CD    . PRO A 1 188 ? 119.582 12.352  105.940 1.00 28.38 ? 275  PRO A CD    1 
ATOM   1320 N  N     . LEU A 1 189 ? 116.138 11.080  102.921 1.00 32.96 ? 276  LEU A N     1 
ATOM   1321 C  CA    . LEU A 1 189 ? 115.774 10.920  101.513 1.00 33.63 ? 276  LEU A CA    1 
ATOM   1322 C  C     . LEU A 1 189 ? 115.108 12.192  100.979 1.00 39.19 ? 276  LEU A C     1 
ATOM   1323 O  O     . LEU A 1 189 ? 114.952 12.359  99.764  1.00 40.49 ? 276  LEU A O     1 
ATOM   1324 C  CB    . LEU A 1 189 ? 114.878 9.689   101.335 1.00 31.19 ? 276  LEU A CB    1 
ATOM   1325 C  CG    . LEU A 1 189 ? 115.516 8.383   101.842 1.00 29.12 ? 276  LEU A CG    1 
ATOM   1326 C  CD1   . LEU A 1 189 ? 114.519 7.243   101.925 1.00 28.39 ? 276  LEU A CD1   1 
ATOM   1327 C  CD2   . LEU A 1 189 ? 116.702 7.987   100.979 1.00 28.15 ? 276  LEU A CD2   1 
ATOM   1328 N  N     . GLU A 1 190 ? 114.739 13.086  101.900 1.00 44.37 ? 277  GLU A N     1 
ATOM   1329 C  CA    . GLU A 1 190 ? 114.161 14.390  101.561 1.00 48.03 ? 277  GLU A CA    1 
ATOM   1330 C  C     . GLU A 1 190 ? 114.947 15.526  102.223 1.00 49.28 ? 277  GLU A C     1 
ATOM   1331 O  O     . GLU A 1 190 ? 114.982 15.619  103.464 1.00 50.44 ? 277  GLU A O     1 
ATOM   1332 C  CB    . GLU A 1 190 ? 112.687 14.463  101.983 1.00 51.36 ? 277  GLU A CB    1 
ATOM   1333 C  CG    . GLU A 1 190 ? 111.906 13.166  101.799 1.00 55.20 ? 277  GLU A CG    1 
ATOM   1334 C  CD    . GLU A 1 190 ? 110.532 13.406  101.166 1.00 56.74 ? 277  GLU A CD    1 
ATOM   1335 O  OE1   . GLU A 1 190 ? 110.060 14.569  101.157 1.00 59.30 ? 277  GLU A OE1   1 
ATOM   1336 O  OE2   . GLU A 1 190 ? 109.924 12.423  100.670 1.00 58.69 ? 277  GLU A OE2   1 
ATOM   1337 N  N     . LEU A 1 197 ? 113.245 20.295  112.462 1.00 50.59 ? 284  LEU A N     1 
ATOM   1338 C  CA    . LEU A 1 197 ? 112.264 19.218  112.335 1.00 50.64 ? 284  LEU A CA    1 
ATOM   1339 C  C     . LEU A 1 197 ? 112.945 17.872  112.117 1.00 48.87 ? 284  LEU A C     1 
ATOM   1340 O  O     . LEU A 1 197 ? 113.985 17.792  111.461 1.00 49.60 ? 284  LEU A O     1 
ATOM   1341 C  CB    . LEU A 1 197 ? 111.280 19.497  111.181 1.00 52.86 ? 284  LEU A CB    1 
ATOM   1342 C  CG    . LEU A 1 197 ? 109.995 20.307  111.451 1.00 54.46 ? 284  LEU A CG    1 
ATOM   1343 C  CD1   . LEU A 1 197 ? 110.307 21.775  111.764 1.00 54.49 ? 284  LEU A CD1   1 
ATOM   1344 C  CD2   . LEU A 1 197 ? 109.049 20.212  110.253 1.00 54.31 ? 284  LEU A CD2   1 
ATOM   1345 N  N     . TRP A 1 198 ? 112.344 16.824  112.676 1.00 45.56 ? 285  TRP A N     1 
ATOM   1346 C  CA    . TRP A 1 198 ? 112.814 15.450  112.514 1.00 41.88 ? 285  TRP A CA    1 
ATOM   1347 C  C     . TRP A 1 198 ? 112.727 15.027  111.065 1.00 38.87 ? 285  TRP A C     1 
ATOM   1348 O  O     . TRP A 1 198 ? 111.623 14.858  110.537 1.00 38.92 ? 285  TRP A O     1 
ATOM   1349 C  CB    . TRP A 1 198 ? 112.006 14.523  113.421 1.00 42.31 ? 285  TRP A CB    1 
ATOM   1350 C  CG    . TRP A 1 198 ? 112.422 13.071  113.375 1.00 42.41 ? 285  TRP A CG    1 
ATOM   1351 C  CD1   . TRP A 1 198 ? 111.656 11.982  112.967 1.00 42.18 ? 285  TRP A CD1   1 
ATOM   1352 C  CD2   . TRP A 1 198 ? 113.723 12.503  113.752 1.00 41.76 ? 285  TRP A CD2   1 
ATOM   1353 N  NE1   . TRP A 1 198 ? 112.371 10.817  113.064 1.00 42.37 ? 285  TRP A NE1   1 
ATOM   1354 C  CE2   . TRP A 1 198 ? 113.618 11.057  113.524 1.00 41.90 ? 285  TRP A CE2   1 
ATOM   1355 C  CE3   . TRP A 1 198 ? 114.923 13.030  114.233 1.00 41.42 ? 285  TRP A CE3   1 
ATOM   1356 C  CZ2   . TRP A 1 198 ? 114.675 10.195  113.777 1.00 40.94 ? 285  TRP A CZ2   1 
ATOM   1357 C  CZ3   . TRP A 1 198 ? 115.984 12.150  114.482 1.00 42.99 ? 285  TRP A CZ3   1 
ATOM   1358 C  CH2   . TRP A 1 198 ? 115.859 10.766  114.256 1.00 42.08 ? 285  TRP A CH2   1 
ATOM   1359 N  N     . PRO A 1 199 ? 113.895 14.847  110.401 1.00 35.42 ? 286  PRO A N     1 
ATOM   1360 C  CA    . PRO A 1 199 ? 113.975 14.629  108.949 1.00 32.83 ? 286  PRO A CA    1 
ATOM   1361 C  C     . PRO A 1 199 ? 113.848 13.173  108.480 1.00 33.51 ? 286  PRO A C     1 
ATOM   1362 O  O     . PRO A 1 199 ? 113.867 12.918  107.276 1.00 32.30 ? 286  PRO A O     1 
ATOM   1363 C  CB    . PRO A 1 199 ? 115.367 15.154  108.608 1.00 32.05 ? 286  PRO A CB    1 
ATOM   1364 C  CG    . PRO A 1 199 ? 116.178 14.875  109.831 1.00 34.68 ? 286  PRO A CG    1 
ATOM   1365 C  CD    . PRO A 1 199 ? 115.237 14.837  111.020 1.00 34.53 ? 286  PRO A CD    1 
ATOM   1366 N  N     . TYR A 1 200 ? 113.731 12.237  109.417 1.00 32.78 ? 287  TYR A N     1 
ATOM   1367 C  CA    . TYR A 1 200 ? 113.618 10.821  109.083 1.00 31.85 ? 287  TYR A CA    1 
ATOM   1368 C  C     . TYR A 1 200 ? 112.183 10.338  109.190 1.00 31.62 ? 287  TYR A C     1 
ATOM   1369 O  O     . TYR A 1 200 ? 111.413 10.855  109.994 1.00 32.87 ? 287  TYR A O     1 
ATOM   1370 C  CB    . TYR A 1 200 ? 114.516 9.978   109.999 1.00 30.23 ? 287  TYR A CB    1 
ATOM   1371 C  CG    . TYR A 1 200 ? 115.985 10.159  109.729 1.00 30.25 ? 287  TYR A CG    1 
ATOM   1372 C  CD1   . TYR A 1 200 ? 116.535 9.782   108.506 1.00 29.69 ? 287  TYR A CD1   1 
ATOM   1373 C  CD2   . TYR A 1 200 ? 116.830 10.707  110.694 1.00 30.55 ? 287  TYR A CD2   1 
ATOM   1374 C  CE1   . TYR A 1 200 ? 117.879 9.945   108.250 1.00 30.42 ? 287  TYR A CE1   1 
ATOM   1375 C  CE2   . TYR A 1 200 ? 118.184 10.875  110.445 1.00 30.36 ? 287  TYR A CE2   1 
ATOM   1376 C  CZ    . TYR A 1 200 ? 118.698 10.489  109.221 1.00 30.06 ? 287  TYR A CZ    1 
ATOM   1377 O  OH    . TYR A 1 200 ? 120.029 10.643  108.945 1.00 30.57 ? 287  TYR A OH    1 
ATOM   1378 N  N     . LYS A 1 201 ? 111.835 9.333   108.391 1.00 30.63 ? 288  LYS A N     1 
ATOM   1379 C  CA    . LYS A 1 201 ? 110.503 8.743   108.448 1.00 31.41 ? 288  LYS A CA    1 
ATOM   1380 C  C     . LYS A 1 201 ? 110.476 7.294   108.913 1.00 30.18 ? 288  LYS A C     1 
ATOM   1381 O  O     . LYS A 1 201 ? 109.476 6.846   109.473 1.00 28.92 ? 288  LYS A O     1 
ATOM   1382 C  CB    . LYS A 1 201 ? 109.798 8.874   107.095 1.00 34.06 ? 288  LYS A CB    1 
ATOM   1383 C  CG    . LYS A 1 201 ? 109.240 10.267  106.840 1.00 36.62 ? 288  LYS A CG    1 
ATOM   1384 C  CD    . LYS A 1 201 ? 108.299 10.262  105.640 1.00 38.44 ? 288  LYS A CD    1 
ATOM   1385 C  CE    . LYS A 1 201 ? 107.806 11.669  105.336 1.00 39.88 ? 288  LYS A CE    1 
ATOM   1386 N  NZ    . LYS A 1 201 ? 108.887 12.563  104.820 1.00 41.38 ? 288  LYS A NZ    1 
ATOM   1387 N  N     . GLY A 1 202 ? 111.565 6.558   108.687 1.00 28.85 ? 289  GLY A N     1 
ATOM   1388 C  CA    . GLY A 1 202 ? 111.616 5.144   109.057 1.00 25.78 ? 289  GLY A CA    1 
ATOM   1389 C  C     . GLY A 1 202 ? 111.422 4.879   110.539 1.00 24.67 ? 289  GLY A C     1 
ATOM   1390 O  O     . GLY A 1 202 ? 110.818 3.871   110.913 1.00 25.18 ? 289  GLY A O     1 
ATOM   1391 N  N     . ARG A 1 203 ? 111.949 5.776   111.376 1.00 26.98 ? 290  ARG A N     1 
ATOM   1392 C  CA    . ARG A 1 203 ? 111.857 5.679   112.840 1.00 28.38 ? 290  ARG A CA    1 
ATOM   1393 C  C     . ARG A 1 203 ? 111.673 7.066   113.484 1.00 30.66 ? 290  ARG A C     1 
ATOM   1394 O  O     . ARG A 1 203 ? 112.225 8.061   112.992 1.00 30.37 ? 290  ARG A O     1 
ATOM   1395 C  CB    . ARG A 1 203 ? 113.119 5.006   113.428 1.00 26.64 ? 290  ARG A CB    1 
ATOM   1396 C  CG    . ARG A 1 203 ? 113.276 3.511   113.140 1.00 25.82 ? 290  ARG A CG    1 
ATOM   1397 C  CD    . ARG A 1 203 ? 112.103 2.700   113.689 1.00 26.12 ? 290  ARG A CD    1 
ATOM   1398 N  NE    . ARG A 1 203 ? 112.267 1.252   113.538 1.00 26.15 ? 290  ARG A NE    1 
ATOM   1399 C  CZ    . ARG A 1 203 ? 112.081 0.571   112.409 1.00 24.91 ? 290  ARG A CZ    1 
ATOM   1400 N  NH1   . ARG A 1 203 ? 111.741 1.190   111.280 1.00 24.47 ? 290  ARG A NH1   1 
ATOM   1401 N  NH2   . ARG A 1 203 ? 112.257 -0.743  112.405 1.00 25.12 ? 290  ARG A NH2   1 
ATOM   1402 N  N     . PRO A 1 204 ? 110.922 7.134   114.606 1.00 32.81 ? 291  PRO A N     1 
ATOM   1403 C  CA    . PRO A 1 204 ? 110.714 8.421   115.283 1.00 34.03 ? 291  PRO A CA    1 
ATOM   1404 C  C     . PRO A 1 204 ? 111.915 8.893   116.116 1.00 35.49 ? 291  PRO A C     1 
ATOM   1405 O  O     . PRO A 1 204 ? 112.931 8.194   116.214 1.00 35.52 ? 291  PRO A O     1 
ATOM   1406 C  CB    . PRO A 1 204 ? 109.503 8.154   116.181 1.00 34.32 ? 291  PRO A CB    1 
ATOM   1407 C  CG    . PRO A 1 204 ? 109.534 6.688   116.444 1.00 34.22 ? 291  PRO A CG    1 
ATOM   1408 C  CD    . PRO A 1 204 ? 110.184 6.034   115.259 1.00 32.67 ? 291  PRO A CD    1 
ATOM   1409 N  N     . GLU A 1 205 ? 111.775 10.075  116.714 1.00 33.81 ? 292  GLU A N     1 
ATOM   1410 C  CA    . GLU A 1 205 ? 112.833 10.731  117.487 1.00 34.89 ? 292  GLU A CA    1 
ATOM   1411 C  C     . GLU A 1 205 ? 113.321 9.937   118.697 1.00 31.42 ? 292  GLU A C     1 
ATOM   1412 O  O     . GLU A 1 205 ? 114.476 10.082  119.117 1.00 32.87 ? 292  GLU A O     1 
ATOM   1413 C  CB    . GLU A 1 205 ? 112.361 12.118  117.948 1.00 37.16 ? 292  GLU A CB    1 
ATOM   1414 C  CG    . GLU A 1 205 ? 112.642 13.237  116.947 1.00 41.61 ? 292  GLU A CG    1 
ATOM   1415 C  CD    . GLU A 1 205 ? 111.681 14.413  117.075 1.00 44.34 ? 292  GLU A CD    1 
ATOM   1416 O  OE1   . GLU A 1 205 ? 112.084 15.549  116.750 1.00 46.04 ? 292  GLU A OE1   1 
ATOM   1417 O  OE2   . GLU A 1 205 ? 110.521 14.208  117.492 1.00 46.53 ? 292  GLU A OE2   1 
ATOM   1418 N  N     . ASN A 1 206 ? 112.452 9.113   119.270 1.00 30.37 ? 293  ASN A N     1 
ATOM   1419 C  CA    . ASN A 1 206 ? 112.848 8.309   120.427 1.00 31.96 ? 293  ASN A CA    1 
ATOM   1420 C  C     . ASN A 1 206 ? 113.684 7.075   120.022 1.00 29.76 ? 293  ASN A C     1 
ATOM   1421 O  O     . ASN A 1 206 ? 114.018 6.236   120.861 1.00 28.26 ? 293  ASN A O     1 
ATOM   1422 C  CB    . ASN A 1 206 ? 111.627 7.914   121.268 1.00 33.60 ? 293  ASN A CB    1 
ATOM   1423 C  CG    . ASN A 1 206 ? 110.690 6.972   120.536 1.00 37.29 ? 293  ASN A CG    1 
ATOM   1424 O  OD1   . ASN A 1 206 ? 110.742 6.849   119.312 1.00 40.24 ? 293  ASN A OD1   1 
ATOM   1425 N  ND2   . ASN A 1 206 ? 109.825 6.302   121.286 1.00 39.26 ? 293  ASN A ND2   1 
ATOM   1426 N  N     . LYS A 1 207 ? 113.995 6.976   118.729 1.00 29.65 ? 294  LYS A N     1 
ATOM   1427 C  CA    . LYS A 1 207 ? 114.868 5.918   118.200 1.00 28.75 ? 294  LYS A CA    1 
ATOM   1428 C  C     . LYS A 1 207 ? 115.922 6.507   117.267 1.00 28.43 ? 294  LYS A C     1 
ATOM   1429 O  O     . LYS A 1 207 ? 116.457 5.818   116.392 1.00 27.25 ? 294  LYS A O     1 
ATOM   1430 C  CB    . LYS A 1 207 ? 114.050 4.801   117.526 1.00 26.57 ? 294  LYS A CB    1 
ATOM   1431 C  CG    . LYS A 1 207 ? 113.475 3.820   118.539 1.00 26.83 ? 294  LYS A CG    1 
ATOM   1432 C  CD    . LYS A 1 207 ? 112.829 2.601   117.905 1.00 26.54 ? 294  LYS A CD    1 
ATOM   1433 C  CE    . LYS A 1 207 ? 112.194 1.724   118.974 1.00 25.20 ? 294  LYS A CE    1 
ATOM   1434 N  NZ    . LYS A 1 207 ? 111.576 0.494   118.410 1.00 24.85 ? 294  LYS A NZ    1 
ATOM   1435 N  N     . SER A 1 208 ? 116.208 7.792   117.486 1.00 27.77 ? 295  SER A N     1 
ATOM   1436 C  CA    . SER A 1 208 ? 117.199 8.569   116.738 1.00 26.28 ? 295  SER A CA    1 
ATOM   1437 C  C     . SER A 1 208 ? 118.583 7.939   116.767 1.00 25.47 ? 295  SER A C     1 
ATOM   1438 O  O     . SER A 1 208 ? 119.315 7.992   115.773 1.00 23.11 ? 295  SER A O     1 
ATOM   1439 C  CB    . SER A 1 208 ? 117.285 9.983   117.330 1.00 27.45 ? 295  SER A CB    1 
ATOM   1440 O  OG    . SER A 1 208 ? 118.455 10.661  116.903 1.00 28.53 ? 295  SER A OG    1 
ATOM   1441 N  N     . PHE A 1 209 ? 118.937 7.378   117.922 1.00 23.67 ? 296  PHE A N     1 
ATOM   1442 C  CA    . PHE A 1 209 ? 120.202 6.668   118.094 1.00 22.71 ? 296  PHE A CA    1 
ATOM   1443 C  C     . PHE A 1 209 ? 120.420 5.582   117.037 1.00 20.83 ? 296  PHE A C     1 
ATOM   1444 O  O     . PHE A 1 209 ? 121.564 5.303   116.688 1.00 21.62 ? 296  PHE A O     1 
ATOM   1445 C  CB    . PHE A 1 209 ? 120.324 6.088   119.515 1.00 22.62 ? 296  PHE A CB    1 
ATOM   1446 C  CG    . PHE A 1 209 ? 119.260 5.086   119.871 1.00 23.56 ? 296  PHE A CG    1 
ATOM   1447 C  CD1   . PHE A 1 209 ? 118.029 5.500   120.385 1.00 24.27 ? 296  PHE A CD1   1 
ATOM   1448 C  CD2   . PHE A 1 209 ? 119.493 3.726   119.720 1.00 23.33 ? 296  PHE A CD2   1 
ATOM   1449 C  CE1   . PHE A 1 209 ? 117.053 4.569   120.721 1.00 24.11 ? 296  PHE A CE1   1 
ATOM   1450 C  CE2   . PHE A 1 209 ? 118.529 2.793   120.066 1.00 23.46 ? 296  PHE A CE2   1 
ATOM   1451 C  CZ    . PHE A 1 209 ? 117.302 3.214   120.556 1.00 24.67 ? 296  PHE A CZ    1 
ATOM   1452 N  N     . LEU A 1 210 ? 119.337 4.982   116.522 1.00 18.04 ? 297  LEU A N     1 
ATOM   1453 C  CA    . LEU A 1 210 ? 119.467 3.922   115.504 1.00 19.10 ? 297  LEU A CA    1 
ATOM   1454 C  C     . LEU A 1 210 ? 120.086 4.433   114.206 1.00 19.41 ? 297  LEU A C     1 
ATOM   1455 O  O     . LEU A 1 210 ? 120.723 3.672   113.463 1.00 18.84 ? 297  LEU A O     1 
ATOM   1456 C  CB    . LEU A 1 210 ? 118.133 3.209   115.222 1.00 18.41 ? 297  LEU A CB    1 
ATOM   1457 C  CG    . LEU A 1 210 ? 117.524 2.380   116.349 1.00 18.90 ? 297  LEU A CG    1 
ATOM   1458 C  CD1   . LEU A 1 210 ? 116.238 1.703   115.882 1.00 19.57 ? 297  LEU A CD1   1 
ATOM   1459 C  CD2   . LEU A 1 210 ? 118.525 1.340   116.861 1.00 20.20 ? 297  LEU A CD2   1 
ATOM   1460 N  N     . TYR A 1 211 ? 119.924 5.724   113.940 1.00 18.38 ? 298  TYR A N     1 
ATOM   1461 C  CA    . TYR A 1 211 ? 120.537 6.348   112.768 1.00 18.79 ? 298  TYR A CA    1 
ATOM   1462 C  C     . TYR A 1 211 ? 122.021 6.716   112.963 1.00 17.62 ? 298  TYR A C     1 
ATOM   1463 O  O     . TYR A 1 211 ? 122.655 7.236   112.041 1.00 20.17 ? 298  TYR A O     1 
ATOM   1464 C  CB    . TYR A 1 211 ? 119.742 7.590   112.352 1.00 20.46 ? 298  TYR A CB    1 
ATOM   1465 C  CG    . TYR A 1 211 ? 118.360 7.295   111.800 1.00 21.14 ? 298  TYR A CG    1 
ATOM   1466 C  CD1   . TYR A 1 211 ? 118.197 6.868   110.481 1.00 21.41 ? 298  TYR A CD1   1 
ATOM   1467 C  CD2   . TYR A 1 211 ? 117.216 7.465   112.585 1.00 22.29 ? 298  TYR A CD2   1 
ATOM   1468 C  CE1   . TYR A 1 211 ? 116.943 6.598   109.962 1.00 22.17 ? 298  TYR A CE1   1 
ATOM   1469 C  CE2   . TYR A 1 211 ? 115.946 7.206   112.070 1.00 22.52 ? 298  TYR A CE2   1 
ATOM   1470 C  CZ    . TYR A 1 211 ? 115.820 6.774   110.757 1.00 22.22 ? 298  TYR A CZ    1 
ATOM   1471 O  OH    . TYR A 1 211 ? 114.573 6.511   110.219 1.00 24.17 ? 298  TYR A OH    1 
ATOM   1472 N  N     . GLU A 1 212 ? 122.559 6.467   114.154 1.00 19.23 ? 299  GLU A N     1 
ATOM   1473 C  CA    . GLU A 1 212 ? 123.944 6.813   114.459 1.00 19.24 ? 299  GLU A CA    1 
ATOM   1474 C  C     . GLU A 1 212 ? 124.855 5.575   114.410 1.00 18.84 ? 299  GLU A C     1 
ATOM   1475 O  O     . GLU A 1 212 ? 126.033 5.651   114.783 1.00 20.09 ? 299  GLU A O     1 
ATOM   1476 C  CB    . GLU A 1 212 ? 124.038 7.458   115.841 1.00 21.12 ? 299  GLU A CB    1 
ATOM   1477 C  CG    . GLU A 1 212 ? 123.464 8.873   115.914 1.00 24.36 ? 299  GLU A CG    1 
ATOM   1478 C  CD    . GLU A 1 212 ? 123.540 9.429   117.319 1.00 26.11 ? 299  GLU A CD    1 
ATOM   1479 O  OE1   . GLU A 1 212 ? 122.667 9.090   118.128 1.00 28.40 ? 299  GLU A OE1   1 
ATOM   1480 O  OE2   . GLU A 1 212 ? 124.481 10.189  117.610 1.00 30.10 ? 299  GLU A OE2   1 
ATOM   1481 N  N     . ILE A 1 213 ? 124.312 4.452   113.940 1.00 15.76 ? 300  ILE A N     1 
ATOM   1482 C  CA    . ILE A 1 213 ? 125.050 3.165   113.984 1.00 14.95 ? 300  ILE A CA    1 
ATOM   1483 C  C     . ILE A 1 213 ? 125.866 2.863   112.717 1.00 14.42 ? 300  ILE A C     1 
ATOM   1484 O  O     . ILE A 1 213 ? 127.093 2.696   112.789 1.00 13.17 ? 300  ILE A O     1 
ATOM   1485 C  CB    . ILE A 1 213 ? 124.122 1.999   114.397 1.00 14.43 ? 300  ILE A CB    1 
ATOM   1486 C  CG1   . ILE A 1 213 ? 123.575 2.251   115.810 1.00 15.24 ? 300  ILE A CG1   1 
ATOM   1487 C  CG2   . ILE A 1 213 ? 124.856 0.644   114.354 1.00 13.71 ? 300  ILE A CG2   1 
ATOM   1488 C  CD1   . ILE A 1 213 ? 122.503 1.272   116.252 1.00 16.27 ? 300  ILE A CD1   1 
ATOM   1489 N  N     . VAL A 1 214 ? 125.203 2.825   111.565 1.00 13.26 ? 301  VAL A N     1 
ATOM   1490 C  CA    . VAL A 1 214 ? 125.856 2.404   110.307 1.00 14.33 ? 301  VAL A CA    1 
ATOM   1491 C  C     . VAL A 1 214 ? 126.624 3.524   109.631 1.00 15.51 ? 301  VAL A C     1 
ATOM   1492 O  O     . VAL A 1 214 ? 127.761 3.346   109.217 1.00 15.52 ? 301  VAL A O     1 
ATOM   1493 C  CB    . VAL A 1 214 ? 124.842 1.768   109.335 1.00 13.76 ? 301  VAL A CB    1 
ATOM   1494 C  CG1   . VAL A 1 214 ? 125.477 1.440   107.984 1.00 14.08 ? 301  VAL A CG1   1 
ATOM   1495 C  CG2   . VAL A 1 214 ? 124.239 0.522   109.959 1.00 14.53 ? 301  VAL A CG2   1 
ATOM   1496 N  N     . SER A 1 215 ? 126.000 4.690   109.529 1.00 16.05 ? 302  SER A N     1 
ATOM   1497 C  CA    . SER A 1 215 ? 126.631 5.837   108.905 1.00 19.19 ? 302  SER A CA    1 
ATOM   1498 C  C     . SER A 1 215 ? 126.217 7.084   109.658 1.00 20.62 ? 302  SER A C     1 
ATOM   1499 O  O     . SER A 1 215 ? 125.127 7.624   109.447 1.00 23.32 ? 302  SER A O     1 
ATOM   1500 C  CB    . SER A 1 215 ? 126.217 5.944   107.440 1.00 21.47 ? 302  SER A CB    1 
ATOM   1501 O  OG    . SER A 1 215 ? 126.905 7.009   106.811 1.00 25.41 ? 302  SER A OG    1 
ATOM   1502 N  N     . ASN A 1 216 ? 127.104 7.536   110.532 1.00 20.21 ? 303  ASN A N     1 
ATOM   1503 C  CA    . ASN A 1 216 ? 126.804 8.605   111.458 1.00 20.97 ? 303  ASN A CA    1 
ATOM   1504 C  C     . ASN A 1 216 ? 127.125 9.946   110.820 1.00 21.29 ? 303  ASN A C     1 
ATOM   1505 O  O     . ASN A 1 216 ? 128.278 10.339  110.762 1.00 19.57 ? 303  ASN A O     1 
ATOM   1506 C  CB    . ASN A 1 216 ? 127.632 8.406   112.733 1.00 19.32 ? 303  ASN A CB    1 
ATOM   1507 C  CG    . ASN A 1 216 ? 127.221 9.342   113.853 1.00 19.70 ? 303  ASN A CG    1 
ATOM   1508 O  OD1   . ASN A 1 216 ? 126.862 10.493  113.616 1.00 19.34 ? 303  ASN A OD1   1 
ATOM   1509 N  ND2   . ASN A 1 216 ? 127.300 8.857   115.085 1.00 20.25 ? 303  ASN A ND2   1 
ATOM   1510 N  N     . LYS A 1 217 ? 126.105 10.636  110.319 1.00 24.26 ? 304  LYS A N     1 
ATOM   1511 C  CA    . LYS A 1 217 ? 126.316 11.927  109.666 1.00 26.27 ? 304  LYS A CA    1 
ATOM   1512 C  C     . LYS A 1 217 ? 126.597 13.053  110.673 1.00 27.00 ? 304  LYS A C     1 
ATOM   1513 O  O     . LYS A 1 217 ? 127.158 14.088  110.310 1.00 29.10 ? 304  LYS A O     1 
ATOM   1514 C  CB    . LYS A 1 217 ? 125.117 12.292  108.770 1.00 28.56 ? 304  LYS A CB    1 
ATOM   1515 C  CG    . LYS A 1 217 ? 124.494 11.139  107.984 1.00 31.03 ? 304  LYS A CG    1 
ATOM   1516 C  CD    . LYS A 1 217 ? 125.374 10.665  106.823 1.00 33.37 ? 304  LYS A CD    1 
ATOM   1517 C  CE    . LYS A 1 217 ? 124.683 9.553   106.035 1.00 34.71 ? 304  LYS A CE    1 
ATOM   1518 N  NZ    . LYS A 1 217 ? 125.599 8.806   105.120 1.00 35.57 ? 304  LYS A NZ    1 
ATOM   1519 N  N     . ARG A 1 218 ? 126.226 12.839  111.936 1.00 25.53 ? 305  ARG A N     1 
ATOM   1520 C  CA    . ARG A 1 218 ? 126.408 13.855  112.977 1.00 24.58 ? 305  ARG A CA    1 
ATOM   1521 C  C     . ARG A 1 218 ? 127.881 14.063  113.355 1.00 22.95 ? 305  ARG A C     1 
ATOM   1522 O  O     . ARG A 1 218 ? 128.346 15.196  113.471 1.00 22.11 ? 305  ARG A O     1 
ATOM   1523 C  CB    . ARG A 1 218 ? 125.554 13.514  114.214 1.00 27.57 ? 305  ARG A CB    1 
ATOM   1524 C  CG    . ARG A 1 218 ? 125.716 14.457  115.401 1.00 31.28 ? 305  ARG A CG    1 
ATOM   1525 C  CD    . ARG A 1 218 ? 124.702 14.157  116.493 1.00 35.06 ? 305  ARG A CD    1 
ATOM   1526 N  NE    . ARG A 1 218 ? 123.353 14.533  116.072 1.00 38.52 ? 305  ARG A NE    1 
ATOM   1527 C  CZ    . ARG A 1 218 ? 122.386 13.679  115.742 1.00 40.04 ? 305  ARG A CZ    1 
ATOM   1528 N  NH1   . ARG A 1 218 ? 122.588 12.364  115.787 1.00 40.71 ? 305  ARG A NH1   1 
ATOM   1529 N  NH2   . ARG A 1 218 ? 121.204 14.148  115.367 1.00 41.02 ? 305  ARG A NH2   1 
ATOM   1530 N  N     . ASN A 1 219 ? 128.625 12.972  113.530 1.00 19.59 ? 306  ASN A N     1 
ATOM   1531 C  CA    . ASN A 1 219 ? 129.996 13.084  114.033 1.00 17.75 ? 306  ASN A CA    1 
ATOM   1532 C  C     . ASN A 1 219 ? 130.965 12.040  113.442 1.00 18.51 ? 306  ASN A C     1 
ATOM   1533 O  O     . ASN A 1 219 ? 132.155 12.044  113.758 1.00 19.31 ? 306  ASN A O     1 
ATOM   1534 C  CB    . ASN A 1 219 ? 129.999 13.059  115.574 1.00 17.91 ? 306  ASN A CB    1 
ATOM   1535 C  CG    . ASN A 1 219 ? 129.267 11.855  116.148 1.00 19.51 ? 306  ASN A CG    1 
ATOM   1536 O  OD1   . ASN A 1 219 ? 129.449 10.731  115.680 1.00 18.65 ? 306  ASN A OD1   1 
ATOM   1537 N  ND2   . ASN A 1 219 ? 128.439 12.083  117.181 1.00 19.20 ? 306  ASN A ND2   1 
ATOM   1538 N  N     . GLY A 1 220 ? 130.444 11.159  112.591 1.00 17.66 ? 307  GLY A N     1 
ATOM   1539 C  CA    . GLY A 1 220 ? 131.275 10.173  111.901 1.00 16.75 ? 307  GLY A CA    1 
ATOM   1540 C  C     . GLY A 1 220 ? 131.634 8.954   112.733 1.00 17.09 ? 307  GLY A C     1 
ATOM   1541 O  O     . GLY A 1 220 ? 132.367 8.083   112.268 1.00 16.38 ? 307  GLY A O     1 
ATOM   1542 N  N     . ILE A 1 221 ? 131.129 8.867   113.959 1.00 15.17 ? 308  ILE A N     1 
ATOM   1543 C  CA    . ILE A 1 221 ? 131.442 7.702   114.797 1.00 15.93 ? 308  ILE A CA    1 
ATOM   1544 C  C     . ILE A 1 221 ? 130.453 6.582   114.472 1.00 14.91 ? 308  ILE A C     1 
ATOM   1545 O  O     . ILE A 1 221 ? 129.309 6.591   114.924 1.00 16.09 ? 308  ILE A O     1 
ATOM   1546 C  CB    . ILE A 1 221 ? 131.439 8.034   116.299 1.00 16.43 ? 308  ILE A CB    1 
ATOM   1547 C  CG1   . ILE A 1 221 ? 132.465 9.127   116.618 1.00 16.66 ? 308  ILE A CG1   1 
ATOM   1548 C  CG2   . ILE A 1 221 ? 131.739 6.781   117.116 1.00 17.66 ? 308  ILE A CG2   1 
ATOM   1549 C  CD1   . ILE A 1 221 ? 132.315 9.702   118.018 1.00 16.87 ? 308  ILE A CD1   1 
ATOM   1550 N  N     . ASP A 1 222 ? 130.896 5.626   113.659 1.00 12.80 ? 309  ASP A N     1 
ATOM   1551 C  CA    . ASP A 1 222 ? 130.020 4.548   113.230 1.00 12.67 ? 309  ASP A CA    1 
ATOM   1552 C  C     . ASP A 1 222 ? 130.749 3.221   113.063 1.00 11.85 ? 309  ASP A C     1 
ATOM   1553 O  O     . ASP A 1 222 ? 131.985 3.177   113.097 1.00 10.94 ? 309  ASP A O     1 
ATOM   1554 C  CB    . ASP A 1 222 ? 129.260 4.923   111.950 1.00 13.28 ? 309  ASP A CB    1 
ATOM   1555 C  CG    . ASP A 1 222 ? 130.162 5.380   110.824 1.00 15.30 ? 309  ASP A CG    1 
ATOM   1556 O  OD1   . ASP A 1 222 ? 131.131 4.683   110.458 1.00 15.04 ? 309  ASP A OD1   1 
ATOM   1557 O  OD2   . ASP A 1 222 ? 129.873 6.443   110.258 1.00 15.88 ? 309  ASP A OD2   1 
ATOM   1558 N  N     . VAL A 1 223 ? 129.977 2.155   112.895 1.00 11.42 ? 310  VAL A N     1 
ATOM   1559 C  CA    . VAL A 1 223 ? 130.530 0.796   112.860 1.00 10.73 ? 310  VAL A CA    1 
ATOM   1560 C  C     . VAL A 1 223 ? 131.247 0.498   111.541 1.00 10.64 ? 310  VAL A C     1 
ATOM   1561 O  O     . VAL A 1 223 ? 132.043 -0.457  111.461 1.00 9.74  ? 310  VAL A O     1 
ATOM   1562 C  CB    . VAL A 1 223 ? 129.466 -0.289  113.163 1.00 10.90 ? 310  VAL A CB    1 
ATOM   1563 C  CG1   . VAL A 1 223 ? 128.791 -0.014  114.520 1.00 11.05 ? 310  VAL A CG1   1 
ATOM   1564 C  CG2   . VAL A 1 223 ? 128.432 -0.380  112.042 1.00 9.82  ? 310  VAL A CG2   1 
ATOM   1565 N  N     . ASP A 1 224 ? 130.957 1.298   110.513 1.00 10.45 ? 311  ASP A N     1 
ATOM   1566 C  CA    . ASP A 1 224 ? 131.656 1.207   109.236 1.00 11.46 ? 311  ASP A CA    1 
ATOM   1567 C  C     . ASP A 1 224 ? 133.162 1.441   109.444 1.00 10.97 ? 311  ASP A C     1 
ATOM   1568 O  O     . ASP A 1 224 ? 133.994 0.604   109.068 1.00 10.60 ? 311  ASP A O     1 
ATOM   1569 C  CB    . ASP A 1 224 ? 131.069 2.231   108.241 1.00 12.50 ? 311  ASP A CB    1 
ATOM   1570 C  CG    . ASP A 1 224 ? 131.544 2.019   106.827 1.00 15.62 ? 311  ASP A CG    1 
ATOM   1571 O  OD1   . ASP A 1 224 ? 132.018 0.913   106.503 1.00 14.48 ? 311  ASP A OD1   1 
ATOM   1572 O  OD2   . ASP A 1 224 ? 131.399 2.939   106.000 1.00 19.73 ? 311  ASP A OD2   1 
ATOM   1573 N  N     . LYS A 1 225 ? 133.507 2.566   110.072 1.00 10.54 ? 312  LYS A N     1 
ATOM   1574 C  CA    . LYS A 1 225 ? 134.888 2.844   110.484 1.00 10.53 ? 312  LYS A CA    1 
ATOM   1575 C  C     . LYS A 1 225 ? 135.485 1.732   111.349 1.00 9.12  ? 312  LYS A C     1 
ATOM   1576 O  O     . LYS A 1 225 ? 136.638 1.342   111.146 1.00 9.93  ? 312  LYS A O     1 
ATOM   1577 C  CB    . LYS A 1 225 ? 134.967 4.167   111.273 1.00 12.24 ? 312  LYS A CB    1 
ATOM   1578 C  CG    . LYS A 1 225 ? 134.751 5.404   110.430 1.00 15.12 ? 312  LYS A CG    1 
ATOM   1579 C  CD    . LYS A 1 225 ? 135.094 6.656   111.224 1.00 16.85 ? 312  LYS A CD    1 
ATOM   1580 C  CE    . LYS A 1 225 ? 134.974 7.895   110.351 1.00 18.65 ? 312  LYS A CE    1 
ATOM   1581 N  NZ    . LYS A 1 225 ? 133.603 8.038   109.802 1.00 20.62 ? 312  LYS A NZ    1 
ATOM   1582 N  N     . TRP A 1 226 ? 134.717 1.236   112.312 1.00 8.62  ? 313  TRP A N     1 
ATOM   1583 C  CA    . TRP A 1 226 ? 135.266 0.232   113.229 1.00 8.79  ? 313  TRP A CA    1 
ATOM   1584 C  C     . TRP A 1 226 ? 135.671 -1.007  112.482 1.00 8.60  ? 313  TRP A C     1 
ATOM   1585 O  O     . TRP A 1 226 ? 136.726 -1.554  112.755 1.00 9.22  ? 313  TRP A O     1 
ATOM   1586 C  CB    . TRP A 1 226 ? 134.309 -0.105  114.344 1.00 9.31  ? 313  TRP A CB    1 
ATOM   1587 C  CG    . TRP A 1 226 ? 133.875 1.120   115.107 1.00 10.08 ? 313  TRP A CG    1 
ATOM   1588 C  CD1   . TRP A 1 226 ? 134.414 2.395   115.070 1.00 10.42 ? 313  TRP A CD1   1 
ATOM   1589 C  CD2   . TRP A 1 226 ? 132.806 1.173   116.074 1.00 10.34 ? 313  TRP A CD2   1 
ATOM   1590 N  NE1   . TRP A 1 226 ? 133.726 3.233   115.930 1.00 11.04 ? 313  TRP A NE1   1 
ATOM   1591 C  CE2   . TRP A 1 226 ? 132.747 2.549   116.556 1.00 11.14 ? 313  TRP A CE2   1 
ATOM   1592 C  CE3   . TRP A 1 226 ? 131.889 0.248   116.547 1.00 10.48 ? 313  TRP A CE3   1 
ATOM   1593 C  CZ2   . TRP A 1 226 ? 131.816 2.953   117.501 1.00 11.60 ? 313  TRP A CZ2   1 
ATOM   1594 C  CZ3   . TRP A 1 226 ? 130.962 0.658   117.511 1.00 11.76 ? 313  TRP A CZ3   1 
ATOM   1595 C  CH2   . TRP A 1 226 ? 130.921 1.984   117.959 1.00 11.75 ? 313  TRP A CH2   1 
ATOM   1596 N  N     . ASP A 1 227 ? 134.871 -1.449  111.509 1.00 7.06  ? 314  ASP A N     1 
ATOM   1597 C  CA    . ASP A 1 227 ? 135.294 -2.630  110.751 1.00 7.49  ? 314  ASP A CA    1 
ATOM   1598 C  C     . ASP A 1 227 ? 136.496 -2.319  109.890 1.00 7.55  ? 314  ASP A C     1 
ATOM   1599 O  O     . ASP A 1 227 ? 137.464 -3.081  109.859 1.00 6.50  ? 314  ASP A O     1 
ATOM   1600 C  CB    . ASP A 1 227 ? 134.194 -3.191  109.861 1.00 7.50  ? 314  ASP A CB    1 
ATOM   1601 C  CG    . ASP A 1 227 ? 134.635 -4.471  109.164 1.00 7.15  ? 314  ASP A CG    1 
ATOM   1602 O  OD1   . ASP A 1 227 ? 134.538 -5.542  109.796 1.00 8.17  ? 314  ASP A OD1   1 
ATOM   1603 O  OD2   . ASP A 1 227 ? 135.149 -4.390  108.024 1.00 7.83  ? 314  ASP A OD2   1 
ATOM   1604 N  N     . TYR A 1 228 ? 136.451 -1.222  109.156 1.00 7.46  ? 315  TYR A N     1 
ATOM   1605 C  CA    . TYR A 1 228 ? 137.541 -1.001  108.233 1.00 8.42  ? 315  TYR A CA    1 
ATOM   1606 C  C     . TYR A 1 228 ? 138.879 -0.710  108.917 1.00 8.19  ? 315  TYR A C     1 
ATOM   1607 O  O     . TYR A 1 228 ? 139.911 -1.132  108.406 1.00 7.08  ? 315  TYR A O     1 
ATOM   1608 C  CB    . TYR A 1 228 ? 137.182 -0.066  107.058 1.00 9.28  ? 315  TYR A CB    1 
ATOM   1609 C  CG    . TYR A 1 228 ? 137.310 1.429   107.263 1.00 10.26 ? 315  TYR A CG    1 
ATOM   1610 C  CD1   . TYR A 1 228 ? 138.559 2.014   107.464 1.00 10.73 ? 315  TYR A CD1   1 
ATOM   1611 C  CD2   . TYR A 1 228 ? 136.196 2.267   107.159 1.00 11.89 ? 315  TYR A CD2   1 
ATOM   1612 C  CE1   . TYR A 1 228 ? 138.696 3.394   107.615 1.00 12.36 ? 315  TYR A CE1   1 
ATOM   1613 C  CE2   . TYR A 1 228 ? 136.325 3.645   107.319 1.00 12.77 ? 315  TYR A CE2   1 
ATOM   1614 C  CZ    . TYR A 1 228 ? 137.577 4.192   107.553 1.00 12.80 ? 315  TYR A CZ    1 
ATOM   1615 O  OH    . TYR A 1 228 ? 137.754 5.552   107.714 1.00 15.34 ? 315  TYR A OH    1 
ATOM   1616 N  N     . PHE A 1 229 ? 138.878 -0.026  110.066 1.00 8.11  ? 316  PHE A N     1 
ATOM   1617 C  CA    . PHE A 1 229 ? 140.139 0.162   110.812 1.00 8.18  ? 316  PHE A CA    1 
ATOM   1618 C  C     . PHE A 1 229 ? 140.747 -1.216  111.083 1.00 8.24  ? 316  PHE A C     1 
ATOM   1619 O  O     . PHE A 1 229 ? 141.924 -1.448  110.832 1.00 8.97  ? 316  PHE A O     1 
ATOM   1620 C  CB    . PHE A 1 229 ? 139.896 0.791   112.196 1.00 9.62  ? 316  PHE A CB    1 
ATOM   1621 C  CG    . PHE A 1 229 ? 139.607 2.274   112.193 1.00 10.63 ? 316  PHE A CG    1 
ATOM   1622 C  CD1   . PHE A 1 229 ? 139.450 2.997   111.023 1.00 10.50 ? 316  PHE A CD1   1 
ATOM   1623 C  CD2   . PHE A 1 229 ? 139.470 2.938   113.414 1.00 11.81 ? 316  PHE A CD2   1 
ATOM   1624 C  CE1   . PHE A 1 229 ? 139.166 4.361   111.059 1.00 11.16 ? 316  PHE A CE1   1 
ATOM   1625 C  CE2   . PHE A 1 229 ? 139.191 4.304   113.457 1.00 12.75 ? 316  PHE A CE2   1 
ATOM   1626 C  CZ    . PHE A 1 229 ? 139.025 5.013   112.272 1.00 12.02 ? 316  PHE A CZ    1 
ATOM   1627 N  N     . ALA A 1 230 ? 139.936 -2.102  111.653 1.00 7.40  ? 317  ALA A N     1 
ATOM   1628 C  CA    . ALA A 1 230 ? 140.409 -3.424  112.095 1.00 6.41  ? 317  ALA A CA    1 
ATOM   1629 C  C     . ALA A 1 230 ? 140.806 -4.296  110.895 1.00 6.49  ? 317  ALA A C     1 
ATOM   1630 O  O     . ALA A 1 230 ? 141.887 -4.912  110.867 1.00 5.75  ? 317  ALA A O     1 
ATOM   1631 C  CB    . ALA A 1 230 ? 139.334 -4.107  112.937 1.00 6.77  ? 317  ALA A CB    1 
ATOM   1632 N  N     . ARG A 1 231 ? 139.935 -4.328  109.896 1.00 5.83  ? 318  ARG A N     1 
ATOM   1633 C  CA    . ARG A 1 231 ? 140.156 -5.170  108.721 1.00 5.84  ? 318  ARG A CA    1 
ATOM   1634 C  C     . ARG A 1 231 ? 141.306 -4.673  107.841 1.00 5.49  ? 318  ARG A C     1 
ATOM   1635 O  O     . ARG A 1 231 ? 142.146 -5.470  107.403 1.00 5.55  ? 318  ARG A O     1 
ATOM   1636 C  CB    . ARG A 1 231 ? 138.860 -5.293  107.909 1.00 5.36  ? 318  ARG A CB    1 
ATOM   1637 C  CG    . ARG A 1 231 ? 138.909 -6.365  106.829 1.00 5.56  ? 318  ARG A CG    1 
ATOM   1638 C  CD    . ARG A 1 231 ? 137.527 -6.582  106.191 1.00 5.57  ? 318  ARG A CD    1 
ATOM   1639 N  NE    . ARG A 1 231 ? 136.554 -6.835  107.256 1.00 5.94  ? 318  ARG A NE    1 
ATOM   1640 C  CZ    . ARG A 1 231 ? 136.309 -8.034  107.785 1.00 5.92  ? 318  ARG A CZ    1 
ATOM   1641 N  NH1   . ARG A 1 231 ? 136.923 -9.145  107.335 1.00 6.06  ? 318  ARG A NH1   1 
ATOM   1642 N  NH2   . ARG A 1 231 ? 135.434 -8.128  108.774 1.00 6.12  ? 318  ARG A NH2   1 
ATOM   1643 N  N     . ASP A 1 232 ? 141.355 -3.364  107.562 1.00 5.17  ? 319  ASP A N     1 
ATOM   1644 C  CA    . ASP A 1 232 ? 142.420 -2.844  106.713 1.00 5.03  ? 319  ASP A CA    1 
ATOM   1645 C  C     . ASP A 1 232 ? 143.745 -3.052  107.414 1.00 5.43  ? 319  ASP A C     1 
ATOM   1646 O  O     . ASP A 1 232 ? 144.736 -3.439  106.791 1.00 6.78  ? 319  ASP A O     1 
ATOM   1647 C  CB    . ASP A 1 232 ? 142.228 -1.348  106.396 1.00 5.65  ? 319  ASP A CB    1 
ATOM   1648 C  CG    . ASP A 1 232 ? 141.042 -1.084  105.471 1.00 6.35  ? 319  ASP A CG    1 
ATOM   1649 O  OD1   . ASP A 1 232 ? 140.489 -2.044  104.862 1.00 6.72  ? 319  ASP A OD1   1 
ATOM   1650 O  OD2   . ASP A 1 232 ? 140.666 0.113   105.348 1.00 6.40  ? 319  ASP A OD2   1 
ATOM   1651 N  N     . CYS A 1 233 ? 143.768 -2.835  108.727 1.00 5.72  ? 320  CYS A N     1 
ATOM   1652 C  CA    . CYS A 1 233 ? 145.017 -3.011  109.452 1.00 6.80  ? 320  CYS A CA    1 
ATOM   1653 C  C     . CYS A 1 233 ? 145.530 -4.458  109.401 1.00 6.99  ? 320  CYS A C     1 
ATOM   1654 O  O     . CYS A 1 233 ? 146.715 -4.700  109.187 1.00 6.77  ? 320  CYS A O     1 
ATOM   1655 C  CB    . CYS A 1 233 ? 144.865 -2.530  110.896 1.00 6.80  ? 320  CYS A CB    1 
ATOM   1656 S  SG    . CYS A 1 233 ? 145.051 -0.737  111.027 1.00 8.88  ? 320  CYS A SG    1 
ATOM   1657 N  N     . HIS A 1 234 ? 144.619 -5.404  109.617 1.00 6.99  ? 321  HIS A N     1 
ATOM   1658 C  CA    . HIS A 1 234 ? 144.919 -6.840  109.515 1.00 7.77  ? 321  HIS A CA    1 
ATOM   1659 C  C     . HIS A 1 234 ? 145.611 -7.200  108.216 1.00 7.90  ? 321  HIS A C     1 
ATOM   1660 O  O     . HIS A 1 234 ? 146.600 -7.943  108.202 1.00 8.30  ? 321  HIS A O     1 
ATOM   1661 C  CB    . HIS A 1 234 ? 143.610 -7.600  109.667 1.00 7.77  ? 321  HIS A CB    1 
ATOM   1662 C  CG    . HIS A 1 234 ? 143.764 -9.101  109.740 1.00 8.70  ? 321  HIS A CG    1 
ATOM   1663 N  ND1   . HIS A 1 234 ? 144.164 -9.736  110.865 1.00 9.27  ? 321  HIS A ND1   1 
ATOM   1664 C  CD2   . HIS A 1 234 ? 143.498 -10.087 108.803 1.00 9.07  ? 321  HIS A CD2   1 
ATOM   1665 C  CE1   . HIS A 1 234 ? 144.162 -11.058 110.648 1.00 9.43  ? 321  HIS A CE1   1 
ATOM   1666 N  NE2   . HIS A 1 234 ? 143.765 -11.272 109.387 1.00 9.00  ? 321  HIS A NE2   1 
ATOM   1667 N  N     . HIS A 1 235 ? 145.129 -6.625  107.112 1.00 7.24  ? 322  HIS A N     1 
ATOM   1668 C  CA    . HIS A 1 235 ? 145.633 -6.970  105.798 1.00 7.28  ? 322  HIS A CA    1 
ATOM   1669 C  C     . HIS A 1 235 ? 146.820 -6.175  105.379 1.00 6.99  ? 322  HIS A C     1 
ATOM   1670 O  O     . HIS A 1 235 ? 147.690 -6.676  104.684 1.00 7.09  ? 322  HIS A O     1 
ATOM   1671 C  CB    . HIS A 1 235 ? 144.511 -6.808  104.783 1.00 8.85  ? 322  HIS A CB    1 
ATOM   1672 C  CG    . HIS A 1 235 ? 143.508 -7.918  104.837 1.00 11.18 ? 322  HIS A CG    1 
ATOM   1673 N  ND1   . HIS A 1 235 ? 142.501 -7.949  105.732 1.00 12.63 ? 322  HIS A ND1   1 
ATOM   1674 C  CD2   . HIS A 1 235 ? 143.383 -9.070  104.063 1.00 13.72 ? 322  HIS A CD2   1 
ATOM   1675 C  CE1   . HIS A 1 235 ? 141.776 -9.073  105.549 1.00 12.04 ? 322  HIS A CE1   1 
ATOM   1676 N  NE2   . HIS A 1 235 ? 142.320 -9.759  104.534 1.00 15.27 ? 322  HIS A NE2   1 
ATOM   1677 N  N     . LEU A 1 236 ? 146.851 -4.903  105.761 1.00 6.99  ? 323  LEU A N     1 
ATOM   1678 C  CA    . LEU A 1 236 ? 147.932 -4.017  105.367 1.00 7.32  ? 323  LEU A CA    1 
ATOM   1679 C  C     . LEU A 1 236 ? 149.226 -4.359  106.096 1.00 8.46  ? 323  LEU A C     1 
ATOM   1680 O  O     . LEU A 1 236 ? 150.300 -4.136  105.573 1.00 10.37 ? 323  LEU A O     1 
ATOM   1681 C  CB    . LEU A 1 236 ? 147.581 -2.561  105.667 1.00 6.79  ? 323  LEU A CB    1 
ATOM   1682 C  CG    . LEU A 1 236 ? 146.504 -1.902  104.819 1.00 6.19  ? 323  LEU A CG    1 
ATOM   1683 C  CD1   . LEU A 1 236 ? 146.038 -0.639  105.546 1.00 5.96  ? 323  LEU A CD1   1 
ATOM   1684 C  CD2   . LEU A 1 236 ? 147.081 -1.546  103.442 1.00 6.39  ? 323  LEU A CD2   1 
ATOM   1685 N  N     . GLY A 1 237 ? 149.125 -4.867  107.325 1.00 6.68  ? 324  GLY A N     1 
ATOM   1686 C  CA    . GLY A 1 237 ? 150.321 -5.061  108.118 1.00 9.62  ? 324  GLY A CA    1 
ATOM   1687 C  C     . GLY A 1 237 ? 150.698 -3.821  108.918 1.00 11.50 ? 324  GLY A C     1 
ATOM   1688 O  O     . GLY A 1 237 ? 151.874 -3.568  109.162 1.00 10.86 ? 324  GLY A O     1 
ATOM   1689 N  N     . ILE A 1 238 ? 149.689 -3.056  109.327 1.00 13.61 ? 325  ILE A N     1 
ATOM   1690 C  CA    . ILE A 1 238 ? 149.836 -1.896  110.229 1.00 15.02 ? 325  ILE A CA    1 
ATOM   1691 C  C     . ILE A 1 238 ? 148.904 -2.202  111.392 1.00 16.68 ? 325  ILE A C     1 
ATOM   1692 O  O     . ILE A 1 238 ? 147.868 -2.815  111.197 1.00 15.22 ? 325  ILE A O     1 
ATOM   1693 C  CB    . ILE A 1 238 ? 149.376 -0.588  109.544 1.00 17.42 ? 325  ILE A CB    1 
ATOM   1694 C  CG1   . ILE A 1 238 ? 150.256 -0.257  108.335 1.00 17.93 ? 325  ILE A CG1   1 
ATOM   1695 C  CG2   . ILE A 1 238 ? 149.335 0.577   110.544 1.00 19.14 ? 325  ILE A CG2   1 
ATOM   1696 C  CD1   . ILE A 1 238 ? 149.648 0.814   107.444 1.00 17.81 ? 325  ILE A CD1   1 
ATOM   1697 N  N     . GLN A 1 239 ? 149.258 -1.807  112.613 1.00 20.15 ? 326  GLN A N     1 
ATOM   1698 C  CA    . GLN A 1 239 ? 148.468 -2.240  113.766 1.00 21.23 ? 326  GLN A CA    1 
ATOM   1699 C  C     . GLN A 1 239 ? 147.377 -1.261  114.166 1.00 22.53 ? 326  GLN A C     1 
ATOM   1700 O  O     . GLN A 1 239 ? 147.583 -0.068  114.135 1.00 19.79 ? 326  GLN A O     1 
ATOM   1701 C  CB    . GLN A 1 239 ? 149.351 -2.584  114.961 1.00 27.04 ? 326  GLN A CB    1 
ATOM   1702 C  CG    . GLN A 1 239 ? 149.651 -4.071  115.109 1.00 32.44 ? 326  GLN A CG    1 
ATOM   1703 C  CD    . GLN A 1 239 ? 149.889 -4.493  116.558 1.00 36.31 ? 326  GLN A CD    1 
ATOM   1704 O  OE1   . GLN A 1 239 ? 149.234 -4.001  117.492 1.00 38.40 ? 326  GLN A OE1   1 
ATOM   1705 N  NE2   . GLN A 1 239 ? 150.831 -5.427  116.749 1.00 38.89 ? 326  GLN A NE2   1 
ATOM   1706 N  N     . ASN A 1 240 ? 146.205 -1.777  114.523 1.00 23.38 ? 327  ASN A N     1 
ATOM   1707 C  CA    . ASN A 1 240 ? 145.114 -0.888  114.913 1.00 22.89 ? 327  ASN A CA    1 
ATOM   1708 C  C     . ASN A 1 240 ? 145.211 -0.495  116.394 1.00 21.13 ? 327  ASN A C     1 
ATOM   1709 O  O     . ASN A 1 240 ? 145.254 -1.365  117.241 1.00 24.37 ? 327  ASN A O     1 
ATOM   1710 C  CB    . ASN A 1 240 ? 143.761 -1.543  114.591 1.00 22.29 ? 327  ASN A CB    1 
ATOM   1711 C  CG    . ASN A 1 240 ? 142.571 -0.674  114.981 1.00 21.86 ? 327  ASN A CG    1 
ATOM   1712 O  OD1   . ASN A 1 240 ? 142.708 0.538   115.193 1.00 19.61 ? 327  ASN A OD1   1 
ATOM   1713 N  ND2   . ASN A 1 240 ? 141.388 -1.311  115.107 1.00 17.66 ? 327  ASN A ND2   1 
ATOM   1714 N  N     . ASN A 1 241 ? 145.208 0.803   116.686 1.00 19.64 ? 328  ASN A N     1 
ATOM   1715 C  CA    . ASN A 1 241 ? 145.207 1.290   118.081 1.00 19.65 ? 328  ASN A CA    1 
ATOM   1716 C  C     . ASN A 1 241 ? 143.833 1.767   118.679 1.00 18.56 ? 328  ASN A C     1 
ATOM   1717 O  O     . ASN A 1 241 ? 143.732 2.181   119.842 1.00 18.31 ? 328  ASN A O     1 
ATOM   1718 C  CB    . ASN A 1 241 ? 146.326 2.326   118.218 1.00 24.96 ? 328  ASN A CB    1 
ATOM   1719 C  CG    . ASN A 1 241 ? 145.939 3.680   117.662 1.00 28.17 ? 328  ASN A CG    1 
ATOM   1720 O  OD1   . ASN A 1 241 ? 146.114 3.977   116.448 1.00 31.98 ? 328  ASN A OD1   1 
ATOM   1721 N  ND2   . ASN A 1 241 ? 145.414 4.531   118.556 1.00 28.83 ? 328  ASN A ND2   1 
ATOM   1722 N  N     . PHE A 1 242 ? 142.768 1.665   117.895 1.00 14.20 ? 329  PHE A N     1 
ATOM   1723 C  CA    . PHE A 1 242 ? 141.439 2.023   118.375 1.00 12.91 ? 329  PHE A CA    1 
ATOM   1724 C  C     . PHE A 1 242 ? 140.685 0.797   118.896 1.00 12.19 ? 329  PHE A C     1 
ATOM   1725 O  O     . PHE A 1 242 ? 140.653 -0.226  118.244 1.00 12.53 ? 329  PHE A O     1 
ATOM   1726 C  CB    . PHE A 1 242 ? 140.603 2.701   117.259 1.00 11.81 ? 329  PHE A CB    1 
ATOM   1727 C  CG    . PHE A 1 242 ? 139.201 3.024   117.699 1.00 11.74 ? 329  PHE A CG    1 
ATOM   1728 C  CD1   . PHE A 1 242 ? 138.991 4.007   118.654 1.00 12.25 ? 329  PHE A CD1   1 
ATOM   1729 C  CD2   . PHE A 1 242 ? 138.100 2.321   117.198 1.00 11.49 ? 329  PHE A CD2   1 
ATOM   1730 C  CE1   . PHE A 1 242 ? 137.719 4.297   119.107 1.00 12.69 ? 329  PHE A CE1   1 
ATOM   1731 C  CE2   . PHE A 1 242 ? 136.814 2.607   117.652 1.00 11.58 ? 329  PHE A CE2   1 
ATOM   1732 C  CZ    . PHE A 1 242 ? 136.626 3.613   118.600 1.00 12.43 ? 329  PHE A CZ    1 
ATOM   1733 N  N     . ASP A 1 243 ? 140.045 0.910   120.054 1.00 10.45 ? 330  ASP A N     1 
ATOM   1734 C  CA    . ASP A 1 243 ? 139.364 -0.237  120.635 1.00 10.87 ? 330  ASP A CA    1 
ATOM   1735 C  C     . ASP A 1 243 ? 137.861 -0.044  120.556 1.00 11.00 ? 330  ASP A C     1 
ATOM   1736 O  O     . ASP A 1 243 ? 137.288 0.611   121.441 1.00 10.38 ? 330  ASP A O     1 
ATOM   1737 C  CB    . ASP A 1 243 ? 139.820 -0.383  122.098 1.00 11.24 ? 330  ASP A CB    1 
ATOM   1738 C  CG    . ASP A 1 243 ? 139.303 -1.654  122.764 1.00 11.91 ? 330  ASP A CG    1 
ATOM   1739 O  OD1   . ASP A 1 243 ? 138.301 -2.227  122.325 1.00 11.58 ? 330  ASP A OD1   1 
ATOM   1740 O  OD2   . ASP A 1 243 ? 139.893 -2.055  123.779 1.00 12.77 ? 330  ASP A OD2   1 
ATOM   1741 N  N     . TYR A 1 244 ? 137.214 -0.585  119.516 1.00 11.10 ? 331  TYR A N     1 
ATOM   1742 C  CA    . TYR A 1 244 ? 135.768 -0.383  119.322 1.00 11.52 ? 331  TYR A CA    1 
ATOM   1743 C  C     . TYR A 1 244 ? 134.936 -1.093  120.391 1.00 11.71 ? 331  TYR A C     1 
ATOM   1744 O  O     . TYR A 1 244 ? 133.859 -0.614  120.755 1.00 11.18 ? 331  TYR A O     1 
ATOM   1745 C  CB    . TYR A 1 244 ? 135.309 -0.805  117.904 1.00 11.69 ? 331  TYR A CB    1 
ATOM   1746 C  CG    . TYR A 1 244 ? 134.890 -2.270  117.821 1.00 13.07 ? 331  TYR A CG    1 
ATOM   1747 C  CD1   . TYR A 1 244 ? 133.644 -2.691  118.315 1.00 12.67 ? 331  TYR A CD1   1 
ATOM   1748 C  CD2   . TYR A 1 244 ? 135.740 -3.229  117.285 1.00 14.32 ? 331  TYR A CD2   1 
ATOM   1749 C  CE1   . TYR A 1 244 ? 133.262 -4.022  118.286 1.00 14.98 ? 331  TYR A CE1   1 
ATOM   1750 C  CE2   . TYR A 1 244 ? 135.368 -4.566  117.238 1.00 15.55 ? 331  TYR A CE2   1 
ATOM   1751 C  CZ    . TYR A 1 244 ? 134.133 -4.960  117.745 1.00 15.76 ? 331  TYR A CZ    1 
ATOM   1752 O  OH    . TYR A 1 244 ? 133.735 -6.284  117.708 1.00 18.47 ? 331  TYR A OH    1 
ATOM   1753 N  N     . LYS A 1 245 ? 135.427 -2.228  120.907 1.00 10.32 ? 332  LYS A N     1 
ATOM   1754 C  CA    . LYS A 1 245 ? 134.652 -2.999  121.882 1.00 10.61 ? 332  LYS A CA    1 
ATOM   1755 C  C     . LYS A 1 245 ? 134.564 -2.201  123.183 1.00 10.87 ? 332  LYS A C     1 
ATOM   1756 O  O     . LYS A 1 245 ? 133.541 -2.243  123.884 1.00 11.87 ? 332  LYS A O     1 
ATOM   1757 C  CB    . LYS A 1 245 ? 135.312 -4.356  122.143 1.00 13.11 ? 332  LYS A CB    1 
ATOM   1758 C  CG    . LYS A 1 245 ? 135.160 -5.336  120.978 1.00 16.92 ? 332  LYS A CG    1 
ATOM   1759 C  CD    . LYS A 1 245 ? 135.872 -6.650  121.275 1.00 20.24 ? 332  LYS A CD    1 
ATOM   1760 C  CE    . LYS A 1 245 ? 135.896 -7.547  120.051 1.00 23.71 ? 332  LYS A CE    1 
ATOM   1761 N  NZ    . LYS A 1 245 ? 137.136 -8.376  120.026 1.00 27.02 ? 332  LYS A NZ    1 
ATOM   1762 N  N     . ARG A 1 246 ? 135.628 -1.467  123.497 1.00 10.36 ? 333  ARG A N     1 
ATOM   1763 C  CA    . ARG A 1 246 ? 135.629 -0.566  124.659 1.00 11.06 ? 333  ARG A CA    1 
ATOM   1764 C  C     . ARG A 1 246 ? 134.608 0.548   124.445 1.00 11.68 ? 333  ARG A C     1 
ATOM   1765 O  O     . ARG A 1 246 ? 133.850 0.874   125.359 1.00 11.30 ? 333  ARG A O     1 
ATOM   1766 C  CB    . ARG A 1 246 ? 137.004 0.062   124.895 1.00 10.68 ? 333  ARG A CB    1 
ATOM   1767 C  CG    . ARG A 1 246 ? 137.036 0.983   126.127 1.00 11.20 ? 333  ARG A CG    1 
ATOM   1768 C  CD    . ARG A 1 246 ? 138.401 1.593   126.450 1.00 11.25 ? 333  ARG A CD    1 
ATOM   1769 N  NE    . ARG A 1 246 ? 138.298 2.538   127.581 1.00 11.21 ? 333  ARG A NE    1 
ATOM   1770 C  CZ    . ARG A 1 246 ? 138.315 2.193   128.875 1.00 11.32 ? 333  ARG A CZ    1 
ATOM   1771 N  NH1   . ARG A 1 246 ? 138.472 0.929   129.241 1.00 10.81 ? 333  ARG A NH1   1 
ATOM   1772 N  NH2   . ARG A 1 246 ? 138.198 3.133   129.815 1.00 11.86 ? 333  ARG A NH2   1 
ATOM   1773 N  N     . PHE A 1 247 ? 134.570 1.117   123.243 1.00 12.03 ? 334  PHE A N     1 
ATOM   1774 C  CA    . PHE A 1 247 ? 133.578 2.159   122.956 1.00 12.94 ? 334  PHE A CA    1 
ATOM   1775 C  C     . PHE A 1 247 ? 132.178 1.619   123.217 1.00 13.15 ? 334  PHE A C     1 
ATOM   1776 O  O     . PHE A 1 247 ? 131.383 2.270   123.898 1.00 14.22 ? 334  PHE A O     1 
ATOM   1777 C  CB    . PHE A 1 247 ? 133.686 2.703   121.522 1.00 13.76 ? 334  PHE A CB    1 
ATOM   1778 C  CG    . PHE A 1 247 ? 132.698 3.818   121.223 1.00 14.79 ? 334  PHE A CG    1 
ATOM   1779 C  CD1   . PHE A 1 247 ? 131.379 3.528   120.863 1.00 15.76 ? 334  PHE A CD1   1 
ATOM   1780 C  CD2   . PHE A 1 247 ? 133.075 5.144   121.353 1.00 16.71 ? 334  PHE A CD2   1 
ATOM   1781 C  CE1   . PHE A 1 247 ? 130.466 4.551   120.589 1.00 15.80 ? 334  PHE A CE1   1 
ATOM   1782 C  CE2   . PHE A 1 247 ? 132.166 6.172   121.099 1.00 17.21 ? 334  PHE A CE2   1 
ATOM   1783 C  CZ    . PHE A 1 247 ? 130.867 5.873   120.716 1.00 16.13 ? 334  PHE A CZ    1 
ATOM   1784 N  N     . ILE A 1 248 ? 131.870 0.444   122.682 1.00 13.69 ? 335  ILE A N     1 
ATOM   1785 C  CA    . ILE A 1 248 ? 130.542 -0.175  122.896 1.00 16.43 ? 335  ILE A CA    1 
ATOM   1786 C  C     . ILE A 1 248 ? 130.197 -0.354  124.374 1.00 18.19 ? 335  ILE A C     1 
ATOM   1787 O  O     . ILE A 1 248 ? 129.078 -0.037  124.794 1.00 19.49 ? 335  ILE A O     1 
ATOM   1788 C  CB    . ILE A 1 248 ? 130.381 -1.517  122.136 1.00 17.05 ? 335  ILE A CB    1 
ATOM   1789 C  CG1   . ILE A 1 248 ? 130.395 -1.285  120.619 1.00 16.90 ? 335  ILE A CG1   1 
ATOM   1790 C  CG2   . ILE A 1 248 ? 129.099 -2.236  122.564 1.00 17.81 ? 335  ILE A CG2   1 
ATOM   1791 C  CD1   . ILE A 1 248 ? 130.295 -2.563  119.792 1.00 19.69 ? 335  ILE A CD1   1 
ATOM   1792 N  N     . LYS A 1 249 ? 131.151 -0.841  125.167 1.00 17.74 ? 336  LYS A N     1 
ATOM   1793 C  CA    . LYS A 1 249 ? 130.937 -0.999  126.612 1.00 19.79 ? 336  LYS A CA    1 
ATOM   1794 C  C     . LYS A 1 249 ? 130.555 0.312   127.288 1.00 20.19 ? 336  LYS A C     1 
ATOM   1795 O  O     . LYS A 1 249 ? 129.806 0.308   128.267 1.00 23.46 ? 336  LYS A O     1 
ATOM   1796 C  CB    . LYS A 1 249 ? 132.190 -1.553  127.302 1.00 21.63 ? 336  LYS A CB    1 
ATOM   1797 C  CG    . LYS A 1 249 ? 132.515 -2.987  126.947 1.00 23.51 ? 336  LYS A CG    1 
ATOM   1798 C  CD    . LYS A 1 249 ? 131.586 -3.954  127.655 1.00 26.58 ? 336  LYS A CD    1 
ATOM   1799 C  CE    . LYS A 1 249 ? 131.694 -5.340  127.058 1.00 28.29 ? 336  LYS A CE    1 
ATOM   1800 N  NZ    . LYS A 1 249 ? 130.440 -6.103  127.284 1.00 31.18 ? 336  LYS A NZ    1 
ATOM   1801 N  N     . PHE A 1 250 ? 131.070 1.428   126.778 1.00 17.97 ? 337  PHE A N     1 
ATOM   1802 C  CA    . PHE A 1 250 ? 130.855 2.725   127.419 1.00 19.65 ? 337  PHE A CA    1 
ATOM   1803 C  C     . PHE A 1 250 ? 129.786 3.579   126.732 1.00 20.64 ? 337  PHE A C     1 
ATOM   1804 O  O     . PHE A 1 250 ? 129.577 4.742   127.093 1.00 24.85 ? 337  PHE A O     1 
ATOM   1805 C  CB    . PHE A 1 250 ? 132.185 3.487   127.520 1.00 18.59 ? 337  PHE A CB    1 
ATOM   1806 C  CG    . PHE A 1 250 ? 133.100 2.960   128.600 1.00 19.31 ? 337  PHE A CG    1 
ATOM   1807 C  CD1   . PHE A 1 250 ? 133.960 1.896   128.353 1.00 16.73 ? 337  PHE A CD1   1 
ATOM   1808 C  CD2   . PHE A 1 250 ? 133.105 3.537   129.867 1.00 20.78 ? 337  PHE A CD2   1 
ATOM   1809 C  CE1   . PHE A 1 250 ? 134.789 1.404   129.352 1.00 18.49 ? 337  PHE A CE1   1 
ATOM   1810 C  CE2   . PHE A 1 250 ? 133.944 3.060   130.870 1.00 21.03 ? 337  PHE A CE2   1 
ATOM   1811 C  CZ    . PHE A 1 250 ? 134.784 1.982   130.614 1.00 20.43 ? 337  PHE A CZ    1 
ATOM   1812 N  N     . ALA A 1 251 ? 129.112 3.007   125.745 1.00 18.26 ? 338  ALA A N     1 
ATOM   1813 C  CA    . ALA A 1 251 ? 128.107 3.743   124.986 1.00 17.73 ? 338  ALA A CA    1 
ATOM   1814 C  C     . ALA A 1 251 ? 126.762 3.621   125.678 1.00 16.67 ? 338  ALA A C     1 
ATOM   1815 O  O     . ALA A 1 251 ? 126.409 2.561   126.163 1.00 15.78 ? 338  ALA A O     1 
ATOM   1816 C  CB    . ALA A 1 251 ? 128.017 3.214   123.566 1.00 17.87 ? 338  ALA A CB    1 
ATOM   1817 N  N     . ARG A 1 252 ? 126.021 4.722   125.728 1.00 18.09 ? 339  ARG A N     1 
ATOM   1818 C  CA    . ARG A 1 252 ? 124.670 4.707   126.294 1.00 19.71 ? 339  ARG A CA    1 
ATOM   1819 C  C     . ARG A 1 252 ? 123.757 5.524   125.389 1.00 19.75 ? 339  ARG A C     1 
ATOM   1820 O  O     . ARG A 1 252 ? 124.218 6.125   124.423 1.00 19.00 ? 339  ARG A O     1 
ATOM   1821 C  CB    . ARG A 1 252 ? 124.666 5.296   127.718 1.00 21.54 ? 339  ARG A CB    1 
ATOM   1822 C  CG    . ARG A 1 252 ? 125.327 4.427   128.780 1.00 24.25 ? 339  ARG A CG    1 
ATOM   1823 C  CD    . ARG A 1 252 ? 125.077 4.974   130.184 1.00 27.53 ? 339  ARG A CD    1 
ATOM   1824 N  NE    . ARG A 1 252 ? 123.648 5.038   130.494 1.00 29.44 ? 339  ARG A NE    1 
ATOM   1825 C  CZ    . ARG A 1 252 ? 122.948 4.042   131.025 1.00 29.97 ? 339  ARG A CZ    1 
ATOM   1826 N  NH1   . ARG A 1 252 ? 121.651 4.202   131.252 1.00 30.86 ? 339  ARG A NH1   1 
ATOM   1827 N  NH2   . ARG A 1 252 ? 123.539 2.883   131.329 1.00 30.52 ? 339  ARG A NH2   1 
ATOM   1828 N  N     . VAL A 1 253 ? 122.462 5.532   125.707 1.00 19.58 ? 340  VAL A N     1 
ATOM   1829 C  CA    . VAL A 1 253 ? 121.511 6.411   125.024 1.00 20.57 ? 340  VAL A CA    1 
ATOM   1830 C  C     . VAL A 1 253 ? 121.001 7.469   126.003 1.00 20.20 ? 340  VAL A C     1 
ATOM   1831 O  O     . VAL A 1 253 ? 120.525 7.134   127.092 1.00 19.48 ? 340  VAL A O     1 
ATOM   1832 C  CB    . VAL A 1 253 ? 120.352 5.607   124.400 1.00 20.62 ? 340  VAL A CB    1 
ATOM   1833 C  CG1   . VAL A 1 253 ? 119.303 6.535   123.797 1.00 20.54 ? 340  VAL A CG1   1 
ATOM   1834 C  CG2   . VAL A 1 253 ? 120.900 4.680   123.319 1.00 21.28 ? 340  VAL A CG2   1 
ATOM   1835 N  N     . CYS A 1 254 ? 121.130 8.734   125.600 1.00 21.91 ? 341  CYS A N     1 
ATOM   1836 C  CA    . CYS A 1 254 ? 120.787 9.892   126.418 1.00 23.48 ? 341  CYS A CA    1 
ATOM   1837 C  C     . CYS A 1 254 ? 119.824 10.791  125.653 1.00 25.09 ? 341  CYS A C     1 
ATOM   1838 O  O     . CYS A 1 254 ? 119.836 10.811  124.427 1.00 24.54 ? 341  CYS A O     1 
ATOM   1839 C  CB    . CYS A 1 254 ? 122.042 10.715  126.701 1.00 24.18 ? 341  CYS A CB    1 
ATOM   1840 S  SG    . CYS A 1 254 ? 123.258 9.959   127.796 1.00 24.42 ? 341  CYS A SG    1 
ATOM   1841 N  N     . GLU A 1 255 ? 119.018 11.558  126.385 1.00 26.98 ? 342  GLU A N     1 
ATOM   1842 C  CA    . GLU A 1 255 ? 118.184 12.597  125.768 1.00 28.83 ? 342  GLU A CA    1 
ATOM   1843 C  C     . GLU A 1 255 ? 118.974 13.826  125.359 1.00 29.07 ? 342  GLU A C     1 
ATOM   1844 O  O     . GLU A 1 255 ? 119.674 14.421  126.176 1.00 29.65 ? 342  GLU A O     1 
ATOM   1845 C  CB    . GLU A 1 255 ? 117.064 13.027  126.712 1.00 32.22 ? 342  GLU A CB    1 
ATOM   1846 C  CG    . GLU A 1 255 ? 115.681 12.738  126.165 1.00 37.01 ? 342  GLU A CG    1 
ATOM   1847 C  CD    . GLU A 1 255 ? 114.612 13.579  126.823 1.00 39.36 ? 342  GLU A CD    1 
ATOM   1848 O  OE1   . GLU A 1 255 ? 114.442 13.463  128.056 1.00 41.04 ? 342  GLU A OE1   1 
ATOM   1849 O  OE2   . GLU A 1 255 ? 113.937 14.346  126.100 1.00 42.73 ? 342  GLU A OE2   1 
ATOM   1850 N  N     . VAL A 1 256 ? 118.869 14.192  124.084 1.00 29.34 ? 343  VAL A N     1 
ATOM   1851 C  CA    . VAL A 1 256 ? 119.412 15.454  123.572 1.00 34.87 ? 343  VAL A CA    1 
ATOM   1852 C  C     . VAL A 1 256 ? 118.300 16.107  122.757 1.00 39.27 ? 343  VAL A C     1 
ATOM   1853 O  O     . VAL A 1 256 ? 117.777 15.496  121.819 1.00 40.84 ? 343  VAL A O     1 
ATOM   1854 C  CB    . VAL A 1 256 ? 120.665 15.260  122.685 1.00 34.75 ? 343  VAL A CB    1 
ATOM   1855 C  CG1   . VAL A 1 256 ? 121.218 16.608  122.233 1.00 34.91 ? 343  VAL A CG1   1 
ATOM   1856 C  CG2   . VAL A 1 256 ? 121.744 14.474  123.417 1.00 34.85 ? 343  VAL A CG2   1 
ATOM   1857 N  N     . ASP A 1 257 ? 117.941 17.339  123.123 1.00 43.51 ? 344  ASP A N     1 
ATOM   1858 C  CA    . ASP A 1 257 ? 116.746 18.008  122.590 1.00 46.17 ? 344  ASP A CA    1 
ATOM   1859 C  C     . ASP A 1 257 ? 115.529 17.100  122.800 1.00 46.52 ? 344  ASP A C     1 
ATOM   1860 O  O     . ASP A 1 257 ? 115.237 16.705  123.934 1.00 47.99 ? 344  ASP A O     1 
ATOM   1861 C  CB    . ASP A 1 257 ? 116.920 18.383  121.108 1.00 49.70 ? 344  ASP A CB    1 
ATOM   1862 C  CG    . ASP A 1 257 ? 118.254 19.063  120.825 1.00 52.76 ? 344  ASP A CG    1 
ATOM   1863 O  OD1   . ASP A 1 257 ? 118.620 20.006  121.558 1.00 55.04 ? 344  ASP A OD1   1 
ATOM   1864 O  OD2   . ASP A 1 257 ? 118.936 18.654  119.861 1.00 56.12 ? 344  ASP A OD2   1 
ATOM   1865 N  N     . ASN A 1 258 ? 114.839 16.756  121.716 1.00 46.48 ? 345  ASN A N     1 
ATOM   1866 C  CA    . ASN A 1 258 ? 113.712 15.833  121.797 1.00 45.10 ? 345  ASN A CA    1 
ATOM   1867 C  C     . ASN A 1 258 ? 114.098 14.400  121.406 1.00 41.66 ? 345  ASN A C     1 
ATOM   1868 O  O     . ASN A 1 258 ? 113.240 13.521  121.347 1.00 41.79 ? 345  ASN A O     1 
ATOM   1869 C  CB    . ASN A 1 258 ? 112.540 16.335  120.940 1.00 49.41 ? 345  ASN A CB    1 
ATOM   1870 C  CG    . ASN A 1 258 ? 111.223 15.654  121.285 1.00 53.86 ? 345  ASN A CG    1 
ATOM   1871 O  OD1   . ASN A 1 258 ? 110.748 14.783  120.548 1.00 56.39 ? 345  ASN A OD1   1 
ATOM   1872 N  ND2   . ASN A 1 258 ? 110.631 16.040  122.415 1.00 58.29 ? 345  ASN A ND2   1 
ATOM   1873 N  N     . GLU A 1 259 ? 115.389 14.167  121.164 1.00 36.50 ? 346  GLU A N     1 
ATOM   1874 C  CA    . GLU A 1 259 ? 115.859 12.876  120.643 1.00 32.66 ? 346  GLU A CA    1 
ATOM   1875 C  C     . GLU A 1 259 ? 116.559 12.024  121.689 1.00 29.33 ? 346  GLU A C     1 
ATOM   1876 O  O     . GLU A 1 259 ? 117.105 12.539  122.660 1.00 27.73 ? 346  GLU A O     1 
ATOM   1877 C  CB    . GLU A 1 259 ? 116.848 13.092  119.506 1.00 33.24 ? 346  GLU A CB    1 
ATOM   1878 C  CG    . GLU A 1 259 ? 116.321 13.874  118.326 1.00 33.25 ? 346  GLU A CG    1 
ATOM   1879 C  CD    . GLU A 1 259 ? 117.442 14.302  117.409 1.00 35.27 ? 346  GLU A CD    1 
ATOM   1880 O  OE1   . GLU A 1 259 ? 118.311 13.459  117.102 1.00 34.07 ? 346  GLU A OE1   1 
ATOM   1881 O  OE2   . GLU A 1 259 ? 117.464 15.481  117.005 1.00 37.93 ? 346  GLU A OE2   1 
ATOM   1882 N  N     . LEU A 1 260 ? 116.546 10.713  121.471 1.00 27.13 ? 347  LEU A N     1 
ATOM   1883 C  CA    . LEU A 1 260 ? 117.381 9.810   122.239 1.00 25.36 ? 347  LEU A CA    1 
ATOM   1884 C  C     . LEU A 1 260 ? 118.579 9.474   121.345 1.00 25.35 ? 347  LEU A C     1 
ATOM   1885 O  O     . LEU A 1 260 ? 118.415 8.839   120.306 1.00 27.03 ? 347  LEU A O     1 
ATOM   1886 C  CB    . LEU A 1 260 ? 116.591 8.562   122.638 1.00 25.55 ? 347  LEU A CB    1 
ATOM   1887 C  CG    . LEU A 1 260 ? 115.519 8.781   123.715 1.00 26.73 ? 347  LEU A CG    1 
ATOM   1888 C  CD1   . LEU A 1 260 ? 114.720 7.511   123.939 1.00 27.15 ? 347  LEU A CD1   1 
ATOM   1889 C  CD2   . LEU A 1 260 ? 116.128 9.247   125.028 1.00 27.70 ? 347  LEU A CD2   1 
ATOM   1890 N  N     . ARG A 1 261 ? 119.765 9.935   121.744 1.00 23.64 ? 348  ARG A N     1 
ATOM   1891 C  CA    . ARG A 1 261 ? 120.975 9.822   120.928 1.00 22.25 ? 348  ARG A CA    1 
ATOM   1892 C  C     . ARG A 1 261 ? 122.042 8.990   121.630 1.00 20.28 ? 348  ARG A C     1 
ATOM   1893 O  O     . ARG A 1 261 ? 121.995 8.795   122.841 1.00 20.13 ? 348  ARG A O     1 
ATOM   1894 C  CB    . ARG A 1 261 ? 121.560 11.196  120.649 1.00 23.64 ? 348  ARG A CB    1 
ATOM   1895 C  CG    . ARG A 1 261 ? 120.749 12.073  119.709 1.00 27.88 ? 348  ARG A CG    1 
ATOM   1896 C  CD    . ARG A 1 261 ? 121.497 13.374  119.500 1.00 29.92 ? 348  ARG A CD    1 
ATOM   1897 N  NE    . ARG A 1 261 ? 120.744 14.335  118.693 1.00 33.86 ? 348  ARG A NE    1 
ATOM   1898 C  CZ    . ARG A 1 261 ? 121.162 15.568  118.416 1.00 35.99 ? 348  ARG A CZ    1 
ATOM   1899 N  NH1   . ARG A 1 261 ? 122.326 16.007  118.886 1.00 35.32 ? 348  ARG A NH1   1 
ATOM   1900 N  NH2   . ARG A 1 261 ? 120.410 16.370  117.673 1.00 38.02 ? 348  ARG A NH2   1 
ATOM   1901 N  N     . ILE A 1 262 ? 123.015 8.509   120.866 1.00 20.23 ? 349  ILE A N     1 
ATOM   1902 C  CA    . ILE A 1 262 ? 124.120 7.785   121.483 1.00 18.88 ? 349  ILE A CA    1 
ATOM   1903 C  C     . ILE A 1 262 ? 124.973 8.768   122.276 1.00 18.05 ? 349  ILE A C     1 
ATOM   1904 O  O     . ILE A 1 262 ? 125.289 9.852   121.789 1.00 20.34 ? 349  ILE A O     1 
ATOM   1905 C  CB    . ILE A 1 262 ? 124.954 7.026   120.436 1.00 19.45 ? 349  ILE A CB    1 
ATOM   1906 C  CG1   . ILE A 1 262 ? 124.161 5.801   119.971 1.00 19.52 ? 349  ILE A CG1   1 
ATOM   1907 C  CG2   . ILE A 1 262 ? 126.289 6.595   121.042 1.00 20.51 ? 349  ILE A CG2   1 
ATOM   1908 C  CD1   . ILE A 1 262 ? 124.710 5.118   118.733 1.00 22.05 ? 349  ILE A CD1   1 
ATOM   1909 N  N     . CYS A 1 263 ? 125.325 8.394   123.504 1.00 17.64 ? 350  CYS A N     1 
ATOM   1910 C  CA    . CYS A 1 263 ? 126.201 9.223   124.329 1.00 19.98 ? 350  CYS A CA    1 
ATOM   1911 C  C     . CYS A 1 263 ? 127.371 8.374   124.850 1.00 20.34 ? 350  CYS A C     1 
ATOM   1912 O  O     . CYS A 1 263 ? 127.169 7.246   125.282 1.00 21.93 ? 350  CYS A O     1 
ATOM   1913 C  CB    . CYS A 1 263 ? 125.426 9.914   125.485 1.00 22.10 ? 350  CYS A CB    1 
ATOM   1914 S  SG    . CYS A 1 263 ? 124.430 8.802   126.533 1.00 27.28 ? 350  CYS A SG    1 
ATOM   1915 N  N     . ALA A 1 264 ? 128.579 8.926   124.782 1.00 18.73 ? 351  ALA A N     1 
ATOM   1916 C  CA    . ALA A 1 264 ? 129.780 8.230   125.249 1.00 18.09 ? 351  ALA A CA    1 
ATOM   1917 C  C     . ALA A 1 264 ? 130.160 8.708   126.643 1.00 18.34 ? 351  ALA A C     1 
ATOM   1918 O  O     . ALA A 1 264 ? 129.865 9.838   127.024 1.00 16.78 ? 351  ALA A O     1 
ATOM   1919 C  CB    . ALA A 1 264 ? 130.934 8.477   124.285 1.00 17.58 ? 351  ALA A CB    1 
ATOM   1920 N  N     . ARG A 1 265 ? 130.812 7.853   127.418 1.00 17.24 ? 352  ARG A N     1 
ATOM   1921 C  CA    . ARG A 1 265 ? 131.283 8.272   128.730 1.00 16.71 ? 352  ARG A CA    1 
ATOM   1922 C  C     . ARG A 1 265 ? 132.312 9.402   128.579 1.00 16.67 ? 352  ARG A C     1 
ATOM   1923 O  O     . ARG A 1 265 ? 133.196 9.338   127.715 1.00 16.20 ? 352  ARG A O     1 
ATOM   1924 C  CB    . ARG A 1 265 ? 131.845 7.065   129.496 1.00 16.10 ? 352  ARG A CB    1 
ATOM   1925 C  CG    . ARG A 1 265 ? 132.554 7.421   130.791 1.00 16.21 ? 352  ARG A CG    1 
ATOM   1926 C  CD    . ARG A 1 265 ? 131.596 7.756   131.952 1.00 16.70 ? 352  ARG A CD    1 
ATOM   1927 N  NE    . ARG A 1 265 ? 132.434 8.213   133.045 1.00 16.51 ? 352  ARG A NE    1 
ATOM   1928 C  CZ    . ARG A 1 265 ? 133.028 7.394   133.903 1.00 15.89 ? 352  ARG A CZ    1 
ATOM   1929 N  NH1   . ARG A 1 265 ? 132.800 6.084   133.840 1.00 15.48 ? 352  ARG A NH1   1 
ATOM   1930 N  NH2   . ARG A 1 265 ? 133.819 7.884   134.837 1.00 16.77 ? 352  ARG A NH2   1 
ATOM   1931 N  N     . ASP A 1 266 ? 132.190 10.440  129.412 1.00 16.69 ? 353  ASP A N     1 
ATOM   1932 C  CA    . ASP A 1 266 ? 133.060 11.632  129.336 1.00 17.69 ? 353  ASP A CA    1 
ATOM   1933 C  C     . ASP A 1 266 ? 134.558 11.333  129.198 1.00 18.43 ? 353  ASP A C     1 
ATOM   1934 O  O     . ASP A 1 266 ? 135.251 11.920  128.372 1.00 17.90 ? 353  ASP A O     1 
ATOM   1935 C  CB    . ASP A 1 266 ? 132.820 12.584  130.537 1.00 18.46 ? 353  ASP A CB    1 
ATOM   1936 C  CG    . ASP A 1 266 ? 132.970 11.897  131.902 1.00 20.81 ? 353  ASP A CG    1 
ATOM   1937 O  OD1   . ASP A 1 266 ? 133.354 10.707  131.980 1.00 20.39 ? 353  ASP A OD1   1 
ATOM   1938 O  OD2   . ASP A 1 266 ? 132.703 12.572  132.922 1.00 23.39 ? 353  ASP A OD2   1 
ATOM   1939 N  N     . LYS A 1 267 ? 135.060 10.406  129.995 1.00 20.98 ? 354  LYS A N     1 
ATOM   1940 C  CA    . LYS A 1 267 ? 136.498 10.187  130.021 1.00 22.25 ? 354  LYS A CA    1 
ATOM   1941 C  C     . LYS A 1 267 ? 136.984 9.401   128.806 1.00 21.57 ? 354  LYS A C     1 
ATOM   1942 O  O     . LYS A 1 267 ? 138.186 9.232   128.622 1.00 23.69 ? 354  LYS A O     1 
ATOM   1943 C  CB    . LYS A 1 267 ? 136.921 9.530   131.332 1.00 24.16 ? 354  LYS A CB    1 
ATOM   1944 C  CG    . LYS A 1 267 ? 136.409 8.123   131.504 1.00 23.89 ? 354  LYS A CG    1 
ATOM   1945 C  CD    . LYS A 1 267 ? 136.845 7.579   132.860 1.00 23.91 ? 354  LYS A CD    1 
ATOM   1946 C  CE    . LYS A 1 267 ? 136.514 6.101   132.938 1.00 23.81 ? 354  LYS A CE    1 
ATOM   1947 N  NZ    . LYS A 1 267 ? 136.979 5.420   131.695 1.00 24.89 ? 354  LYS A NZ    1 
ATOM   1948 N  N     . GLU A 1 268 ? 136.046 8.949   127.974 1.00 19.82 ? 355  GLU A N     1 
ATOM   1949 C  CA    . GLU A 1 268 ? 136.375 8.363   126.673 1.00 19.11 ? 355  GLU A CA    1 
ATOM   1950 C  C     . GLU A 1 268 ? 136.724 9.401   125.609 1.00 17.57 ? 355  GLU A C     1 
ATOM   1951 O  O     . GLU A 1 268 ? 137.036 9.034   124.474 1.00 15.65 ? 355  GLU A O     1 
ATOM   1952 C  CB    . GLU A 1 268 ? 135.205 7.534   126.140 1.00 21.62 ? 355  GLU A CB    1 
ATOM   1953 C  CG    . GLU A 1 268 ? 135.082 6.129   126.704 1.00 24.17 ? 355  GLU A CG    1 
ATOM   1954 C  CD    . GLU A 1 268 ? 136.087 5.163   126.082 1.00 26.44 ? 355  GLU A CD    1 
ATOM   1955 O  OE1   . GLU A 1 268 ? 135.898 4.718   124.908 1.00 29.38 ? 355  GLU A OE1   1 
ATOM   1956 O  OE2   . GLU A 1 268 ? 137.072 4.867   126.784 1.00 23.63 ? 355  GLU A OE2   1 
ATOM   1957 N  N     . VAL A 1 269 ? 136.662 10.689  125.950 1.00 14.80 ? 356  VAL A N     1 
ATOM   1958 C  CA    . VAL A 1 269 ? 136.890 11.731  124.935 1.00 13.50 ? 356  VAL A CA    1 
ATOM   1959 C  C     . VAL A 1 269 ? 138.263 11.628  124.260 1.00 13.25 ? 356  VAL A C     1 
ATOM   1960 O  O     . VAL A 1 269 ? 138.370 11.780  123.040 1.00 11.14 ? 356  VAL A O     1 
ATOM   1961 C  CB    . VAL A 1 269 ? 136.609 13.168  125.476 1.00 13.73 ? 356  VAL A CB    1 
ATOM   1962 C  CG1   . VAL A 1 269 ? 137.595 13.547  126.583 1.00 14.44 ? 356  VAL A CG1   1 
ATOM   1963 C  CG2   . VAL A 1 269 ? 136.649 14.184  124.343 1.00 13.36 ? 356  VAL A CG2   1 
ATOM   1964 N  N     . GLY A 1 270 ? 139.306 11.354  125.048 1.00 12.12 ? 357  GLY A N     1 
ATOM   1965 C  CA    . GLY A 1 270 ? 140.647 11.176  124.513 1.00 12.92 ? 357  GLY A CA    1 
ATOM   1966 C  C     . GLY A 1 270 ? 140.716 10.058  123.480 1.00 11.80 ? 357  GLY A C     1 
ATOM   1967 O  O     . GLY A 1 270 ? 141.347 10.215  122.437 1.00 12.48 ? 357  GLY A O     1 
ATOM   1968 N  N     . ASN A 1 271 ? 140.040 8.948   123.770 1.00 12.24 ? 358  ASN A N     1 
ATOM   1969 C  CA    . ASN A 1 271 ? 139.951 7.829   122.836 1.00 12.01 ? 358  ASN A CA    1 
ATOM   1970 C  C     . ASN A 1 271 ? 139.271 8.202   121.520 1.00 12.48 ? 358  ASN A C     1 
ATOM   1971 O  O     . ASN A 1 271 ? 139.653 7.698   120.456 1.00 12.12 ? 358  ASN A O     1 
ATOM   1972 C  CB    . ASN A 1 271 ? 139.245 6.647   123.486 1.00 11.49 ? 358  ASN A CB    1 
ATOM   1973 C  CG    . ASN A 1 271 ? 140.119 5.957   124.526 1.00 13.58 ? 358  ASN A CG    1 
ATOM   1974 O  OD1   . ASN A 1 271 ? 141.333 6.159   124.567 1.00 14.47 ? 358  ASN A OD1   1 
ATOM   1975 N  ND2   . ASN A 1 271 ? 139.508 5.149   125.369 1.00 15.35 ? 358  ASN A ND2   1 
ATOM   1976 N  N     . LEU A 1 272 ? 138.283 9.102   121.593 1.00 12.13 ? 359  LEU A N     1 
ATOM   1977 C  CA    . LEU A 1 272 ? 137.586 9.552   120.385 1.00 13.61 ? 359  LEU A CA    1 
ATOM   1978 C  C     . LEU A 1 272 ? 138.430 10.481  119.540 1.00 12.97 ? 359  LEU A C     1 
ATOM   1979 O  O     . LEU A 1 272 ? 138.426 10.368  118.329 1.00 12.71 ? 359  LEU A O     1 
ATOM   1980 C  CB    . LEU A 1 272 ? 136.237 10.176  120.713 1.00 13.89 ? 359  LEU A CB    1 
ATOM   1981 C  CG    . LEU A 1 272 ? 135.235 9.253   121.395 1.00 16.08 ? 359  LEU A CG    1 
ATOM   1982 C  CD1   . LEU A 1 272 ? 133.910 9.984   121.551 1.00 15.46 ? 359  LEU A CD1   1 
ATOM   1983 C  CD2   . LEU A 1 272 ? 135.059 7.960   120.601 1.00 17.12 ? 359  LEU A CD2   1 
ATOM   1984 N  N     . TYR A 1 273 ? 139.176 11.389  120.172 1.00 13.64 ? 360  TYR A N     1 
ATOM   1985 C  CA    . TYR A 1 273 ? 140.170 12.158  119.437 1.00 14.35 ? 360  TYR A CA    1 
ATOM   1986 C  C     . TYR A 1 273 ? 141.172 11.230  118.738 1.00 14.59 ? 360  TYR A C     1 
ATOM   1987 O  O     . TYR A 1 273 ? 141.498 11.417  117.567 1.00 14.45 ? 360  TYR A O     1 
ATOM   1988 C  CB    . TYR A 1 273 ? 140.896 13.161  120.336 1.00 14.86 ? 360  TYR A CB    1 
ATOM   1989 C  CG    . TYR A 1 273 ? 140.157 14.477  120.454 1.00 15.80 ? 360  TYR A CG    1 
ATOM   1990 C  CD1   . TYR A 1 273 ? 140.238 15.443  119.442 1.00 16.97 ? 360  TYR A CD1   1 
ATOM   1991 C  CD2   . TYR A 1 273 ? 139.370 14.759  121.574 1.00 15.97 ? 360  TYR A CD2   1 
ATOM   1992 C  CE1   . TYR A 1 273 ? 139.551 16.656  119.548 1.00 17.26 ? 360  TYR A CE1   1 
ATOM   1993 C  CE2   . TYR A 1 273 ? 138.690 15.971  121.692 1.00 17.08 ? 360  TYR A CE2   1 
ATOM   1994 C  CZ    . TYR A 1 273 ? 138.779 16.911  120.675 1.00 17.29 ? 360  TYR A CZ    1 
ATOM   1995 O  OH    . TYR A 1 273 ? 138.093 18.110  120.802 1.00 17.91 ? 360  TYR A OH    1 
ATOM   1996 N  N     . ASP A 1 274 ? 141.626 10.205  119.455 1.00 14.00 ? 361  ASP A N     1 
ATOM   1997 C  CA    . ASP A 1 274 ? 142.578 9.246   118.904 1.00 14.62 ? 361  ASP A CA    1 
ATOM   1998 C  C     . ASP A 1 274 ? 141.972 8.383   117.782 1.00 13.37 ? 361  ASP A C     1 
ATOM   1999 O  O     . ASP A 1 274 ? 142.693 7.906   116.910 1.00 14.46 ? 361  ASP A O     1 
ATOM   2000 C  CB    . ASP A 1 274 ? 143.132 8.337   120.017 1.00 16.09 ? 361  ASP A CB    1 
ATOM   2001 C  CG    . ASP A 1 274 ? 144.296 8.959   120.770 1.00 21.12 ? 361  ASP A CG    1 
ATOM   2002 O  OD1   . ASP A 1 274 ? 144.684 10.102  120.468 1.00 23.96 ? 361  ASP A OD1   1 
ATOM   2003 O  OD2   . ASP A 1 274 ? 144.835 8.300   121.682 1.00 23.90 ? 361  ASP A OD2   1 
ATOM   2004 N  N     . MET A 1 275 ? 140.666 8.140   117.832 1.00 12.43 ? 362  MET A N     1 
ATOM   2005 C  CA    . MET A 1 275 ? 139.994 7.421   116.736 1.00 11.58 ? 362  MET A CA    1 
ATOM   2006 C  C     . MET A 1 275 ? 140.168 8.188   115.417 1.00 11.68 ? 362  MET A C     1 
ATOM   2007 O  O     . MET A 1 275 ? 140.433 7.596   114.372 1.00 10.28 ? 362  MET A O     1 
ATOM   2008 C  CB    . MET A 1 275 ? 138.507 7.264   117.009 1.00 12.18 ? 362  MET A CB    1 
ATOM   2009 C  CG    . MET A 1 275 ? 137.822 6.329   116.008 1.00 12.29 ? 362  MET A CG    1 
ATOM   2010 S  SD    . MET A 1 275 ? 136.032 6.375   116.016 1.00 16.05 ? 362  MET A SD    1 
ATOM   2011 C  CE    . MET A 1 275 ? 135.771 7.767   114.907 1.00 15.15 ? 362  MET A CE    1 
ATOM   2012 N  N     . PHE A 1 276 ? 140.024 9.514   115.473 1.00 10.96 ? 363  PHE A N     1 
ATOM   2013 C  CA    . PHE A 1 276 ? 140.153 10.326  114.253 1.00 11.44 ? 363  PHE A CA    1 
ATOM   2014 C  C     . PHE A 1 276 ? 141.599 10.462  113.835 1.00 10.68 ? 363  PHE A C     1 
ATOM   2015 O  O     . PHE A 1 276 ? 141.920 10.514  112.645 1.00 10.03 ? 363  PHE A O     1 
ATOM   2016 C  CB    . PHE A 1 276 ? 139.449 11.681  114.411 1.00 11.58 ? 363  PHE A CB    1 
ATOM   2017 C  CG    . PHE A 1 276 ? 137.964 11.570  114.336 1.00 10.67 ? 363  PHE A CG    1 
ATOM   2018 C  CD1   . PHE A 1 276 ? 137.318 11.465  113.103 1.00 12.12 ? 363  PHE A CD1   1 
ATOM   2019 C  CD2   . PHE A 1 276 ? 137.212 11.523  115.497 1.00 11.65 ? 363  PHE A CD2   1 
ATOM   2020 C  CE1   . PHE A 1 276 ? 135.943 11.317  113.051 1.00 13.17 ? 363  PHE A CE1   1 
ATOM   2021 C  CE2   . PHE A 1 276 ? 135.833 11.383  115.451 1.00 13.58 ? 363  PHE A CE2   1 
ATOM   2022 C  CZ    . PHE A 1 276 ? 135.203 11.279  114.224 1.00 13.24 ? 363  PHE A CZ    1 
ATOM   2023 N  N     . HIS A 1 277 ? 142.488 10.481  114.824 1.00 11.65 ? 364  HIS A N     1 
ATOM   2024 C  CA    . HIS A 1 277 ? 143.913 10.441  114.557 1.00 12.80 ? 364  HIS A CA    1 
ATOM   2025 C  C     . HIS A 1 277 ? 144.256 9.177   113.821 1.00 12.26 ? 364  HIS A C     1 
ATOM   2026 O  O     . HIS A 1 277 ? 144.975 9.212   112.819 1.00 11.78 ? 364  HIS A O     1 
ATOM   2027 C  CB    . HIS A 1 277 ? 144.702 10.559  115.867 1.00 14.02 ? 364  HIS A CB    1 
ATOM   2028 C  CG    . HIS A 1 277 ? 146.187 10.630  115.674 1.00 16.49 ? 364  HIS A CG    1 
ATOM   2029 N  ND1   . HIS A 1 277 ? 146.861 11.788  115.716 1.00 19.50 ? 364  HIS A ND1   1 
ATOM   2030 C  CD2   . HIS A 1 277 ? 147.127 9.633   115.420 1.00 17.90 ? 364  HIS A CD2   1 
ATOM   2031 C  CE1   . HIS A 1 277 ? 148.174 11.549  115.485 1.00 19.50 ? 364  HIS A CE1   1 
ATOM   2032 N  NE2   . HIS A 1 277 ? 148.330 10.231  115.305 1.00 18.92 ? 364  HIS A NE2   1 
ATOM   2033 N  N     . THR A 1 278 ? 143.727 8.055   114.301 1.00 11.42 ? 365  THR A N     1 
ATOM   2034 C  CA    . THR A 1 278 ? 143.932 6.740   113.663 1.00 12.56 ? 365  THR A CA    1 
ATOM   2035 C  C     . THR A 1 278 ? 143.486 6.756   112.198 1.00 11.31 ? 365  THR A C     1 
ATOM   2036 O  O     . THR A 1 278 ? 144.215 6.319   111.300 1.00 12.16 ? 365  THR A O     1 
ATOM   2037 C  CB    . THR A 1 278 ? 143.173 5.657   114.441 1.00 13.13 ? 365  THR A CB    1 
ATOM   2038 O  OG1   . THR A 1 278 ? 143.824 5.459   115.703 1.00 14.02 ? 365  THR A OG1   1 
ATOM   2039 C  CG2   . THR A 1 278 ? 143.135 4.316   113.658 1.00 12.51 ? 365  THR A CG2   1 
ATOM   2040 N  N     . ARG A 1 279 ? 142.283 7.275   111.969 1.00 10.96 ? 366  ARG A N     1 
ATOM   2041 C  CA    . ARG A 1 279 ? 141.752 7.418   110.622 1.00 11.26 ? 366  ARG A CA    1 
ATOM   2042 C  C     . ARG A 1 279 ? 142.712 8.225   109.755 1.00 10.31 ? 366  ARG A C     1 
ATOM   2043 O  O     . ARG A 1 279 ? 143.014 7.827   108.627 1.00 10.06 ? 366  ARG A O     1 
ATOM   2044 C  CB    . ARG A 1 279 ? 140.362 8.057   110.664 1.00 11.56 ? 366  ARG A CB    1 
ATOM   2045 C  CG    . ARG A 1 279 ? 139.721 8.218   109.283 1.00 12.81 ? 366  ARG A CG    1 
ATOM   2046 C  CD    . ARG A 1 279 ? 138.367 8.901   109.402 1.00 14.90 ? 366  ARG A CD    1 
ATOM   2047 N  NE    . ARG A 1 279 ? 137.801 9.214   108.094 1.00 16.42 ? 366  ARG A NE    1 
ATOM   2048 C  CZ    . ARG A 1 279 ? 138.001 10.353  107.439 1.00 18.37 ? 366  ARG A CZ    1 
ATOM   2049 N  NH1   . ARG A 1 279 ? 138.761 11.315  107.963 1.00 18.25 ? 366  ARG A NH1   1 
ATOM   2050 N  NH2   . ARG A 1 279 ? 137.430 10.532  106.254 1.00 19.72 ? 366  ARG A NH2   1 
ATOM   2051 N  N     . ASN A 1 280 ? 143.209 9.353   110.277 1.00 11.00 ? 367  ASN A N     1 
ATOM   2052 C  CA    . ASN A 1 280 ? 144.155 10.192  109.535 1.00 12.31 ? 367  ASN A CA    1 
ATOM   2053 C  C     . ASN A 1 280 ? 145.477 9.469   109.259 1.00 12.04 ? 367  ASN A C     1 
ATOM   2054 O  O     . ASN A 1 280 ? 146.054 9.610   108.176 1.00 11.46 ? 367  ASN A O     1 
ATOM   2055 C  CB    . ASN A 1 280 ? 144.401 11.514  110.295 1.00 15.95 ? 367  ASN A CB    1 
ATOM   2056 C  CG    . ASN A 1 280 ? 145.230 12.512  109.506 1.00 19.02 ? 367  ASN A CG    1 
ATOM   2057 O  OD1   . ASN A 1 280 ? 144.733 13.149  108.583 1.00 23.51 ? 367  ASN A OD1   1 
ATOM   2058 N  ND2   . ASN A 1 280 ? 146.494 12.672  109.887 1.00 21.29 ? 367  ASN A ND2   1 
ATOM   2059 N  N     . SER A 1 281 ? 145.956 8.675   110.223 1.00 12.22 ? 368  SER A N     1 
ATOM   2060 C  CA    . SER A 1 281 ? 147.219 7.934   110.012 1.00 11.97 ? 368  SER A CA    1 
ATOM   2061 C  C     . SER A 1 281 ? 147.075 6.874   108.930 1.00 10.86 ? 368  SER A C     1 
ATOM   2062 O  O     . SER A 1 281 ? 148.017 6.632   108.161 1.00 11.24 ? 368  SER A O     1 
ATOM   2063 C  CB    . SER A 1 281 ? 147.703 7.250   111.296 1.00 14.37 ? 368  SER A CB    1 
ATOM   2064 O  OG    . SER A 1 281 ? 148.179 8.202   112.226 1.00 19.55 ? 368  SER A OG    1 
ATOM   2065 N  N     . LEU A 1 282 ? 145.930 6.213   108.902 1.00 10.29 ? 369  LEU A N     1 
ATOM   2066 C  CA    . LEU A 1 282 ? 145.678 5.185   107.886 1.00 10.85 ? 369  LEU A CA    1 
ATOM   2067 C  C     . LEU A 1 282 ? 145.608 5.823   106.501 1.00 11.24 ? 369  LEU A C     1 
ATOM   2068 O  O     . LEU A 1 282 ? 146.124 5.268   105.538 1.00 11.14 ? 369  LEU A O     1 
ATOM   2069 C  CB    . LEU A 1 282 ? 144.411 4.394   108.193 1.00 11.46 ? 369  LEU A CB    1 
ATOM   2070 C  CG    . LEU A 1 282 ? 144.525 3.483   109.423 1.00 13.15 ? 369  LEU A CG    1 
ATOM   2071 C  CD1   . LEU A 1 282 ? 143.180 2.853   109.739 1.00 11.99 ? 369  LEU A CD1   1 
ATOM   2072 C  CD2   . LEU A 1 282 ? 145.581 2.404   109.194 1.00 13.76 ? 369  LEU A CD2   1 
ATOM   2073 N  N     . HIS A 1 283 ? 145.005 7.007   106.402 1.00 11.33 ? 370  HIS A N     1 
ATOM   2074 C  CA    . HIS A 1 283 ? 145.058 7.746   105.141 1.00 11.90 ? 370  HIS A CA    1 
ATOM   2075 C  C     . HIS A 1 283 ? 146.463 8.117   104.753 1.00 11.62 ? 370  HIS A C     1 
ATOM   2076 O  O     . HIS A 1 283 ? 146.855 7.929   103.600 1.00 12.38 ? 370  HIS A O     1 
ATOM   2077 C  CB    . HIS A 1 283 ? 144.125 8.961   105.170 1.00 11.62 ? 370  HIS A CB    1 
ATOM   2078 C  CG    . HIS A 1 283 ? 142.709 8.630   104.815 1.00 11.67 ? 370  HIS A CG    1 
ATOM   2079 N  ND1   . HIS A 1 283 ? 142.287 8.530   103.534 1.00 12.66 ? 370  HIS A ND1   1 
ATOM   2080 C  CD2   . HIS A 1 283 ? 141.612 8.331   105.613 1.00 11.66 ? 370  HIS A CD2   1 
ATOM   2081 C  CE1   . HIS A 1 283 ? 140.988 8.200   103.520 1.00 12.74 ? 370  HIS A CE1   1 
ATOM   2082 N  NE2   . HIS A 1 283 ? 140.571 8.091   104.791 1.00 12.56 ? 370  HIS A NE2   1 
ATOM   2083 N  N     . ARG A 1 284 ? 147.255 8.617   105.706 1.00 11.92 ? 371  ARG A N     1 
ATOM   2084 C  CA    . ARG A 1 284 ? 148.644 8.983   105.445 1.00 13.32 ? 371  ARG A CA    1 
ATOM   2085 C  C     . ARG A 1 284 ? 149.528 7.811   105.029 1.00 13.24 ? 371  ARG A C     1 
ATOM   2086 O  O     . ARG A 1 284 ? 150.294 7.906   104.071 1.00 13.50 ? 371  ARG A O     1 
ATOM   2087 C  CB    . ARG A 1 284 ? 149.278 9.659   106.666 1.00 15.00 ? 371  ARG A CB    1 
ATOM   2088 C  CG    . ARG A 1 284 ? 148.785 11.086  106.887 1.00 21.14 ? 371  ARG A CG    1 
ATOM   2089 C  CD    . ARG A 1 284 ? 149.455 12.029  105.893 1.00 25.83 ? 371  ARG A CD    1 
ATOM   2090 N  NE    . ARG A 1 284 ? 149.234 13.434  106.226 1.00 30.58 ? 371  ARG A NE    1 
ATOM   2091 C  CZ    . ARG A 1 284 ? 150.094 14.412  105.953 1.00 33.29 ? 371  ARG A CZ    1 
ATOM   2092 N  NH1   . ARG A 1 284 ? 151.243 14.143  105.344 1.00 33.95 ? 371  ARG A NH1   1 
ATOM   2093 N  NH2   . ARG A 1 284 ? 149.804 15.664  106.299 1.00 35.07 ? 371  ARG A NH2   1 
ATOM   2094 N  N     . ARG A 1 285 ? 149.435 6.716   105.768 1.00 12.58 ? 372  ARG A N     1 
ATOM   2095 C  CA    . ARG A 1 285 ? 150.320 5.585   105.519 1.00 12.26 ? 372  ARG A CA    1 
ATOM   2096 C  C     . ARG A 1 285 ? 149.910 4.759   104.310 1.00 11.69 ? 372  ARG A C     1 
ATOM   2097 O  O     . ARG A 1 285 ? 150.770 4.296   103.547 1.00 12.59 ? 372  ARG A O     1 
ATOM   2098 C  CB    . ARG A 1 285 ? 150.401 4.678   106.747 1.00 12.79 ? 372  ARG A CB    1 
ATOM   2099 C  CG    . ARG A 1 285 ? 151.000 5.362   107.944 1.00 14.54 ? 372  ARG A CG    1 
ATOM   2100 C  CD    . ARG A 1 285 ? 150.917 4.478   109.157 1.00 18.27 ? 372  ARG A CD    1 
ATOM   2101 N  NE    . ARG A 1 285 ? 151.425 5.203   110.308 1.00 21.51 ? 372  ARG A NE    1 
ATOM   2102 C  CZ    . ARG A 1 285 ? 151.516 4.690   111.526 1.00 24.38 ? 372  ARG A CZ    1 
ATOM   2103 N  NH1   . ARG A 1 285 ? 151.118 3.439   111.750 1.00 27.99 ? 372  ARG A NH1   1 
ATOM   2104 N  NH2   . ARG A 1 285 ? 152.004 5.432   112.508 1.00 24.62 ? 372  ARG A NH2   1 
ATOM   2105 N  N     . ALA A 1 286 ? 148.601 4.576   104.137 1.00 10.04 ? 373  ALA A N     1 
ATOM   2106 C  CA    . ALA A 1 286 ? 148.104 3.556   103.212 1.00 8.92  ? 373  ALA A CA    1 
ATOM   2107 C  C     . ALA A 1 286 ? 147.161 4.106   102.129 1.00 9.57  ? 373  ALA A C     1 
ATOM   2108 O  O     . ALA A 1 286 ? 147.456 3.986   100.928 1.00 10.05 ? 373  ALA A O     1 
ATOM   2109 C  CB    . ALA A 1 286 ? 147.434 2.421   103.990 1.00 8.62  ? 373  ALA A CB    1 
ATOM   2110 N  N     . TYR A 1 287 ? 146.047 4.705   102.530 1.00 9.05  ? 374  TYR A N     1 
ATOM   2111 C  CA    . TYR A 1 287 ? 144.988 4.984   101.541 1.00 9.12  ? 374  TYR A CA    1 
ATOM   2112 C  C     . TYR A 1 287 ? 145.423 6.052   100.560 1.00 10.25 ? 374  TYR A C     1 
ATOM   2113 O  O     . TYR A 1 287 ? 145.021 6.026   99.403  1.00 10.56 ? 374  TYR A O     1 
ATOM   2114 C  CB    . TYR A 1 287 ? 143.673 5.420   102.195 1.00 9.17  ? 374  TYR A CB    1 
ATOM   2115 C  CG    . TYR A 1 287 ? 143.190 4.527   103.318 1.00 8.97  ? 374  TYR A CG    1 
ATOM   2116 C  CD1   . TYR A 1 287 ? 143.381 3.146   103.287 1.00 8.60  ? 374  TYR A CD1   1 
ATOM   2117 C  CD2   . TYR A 1 287 ? 142.541 5.086   104.409 1.00 8.83  ? 374  TYR A CD2   1 
ATOM   2118 C  CE1   . TYR A 1 287 ? 142.939 2.343   104.338 1.00 8.39  ? 374  TYR A CE1   1 
ATOM   2119 C  CE2   . TYR A 1 287 ? 142.083 4.313   105.452 1.00 8.13  ? 374  TYR A CE2   1 
ATOM   2120 C  CZ    . TYR A 1 287 ? 142.283 2.937   105.417 1.00 8.15  ? 374  TYR A CZ    1 
ATOM   2121 O  OH    . TYR A 1 287 ? 141.819 2.177   106.468 1.00 8.03  ? 374  TYR A OH    1 
ATOM   2122 N  N     . GLN A 1 288 ? 146.217 7.008   101.045 1.00 10.64 ? 375  GLN A N     1 
ATOM   2123 C  CA    . GLN A 1 288 ? 146.782 8.037   100.172 1.00 10.81 ? 375  GLN A CA    1 
ATOM   2124 C  C     . GLN A 1 288 ? 148.249 7.833   99.882  1.00 10.96 ? 375  GLN A C     1 
ATOM   2125 O  O     . GLN A 1 288 ? 148.950 8.798   99.554  1.00 11.30 ? 375  GLN A O     1 
ATOM   2126 C  CB    . GLN A 1 288 ? 146.577 9.441   100.765 1.00 11.33 ? 375  GLN A CB    1 
ATOM   2127 C  CG    . GLN A 1 288 ? 145.163 9.711   101.232 1.00 12.42 ? 375  GLN A CG    1 
ATOM   2128 C  CD    . GLN A 1 288 ? 144.131 9.562   100.138 1.00 13.38 ? 375  GLN A CD    1 
ATOM   2129 O  OE1   . GLN A 1 288 ? 144.410 9.773   98.947  1.00 13.76 ? 375  GLN A OE1   1 
ATOM   2130 N  NE2   . GLN A 1 288 ? 142.919 9.199   100.535 1.00 14.85 ? 375  GLN A NE2   1 
ATOM   2131 N  N     . HIS A 1 289 ? 148.727 6.586   99.948  1.00 10.53 ? 376  HIS A N     1 
ATOM   2132 C  CA    . HIS A 1 289 ? 150.099 6.303   99.562  1.00 10.65 ? 376  HIS A CA    1 
ATOM   2133 C  C     . HIS A 1 289 ? 150.364 6.870   98.179  1.00 10.93 ? 376  HIS A C     1 
ATOM   2134 O  O     . HIS A 1 289 ? 149.557 6.680   97.266  1.00 10.38 ? 376  HIS A O     1 
ATOM   2135 C  CB    . HIS A 1 289 ? 150.357 4.799   99.544  1.00 10.41 ? 376  HIS A CB    1 
ATOM   2136 C  CG    . HIS A 1 289 ? 151.811 4.444   99.373  1.00 9.32  ? 376  HIS A CG    1 
ATOM   2137 N  ND1   . HIS A 1 289 ? 152.404 4.319   98.154  1.00 8.77  ? 376  HIS A ND1   1 
ATOM   2138 C  CD2   . HIS A 1 289 ? 152.799 4.206   100.314 1.00 9.31  ? 376  HIS A CD2   1 
ATOM   2139 C  CE1   . HIS A 1 289 ? 153.698 4.015   98.322  1.00 9.70  ? 376  HIS A CE1   1 
ATOM   2140 N  NE2   . HIS A 1 289 ? 153.944 3.944   99.641  1.00 10.29 ? 376  HIS A NE2   1 
ATOM   2141 N  N     . LYS A 1 290 ? 151.490 7.556   98.012  1.00 12.43 ? 377  LYS A N     1 
ATOM   2142 C  CA    . LYS A 1 290 ? 151.783 8.268   96.748  1.00 14.67 ? 377  LYS A CA    1 
ATOM   2143 C  C     . LYS A 1 290 ? 151.764 7.347   95.539  1.00 13.90 ? 377  LYS A C     1 
ATOM   2144 O  O     . LYS A 1 290 ? 151.319 7.747   94.471  1.00 14.25 ? 377  LYS A O     1 
ATOM   2145 C  CB    . LYS A 1 290 ? 153.127 9.006   96.817  1.00 16.56 ? 377  LYS A CB    1 
ATOM   2146 C  CG    . LYS A 1 290 ? 154.304 8.106   97.189  1.00 19.66 ? 377  LYS A CG    1 
ATOM   2147 C  CD    . LYS A 1 290 ? 155.616 8.855   97.302  1.00 22.53 ? 377  LYS A CD    1 
ATOM   2148 C  CE    . LYS A 1 290 ? 156.795 7.890   97.401  1.00 24.10 ? 377  LYS A CE    1 
ATOM   2149 N  NZ    . LYS A 1 290 ? 156.632 6.906   98.512  1.00 26.64 ? 377  LYS A NZ    1 
ATOM   2150 N  N     . VAL A 1 291 ? 152.233 6.112   95.714  1.00 11.66 ? 378  VAL A N     1 
ATOM   2151 C  CA    . VAL A 1 291 ? 152.260 5.153   94.605  1.00 12.18 ? 378  VAL A CA    1 
ATOM   2152 C  C     . VAL A 1 291 ? 150.906 4.465   94.428  1.00 11.78 ? 378  VAL A C     1 
ATOM   2153 O  O     . VAL A 1 291 ? 150.485 4.203   93.301  1.00 12.00 ? 378  VAL A O     1 
ATOM   2154 C  CB    . VAL A 1 291 ? 153.400 4.121   94.747  1.00 11.64 ? 378  VAL A CB    1 
ATOM   2155 C  CG1   . VAL A 1 291 ? 153.428 3.187   93.536  1.00 11.41 ? 378  VAL A CG1   1 
ATOM   2156 C  CG2   . VAL A 1 291 ? 154.752 4.819   94.903  1.00 11.83 ? 378  VAL A CG2   1 
ATOM   2157 N  N     . GLY A 1 292 ? 150.223 4.166   95.534  1.00 10.94 ? 379  GLY A N     1 
ATOM   2158 C  CA    . GLY A 1 292 ? 148.869 3.629   95.464  1.00 11.40 ? 379  GLY A CA    1 
ATOM   2159 C  C     . GLY A 1 292 ? 147.970 4.577   94.681  1.00 12.08 ? 379  GLY A C     1 
ATOM   2160 O  O     . GLY A 1 292 ? 147.157 4.150   93.842  1.00 11.28 ? 379  GLY A O     1 
ATOM   2161 N  N     . ASN A 1 293 ? 148.136 5.871   94.928  1.00 11.90 ? 380  ASN A N     1 
ATOM   2162 C  CA    . ASN A 1 293 ? 147.330 6.877   94.244  1.00 12.93 ? 380  ASN A CA    1 
ATOM   2163 C  C     . ASN A 1 293 ? 147.667 6.979   92.757  1.00 13.07 ? 380  ASN A C     1 
ATOM   2164 O  O     . ASN A 1 293 ? 146.771 7.186   91.931  1.00 13.12 ? 380  ASN A O     1 
ATOM   2165 C  CB    . ASN A 1 293 ? 147.477 8.245   94.905  1.00 12.24 ? 380  ASN A CB    1 
ATOM   2166 C  CG    . ASN A 1 293 ? 146.653 8.376   96.177  1.00 13.99 ? 380  ASN A CG    1 
ATOM   2167 O  OD1   . ASN A 1 293 ? 146.050 7.415   96.654  1.00 13.37 ? 380  ASN A OD1   1 
ATOM   2168 N  ND2   . ASN A 1 293 ? 146.612 9.579   96.728  1.00 13.29 ? 380  ASN A ND2   1 
ATOM   2169 N  N     . ILE A 1 294 ? 148.945 6.839   92.417  1.00 12.48 ? 381  ILE A N     1 
ATOM   2170 C  CA    . ILE A 1 294 ? 149.343 6.919   91.005  1.00 14.65 ? 381  ILE A CA    1 
ATOM   2171 C  C     . ILE A 1 294 ? 148.869 5.693   90.241  1.00 14.94 ? 381  ILE A C     1 
ATOM   2172 O  O     . ILE A 1 294 ? 148.482 5.802   89.090  1.00 14.15 ? 381  ILE A O     1 
ATOM   2173 C  CB    . ILE A 1 294 ? 150.853 7.239   90.797  1.00 15.29 ? 381  ILE A CB    1 
ATOM   2174 C  CG1   . ILE A 1 294 ? 151.076 8.058   89.502  1.00 16.03 ? 381  ILE A CG1   1 
ATOM   2175 C  CG2   . ILE A 1 294 ? 151.710 5.998   90.790  1.00 15.86 ? 381  ILE A CG2   1 
ATOM   2176 C  CD1   . ILE A 1 294 ? 150.167 9.270   89.372  1.00 16.93 ? 381  ILE A CD1   1 
ATOM   2177 N  N     . ILE A 1 295 ? 148.841 4.534   90.907  1.00 14.20 ? 382  ILE A N     1 
ATOM   2178 C  CA    . ILE A 1 295 ? 148.272 3.336   90.302  1.00 14.49 ? 382  ILE A CA    1 
ATOM   2179 C  C     . ILE A 1 295 ? 146.776 3.496   90.075  1.00 14.31 ? 382  ILE A C     1 
ATOM   2180 O  O     . ILE A 1 295 ? 146.279 3.135   89.007  1.00 14.46 ? 382  ILE A O     1 
ATOM   2181 C  CB    . ILE A 1 295 ? 148.650 2.049   91.070  1.00 14.43 ? 382  ILE A CB    1 
ATOM   2182 C  CG1   . ILE A 1 295 ? 150.131 1.730   90.820  1.00 15.92 ? 382  ILE A CG1   1 
ATOM   2183 C  CG2   . ILE A 1 295 ? 147.784 0.869   90.621  1.00 14.73 ? 382  ILE A CG2   1 
ATOM   2184 C  CD1   . ILE A 1 295 ? 150.721 0.670   91.725  1.00 16.46 ? 382  ILE A CD1   1 
ATOM   2185 N  N     . ASP A 1 296 ? 146.060 4.047   91.057  1.00 13.56 ? 383  ASP A N     1 
ATOM   2186 C  CA    . ASP A 1 296 ? 144.635 4.339   90.899  1.00 14.06 ? 383  ASP A CA    1 
ATOM   2187 C  C     . ASP A 1 296 ? 144.386 5.295   89.715  1.00 14.28 ? 383  ASP A C     1 
ATOM   2188 O  O     . ASP A 1 296 ? 143.437 5.118   88.956  1.00 14.69 ? 383  ASP A O     1 
ATOM   2189 C  CB    . ASP A 1 296 ? 144.055 4.951   92.177  1.00 16.11 ? 383  ASP A CB    1 
ATOM   2190 C  CG    . ASP A 1 296 ? 143.571 3.901   93.163  1.00 16.76 ? 383  ASP A CG    1 
ATOM   2191 O  OD1   . ASP A 1 296 ? 143.490 2.711   92.784  1.00 17.36 ? 383  ASP A OD1   1 
ATOM   2192 O  OD2   . ASP A 1 296 ? 143.254 4.267   94.310  1.00 18.73 ? 383  ASP A OD2   1 
ATOM   2193 N  N     . THR A 1 297 ? 145.273 6.282   89.580  1.00 14.33 ? 384  THR A N     1 
ATOM   2194 C  CA    . THR A 1 297 ? 145.258 7.261   88.487  1.00 15.57 ? 384  THR A CA    1 
ATOM   2195 C  C     . THR A 1 297 ? 145.462 6.604   87.123  1.00 14.46 ? 384  THR A C     1 
ATOM   2196 O  O     . THR A 1 297 ? 144.728 6.895   86.168  1.00 15.57 ? 384  THR A O     1 
ATOM   2197 C  CB    . THR A 1 297 ? 146.358 8.322   88.716  1.00 16.36 ? 384  THR A CB    1 
ATOM   2198 O  OG1   . THR A 1 297 ? 146.077 9.018   89.930  1.00 17.41 ? 384  THR A OG1   1 
ATOM   2199 C  CG2   . THR A 1 297 ? 146.415 9.340   87.569  1.00 17.30 ? 384  THR A CG2   1 
ATOM   2200 N  N     . MET A 1 298 ? 146.444 5.715   87.033  1.00 15.02 ? 385  MET A N     1 
ATOM   2201 C  CA    . MET A 1 298 ? 146.700 5.004   85.778  1.00 15.10 ? 385  MET A CA    1 
ATOM   2202 C  C     . MET A 1 298 ? 145.548 4.074   85.408  1.00 15.47 ? 385  MET A C     1 
ATOM   2203 O  O     . MET A 1 298 ? 145.145 4.011   84.237  1.00 15.25 ? 385  MET A O     1 
ATOM   2204 C  CB    . MET A 1 298 ? 148.030 4.262   85.850  1.00 14.40 ? 385  MET A CB    1 
ATOM   2205 C  CG    . MET A 1 298 ? 149.217 5.204   85.994  1.00 14.15 ? 385  MET A CG    1 
ATOM   2206 S  SD    . MET A 1 298 ? 150.803 4.368   86.194  1.00 17.45 ? 385  MET A SD    1 
ATOM   2207 C  CE    . MET A 1 298 ? 151.169 3.853   84.510  1.00 16.85 ? 385  MET A CE    1 
ATOM   2208 N  N     . ILE A 1 299 ? 145.002 3.359   86.397  1.00 14.21 ? 386  ILE A N     1 
ATOM   2209 C  CA    . ILE A 1 299 ? 143.857 2.493   86.118  1.00 13.68 ? 386  ILE A CA    1 
ATOM   2210 C  C     . ILE A 1 299 ? 142.675 3.332   85.606  1.00 14.14 ? 386  ILE A C     1 
ATOM   2211 O  O     . ILE A 1 299 ? 142.006 2.959   84.625  1.00 12.47 ? 386  ILE A O     1 
ATOM   2212 C  CB    . ILE A 1 299 ? 143.441 1.667   87.350  1.00 13.46 ? 386  ILE A CB    1 
ATOM   2213 C  CG1   . ILE A 1 299 ? 144.549 0.678   87.721  1.00 13.30 ? 386  ILE A CG1   1 
ATOM   2214 C  CG2   . ILE A 1 299 ? 142.160 0.911   87.073  1.00 12.63 ? 386  ILE A CG2   1 
ATOM   2215 C  CD1   . ILE A 1 299 ? 144.286 -0.050  89.044  1.00 13.52 ? 386  ILE A CD1   1 
ATOM   2216 N  N     . THR A 1 300 ? 142.428 4.459   86.271  1.00 13.99 ? 387  THR A N     1 
ATOM   2217 C  CA    . THR A 1 300 ? 141.371 5.385   85.864  1.00 15.64 ? 387  THR A CA    1 
ATOM   2218 C  C     . THR A 1 300 ? 141.569 5.845   84.409  1.00 15.55 ? 387  THR A C     1 
ATOM   2219 O  O     . THR A 1 300 ? 140.593 5.905   83.630  1.00 16.01 ? 387  THR A O     1 
ATOM   2220 C  CB    . THR A 1 300 ? 141.294 6.584   86.826  1.00 15.52 ? 387  THR A CB    1 
ATOM   2221 O  OG1   . THR A 1 300 ? 140.746 6.139   88.072  1.00 14.98 ? 387  THR A OG1   1 
ATOM   2222 C  CG2   . THR A 1 300 ? 140.399 7.694   86.271  1.00 14.75 ? 387  THR A CG2   1 
ATOM   2223 N  N     . ASP A 1 301 ? 142.820 6.154   84.053  1.00 18.28 ? 388  ASP A N     1 
ATOM   2224 C  CA    . ASP A 1 301 ? 143.186 6.552   82.682  1.00 19.85 ? 388  ASP A CA    1 
ATOM   2225 C  C     . ASP A 1 301 ? 142.864 5.460   81.671  1.00 20.40 ? 388  ASP A C     1 
ATOM   2226 O  O     . ASP A 1 301 ? 142.278 5.738   80.623  1.00 18.93 ? 388  ASP A O     1 
ATOM   2227 C  CB    . ASP A 1 301 ? 144.680 6.873   82.574  1.00 21.04 ? 388  ASP A CB    1 
ATOM   2228 C  CG    . ASP A 1 301 ? 145.055 8.212   83.209  1.00 25.38 ? 388  ASP A CG    1 
ATOM   2229 O  OD1   . ASP A 1 301 ? 144.151 9.003   83.568  1.00 29.06 ? 388  ASP A OD1   1 
ATOM   2230 O  OD2   . ASP A 1 301 ? 146.274 8.481   83.340  1.00 26.90 ? 388  ASP A OD2   1 
ATOM   2231 N  N     . ALA A 1 302 ? 143.260 4.224   81.987  1.00 18.96 ? 389  ALA A N     1 
ATOM   2232 C  CA    . ALA A 1 302 ? 142.920 3.069   81.145  1.00 17.87 ? 389  ALA A CA    1 
ATOM   2233 C  C     . ALA A 1 302 ? 141.408 2.880   81.003  1.00 18.47 ? 389  ALA A C     1 
ATOM   2234 O  O     . ALA A 1 302 ? 140.916 2.626   79.901  1.00 18.96 ? 389  ALA A O     1 
ATOM   2235 C  CB    . ALA A 1 302 ? 143.583 1.805   81.673  1.00 17.39 ? 389  ALA A CB    1 
ATOM   2236 N  N     . PHE A 1 303 ? 140.661 3.035   82.096  1.00 16.42 ? 390  PHE A N     1 
ATOM   2237 C  CA    . PHE A 1 303 ? 139.200 2.931   82.020  1.00 15.81 ? 390  PHE A CA    1 
ATOM   2238 C  C     . PHE A 1 303 ? 138.623 4.017   81.100  1.00 17.29 ? 390  PHE A C     1 
ATOM   2239 O  O     . PHE A 1 303 ? 137.710 3.735   80.325  1.00 17.49 ? 390  PHE A O     1 
ATOM   2240 C  CB    . PHE A 1 303 ? 138.550 3.032   83.398  1.00 15.77 ? 390  PHE A CB    1 
ATOM   2241 C  CG    . PHE A 1 303 ? 138.677 1.775   84.236  1.00 14.95 ? 390  PHE A CG    1 
ATOM   2242 C  CD1   . PHE A 1 303 ? 139.601 0.795   83.907  1.00 15.62 ? 390  PHE A CD1   1 
ATOM   2243 C  CD2   . PHE A 1 303 ? 137.903 1.609   85.371  1.00 17.06 ? 390  PHE A CD2   1 
ATOM   2244 C  CE1   . PHE A 1 303 ? 139.741 -0.352  84.687  1.00 15.85 ? 390  PHE A CE1   1 
ATOM   2245 C  CE2   . PHE A 1 303 ? 138.036 0.471   86.161  1.00 16.77 ? 390  PHE A CE2   1 
ATOM   2246 C  CZ    . PHE A 1 303 ? 138.954 -0.510  85.807  1.00 16.44 ? 390  PHE A CZ    1 
ATOM   2247 N  N     . LEU A 1 304 ? 139.159 5.238   81.181  1.00 17.44 ? 391  LEU A N     1 
ATOM   2248 C  CA    . LEU A 1 304 ? 138.687 6.331   80.317  1.00 17.96 ? 391  LEU A CA    1 
ATOM   2249 C  C     . LEU A 1 304 ? 138.940 6.010   78.849  1.00 19.71 ? 391  LEU A C     1 
ATOM   2250 O  O     . LEU A 1 304 ? 138.076 6.242   78.001  1.00 22.14 ? 391  LEU A O     1 
ATOM   2251 C  CB    . LEU A 1 304 ? 139.342 7.665   80.697  1.00 18.04 ? 391  LEU A CB    1 
ATOM   2252 C  CG    . LEU A 1 304 ? 138.826 8.257   82.006  1.00 17.87 ? 391  LEU A CG    1 
ATOM   2253 C  CD1   . LEU A 1 304 ? 139.730 9.375   82.501  1.00 18.18 ? 391  LEU A CD1   1 
ATOM   2254 C  CD2   . LEU A 1 304 ? 137.379 8.721   81.888  1.00 18.74 ? 391  LEU A CD2   1 
ATOM   2255 N  N     . LYS A 1 305 ? 140.119 5.468   78.562  1.00 19.44 ? 392  LYS A N     1 
ATOM   2256 C  CA    . LYS A 1 305 ? 140.501 5.090   77.201  1.00 21.32 ? 392  LYS A CA    1 
ATOM   2257 C  C     . LYS A 1 305 ? 139.766 3.855   76.687  1.00 21.89 ? 392  LYS A C     1 
ATOM   2258 O  O     . LYS A 1 305 ? 139.690 3.634   75.473  1.00 23.40 ? 392  LYS A O     1 
ATOM   2259 C  CB    . LYS A 1 305 ? 142.021 4.902   77.098  1.00 21.36 ? 392  LYS A CB    1 
ATOM   2260 C  CG    . LYS A 1 305 ? 142.783 6.219   77.198  1.00 25.96 ? 392  LYS A CG    1 
ATOM   2261 C  CD    . LYS A 1 305 ? 144.281 6.039   77.006  1.00 29.17 ? 392  LYS A CD    1 
ATOM   2262 C  CE    . LYS A 1 305 ? 145.013 7.372   77.123  1.00 31.12 ? 392  LYS A CE    1 
ATOM   2263 N  NZ    . LYS A 1 305 ? 146.497 7.180   77.068  1.00 34.47 ? 392  LYS A NZ    1 
ATOM   2264 N  N     . ALA A 1 306 ? 139.212 3.059   77.603  1.00 19.37 ? 393  ALA A N     1 
ATOM   2265 C  CA    . ALA A 1 306 ? 138.436 1.875   77.228  1.00 18.80 ? 393  ALA A CA    1 
ATOM   2266 C  C     . ALA A 1 306 ? 136.936 2.135   77.167  1.00 16.49 ? 393  ALA A C     1 
ATOM   2267 O  O     . ALA A 1 306 ? 136.199 1.311   76.629  1.00 19.06 ? 393  ALA A O     1 
ATOM   2268 C  CB    . ALA A 1 306 ? 138.725 0.725   78.196  1.00 18.07 ? 393  ALA A CB    1 
ATOM   2269 N  N     . ASP A 1 307 ? 136.492 3.259   77.728  1.00 17.33 ? 394  ASP A N     1 
ATOM   2270 C  CA    . ASP A 1 307 ? 135.077 3.473   78.054  1.00 19.03 ? 394  ASP A CA    1 
ATOM   2271 C  C     . ASP A 1 307 ? 134.128 3.446   76.850  1.00 23.24 ? 394  ASP A C     1 
ATOM   2272 O  O     . ASP A 1 307 ? 132.971 3.036   76.975  1.00 23.71 ? 394  ASP A O     1 
ATOM   2273 C  CB    . ASP A 1 307 ? 134.893 4.784   78.833  1.00 20.61 ? 394  ASP A CB    1 
ATOM   2274 C  CG    . ASP A 1 307 ? 133.538 4.874   79.515  1.00 21.94 ? 394  ASP A CG    1 
ATOM   2275 O  OD1   . ASP A 1 307 ? 133.083 3.862   80.086  1.00 21.29 ? 394  ASP A OD1   1 
ATOM   2276 O  OD2   . ASP A 1 307 ? 132.910 5.958   79.485  1.00 23.83 ? 394  ASP A OD2   1 
ATOM   2277 N  N     . ASP A 1 308 ? 134.619 3.882   75.695  1.00 26.68 ? 395  ASP A N     1 
ATOM   2278 C  CA    . ASP A 1 308 ? 133.817 3.887   74.465  1.00 30.36 ? 395  ASP A CA    1 
ATOM   2279 C  C     . ASP A 1 308 ? 133.562 2.488   73.920  1.00 30.76 ? 395  ASP A C     1 
ATOM   2280 O  O     . ASP A 1 308 ? 132.610 2.273   73.168  1.00 33.62 ? 395  ASP A O     1 
ATOM   2281 C  CB    . ASP A 1 308 ? 134.521 4.704   73.376  1.00 33.63 ? 395  ASP A CB    1 
ATOM   2282 C  CG    . ASP A 1 308 ? 134.503 6.194   73.650  1.00 36.40 ? 395  ASP A CG    1 
ATOM   2283 O  OD1   . ASP A 1 308 ? 133.580 6.671   74.339  1.00 38.85 ? 395  ASP A OD1   1 
ATOM   2284 O  OD2   . ASP A 1 308 ? 135.418 6.894   73.167  1.00 39.12 ? 395  ASP A OD2   1 
ATOM   2285 N  N     . TYR A 1 309 ? 134.416 1.542   74.305  1.00 29.04 ? 396  TYR A N     1 
ATOM   2286 C  CA    . TYR A 1 309 ? 134.537 0.271   73.592  1.00 29.15 ? 396  TYR A CA    1 
ATOM   2287 C  C     . TYR A 1 309 ? 134.110 -0.960  74.378  1.00 30.12 ? 396  TYR A C     1 
ATOM   2288 O  O     . TYR A 1 309 ? 133.937 -2.028  73.801  1.00 29.22 ? 396  TYR A O     1 
ATOM   2289 C  CB    . TYR A 1 309 ? 135.961 0.111   73.071  1.00 27.75 ? 396  TYR A CB    1 
ATOM   2290 C  CG    . TYR A 1 309 ? 136.471 1.366   72.395  1.00 29.58 ? 396  TYR A CG    1 
ATOM   2291 C  CD1   . TYR A 1 309 ? 135.863 1.856   71.235  1.00 31.33 ? 396  TYR A CD1   1 
ATOM   2292 C  CD2   . TYR A 1 309 ? 137.548 2.068   72.916  1.00 30.20 ? 396  TYR A CD2   1 
ATOM   2293 C  CE1   . TYR A 1 309 ? 136.321 3.012   70.619  1.00 31.71 ? 396  TYR A CE1   1 
ATOM   2294 C  CE2   . TYR A 1 309 ? 138.012 3.230   72.309  1.00 33.32 ? 396  TYR A CE2   1 
ATOM   2295 C  CZ    . TYR A 1 309 ? 137.394 3.695   71.157  1.00 33.10 ? 396  TYR A CZ    1 
ATOM   2296 O  OH    . TYR A 1 309 ? 137.850 4.844   70.539  1.00 36.60 ? 396  TYR A OH    1 
ATOM   2297 N  N     . ILE A 1 310 ? 133.951 -0.816  75.690  1.00 30.68 ? 397  ILE A N     1 
ATOM   2298 C  CA    . ILE A 1 310 ? 133.500 -1.927  76.518  1.00 31.01 ? 397  ILE A CA    1 
ATOM   2299 C  C     . ILE A 1 310 ? 131.979 -1.905  76.578  1.00 31.27 ? 397  ILE A C     1 
ATOM   2300 O  O     . ILE A 1 310 ? 131.371 -0.865  76.829  1.00 32.07 ? 397  ILE A O     1 
ATOM   2301 C  CB    . ILE A 1 310 ? 134.115 -1.879  77.943  1.00 31.87 ? 397  ILE A CB    1 
ATOM   2302 C  CG1   . ILE A 1 310 ? 135.643 -2.064  77.907  1.00 31.86 ? 397  ILE A CG1   1 
ATOM   2303 C  CG2   . ILE A 1 310 ? 133.422 -2.873  78.873  1.00 31.76 ? 397  ILE A CG2   1 
ATOM   2304 C  CD1   . ILE A 1 310 ? 136.134 -3.491  77.738  1.00 31.46 ? 397  ILE A CD1   1 
ATOM   2305 N  N     . GLU A 1 311 ? 131.369 -3.061  76.335  1.00 32.98 ? 398  GLU A N     1 
ATOM   2306 C  CA    . GLU A 1 311 ? 129.921 -3.183  76.372  1.00 33.49 ? 398  GLU A CA    1 
ATOM   2307 C  C     . GLU A 1 311 ? 129.493 -4.075  77.522  1.00 33.17 ? 398  GLU A C     1 
ATOM   2308 O  O     . GLU A 1 311 ? 130.011 -5.178  77.697  1.00 34.47 ? 398  GLU A O     1 
ATOM   2309 C  CB    . GLU A 1 311 ? 129.390 -3.751  75.055  1.00 36.98 ? 398  GLU A CB    1 
ATOM   2310 C  CG    . GLU A 1 311 ? 129.684 -2.875  73.846  1.00 39.44 ? 398  GLU A CG    1 
ATOM   2311 C  CD    . GLU A 1 311 ? 129.019 -3.385  72.580  1.00 42.00 ? 398  GLU A CD    1 
ATOM   2312 O  OE1   . GLU A 1 311 ? 128.282 -2.595  71.952  1.00 44.20 ? 398  GLU A OE1   1 
ATOM   2313 O  OE2   . GLU A 1 311 ? 129.230 -4.566  72.216  1.00 44.48 ? 398  GLU A OE2   1 
ATOM   2314 N  N     . ILE A 1 312 ? 128.550 -3.580  78.312  1.00 30.76 ? 399  ILE A N     1 
ATOM   2315 C  CA    . ILE A 1 312 ? 128.008 -4.343  79.420  1.00 29.53 ? 399  ILE A CA    1 
ATOM   2316 C  C     . ILE A 1 312 ? 126.495 -4.370  79.267  1.00 29.89 ? 399  ILE A C     1 
ATOM   2317 O  O     . ILE A 1 312 ? 125.853 -3.327  79.155  1.00 28.21 ? 399  ILE A O     1 
ATOM   2318 C  CB    . ILE A 1 312 ? 128.453 -3.751  80.779  1.00 30.01 ? 399  ILE A CB    1 
ATOM   2319 C  CG1   . ILE A 1 312 ? 129.976 -3.880  80.930  1.00 30.26 ? 399  ILE A CG1   1 
ATOM   2320 C  CG2   . ILE A 1 312 ? 127.747 -4.456  81.927  1.00 26.64 ? 399  ILE A CG2   1 
ATOM   2321 C  CD1   . ILE A 1 312 ? 130.648 -2.687  81.581  1.00 31.30 ? 399  ILE A CD1   1 
ATOM   2322 N  N     . THR A 1 313 ? 125.941 -5.577  79.249  1.00 30.62 ? 400  THR A N     1 
ATOM   2323 C  CA    . THR A 1 313 ? 124.527 -5.786  78.987  1.00 30.21 ? 400  THR A CA    1 
ATOM   2324 C  C     . THR A 1 313 ? 123.660 -5.550  80.223  1.00 28.86 ? 400  THR A C     1 
ATOM   2325 O  O     . THR A 1 313 ? 123.878 -6.145  81.272  1.00 30.53 ? 400  THR A O     1 
ATOM   2326 C  CB    . THR A 1 313 ? 124.294 -7.196  78.407  1.00 32.28 ? 400  THR A CB    1 
ATOM   2327 O  OG1   . THR A 1 313 ? 125.022 -7.321  77.176  1.00 34.80 ? 400  THR A OG1   1 
ATOM   2328 C  CG2   . THR A 1 313 ? 122.823 -7.447  78.138  1.00 32.23 ? 400  THR A CG2   1 
ATOM   2329 N  N     . GLY A 1 314 ? 122.667 -4.681  80.083  1.00 24.80 ? 401  GLY A N     1 
ATOM   2330 C  CA    . GLY A 1 314 ? 121.734 -4.386  81.164  1.00 26.13 ? 401  GLY A CA    1 
ATOM   2331 C  C     . GLY A 1 314 ? 120.325 -4.886  80.903  1.00 28.31 ? 401  GLY A C     1 
ATOM   2332 O  O     . GLY A 1 314 ? 120.125 -5.820  80.129  1.00 29.82 ? 401  GLY A O     1 
ATOM   2333 N  N     . ALA A 1 315 ? 119.354 -4.259  81.561  1.00 28.15 ? 402  ALA A N     1 
ATOM   2334 C  CA    . ALA A 1 315 ? 117.955 -4.677  81.490  1.00 31.51 ? 402  ALA A CA    1 
ATOM   2335 C  C     . ALA A 1 315 ? 117.382 -4.450  80.093  1.00 34.19 ? 402  ALA A C     1 
ATOM   2336 O  O     . ALA A 1 315 ? 117.597 -3.395  79.488  1.00 35.68 ? 402  ALA A O     1 
ATOM   2337 C  CB    . ALA A 1 315 ? 117.132 -3.934  82.524  1.00 30.71 ? 402  ALA A CB    1 
ATOM   2338 N  N     . GLY A 1 316 ? 116.658 -5.447  79.590  1.00 36.88 ? 403  GLY A N     1 
ATOM   2339 C  CA    . GLY A 1 316 ? 116.109 -5.399  78.234  1.00 38.51 ? 403  GLY A CA    1 
ATOM   2340 C  C     . GLY A 1 316 ? 117.190 -5.505  77.172  1.00 40.30 ? 403  GLY A C     1 
ATOM   2341 O  O     . GLY A 1 316 ? 117.000 -5.068  76.036  1.00 42.58 ? 403  GLY A O     1 
ATOM   2342 N  N     . GLY A 1 317 ? 118.333 -6.075  77.551  1.00 38.94 ? 404  GLY A N     1 
ATOM   2343 C  CA    . GLY A 1 317 ? 119.450 -6.279  76.638  1.00 38.71 ? 404  GLY A CA    1 
ATOM   2344 C  C     . GLY A 1 317 ? 120.171 -5.015  76.196  1.00 39.79 ? 404  GLY A C     1 
ATOM   2345 O  O     . GLY A 1 317 ? 121.051 -5.084  75.335  1.00 42.17 ? 404  GLY A O     1 
ATOM   2346 N  N     . LYS A 1 318 ? 119.807 -3.866  76.771  1.00 40.86 ? 405  LYS A N     1 
ATOM   2347 C  CA    . LYS A 1 318 ? 120.468 -2.598  76.447  1.00 41.00 ? 405  LYS A CA    1 
ATOM   2348 C  C     . LYS A 1 318 ? 121.960 -2.670  76.778  1.00 40.86 ? 405  LYS A C     1 
ATOM   2349 O  O     . LYS A 1 318 ? 122.359 -3.364  77.716  1.00 38.96 ? 405  LYS A O     1 
ATOM   2350 C  CB    . LYS A 1 318 ? 119.811 -1.420  77.174  1.00 42.76 ? 405  LYS A CB    1 
ATOM   2351 C  CG    . LYS A 1 318 ? 120.175 -0.069  76.564  1.00 46.27 ? 405  LYS A CG    1 
ATOM   2352 C  CD    . LYS A 1 318 ? 119.747 1.131   77.407  1.00 47.61 ? 405  LYS A CD    1 
ATOM   2353 C  CE    . LYS A 1 318 ? 118.264 1.453   77.268  1.00 49.41 ? 405  LYS A CE    1 
ATOM   2354 N  NZ    . LYS A 1 318 ? 117.469 0.760   78.352  1.00 50.68 ? 405  LYS A NZ    1 
ATOM   2355 N  N     . LYS A 1 319 ? 122.775 -1.973  75.992  1.00 39.40 ? 406  LYS A N     1 
ATOM   2356 C  CA    . LYS A 1 319 ? 124.223 -1.996  76.185  1.00 37.50 ? 406  LYS A CA    1 
ATOM   2357 C  C     . LYS A 1 319 ? 124.713 -0.752  76.913  1.00 33.38 ? 406  LYS A C     1 
ATOM   2358 O  O     . LYS A 1 319 ? 124.254 0.363   76.651  1.00 33.85 ? 406  LYS A O     1 
ATOM   2359 C  CB    . LYS A 1 319 ? 124.961 -2.185  74.854  1.00 41.47 ? 406  LYS A CB    1 
ATOM   2360 C  CG    . LYS A 1 319 ? 125.199 -3.642  74.463  1.00 44.93 ? 406  LYS A CG    1 
ATOM   2361 C  CD    . LYS A 1 319 ? 123.908 -4.367  74.095  1.00 46.66 ? 406  LYS A CD    1 
ATOM   2362 C  CE    . LYS A 1 319 ? 124.143 -5.844  73.793  1.00 48.27 ? 406  LYS A CE    1 
ATOM   2363 N  NZ    . LYS A 1 319 ? 124.894 -6.052  72.516  1.00 50.02 ? 406  LYS A NZ    1 
ATOM   2364 N  N     . TYR A 1 320 ? 125.647 -0.958  77.838  1.00 27.65 ? 407  TYR A N     1 
ATOM   2365 C  CA    . TYR A 1 320 ? 126.166 0.123   78.653  1.00 24.08 ? 407  TYR A CA    1 
ATOM   2366 C  C     . TYR A 1 320 ? 127.676 0.182   78.610  1.00 20.99 ? 407  TYR A C     1 
ATOM   2367 O  O     . TYR A 1 320 ? 128.335 -0.775  78.231  1.00 23.87 ? 407  TYR A O     1 
ATOM   2368 C  CB    . TYR A 1 320 ? 125.676 -0.018  80.094  1.00 23.80 ? 407  TYR A CB    1 
ATOM   2369 C  CG    . TYR A 1 320 ? 124.193 0.222   80.235  1.00 23.74 ? 407  TYR A CG    1 
ATOM   2370 C  CD1   . TYR A 1 320 ? 123.697 1.506   80.470  1.00 24.32 ? 407  TYR A CD1   1 
ATOM   2371 C  CD2   . TYR A 1 320 ? 123.281 -0.833  80.130  1.00 23.65 ? 407  TYR A CD2   1 
ATOM   2372 C  CE1   . TYR A 1 320 ? 122.335 1.731   80.596  1.00 25.95 ? 407  TYR A CE1   1 
ATOM   2373 C  CE2   . TYR A 1 320 ? 121.919 -0.619  80.259  1.00 26.08 ? 407  TYR A CE2   1 
ATOM   2374 C  CZ    . TYR A 1 320 ? 121.454 0.667   80.481  1.00 27.11 ? 407  TYR A CZ    1 
ATOM   2375 O  OH    . TYR A 1 320 ? 120.105 0.884   80.612  1.00 30.70 ? 407  TYR A OH    1 
ATOM   2376 N  N     . ARG A 1 321 ? 128.209 1.333   78.986  1.00 21.50 ? 408  ARG A N     1 
ATOM   2377 C  CA    . ARG A 1 321 ? 129.636 1.544   79.074  1.00 22.13 ? 408  ARG A CA    1 
ATOM   2378 C  C     . ARG A 1 321 ? 130.037 1.389   80.543  1.00 19.70 ? 408  ARG A C     1 
ATOM   2379 O  O     . ARG A 1 321 ? 129.165 1.313   81.405  1.00 19.96 ? 408  ARG A O     1 
ATOM   2380 C  CB    . ARG A 1 321 ? 129.963 2.951   78.595  1.00 23.21 ? 408  ARG A CB    1 
ATOM   2381 C  CG    . ARG A 1 321 ? 129.529 3.199   77.157  1.00 27.30 ? 408  ARG A CG    1 
ATOM   2382 C  CD    . ARG A 1 321 ? 129.470 4.681   76.849  1.00 30.03 ? 408  ARG A CD    1 
ATOM   2383 N  NE    . ARG A 1 321 ? 130.795 5.290   76.869  1.00 33.79 ? 408  ARG A NE    1 
ATOM   2384 C  CZ    . ARG A 1 321 ? 131.096 6.439   76.276  1.00 36.94 ? 408  ARG A CZ    1 
ATOM   2385 N  NH1   . ARG A 1 321 ? 130.167 7.106   75.597  1.00 37.07 ? 408  ARG A NH1   1 
ATOM   2386 N  NH2   . ARG A 1 321 ? 132.331 6.918   76.357  1.00 38.41 ? 408  ARG A NH2   1 
ATOM   2387 N  N     . ILE A 1 322 ? 131.340 1.353   80.811  1.00 19.85 ? 409  ILE A N     1 
ATOM   2388 C  CA    . ILE A 1 322 ? 131.845 1.388   82.199  1.00 17.72 ? 409  ILE A CA    1 
ATOM   2389 C  C     . ILE A 1 322 ? 131.198 2.572   82.932  1.00 18.44 ? 409  ILE A C     1 
ATOM   2390 O  O     . ILE A 1 322 ? 130.665 2.425   84.046  1.00 17.29 ? 409  ILE A O     1 
ATOM   2391 C  CB    . ILE A 1 322 ? 133.390 1.502   82.260  1.00 17.36 ? 409  ILE A CB    1 
ATOM   2392 C  CG1   . ILE A 1 322 ? 134.058 0.351   81.485  1.00 15.78 ? 409  ILE A CG1   1 
ATOM   2393 C  CG2   . ILE A 1 322 ? 133.864 1.502   83.721  1.00 17.14 ? 409  ILE A CG2   1 
ATOM   2394 C  CD1   . ILE A 1 322 ? 135.552 0.498   81.287  1.00 17.07 ? 409  ILE A CD1   1 
ATOM   2395 N  N     . SER A 1 323 ? 131.197 3.737   82.284  1.00 18.53 ? 410  SER A N     1 
ATOM   2396 C  CA    . SER A 1 323 ? 130.688 4.949   82.924  1.00 19.34 ? 410  SER A CA    1 
ATOM   2397 C  C     . SER A 1 323 ? 129.167 5.030   82.984  1.00 19.76 ? 410  SER A C     1 
ATOM   2398 O  O     . SER A 1 323 ? 128.612 5.739   83.838  1.00 20.70 ? 410  SER A O     1 
ATOM   2399 C  CB    . SER A 1 323 ? 131.276 6.193   82.254  1.00 20.83 ? 410  SER A CB    1 
ATOM   2400 O  OG    . SER A 1 323 ? 130.933 6.235   80.875  1.00 21.87 ? 410  SER A OG    1 
ATOM   2401 N  N     . THR A 1 324 ? 128.476 4.306   82.102  1.00 20.53 ? 411  THR A N     1 
ATOM   2402 C  CA    . THR A 1 324 ? 127.011 4.363   82.112  1.00 20.56 ? 411  THR A CA    1 
ATOM   2403 C  C     . THR A 1 324 ? 126.322 3.198   82.829  1.00 21.07 ? 411  THR A C     1 
ATOM   2404 O  O     . THR A 1 324 ? 125.126 3.277   83.118  1.00 20.41 ? 411  THR A O     1 
ATOM   2405 C  CB    . THR A 1 324 ? 126.402 4.644   80.706  1.00 21.29 ? 411  THR A CB    1 
ATOM   2406 O  OG1   . THR A 1 324 ? 126.854 3.660   79.762  1.00 22.64 ? 411  THR A OG1   1 
ATOM   2407 C  CG2   . THR A 1 324 ? 126.829 6.030   80.225  1.00 21.48 ? 411  THR A CG2   1 
ATOM   2408 N  N     . ALA A 1 325 ? 127.075 2.146   83.171  1.00 20.64 ? 412  ALA A N     1 
ATOM   2409 C  CA    . ALA A 1 325 ? 126.493 1.020   83.919  1.00 18.79 ? 412  ALA A CA    1 
ATOM   2410 C  C     . ALA A 1 325 ? 125.861 1.478   85.232  1.00 18.97 ? 412  ALA A C     1 
ATOM   2411 O  O     . ALA A 1 325 ? 124.947 0.827   85.738  1.00 20.24 ? 412  ALA A O     1 
ATOM   2412 C  CB    . ALA A 1 325 ? 127.526 -0.088  84.157  1.00 18.57 ? 412  ALA A CB    1 
ATOM   2413 N  N     . ILE A 1 326 ? 126.324 2.614   85.765  1.00 17.50 ? 413  ILE A N     1 
ATOM   2414 C  CA    . ILE A 1 326 ? 125.748 3.170   86.990  1.00 18.59 ? 413  ILE A CA    1 
ATOM   2415 C  C     . ILE A 1 326 ? 124.275 3.573   86.839  1.00 20.12 ? 413  ILE A C     1 
ATOM   2416 O  O     . ILE A 1 326 ? 123.586 3.787   87.824  1.00 17.87 ? 413  ILE A O     1 
ATOM   2417 C  CB    . ILE A 1 326 ? 126.555 4.372   87.536  1.00 19.17 ? 413  ILE A CB    1 
ATOM   2418 C  CG1   . ILE A 1 326 ? 126.584 5.522   86.514  1.00 19.49 ? 413  ILE A CG1   1 
ATOM   2419 C  CG2   . ILE A 1 326 ? 127.959 3.939   87.954  1.00 18.14 ? 413  ILE A CG2   1 
ATOM   2420 C  CD1   . ILE A 1 326 ? 127.180 6.806   87.051  1.00 19.54 ? 413  ILE A CD1   1 
ATOM   2421 N  N     . ASP A 1 327 ? 123.809 3.678   85.599  1.00 23.36 ? 414  ASP A N     1 
ATOM   2422 C  CA    . ASP A 1 327 ? 122.430 4.062   85.329  1.00 25.55 ? 414  ASP A CA    1 
ATOM   2423 C  C     . ASP A 1 327 ? 121.493 2.857   85.312  1.00 25.67 ? 414  ASP A C     1 
ATOM   2424 O  O     . ASP A 1 327 ? 120.277 3.021   85.375  1.00 26.08 ? 414  ASP A O     1 
ATOM   2425 C  CB    . ASP A 1 327 ? 122.337 4.819   83.998  1.00 28.60 ? 414  ASP A CB    1 
ATOM   2426 C  CG    . ASP A 1 327 ? 123.186 6.077   83.979  1.00 30.79 ? 414  ASP A CG    1 
ATOM   2427 O  OD1   . ASP A 1 327 ? 123.304 6.736   85.031  1.00 31.98 ? 414  ASP A OD1   1 
ATOM   2428 O  OD2   . ASP A 1 327 ? 123.730 6.413   82.908  1.00 33.23 ? 414  ASP A OD2   1 
ATOM   2429 N  N     . ASP A 1 328 ? 122.055 1.650   85.232  1.00 23.11 ? 415  ASP A N     1 
ATOM   2430 C  CA    . ASP A 1 328 ? 121.228 0.445   85.191  1.00 23.34 ? 415  ASP A CA    1 
ATOM   2431 C  C     . ASP A 1 328 ? 121.779 -0.650  86.112  1.00 21.68 ? 415  ASP A C     1 
ATOM   2432 O  O     . ASP A 1 328 ? 122.832 -1.221  85.824  1.00 21.90 ? 415  ASP A O     1 
ATOM   2433 C  CB    . ASP A 1 328 ? 121.116 -0.087  83.763  1.00 24.90 ? 415  ASP A CB    1 
ATOM   2434 C  CG    . ASP A 1 328 ? 120.269 -1.340  83.680  1.00 27.84 ? 415  ASP A CG    1 
ATOM   2435 O  OD1   . ASP A 1 328 ? 119.029 -1.228  83.801  1.00 31.12 ? 415  ASP A OD1   1 
ATOM   2436 O  OD2   . ASP A 1 328 ? 120.841 -2.439  83.524  1.00 27.99 ? 415  ASP A OD2   1 
ATOM   2437 N  N     . MET A 1 329 ? 121.042 -0.955  87.181  1.00 21.35 ? 416  MET A N     1 
ATOM   2438 C  CA    . MET A 1 329 ? 121.558 -1.850  88.229  1.00 22.04 ? 416  MET A CA    1 
ATOM   2439 C  C     . MET A 1 329 ? 121.826 -3.270  87.745  1.00 22.44 ? 416  MET A C     1 
ATOM   2440 O  O     . MET A 1 329 ? 122.723 -3.946  88.267  1.00 21.74 ? 416  MET A O     1 
ATOM   2441 C  CB    . MET A 1 329 ? 120.658 -1.831  89.469  1.00 21.96 ? 416  MET A CB    1 
ATOM   2442 C  CG    . MET A 1 329 ? 120.732 -0.539  90.274  1.00 22.08 ? 416  MET A CG    1 
ATOM   2443 S  SD    . MET A 1 329 ? 122.412 -0.086  90.759  1.00 23.03 ? 416  MET A SD    1 
ATOM   2444 C  CE    . MET A 1 329 ? 122.921 1.049   89.467  1.00 21.55 ? 416  MET A CE    1 
ATOM   2445 N  N     . GLU A 1 330 ? 121.078 -3.719  86.734  1.00 22.87 ? 417  GLU A N     1 
ATOM   2446 C  CA    . GLU A 1 330 ? 121.349 -5.011  86.108  1.00 22.74 ? 417  GLU A CA    1 
ATOM   2447 C  C     . GLU A 1 330 ? 122.723 -5.024  85.441  1.00 20.75 ? 417  GLU A C     1 
ATOM   2448 O  O     . GLU A 1 330 ? 123.467 -5.993  85.586  1.00 20.91 ? 417  GLU A O     1 
ATOM   2449 C  CB    . GLU A 1 330 ? 120.266 -5.369  85.095  1.00 26.24 ? 417  GLU A CB    1 
ATOM   2450 C  CG    . GLU A 1 330 ? 119.790 -6.810  85.213  1.00 30.60 ? 417  GLU A CG    1 
ATOM   2451 C  CD    . GLU A 1 330 ? 118.777 -7.154  84.137  1.00 33.35 ? 417  GLU A CD    1 
ATOM   2452 O  OE1   . GLU A 1 330 ? 119.169 -7.817  83.149  1.00 36.50 ? 417  GLU A OE1   1 
ATOM   2453 O  OE2   . GLU A 1 330 ? 117.603 -6.745  84.274  1.00 35.25 ? 417  GLU A OE2   1 
ATOM   2454 N  N     . ALA A 1 331 ? 123.061 -3.953  84.720  1.00 17.11 ? 418  ALA A N     1 
ATOM   2455 C  CA    . ALA A 1 331 ? 124.389 -3.809  84.122  1.00 16.33 ? 418  ALA A CA    1 
ATOM   2456 C  C     . ALA A 1 331 ? 125.472 -3.658  85.204  1.00 16.33 ? 418  ALA A C     1 
ATOM   2457 O  O     . ALA A 1 331 ? 126.564 -4.226  85.081  1.00 15.15 ? 418  ALA A O     1 
ATOM   2458 C  CB    . ALA A 1 331 ? 124.440 -2.598  83.198  1.00 18.46 ? 418  ALA A CB    1 
ATOM   2459 N  N     . TYR A 1 332 ? 125.165 -2.853  86.221  1.00 15.45 ? 419  TYR A N     1 
ATOM   2460 C  CA    . TYR A 1 332 ? 126.143 -2.497  87.254  1.00 14.19 ? 419  TYR A CA    1 
ATOM   2461 C  C     . TYR A 1 332 ? 126.530 -3.725  88.082  1.00 14.62 ? 419  TYR A C     1 
ATOM   2462 O  O     . TYR A 1 332 ? 127.687 -3.856  88.519  1.00 13.78 ? 419  TYR A O     1 
ATOM   2463 C  CB    . TYR A 1 332 ? 125.575 -1.421  88.169  1.00 13.64 ? 419  TYR A CB    1 
ATOM   2464 C  CG    . TYR A 1 332 ? 126.616 -0.710  89.025  1.00 11.83 ? 419  TYR A CG    1 
ATOM   2465 C  CD1   . TYR A 1 332 ? 127.739 -0.121  88.443  1.00 13.12 ? 419  TYR A CD1   1 
ATOM   2466 C  CD2   . TYR A 1 332 ? 126.450 -0.594  90.406  1.00 13.21 ? 419  TYR A CD2   1 
ATOM   2467 C  CE1   . TYR A 1 332 ? 128.681 0.550   89.210  1.00 13.00 ? 419  TYR A CE1   1 
ATOM   2468 C  CE2   . TYR A 1 332 ? 127.386 0.075   91.189  1.00 12.28 ? 419  TYR A CE2   1 
ATOM   2469 C  CZ    . TYR A 1 332 ? 128.494 0.640   90.587  1.00 12.03 ? 419  TYR A CZ    1 
ATOM   2470 O  OH    . TYR A 1 332 ? 129.419 1.303   91.366  1.00 13.05 ? 419  TYR A OH    1 
ATOM   2471 N  N     . THR A 1 333 ? 125.559 -4.611  88.285  1.00 15.14 ? 420  THR A N     1 
ATOM   2472 C  CA    . THR A 1 333 ? 125.788 -5.916  88.922  1.00 15.42 ? 420  THR A CA    1 
ATOM   2473 C  C     . THR A 1 333 ? 126.983 -6.652  88.312  1.00 16.65 ? 420  THR A C     1 
ATOM   2474 O  O     . THR A 1 333 ? 127.731 -7.340  89.024  1.00 17.39 ? 420  THR A O     1 
ATOM   2475 C  CB    . THR A 1 333 ? 124.530 -6.796  88.836  1.00 15.21 ? 420  THR A CB    1 
ATOM   2476 O  OG1   . THR A 1 333 ? 123.468 -6.166  89.549  1.00 14.88 ? 420  THR A OG1   1 
ATOM   2477 C  CG2   . THR A 1 333 ? 124.783 -8.187  89.444  1.00 15.49 ? 420  THR A CG2   1 
ATOM   2478 N  N     . LYS A 1 334 ? 127.182 -6.485  87.008  1.00 16.97 ? 421  LYS A N     1 
ATOM   2479 C  CA    . LYS A 1 334 ? 128.247 -7.169  86.290  1.00 17.48 ? 421  LYS A CA    1 
ATOM   2480 C  C     . LYS A 1 334 ? 129.502 -6.319  86.110  1.00 16.34 ? 421  LYS A C     1 
ATOM   2481 O  O     . LYS A 1 334 ? 130.382 -6.674  85.324  1.00 18.78 ? 421  LYS A O     1 
ATOM   2482 C  CB    . LYS A 1 334 ? 127.730 -7.677  84.928  1.00 20.06 ? 421  LYS A CB    1 
ATOM   2483 C  CG    . LYS A 1 334 ? 126.444 -8.483  85.037  1.00 23.25 ? 421  LYS A CG    1 
ATOM   2484 C  CD    . LYS A 1 334 ? 126.173 -9.345  83.807  1.00 27.32 ? 421  LYS A CD    1 
ATOM   2485 C  CE    . LYS A 1 334 ? 125.808 -8.529  82.571  1.00 30.33 ? 421  LYS A CE    1 
ATOM   2486 N  NZ    . LYS A 1 334 ? 125.865 -9.376  81.337  1.00 33.81 ? 421  LYS A NZ    1 
ATOM   2487 N  N     . LEU A 1 335 ? 129.593 -5.213  86.855  1.00 14.28 ? 422  LEU A N     1 
ATOM   2488 C  CA    . LEU A 1 335 ? 130.715 -4.296  86.743  1.00 12.50 ? 422  LEU A CA    1 
ATOM   2489 C  C     . LEU A 1 335 ? 131.559 -4.303  88.022  1.00 12.41 ? 422  LEU A C     1 
ATOM   2490 O  O     . LEU A 1 335 ? 131.166 -3.715  89.029  1.00 12.56 ? 422  LEU A O     1 
ATOM   2491 C  CB    . LEU A 1 335 ? 130.222 -2.869  86.449  1.00 13.46 ? 422  LEU A CB    1 
ATOM   2492 C  CG    . LEU A 1 335 ? 131.338 -1.824  86.302  1.00 13.77 ? 422  LEU A CG    1 
ATOM   2493 C  CD1   . LEU A 1 335 ? 132.400 -2.235  85.280  1.00 15.48 ? 422  LEU A CD1   1 
ATOM   2494 C  CD2   . LEU A 1 335 ? 130.824 -0.420  86.016  1.00 15.19 ? 422  LEU A CD2   1 
ATOM   2495 N  N     . THR A 1 336 ? 132.702 -4.973  87.954  1.00 13.12 ? 423  THR A N     1 
ATOM   2496 C  CA    . THR A 1 336 ? 133.546 -5.221  89.136  1.00 12.98 ? 423  THR A CA    1 
ATOM   2497 C  C     . THR A 1 336 ? 135.016 -5.070  88.755  1.00 13.15 ? 423  THR A C     1 
ATOM   2498 O  O     . THR A 1 336 ? 135.320 -4.568  87.671  1.00 12.82 ? 423  THR A O     1 
ATOM   2499 C  CB    . THR A 1 336 ? 133.306 -6.642  89.675  1.00 12.94 ? 423  THR A CB    1 
ATOM   2500 O  OG1   . THR A 1 336 ? 133.683 -7.599  88.678  1.00 11.87 ? 423  THR A OG1   1 
ATOM   2501 C  CG2   . THR A 1 336 ? 131.868 -6.830  90.063  1.00 12.78 ? 423  THR A CG2   1 
ATOM   2502 N  N     . ASP A 1 337 ? 135.948 -5.507  89.618  1.00 12.85 ? 424  ASP A N     1 
ATOM   2503 C  CA    . ASP A 1 337 ? 137.367 -5.396  89.266  1.00 12.43 ? 424  ASP A CA    1 
ATOM   2504 C  C     . ASP A 1 337 ? 137.726 -6.198  88.019  1.00 13.17 ? 424  ASP A C     1 
ATOM   2505 O  O     . ASP A 1 337 ? 138.796 -5.999  87.445  1.00 13.32 ? 424  ASP A O     1 
ATOM   2506 C  CB    . ASP A 1 337 ? 138.313 -5.808  90.408  1.00 12.67 ? 424  ASP A CB    1 
ATOM   2507 C  CG    . ASP A 1 337 ? 138.224 -4.889  91.615  1.00 12.59 ? 424  ASP A CG    1 
ATOM   2508 O  OD1   . ASP A 1 337 ? 137.393 -3.937  91.632  1.00 10.76 ? 424  ASP A OD1   1 
ATOM   2509 O  OD2   . ASP A 1 337 ? 138.982 -5.155  92.569  1.00 12.88 ? 424  ASP A OD2   1 
ATOM   2510 N  N     . ASN A 1 338 ? 136.844 -7.110  87.622  1.00 13.92 ? 425  ASN A N     1 
ATOM   2511 C  CA    . ASN A 1 338 ? 137.039 -7.916  86.401  1.00 15.38 ? 425  ASN A CA    1 
ATOM   2512 C  C     . ASN A 1 338 ? 137.324 -7.058  85.159  1.00 15.09 ? 425  ASN A C     1 
ATOM   2513 O  O     . ASN A 1 338 ? 138.063 -7.482  84.276  1.00 13.78 ? 425  ASN A O     1 
ATOM   2514 C  CB    . ASN A 1 338 ? 135.830 -8.843  86.162  1.00 17.02 ? 425  ASN A CB    1 
ATOM   2515 C  CG    . ASN A 1 338 ? 135.592 -9.155  84.683  1.00 20.29 ? 425  ASN A CG    1 
ATOM   2516 O  OD1   . ASN A 1 338 ? 136.195 -10.066 84.124  1.00 22.69 ? 425  ASN A OD1   1 
ATOM   2517 N  ND2   . ASN A 1 338 ? 134.697 -8.394  84.049  1.00 22.39 ? 425  ASN A ND2   1 
ATOM   2518 N  N     . ILE A 1 339 ? 136.764 -5.850  85.117  1.00 15.04 ? 426  ILE A N     1 
ATOM   2519 C  CA    . ILE A 1 339 ? 137.013 -4.935  83.984  1.00 15.81 ? 426  ILE A CA    1 
ATOM   2520 C  C     . ILE A 1 339 ? 138.514 -4.679  83.745  1.00 14.62 ? 426  ILE A C     1 
ATOM   2521 O  O     . ILE A 1 339 ? 138.957 -4.604  82.610  1.00 14.59 ? 426  ILE A O     1 
ATOM   2522 C  CB    . ILE A 1 339 ? 136.158 -3.635  84.075  1.00 16.76 ? 426  ILE A CB    1 
ATOM   2523 C  CG1   . ILE A 1 339 ? 136.125 -2.909  82.733  1.00 18.84 ? 426  ILE A CG1   1 
ATOM   2524 C  CG2   . ILE A 1 339 ? 136.642 -2.702  85.168  1.00 17.50 ? 426  ILE A CG2   1 
ATOM   2525 C  CD1   . ILE A 1 339 ? 135.323 -3.664  81.696  1.00 20.91 ? 426  ILE A CD1   1 
ATOM   2526 N  N     . PHE A 1 340 ? 139.305 -4.572  84.820  1.00 13.18 ? 427  PHE A N     1 
ATOM   2527 C  CA    . PHE A 1 340 ? 140.755 -4.429  84.689  1.00 12.30 ? 427  PHE A CA    1 
ATOM   2528 C  C     . PHE A 1 340 ? 141.338 -5.588  83.867  1.00 12.11 ? 427  PHE A C     1 
ATOM   2529 O  O     . PHE A 1 340 ? 142.127 -5.366  82.944  1.00 11.85 ? 427  PHE A O     1 
ATOM   2530 C  CB    . PHE A 1 340 ? 141.389 -4.345  86.096  1.00 11.45 ? 427  PHE A CB    1 
ATOM   2531 C  CG    . PHE A 1 340 ? 142.887 -4.290  86.119  1.00 11.09 ? 427  PHE A CG    1 
ATOM   2532 C  CD1   . PHE A 1 340 ? 143.649 -5.447  85.964  1.00 11.64 ? 427  PHE A CD1   1 
ATOM   2533 C  CD2   . PHE A 1 340 ? 143.555 -3.082  86.387  1.00 9.89  ? 427  PHE A CD2   1 
ATOM   2534 C  CE1   . PHE A 1 340 ? 145.034 -5.399  86.025  1.00 11.06 ? 427  PHE A CE1   1 
ATOM   2535 C  CE2   . PHE A 1 340 ? 144.929 -3.033  86.460  1.00 11.27 ? 427  PHE A CE2   1 
ATOM   2536 C  CZ    . PHE A 1 340 ? 145.679 -4.190  86.287  1.00 11.10 ? 427  PHE A CZ    1 
ATOM   2537 N  N     . LEU A 1 341 ? 140.969 -6.827  84.189  1.00 11.37 ? 428  LEU A N     1 
ATOM   2538 C  CA    . LEU A 1 341 ? 141.538 -7.968  83.466  1.00 11.92 ? 428  LEU A CA    1 
ATOM   2539 C  C     . LEU A 1 341 ? 140.925 -8.122  82.050  1.00 13.06 ? 428  LEU A C     1 
ATOM   2540 O  O     . LEU A 1 341 ? 141.616 -8.542  81.118  1.00 13.38 ? 428  LEU A O     1 
ATOM   2541 C  CB    . LEU A 1 341 ? 141.393 -9.266  84.278  1.00 12.99 ? 428  LEU A CB    1 
ATOM   2542 C  CG    . LEU A 1 341 ? 142.250 -9.293  85.559  1.00 13.60 ? 428  LEU A CG    1 
ATOM   2543 C  CD1   . LEU A 1 341 ? 142.011 -10.576 86.339  1.00 14.68 ? 428  LEU A CD1   1 
ATOM   2544 C  CD2   . LEU A 1 341 ? 143.727 -9.164  85.239  1.00 12.50 ? 428  LEU A CD2   1 
ATOM   2545 N  N     . GLU A 1 342 ? 139.643 -7.780  81.903  1.00 13.74 ? 429  GLU A N     1 
ATOM   2546 C  CA    . GLU A 1 342 ? 139.020 -7.747  80.560  1.00 15.52 ? 429  GLU A CA    1 
ATOM   2547 C  C     . GLU A 1 342 ? 139.843 -6.840  79.630  1.00 16.81 ? 429  GLU A C     1 
ATOM   2548 O  O     . GLU A 1 342 ? 140.129 -7.207  78.489  1.00 16.65 ? 429  GLU A O     1 
ATOM   2549 C  CB    . GLU A 1 342 ? 137.558 -7.292  80.623  1.00 18.99 ? 429  GLU A CB    1 
ATOM   2550 C  CG    . GLU A 1 342 ? 136.875 -7.268  79.254  1.00 23.62 ? 429  GLU A CG    1 
ATOM   2551 C  CD    . GLU A 1 342 ? 135.390 -6.950  79.300  1.00 26.71 ? 429  GLU A CD    1 
ATOM   2552 O  OE1   . GLU A 1 342 ? 134.836 -6.736  80.401  1.00 29.67 ? 429  GLU A OE1   1 
ATOM   2553 O  OE2   . GLU A 1 342 ? 134.767 -6.918  78.214  1.00 29.92 ? 429  GLU A OE2   1 
ATOM   2554 N  N     . ILE A 1 343 ? 140.239 -5.668  80.125  1.00 15.52 ? 430  ILE A N     1 
ATOM   2555 C  CA    . ILE A 1 343 ? 141.082 -4.755  79.345  1.00 15.64 ? 430  ILE A CA    1 
ATOM   2556 C  C     . ILE A 1 343 ? 142.472 -5.358  79.133  1.00 16.27 ? 430  ILE A C     1 
ATOM   2557 O  O     . ILE A 1 343 ? 142.962 -5.404  78.009  1.00 15.35 ? 430  ILE A O     1 
ATOM   2558 C  CB    . ILE A 1 343 ? 141.125 -3.334  79.972  1.00 15.18 ? 430  ILE A CB    1 
ATOM   2559 C  CG1   . ILE A 1 343 ? 139.716 -2.727  79.993  1.00 15.36 ? 430  ILE A CG1   1 
ATOM   2560 C  CG2   . ILE A 1 343 ? 142.120 -2.435  79.252  1.00 16.06 ? 430  ILE A CG2   1 
ATOM   2561 C  CD1   . ILE A 1 343 ? 139.571 -1.519  80.906  1.00 15.16 ? 430  ILE A CD1   1 
ATOM   2562 N  N     . LEU A 1 344 ? 143.085 -5.865  80.204  1.00 16.26 ? 431  LEU A N     1 
ATOM   2563 C  CA    . LEU A 1 344 ? 144.442 -6.395  80.128  1.00 15.43 ? 431  LEU A CA    1 
ATOM   2564 C  C     . LEU A 1 344 ? 144.541 -7.565  79.154  1.00 15.97 ? 431  LEU A C     1 
ATOM   2565 O  O     . LEU A 1 344 ? 145.536 -7.704  78.445  1.00 17.23 ? 431  LEU A O     1 
ATOM   2566 C  CB    . LEU A 1 344 ? 144.938 -6.826  81.523  1.00 14.92 ? 431  LEU A CB    1 
ATOM   2567 C  CG    . LEU A 1 344 ? 146.335 -7.441  81.651  1.00 16.27 ? 431  LEU A CG    1 
ATOM   2568 C  CD1   . LEU A 1 344 ? 147.416 -6.456  81.207  1.00 16.78 ? 431  LEU A CD1   1 
ATOM   2569 C  CD2   . LEU A 1 344 ? 146.574 -7.912  83.082  1.00 15.44 ? 431  LEU A CD2   1 
ATOM   2570 N  N     . TYR A 1 345 ? 143.506 -8.394  79.115  1.00 15.40 ? 432  TYR A N     1 
ATOM   2571 C  CA    . TYR A 1 345 ? 143.570 -9.615  78.319  1.00 16.91 ? 432  TYR A CA    1 
ATOM   2572 C  C     . TYR A 1 345 ? 143.044 -9.421  76.897  1.00 19.28 ? 432  TYR A C     1 
ATOM   2573 O  O     . TYR A 1 345 ? 143.133 -10.340 76.086  1.00 20.55 ? 432  TYR A O     1 
ATOM   2574 C  CB    . TYR A 1 345 ? 142.807 -10.757 79.002  1.00 15.64 ? 432  TYR A CB    1 
ATOM   2575 C  CG    . TYR A 1 345 ? 143.368 -11.213 80.355  1.00 14.50 ? 432  TYR A CG    1 
ATOM   2576 C  CD1   . TYR A 1 345 ? 144.698 -10.976 80.721  1.00 13.92 ? 432  TYR A CD1   1 
ATOM   2577 C  CD2   . TYR A 1 345 ? 142.558 -11.914 81.247  1.00 14.29 ? 432  TYR A CD2   1 
ATOM   2578 C  CE1   . TYR A 1 345 ? 145.191 -11.411 81.959  1.00 14.29 ? 432  TYR A CE1   1 
ATOM   2579 C  CE2   . TYR A 1 345 ? 143.039 -12.353 82.479  1.00 14.47 ? 432  TYR A CE2   1 
ATOM   2580 C  CZ    . TYR A 1 345 ? 144.349 -12.119 82.823  1.00 13.53 ? 432  TYR A CZ    1 
ATOM   2581 O  OH    . TYR A 1 345 ? 144.799 -12.560 84.067  1.00 14.43 ? 432  TYR A OH    1 
ATOM   2582 N  N     . SER A 1 346 ? 142.489 -8.241  76.609  1.00 19.92 ? 433  SER A N     1 
ATOM   2583 C  CA    . SER A 1 346 ? 141.830 -7.956  75.317  1.00 20.29 ? 433  SER A CA    1 
ATOM   2584 C  C     . SER A 1 346 ? 142.782 -8.028  74.121  1.00 20.97 ? 433  SER A C     1 
ATOM   2585 O  O     . SER A 1 346 ? 143.990 -7.888  74.266  1.00 19.57 ? 433  SER A O     1 
ATOM   2586 C  CB    . SER A 1 346 ? 141.176 -6.571  75.359  1.00 19.77 ? 433  SER A CB    1 
ATOM   2587 O  OG    . SER A 1 346 ? 142.176 -5.567  75.483  1.00 21.04 ? 433  SER A OG    1 
ATOM   2588 N  N     . THR A 1 347 ? 142.224 -8.254  72.934  1.00 23.49 ? 434  THR A N     1 
ATOM   2589 C  CA    . THR A 1 347 ? 143.014 -8.206  71.692  1.00 25.12 ? 434  THR A CA    1 
ATOM   2590 C  C     . THR A 1 347 ? 142.483 -7.155  70.722  1.00 26.91 ? 434  THR A C     1 
ATOM   2591 O  O     . THR A 1 347 ? 143.158 -6.811  69.744  1.00 29.14 ? 434  THR A O     1 
ATOM   2592 C  CB    . THR A 1 347 ? 143.044 -9.570  70.978  1.00 25.67 ? 434  THR A CB    1 
ATOM   2593 O  OG1   . THR A 1 347 ? 141.735 -10.148 71.029  1.00 25.44 ? 434  THR A OG1   1 
ATOM   2594 C  CG2   . THR A 1 347 ? 144.049 -10.508 71.643  1.00 26.42 ? 434  THR A CG2   1 
ATOM   2595 N  N     . ASP A 1 348 ? 141.266 -6.675  70.989  1.00 27.15 ? 435  ASP A N     1 
ATOM   2596 C  CA    . ASP A 1 348 ? 140.640 -5.594  70.215  1.00 28.24 ? 435  ASP A CA    1 
ATOM   2597 C  C     . ASP A 1 348 ? 141.600 -4.417  70.020  1.00 27.21 ? 435  ASP A C     1 
ATOM   2598 O  O     . ASP A 1 348 ? 142.075 -3.828  70.999  1.00 25.51 ? 435  ASP A O     1 
ATOM   2599 C  CB    . ASP A 1 348 ? 139.374 -5.114  70.928  1.00 29.77 ? 435  ASP A CB    1 
ATOM   2600 C  CG    . ASP A 1 348 ? 138.421 -4.363  70.011  1.00 32.55 ? 435  ASP A CG    1 
ATOM   2601 O  OD1   . ASP A 1 348 ? 138.876 -3.681  69.063  1.00 31.85 ? 435  ASP A OD1   1 
ATOM   2602 O  OD2   . ASP A 1 348 ? 137.198 -4.448  70.257  1.00 33.99 ? 435  ASP A OD2   1 
ATOM   2603 N  N     . PRO A 1 349 ? 141.902 -4.070  68.752  1.00 26.04 ? 436  PRO A N     1 
ATOM   2604 C  CA    . PRO A 1 349 ? 142.778 -2.917  68.519  1.00 24.98 ? 436  PRO A CA    1 
ATOM   2605 C  C     . PRO A 1 349 ? 142.209 -1.602  69.067  1.00 22.64 ? 436  PRO A C     1 
ATOM   2606 O  O     . PRO A 1 349 ? 142.983 -0.705  69.378  1.00 24.69 ? 436  PRO A O     1 
ATOM   2607 C  CB    . PRO A 1 349 ? 142.911 -2.869  66.982  1.00 26.80 ? 436  PRO A CB    1 
ATOM   2608 C  CG    . PRO A 1 349 ? 141.796 -3.715  66.460  1.00 26.72 ? 436  PRO A CG    1 
ATOM   2609 C  CD    . PRO A 1 349 ? 141.583 -4.778  67.496  1.00 27.30 ? 436  PRO A CD    1 
ATOM   2610 N  N     . LYS A 1 350 ? 140.883 -1.495  69.189  1.00 22.04 ? 437  LYS A N     1 
ATOM   2611 C  CA    . LYS A 1 350 ? 140.257 -0.317  69.799  1.00 22.73 ? 437  LYS A CA    1 
ATOM   2612 C  C     . LYS A 1 350 ? 140.619 -0.178  71.279  1.00 23.52 ? 437  LYS A C     1 
ATOM   2613 O  O     . LYS A 1 350 ? 140.516 0.915   71.841  1.00 23.00 ? 437  LYS A O     1 
ATOM   2614 C  CB    . LYS A 1 350 ? 138.736 -0.357  69.659  1.00 24.38 ? 437  LYS A CB    1 
ATOM   2615 C  CG    . LYS A 1 350 ? 138.224 -0.359  68.216  1.00 25.58 ? 437  LYS A CG    1 
ATOM   2616 C  CD    . LYS A 1 350 ? 136.742 -0.021  68.186  1.00 28.43 ? 437  LYS A CD    1 
ATOM   2617 C  CE    . LYS A 1 350 ? 136.257 0.291   66.779  1.00 30.98 ? 437  LYS A CE    1 
ATOM   2618 N  NZ    . LYS A 1 350 ? 135.010 1.111   66.796  1.00 34.09 ? 437  LYS A NZ    1 
ATOM   2619 N  N     . LEU A 1 351 ? 141.025 -1.289  71.897  1.00 23.36 ? 438  LEU A N     1 
ATOM   2620 C  CA    . LEU A 1 351 ? 141.375 -1.303  73.327  1.00 21.82 ? 438  LEU A CA    1 
ATOM   2621 C  C     . LEU A 1 351 ? 142.869 -1.214  73.575  1.00 22.42 ? 438  LEU A C     1 
ATOM   2622 O  O     . LEU A 1 351 ? 143.319 -1.239  74.729  1.00 22.03 ? 438  LEU A O     1 
ATOM   2623 C  CB    . LEU A 1 351 ? 140.788 -2.539  74.029  1.00 20.73 ? 438  LEU A CB    1 
ATOM   2624 C  CG    . LEU A 1 351 ? 139.280 -2.508  74.321  1.00 19.55 ? 438  LEU A CG    1 
ATOM   2625 C  CD1   . LEU A 1 351 ? 138.818 -3.826  74.913  1.00 19.37 ? 438  LEU A CD1   1 
ATOM   2626 C  CD2   . LEU A 1 351 ? 138.915 -1.354  75.243  1.00 19.82 ? 438  LEU A CD2   1 
ATOM   2627 N  N     . LYS A 1 352 ? 143.644 -1.069  72.506  1.00 21.60 ? 439  LYS A N     1 
ATOM   2628 C  CA    . LYS A 1 352 ? 145.096 -1.076  72.624  1.00 22.51 ? 439  LYS A CA    1 
ATOM   2629 C  C     . LYS A 1 352 ? 145.638 0.021   73.542  1.00 22.11 ? 439  LYS A C     1 
ATOM   2630 O  O     . LYS A 1 352 ? 146.559 -0.240  74.326  1.00 21.55 ? 439  LYS A O     1 
ATOM   2631 C  CB    . LYS A 1 352 ? 145.779 -1.003  71.250  1.00 26.23 ? 439  LYS A CB    1 
ATOM   2632 C  CG    . LYS A 1 352 ? 147.284 -1.241  71.303  1.00 29.77 ? 439  LYS A CG    1 
ATOM   2633 C  CD    . LYS A 1 352 ? 147.899 -1.261  69.902  1.00 33.39 ? 439  LYS A CD    1 
ATOM   2634 C  CE    . LYS A 1 352 ? 149.377 -1.624  69.959  1.00 36.14 ? 439  LYS A CE    1 
ATOM   2635 N  NZ    . LYS A 1 352 ? 149.582 -3.132  70.037  1.00 38.93 ? 439  LYS A NZ    1 
ATOM   2636 N  N     . ASP A 1 353 ? 145.090 1.235   73.445  1.00 20.98 ? 440  ASP A N     1 
ATOM   2637 C  CA    . ASP A 1 353 ? 145.588 2.358   74.261  1.00 22.71 ? 440  ASP A CA    1 
ATOM   2638 C  C     . ASP A 1 353 ? 145.344 2.084   75.745  1.00 20.98 ? 440  ASP A C     1 
ATOM   2639 O  O     . ASP A 1 353 ? 146.233 2.308   76.574  1.00 21.33 ? 440  ASP A O     1 
ATOM   2640 C  CB    . ASP A 1 353 ? 144.937 3.691   73.872  1.00 25.99 ? 440  ASP A CB    1 
ATOM   2641 C  CG    . ASP A 1 353 ? 145.277 4.126   72.454  1.00 30.03 ? 440  ASP A CG    1 
ATOM   2642 O  OD1   . ASP A 1 353 ? 146.441 3.941   72.018  1.00 31.82 ? 440  ASP A OD1   1 
ATOM   2643 O  OD2   . ASP A 1 353 ? 144.366 4.659   71.780  1.00 33.77 ? 440  ASP A OD2   1 
ATOM   2644 N  N     . ALA A 1 354 ? 144.147 1.597   76.063  1.00 18.87 ? 441  ALA A N     1 
ATOM   2645 C  CA    . ALA A 1 354 ? 143.791 1.239   77.445  1.00 18.93 ? 441  ALA A CA    1 
ATOM   2646 C  C     . ALA A 1 354 ? 144.693 0.109   77.937  1.00 19.42 ? 441  ALA A C     1 
ATOM   2647 O  O     . ALA A 1 354 ? 145.284 0.178   79.032  1.00 18.15 ? 441  ALA A O     1 
ATOM   2648 C  CB    . ALA A 1 354 ? 142.338 0.815   77.504  1.00 19.19 ? 441  ALA A CB    1 
ATOM   2649 N  N     . ARG A 1 355 ? 144.804 -0.926  77.107  1.00 18.05 ? 442  ARG A N     1 
ATOM   2650 C  CA    . ARG A 1 355 ? 145.610 -2.102  77.407  1.00 17.92 ? 442  ARG A CA    1 
ATOM   2651 C  C     . ARG A 1 355 ? 147.062 -1.748  77.676  1.00 18.90 ? 442  ARG A C     1 
ATOM   2652 O  O     . ARG A 1 355 ? 147.678 -2.306  78.582  1.00 19.11 ? 442  ARG A O     1 
ATOM   2653 C  CB    . ARG A 1 355 ? 145.485 -3.095  76.243  1.00 18.97 ? 442  ARG A CB    1 
ATOM   2654 C  CG    . ARG A 1 355 ? 146.238 -4.406  76.372  1.00 20.72 ? 442  ARG A CG    1 
ATOM   2655 C  CD    . ARG A 1 355 ? 145.686 -5.420  75.366  1.00 22.74 ? 442  ARG A CD    1 
ATOM   2656 N  NE    . ARG A 1 355 ? 145.996 -5.076  73.972  1.00 23.60 ? 442  ARG A NE    1 
ATOM   2657 C  CZ    . ARG A 1 355 ? 145.094 -4.781  73.032  1.00 24.24 ? 442  ARG A CZ    1 
ATOM   2658 N  NH1   . ARG A 1 355 ? 143.789 -4.787  73.294  1.00 22.03 ? 442  ARG A NH1   1 
ATOM   2659 N  NH2   . ARG A 1 355 ? 145.507 -4.486  71.802  1.00 25.72 ? 442  ARG A NH2   1 
ATOM   2660 N  N     . GLU A 1 356 ? 147.617 -0.822  76.891  1.00 17.26 ? 443  GLU A N     1 
ATOM   2661 C  CA    . GLU A 1 356 ? 149.008 -0.412  77.066  1.00 18.13 ? 443  GLU A CA    1 
ATOM   2662 C  C     . GLU A 1 356 ? 149.279 0.205   78.443  1.00 16.75 ? 443  GLU A C     1 
ATOM   2663 O  O     . GLU A 1 356 ? 150.349 0.017   79.007  1.00 17.35 ? 443  GLU A O     1 
ATOM   2664 C  CB    . GLU A 1 356 ? 149.428 0.582   75.969  1.00 21.90 ? 443  GLU A CB    1 
ATOM   2665 C  CG    . GLU A 1 356 ? 149.540 -0.047  74.593  1.00 27.24 ? 443  GLU A CG    1 
ATOM   2666 C  CD    . GLU A 1 356 ? 150.458 -1.254  74.574  1.00 30.65 ? 443  GLU A CD    1 
ATOM   2667 O  OE1   . GLU A 1 356 ? 151.591 -1.152  75.099  1.00 35.27 ? 443  GLU A OE1   1 
ATOM   2668 O  OE2   . GLU A 1 356 ? 150.044 -2.303  74.033  1.00 34.81 ? 443  GLU A OE2   1 
ATOM   2669 N  N     . ILE A 1 357 ? 148.317 0.963   78.953  1.00 15.85 ? 444  ILE A N     1 
ATOM   2670 C  CA    . ILE A 1 357 ? 148.464 1.600   80.258  1.00 15.25 ? 444  ILE A CA    1 
ATOM   2671 C  C     . ILE A 1 357 ? 148.510 0.523   81.349  1.00 15.66 ? 444  ILE A C     1 
ATOM   2672 O  O     . ILE A 1 357 ? 149.377 0.557   82.236  1.00 15.41 ? 444  ILE A O     1 
ATOM   2673 C  CB    . ILE A 1 357 ? 147.334 2.595   80.523  1.00 17.21 ? 444  ILE A CB    1 
ATOM   2674 C  CG1   . ILE A 1 357 ? 147.370 3.713   79.465  1.00 19.25 ? 444  ILE A CG1   1 
ATOM   2675 C  CG2   . ILE A 1 357 ? 147.469 3.191   81.924  1.00 16.99 ? 444  ILE A CG2   1 
ATOM   2676 C  CD1   . ILE A 1 357 ? 146.256 4.731   79.618  1.00 21.32 ? 444  ILE A CD1   1 
ATOM   2677 N  N     . LEU A 1 358 ? 147.615 -0.458  81.253  1.00 15.20 ? 445  LEU A N     1 
ATOM   2678 C  CA    . LEU A 1 358 ? 147.619 -1.549  82.237  1.00 15.58 ? 445  LEU A CA    1 
ATOM   2679 C  C     . LEU A 1 358 ? 148.888 -2.376  82.137  1.00 16.07 ? 445  LEU A C     1 
ATOM   2680 O  O     . LEU A 1 358 ? 149.424 -2.819  83.147  1.00 15.97 ? 445  LEU A O     1 
ATOM   2681 C  CB    . LEU A 1 358 ? 146.383 -2.431  82.120  1.00 14.62 ? 445  LEU A CB    1 
ATOM   2682 C  CG    . LEU A 1 358 ? 145.052 -1.715  82.345  1.00 14.47 ? 445  LEU A CG    1 
ATOM   2683 C  CD1   . LEU A 1 358 ? 143.931 -2.729  82.467  1.00 14.25 ? 445  LEU A CD1   1 
ATOM   2684 C  CD2   . LEU A 1 358 ? 145.073 -0.778  83.548  1.00 13.51 ? 445  LEU A CD2   1 
ATOM   2685 N  N     . LYS A 1 359 ? 149.391 -2.567  80.918  1.00 16.36 ? 446  LYS A N     1 
ATOM   2686 C  CA    . LYS A 1 359 ? 150.639 -3.285  80.732  1.00 18.04 ? 446  LYS A CA    1 
ATOM   2687 C  C     . LYS A 1 359 ? 151.808 -2.528  81.367  1.00 17.83 ? 446  LYS A C     1 
ATOM   2688 O  O     . LYS A 1 359 ? 152.747 -3.133  81.896  1.00 17.19 ? 446  LYS A O     1 
ATOM   2689 C  CB    . LYS A 1 359 ? 150.882 -3.549  79.245  1.00 19.20 ? 446  LYS A CB    1 
ATOM   2690 C  CG    . LYS A 1 359 ? 150.061 -4.710  78.699  1.00 22.76 ? 446  LYS A CG    1 
ATOM   2691 C  CD    . LYS A 1 359 ? 150.119 -4.812  77.169  1.00 26.42 ? 446  LYS A CD    1 
ATOM   2692 C  CE    . LYS A 1 359 ? 151.486 -5.269  76.644  1.00 28.66 ? 446  LYS A CE    1 
ATOM   2693 N  NZ    . LYS A 1 359 ? 152.453 -4.131  76.475  1.00 31.75 ? 446  LYS A NZ    1 
ATOM   2694 N  N     . GLN A 1 360 ? 151.748 -1.203  81.341  1.00 18.20 ? 447  GLN A N     1 
ATOM   2695 C  CA    . GLN A 1 360 ? 152.791 -0.418  81.976  1.00 18.42 ? 447  GLN A CA    1 
ATOM   2696 C  C     . GLN A 1 360 ? 152.753 -0.606  83.495  1.00 17.48 ? 447  GLN A C     1 
ATOM   2697 O  O     . GLN A 1 360 ? 153.793 -0.667  84.123  1.00 17.89 ? 447  GLN A O     1 
ATOM   2698 C  CB    . GLN A 1 360 ? 152.708 1.067   81.602  1.00 21.48 ? 447  GLN A CB    1 
ATOM   2699 C  CG    . GLN A 1 360 ? 153.028 1.372   80.129  1.00 24.74 ? 447  GLN A CG    1 
ATOM   2700 C  CD    . GLN A 1 360 ? 153.912 0.331   79.450  1.00 27.62 ? 447  GLN A CD    1 
ATOM   2701 O  OE1   . GLN A 1 360 ? 155.091 0.160   79.791  1.00 30.03 ? 447  GLN A OE1   1 
ATOM   2702 N  NE2   . GLN A 1 360 ? 153.340 -0.374  78.472  1.00 30.47 ? 447  GLN A NE2   1 
ATOM   2703 N  N     . ILE A 1 361 ? 151.556 -0.723  84.067  1.00 15.63 ? 448  ILE A N     1 
ATOM   2704 C  CA    . ILE A 1 361 ? 151.450 -1.057  85.506  1.00 14.01 ? 448  ILE A CA    1 
ATOM   2705 C  C     . ILE A 1 361 ? 152.153 -2.389  85.805  1.00 13.88 ? 448  ILE A C     1 
ATOM   2706 O  O     . ILE A 1 361 ? 152.954 -2.472  86.736  1.00 13.52 ? 448  ILE A O     1 
ATOM   2707 C  CB    . ILE A 1 361 ? 149.988 -1.096  85.993  1.00 13.17 ? 448  ILE A CB    1 
ATOM   2708 C  CG1   . ILE A 1 361 ? 149.334 0.286   85.809  1.00 13.09 ? 448  ILE A CG1   1 
ATOM   2709 C  CG2   . ILE A 1 361 ? 149.903 -1.590  87.454  1.00 10.78 ? 448  ILE A CG2   1 
ATOM   2710 C  CD1   . ILE A 1 361 ? 147.842 0.306   86.105  1.00 12.83 ? 448  ILE A CD1   1 
ATOM   2711 N  N     . GLU A 1 362 ? 151.867 -3.423  85.015  1.00 15.09 ? 449  GLU A N     1 
ATOM   2712 C  CA    . GLU A 1 362 ? 152.465 -4.743  85.243  1.00 14.81 ? 449  GLU A CA    1 
ATOM   2713 C  C     . GLU A 1 362 ? 153.981 -4.755  85.227  1.00 14.79 ? 449  GLU A C     1 
ATOM   2714 O  O     . GLU A 1 362 ? 154.627 -5.447  86.013  1.00 14.21 ? 449  GLU A O     1 
ATOM   2715 C  CB    . GLU A 1 362 ? 151.971 -5.745  84.207  1.00 16.18 ? 449  GLU A CB    1 
ATOM   2716 C  CG    . GLU A 1 362 ? 150.510 -6.076  84.280  1.00 17.76 ? 449  GLU A CG    1 
ATOM   2717 C  CD    . GLU A 1 362 ? 150.281 -7.509  83.848  1.00 18.18 ? 449  GLU A CD    1 
ATOM   2718 O  OE1   . GLU A 1 362 ? 149.792 -8.303  84.686  1.00 16.32 ? 449  GLU A OE1   1 
ATOM   2719 O  OE2   . GLU A 1 362 ? 150.645 -7.838  82.690  1.00 17.02 ? 449  GLU A OE2   1 
ATOM   2720 N  N     . TYR A 1 363 ? 154.567 -3.999  84.306  1.00 14.05 ? 450  TYR A N     1 
ATOM   2721 C  CA    . TYR A 1 363 ? 156.006 -3.907  84.229  1.00 13.32 ? 450  TYR A CA    1 
ATOM   2722 C  C     . TYR A 1 363 ? 156.561 -2.899  85.212  1.00 12.96 ? 450  TYR A C     1 
ATOM   2723 O  O     . TYR A 1 363 ? 157.774 -2.731  85.307  1.00 12.10 ? 450  TYR A O     1 
ATOM   2724 C  CB    . TYR A 1 363 ? 156.427 -3.492  82.811  1.00 15.33 ? 450  TYR A CB    1 
ATOM   2725 C  CG    . TYR A 1 363 ? 156.335 -4.599  81.792  1.00 17.01 ? 450  TYR A CG    1 
ATOM   2726 C  CD1   . TYR A 1 363 ? 157.292 -5.608  81.744  1.00 16.61 ? 450  TYR A CD1   1 
ATOM   2727 C  CD2   . TYR A 1 363 ? 155.296 -4.626  80.869  1.00 19.28 ? 450  TYR A CD2   1 
ATOM   2728 C  CE1   . TYR A 1 363 ? 157.212 -6.631  80.801  1.00 19.05 ? 450  TYR A CE1   1 
ATOM   2729 C  CE2   . TYR A 1 363 ? 155.206 -5.629  79.924  1.00 20.71 ? 450  TYR A CE2   1 
ATOM   2730 C  CZ    . TYR A 1 363 ? 156.163 -6.628  79.893  1.00 20.70 ? 450  TYR A CZ    1 
ATOM   2731 O  OH    . TYR A 1 363 ? 156.051 -7.609  78.932  1.00 23.17 ? 450  TYR A OH    1 
ATOM   2732 N  N     . ARG A 1 364 ? 155.673 -2.236  85.955  1.00 12.66 ? 451  ARG A N     1 
ATOM   2733 C  CA    . ARG A 1 364 ? 156.054 -1.249  86.978  1.00 12.84 ? 451  ARG A CA    1 
ATOM   2734 C  C     . ARG A 1 364 ? 156.742 -0.029  86.350  1.00 15.01 ? 451  ARG A C     1 
ATOM   2735 O  O     . ARG A 1 364 ? 157.675 0.540   86.920  1.00 15.20 ? 451  ARG A O     1 
ATOM   2736 C  CB    . ARG A 1 364 ? 156.933 -1.879  88.083  1.00 13.34 ? 451  ARG A CB    1 
ATOM   2737 C  CG    . ARG A 1 364 ? 156.758 -1.249  89.470  1.00 12.19 ? 451  ARG A CG    1 
ATOM   2738 C  CD    . ARG A 1 364 ? 155.469 -1.732  90.123  1.00 11.74 ? 451  ARG A CD    1 
ATOM   2739 N  NE    . ARG A 1 364 ? 155.296 -1.204  91.484  1.00 10.39 ? 451  ARG A NE    1 
ATOM   2740 C  CZ    . ARG A 1 364 ? 154.283 -1.530  92.281  1.00 10.29 ? 451  ARG A CZ    1 
ATOM   2741 N  NH1   . ARG A 1 364 ? 153.357 -2.383  91.854  1.00 11.26 ? 451  ARG A NH1   1 
ATOM   2742 N  NH2   . ARG A 1 364 ? 154.203 -1.009  93.509  1.00 9.15  ? 451  ARG A NH2   1 
ATOM   2743 N  N     . ASN A 1 365 ? 156.276 0.330   85.160  1.00 16.03 ? 452  ASN A N     1 
ATOM   2744 C  CA    . ASN A 1 365 ? 156.676 1.558   84.487  1.00 17.01 ? 452  ASN A CA    1 
ATOM   2745 C  C     . ASN A 1 365 ? 155.646 2.628   84.843  1.00 16.45 ? 452  ASN A C     1 
ATOM   2746 O  O     . ASN A 1 365 ? 154.791 2.992   84.029  1.00 17.26 ? 452  ASN A O     1 
ATOM   2747 C  CB    . ASN A 1 365 ? 156.714 1.313   82.974  1.00 18.50 ? 452  ASN A CB    1 
ATOM   2748 C  CG    . ASN A 1 365 ? 157.149 2.539   82.190  1.00 23.07 ? 452  ASN A CG    1 
ATOM   2749 O  OD1   . ASN A 1 365 ? 157.946 3.351   82.665  1.00 26.53 ? 452  ASN A OD1   1 
ATOM   2750 N  ND2   . ASN A 1 365 ? 156.630 2.671   80.968  1.00 25.26 ? 452  ASN A ND2   1 
ATOM   2751 N  N     . LEU A 1 366 ? 155.691 3.104   86.087  1.00 15.23 ? 453  LEU A N     1 
ATOM   2752 C  CA    . LEU A 1 366 ? 154.680 4.038   86.567  1.00 13.74 ? 453  LEU A CA    1 
ATOM   2753 C  C     . LEU A 1 366 ? 155.125 5.480   86.365  1.00 14.97 ? 453  LEU A C     1 
ATOM   2754 O  O     . LEU A 1 366 ? 156.314 5.765   86.257  1.00 17.22 ? 453  LEU A O     1 
ATOM   2755 C  CB    . LEU A 1 366 ? 154.418 3.823   88.065  1.00 13.51 ? 453  LEU A CB    1 
ATOM   2756 C  CG    . LEU A 1 366 ? 154.289 2.361   88.498  1.00 13.02 ? 453  LEU A CG    1 
ATOM   2757 C  CD1   . LEU A 1 366 ? 154.188 2.268   90.023  1.00 11.99 ? 453  LEU A CD1   1 
ATOM   2758 C  CD2   . LEU A 1 366 ? 153.047 1.790   87.828  1.00 12.74 ? 453  LEU A CD2   1 
ATOM   2759 N  N     . PHE A 1 367 ? 154.160 6.385   86.369  1.00 17.05 ? 454  PHE A N     1 
ATOM   2760 C  CA    . PHE A 1 367 ? 154.483 7.807   86.403  1.00 19.39 ? 454  PHE A CA    1 
ATOM   2761 C  C     . PHE A 1 367 ? 155.370 8.089   87.613  1.00 20.56 ? 454  PHE A C     1 
ATOM   2762 O  O     . PHE A 1 367 ? 155.231 7.440   88.660  1.00 20.07 ? 454  PHE A O     1 
ATOM   2763 C  CB    . PHE A 1 367 ? 153.218 8.642   86.456  1.00 19.66 ? 454  PHE A CB    1 
ATOM   2764 C  CG    . PHE A 1 367 ? 152.264 8.371   85.327  1.00 20.88 ? 454  PHE A CG    1 
ATOM   2765 C  CD1   . PHE A 1 367 ? 152.717 7.845   84.123  1.00 21.26 ? 454  PHE A CD1   1 
ATOM   2766 C  CD2   . PHE A 1 367 ? 150.918 8.667   85.457  1.00 20.81 ? 454  PHE A CD2   1 
ATOM   2767 C  CE1   . PHE A 1 367 ? 151.837 7.602   83.080  1.00 22.40 ? 454  PHE A CE1   1 
ATOM   2768 C  CE2   . PHE A 1 367 ? 150.035 8.434   84.416  1.00 21.84 ? 454  PHE A CE2   1 
ATOM   2769 C  CZ    . PHE A 1 367 ? 150.495 7.903   83.223  1.00 22.55 ? 454  PHE A CZ    1 
ATOM   2770 N  N     . LYS A 1 368 ? 156.291 9.037   87.465  1.00 22.44 ? 455  LYS A N     1 
ATOM   2771 C  CA    . LYS A 1 368 ? 157.275 9.301   88.504  1.00 23.73 ? 455  LYS A CA    1 
ATOM   2772 C  C     . LYS A 1 368 ? 156.800 10.331  89.507  1.00 23.38 ? 455  LYS A C     1 
ATOM   2773 O  O     . LYS A 1 368 ? 156.306 11.391  89.138  1.00 21.82 ? 455  LYS A O     1 
ATOM   2774 C  CB    . LYS A 1 368 ? 158.625 9.717   87.899  1.00 27.01 ? 455  LYS A CB    1 
ATOM   2775 C  CG    . LYS A 1 368 ? 159.287 8.660   87.019  1.00 29.91 ? 455  LYS A CG    1 
ATOM   2776 C  CD    . LYS A 1 368 ? 159.252 7.286   87.668  1.00 32.02 ? 455  LYS A CD    1 
ATOM   2777 C  CE    . LYS A 1 368 ? 160.598 6.583   87.567  1.00 34.12 ? 455  LYS A CE    1 
ATOM   2778 N  NZ    . LYS A 1 368 ? 160.816 5.741   88.780  1.00 36.39 ? 455  LYS A NZ    1 
ATOM   2779 N  N     . TYR A 1 369 ? 156.938 10.000  90.786  1.00 20.65 ? 456  TYR A N     1 
ATOM   2780 C  CA    . TYR A 1 369 ? 156.664 10.939  91.861  1.00 22.00 ? 456  TYR A CA    1 
ATOM   2781 C  C     . TYR A 1 369 ? 157.720 12.037  91.849  1.00 22.49 ? 456  TYR A C     1 
ATOM   2782 O  O     . TYR A 1 369 ? 158.916 11.751  91.859  1.00 23.42 ? 456  TYR A O     1 
ATOM   2783 C  CB    . TYR A 1 369 ? 156.699 10.187  93.191  1.00 21.73 ? 456  TYR A CB    1 
ATOM   2784 C  CG    . TYR A 1 369 ? 156.507 11.019  94.435  1.00 20.87 ? 456  TYR A CG    1 
ATOM   2785 C  CD1   . TYR A 1 369 ? 155.292 11.659  94.696  1.00 20.37 ? 456  TYR A CD1   1 
ATOM   2786 C  CD2   . TYR A 1 369 ? 157.531 11.128  95.376  1.00 22.83 ? 456  TYR A CD2   1 
ATOM   2787 C  CE1   . TYR A 1 369 ? 155.112 12.399  95.859  1.00 22.64 ? 456  TYR A CE1   1 
ATOM   2788 C  CE2   . TYR A 1 369 ? 157.360 11.861  96.540  1.00 24.39 ? 456  TYR A CE2   1 
ATOM   2789 C  CZ    . TYR A 1 369 ? 156.148 12.480  96.778  1.00 23.71 ? 456  TYR A CZ    1 
ATOM   2790 O  OH    . TYR A 1 369 ? 155.993 13.197  97.927  1.00 26.63 ? 456  TYR A OH    1 
ATOM   2791 N  N     . VAL A 1 370 ? 157.270 13.286  91.806  1.00 22.88 ? 457  VAL A N     1 
ATOM   2792 C  CA    . VAL A 1 370 ? 158.182 14.431  91.837  1.00 23.32 ? 457  VAL A CA    1 
ATOM   2793 C  C     . VAL A 1 370 ? 158.235 15.015  93.244  1.00 23.82 ? 457  VAL A C     1 
ATOM   2794 O  O     . VAL A 1 370 ? 159.305 15.351  93.746  1.00 26.60 ? 457  VAL A O     1 
ATOM   2795 C  CB    . VAL A 1 370 ? 157.783 15.507  90.802  1.00 23.92 ? 457  VAL A CB    1 
ATOM   2796 C  CG1   . VAL A 1 370 ? 158.775 16.657  90.804  1.00 25.42 ? 457  VAL A CG1   1 
ATOM   2797 C  CG2   . VAL A 1 370 ? 157.702 14.891  89.410  1.00 24.42 ? 457  VAL A CG2   1 
ATOM   2798 N  N     . GLY A 1 371 ? 157.085 15.140  93.889  1.00 22.90 ? 458  GLY A N     1 
ATOM   2799 C  CA    . GLY A 1 371 ? 157.101 15.570  95.277  1.00 23.73 ? 458  GLY A CA    1 
ATOM   2800 C  C     . GLY A 1 371 ? 155.768 15.967  95.831  1.00 24.08 ? 458  GLY A C     1 
ATOM   2801 O  O     . GLY A 1 371 ? 154.740 15.804  95.182  1.00 22.55 ? 458  GLY A O     1 
ATOM   2802 N  N     . GLU A 1 372 ? 155.804 16.498  97.053  1.00 25.28 ? 459  GLU A N     1 
ATOM   2803 C  CA    . GLU A 1 372 ? 154.608 16.832  97.803  1.00 26.21 ? 459  GLU A CA    1 
ATOM   2804 C  C     . GLU A 1 372 ? 154.778 18.202  98.447  1.00 25.60 ? 459  GLU A C     1 
ATOM   2805 O  O     . GLU A 1 372 ? 155.879 18.561  98.860  1.00 26.57 ? 459  GLU A O     1 
ATOM   2806 C  CB    . GLU A 1 372 ? 154.375 15.775  98.889  1.00 28.90 ? 459  GLU A CB    1 
ATOM   2807 C  CG    . GLU A 1 372 ? 153.164 16.015  99.778  1.00 31.36 ? 459  GLU A CG    1 
ATOM   2808 C  CD    . GLU A 1 372 ? 152.904 14.857  100.721 1.00 34.07 ? 459  GLU A CD    1 
ATOM   2809 O  OE1   . GLU A 1 372 ? 153.881 14.329  101.296 1.00 36.65 ? 459  GLU A OE1   1 
ATOM   2810 O  OE2   . GLU A 1 372 ? 151.726 14.468  100.880 1.00 34.11 ? 459  GLU A OE2   1 
ATOM   2811 N  N     . THR A 1 373 ? 153.685 18.956  98.528  1.00 24.24 ? 460  THR A N     1 
ATOM   2812 C  CA    . THR A 1 373 ? 153.718 20.278  99.140  1.00 23.29 ? 460  THR A CA    1 
ATOM   2813 C  C     . THR A 1 373 ? 152.368 20.584  99.763  1.00 22.75 ? 460  THR A C     1 
ATOM   2814 O  O     . THR A 1 373 ? 151.409 19.828  99.592  1.00 21.90 ? 460  THR A O     1 
ATOM   2815 C  CB    . THR A 1 373 ? 154.120 21.378  98.120  1.00 23.87 ? 460  THR A CB    1 
ATOM   2816 O  OG1   . THR A 1 373 ? 154.375 22.609  98.814  1.00 24.76 ? 460  THR A OG1   1 
ATOM   2817 C  CG2   . THR A 1 373 ? 153.015 21.600  97.085  1.00 22.44 ? 460  THR A CG2   1 
ATOM   2818 N  N     . GLN A 1 374 ? 152.291 21.696  100.491 1.00 21.74 ? 461  GLN A N     1 
ATOM   2819 C  CA    . GLN A 1 374 ? 151.040 22.132  101.096 1.00 23.85 ? 461  GLN A CA    1 
ATOM   2820 C  C     . GLN A 1 374 ? 150.860 23.642  100.957 1.00 24.90 ? 461  GLN A C     1 
ATOM   2821 O  O     . GLN A 1 374 ? 151.845 24.374  100.951 1.00 24.66 ? 461  GLN A O     1 
ATOM   2822 C  CB    . GLN A 1 374 ? 151.037 21.801  102.584 1.00 24.32 ? 461  GLN A CB    1 
ATOM   2823 C  CG    . GLN A 1 374 ? 151.054 20.316  102.936 1.00 23.88 ? 461  GLN A CG    1 
ATOM   2824 C  CD    . GLN A 1 374 ? 150.684 20.119  104.386 1.00 24.91 ? 461  GLN A CD    1 
ATOM   2825 O  OE1   . GLN A 1 374 ? 151.554 19.991  105.230 1.00 26.04 ? 461  GLN A OE1   1 
ATOM   2826 N  NE2   . GLN A 1 374 ? 149.387 20.160  104.686 1.00 25.61 ? 461  GLN A NE2   1 
ATOM   2827 N  N     . PRO A 1 375 ? 149.601 24.109  100.881 1.00 27.91 ? 462  PRO A N     1 
ATOM   2828 C  CA    . PRO A 1 375 ? 149.372 25.554  100.946 1.00 31.98 ? 462  PRO A CA    1 
ATOM   2829 C  C     . PRO A 1 375 ? 149.803 26.103  102.309 1.00 35.21 ? 462  PRO A C     1 
ATOM   2830 O  O     . PRO A 1 375 ? 149.663 25.414  103.323 1.00 33.86 ? 462  PRO A O     1 
ATOM   2831 C  CB    . PRO A 1 375 ? 147.849 25.684  100.782 1.00 32.19 ? 462  PRO A CB    1 
ATOM   2832 C  CG    . PRO A 1 375 ? 147.378 24.366  100.257 1.00 31.61 ? 462  PRO A CG    1 
ATOM   2833 C  CD    . PRO A 1 375 ? 148.336 23.354  100.803 1.00 29.64 ? 462  PRO A CD    1 
ATOM   2834 N  N     . THR A 1 376 ? 150.341 27.321  102.322 1.00 40.12 ? 463  THR A N     1 
ATOM   2835 C  CA    . THR A 1 376 ? 150.692 28.003  103.571 1.00 44.17 ? 463  THR A CA    1 
ATOM   2836 C  C     . THR A 1 376 ? 149.582 28.993  103.943 1.00 47.56 ? 463  THR A C     1 
ATOM   2837 O  O     . THR A 1 376 ? 148.816 29.440  103.080 1.00 46.71 ? 463  THR A O     1 
ATOM   2838 C  CB    . THR A 1 376 ? 152.068 28.703  103.467 1.00 45.54 ? 463  THR A CB    1 
ATOM   2839 O  OG1   . THR A 1 376 ? 153.062 27.747  103.076 1.00 46.21 ? 463  THR A OG1   1 
ATOM   2840 C  CG2   . THR A 1 376 ? 152.493 29.323  104.797 1.00 46.92 ? 463  THR A CG2   1 
ATOM   2841 N  N     . GLY A 1 377 ? 149.491 29.308  105.235 1.00 51.28 ? 464  GLY A N     1 
ATOM   2842 C  CA    . GLY A 1 377 ? 148.476 30.220  105.732 1.00 55.16 ? 464  GLY A CA    1 
ATOM   2843 C  C     . GLY A 1 377 ? 147.125 29.542  105.829 1.00 58.32 ? 464  GLY A C     1 
ATOM   2844 O  O     . GLY A 1 377 ? 147.029 28.367  106.203 1.00 61.77 ? 464  GLY A O     1 
ATOM   2845 N  N     . GLN A 1 378 ? 146.081 30.300  105.480 1.00 60.09 ? 465  GLN A N     1 
ATOM   2846 C  CA    . GLN A 1 378 ? 144.706 29.783  105.570 1.00 61.22 ? 465  GLN A CA    1 
ATOM   2847 C  C     . GLN A 1 378 ? 144.116 29.596  104.174 1.00 61.09 ? 465  GLN A C     1 
ATOM   2848 O  O     . GLN A 1 378 ? 142.906 29.406  104.017 1.00 62.01 ? 465  GLN A O     1 
ATOM   2849 C  CB    . GLN A 1 378 ? 143.815 30.720  106.449 1.00 62.35 ? 465  GLN A CB    1 
ATOM   2850 C  CG    . GLN A 1 378 ? 143.562 30.256  107.903 1.00 63.37 ? 465  GLN A CG    1 
ATOM   2851 C  CD    . GLN A 1 378 ? 144.895 30.123  108.685 1.00 65.01 ? 465  GLN A CD    1 
ATOM   2852 O  OE1   . GLN A 1 378 ? 145.278 29.010  109.115 1.00 67.34 ? 465  GLN A OE1   1 
ATOM   2853 N  NE2   . GLN A 1 378 ? 145.642 31.260  108.874 1.00 66.23 ? 465  GLN A NE2   1 
ATOM   2854 N  N     . ILE A 1 379 ? 144.990 29.637  103.168 1.00 60.64 ? 466  ILE A N     1 
ATOM   2855 C  CA    . ILE A 1 379 ? 144.622 29.417  101.766 1.00 59.15 ? 466  ILE A CA    1 
ATOM   2856 C  C     . ILE A 1 379 ? 144.116 27.992  101.547 1.00 57.68 ? 466  ILE A C     1 
ATOM   2857 O  O     . ILE A 1 379 ? 144.787 27.020  101.914 1.00 58.02 ? 466  ILE A O     1 
ATOM   2858 C  CB    . ILE A 1 379 ? 145.828 29.665  100.828 1.00 59.38 ? 466  ILE A CB    1 
ATOM   2859 C  CG1   . ILE A 1 379 ? 146.232 31.147  100.845 1.00 59.59 ? 466  ILE A CG1   1 
ATOM   2860 C  CG2   . ILE A 1 379 ? 145.539 29.173  99.407  1.00 59.53 ? 466  ILE A CG2   1 
ATOM   2861 C  CD1   . ILE A 1 379 ? 147.663 31.411  100.406 1.00 59.29 ? 466  ILE A CD1   1 
ATOM   2862 N  N     . LYS A 1 380 ? 142.925 27.878  100.963 1.00 53.91 ? 467  LYS A N     1 
ATOM   2863 C  CA    . LYS A 1 380 ? 142.416 26.593  100.505 1.00 50.15 ? 467  LYS A CA    1 
ATOM   2864 C  C     . LYS A 1 380 ? 142.425 26.580  98.982  1.00 48.94 ? 467  LYS A C     1 
ATOM   2865 O  O     . LYS A 1 380 ? 142.100 27.584  98.346  1.00 49.63 ? 467  LYS A O     1 
ATOM   2866 C  CB    . LYS A 1 380 ? 141.000 26.335  101.034 1.00 50.64 ? 467  LYS A CB    1 
ATOM   2867 C  CG    . LYS A 1 380 ? 140.531 24.892  100.855 1.00 50.70 ? 467  LYS A CG    1 
ATOM   2868 C  CD    . LYS A 1 380 ? 139.194 24.633  101.535 1.00 50.88 ? 467  LYS A CD    1 
ATOM   2869 C  CE    . LYS A 1 380 ? 138.957 23.143  101.750 1.00 49.52 ? 467  LYS A CE    1 
ATOM   2870 N  NZ    . LYS A 1 380 ? 138.491 22.424  100.519 1.00 50.15 ? 467  LYS A NZ    1 
ATOM   2871 N  N     . ILE A 1 381 ? 142.825 25.449  98.406  1.00 44.16 ? 468  ILE A N     1 
ATOM   2872 C  CA    . ILE A 1 381 ? 142.712 25.240  96.968  1.00 40.69 ? 468  ILE A CA    1 
ATOM   2873 C  C     . ILE A 1 381 ? 141.312 24.731  96.668  1.00 43.63 ? 468  ILE A C     1 
ATOM   2874 O  O     . ILE A 1 381 ? 140.873 23.724  97.230  1.00 42.36 ? 468  ILE A O     1 
ATOM   2875 C  CB    . ILE A 1 381 ? 143.794 24.277  96.444  1.00 38.87 ? 468  ILE A CB    1 
ATOM   2876 C  CG1   . ILE A 1 381 ? 145.164 24.934  96.602  1.00 34.79 ? 468  ILE A CG1   1 
ATOM   2877 C  CG2   . ILE A 1 381 ? 143.534 23.895  94.991  1.00 37.24 ? 468  ILE A CG2   1 
ATOM   2878 C  CD1   . ILE A 1 381 ? 146.314 24.149  96.022  1.00 36.17 ? 468  ILE A CD1   1 
ATOM   2879 N  N     . LYS A 1 382 ? 140.610 25.451  95.797  1.00 45.05 ? 469  LYS A N     1 
ATOM   2880 C  CA    . LYS A 1 382 ? 139.225 25.124  95.466  1.00 47.77 ? 469  LYS A CA    1 
ATOM   2881 C  C     . LYS A 1 382 ? 139.152 24.033  94.401  1.00 48.21 ? 469  LYS A C     1 
ATOM   2882 O  O     . LYS A 1 382 ? 140.026 23.943  93.535  1.00 45.89 ? 469  LYS A O     1 
ATOM   2883 C  CB    . LYS A 1 382 ? 138.475 26.385  95.024  1.00 50.60 ? 469  LYS A CB    1 
ATOM   2884 C  CG    . LYS A 1 382 ? 138.292 27.411  96.140  1.00 50.95 ? 469  LYS A CG    1 
ATOM   2885 C  CD    . LYS A 1 382 ? 138.212 28.830  95.593  1.00 52.43 ? 469  LYS A CD    1 
ATOM   2886 C  CE    . LYS A 1 382 ? 138.486 29.865  96.675  1.00 52.00 ? 469  LYS A CE    1 
ATOM   2887 N  NZ    . LYS A 1 382 ? 139.897 29.822  97.158  1.00 51.80 ? 469  LYS A NZ    1 
ATOM   2888 N  N     . ARG A 1 383 ? 138.108 23.207  94.477  1.00 50.72 ? 470  ARG A N     1 
ATOM   2889 C  CA    . ARG A 1 383 ? 137.944 22.056  93.581  1.00 54.23 ? 470  ARG A CA    1 
ATOM   2890 C  C     . ARG A 1 383 ? 137.799 22.454  92.105  1.00 55.77 ? 470  ARG A C     1 
ATOM   2891 O  O     . ARG A 1 383 ? 138.187 21.693  91.213  1.00 56.54 ? 470  ARG A O     1 
ATOM   2892 C  CB    . ARG A 1 383 ? 136.764 21.186  94.037  1.00 56.83 ? 470  ARG A CB    1 
ATOM   2893 C  CG    . ARG A 1 383 ? 136.717 19.782  93.411  1.00 59.37 ? 470  ARG A CG    1 
ATOM   2894 C  CD    . ARG A 1 383 ? 135.680 18.911  94.103  1.00 61.93 ? 470  ARG A CD    1 
ATOM   2895 N  NE    . ARG A 1 383 ? 136.226 18.227  95.279  1.00 64.89 ? 470  ARG A NE    1 
ATOM   2896 C  CZ    . ARG A 1 383 ? 136.641 16.955  95.287  1.00 66.00 ? 470  ARG A CZ    1 
ATOM   2897 N  NH1   . ARG A 1 383 ? 136.571 16.206  94.183  1.00 67.55 ? 470  ARG A NH1   1 
ATOM   2898 N  NH2   . ARG A 1 383 ? 137.125 16.425  96.404  1.00 67.14 ? 470  ARG A NH2   1 
ATOM   2899 N  N     . GLU A 1 384 ? 137.255 23.647  91.856  1.00 56.14 ? 471  GLU A N     1 
ATOM   2900 C  CA    . GLU A 1 384 ? 137.132 24.172  90.493  1.00 56.37 ? 471  GLU A CA    1 
ATOM   2901 C  C     . GLU A 1 384 ? 138.475 24.645  89.907  1.00 54.23 ? 471  GLU A C     1 
ATOM   2902 O  O     . GLU A 1 384 ? 138.541 25.061  88.746  1.00 56.02 ? 471  GLU A O     1 
ATOM   2903 C  CB    . GLU A 1 384 ? 136.059 25.278  90.414  1.00 58.76 ? 471  GLU A CB    1 
ATOM   2904 C  CG    . GLU A 1 384 ? 136.507 26.678  90.843  1.00 61.77 ? 471  GLU A CG    1 
ATOM   2905 C  CD    . GLU A 1 384 ? 136.297 26.961  92.324  1.00 64.29 ? 471  GLU A CD    1 
ATOM   2906 O  OE1   . GLU A 1 384 ? 135.803 26.073  93.056  1.00 66.19 ? 471  GLU A OE1   1 
ATOM   2907 O  OE2   . GLU A 1 384 ? 136.630 28.085  92.762  1.00 65.10 ? 471  GLU A OE2   1 
ATOM   2908 N  N     . ASP A 1 385 ? 139.537 24.571  90.710  1.00 49.96 ? 472  ASP A N     1 
ATOM   2909 C  CA    . ASP A 1 385 ? 140.869 25.018  90.292  1.00 45.38 ? 472  ASP A CA    1 
ATOM   2910 C  C     . ASP A 1 385 ? 141.863 23.876  90.048  1.00 41.41 ? 472  ASP A C     1 
ATOM   2911 O  O     . ASP A 1 385 ? 142.978 24.121  89.583  1.00 39.51 ? 472  ASP A O     1 
ATOM   2912 C  CB    . ASP A 1 385 ? 141.457 25.993  91.323  1.00 45.60 ? 472  ASP A CB    1 
ATOM   2913 C  CG    . ASP A 1 385 ? 141.052 27.440  91.073  1.00 48.94 ? 472  ASP A CG    1 
ATOM   2914 O  OD1   . ASP A 1 385 ? 139.967 27.686  90.486  1.00 49.52 ? 472  ASP A OD1   1 
ATOM   2915 O  OD2   . ASP A 1 385 ? 141.827 28.338  91.478  1.00 47.05 ? 472  ASP A OD2   1 
ATOM   2916 N  N     . TYR A 1 386 ? 141.469 22.644  90.368  1.00 41.18 ? 473  TYR A N     1 
ATOM   2917 C  CA    . TYR A 1 386 ? 142.379 21.486  90.276  1.00 40.43 ? 473  TYR A CA    1 
ATOM   2918 C  C     . TYR A 1 386 ? 142.950 21.311  88.873  1.00 41.41 ? 473  TYR A C     1 
ATOM   2919 O  O     . TYR A 1 386 ? 144.147 21.083  88.709  1.00 38.67 ? 473  TYR A O     1 
ATOM   2920 C  CB    . TYR A 1 386 ? 141.673 20.186  90.693  1.00 41.53 ? 473  TYR A CB    1 
ATOM   2921 C  CG    . TYR A 1 386 ? 141.329 20.045  92.166  1.00 42.17 ? 473  TYR A CG    1 
ATOM   2922 C  CD1   . TYR A 1 386 ? 141.502 21.106  93.067  1.00 42.12 ? 473  TYR A CD1   1 
ATOM   2923 C  CD2   . TYR A 1 386 ? 140.795 18.850  92.651  1.00 42.52 ? 473  TYR A CD2   1 
ATOM   2924 C  CE1   . TYR A 1 386 ? 141.170 20.967  94.409  1.00 41.55 ? 473  TYR A CE1   1 
ATOM   2925 C  CE2   . TYR A 1 386 ? 140.456 18.704  93.990  1.00 42.02 ? 473  TYR A CE2   1 
ATOM   2926 C  CZ    . TYR A 1 386 ? 140.645 19.761  94.861  1.00 41.72 ? 473  TYR A CZ    1 
ATOM   2927 O  OH    . TYR A 1 386 ? 140.307 19.607  96.184  1.00 42.21 ? 473  TYR A OH    1 
ATOM   2928 N  N     . GLU A 1 387 ? 142.082 21.435  87.869  1.00 44.10 ? 474  GLU A N     1 
ATOM   2929 C  CA    . GLU A 1 387 ? 142.438 21.187  86.470  1.00 44.93 ? 474  GLU A CA    1 
ATOM   2930 C  C     . GLU A 1 387 ? 143.417 22.209  85.879  1.00 42.36 ? 474  GLU A C     1 
ATOM   2931 O  O     . GLU A 1 387 ? 144.055 21.940  84.858  1.00 42.25 ? 474  GLU A O     1 
ATOM   2932 C  CB    . GLU A 1 387 ? 141.166 21.118  85.623  1.00 49.53 ? 474  GLU A CB    1 
ATOM   2933 C  CG    . GLU A 1 387 ? 141.287 20.256  84.374  1.00 54.40 ? 474  GLU A CG    1 
ATOM   2934 C  CD    . GLU A 1 387 ? 139.945 19.978  83.712  1.00 64.16 ? 474  GLU A CD    1 
ATOM   2935 O  OE1   . GLU A 1 387 ? 138.912 20.509  84.186  1.00 63.55 ? 474  GLU A OE1   1 
ATOM   2936 O  OE2   . GLU A 1 387 ? 139.922 19.222  82.712  1.00 68.99 ? 474  GLU A OE2   1 
ATOM   2937 N  N     . SER A 1 388 ? 143.536 23.371  86.524  1.00 39.50 ? 475  SER A N     1 
ATOM   2938 C  CA    . SER A 1 388 ? 144.449 24.425  86.071  1.00 35.35 ? 475  SER A CA    1 
ATOM   2939 C  C     . SER A 1 388 ? 145.885 24.276  86.594  1.00 33.93 ? 475  SER A C     1 
ATOM   2940 O  O     . SER A 1 388 ? 146.782 25.010  86.173  1.00 33.19 ? 475  SER A O     1 
ATOM   2941 C  CB    . SER A 1 388 ? 143.888 25.807  86.433  1.00 38.65 ? 475  SER A CB    1 
ATOM   2942 O  OG    . SER A 1 388 ? 143.898 26.024  87.835  1.00 41.09 ? 475  SER A OG    1 
ATOM   2943 N  N     . LEU A 1 389 ? 146.105 23.321  87.501  1.00 30.86 ? 476  LEU A N     1 
ATOM   2944 C  CA    . LEU A 1 389 ? 147.394 23.199  88.206  1.00 27.74 ? 476  LEU A CA    1 
ATOM   2945 C  C     . LEU A 1 389 ? 148.571 22.603  87.417  1.00 25.81 ? 476  LEU A C     1 
ATOM   2946 O  O     . LEU A 1 389 ? 149.695 23.097  87.539  1.00 25.31 ? 476  LEU A O     1 
ATOM   2947 C  CB    . LEU A 1 389 ? 147.211 22.462  89.548  1.00 28.48 ? 476  LEU A CB    1 
ATOM   2948 C  CG    . LEU A 1 389 ? 146.149 23.022  90.507  1.00 29.63 ? 476  LEU A CG    1 
ATOM   2949 C  CD1   . LEU A 1 389 ? 146.137 22.245  91.820  1.00 30.36 ? 476  LEU A CD1   1 
ATOM   2950 C  CD2   . LEU A 1 389 ? 146.343 24.511  90.788  1.00 30.97 ? 476  LEU A CD2   1 
ATOM   2951 N  N     . PRO A 1 390 ? 148.340 21.534  86.617  1.00 25.10 ? 477  PRO A N     1 
ATOM   2952 C  CA    . PRO A 1 390 ? 149.451 21.053  85.785  1.00 25.84 ? 477  PRO A CA    1 
ATOM   2953 C  C     . PRO A 1 390 ? 149.970 22.147  84.834  1.00 27.28 ? 477  PRO A C     1 
ATOM   2954 O  O     . PRO A 1 390 ? 151.183 22.228  84.588  1.00 23.72 ? 477  PRO A O     1 
ATOM   2955 C  CB    . PRO A 1 390 ? 148.820 19.911  84.968  1.00 25.03 ? 477  PRO A CB    1 
ATOM   2956 C  CG    . PRO A 1 390 ? 147.624 19.479  85.746  1.00 25.55 ? 477  PRO A CG    1 
ATOM   2957 C  CD    . PRO A 1 390 ? 147.121 20.720  86.433  1.00 25.29 ? 477  PRO A CD    1 
ATOM   2958 N  N     . LYS A 1 391 ? 149.048 22.960  84.310  1.00 30.59 ? 478  LYS A N     1 
ATOM   2959 C  CA    . LYS A 1 391 ? 149.381 24.138  83.497  1.00 33.17 ? 478  LYS A CA    1 
ATOM   2960 C  C     . LYS A 1 391 ? 150.320 25.067  84.261  1.00 32.91 ? 478  LYS A C     1 
ATOM   2961 O  O     . LYS A 1 391 ? 151.365 25.461  83.740  1.00 32.79 ? 478  LYS A O     1 
ATOM   2962 C  CB    . LYS A 1 391 ? 148.109 24.898  83.098  1.00 36.43 ? 478  LYS A CB    1 
ATOM   2963 C  CG    . LYS A 1 391 ? 147.239 24.201  82.066  1.00 39.01 ? 478  LYS A CG    1 
ATOM   2964 C  CD    . LYS A 1 391 ? 145.779 24.595  82.233  1.00 41.63 ? 478  LYS A CD    1 
ATOM   2965 C  CE    . LYS A 1 391 ? 144.903 24.038  81.121  1.00 43.08 ? 478  LYS A CE    1 
ATOM   2966 N  NZ    . LYS A 1 391 ? 144.808 24.973  79.960  1.00 45.50 ? 478  LYS A NZ    1 
ATOM   2967 N  N     . GLU A 1 392 ? 149.954 25.388  85.506  1.00 31.44 ? 479  GLU A N     1 
ATOM   2968 C  CA    . GLU A 1 392 ? 150.767 26.278  86.349  1.00 30.87 ? 479  GLU A CA    1 
ATOM   2969 C  C     . GLU A 1 392 ? 152.182 25.748  86.549  1.00 29.28 ? 479  GLU A C     1 
ATOM   2970 O  O     . GLU A 1 392 ? 153.155 26.496  86.443  1.00 28.67 ? 479  GLU A O     1 
ATOM   2971 C  CB    . GLU A 1 392 ? 150.100 26.529  87.709  1.00 32.66 ? 479  GLU A CB    1 
ATOM   2972 C  CG    . GLU A 1 392 ? 148.806 27.333  87.660  1.00 33.60 ? 479  GLU A CG    1 
ATOM   2973 C  CD    . GLU A 1 392 ? 148.255 27.632  89.043  1.00 36.10 ? 479  GLU A CD    1 
ATOM   2974 O  OE1   . GLU A 1 392 ? 148.980 27.389  90.032  1.00 35.81 ? 479  GLU A OE1   1 
ATOM   2975 O  OE2   . GLU A 1 392 ? 147.098 28.104  89.147  1.00 37.19 ? 479  GLU A OE2   1 
ATOM   2976 N  N     . VAL A 1 393 ? 152.300 24.452  86.844  1.00 28.45 ? 480  VAL A N     1 
ATOM   2977 C  CA    . VAL A 1 393 ? 153.615 23.836  87.049  1.00 26.23 ? 480  VAL A CA    1 
ATOM   2978 C  C     . VAL A 1 393 ? 154.463 23.918  85.781  1.00 27.67 ? 480  VAL A C     1 
ATOM   2979 O  O     . VAL A 1 393 ? 155.660 24.213  85.843  1.00 29.20 ? 480  VAL A O     1 
ATOM   2980 C  CB    . VAL A 1 393 ? 153.490 22.366  87.534  1.00 25.88 ? 480  VAL A CB    1 
ATOM   2981 C  CG1   . VAL A 1 393 ? 154.859 21.702  87.640  1.00 25.53 ? 480  VAL A CG1   1 
ATOM   2982 C  CG2   . VAL A 1 393 ? 152.767 22.315  88.874  1.00 25.43 ? 480  VAL A CG2   1 
ATOM   2983 N  N     . ALA A 1 394 ? 153.845 23.653  84.631  1.00 28.52 ? 481  ALA A N     1 
ATOM   2984 C  CA    . ALA A 1 394 ? 154.557 23.722  83.358  1.00 31.44 ? 481  ALA A CA    1 
ATOM   2985 C  C     . ALA A 1 394 ? 154.916 25.167  83.001  1.00 33.08 ? 481  ALA A C     1 
ATOM   2986 O  O     . ALA A 1 394 ? 155.926 25.412  82.344  1.00 33.12 ? 481  ALA A O     1 
ATOM   2987 C  CB    . ALA A 1 394 ? 153.732 23.091  82.251  1.00 30.24 ? 481  ALA A CB    1 
ATOM   2988 N  N     . SER A 1 395 ? 154.088 26.108  83.460  1.00 35.09 ? 482  SER A N     1 
ATOM   2989 C  CA    . SER A 1 395 ? 154.290 27.546  83.215  1.00 38.23 ? 482  SER A CA    1 
ATOM   2990 C  C     . SER A 1 395 ? 155.245 28.218  84.201  1.00 41.05 ? 482  SER A C     1 
ATOM   2991 O  O     . SER A 1 395 ? 155.562 29.403  84.042  1.00 43.05 ? 482  SER A O     1 
ATOM   2992 C  CB    . SER A 1 395 ? 152.952 28.287  83.228  1.00 38.08 ? 482  SER A CB    1 
ATOM   2993 O  OG    . SER A 1 395 ? 152.066 27.749  82.266  1.00 40.12 ? 482  SER A OG    1 
ATOM   2994 N  N     . ALA A 1 396 ? 155.692 27.478  85.220  1.00 42.55 ? 483  ALA A N     1 
ATOM   2995 C  CA    . ALA A 1 396 ? 156.722 27.968  86.139  1.00 43.57 ? 483  ALA A CA    1 
ATOM   2996 C  C     . ALA A 1 396 ? 158.028 28.165  85.376  1.00 46.93 ? 483  ALA A C     1 
ATOM   2997 O  O     . ALA A 1 396 ? 158.242 27.533  84.331  1.00 48.41 ? 483  ALA A O     1 
ATOM   2998 C  CB    . ALA A 1 396 ? 156.919 27.001  87.301  1.00 43.06 ? 483  ALA A CB    1 
ATOM   2999 N  N     . LYS A 1 397 ? 158.887 29.045  85.892  1.00 50.90 ? 484  LYS A N     1 
ATOM   3000 C  CA    . LYS A 1 397 ? 160.116 29.428  85.190  1.00 53.55 ? 484  LYS A CA    1 
ATOM   3001 C  C     . LYS A 1 397 ? 161.365 29.197  86.041  1.00 54.26 ? 484  LYS A C     1 
ATOM   3002 O  O     . LYS A 1 397 ? 161.928 30.152  86.587  1.00 55.23 ? 484  LYS A O     1 
ATOM   3003 C  CB    . LYS A 1 397 ? 160.041 30.901  84.731  1.00 54.64 ? 484  LYS A CB    1 
ATOM   3004 C  CG    . LYS A 1 397 ? 158.976 31.188  83.680  1.00 55.59 ? 484  LYS A CG    1 
ATOM   3005 C  CD    . LYS A 1 397 ? 159.503 30.954  82.243  1.00 55.82 ? 484  LYS A CD    1 
ATOM   3006 C  CE    . LYS A 1 397 ? 158.431 30.319  81.361  1.00 57.75 ? 484  LYS A CE    1 
ATOM   3007 N  NZ    . LYS A 1 397 ? 157.021 31.019  81.522  1.00 57.85 ? 484  LYS A NZ    1 
ATOM   3008 N  N     . PRO A 1 398 ? 161.801 27.924  86.166  1.00 55.26 ? 485  PRO A N     1 
ATOM   3009 C  CA    . PRO A 1 398 ? 163.021 27.629  86.936  1.00 56.37 ? 485  PRO A CA    1 
ATOM   3010 C  C     . PRO A 1 398 ? 164.256 28.213  86.260  1.00 60.19 ? 485  PRO A C     1 
ATOM   3011 O  O     . PRO A 1 398 ? 164.525 27.909  85.094  1.00 60.73 ? 485  PRO A O     1 
ATOM   3012 C  CB    . PRO A 1 398 ? 163.098 26.093  86.943  1.00 53.91 ? 485  PRO A CB    1 
ATOM   3013 C  CG    . PRO A 1 398 ? 162.088 25.604  85.948  1.00 52.68 ? 485  PRO A CG    1 
ATOM   3014 C  CD    . PRO A 1 398 ? 161.070 26.690  85.787  1.00 53.03 ? 485  PRO A CD    1 
ATOM   3015 N  N     . LYS A 1 399 ? 165.003 29.042  87.000  1.00 64.51 ? 486  LYS A N     1 
ATOM   3016 C  CA    . LYS A 1 399 ? 166.216 29.687  86.490  1.00 67.33 ? 486  LYS A CA    1 
ATOM   3017 C  C     . LYS A 1 399 ? 167.390 28.713  86.414  1.00 68.60 ? 486  LYS A C     1 
ATOM   3018 O  O     . LYS A 1 399 ? 168.471 28.976  86.952  1.00 68.37 ? 486  LYS A O     1 
ATOM   3019 C  CB    . LYS A 1 399 ? 166.588 30.883  87.380  1.00 68.21 ? 486  LYS A CB    1 
ATOM   3020 C  CG    . LYS A 1 399 ? 165.619 32.142  87.165  1.00 69.11 ? 486  LYS A CG    1 
ATOM   3021 C  CD    . LYS A 1 399 ? 166.128 33.179  88.245  1.00 69.29 ? 486  LYS A CD    1 
ATOM   3022 C  CE    . LYS A 1 399 ? 165.359 34.488  88.054  1.00 69.62 ? 486  LYS A CE    1 
ATOM   3023 N  NZ    . LYS A 1 399 ? 165.911 35.582  88.925  1.00 70.38 ? 486  LYS A NZ    1 
ATOM   3024 N  N     . VAL A 1 400 ? 167.181 27.586  85.728  1.00 69.93 ? 487  VAL A N     1 
ATOM   3025 C  CA    . VAL A 1 400 ? 168.158 26.500  85.709  1.00 71.47 ? 487  VAL A CA    1 
ATOM   3026 C  C     . VAL A 1 400 ? 168.417 25.996  84.287  1.00 73.85 ? 487  VAL A C     1 
ATOM   3027 O  O     . VAL A 1 400 ? 167.531 26.083  83.414  1.00 74.56 ? 487  VAL A O     1 
ATOM   3028 C  CB    . VAL A 1 400 ? 167.707 25.327  86.626  1.00 69.84 ? 487  VAL A CB    1 
ATOM   3029 C  CG1   . VAL A 1 400 ? 168.618 24.114  86.476  1.00 68.82 ? 487  VAL A CG1   1 
ATOM   3030 C  CG2   . VAL A 1 400 ? 167.674 25.775  88.079  1.00 68.35 ? 487  VAL A CG2   1 
ATOM   3031 N  N     . LEU A 1 401 ? 169.657 25.470  84.077  1.00 74.70 ? 488  LEU A N     1 
ATOM   3032 C  CA    . LEU A 1 401 ? 169.988 24.819  82.825  1.00 76.15 ? 488  LEU A CA    1 
ATOM   3033 C  C     . LEU A 1 401 ? 169.086 23.586  82.664  1.00 77.67 ? 488  LEU A C     1 
ATOM   3034 O  O     . LEU A 1 401 ? 169.353 22.526  83.236  1.00 79.23 ? 488  LEU A O     1 
ATOM   3035 C  CB    . LEU A 1 401 ? 171.485 24.387  82.867  1.00 76.71 ? 488  LEU A CB    1 
ATOM   3036 C  CG    . LEU A 1 401 ? 172.194 23.875  81.605  1.00 76.93 ? 488  LEU A CG    1 
ATOM   3037 C  CD1   . LEU A 1 401 ? 173.668 24.334  81.620  1.00 76.23 ? 488  LEU A CD1   1 
ATOM   3038 C  CD2   . LEU A 1 401 ? 172.110 22.354  81.482  1.00 76.75 ? 488  LEU A CD2   1 
ATOM   3039 N  N     . LEU A 1 402 ? 167.995 23.756  81.909  1.00 77.53 ? 489  LEU A N     1 
ATOM   3040 C  CA    . LEU A 1 402 ? 167.039 22.682  81.679  1.00 76.42 ? 489  LEU A CA    1 
ATOM   3041 C  C     . LEU A 1 402 ? 167.323 21.990  80.337  1.00 74.80 ? 489  LEU A C     1 
ATOM   3042 O  O     . LEU A 1 402 ? 167.252 22.623  79.279  1.00 73.48 ? 489  LEU A O     1 
ATOM   3043 C  CB    . LEU A 1 402 ? 165.597 23.167  81.735  1.00 75.18 ? 489  LEU A CB    1 
ATOM   3044 C  CG    . LEU A 1 402 ? 165.072 23.584  83.124  1.00 74.99 ? 489  LEU A CG    1 
ATOM   3045 C  CD1   . LEU A 1 402 ? 163.603 24.003  83.019  1.00 73.05 ? 489  LEU A CD1   1 
ATOM   3046 C  CD2   . LEU A 1 402 ? 165.243 22.457  84.142  1.00 73.19 ? 489  LEU A CD2   1 
ATOM   3047 N  N     . ASP A 1 403 ? 167.644 20.698  80.401  1.00 74.36 ? 490  ASP A N     1 
ATOM   3048 C  CA    . ASP A 1 403 ? 167.962 19.918  79.203  1.00 73.87 ? 490  ASP A CA    1 
ATOM   3049 C  C     . ASP A 1 403 ? 166.720 19.529  78.398  1.00 71.57 ? 490  ASP A C     1 
ATOM   3050 O  O     . ASP A 1 403 ? 166.855 19.109  77.219  1.00 71.13 ? 490  ASP A O     1 
ATOM   3051 C  CB    . ASP A 1 403 ? 168.793 18.682  79.567  1.00 75.81 ? 490  ASP A CB    1 
ATOM   3052 C  CG    . ASP A 1 403 ? 170.201 19.054  80.077  1.00 77.25 ? 490  ASP A CG    1 
ATOM   3053 O  OD1   . ASP A 1 403 ? 170.776 20.061  79.567  1.00 77.90 ? 490  ASP A OD1   1 
ATOM   3054 O  OD2   . ASP A 1 403 ? 170.736 18.338  80.976  1.00 77.58 ? 490  ASP A OD2   1 
ATOM   3055 N  N     . VAL A 1 404 ? 165.525 19.665  79.036  1.00 68.78 ? 491  VAL A N     1 
ATOM   3056 C  CA    . VAL A 1 404 ? 164.250 19.401  78.355  1.00 64.64 ? 491  VAL A CA    1 
ATOM   3057 C  C     . VAL A 1 404 ? 163.145 20.372  78.790  1.00 60.85 ? 491  VAL A C     1 
ATOM   3058 O  O     . VAL A 1 404 ? 163.198 20.948  79.888  1.00 63.33 ? 491  VAL A O     1 
ATOM   3059 C  CB    . VAL A 1 404 ? 163.755 17.937  78.541  1.00 66.73 ? 491  VAL A CB    1 
ATOM   3060 C  CG1   . VAL A 1 404 ? 164.564 16.925  77.621  1.00 66.83 ? 491  VAL A CG1   1 
ATOM   3061 C  CG2   . VAL A 1 404 ? 163.844 17.532  80.026  1.00 68.03 ? 491  VAL A CG2   1 
ATOM   3062 N  N     . LYS A 1 405 ? 162.151 20.557  77.911  1.00 54.94 ? 492  LYS A N     1 
ATOM   3063 C  CA    . LYS A 1 405 ? 160.963 21.342  78.239  1.00 50.12 ? 492  LYS A CA    1 
ATOM   3064 C  C     . LYS A 1 405 ? 159.789 20.377  78.403  1.00 46.85 ? 492  LYS A C     1 
ATOM   3065 O  O     . LYS A 1 405 ? 159.602 19.474  77.580  1.00 47.59 ? 492  LYS A O     1 
ATOM   3066 C  CB    . LYS A 1 405 ? 160.677 22.378  77.139  1.00 50.38 ? 492  LYS A CB    1 
ATOM   3067 C  CG    . LYS A 1 405 ? 159.363 23.153  77.332  1.00 51.12 ? 492  LYS A CG    1 
ATOM   3068 C  CD    . LYS A 1 405 ? 159.178 24.155  76.158  1.00 53.00 ? 492  LYS A CD    1 
ATOM   3069 C  CE    . LYS A 1 405 ? 157.900 24.968  76.335  1.00 54.20 ? 492  LYS A CE    1 
ATOM   3070 N  NZ    . LYS A 1 405 ? 158.128 26.059  77.452  1.00 55.69 ? 492  LYS A NZ    1 
ATOM   3071 N  N     . LEU A 1 406 ? 159.010 20.571  79.467  1.00 41.01 ? 493  LEU A N     1 
ATOM   3072 C  CA    . LEU A 1 406 ? 157.843 19.736  79.725  1.00 36.98 ? 493  LEU A CA    1 
ATOM   3073 C  C     . LEU A 1 406 ? 156.596 20.599  79.621  1.00 36.80 ? 493  LEU A C     1 
ATOM   3074 O  O     . LEU A 1 406 ? 156.642 21.799  79.887  1.00 38.17 ? 493  LEU A O     1 
ATOM   3075 C  CB    . LEU A 1 406 ? 157.938 19.090  81.116  1.00 34.85 ? 493  LEU A CB    1 
ATOM   3076 C  CG    . LEU A 1 406 ? 159.194 18.270  81.434  1.00 34.35 ? 493  LEU A CG    1 
ATOM   3077 C  CD1   . LEU A 1 406 ? 159.346 18.082  82.935  1.00 32.70 ? 493  LEU A CD1   1 
ATOM   3078 C  CD2   . LEU A 1 406 ? 159.154 16.918  80.738  1.00 35.00 ? 493  LEU A CD2   1 
ATOM   3079 N  N     . LYS A 1 407 ? 155.484 19.983  79.239  1.00 35.67 ? 494  LYS A N     1 
ATOM   3080 C  CA    . LYS A 1 407 ? 154.232 20.704  79.057  1.00 37.35 ? 494  LYS A CA    1 
ATOM   3081 C  C     . LYS A 1 407 ? 153.194 20.298  80.100  1.00 37.27 ? 494  LYS A C     1 
ATOM   3082 O  O     . LYS A 1 407 ? 153.403 19.350  80.862  1.00 37.62 ? 494  LYS A O     1 
ATOM   3083 C  CB    . LYS A 1 407 ? 153.698 20.465  77.638  1.00 40.08 ? 494  LYS A CB    1 
ATOM   3084 C  CG    . LYS A 1 407 ? 153.781 19.016  77.187  1.00 41.68 ? 494  LYS A CG    1 
ATOM   3085 C  CD    . LYS A 1 407 ? 153.741 18.892  75.672  1.00 44.87 ? 494  LYS A CD    1 
ATOM   3086 C  CE    . LYS A 1 407 ? 154.449 17.625  75.205  1.00 46.02 ? 494  LYS A CE    1 
ATOM   3087 N  NZ    . LYS A 1 407 ? 153.906 16.362  75.799  1.00 45.57 ? 494  LYS A NZ    1 
ATOM   3088 N  N     . ALA A 1 408 ? 152.073 21.019  80.117  1.00 34.27 ? 495  ALA A N     1 
ATOM   3089 C  CA    . ALA A 1 408 ? 151.005 20.775  81.078  1.00 33.99 ? 495  ALA A CA    1 
ATOM   3090 C  C     . ALA A 1 408 ? 150.552 19.308  81.104  1.00 35.04 ? 495  ALA A C     1 
ATOM   3091 O  O     . ALA A 1 408 ? 150.249 18.773  82.172  1.00 33.64 ? 495  ALA A O     1 
ATOM   3092 C  CB    . ALA A 1 408 ? 149.830 21.702  80.811  1.00 32.64 ? 495  ALA A CB    1 
ATOM   3093 N  N     . GLU A 1 409 ? 150.534 18.659  79.940  1.00 34.43 ? 496  GLU A N     1 
ATOM   3094 C  CA    . GLU A 1 409 ? 150.083 17.272  79.847  1.00 35.19 ? 496  GLU A CA    1 
ATOM   3095 C  C     . GLU A 1 409 ? 151.109 16.268  80.394  1.00 32.69 ? 496  GLU A C     1 
ATOM   3096 O  O     . GLU A 1 409 ? 150.785 15.094  80.593  1.00 32.69 ? 496  GLU A O     1 
ATOM   3097 C  CB    . GLU A 1 409 ? 149.666 16.924  78.413  1.00 38.32 ? 496  GLU A CB    1 
ATOM   3098 C  CG    . GLU A 1 409 ? 150.828 16.753  77.445  1.00 42.57 ? 496  GLU A CG    1 
ATOM   3099 C  CD    . GLU A 1 409 ? 150.391 16.700  75.987  1.00 46.45 ? 496  GLU A CD    1 
ATOM   3100 O  OE1   . GLU A 1 409 ? 151.268 16.801  75.102  1.00 49.19 ? 496  GLU A OE1   1 
ATOM   3101 O  OE2   . GLU A 1 409 ? 149.177 16.559  75.719  1.00 49.53 ? 496  GLU A OE2   1 
ATOM   3102 N  N     . ASP A 1 410 ? 152.333 16.731  80.645  1.00 30.11 ? 497  ASP A N     1 
ATOM   3103 C  CA    . ASP A 1 410 ? 153.373 15.883  81.226  1.00 29.88 ? 497  ASP A CA    1 
ATOM   3104 C  C     . ASP A 1 410 ? 153.241 15.753  82.748  1.00 29.36 ? 497  ASP A C     1 
ATOM   3105 O  O     . ASP A 1 410 ? 153.936 14.938  83.363  1.00 29.31 ? 497  ASP A O     1 
ATOM   3106 C  CB    . ASP A 1 410 ? 154.765 16.422  80.890  1.00 30.72 ? 497  ASP A CB    1 
ATOM   3107 C  CG    . ASP A 1 410 ? 155.107 16.302  79.415  1.00 32.75 ? 497  ASP A CG    1 
ATOM   3108 O  OD1   . ASP A 1 410 ? 154.469 15.493  78.706  1.00 30.73 ? 497  ASP A OD1   1 
ATOM   3109 O  OD2   . ASP A 1 410 ? 156.029 17.015  78.970  1.00 34.46 ? 497  ASP A OD2   1 
ATOM   3110 N  N     . PHE A 1 411 ? 152.362 16.558  83.342  1.00 26.58 ? 498  PHE A N     1 
ATOM   3111 C  CA    . PHE A 1 411 ? 152.246 16.634  84.798  1.00 25.88 ? 498  PHE A CA    1 
ATOM   3112 C  C     . PHE A 1 411 ? 150.904 16.141  85.320  1.00 24.63 ? 498  PHE A C     1 
ATOM   3113 O  O     . PHE A 1 411 ? 149.855 16.371  84.712  1.00 24.20 ? 498  PHE A O     1 
ATOM   3114 C  CB    . PHE A 1 411 ? 152.484 18.072  85.293  1.00 25.62 ? 498  PHE A CB    1 
ATOM   3115 C  CG    . PHE A 1 411 ? 153.907 18.540  85.156  1.00 26.18 ? 498  PHE A CG    1 
ATOM   3116 C  CD1   . PHE A 1 411 ? 154.897 18.082  86.022  1.00 27.03 ? 498  PHE A CD1   1 
ATOM   3117 C  CD2   . PHE A 1 411 ? 154.261 19.463  84.169  1.00 27.76 ? 498  PHE A CD2   1 
ATOM   3118 C  CE1   . PHE A 1 411 ? 156.213 18.520  85.906  1.00 28.19 ? 498  PHE A CE1   1 
ATOM   3119 C  CE2   . PHE A 1 411 ? 155.575 19.900  84.044  1.00 27.65 ? 498  PHE A CE2   1 
ATOM   3120 C  CZ    . PHE A 1 411 ? 156.554 19.433  84.911  1.00 28.36 ? 498  PHE A CZ    1 
ATOM   3121 N  N     . ILE A 1 412 ? 150.947 15.463  86.463  1.00 21.79 ? 499  ILE A N     1 
ATOM   3122 C  CA    . ILE A 1 412 ? 149.738 15.163  87.199  1.00 21.32 ? 499  ILE A CA    1 
ATOM   3123 C  C     . ILE A 1 412 ? 149.825 15.882  88.539  1.00 18.71 ? 499  ILE A C     1 
ATOM   3124 O  O     . ILE A 1 412 ? 150.869 15.858  89.194  1.00 19.18 ? 499  ILE A O     1 
ATOM   3125 C  CB    . ILE A 1 412 ? 149.570 13.644  87.405  1.00 22.34 ? 499  ILE A CB    1 
ATOM   3126 C  CG1   . ILE A 1 412 ? 149.073 13.001  86.112  1.00 23.69 ? 499  ILE A CG1   1 
ATOM   3127 C  CG2   . ILE A 1 412 ? 148.608 13.354  88.555  1.00 20.64 ? 499  ILE A CG2   1 
ATOM   3128 C  CD1   . ILE A 1 412 ? 149.353 11.522  86.045  1.00 24.37 ? 499  ILE A CD1   1 
ATOM   3129 N  N     . VAL A 1 413 ? 148.740 16.537  88.925  1.00 21.58 ? 500  VAL A N     1 
ATOM   3130 C  CA    . VAL A 1 413 ? 148.691 17.218  90.218  1.00 22.78 ? 500  VAL A CA    1 
ATOM   3131 C  C     . VAL A 1 413 ? 147.510 16.677  91.008  1.00 23.60 ? 500  VAL A C     1 
ATOM   3132 O  O     . VAL A 1 413 ? 146.355 16.942  90.690  1.00 24.42 ? 500  VAL A O     1 
ATOM   3133 C  CB    . VAL A 1 413 ? 148.629 18.764  90.076  1.00 23.72 ? 500  VAL A CB    1 
ATOM   3134 C  CG1   . VAL A 1 413 ? 148.496 19.430  91.444  1.00 23.94 ? 500  VAL A CG1   1 
ATOM   3135 C  CG2   . VAL A 1 413 ? 149.873 19.285  89.372  1.00 23.49 ? 500  VAL A CG2   1 
ATOM   3136 N  N     . ASP A 1 414 ? 147.821 15.902  92.041  1.00 22.41 ? 501  ASP A N     1 
ATOM   3137 C  CA    . ASP A 1 414 ? 146.804 15.246  92.852  1.00 22.69 ? 501  ASP A CA    1 
ATOM   3138 C  C     . ASP A 1 414 ? 146.647 16.052  94.133  1.00 23.00 ? 501  ASP A C     1 
ATOM   3139 O  O     . ASP A 1 414 ? 147.600 16.178  94.894  1.00 22.21 ? 501  ASP A O     1 
ATOM   3140 C  CB    . ASP A 1 414 ? 147.275 13.822  93.171  1.00 23.27 ? 501  ASP A CB    1 
ATOM   3141 C  CG    . ASP A 1 414 ? 146.131 12.843  93.380  1.00 24.35 ? 501  ASP A CG    1 
ATOM   3142 O  OD1   . ASP A 1 414 ? 144.976 13.166  93.041  1.00 26.75 ? 501  ASP A OD1   1 
ATOM   3143 O  OD2   . ASP A 1 414 ? 146.394 11.733  93.891  1.00 24.15 ? 501  ASP A OD2   1 
ATOM   3144 N  N     . VAL A 1 415 ? 145.459 16.614  94.354  1.00 23.41 ? 502  VAL A N     1 
ATOM   3145 C  CA    . VAL A 1 415 ? 145.167 17.380  95.568  1.00 23.18 ? 502  VAL A CA    1 
ATOM   3146 C  C     . VAL A 1 415 ? 144.388 16.481  96.528  1.00 22.95 ? 502  VAL A C     1 
ATOM   3147 O  O     . VAL A 1 415 ? 143.369 15.891  96.161  1.00 23.64 ? 502  VAL A O     1 
ATOM   3148 C  CB    . VAL A 1 415 ? 144.385 18.675  95.268  1.00 24.60 ? 502  VAL A CB    1 
ATOM   3149 C  CG1   . VAL A 1 415 ? 143.895 19.337  96.555  1.00 25.44 ? 502  VAL A CG1   1 
ATOM   3150 C  CG2   . VAL A 1 415 ? 145.254 19.649  94.476  1.00 24.37 ? 502  VAL A CG2   1 
ATOM   3151 N  N     . ILE A 1 416 ? 144.898 16.350  97.747  1.00 21.09 ? 503  ILE A N     1 
ATOM   3152 C  CA    . ILE A 1 416 ? 144.322 15.423  98.711  1.00 22.23 ? 503  ILE A CA    1 
ATOM   3153 C  C     . ILE A 1 416 ? 143.798 16.216  99.898  1.00 22.11 ? 503  ILE A C     1 
ATOM   3154 O  O     . ILE A 1 416 ? 144.562 16.918  100.549 1.00 19.33 ? 503  ILE A O     1 
ATOM   3155 C  CB    . ILE A 1 416 ? 145.370 14.399  99.230  1.00 22.11 ? 503  ILE A CB    1 
ATOM   3156 C  CG1   . ILE A 1 416 ? 146.185 13.761  98.087  1.00 23.19 ? 503  ILE A CG1   1 
ATOM   3157 C  CG2   . ILE A 1 416 ? 144.704 13.325  100.093 1.00 23.18 ? 503  ILE A CG2   1 
ATOM   3158 C  CD1   . ILE A 1 416 ? 145.386 12.941  97.093  1.00 24.06 ? 503  ILE A CD1   1 
ATOM   3159 N  N     . ASN A 1 417 ? 142.505 16.079  100.175 1.00 23.43 ? 504  ASN A N     1 
ATOM   3160 C  CA    . ASN A 1 417 ? 141.873 16.700  101.337 1.00 26.44 ? 504  ASN A CA    1 
ATOM   3161 C  C     . ASN A 1 417 ? 141.900 15.755  102.540 1.00 26.15 ? 504  ASN A C     1 
ATOM   3162 O  O     . ASN A 1 417 ? 141.256 14.707  102.530 1.00 27.35 ? 504  ASN A O     1 
ATOM   3163 C  CB    . ASN A 1 417 ? 140.431 17.104  101.016 1.00 28.71 ? 504  ASN A CB    1 
ATOM   3164 C  CG    . ASN A 1 417 ? 140.348 18.303  100.087 1.00 31.47 ? 504  ASN A CG    1 
ATOM   3165 O  OD1   . ASN A 1 417 ? 141.167 19.221  100.153 1.00 32.46 ? 504  ASN A OD1   1 
ATOM   3166 N  ND2   . ASN A 1 417 ? 139.345 18.302  99.217  1.00 32.81 ? 504  ASN A ND2   1 
ATOM   3167 N  N     . MET A 1 418 ? 142.667 16.134  103.560 1.00 24.64 ? 505  MET A N     1 
ATOM   3168 C  CA    . MET A 1 418 ? 142.831 15.336  104.773 1.00 22.75 ? 505  MET A CA    1 
ATOM   3169 C  C     . MET A 1 418 ? 142.128 16.088  105.896 1.00 23.03 ? 505  MET A C     1 
ATOM   3170 O  O     . MET A 1 418 ? 142.484 17.222  106.197 1.00 24.26 ? 505  MET A O     1 
ATOM   3171 C  CB    . MET A 1 418 ? 144.318 15.191  105.110 1.00 22.68 ? 505  MET A CB    1 
ATOM   3172 C  CG    . MET A 1 418 ? 145.163 14.491  104.060 1.00 26.01 ? 505  MET A CG    1 
ATOM   3173 S  SD    . MET A 1 418 ? 144.867 12.709  104.046 1.00 28.68 ? 505  MET A SD    1 
ATOM   3174 C  CE    . MET A 1 418 ? 145.430 12.247  105.681 1.00 26.61 ? 505  MET A CE    1 
ATOM   3175 N  N     . ASP A 1 419 ? 141.109 15.480  106.489 1.00 21.69 ? 506  ASP A N     1 
ATOM   3176 C  CA    . ASP A 1 419 ? 140.366 16.136  107.575 1.00 21.90 ? 506  ASP A CA    1 
ATOM   3177 C  C     . ASP A 1 419 ? 139.815 15.118  108.554 1.00 22.32 ? 506  ASP A C     1 
ATOM   3178 O  O     . ASP A 1 419 ? 140.132 13.935  108.453 1.00 24.10 ? 506  ASP A O     1 
ATOM   3179 C  CB    . ASP A 1 419 ? 139.226 17.007  107.018 1.00 22.54 ? 506  ASP A CB    1 
ATOM   3180 C  CG    . ASP A 1 419 ? 138.260 16.231  106.139 1.00 25.34 ? 506  ASP A CG    1 
ATOM   3181 O  OD1   . ASP A 1 419 ? 137.825 15.128  106.547 1.00 24.60 ? 506  ASP A OD1   1 
ATOM   3182 O  OD2   . ASP A 1 419 ? 137.920 16.739  105.046 1.00 26.55 ? 506  ASP A OD2   1 
ATOM   3183 N  N     . TYR A 1 420 ? 138.961 15.571  109.473 1.00 21.74 ? 507  TYR A N     1 
ATOM   3184 C  CA    . TYR A 1 420 ? 138.387 14.690  110.483 1.00 21.93 ? 507  TYR A CA    1 
ATOM   3185 C  C     . TYR A 1 420 ? 136.971 14.283  110.122 1.00 22.08 ? 507  TYR A C     1 
ATOM   3186 O  O     . TYR A 1 420 ? 136.174 13.914  110.990 1.00 23.20 ? 507  TYR A O     1 
ATOM   3187 C  CB    . TYR A 1 420 ? 138.475 15.321  111.882 1.00 21.38 ? 507  TYR A CB    1 
ATOM   3188 C  CG    . TYR A 1 420 ? 139.769 15.025  112.616 1.00 21.70 ? 507  TYR A CG    1 
ATOM   3189 C  CD1   . TYR A 1 420 ? 140.949 14.732  111.919 1.00 22.13 ? 507  TYR A CD1   1 
ATOM   3190 C  CD2   . TYR A 1 420 ? 139.821 15.045  114.009 1.00 20.41 ? 507  TYR A CD2   1 
ATOM   3191 C  CE1   . TYR A 1 420 ? 142.131 14.455  112.595 1.00 23.02 ? 507  TYR A CE1   1 
ATOM   3192 C  CE2   . TYR A 1 420 ? 141.003 14.770  114.693 1.00 20.30 ? 507  TYR A CE2   1 
ATOM   3193 C  CZ    . TYR A 1 420 ? 142.152 14.477  113.984 1.00 22.55 ? 507  TYR A CZ    1 
ATOM   3194 O  OH    . TYR A 1 420 ? 143.325 14.210  114.666 1.00 24.23 ? 507  TYR A OH    1 
ATOM   3195 N  N     . GLY A 1 421 ? 136.667 14.353  108.826 1.00 21.54 ? 508  GLY A N     1 
ATOM   3196 C  CA    . GLY A 1 421 ? 135.418 13.819  108.295 1.00 23.34 ? 508  GLY A CA    1 
ATOM   3197 C  C     . GLY A 1 421 ? 134.291 14.824  108.215 1.00 25.91 ? 508  GLY A C     1 
ATOM   3198 O  O     . GLY A 1 421 ? 133.182 14.484  107.806 1.00 27.63 ? 508  GLY A O     1 
ATOM   3199 N  N     . MET A 1 422 ? 134.570 16.062  108.610 1.00 27.18 ? 509  MET A N     1 
ATOM   3200 C  CA    . MET A 1 422 ? 133.541 17.100  108.644 1.00 29.49 ? 509  MET A CA    1 
ATOM   3201 C  C     . MET A 1 422 ? 134.139 18.436  108.229 1.00 29.19 ? 509  MET A C     1 
ATOM   3202 O  O     . MET A 1 422 ? 133.927 19.460  108.887 1.00 29.12 ? 509  MET A O     1 
ATOM   3203 C  CB    . MET A 1 422 ? 132.933 17.204  110.041 1.00 29.66 ? 509  MET A CB    1 
ATOM   3204 C  CG    . MET A 1 422 ? 131.866 16.159  110.371 1.00 32.42 ? 509  MET A CG    1 
ATOM   3205 S  SD    . MET A 1 422 ? 131.383 16.317  112.110 1.00 35.89 ? 509  MET A SD    1 
ATOM   3206 C  CE    . MET A 1 422 ? 132.156 17.885  112.492 1.00 29.55 ? 509  MET A CE    1 
ATOM   3207 N  N     . GLN A 1 423 ? 134.888 18.411  107.130 1.00 30.57 ? 510  GLN A N     1 
ATOM   3208 C  CA    . GLN A 1 423 ? 135.587 19.591  106.621 1.00 31.66 ? 510  GLN A CA    1 
ATOM   3209 C  C     . GLN A 1 423 ? 136.370 20.257  107.753 1.00 30.16 ? 510  GLN A C     1 
ATOM   3210 O  O     . GLN A 1 423 ? 137.184 19.606  108.417 1.00 29.53 ? 510  GLN A O     1 
ATOM   3211 C  CB    . GLN A 1 423 ? 134.614 20.584  105.948 1.00 35.09 ? 510  GLN A CB    1 
ATOM   3212 C  CG    . GLN A 1 423 ? 133.590 19.960  105.001 1.00 39.04 ? 510  GLN A CG    1 
ATOM   3213 C  CD    . GLN A 1 423 ? 132.312 19.528  105.709 1.00 41.62 ? 510  GLN A CD    1 
ATOM   3214 O  OE1   . GLN A 1 423 ? 131.774 20.251  106.549 1.00 46.94 ? 510  GLN A OE1   1 
ATOM   3215 N  NE2   . GLN A 1 423 ? 131.823 18.341  105.373 1.00 42.80 ? 510  GLN A NE2   1 
ATOM   3216 N  N     . GLU A 1 424 ? 136.101 21.543  107.990 1.00 25.54 ? 511  GLU A N     1 
ATOM   3217 C  CA    . GLU A 1 424 ? 136.857 22.331  108.966 1.00 27.54 ? 511  GLU A CA    1 
ATOM   3218 C  C     . GLU A 1 424 ? 136.471 22.043  110.415 1.00 24.26 ? 511  GLU A C     1 
ATOM   3219 O  O     . GLU A 1 424 ? 137.164 22.459  111.344 1.00 26.03 ? 511  GLU A O     1 
ATOM   3220 C  CB    . GLU A 1 424 ? 136.680 23.836  108.692 1.00 29.72 ? 511  GLU A CB    1 
ATOM   3221 C  CG    . GLU A 1 424 ? 137.196 24.299  107.333 1.00 35.36 ? 511  GLU A CG    1 
ATOM   3222 C  CD    . GLU A 1 424 ? 138.708 24.193  107.195 1.00 38.97 ? 511  GLU A CD    1 
ATOM   3223 O  OE1   . GLU A 1 424 ? 139.190 23.989  106.056 1.00 41.97 ? 511  GLU A OE1   1 
ATOM   3224 O  OE2   . GLU A 1 424 ? 139.423 24.308  108.218 1.00 41.64 ? 511  GLU A OE2   1 
ATOM   3225 N  N     . LYS A 1 425 ? 135.375 21.328  110.609 1.00 24.54 ? 512  LYS A N     1 
ATOM   3226 C  CA    . LYS A 1 425 ? 134.777 21.229  111.931 1.00 24.06 ? 512  LYS A CA    1 
ATOM   3227 C  C     . LYS A 1 425 ? 135.413 20.136  112.782 1.00 23.44 ? 512  LYS A C     1 
ATOM   3228 O  O     . LYS A 1 425 ? 135.957 19.161  112.261 1.00 21.89 ? 512  LYS A O     1 
ATOM   3229 C  CB    . LYS A 1 425 ? 133.270 21.017  111.818 1.00 25.46 ? 512  LYS A CB    1 
ATOM   3230 C  CG    . LYS A 1 425 ? 132.601 21.981  110.851 1.00 28.75 ? 512  LYS A CG    1 
ATOM   3231 C  CD    . LYS A 1 425 ? 131.099 22.045  111.068 1.00 30.46 ? 512  LYS A CD    1 
ATOM   3232 C  CE    . LYS A 1 425 ? 130.393 20.811  110.504 1.00 33.71 ? 512  LYS A CE    1 
ATOM   3233 N  NZ    . LYS A 1 425 ? 128.920 21.070  110.418 1.00 35.58 ? 512  LYS A NZ    1 
ATOM   3234 N  N     . ASN A 1 426 ? 135.364 20.337  114.095 1.00 20.97 ? 513  ASN A N     1 
ATOM   3235 C  CA    . ASN A 1 426 ? 135.798 19.324  115.057 1.00 19.20 ? 513  ASN A CA    1 
ATOM   3236 C  C     . ASN A 1 426 ? 134.643 18.364  115.354 1.00 17.92 ? 513  ASN A C     1 
ATOM   3237 O  O     . ASN A 1 426 ? 133.638 18.759  115.946 1.00 16.38 ? 513  ASN A O     1 
ATOM   3238 C  CB    . ASN A 1 426 ? 136.272 20.025  116.334 1.00 19.82 ? 513  ASN A CB    1 
ATOM   3239 C  CG    . ASN A 1 426 ? 136.823 19.063  117.374 1.00 20.72 ? 513  ASN A CG    1 
ATOM   3240 O  OD1   . ASN A 1 426 ? 136.748 17.832  117.221 1.00 18.13 ? 513  ASN A OD1   1 
ATOM   3241 N  ND2   . ASN A 1 426 ? 137.383 19.623  118.446 1.00 20.99 ? 513  ASN A ND2   1 
ATOM   3242 N  N     . PRO A 1 427 ? 134.784 17.072  114.965 1.00 17.25 ? 514  PRO A N     1 
ATOM   3243 C  CA    . PRO A 1 427 ? 133.666 16.155  115.176 1.00 16.46 ? 514  PRO A CA    1 
ATOM   3244 C  C     . PRO A 1 427 ? 133.318 15.956  116.644 1.00 15.52 ? 514  PRO A C     1 
ATOM   3245 O  O     . PRO A 1 427 ? 132.164 15.694  116.965 1.00 15.87 ? 514  PRO A O     1 
ATOM   3246 C  CB    . PRO A 1 427 ? 134.152 14.835  114.550 1.00 15.98 ? 514  PRO A CB    1 
ATOM   3247 C  CG    . PRO A 1 427 ? 135.622 14.966  114.472 1.00 17.03 ? 514  PRO A CG    1 
ATOM   3248 C  CD    . PRO A 1 427 ? 135.903 16.425  114.262 1.00 17.76 ? 514  PRO A CD    1 
ATOM   3249 N  N     . ILE A 1 428 ? 134.303 16.096  117.532 1.00 16.99 ? 515  ILE A N     1 
ATOM   3250 C  CA    . ILE A 1 428 ? 134.064 15.880  118.963 1.00 17.16 ? 515  ILE A CA    1 
ATOM   3251 C  C     . ILE A 1 428 ? 133.120 16.940  119.563 1.00 19.99 ? 515  ILE A C     1 
ATOM   3252 O  O     . ILE A 1 428 ? 132.422 16.666  120.543 1.00 20.48 ? 515  ILE A O     1 
ATOM   3253 C  CB    . ILE A 1 428 ? 135.396 15.751  119.750 1.00 17.71 ? 515  ILE A CB    1 
ATOM   3254 C  CG1   . ILE A 1 428 ? 136.346 14.774  119.045 1.00 16.07 ? 515  ILE A CG1   1 
ATOM   3255 C  CG2   . ILE A 1 428 ? 135.152 15.314  121.189 1.00 18.08 ? 515  ILE A CG2   1 
ATOM   3256 C  CD1   . ILE A 1 428 ? 135.738 13.424  118.722 1.00 15.76 ? 515  ILE A CD1   1 
ATOM   3257 N  N     . ASP A 1 429 ? 133.071 18.129  118.951 1.00 23.06 ? 516  ASP A N     1 
ATOM   3258 C  CA    . ASP A 1 429 ? 132.036 19.132  119.273 1.00 24.94 ? 516  ASP A CA    1 
ATOM   3259 C  C     . ASP A 1 429 ? 130.619 18.636  118.965 1.00 24.75 ? 516  ASP A C     1 
ATOM   3260 O  O     . ASP A 1 429 ? 129.642 19.236  119.418 1.00 26.83 ? 516  ASP A O     1 
ATOM   3261 C  CB    . ASP A 1 429 ? 132.276 20.469  118.534 1.00 26.40 ? 516  ASP A CB    1 
ATOM   3262 C  CG    . ASP A 1 429 ? 133.548 21.183  118.976 1.00 28.31 ? 516  ASP A CG    1 
ATOM   3263 O  OD1   . ASP A 1 429 ? 134.066 20.903  120.078 1.00 29.38 ? 516  ASP A OD1   1 
ATOM   3264 O  OD2   . ASP A 1 429 ? 134.037 22.038  118.207 1.00 29.52 ? 516  ASP A OD2   1 
ATOM   3265 N  N     . HIS A 1 430 ? 130.501 17.555  118.190 1.00 21.84 ? 517  HIS A N     1 
ATOM   3266 C  CA    . HIS A 1 430 ? 129.193 16.984  117.861 1.00 21.14 ? 517  HIS A CA    1 
ATOM   3267 C  C     . HIS A 1 430 ? 128.920 15.643  118.516 1.00 21.35 ? 517  HIS A C     1 
ATOM   3268 O  O     . HIS A 1 430 ? 128.041 14.881  118.097 1.00 20.73 ? 517  HIS A O     1 
ATOM   3269 C  CB    . HIS A 1 430 ? 129.012 16.953  116.343 1.00 22.12 ? 517  HIS A CB    1 
ATOM   3270 C  CG    . HIS A 1 430 ? 129.177 18.312  115.699 1.00 25.13 ? 517  HIS A CG    1 
ATOM   3271 N  ND1   . HIS A 1 430 ? 128.145 19.158  115.521 1.00 26.82 ? 517  HIS A ND1   1 
ATOM   3272 C  CD2   . HIS A 1 430 ? 130.313 18.973  115.240 1.00 26.17 ? 517  HIS A CD2   1 
ATOM   3273 C  CE1   . HIS A 1 430 ? 128.593 20.294  114.950 1.00 27.23 ? 517  HIS A CE1   1 
ATOM   3274 N  NE2   . HIS A 1 430 ? 129.920 20.180  114.780 1.00 26.30 ? 517  HIS A NE2   1 
ATOM   3275 N  N     . VAL A 1 431 ? 129.669 15.358  119.576 1.00 20.14 ? 518  VAL A N     1 
ATOM   3276 C  CA    . VAL A 1 431 ? 129.478 14.152  120.376 1.00 18.54 ? 518  VAL A CA    1 
ATOM   3277 C  C     . VAL A 1 431 ? 128.837 14.532  121.707 1.00 19.16 ? 518  VAL A C     1 
ATOM   3278 O  O     . VAL A 1 431 ? 129.224 15.518  122.332 1.00 20.18 ? 518  VAL A O     1 
ATOM   3279 C  CB    . VAL A 1 431 ? 130.826 13.447  120.655 1.00 19.01 ? 518  VAL A CB    1 
ATOM   3280 C  CG1   . VAL A 1 431 ? 130.615 12.174  121.479 1.00 18.26 ? 518  VAL A CG1   1 
ATOM   3281 C  CG2   . VAL A 1 431 ? 131.546 13.148  119.344 1.00 18.64 ? 518  VAL A CG2   1 
ATOM   3282 N  N     . SER A 1 432 ? 127.857 13.746  122.132 1.00 18.30 ? 519  SER A N     1 
ATOM   3283 C  CA    . SER A 1 432 ? 127.287 13.902  123.462 1.00 19.59 ? 519  SER A CA    1 
ATOM   3284 C  C     . SER A 1 432 ? 127.944 12.930  124.426 1.00 18.45 ? 519  SER A C     1 
ATOM   3285 O  O     . SER A 1 432 ? 128.171 11.772  124.068 1.00 15.98 ? 519  SER A O     1 
ATOM   3286 C  CB    . SER A 1 432 ? 125.783 13.676  123.426 1.00 21.55 ? 519  SER A CB    1 
ATOM   3287 O  OG    . SER A 1 432 ? 125.156 14.707  122.673 1.00 24.73 ? 519  SER A OG    1 
ATOM   3288 N  N     . PHE A 1 433 ? 128.227 13.402  125.640 1.00 18.48 ? 520  PHE A N     1 
ATOM   3289 C  CA    . PHE A 1 433 ? 128.870 12.589  126.675 1.00 18.02 ? 520  PHE A CA    1 
ATOM   3290 C  C     . PHE A 1 433 ? 127.974 12.428  127.901 1.00 19.22 ? 520  PHE A C     1 
ATOM   3291 O  O     . PHE A 1 433 ? 127.013 13.170  128.077 1.00 20.62 ? 520  PHE A O     1 
ATOM   3292 C  CB    . PHE A 1 433 ? 130.226 13.198  127.075 1.00 17.51 ? 520  PHE A CB    1 
ATOM   3293 C  CG    . PHE A 1 433 ? 131.244 13.210  125.966 1.00 18.50 ? 520  PHE A CG    1 
ATOM   3294 C  CD1   . PHE A 1 433 ? 132.087 12.108  125.753 1.00 17.48 ? 520  PHE A CD1   1 
ATOM   3295 C  CD2   . PHE A 1 433 ? 131.384 14.325  125.140 1.00 18.51 ? 520  PHE A CD2   1 
ATOM   3296 C  CE1   . PHE A 1 433 ? 133.022 12.122  124.732 1.00 16.67 ? 520  PHE A CE1   1 
ATOM   3297 C  CE2   . PHE A 1 433 ? 132.324 14.341  124.116 1.00 18.24 ? 520  PHE A CE2   1 
ATOM   3298 C  CZ    . PHE A 1 433 ? 133.145 13.236  123.910 1.00 17.13 ? 520  PHE A CZ    1 
ATOM   3299 N  N     . TYR A 1 434 ? 128.270 11.443  128.739 1.00 19.78 ? 521  TYR A N     1 
ATOM   3300 C  CA    . TYR A 1 434 ? 127.606 11.323  130.036 1.00 20.45 ? 521  TYR A CA    1 
ATOM   3301 C  C     . TYR A 1 434 ? 128.658 11.159  131.121 1.00 21.42 ? 521  TYR A C     1 
ATOM   3302 O  O     . TYR A 1 434 ? 129.774 10.696  130.848 1.00 18.57 ? 521  TYR A O     1 
ATOM   3303 C  CB    . TYR A 1 434 ? 126.601 10.160  130.077 1.00 21.08 ? 521  TYR A CB    1 
ATOM   3304 C  CG    . TYR A 1 434 ? 127.224 8.782   130.034 1.00 21.66 ? 521  TYR A CG    1 
ATOM   3305 C  CD1   . TYR A 1 434 ? 127.461 8.150   128.819 1.00 22.79 ? 521  TYR A CD1   1 
ATOM   3306 C  CD2   . TYR A 1 434 ? 127.581 8.110   131.209 1.00 21.26 ? 521  TYR A CD2   1 
ATOM   3307 C  CE1   . TYR A 1 434 ? 128.034 6.886   128.771 1.00 22.24 ? 521  TYR A CE1   1 
ATOM   3308 C  CE2   . TYR A 1 434 ? 128.161 6.845   131.171 1.00 23.04 ? 521  TYR A CE2   1 
ATOM   3309 C  CZ    . TYR A 1 434 ? 128.385 6.243   129.941 1.00 23.70 ? 521  TYR A CZ    1 
ATOM   3310 O  OH    . TYR A 1 434 ? 128.958 4.991   129.875 1.00 24.37 ? 521  TYR A OH    1 
ATOM   3311 N  N     . CYS A 1 435 ? 128.298 11.546  132.343 1.00 21.81 ? 522  CYS A N     1 
ATOM   3312 C  CA    . CYS A 1 435 ? 129.197 11.432  133.494 1.00 23.90 ? 522  CYS A CA    1 
ATOM   3313 C  C     . CYS A 1 435 ? 128.770 10.319  134.441 1.00 22.83 ? 522  CYS A C     1 
ATOM   3314 O  O     . CYS A 1 435 ? 127.594 9.969   134.509 1.00 22.43 ? 522  CYS A O     1 
ATOM   3315 C  CB    . CYS A 1 435 ? 129.269 12.767  134.250 1.00 26.15 ? 522  CYS A CB    1 
ATOM   3316 S  SG    . CYS A 1 435 ? 129.794 14.140  133.204 1.00 30.36 ? 522  CYS A SG    1 
ATOM   3317 N  N     . LYS A 1 436 ? 129.750 9.782   135.170 1.00 22.38 ? 523  LYS A N     1 
ATOM   3318 C  CA    . LYS A 1 436 ? 129.580 8.666   136.101 1.00 25.67 ? 523  LYS A CA    1 
ATOM   3319 C  C     . LYS A 1 436 ? 128.392 8.851   137.056 1.00 27.47 ? 523  LYS A C     1 
ATOM   3320 O  O     . LYS A 1 436 ? 127.595 7.930   137.250 1.00 29.44 ? 523  LYS A O     1 
ATOM   3321 C  CB    . LYS A 1 436 ? 130.884 8.493   136.899 1.00 24.21 ? 523  LYS A CB    1 
ATOM   3322 C  CG    . LYS A 1 436 ? 130.974 7.270   137.801 1.00 24.71 ? 523  LYS A CG    1 
ATOM   3323 C  CD    . LYS A 1 436 ? 132.288 7.324   138.577 1.00 23.08 ? 523  LYS A CD    1 
ATOM   3324 C  CE    . LYS A 1 436 ? 132.597 6.020   139.288 1.00 23.78 ? 523  LYS A CE    1 
ATOM   3325 N  NZ    . LYS A 1 436 ? 133.919 6.070   139.968 1.00 20.55 ? 523  LYS A NZ    1 
ATOM   3326 N  N     . THR A 1 437 ? 128.275 10.043  137.634 1.00 30.01 ? 524  THR A N     1 
ATOM   3327 C  CA    . THR A 1 437 ? 127.245 10.301  138.656 1.00 33.29 ? 524  THR A CA    1 
ATOM   3328 C  C     . THR A 1 437 ? 125.881 10.723  138.091 1.00 33.63 ? 524  THR A C     1 
ATOM   3329 O  O     . THR A 1 437 ? 124.943 10.964  138.858 1.00 36.58 ? 524  THR A O     1 
ATOM   3330 C  CB    . THR A 1 437 ? 127.714 11.336  139.698 1.00 34.93 ? 524  THR A CB    1 
ATOM   3331 O  OG1   . THR A 1 437 ? 127.949 12.591  139.051 1.00 36.83 ? 524  THR A OG1   1 
ATOM   3332 C  CG2   . THR A 1 437 ? 128.996 10.870  140.392 1.00 35.81 ? 524  THR A CG2   1 
ATOM   3333 N  N     . ALA A 1 438 ? 125.778 10.818  136.762 1.00 31.86 ? 525  ALA A N     1 
ATOM   3334 C  CA    . ALA A 1 438 ? 124.491 11.039  136.076 1.00 30.56 ? 525  ALA A CA    1 
ATOM   3335 C  C     . ALA A 1 438 ? 124.489 10.412  134.672 1.00 29.92 ? 525  ALA A C     1 
ATOM   3336 O  O     . ALA A 1 438 ? 124.481 11.129  133.663 1.00 25.39 ? 525  ALA A O     1 
ATOM   3337 C  CB    . ALA A 1 438 ? 124.146 12.522  136.014 1.00 29.72 ? 525  ALA A CB    1 
ATOM   3338 N  N     . PRO A 1 439 ? 124.490 9.067   134.606 1.00 32.32 ? 526  PRO A N     1 
ATOM   3339 C  CA    . PRO A 1 439 ? 124.640 8.348   133.335 1.00 34.46 ? 526  PRO A CA    1 
ATOM   3340 C  C     . PRO A 1 439 ? 123.558 8.667   132.304 1.00 35.32 ? 526  PRO A C     1 
ATOM   3341 O  O     . PRO A 1 439 ? 123.727 8.347   131.127 1.00 36.92 ? 526  PRO A O     1 
ATOM   3342 C  CB    . PRO A 1 439 ? 124.556 6.873   133.751 1.00 34.27 ? 526  PRO A CB    1 
ATOM   3343 C  CG    . PRO A 1 439 ? 123.802 6.886   135.037 1.00 34.90 ? 526  PRO A CG    1 
ATOM   3344 C  CD    . PRO A 1 439 ? 124.259 8.137   135.728 1.00 33.93 ? 526  PRO A CD    1 
ATOM   3345 N  N     . ASN A 1 440 ? 122.466 9.292   132.738 1.00 35.78 ? 527  ASN A N     1 
ATOM   3346 C  CA    . ASN A 1 440 ? 121.363 9.606   131.830 1.00 37.27 ? 527  ASN A CA    1 
ATOM   3347 C  C     . ASN A 1 440 ? 121.303 11.069  131.386 1.00 37.92 ? 527  ASN A C     1 
ATOM   3348 O  O     . ASN A 1 440 ? 120.344 11.482  130.741 1.00 38.48 ? 527  ASN A O     1 
ATOM   3349 C  CB    . ASN A 1 440 ? 120.022 9.157   132.421 1.00 38.50 ? 527  ASN A CB    1 
ATOM   3350 C  CG    . ASN A 1 440 ? 119.966 7.658   132.664 1.00 40.48 ? 527  ASN A CG    1 
ATOM   3351 O  OD1   . ASN A 1 440 ? 120.363 7.175   133.728 1.00 42.99 ? 527  ASN A OD1   1 
ATOM   3352 N  ND2   . ASN A 1 440 ? 119.479 6.913   131.676 1.00 39.68 ? 527  ASN A ND2   1 
ATOM   3353 N  N     . ARG A 1 441 ? 122.338 11.841  131.705 1.00 37.82 ? 528  ARG A N     1 
ATOM   3354 C  CA    . ARG A 1 441 ? 122.357 13.264  131.369 1.00 37.25 ? 528  ARG A CA    1 
ATOM   3355 C  C     . ARG A 1 441 ? 123.475 13.634  130.386 1.00 35.17 ? 528  ARG A C     1 
ATOM   3356 O  O     . ARG A 1 441 ? 124.662 13.530  130.711 1.00 35.50 ? 528  ARG A O     1 
ATOM   3357 C  CB    . ARG A 1 441 ? 122.454 14.099  132.647 1.00 39.88 ? 528  ARG A CB    1 
ATOM   3358 C  CG    . ARG A 1 441 ? 121.798 15.460  132.534 1.00 43.14 ? 528  ARG A CG    1 
ATOM   3359 C  CD    . ARG A 1 441 ? 122.817 16.576  132.417 1.00 46.82 ? 528  ARG A CD    1 
ATOM   3360 N  NE    . ARG A 1 441 ? 123.220 17.069  133.741 1.00 49.95 ? 528  ARG A NE    1 
ATOM   3361 C  CZ    . ARG A 1 441 ? 123.679 18.309  133.991 1.00 51.59 ? 528  ARG A CZ    1 
ATOM   3362 N  NH1   . ARG A 1 441 ? 123.789 19.204  133.010 1.00 52.56 ? 528  ARG A NH1   1 
ATOM   3363 N  NH2   . ARG A 1 441 ? 124.021 18.660  135.229 1.00 53.36 ? 528  ARG A NH2   1 
ATOM   3364 N  N     . ALA A 1 442 ? 123.090 14.069  129.186 1.00 30.86 ? 529  ALA A N     1 
ATOM   3365 C  CA    . ALA A 1 442 ? 124.063 14.441  128.160 1.00 28.83 ? 529  ALA A CA    1 
ATOM   3366 C  C     . ALA A 1 442 ? 124.766 15.759  128.474 1.00 27.98 ? 529  ALA A C     1 
ATOM   3367 O  O     . ALA A 1 442 ? 124.137 16.711  128.927 1.00 28.75 ? 529  ALA A O     1 
ATOM   3368 C  CB    . ALA A 1 442 ? 123.401 14.507  126.792 1.00 27.14 ? 529  ALA A CB    1 
ATOM   3369 N  N     . ILE A 1 443 ? 126.073 15.801  128.237 1.00 23.50 ? 530  ILE A N     1 
ATOM   3370 C  CA    . ILE A 1 443 ? 126.863 17.023  128.374 1.00 23.91 ? 530  ILE A CA    1 
ATOM   3371 C  C     . ILE A 1 443 ? 127.746 17.201  127.149 1.00 25.36 ? 530  ILE A C     1 
ATOM   3372 O  O     . ILE A 1 443 ? 127.857 16.297  126.317 1.00 26.00 ? 530  ILE A O     1 
ATOM   3373 C  CB    . ILE A 1 443 ? 127.756 17.019  129.643 1.00 25.59 ? 530  ILE A CB    1 
ATOM   3374 C  CG1   . ILE A 1 443 ? 128.739 15.840  129.619 1.00 25.39 ? 530  ILE A CG1   1 
ATOM   3375 C  CG2   . ILE A 1 443 ? 126.913 17.035  130.914 1.00 26.08 ? 530  ILE A CG2   1 
ATOM   3376 C  CD1   . ILE A 1 443 ? 130.095 16.161  130.210 1.00 26.06 ? 530  ILE A CD1   1 
ATOM   3377 N  N     . ARG A 1 444 ? 128.367 18.369  127.036 1.00 26.05 ? 531  ARG A N     1 
ATOM   3378 C  CA    . ARG A 1 444 ? 129.340 18.637  125.980 1.00 27.29 ? 531  ARG A CA    1 
ATOM   3379 C  C     . ARG A 1 444 ? 130.714 18.817  126.590 1.00 26.44 ? 531  ARG A C     1 
ATOM   3380 O  O     . ARG A 1 444 ? 130.838 19.224  127.748 1.00 27.47 ? 531  ARG A O     1 
ATOM   3381 C  CB    . ARG A 1 444 ? 128.973 19.901  125.191 1.00 31.29 ? 531  ARG A CB    1 
ATOM   3382 C  CG    . ARG A 1 444 ? 127.664 19.821  124.426 1.00 34.58 ? 531  ARG A CG    1 
ATOM   3383 C  CD    . ARG A 1 444 ? 127.835 19.114  123.092 1.00 38.23 ? 531  ARG A CD    1 
ATOM   3384 N  NE    . ARG A 1 444 ? 126.552 18.902  122.425 1.00 41.65 ? 531  ARG A NE    1 
ATOM   3385 C  CZ    . ARG A 1 444 ? 126.374 18.134  121.352 1.00 43.18 ? 531  ARG A CZ    1 
ATOM   3386 N  NH1   . ARG A 1 444 ? 127.400 17.487  120.813 1.00 41.22 ? 531  ARG A NH1   1 
ATOM   3387 N  NH2   . ARG A 1 444 ? 125.163 18.007  120.821 1.00 43.77 ? 531  ARG A NH2   1 
ATOM   3388 N  N     . ILE A 1 445 ? 131.743 18.509  125.804 1.00 23.18 ? 532  ILE A N     1 
ATOM   3389 C  CA    . ILE A 1 445 ? 133.131 18.657  126.221 1.00 22.73 ? 532  ILE A CA    1 
ATOM   3390 C  C     . ILE A 1 445 ? 133.864 19.385  125.094 1.00 24.18 ? 532  ILE A C     1 
ATOM   3391 O  O     . ILE A 1 445 ? 133.805 18.952  123.945 1.00 24.35 ? 532  ILE A O     1 
ATOM   3392 C  CB    . ILE A 1 445 ? 133.796 17.288  126.496 1.00 21.99 ? 532  ILE A CB    1 
ATOM   3393 C  CG1   . ILE A 1 445 ? 133.035 16.514  127.588 1.00 20.28 ? 532  ILE A CG1   1 
ATOM   3394 C  CG2   . ILE A 1 445 ? 135.257 17.471  126.877 1.00 20.95 ? 532  ILE A CG2   1 
ATOM   3395 C  CD1   . ILE A 1 445 ? 133.609 15.138  127.907 1.00 20.70 ? 532  ILE A CD1   1 
ATOM   3396 N  N     . THR A 1 446 ? 134.543 20.485  125.419 1.00 25.20 ? 533  THR A N     1 
ATOM   3397 C  CA    . THR A 1 446 ? 135.254 21.293  124.412 1.00 27.74 ? 533  THR A CA    1 
ATOM   3398 C  C     . THR A 1 446 ? 136.705 20.855  124.281 1.00 27.35 ? 533  THR A C     1 
ATOM   3399 O  O     . THR A 1 446 ? 137.214 20.132  125.134 1.00 26.93 ? 533  THR A O     1 
ATOM   3400 C  CB    . THR A 1 446 ? 135.196 22.809  124.718 1.00 29.27 ? 533  THR A CB    1 
ATOM   3401 O  OG1   . THR A 1 446 ? 136.132 23.130  125.756 1.00 32.04 ? 533  THR A OG1   1 
ATOM   3402 C  CG2   . THR A 1 446 ? 133.783 23.233  125.140 1.00 29.32 ? 533  THR A CG2   1 
ATOM   3403 N  N     . LYS A 1 447 ? 137.372 21.296  123.214 1.00 29.77 ? 534  LYS A N     1 
ATOM   3404 C  CA    . LYS A 1 447 ? 138.747 20.865  122.912 1.00 30.95 ? 534  LYS A CA    1 
ATOM   3405 C  C     . LYS A 1 447 ? 139.735 21.185  124.046 1.00 32.77 ? 534  LYS A C     1 
ATOM   3406 O  O     . LYS A 1 447 ? 140.566 20.335  124.417 1.00 31.33 ? 534  LYS A O     1 
ATOM   3407 C  CB    . LYS A 1 447 ? 139.240 21.478  121.591 1.00 32.10 ? 534  LYS A CB    1 
ATOM   3408 C  CG    . LYS A 1 447 ? 140.438 20.762  120.985 1.00 31.75 ? 534  LYS A CG    1 
ATOM   3409 C  CD    . LYS A 1 447 ? 140.989 21.485  119.764 1.00 32.53 ? 534  LYS A CD    1 
ATOM   3410 C  CE    . LYS A 1 447 ? 142.120 22.432  120.136 1.00 35.70 ? 534  LYS A CE    1 
ATOM   3411 N  NZ    . LYS A 1 447 ? 142.534 23.256  118.961 1.00 37.95 ? 534  LYS A NZ    1 
ATOM   3412 N  N     . ASN A 1 448 ? 139.628 22.400  124.587 1.00 32.71 ? 535  ASN A N     1 
ATOM   3413 C  CA    . ASN A 1 448 ? 140.511 22.879  125.673 1.00 34.91 ? 535  ASN A CA    1 
ATOM   3414 C  C     . ASN A 1 448 ? 140.276 22.187  127.020 1.00 32.16 ? 535  ASN A C     1 
ATOM   3415 O  O     . ASN A 1 448 ? 141.152 22.199  127.891 1.00 32.13 ? 535  ASN A O     1 
ATOM   3416 C  CB    . ASN A 1 448 ? 140.366 24.388  125.852 1.00 39.33 ? 535  ASN A CB    1 
ATOM   3417 C  CG    . ASN A 1 448 ? 138.918 24.826  125.867 1.00 42.89 ? 535  ASN A CG    1 
ATOM   3418 O  OD1   . ASN A 1 448 ? 138.266 24.873  124.822 1.00 48.41 ? 535  ASN A OD1   1 
ATOM   3419 N  ND2   . ASN A 1 448 ? 138.400 25.135  127.052 1.00 44.70 ? 535  ASN A ND2   1 
ATOM   3420 N  N     . GLN A 1 449 ? 139.091 21.601  127.193 1.00 28.61 ? 536  GLN A N     1 
ATOM   3421 C  CA    . GLN A 1 449 ? 138.829 20.740  128.347 1.00 25.94 ? 536  GLN A CA    1 
ATOM   3422 C  C     . GLN A 1 449 ? 139.535 19.376  128.223 1.00 26.34 ? 536  GLN A C     1 
ATOM   3423 O  O     . GLN A 1 449 ? 139.470 18.550  129.139 1.00 27.09 ? 536  GLN A O     1 
ATOM   3424 C  CB    . GLN A 1 449 ? 137.339 20.502  128.511 1.00 25.39 ? 536  GLN A CB    1 
ATOM   3425 C  CG    . GLN A 1 449 ? 136.524 21.690  129.011 1.00 24.57 ? 536  GLN A CG    1 
ATOM   3426 C  CD    . GLN A 1 449 ? 135.066 21.323  129.101 1.00 23.98 ? 536  GLN A CD    1 
ATOM   3427 O  OE1   . GLN A 1 449 ? 134.374 21.267  128.092 1.00 24.23 ? 536  GLN A OE1   1 
ATOM   3428 N  NE2   . GLN A 1 449 ? 134.596 21.029  130.309 1.00 23.76 ? 536  GLN A NE2   1 
ATOM   3429 N  N     . VAL A 1 450 ? 140.199 19.124  127.099 1.00 24.61 ? 537  VAL A N     1 
ATOM   3430 C  CA    . VAL A 1 450 ? 140.773 17.790  126.890 1.00 25.09 ? 537  VAL A CA    1 
ATOM   3431 C  C     . VAL A 1 450 ? 142.297 17.745  126.946 1.00 25.25 ? 537  VAL A C     1 
ATOM   3432 O  O     . VAL A 1 450 ? 142.880 17.067  127.794 1.00 26.94 ? 537  VAL A O     1 
ATOM   3433 C  CB    . VAL A 1 450 ? 140.277 17.134  125.579 1.00 24.49 ? 537  VAL A CB    1 
ATOM   3434 C  CG1   . VAL A 1 450 ? 140.958 15.779  125.369 1.00 24.82 ? 537  VAL A CG1   1 
ATOM   3435 C  CG2   . VAL A 1 450 ? 138.771 16.965  125.614 1.00 22.63 ? 537  VAL A CG2   1 
ATOM   3436 N  N     . SER A 1 451 ? 142.934 18.446  126.020 1.00 24.65 ? 538  SER A N     1 
ATOM   3437 C  CA    . SER A 1 451 ? 144.377 18.453  125.923 1.00 23.75 ? 538  SER A CA    1 
ATOM   3438 C  C     . SER A 1 451 ? 144.792 19.610  125.049 1.00 25.00 ? 538  SER A C     1 
ATOM   3439 O  O     . SER A 1 451 ? 144.083 19.975  124.115 1.00 28.04 ? 538  SER A O     1 
ATOM   3440 C  CB    . SER A 1 451 ? 144.898 17.146  125.316 1.00 21.04 ? 538  SER A CB    1 
ATOM   3441 O  OG    . SER A 1 451 ? 146.287 17.248  125.051 1.00 18.91 ? 538  SER A OG    1 
ATOM   3442 N  N     . GLN A 1 452 ? 145.956 20.169  125.345 1.00 23.16 ? 539  GLN A N     1 
ATOM   3443 C  CA    . GLN A 1 452 ? 146.485 21.286  124.570 1.00 25.59 ? 539  GLN A CA    1 
ATOM   3444 C  C     . GLN A 1 452 ? 147.451 20.778  123.494 1.00 24.62 ? 539  GLN A C     1 
ATOM   3445 O  O     . GLN A 1 452 ? 148.047 21.569  122.771 1.00 24.86 ? 539  GLN A O     1 
ATOM   3446 C  CB    . GLN A 1 452 ? 147.148 22.298  125.512 1.00 26.53 ? 539  GLN A CB    1 
ATOM   3447 C  CG    . GLN A 1 452 ? 146.232 22.711  126.659 1.00 29.68 ? 539  GLN A CG    1 
ATOM   3448 C  CD    . GLN A 1 452 ? 146.966 23.320  127.846 1.00 31.94 ? 539  GLN A CD    1 
ATOM   3449 O  OE1   . GLN A 1 452 ? 148.186 23.504  127.822 1.00 35.94 ? 539  GLN A OE1   1 
ATOM   3450 N  NE2   . GLN A 1 452 ? 146.218 23.643  128.894 1.00 32.67 ? 539  GLN A NE2   1 
ATOM   3451 N  N     . LEU A 1 453 ? 147.595 19.457  123.391 1.00 24.66 ? 540  LEU A N     1 
ATOM   3452 C  CA    . LEU A 1 453 ? 148.469 18.872  122.377 1.00 25.77 ? 540  LEU A CA    1 
ATOM   3453 C  C     . LEU A 1 453 ? 147.685 18.393  121.142 1.00 26.02 ? 540  LEU A C     1 
ATOM   3454 O  O     . LEU A 1 453 ? 148.274 17.851  120.206 1.00 28.56 ? 540  LEU A O     1 
ATOM   3455 C  CB    . LEU A 1 453 ? 149.335 17.743  122.964 1.00 26.59 ? 540  LEU A CB    1 
ATOM   3456 C  CG    . LEU A 1 453 ? 150.218 17.971  124.209 1.00 29.04 ? 540  LEU A CG    1 
ATOM   3457 C  CD1   . LEU A 1 453 ? 151.226 16.837  124.347 1.00 30.29 ? 540  LEU A CD1   1 
ATOM   3458 C  CD2   . LEU A 1 453 ? 150.941 19.309  124.205 1.00 29.44 ? 540  LEU A CD2   1 
ATOM   3459 N  N     . LEU A 1 454 ? 146.368 18.615  121.146 1.00 23.31 ? 541  LEU A N     1 
ATOM   3460 C  CA    . LEU A 1 454 ? 145.493 18.204  120.046 1.00 23.59 ? 541  LEU A CA    1 
ATOM   3461 C  C     . LEU A 1 454 ? 145.667 19.147  118.846 1.00 24.51 ? 541  LEU A C     1 
ATOM   3462 O  O     . LEU A 1 454 ? 146.249 20.222  118.996 1.00 26.01 ? 541  LEU A O     1 
ATOM   3463 C  CB    . LEU A 1 454 ? 144.036 18.162  120.518 1.00 22.14 ? 541  LEU A CB    1 
ATOM   3464 C  CG    . LEU A 1 454 ? 143.726 17.097  121.584 1.00 23.26 ? 541  LEU A CG    1 
ATOM   3465 C  CD1   . LEU A 1 454 ? 142.352 17.301  122.196 1.00 23.25 ? 541  LEU A CD1   1 
ATOM   3466 C  CD2   . LEU A 1 454 ? 143.861 15.695  121.002 1.00 23.63 ? 541  LEU A CD2   1 
ATOM   3467 N  N     . PRO A 1 455 ? 145.188 18.742  117.646 1.00 23.56 ? 542  PRO A N     1 
ATOM   3468 C  CA    . PRO A 1 455 ? 145.260 19.607  116.449 1.00 24.16 ? 542  PRO A CA    1 
ATOM   3469 C  C     . PRO A 1 455 ? 144.663 21.016  116.654 1.00 24.57 ? 542  PRO A C     1 
ATOM   3470 O  O     . PRO A 1 455 ? 143.620 21.144  117.297 1.00 23.50 ? 542  PRO A O     1 
ATOM   3471 C  CB    . PRO A 1 455 ? 144.414 18.839  115.421 1.00 24.29 ? 542  PRO A CB    1 
ATOM   3472 C  CG    . PRO A 1 455 ? 144.531 17.410  115.834 1.00 24.00 ? 542  PRO A CG    1 
ATOM   3473 C  CD    . PRO A 1 455 ? 144.611 17.417  117.336 1.00 23.59 ? 542  PRO A CD    1 
ATOM   3474 N  N     . GLU A 1 456 ? 145.324 22.044  116.111 1.00 27.78 ? 543  GLU A N     1 
ATOM   3475 C  CA    . GLU A 1 456 ? 144.800 23.430  116.111 1.00 31.39 ? 543  GLU A CA    1 
ATOM   3476 C  C     . GLU A 1 456 ? 143.661 23.590  115.102 1.00 30.62 ? 543  GLU A C     1 
ATOM   3477 O  O     . GLU A 1 456 ? 142.744 24.388  115.310 1.00 31.71 ? 543  GLU A O     1 
ATOM   3478 C  CB    . GLU A 1 456 ? 145.903 24.492  115.858 1.00 36.31 ? 543  GLU A CB    1 
ATOM   3479 C  CG    . GLU A 1 456 ? 147.269 23.934  115.414 1.00 42.60 ? 543  GLU A CG    1 
ATOM   3480 C  CD    . GLU A 1 456 ? 148.344 24.998  115.225 1.00 47.41 ? 543  GLU A CD    1 
ATOM   3481 O  OE1   . GLU A 1 456 ? 148.003 26.123  114.782 1.00 52.70 ? 543  GLU A OE1   1 
ATOM   3482 O  OE2   . GLU A 1 456 ? 149.543 24.707  115.507 1.00 51.54 ? 543  GLU A OE2   1 
ATOM   3483 N  N     . LYS A 1 457 ? 143.727 22.822  114.017 1.00 28.84 ? 544  LYS A N     1 
ATOM   3484 C  CA    . LYS A 1 457 ? 142.641 22.751  113.027 1.00 26.52 ? 544  LYS A CA    1 
ATOM   3485 C  C     . LYS A 1 457 ? 142.449 21.314  112.533 1.00 24.08 ? 544  LYS A C     1 
ATOM   3486 O  O     . LYS A 1 457 ? 143.266 20.439  112.817 1.00 22.35 ? 544  LYS A O     1 
ATOM   3487 C  CB    . LYS A 1 457 ? 142.892 23.695  111.849 1.00 27.87 ? 544  LYS A CB    1 
ATOM   3488 C  CG    . LYS A 1 457 ? 144.185 23.424  111.103 1.00 29.71 ? 544  LYS A CG    1 
ATOM   3489 C  CD    . LYS A 1 457 ? 144.194 24.143  109.764 1.00 31.71 ? 544  LYS A CD    1 
ATOM   3490 C  CE    . LYS A 1 457 ? 145.533 23.969  109.072 1.00 33.23 ? 544  LYS A CE    1 
ATOM   3491 N  NZ    . LYS A 1 457 ? 145.419 24.145  107.594 1.00 36.03 ? 544  LYS A NZ    1 
ATOM   3492 N  N     . PHE A 1 458 ? 141.384 21.090  111.773 1.00 22.39 ? 545  PHE A N     1 
ATOM   3493 C  CA    . PHE A 1 458 ? 140.891 19.739  111.535 1.00 21.99 ? 545  PHE A CA    1 
ATOM   3494 C  C     . PHE A 1 458 ? 140.794 19.353  110.076 1.00 21.34 ? 545  PHE A C     1 
ATOM   3495 O  O     . PHE A 1 458 ? 140.162 18.349  109.751 1.00 18.93 ? 545  PHE A O     1 
ATOM   3496 C  CB    . PHE A 1 458 ? 139.557 19.559  112.252 1.00 22.08 ? 545  PHE A CB    1 
ATOM   3497 C  CG    . PHE A 1 458 ? 139.697 19.598  113.742 1.00 24.35 ? 545  PHE A CG    1 
ATOM   3498 C  CD1   . PHE A 1 458 ? 140.054 18.450  114.449 1.00 24.27 ? 545  PHE A CD1   1 
ATOM   3499 C  CD2   . PHE A 1 458 ? 139.556 20.799  114.433 1.00 25.18 ? 545  PHE A CD2   1 
ATOM   3500 C  CE1   . PHE A 1 458 ? 140.230 18.484  115.821 1.00 24.92 ? 545  PHE A CE1   1 
ATOM   3501 C  CE2   . PHE A 1 458 ? 139.732 20.844  115.808 1.00 24.99 ? 545  PHE A CE2   1 
ATOM   3502 C  CZ    . PHE A 1 458 ? 140.067 19.684  116.505 1.00 25.61 ? 545  PHE A CZ    1 
ATOM   3503 N  N     . ALA A 1 459 ? 141.440 20.149  109.220 1.00 19.67 ? 546  ALA A N     1 
ATOM   3504 C  CA    . ALA A 1 459 ? 141.474 19.901  107.774 1.00 20.08 ? 546  ALA A CA    1 
ATOM   3505 C  C     . ALA A 1 459 ? 142.706 20.546  107.179 1.00 19.45 ? 546  ALA A C     1 
ATOM   3506 O  O     . ALA A 1 459 ? 143.113 21.628  107.594 1.00 20.33 ? 546  ALA A O     1 
ATOM   3507 C  CB    . ALA A 1 459 ? 140.223 20.445  107.098 1.00 20.92 ? 546  ALA A CB    1 
ATOM   3508 N  N     . GLU A 1 460 ? 143.318 19.875  106.218 1.00 18.79 ? 547  GLU A N     1 
ATOM   3509 C  CA    . GLU A 1 460 ? 144.462 20.419  105.493 1.00 17.44 ? 547  GLU A CA    1 
ATOM   3510 C  C     . GLU A 1 460 ? 144.462 19.825  104.096 1.00 17.88 ? 547  GLU A C     1 
ATOM   3511 O  O     . GLU A 1 460 ? 143.661 18.936  103.804 1.00 18.64 ? 547  GLU A O     1 
ATOM   3512 C  CB    . GLU A 1 460 ? 145.776 20.083  106.200 1.00 18.57 ? 547  GLU A CB    1 
ATOM   3513 C  CG    . GLU A 1 460 ? 146.098 18.589  106.295 1.00 19.50 ? 547  GLU A CG    1 
ATOM   3514 C  CD    . GLU A 1 460 ? 147.427 18.313  106.982 1.00 21.05 ? 547  GLU A CD    1 
ATOM   3515 O  OE1   . GLU A 1 460 ? 148.278 19.223  107.024 1.00 22.66 ? 547  GLU A OE1   1 
ATOM   3516 O  OE2   . GLU A 1 460 ? 147.628 17.183  107.488 1.00 19.99 ? 547  GLU A OE2   1 
ATOM   3517 N  N     . GLN A 1 461 ? 145.364 20.310  103.244 1.00 16.67 ? 548  GLN A N     1 
ATOM   3518 C  CA    . GLN A 1 461 ? 145.475 19.801  101.885 1.00 18.88 ? 548  GLN A CA    1 
ATOM   3519 C  C     . GLN A 1 461 ? 146.896 19.384  101.605 1.00 18.26 ? 548  GLN A C     1 
ATOM   3520 O  O     . GLN A 1 461 ? 147.850 20.064  101.998 1.00 17.86 ? 548  GLN A O     1 
ATOM   3521 C  CB    . GLN A 1 461 ? 145.017 20.858  100.869 1.00 20.92 ? 548  GLN A CB    1 
ATOM   3522 C  CG    . GLN A 1 461 ? 143.536 21.174  100.935 1.00 23.25 ? 548  GLN A CG    1 
ATOM   3523 C  CD    . GLN A 1 461 ? 143.114 22.109  99.815  1.00 25.58 ? 548  GLN A CD    1 
ATOM   3524 O  OE1   . GLN A 1 461 ? 143.614 23.223  99.713  1.00 28.67 ? 548  GLN A OE1   1 
ATOM   3525 N  NE2   . GLN A 1 461 ? 142.207 21.651  98.964  1.00 26.86 ? 548  GLN A NE2   1 
ATOM   3526 N  N     . LEU A 1 462 ? 147.040 18.231  100.955 1.00 18.33 ? 549  LEU A N     1 
ATOM   3527 C  CA    . LEU A 1 462 ? 148.333 17.800  100.451 1.00 18.17 ? 549  LEU A CA    1 
ATOM   3528 C  C     . LEU A 1 462 ? 148.274 17.837  98.940  1.00 18.73 ? 549  LEU A C     1 
ATOM   3529 O  O     . LEU A 1 462 ? 147.279 17.423  98.345  1.00 20.30 ? 549  LEU A O     1 
ATOM   3530 C  CB    . LEU A 1 462 ? 148.663 16.360  100.880 1.00 21.22 ? 549  LEU A CB    1 
ATOM   3531 C  CG    . LEU A 1 462 ? 148.632 15.985  102.362 1.00 24.24 ? 549  LEU A CG    1 
ATOM   3532 C  CD1   . LEU A 1 462 ? 148.820 14.480  102.531 1.00 25.63 ? 549  LEU A CD1   1 
ATOM   3533 C  CD2   . LEU A 1 462 ? 149.668 16.760  103.162 1.00 25.25 ? 549  LEU A CD2   1 
ATOM   3534 N  N     . ILE A 1 463 ? 149.352 18.310  98.329  1.00 17.53 ? 550  ILE A N     1 
ATOM   3535 C  CA    . ILE A 1 463 ? 149.435 18.398  96.875  1.00 18.76 ? 550  ILE A CA    1 
ATOM   3536 C  C     . ILE A 1 463 ? 150.595 17.538  96.388  1.00 19.03 ? 550  ILE A C     1 
ATOM   3537 O  O     . ILE A 1 463 ? 151.748 17.805  96.720  1.00 19.77 ? 550  ILE A O     1 
ATOM   3538 C  CB    . ILE A 1 463 ? 149.678 19.859  96.410  1.00 20.43 ? 550  ILE A CB    1 
ATOM   3539 C  CG1   . ILE A 1 463 ? 148.619 20.804  96.993  1.00 20.54 ? 550  ILE A CG1   1 
ATOM   3540 C  CG2   . ILE A 1 463 ? 149.724 19.919  94.883  1.00 20.08 ? 550  ILE A CG2   1 
ATOM   3541 C  CD1   . ILE A 1 463 ? 149.039 22.266  97.021  1.00 22.09 ? 550  ILE A CD1   1 
ATOM   3542 N  N     . ARG A 1 464 ? 150.298 16.501  95.612  1.00 17.67 ? 551  ARG A N     1 
ATOM   3543 C  CA    . ARG A 1 464 ? 151.354 15.657  95.058  1.00 17.53 ? 551  ARG A CA    1 
ATOM   3544 C  C     . ARG A 1 464 ? 151.522 15.957  93.577  1.00 18.01 ? 551  ARG A C     1 
ATOM   3545 O  O     . ARG A 1 464 ? 150.548 16.184  92.873  1.00 19.11 ? 551  ARG A O     1 
ATOM   3546 C  CB    . ARG A 1 464 ? 151.060 14.159  95.234  1.00 18.00 ? 551  ARG A CB    1 
ATOM   3547 C  CG    . ARG A 1 464 ? 151.344 13.616  96.628  1.00 19.78 ? 551  ARG A CG    1 
ATOM   3548 C  CD    . ARG A 1 464 ? 150.135 13.829  97.532  1.00 20.05 ? 551  ARG A CD    1 
ATOM   3549 N  NE    . ARG A 1 464 ? 150.319 13.183  98.833  1.00 21.55 ? 551  ARG A NE    1 
ATOM   3550 C  CZ    . ARG A 1 464 ? 149.969 11.926  99.098  1.00 21.78 ? 551  ARG A CZ    1 
ATOM   3551 N  NH1   . ARG A 1 464 ? 149.416 11.162  98.158  1.00 17.83 ? 551  ARG A NH1   1 
ATOM   3552 N  NH2   . ARG A 1 464 ? 150.173 11.434  100.311 1.00 21.58 ? 551  ARG A NH2   1 
ATOM   3553 N  N     . VAL A 1 465 ? 152.762 15.943  93.122  1.00 18.26 ? 552  VAL A N     1 
ATOM   3554 C  CA    . VAL A 1 465 ? 153.058 16.163  91.716  1.00 17.93 ? 552  VAL A CA    1 
ATOM   3555 C  C     . VAL A 1 465 ? 153.840 14.983  91.178  1.00 17.78 ? 552  VAL A C     1 
ATOM   3556 O  O     . VAL A 1 465 ? 154.807 14.523  91.806  1.00 18.97 ? 552  VAL A O     1 
ATOM   3557 C  CB    . VAL A 1 465 ? 153.862 17.470  91.504  1.00 18.61 ? 552  VAL A CB    1 
ATOM   3558 C  CG1   . VAL A 1 465 ? 154.223 17.657  90.033  1.00 19.58 ? 552  VAL A CG1   1 
ATOM   3559 C  CG2   . VAL A 1 465 ? 153.065 18.662  92.014  1.00 19.58 ? 552  VAL A CG2   1 
ATOM   3560 N  N     . TYR A 1 466 ? 153.421 14.503  90.008  1.00 17.79 ? 553  TYR A N     1 
ATOM   3561 C  CA    . TYR A 1 466 ? 154.099 13.416  89.320  1.00 18.18 ? 553  TYR A CA    1 
ATOM   3562 C  C     . TYR A 1 466 ? 154.395 13.831  87.890  1.00 19.92 ? 553  TYR A C     1 
ATOM   3563 O  O     . TYR A 1 466 ? 153.704 14.692  87.330  1.00 19.43 ? 553  TYR A O     1 
ATOM   3564 C  CB    . TYR A 1 466 ? 153.214 12.168  89.230  1.00 18.13 ? 553  TYR A CB    1 
ATOM   3565 C  CG    . TYR A 1 466 ? 152.607 11.680  90.524  1.00 17.90 ? 553  TYR A CG    1 
ATOM   3566 C  CD1   . TYR A 1 466 ? 151.498 12.314  91.071  1.00 17.67 ? 553  TYR A CD1   1 
ATOM   3567 C  CD2   . TYR A 1 466 ? 153.110 10.549  91.170  1.00 18.73 ? 553  TYR A CD2   1 
ATOM   3568 C  CE1   . TYR A 1 466 ? 150.916 11.855  92.243  1.00 18.51 ? 553  TYR A CE1   1 
ATOM   3569 C  CE2   . TYR A 1 466 ? 152.536 10.081  92.352  1.00 17.44 ? 553  TYR A CE2   1 
ATOM   3570 C  CZ    . TYR A 1 466 ? 151.445 10.736  92.879  1.00 17.59 ? 553  TYR A CZ    1 
ATOM   3571 O  OH    . TYR A 1 466 ? 150.845 10.282  94.041  1.00 18.62 ? 553  TYR A OH    1 
ATOM   3572 N  N     . CYS A 1 467 ? 155.381 13.175  87.294  1.00 19.58 ? 554  CYS A N     1 
ATOM   3573 C  CA    . CYS A 1 467 ? 155.694 13.393  85.879  1.00 22.53 ? 554  CYS A CA    1 
ATOM   3574 C  C     . CYS A 1 467 ? 155.474 12.124  85.057  1.00 24.23 ? 554  CYS A C     1 
ATOM   3575 O  O     . CYS A 1 467 ? 155.942 11.042  85.423  1.00 22.24 ? 554  CYS A O     1 
ATOM   3576 C  CB    . CYS A 1 467 ? 157.127 13.887  85.713  1.00 24.50 ? 554  CYS A CB    1 
ATOM   3577 S  SG    . CYS A 1 467 ? 157.541 14.377  84.007  1.00 27.49 ? 554  CYS A SG    1 
ATOM   3578 N  N     . LYS A 1 468 ? 154.764 12.265  83.940  1.00 26.60 ? 555  LYS A N     1 
ATOM   3579 C  CA    . LYS A 1 468 ? 154.483 11.138  83.050  1.00 30.07 ? 555  LYS A CA    1 
ATOM   3580 C  C     . LYS A 1 468 ? 155.694 10.730  82.222  1.00 33.71 ? 555  LYS A C     1 
ATOM   3581 O  O     . LYS A 1 468 ? 155.743 9.624   81.689  1.00 36.19 ? 555  LYS A O     1 
ATOM   3582 C  CB    . LYS A 1 468 ? 153.320 11.465  82.125  1.00 29.05 ? 555  LYS A CB    1 
ATOM   3583 C  CG    . LYS A 1 468 ? 151.977 11.556  82.817  1.00 29.11 ? 555  LYS A CG    1 
ATOM   3584 C  CD    . LYS A 1 468 ? 150.935 12.093  81.854  1.00 31.41 ? 555  LYS A CD    1 
ATOM   3585 C  CE    . LYS A 1 468 ? 149.574 11.439  82.090  1.00 33.35 ? 555  LYS A CE    1 
ATOM   3586 N  NZ    . LYS A 1 468 ? 148.493 12.250  81.451  1.00 34.75 ? 555  LYS A NZ    1 
ATOM   3587 N  N     . LYS A 1 469 ? 156.658 11.637  82.109  1.00 37.49 ? 556  LYS A N     1 
ATOM   3588 C  CA    . LYS A 1 469 ? 157.898 11.368  81.400  1.00 41.41 ? 556  LYS A CA    1 
ATOM   3589 C  C     . LYS A 1 469 ? 158.941 10.915  82.408  1.00 42.42 ? 556  LYS A C     1 
ATOM   3590 O  O     . LYS A 1 469 ? 159.313 11.660  83.318  1.00 44.50 ? 556  LYS A O     1 
ATOM   3591 C  CB    . LYS A 1 469 ? 158.353 12.599  80.620  1.00 42.48 ? 556  LYS A CB    1 
ATOM   3592 C  CG    . LYS A 1 469 ? 157.379 12.998  79.514  1.00 45.14 ? 556  LYS A CG    1 
ATOM   3593 C  CD    . LYS A 1 469 ? 158.012 13.971  78.537  1.00 47.68 ? 556  LYS A CD    1 
ATOM   3594 C  CE    . LYS A 1 469 ? 158.993 13.265  77.616  1.00 49.09 ? 556  LYS A CE    1 
ATOM   3595 N  NZ    . LYS A 1 469 ? 160.045 14.214  77.129  1.00 50.95 ? 556  LYS A NZ    1 
ATOM   3596 N  N     . VAL A 1 470 ? 159.408 9.684   82.227  1.00 43.87 ? 557  VAL A N     1 
ATOM   3597 C  CA    . VAL A 1 470 ? 160.067 8.935   83.297  1.00 43.65 ? 557  VAL A CA    1 
ATOM   3598 C  C     . VAL A 1 470 ? 161.581 8.786   83.143  1.00 44.80 ? 557  VAL A C     1 
ATOM   3599 O  O     . VAL A 1 470 ? 162.225 8.110   83.950  1.00 45.90 ? 557  VAL A O     1 
ATOM   3600 C  CB    . VAL A 1 470 ? 159.405 7.542   83.491  1.00 43.13 ? 557  VAL A CB    1 
ATOM   3601 C  CG1   . VAL A 1 470 ? 157.897 7.686   83.694  1.00 41.87 ? 557  VAL A CG1   1 
ATOM   3602 C  CG2   . VAL A 1 470 ? 159.700 6.617   82.314  1.00 42.01 ? 557  VAL A CG2   1 
ATOM   3603 N  N     . ASP A 1 471 ? 162.148 9.421   82.118  1.00 44.27 ? 558  ASP A N     1 
ATOM   3604 C  CA    . ASP A 1 471 ? 163.595 9.393   81.918  1.00 45.97 ? 558  ASP A CA    1 
ATOM   3605 C  C     . ASP A 1 471 ? 164.309 10.314  82.909  1.00 47.81 ? 558  ASP A C     1 
ATOM   3606 O  O     . ASP A 1 471 ? 163.698 11.221  83.487  1.00 48.24 ? 558  ASP A O     1 
ATOM   3607 C  CB    . ASP A 1 471 ? 163.968 9.750   80.471  1.00 45.36 ? 558  ASP A CB    1 
ATOM   3608 C  CG    . ASP A 1 471 ? 163.519 11.142  80.078  1.00 45.27 ? 558  ASP A CG    1 
ATOM   3609 O  OD1   . ASP A 1 471 ? 162.367 11.292  79.617  1.00 45.55 ? 558  ASP A OD1   1 
ATOM   3610 O  OD2   . ASP A 1 471 ? 164.321 12.089  80.227  1.00 46.62 ? 558  ASP A OD2   1 
ATOM   3611 N  N     . ARG A 1 472 ? 165.607 10.069  83.084  1.00 51.18 ? 559  ARG A N     1 
ATOM   3612 C  CA    . ARG A 1 472 ? 166.460 10.807  84.016  1.00 53.96 ? 559  ARG A CA    1 
ATOM   3613 C  C     . ARG A 1 472 ? 166.434 12.327  83.805  1.00 54.00 ? 559  ARG A C     1 
ATOM   3614 O  O     . ARG A 1 472 ? 166.425 13.094  84.772  1.00 53.78 ? 559  ARG A O     1 
ATOM   3615 C  CB    . ARG A 1 472 ? 167.902 10.280  83.919  1.00 56.83 ? 559  ARG A CB    1 
ATOM   3616 C  CG    . ARG A 1 472 ? 168.910 10.865  84.987  1.00 60.40 ? 559  ARG A CG    1 
ATOM   3617 C  CD    . ARG A 1 472 ? 170.351 10.263  84.495  1.00 63.85 ? 559  ARG A CD    1 
ATOM   3618 N  NE    . ARG A 1 472 ? 171.458 11.162  84.877  1.00 71.07 ? 559  ARG A NE    1 
ATOM   3619 C  CZ    . ARG A 1 472 ? 172.037 11.200  86.084  1.00 73.59 ? 559  ARG A CZ    1 
ATOM   3620 N  NH1   . ARG A 1 472 ? 171.629 10.390  87.065  1.00 70.70 ? 559  ARG A NH1   1 
ATOM   3621 N  NH2   . ARG A 1 472 ? 173.031 12.058  86.317  1.00 70.59 ? 559  ARG A NH2   1 
ATOM   3622 N  N     . LYS A 1 473 ? 166.407 12.754  82.543  1.00 53.61 ? 560  LYS A N     1 
ATOM   3623 C  CA    . LYS A 1 473 ? 166.456 14.178  82.205  1.00 52.12 ? 560  LYS A CA    1 
ATOM   3624 C  C     . LYS A 1 473 ? 165.113 14.891  82.369  1.00 49.50 ? 560  LYS A C     1 
ATOM   3625 O  O     . LYS A 1 473 ? 165.072 16.055  82.784  1.00 49.61 ? 560  LYS A O     1 
ATOM   3626 C  CB    . LYS A 1 473 ? 167.011 14.383  80.792  1.00 55.17 ? 560  LYS A CB    1 
ATOM   3627 C  CG    . LYS A 1 473 ? 168.475 13.972  80.644  1.00 57.31 ? 560  LYS A CG    1 
ATOM   3628 C  CD    . LYS A 1 473 ? 169.084 14.523  79.341  1.00 58.32 ? 560  LYS A CD    1 
ATOM   3629 C  CE    . LYS A 1 473 ? 168.786 13.611  78.134  1.00 58.59 ? 560  LYS A CE    1 
ATOM   3630 N  NZ    . LYS A 1 473 ? 169.713 13.991  76.985  1.00 61.09 ? 560  LYS A NZ    1 
ATOM   3631 N  N     . SER A 1 474 ? 164.022 14.199  82.044  1.00 46.66 ? 561  SER A N     1 
ATOM   3632 C  CA    . SER A 1 474 ? 162.674 14.743  82.238  1.00 46.23 ? 561  SER A CA    1 
ATOM   3633 C  C     . SER A 1 474 ? 162.323 14.873  83.719  1.00 43.95 ? 561  SER A C     1 
ATOM   3634 O  O     . SER A 1 474 ? 161.605 15.799  84.115  1.00 38.25 ? 561  SER A O     1 
ATOM   3635 C  CB    . SER A 1 474 ? 161.628 13.868  81.549  1.00 47.87 ? 561  SER A CB    1 
ATOM   3636 O  OG    . SER A 1 474 ? 161.806 13.855  80.144  1.00 50.30 ? 561  SER A OG    1 
ATOM   3637 N  N     . LEU A 1 475 ? 162.831 13.937  84.523  1.00 43.06 ? 562  LEU A N     1 
ATOM   3638 C  CA    . LEU A 1 475 ? 162.558 13.903  85.960  1.00 41.81 ? 562  LEU A CA    1 
ATOM   3639 C  C     . LEU A 1 475 ? 163.282 15.031  86.689  1.00 41.04 ? 562  LEU A C     1 
ATOM   3640 O  O     . LEU A 1 475 ? 162.681 15.742  87.505  1.00 38.84 ? 562  LEU A O     1 
ATOM   3641 C  CB    . LEU A 1 475 ? 162.925 12.537  86.555  1.00 40.65 ? 562  LEU A CB    1 
ATOM   3642 C  CG    . LEU A 1 475 ? 162.603 12.303  88.037  1.00 40.58 ? 562  LEU A CG    1 
ATOM   3643 C  CD1   . LEU A 1 475 ? 161.115 12.499  88.314  1.00 39.85 ? 562  LEU A CD1   1 
ATOM   3644 C  CD2   . LEU A 1 475 ? 163.051 10.917  88.475  1.00 40.96 ? 562  LEU A CD2   1 
ATOM   3645 N  N     . TYR A 1 476 ? 164.568 15.197  86.383  1.00 42.25 ? 563  TYR A N     1 
ATOM   3646 C  CA    . TYR A 1 476 ? 165.341 16.315  86.909  1.00 42.73 ? 563  TYR A CA    1 
ATOM   3647 C  C     . TYR A 1 476 ? 164.643 17.633  86.580  1.00 40.34 ? 563  TYR A C     1 
ATOM   3648 O  O     . TYR A 1 476 ? 164.490 18.486  87.452  1.00 40.25 ? 563  TYR A O     1 
ATOM   3649 C  CB    . TYR A 1 476 ? 166.771 16.297  86.361  1.00 46.27 ? 563  TYR A CB    1 
ATOM   3650 C  CG    . TYR A 1 476 ? 167.551 17.553  86.671  1.00 50.34 ? 563  TYR A CG    1 
ATOM   3651 C  CD1   . TYR A 1 476 ? 168.137 17.745  87.925  1.00 52.36 ? 563  TYR A CD1   1 
ATOM   3652 C  CD2   . TYR A 1 476 ? 167.697 18.557  85.712  1.00 52.62 ? 563  TYR A CD2   1 
ATOM   3653 C  CE1   . TYR A 1 476 ? 168.849 18.900  88.214  1.00 53.94 ? 563  TYR A CE1   1 
ATOM   3654 C  CE2   . TYR A 1 476 ? 168.405 19.715  85.990  1.00 53.84 ? 563  TYR A CE2   1 
ATOM   3655 C  CZ    . TYR A 1 476 ? 168.979 19.882  87.240  1.00 54.95 ? 563  TYR A CZ    1 
ATOM   3656 O  OH    . TYR A 1 476 ? 169.682 21.037  87.516  1.00 55.71 ? 563  TYR A OH    1 
ATOM   3657 N  N     . ALA A 1 477 ? 164.209 17.777  85.325  1.00 36.93 ? 564  ALA A N     1 
ATOM   3658 C  CA    . ALA A 1 477 ? 163.483 18.965  84.876  1.00 34.72 ? 564  ALA A CA    1 
ATOM   3659 C  C     . ALA A 1 477 ? 162.194 19.147  85.663  1.00 33.75 ? 564  ALA A C     1 
ATOM   3660 O  O     . ALA A 1 477 ? 161.934 20.230  86.182  1.00 31.15 ? 564  ALA A O     1 
ATOM   3661 C  CB    . ALA A 1 477 ? 163.184 18.882  83.385  1.00 35.75 ? 564  ALA A CB    1 
ATOM   3662 N  N     . ALA A 1 478 ? 161.404 18.074  85.760  1.00 32.18 ? 565  ALA A N     1 
ATOM   3663 C  CA    . ALA A 1 478 ? 160.148 18.082  86.503  1.00 31.11 ? 565  ALA A CA    1 
ATOM   3664 C  C     . ALA A 1 478 ? 160.331 18.590  87.930  1.00 29.68 ? 565  ALA A C     1 
ATOM   3665 O  O     . ALA A 1 478 ? 159.489 19.329  88.446  1.00 27.69 ? 565  ALA A O     1 
ATOM   3666 C  CB    . ALA A 1 478 ? 159.531 16.690  86.509  1.00 29.56 ? 565  ALA A CB    1 
ATOM   3667 N  N     . ARG A 1 479 ? 161.437 18.201  88.556  1.00 32.01 ? 566  ARG A N     1 
ATOM   3668 C  CA    . ARG A 1 479 ? 161.753 18.649  89.910  1.00 34.08 ? 566  ARG A CA    1 
ATOM   3669 C  C     . ARG A 1 479 ? 161.932 20.166  90.003  1.00 33.34 ? 566  ARG A C     1 
ATOM   3670 O  O     . ARG A 1 479 ? 161.427 20.807  90.936  1.00 32.74 ? 566  ARG A O     1 
ATOM   3671 C  CB    . ARG A 1 479 ? 162.982 17.911  90.438  1.00 37.01 ? 566  ARG A CB    1 
ATOM   3672 C  CG    . ARG A 1 479 ? 162.625 16.562  91.042  1.00 40.45 ? 566  ARG A CG    1 
ATOM   3673 C  CD    . ARG A 1 479 ? 163.721 15.507  90.790  1.00 43.05 ? 566  ARG A CD    1 
ATOM   3674 N  NE    . ARG A 1 479 ? 163.268 14.202  91.283  1.00 46.84 ? 566  ARG A NE    1 
ATOM   3675 C  CZ    . ARG A 1 479 ? 164.053 13.145  91.492  1.00 47.51 ? 566  ARG A CZ    1 
ATOM   3676 N  NH1   . ARG A 1 479 ? 165.356 13.212  91.258  1.00 47.44 ? 566  ARG A NH1   1 
ATOM   3677 N  NH2   . ARG A 1 479 ? 163.529 12.012  91.944  1.00 49.29 ? 566  ARG A NH2   1 
ATOM   3678 N  N     . GLN A 1 480 ? 162.622 20.747  89.020  1.00 30.59 ? 567  GLN A N     1 
ATOM   3679 C  CA    . GLN A 1 480 ? 162.863 22.192  89.006  1.00 31.37 ? 567  GLN A CA    1 
ATOM   3680 C  C     . GLN A 1 480 ? 161.570 22.979  88.827  1.00 30.42 ? 567  GLN A C     1 
ATOM   3681 O  O     . GLN A 1 480 ? 161.332 23.932  89.564  1.00 32.67 ? 567  GLN A O     1 
ATOM   3682 C  CB    . GLN A 1 480 ? 163.900 22.577  87.942  1.00 32.62 ? 567  GLN A CB    1 
ATOM   3683 C  CG    . GLN A 1 480 ? 165.097 21.636  87.843  1.00 35.08 ? 567  GLN A CG    1 
ATOM   3684 C  CD    . GLN A 1 480 ? 165.776 21.383  89.179  1.00 36.46 ? 567  GLN A CD    1 
ATOM   3685 O  OE1   . GLN A 1 480 ? 166.070 22.315  89.926  1.00 38.23 ? 567  GLN A OE1   1 
ATOM   3686 N  NE2   . GLN A 1 480 ? 166.020 20.112  89.487  1.00 36.94 ? 567  GLN A NE2   1 
ATOM   3687 N  N     . TYR A 1 481 ? 160.737 22.568  87.865  1.00 29.24 ? 568  TYR A N     1 
ATOM   3688 C  CA    . TYR A 1 481 ? 159.409 23.156  87.673  1.00 28.73 ? 568  TYR A CA    1 
ATOM   3689 C  C     . TYR A 1 481 ? 158.579 23.090  88.943  1.00 28.83 ? 568  TYR A C     1 
ATOM   3690 O  O     . TYR A 1 481 ? 157.905 24.059  89.316  1.00 28.31 ? 568  TYR A O     1 
ATOM   3691 C  CB    . TYR A 1 481 ? 158.633 22.412  86.589  1.00 32.22 ? 568  TYR A CB    1 
ATOM   3692 C  CG    . TYR A 1 481 ? 159.070 22.674  85.167  1.00 34.26 ? 568  TYR A CG    1 
ATOM   3693 C  CD1   . TYR A 1 481 ? 158.736 23.867  84.520  1.00 35.82 ? 568  TYR A CD1   1 
ATOM   3694 C  CD2   . TYR A 1 481 ? 159.783 21.711  84.453  1.00 36.20 ? 568  TYR A CD2   1 
ATOM   3695 C  CE1   . TYR A 1 481 ? 159.123 24.098  83.206  1.00 37.46 ? 568  TYR A CE1   1 
ATOM   3696 C  CE2   . TYR A 1 481 ? 160.173 21.933  83.144  1.00 38.04 ? 568  TYR A CE2   1 
ATOM   3697 C  CZ    . TYR A 1 481 ? 159.842 23.127  82.527  1.00 38.79 ? 568  TYR A CZ    1 
ATOM   3698 O  OH    . TYR A 1 481 ? 160.231 23.338  81.224  1.00 40.95 ? 568  TYR A OH    1 
ATOM   3699 N  N     . PHE A 1 482 ? 158.617 21.928  89.597  1.00 27.52 ? 569  PHE A N     1 
ATOM   3700 C  CA    . PHE A 1 482 ? 157.805 21.700  90.783  1.00 26.41 ? 569  PHE A CA    1 
ATOM   3701 C  C     . PHE A 1 482 ? 158.187 22.632  91.941  1.00 26.06 ? 569  PHE A C     1 
ATOM   3702 O  O     . PHE A 1 482 ? 157.333 23.322  92.511  1.00 25.92 ? 569  PHE A O     1 
ATOM   3703 C  CB    . PHE A 1 482 ? 157.893 20.225  91.212  1.00 25.17 ? 569  PHE A CB    1 
ATOM   3704 C  CG    . PHE A 1 482 ? 157.348 19.967  92.589  1.00 24.74 ? 569  PHE A CG    1 
ATOM   3705 C  CD1   . PHE A 1 482 ? 156.017 20.237  92.887  1.00 23.15 ? 569  PHE A CD1   1 
ATOM   3706 C  CD2   . PHE A 1 482 ? 158.170 19.463  93.593  1.00 24.87 ? 569  PHE A CD2   1 
ATOM   3707 C  CE1   . PHE A 1 482 ? 155.509 20.005  94.161  1.00 24.85 ? 569  PHE A CE1   1 
ATOM   3708 C  CE2   . PHE A 1 482 ? 157.670 19.235  94.871  1.00 23.27 ? 569  PHE A CE2   1 
ATOM   3709 C  CZ    . PHE A 1 482 ? 156.339 19.500  95.152  1.00 23.51 ? 569  PHE A CZ    1 
ATOM   3710 N  N     . VAL A 1 483 ? 159.466 22.641  92.288  1.00 28.10 ? 570  VAL A N     1 
ATOM   3711 C  CA    . VAL A 1 483 ? 159.953 23.434  93.421  1.00 29.82 ? 570  VAL A CA    1 
ATOM   3712 C  C     . VAL A 1 483 ? 159.828 24.933  93.150  1.00 30.44 ? 570  VAL A C     1 
ATOM   3713 O  O     . VAL A 1 483 ? 159.456 25.707  94.040  1.00 31.31 ? 570  VAL A O     1 
ATOM   3714 C  CB    . VAL A 1 483 ? 161.395 23.043  93.810  1.00 28.96 ? 570  VAL A CB    1 
ATOM   3715 C  CG1   . VAL A 1 483 ? 161.877 23.852  95.010  1.00 30.15 ? 570  VAL A CG1   1 
ATOM   3716 C  CG2   . VAL A 1 483 ? 161.455 21.557  94.137  1.00 29.75 ? 570  VAL A CG2   1 
ATOM   3717 N  N     . GLN A 1 484 ? 160.109 25.333  91.912  1.00 32.40 ? 571  GLN A N     1 
ATOM   3718 C  CA    . GLN A 1 484 ? 159.892 26.712  91.482  1.00 31.87 ? 571  GLN A CA    1 
ATOM   3719 C  C     . GLN A 1 484 ? 158.432 27.112  91.679  1.00 31.92 ? 571  GLN A C     1 
ATOM   3720 O  O     . GLN A 1 484 ? 158.145 28.192  92.204  1.00 34.04 ? 571  GLN A O     1 
ATOM   3721 C  CB    . GLN A 1 484 ? 160.313 26.899  90.018  1.00 33.46 ? 571  GLN A CB    1 
ATOM   3722 C  CG    . GLN A 1 484 ? 160.275 28.347  89.531  1.00 34.47 ? 571  GLN A CG    1 
ATOM   3723 C  CD    . GLN A 1 484 ? 161.151 29.264  90.361  1.00 34.22 ? 571  GLN A CD    1 
ATOM   3724 O  OE1   . GLN A 1 484 ? 162.367 29.078  90.438  1.00 35.40 ? 571  GLN A OE1   1 
ATOM   3725 N  NE2   . GLN A 1 484 ? 160.532 30.259  90.996  1.00 33.65 ? 571  GLN A NE2   1 
ATOM   3726 N  N     . TRP A 1 485 ? 157.518 26.233  91.265  1.00 29.76 ? 572  TRP A N     1 
ATOM   3727 C  CA    . TRP A 1 485 ? 156.083 26.439  91.444  1.00 28.94 ? 572  TRP A CA    1 
ATOM   3728 C  C     . TRP A 1 485 ? 155.710 26.591  92.901  1.00 29.48 ? 572  TRP A C     1 
ATOM   3729 O  O     . TRP A 1 485 ? 154.876 27.435  93.249  1.00 28.23 ? 572  TRP A O     1 
ATOM   3730 C  CB    . TRP A 1 485 ? 155.313 25.287  90.793  1.00 27.78 ? 572  TRP A CB    1 
ATOM   3731 C  CG    . TRP A 1 485 ? 153.814 25.369  90.906  1.00 28.23 ? 572  TRP A CG    1 
ATOM   3732 C  CD1   . TRP A 1 485 ? 152.972 26.322  90.346  1.00 28.46 ? 572  TRP A CD1   1 
ATOM   3733 C  CD2   . TRP A 1 485 ? 152.919 24.434  91.609  1.00 28.15 ? 572  TRP A CD2   1 
ATOM   3734 N  NE1   . TRP A 1 485 ? 151.661 26.061  90.656  1.00 28.22 ? 572  TRP A NE1   1 
ATOM   3735 C  CE2   . TRP A 1 485 ? 151.558 24.934  91.401  1.00 28.61 ? 572  TRP A CE2   1 
ATOM   3736 C  CE3   . TRP A 1 485 ? 153.107 23.268  92.354  1.00 29.04 ? 572  TRP A CE3   1 
ATOM   3737 C  CZ2   . TRP A 1 485 ? 150.444 24.288  91.930  1.00 27.93 ? 572  TRP A CZ2   1 
ATOM   3738 C  CZ3   . TRP A 1 485 ? 151.977 22.621  92.874  1.00 26.71 ? 572  TRP A CZ3   1 
ATOM   3739 C  CH2   . TRP A 1 485 ? 150.680 23.124  92.677  1.00 28.58 ? 572  TRP A CH2   1 
ATOM   3740 N  N     . CYS A 1 486 ? 156.327 25.780  93.764  1.00 30.72 ? 573  CYS A N     1 
ATOM   3741 C  CA    . CYS A 1 486 ? 156.094 25.866  95.213  1.00 30.87 ? 573  CYS A CA    1 
ATOM   3742 C  C     . CYS A 1 486 ? 156.514 27.236  95.746  1.00 32.89 ? 573  CYS A C     1 
ATOM   3743 O  O     . CYS A 1 486 ? 155.775 27.864  96.509  1.00 33.15 ? 573  CYS A O     1 
ATOM   3744 C  CB    . CYS A 1 486 ? 156.838 24.752  95.954  1.00 30.64 ? 573  CYS A CB    1 
ATOM   3745 S  SG    . CYS A 1 486 ? 156.128 23.104  95.697  1.00 27.67 ? 573  CYS A SG    1 
ATOM   3746 N  N     . ALA A 1 487 ? 157.699 27.684  95.334  1.00 34.09 ? 574  ALA A N     1 
ATOM   3747 C  CA    . ALA A 1 487 ? 158.178 29.037  95.642  1.00 36.40 ? 574  ALA A CA    1 
ATOM   3748 C  C     . ALA A 1 487 ? 157.155 30.097  95.217  1.00 37.28 ? 574  ALA A C     1 
ATOM   3749 O  O     . ALA A 1 487 ? 156.682 30.867  96.056  1.00 38.40 ? 574  ALA A O     1 
ATOM   3750 C  CB    . ALA A 1 487 ? 159.530 29.291  94.986  1.00 36.43 ? 574  ALA A CB    1 
ATOM   3751 N  N     . ASP A 1 488 ? 156.788 30.092  93.931  1.00 37.71 ? 575  ASP A N     1 
ATOM   3752 C  CA    . ASP A 1 488 ? 155.863 31.075  93.343  1.00 36.15 ? 575  ASP A CA    1 
ATOM   3753 C  C     . ASP A 1 488 ? 154.526 31.157  94.062  1.00 36.18 ? 575  ASP A C     1 
ATOM   3754 O  O     . ASP A 1 488 ? 153.933 32.232  94.165  1.00 36.95 ? 575  ASP A O     1 
ATOM   3755 C  CB    . ASP A 1 488 ? 155.586 30.753  91.869  1.00 36.72 ? 575  ASP A CB    1 
ATOM   3756 C  CG    . ASP A 1 488 ? 156.841 30.694  91.018  1.00 38.83 ? 575  ASP A CG    1 
ATOM   3757 O  OD1   . ASP A 1 488 ? 157.932 31.091  91.489  1.00 40.09 ? 575  ASP A OD1   1 
ATOM   3758 O  OD2   . ASP A 1 488 ? 156.725 30.229  89.862  1.00 40.84 ? 575  ASP A OD2   1 
ATOM   3759 N  N     . ARG A 1 489 ? 154.040 30.008  94.525  1.00 32.34 ? 576  ARG A N     1 
ATOM   3760 C  CA    . ARG A 1 489 ? 152.734 29.921  95.160  1.00 33.40 ? 576  ARG A CA    1 
ATOM   3761 C  C     . ARG A 1 489 ? 152.808 30.122  96.670  1.00 32.77 ? 576  ARG A C     1 
ATOM   3762 O  O     . ARG A 1 489 ? 151.781 30.153  97.346  1.00 32.49 ? 576  ARG A O     1 
ATOM   3763 C  CB    . ARG A 1 489 ? 152.124 28.554  94.858  1.00 32.42 ? 576  ARG A CB    1 
ATOM   3764 C  CG    . ARG A 1 489 ? 151.627 28.388  93.435  1.00 32.07 ? 576  ARG A CG    1 
ATOM   3765 C  CD    . ARG A 1 489 ? 150.370 29.229  93.281  1.00 32.29 ? 576  ARG A CD    1 
ATOM   3766 N  NE    . ARG A 1 489 ? 149.287 28.435  92.736  1.00 32.83 ? 576  ARG A NE    1 
ATOM   3767 C  CZ    . ARG A 1 489 ? 148.124 28.231  93.349  1.00 33.08 ? 576  ARG A CZ    1 
ATOM   3768 N  NH1   . ARG A 1 489 ? 147.195 27.495  92.757  1.00 31.29 ? 576  ARG A NH1   1 
ATOM   3769 N  NH2   . ARG A 1 489 ? 147.885 28.758  94.543  1.00 32.89 ? 576  ARG A NH2   1 
ATOM   3770 N  N     . ASN A 1 490 ? 154.028 30.257  97.191  1.00 34.67 ? 577  ASN A N     1 
ATOM   3771 C  CA    . ASN A 1 490 ? 154.266 30.323  98.643  1.00 36.81 ? 577  ASN A CA    1 
ATOM   3772 C  C     . ASN A 1 490 ? 153.729 29.085  99.360  1.00 35.41 ? 577  ASN A C     1 
ATOM   3773 O  O     . ASN A 1 490 ? 153.166 29.172  100.453 1.00 35.12 ? 577  ASN A O     1 
ATOM   3774 C  CB    . ASN A 1 490 ? 153.687 31.608  99.247  1.00 39.73 ? 577  ASN A CB    1 
ATOM   3775 C  CG    . ASN A 1 490 ? 154.377 32.857  98.722  1.00 43.52 ? 577  ASN A CG    1 
ATOM   3776 O  OD1   . ASN A 1 490 ? 155.567 32.836  98.393  1.00 45.71 ? 577  ASN A OD1   1 
ATOM   3777 N  ND2   . ASN A 1 490 ? 153.630 33.950  98.632  1.00 45.56 ? 577  ASN A ND2   1 
ATOM   3778 N  N     . PHE A 1 491 ? 153.905 27.940  98.704  1.00 32.18 ? 578  PHE A N     1 
ATOM   3779 C  CA    . PHE A 1 491 ? 153.591 26.638  99.277  1.00 32.20 ? 578  PHE A CA    1 
ATOM   3780 C  C     . PHE A 1 491 ? 154.775 26.220  100.142 1.00 32.08 ? 578  PHE A C     1 
ATOM   3781 O  O     . PHE A 1 491 ? 155.850 26.821  100.054 1.00 32.83 ? 578  PHE A O     1 
ATOM   3782 C  CB    . PHE A 1 491 ? 153.350 25.606  98.160  1.00 30.43 ? 578  PHE A CB    1 
ATOM   3783 C  CG    . PHE A 1 491 ? 152.057 25.796  97.408  1.00 29.32 ? 578  PHE A CG    1 
ATOM   3784 C  CD1   . PHE A 1 491 ? 151.004 26.534  97.944  1.00 29.86 ? 578  PHE A CD1   1 
ATOM   3785 C  CD2   . PHE A 1 491 ? 151.875 25.183  96.167  1.00 28.75 ? 578  PHE A CD2   1 
ATOM   3786 C  CE1   . PHE A 1 491 ? 149.810 26.679  97.247  1.00 29.23 ? 578  PHE A CE1   1 
ATOM   3787 C  CE2   . PHE A 1 491 ? 150.687 25.328  95.468  1.00 29.06 ? 578  PHE A CE2   1 
ATOM   3788 C  CZ    . PHE A 1 491 ? 149.652 26.076  96.007  1.00 27.71 ? 578  PHE A CZ    1 
ATOM   3789 N  N     . THR A 1 492 ? 154.589 25.193  100.970 1.00 28.87 ? 579  THR A N     1 
ATOM   3790 C  CA    . THR A 1 492 ? 155.660 24.740  101.860 1.00 27.94 ? 579  THR A CA    1 
ATOM   3791 C  C     . THR A 1 492 ? 156.805 24.129  101.059 1.00 29.47 ? 579  THR A C     1 
ATOM   3792 O  O     . THR A 1 492 ? 156.607 23.614  99.953  1.00 30.07 ? 579  THR A O     1 
ATOM   3793 C  CB    . THR A 1 492 ? 155.154 23.727  102.913 1.00 27.11 ? 579  THR A CB    1 
ATOM   3794 O  OG1   . THR A 1 492 ? 154.871 22.479  102.272 1.00 25.11 ? 579  THR A OG1   1 
ATOM   3795 C  CG2   . THR A 1 492 ? 153.897 24.248  103.608 1.00 24.89 ? 579  THR A CG2   1 
ATOM   3796 N  N     . LYS A 1 493 ? 158.005 24.215  101.620 1.00 29.25 ? 580  LYS A N     1 
ATOM   3797 C  CA    . LYS A 1 493 ? 159.197 23.658  101.016 1.00 31.42 ? 580  LYS A CA    1 
ATOM   3798 C  C     . LYS A 1 493 ? 159.149 22.131  101.052 1.00 32.54 ? 580  LYS A C     1 
ATOM   3799 O  O     . LYS A 1 493 ? 159.009 21.538  102.130 1.00 32.02 ? 580  LYS A O     1 
ATOM   3800 C  CB    . LYS A 1 493 ? 160.424 24.148  101.783 1.00 32.60 ? 580  LYS A CB    1 
ATOM   3801 C  CG    . LYS A 1 493 ? 161.732 23.502  101.369 1.00 35.02 ? 580  LYS A CG    1 
ATOM   3802 C  CD    . LYS A 1 493 ? 162.780 23.756  102.432 1.00 36.49 ? 580  LYS A CD    1 
ATOM   3803 C  CE    . LYS A 1 493 ? 164.047 22.980  102.144 1.00 37.98 ? 580  LYS A CE    1 
ATOM   3804 N  NZ    . LYS A 1 493 ? 165.079 23.335  103.152 1.00 40.28 ? 580  LYS A NZ    1 
ATOM   3805 N  N     . PRO A 1 494 ? 159.265 21.490  99.876  1.00 31.28 ? 581  PRO A N     1 
ATOM   3806 C  CA    . PRO A 1 494 ? 159.355 20.029  99.802  1.00 31.10 ? 581  PRO A CA    1 
ATOM   3807 C  C     . PRO A 1 494 ? 160.471 19.505  100.697 1.00 31.54 ? 581  PRO A C     1 
ATOM   3808 O  O     . PRO A 1 494 ? 161.539 20.118  100.771 1.00 31.54 ? 581  PRO A O     1 
ATOM   3809 C  CB    . PRO A 1 494 ? 159.698 19.782  98.331  1.00 32.06 ? 581  PRO A CB    1 
ATOM   3810 C  CG    . PRO A 1 494 ? 159.037 20.919  97.622  1.00 31.60 ? 581  PRO A CG    1 
ATOM   3811 C  CD    . PRO A 1 494 ? 159.220 22.104  98.534  1.00 31.61 ? 581  PRO A CD    1 
ATOM   3812 N  N     . GLN A 1 495 ? 160.220 18.380  101.369 1.00 30.36 ? 582  GLN A N     1 
ATOM   3813 C  CA    . GLN A 1 495 ? 161.176 17.815  102.326 1.00 29.42 ? 582  GLN A CA    1 
ATOM   3814 C  C     . GLN A 1 495 ? 162.530 17.492  101.705 1.00 29.97 ? 582  GLN A C     1 
ATOM   3815 O  O     . GLN A 1 495 ? 163.563 17.667  102.352 1.00 30.23 ? 582  GLN A O     1 
ATOM   3816 C  CB    . GLN A 1 495 ? 160.591 16.576  103.016 1.00 29.22 ? 582  GLN A CB    1 
ATOM   3817 C  CG    . GLN A 1 495 ? 159.280 16.852  103.726 1.00 31.25 ? 582  GLN A CG    1 
ATOM   3818 C  CD    . GLN A 1 495 ? 158.610 15.597  104.257 1.00 32.17 ? 582  GLN A CD    1 
ATOM   3819 O  OE1   . GLN A 1 495 ? 159.062 14.476  104.010 1.00 32.66 ? 582  GLN A OE1   1 
ATOM   3820 N  NE2   . GLN A 1 495 ? 157.513 15.782  104.979 1.00 31.86 ? 582  GLN A NE2   1 
ATOM   3821 N  N     . ASP A 1 496 ? 162.531 17.033  100.454 1.00 27.67 ? 583  ASP A N     1 
ATOM   3822 C  CA    . ASP A 1 496 ? 163.791 16.780  99.743  1.00 29.72 ? 583  ASP A CA    1 
ATOM   3823 C  C     . ASP A 1 496 ? 164.232 17.991  98.904  1.00 31.53 ? 583  ASP A C     1 
ATOM   3824 O  O     . ASP A 1 496 ? 165.089 17.856  98.032  1.00 32.73 ? 583  ASP A O     1 
ATOM   3825 C  CB    . ASP A 1 496 ? 163.673 15.543  98.837  1.00 31.11 ? 583  ASP A CB    1 
ATOM   3826 C  CG    . ASP A 1 496 ? 162.518 15.638  97.846  1.00 32.60 ? 583  ASP A CG    1 
ATOM   3827 O  OD1   . ASP A 1 496 ? 161.854 16.698  97.766  1.00 31.33 ? 583  ASP A OD1   1 
ATOM   3828 O  OD2   . ASP A 1 496 ? 162.272 14.636  97.142  1.00 34.46 ? 583  ASP A OD2   1 
ATOM   3829 N  N     . GLY A 1 497 ? 163.652 19.159  99.187  1.00 34.89 ? 584  GLY A N     1 
ATOM   3830 C  CA    . GLY A 1 497 ? 163.814 20.356  98.347  1.00 38.13 ? 584  GLY A CA    1 
ATOM   3831 C  C     . GLY A 1 497 ? 165.240 20.751  97.994  1.00 41.00 ? 584  GLY A C     1 
ATOM   3832 O  O     . GLY A 1 497 ? 165.527 21.123  96.848  1.00 43.49 ? 584  GLY A O     1 
ATOM   3833 N  N     . ASP A 1 498 ? 166.134 20.668  98.977  1.00 41.52 ? 585  ASP A N     1 
ATOM   3834 C  CA    . ASP A 1 498 ? 167.531 21.054  98.783  1.00 43.22 ? 585  ASP A CA    1 
ATOM   3835 C  C     . ASP A 1 498 ? 168.328 20.009  98.018  1.00 43.83 ? 585  ASP A C     1 
ATOM   3836 O  O     . ASP A 1 498 ? 169.288 20.341  97.317  1.00 44.06 ? 585  ASP A O     1 
ATOM   3837 C  CB    . ASP A 1 498 ? 168.202 21.336  100.126 1.00 44.63 ? 585  ASP A CB    1 
ATOM   3838 C  CG    . ASP A 1 498 ? 167.747 22.642  100.739 1.00 46.38 ? 585  ASP A CG    1 
ATOM   3839 O  OD1   . ASP A 1 498 ? 167.872 23.691  100.074 1.00 49.06 ? 585  ASP A OD1   1 
ATOM   3840 O  OD2   . ASP A 1 498 ? 167.270 22.628  101.889 1.00 46.15 ? 585  ASP A OD2   1 
ATOM   3841 N  N     . VAL A 1 499 ? 167.935 18.743  98.157  1.00 41.90 ? 586  VAL A N     1 
ATOM   3842 C  CA    . VAL A 1 499 ? 168.614 17.671  97.433  1.00 41.68 ? 586  VAL A CA    1 
ATOM   3843 C  C     . VAL A 1 499 ? 168.169 17.653  95.964  1.00 41.25 ? 586  VAL A C     1 
ATOM   3844 O  O     . VAL A 1 499 ? 169.010 17.576  95.069  1.00 41.39 ? 586  VAL A O     1 
ATOM   3845 C  CB    . VAL A 1 499 ? 168.436 16.289  98.117  1.00 40.58 ? 586  VAL A CB    1 
ATOM   3846 C  CG1   . VAL A 1 499 ? 169.304 15.235  97.439  1.00 41.09 ? 586  VAL A CG1   1 
ATOM   3847 C  CG2   . VAL A 1 499 ? 168.805 16.372  99.596  1.00 40.26 ? 586  VAL A CG2   1 
ATOM   3848 N  N     . ILE A 1 500 ? 166.861 17.758  95.716  1.00 40.86 ? 587  ILE A N     1 
ATOM   3849 C  CA    . ILE A 1 500 ? 166.343 17.676  94.338  1.00 40.87 ? 587  ILE A CA    1 
ATOM   3850 C  C     . ILE A 1 500 ? 166.470 18.973  93.525  1.00 41.10 ? 587  ILE A C     1 
ATOM   3851 O  O     . ILE A 1 500 ? 166.757 18.923  92.329  1.00 41.64 ? 587  ILE A O     1 
ATOM   3852 C  CB    . ILE A 1 500 ? 164.884 17.147  94.265  1.00 39.79 ? 587  ILE A CB    1 
ATOM   3853 C  CG1   . ILE A 1 500 ? 163.911 18.063  95.026  1.00 38.32 ? 587  ILE A CG1   1 
ATOM   3854 C  CG2   . ILE A 1 500 ? 164.814 15.702  94.756  1.00 40.37 ? 587  ILE A CG2   1 
ATOM   3855 C  CD1   . ILE A 1 500 ? 162.484 18.024  94.511  1.00 35.89 ? 587  ILE A CD1   1 
ATOM   3856 N  N     . ALA A 1 501 ? 166.252 20.120  94.165  1.00 40.48 ? 588  ALA A N     1 
ATOM   3857 C  CA    . ALA A 1 501 ? 166.288 21.403  93.459  1.00 40.19 ? 588  ALA A CA    1 
ATOM   3858 C  C     . ALA A 1 501 ? 167.158 22.416  94.201  1.00 39.57 ? 588  ALA A C     1 
ATOM   3859 O  O     . ALA A 1 501 ? 166.650 23.429  94.705  1.00 39.99 ? 588  ALA A O     1 
ATOM   3860 C  CB    . ALA A 1 501 ? 164.878 21.940  93.256  1.00 39.73 ? 588  ALA A CB    1 
ATOM   3861 N  N     . PRO A 1 502 ? 168.477 22.153  94.252  1.00 37.45 ? 589  PRO A N     1 
ATOM   3862 C  CA    . PRO A 1 502 ? 169.403 22.981  95.036  1.00 40.61 ? 589  PRO A CA    1 
ATOM   3863 C  C     . PRO A 1 502 ? 169.566 24.411  94.504  1.00 43.21 ? 589  PRO A C     1 
ATOM   3864 O  O     . PRO A 1 502 ? 169.882 25.317  95.274  1.00 44.76 ? 589  PRO A O     1 
ATOM   3865 C  CB    . PRO A 1 502 ? 170.734 22.221  94.966  1.00 38.68 ? 589  PRO A CB    1 
ATOM   3866 C  CG    . PRO A 1 502 ? 170.561 21.126  93.969  1.00 37.88 ? 589  PRO A CG    1 
ATOM   3867 C  CD    . PRO A 1 502 ? 169.173 21.156  93.416  1.00 37.24 ? 589  PRO A CD    1 
ATOM   3868 N  N     . LEU A 1 503 ? 169.335 24.612  93.210  1.00 46.42 ? 590  LEU A N     1 
ATOM   3869 C  CA    . LEU A 1 503 ? 169.476 25.940  92.608  1.00 47.97 ? 590  LEU A CA    1 
ATOM   3870 C  C     . LEU A 1 503 ? 168.173 26.738  92.694  1.00 48.44 ? 590  LEU A C     1 
ATOM   3871 O  O     . LEU A 1 503 ? 168.088 27.865  92.196  1.00 49.90 ? 590  LEU A O     1 
ATOM   3872 C  CB    . LEU A 1 503 ? 169.972 25.822  91.156  1.00 48.96 ? 590  LEU A CB    1 
ATOM   3873 C  CG    . LEU A 1 503 ? 171.230 24.944  90.930  1.00 50.40 ? 590  LEU A CG    1 
ATOM   3874 C  CD1   . LEU A 1 503 ? 171.558 24.766  89.421  1.00 49.57 ? 590  LEU A CD1   1 
ATOM   3875 C  CD2   . LEU A 1 503 ? 172.467 25.481  91.681  1.00 49.93 ? 590  LEU A CD2   1 
ATOM   3876 N  N     . ILE A 1 504 ? 167.170 26.153  93.348  1.00 46.60 ? 591  ILE A N     1 
ATOM   3877 C  CA    . ILE A 1 504 ? 165.848 26.777  93.479  1.00 47.65 ? 591  ILE A CA    1 
ATOM   3878 C  C     . ILE A 1 504 ? 165.542 27.209  94.917  1.00 51.18 ? 591  ILE A C     1 
ATOM   3879 O  O     . ILE A 1 504 ? 165.032 28.308  95.132  1.00 50.70 ? 591  ILE A O     1 
ATOM   3880 C  CB    . ILE A 1 504 ? 164.715 25.843  92.965  1.00 46.74 ? 591  ILE A CB    1 
ATOM   3881 C  CG1   . ILE A 1 504 ? 165.048 25.263  91.582  1.00 45.34 ? 591  ILE A CG1   1 
ATOM   3882 C  CG2   . ILE A 1 504 ? 163.360 26.572  92.941  1.00 45.67 ? 591  ILE A CG2   1 
ATOM   3883 C  CD1   . ILE A 1 504 ? 165.125 26.290  90.462  1.00 48.40 ? 591  ILE A CD1   1 
ATOM   3884 N  N     . THR A 1 505 ? 165.854 26.352  95.892  1.00 52.93 ? 592  THR A N     1 
ATOM   3885 C  CA    . THR A 1 505 ? 165.488 26.616  97.303  1.00 55.42 ? 592  THR A CA    1 
ATOM   3886 C  C     . THR A 1 505 ? 166.068 27.898  97.943  1.00 59.24 ? 592  THR A C     1 
ATOM   3887 O  O     . THR A 1 505 ? 165.370 28.547  98.731  1.00 61.48 ? 592  THR A O     1 
ATOM   3888 C  CB    . THR A 1 505 ? 165.763 25.394  98.218  1.00 53.65 ? 592  THR A CB    1 
ATOM   3889 O  OG1   . THR A 1 505 ? 167.084 24.887  97.972  1.00 51.45 ? 592  THR A OG1   1 
ATOM   3890 C  CG2   . THR A 1 505 ? 164.742 24.286  97.966  1.00 49.32 ? 592  THR A CG2   1 
ATOM   3891 N  N     . PRO A 1 506 ? 167.331 28.271  97.615  1.00 61.06 ? 593  PRO A N     1 
ATOM   3892 C  CA    . PRO A 1 506 ? 167.899 29.523  98.145  1.00 61.48 ? 593  PRO A CA    1 
ATOM   3893 C  C     . PRO A 1 506 ? 167.081 30.777  97.809  1.00 62.35 ? 593  PRO A C     1 
ATOM   3894 O  O     . PRO A 1 506 ? 166.903 31.645  98.679  1.00 63.55 ? 593  PRO A O     1 
ATOM   3895 C  CB    . PRO A 1 506 ? 169.276 29.594  97.477  1.00 61.00 ? 593  PRO A CB    1 
ATOM   3896 C  CG    . PRO A 1 506 ? 169.632 28.170  97.218  1.00 61.83 ? 593  PRO A CG    1 
ATOM   3897 C  CD    . PRO A 1 506 ? 168.334 27.515  96.832  1.00 61.66 ? 593  PRO A CD    1 
ATOM   3898 N  N     . GLN A 1 507 ? 166.570 30.871  96.578  1.00 63.75 ? 594  GLN A N     1 
ATOM   3899 C  CA    . GLN A 1 507 ? 165.750 32.027  96.146  1.00 63.10 ? 594  GLN A CA    1 
ATOM   3900 C  C     . GLN A 1 507 ? 164.632 32.372  97.143  1.00 62.77 ? 594  GLN A C     1 
ATOM   3901 O  O     . GLN A 1 507 ? 164.257 33.537  97.286  1.00 61.92 ? 594  GLN A O     1 
ATOM   3902 C  CB    . GLN A 1 507 ? 165.159 31.795  94.744  1.00 63.21 ? 594  GLN A CB    1 
ATOM   3903 C  CG    . GLN A 1 507 ? 163.963 30.846  94.710  1.00 63.63 ? 594  GLN A CG    1 
ATOM   3904 C  CD    . GLN A 1 507 ? 163.290 30.770  93.355  1.00 63.79 ? 594  GLN A CD    1 
ATOM   3905 O  OE1   . GLN A 1 507 ? 162.393 31.560  93.047  1.00 62.29 ? 594  GLN A OE1   1 
ATOM   3906 N  NE2   . GLN A 1 507 ? 163.705 29.805  92.545  1.00 62.30 ? 594  GLN A NE2   1 
ATOM   3907 N  N     . LYS A 1 508 ? 164.112 31.350  97.825  1.00 61.39 ? 595  LYS A N     1 
ATOM   3908 C  CA    . LYS A 1 508 ? 163.057 31.526  98.811  1.00 60.08 ? 595  LYS A CA    1 
ATOM   3909 C  C     . LYS A 1 508 ? 163.682 31.674  100.194 1.00 63.84 ? 595  LYS A C     1 
ATOM   3910 O  O     . LYS A 1 508 ? 164.299 30.731  100.710 1.00 65.42 ? 595  LYS A O     1 
ATOM   3911 C  CB    . LYS A 1 508 ? 162.101 30.327  98.774  1.00 55.98 ? 595  LYS A CB    1 
ATOM   3912 C  CG    . LYS A 1 508 ? 160.714 30.605  99.331  1.00 53.57 ? 595  LYS A CG    1 
ATOM   3913 C  CD    . LYS A 1 508 ? 159.925 31.470  98.368  1.00 52.11 ? 595  LYS A CD    1 
ATOM   3914 C  CE    . LYS A 1 508 ? 158.508 31.698  98.843  1.00 50.84 ? 595  LYS A CE    1 
ATOM   3915 N  NZ    . LYS A 1 508 ? 157.855 32.645  97.899  1.00 51.62 ? 595  LYS A NZ    1 
ATOM   3916 N  N     . LYS A 1 509 ? 163.540 32.863  100.786 1.00 66.18 ? 596  LYS A N     1 
ATOM   3917 C  CA    . LYS A 1 509 ? 164.048 33.099  102.145 1.00 66.12 ? 596  LYS A CA    1 
ATOM   3918 C  C     . LYS A 1 509 ? 163.014 32.703  103.205 1.00 65.78 ? 596  LYS A C     1 
ATOM   3919 O  O     . LYS A 1 509 ? 163.356 32.519  104.376 1.00 64.62 ? 596  LYS A O     1 
ATOM   3920 C  CB    . LYS A 1 509 ? 164.521 34.562  102.339 1.00 66.89 ? 596  LYS A CB    1 
ATOM   3921 C  CG    . LYS A 1 509 ? 165.247 34.798  103.669 1.00 67.30 ? 596  LYS A CG    1 
ATOM   3922 C  CD    . LYS A 1 509 ? 166.061 36.114  103.699 1.00 67.07 ? 596  LYS A CD    1 
ATOM   3923 C  CE    . LYS A 1 509 ? 167.521 35.849  103.162 1.00 65.97 ? 596  LYS A CE    1 
ATOM   3924 N  NZ    . LYS A 1 509 ? 168.414 36.902  103.911 1.00 64.96 ? 596  LYS A NZ    1 
ATOM   3925 N  N     . GLU A 1 510 ? 161.755 32.558  102.784 1.00 65.77 ? 597  GLU A N     1 
ATOM   3926 C  CA    . GLU A 1 510 ? 160.691 32.066  103.676 1.00 63.76 ? 597  GLU A CA    1 
ATOM   3927 C  C     . GLU A 1 510 ? 160.941 30.605  104.091 1.00 62.21 ? 597  GLU A C     1 
ATOM   3928 O  O     . GLU A 1 510 ? 160.336 30.112  105.048 1.00 62.83 ? 597  GLU A O     1 
ATOM   3929 C  CB    . GLU A 1 510 ? 159.311 32.190  103.004 1.00 64.74 ? 597  GLU A CB    1 
ATOM   3930 C  CG    . GLU A 1 510 ? 158.808 33.630  102.846 1.00 64.87 ? 597  GLU A CG    1 
ATOM   3931 C  CD    . GLU A 1 510 ? 159.091 34.208  101.455 1.00 66.05 ? 597  GLU A CD    1 
ATOM   3932 O  OE1   . GLU A 1 510 ? 160.178 33.948  100.885 1.00 66.85 ? 597  GLU A OE1   1 
ATOM   3933 O  OE2   . GLU A 1 510 ? 158.219 34.934  100.923 1.00 66.50 ? 597  GLU A OE2   1 
ATOM   3934 N  N     . TRP A 1 511 ? 161.843 29.935  103.368 1.00 58.03 ? 598  TRP A N     1 
ATOM   3935 C  CA    . TRP A 1 511 ? 162.125 28.511  103.574 1.00 55.28 ? 598  TRP A CA    1 
ATOM   3936 C  C     . TRP A 1 511 ? 163.353 28.225  104.391 1.00 58.64 ? 598  TRP A C     1 
ATOM   3937 O  O     . TRP A 1 511 ? 163.672 27.059  104.639 1.00 60.79 ? 598  TRP A O     1 
ATOM   3938 C  CB    . TRP A 1 511 ? 162.246 27.785  102.235 1.00 47.05 ? 598  TRP A CB    1 
ATOM   3939 C  CG    . TRP A 1 511 ? 160.951 27.627  101.480 1.00 41.49 ? 598  TRP A CG    1 
ATOM   3940 C  CD1   . TRP A 1 511 ? 159.655 27.868  101.937 1.00 40.23 ? 598  TRP A CD1   1 
ATOM   3941 C  CD2   . TRP A 1 511 ? 160.785 27.132  100.107 1.00 37.04 ? 598  TRP A CD2   1 
ATOM   3942 N  NE1   . TRP A 1 511 ? 158.732 27.590  100.960 1.00 39.99 ? 598  TRP A NE1   1 
ATOM   3943 C  CE2   . TRP A 1 511 ? 159.343 27.141  99.839  1.00 38.06 ? 598  TRP A CE2   1 
ATOM   3944 C  CE3   . TRP A 1 511 ? 161.657 26.706  99.110  1.00 37.63 ? 598  TRP A CE3   1 
ATOM   3945 C  CZ2   . TRP A 1 511 ? 158.820 26.741  98.616  1.00 37.27 ? 598  TRP A CZ2   1 
ATOM   3946 C  CZ3   . TRP A 1 511 ? 161.119 26.305  97.880  1.00 37.44 ? 598  TRP A CZ3   1 
ATOM   3947 C  CH2   . TRP A 1 511 ? 159.735 26.319  97.643  1.00 34.88 ? 598  TRP A CH2   1 
ATOM   3948 N  N     . ASN A 1 512 ? 164.061 29.270  104.813 1.00 61.95 ? 599  ASN A N     1 
ATOM   3949 C  CA    . ASN A 1 512 ? 165.312 29.090  105.557 1.00 63.72 ? 599  ASN A CA    1 
ATOM   3950 C  C     . ASN A 1 512 ? 165.449 30.045  106.744 1.00 64.47 ? 599  ASN A C     1 
ATOM   3951 O  O     . ASN A 1 512 ? 166.198 29.754  107.700 1.00 66.25 ? 599  ASN A O     1 
ATOM   3952 C  CB    . ASN A 1 512 ? 166.522 29.208  104.620 1.00 64.22 ? 599  ASN A CB    1 
ATOM   3953 C  CG    . ASN A 1 512 ? 166.445 30.430  103.711 1.00 65.08 ? 599  ASN A CG    1 
ATOM   3954 O  OD1   . ASN A 1 512 ? 166.101 31.530  104.157 1.00 66.68 ? 599  ASN A OD1   1 
ATOM   3955 N  ND2   . ASN A 1 512 ? 166.772 30.240  102.430 1.00 64.40 ? 599  ASN A ND2   1 
ATOM   3956 N  N     . ASN B 1 15  ? 178.884 8.333   91.761  1.00 54.10 ? 102  ASN B N     1 
ATOM   3957 C  CA    . ASN B 1 15  ? 178.576 8.995   93.067  1.00 53.76 ? 102  ASN B CA    1 
ATOM   3958 C  C     . ASN B 1 15  ? 179.640 8.674   94.126  1.00 51.89 ? 102  ASN B C     1 
ATOM   3959 O  O     . ASN B 1 15  ? 180.489 9.518   94.438  1.00 53.58 ? 102  ASN B O     1 
ATOM   3960 C  CB    . ASN B 1 15  ? 177.163 8.620   93.562  1.00 56.16 ? 102  ASN B CB    1 
ATOM   3961 C  CG    . ASN B 1 15  ? 176.477 9.792   94.283  1.00 57.52 ? 102  ASN B CG    1 
ATOM   3962 O  OD1   . ASN B 1 15  ? 176.617 10.962  93.896  1.00 58.71 ? 102  ASN B OD1   1 
ATOM   3963 N  ND2   . ASN B 1 15  ? 175.715 9.474   95.329  1.00 58.80 ? 102  ASN B ND2   1 
ATOM   3964 N  N     . LEU B 1 16  ? 179.609 7.451   94.654  1.00 47.96 ? 103  LEU B N     1 
ATOM   3965 C  CA    . LEU B 1 16  ? 180.496 7.065   95.758  1.00 44.44 ? 103  LEU B CA    1 
ATOM   3966 C  C     . LEU B 1 16  ? 181.489 5.957   95.402  1.00 40.58 ? 103  LEU B C     1 
ATOM   3967 O  O     . LEU B 1 16  ? 181.272 5.192   94.457  1.00 38.37 ? 103  LEU B O     1 
ATOM   3968 C  CB    . LEU B 1 16  ? 179.682 6.681   97.004  1.00 45.11 ? 103  LEU B CB    1 
ATOM   3969 C  CG    . LEU B 1 16  ? 178.627 7.671   97.521  1.00 45.72 ? 103  LEU B CG    1 
ATOM   3970 C  CD1   . LEU B 1 16  ? 178.121 7.219   98.881  1.00 45.53 ? 103  LEU B CD1   1 
ATOM   3971 C  CD2   . LEU B 1 16  ? 179.144 9.101   97.607  1.00 46.82 ? 103  LEU B CD2   1 
ATOM   3972 N  N     . TYR B 1 17  ? 182.576 5.889   96.176  1.00 37.35 ? 104  TYR B N     1 
ATOM   3973 C  CA    . TYR B 1 17  ? 183.703 4.982   95.918  1.00 35.41 ? 104  TYR B CA    1 
ATOM   3974 C  C     . TYR B 1 17  ? 184.142 4.253   97.185  1.00 33.65 ? 104  TYR B C     1 
ATOM   3975 O  O     . TYR B 1 17  ? 183.982 4.775   98.290  1.00 33.16 ? 104  TYR B O     1 
ATOM   3976 C  CB    . TYR B 1 17  ? 184.895 5.766   95.352  1.00 36.50 ? 104  TYR B CB    1 
ATOM   3977 C  CG    . TYR B 1 17  ? 184.612 6.425   94.023  1.00 35.58 ? 104  TYR B CG    1 
ATOM   3978 C  CD1   . TYR B 1 17  ? 183.953 7.658   93.957  1.00 35.75 ? 104  TYR B CD1   1 
ATOM   3979 C  CD2   . TYR B 1 17  ? 185.000 5.815   92.831  1.00 35.69 ? 104  TYR B CD2   1 
ATOM   3980 C  CE1   . TYR B 1 17  ? 183.681 8.257   92.737  1.00 35.97 ? 104  TYR B CE1   1 
ATOM   3981 C  CE2   . TYR B 1 17  ? 184.735 6.406   91.608  1.00 35.57 ? 104  TYR B CE2   1 
ATOM   3982 C  CZ    . TYR B 1 17  ? 184.081 7.625   91.567  1.00 35.91 ? 104  TYR B CZ    1 
ATOM   3983 O  OH    . TYR B 1 17  ? 183.825 8.209   90.351  1.00 37.33 ? 104  TYR B OH    1 
ATOM   3984 N  N     . PHE B 1 18  ? 184.699 3.056   97.008  1.00 31.14 ? 105  PHE B N     1 
ATOM   3985 C  CA    . PHE B 1 18  ? 185.176 2.232   98.110  1.00 31.55 ? 105  PHE B CA    1 
ATOM   3986 C  C     . PHE B 1 18  ? 186.310 1.347   97.611  1.00 33.29 ? 105  PHE B C     1 
ATOM   3987 O  O     . PHE B 1 18  ? 186.177 0.694   96.581  1.00 32.44 ? 105  PHE B O     1 
ATOM   3988 C  CB    . PHE B 1 18  ? 184.046 1.373   98.687  1.00 32.82 ? 105  PHE B CB    1 
ATOM   3989 C  CG    . PHE B 1 18  ? 184.367 0.772   100.028 1.00 32.50 ? 105  PHE B CG    1 
ATOM   3990 C  CD1   . PHE B 1 18  ? 184.108 1.480   101.201 1.00 31.60 ? 105  PHE B CD1   1 
ATOM   3991 C  CD2   . PHE B 1 18  ? 184.940 -0.493  100.123 1.00 32.13 ? 105  PHE B CD2   1 
ATOM   3992 C  CE1   . PHE B 1 18  ? 184.408 0.932   102.440 1.00 31.68 ? 105  PHE B CE1   1 
ATOM   3993 C  CE2   . PHE B 1 18  ? 185.241 -1.047  101.360 1.00 32.42 ? 105  PHE B CE2   1 
ATOM   3994 C  CZ    . PHE B 1 18  ? 184.974 -0.332  102.520 1.00 32.05 ? 105  PHE B CZ    1 
ATOM   3995 N  N     . GLN B 1 19  ? 187.422 1.332   98.347  1.00 33.83 ? 106  GLN B N     1 
ATOM   3996 C  CA    . GLN B 1 19  ? 188.668 0.699   97.891  1.00 34.35 ? 106  GLN B CA    1 
ATOM   3997 C  C     . GLN B 1 19  ? 189.157 1.242   96.539  1.00 33.21 ? 106  GLN B C     1 
ATOM   3998 O  O     . GLN B 1 19  ? 189.798 0.532   95.761  1.00 32.60 ? 106  GLN B O     1 
ATOM   3999 C  CB    . GLN B 1 19  ? 188.576 -0.838  97.918  1.00 37.65 ? 106  GLN B CB    1 
ATOM   4000 C  CG    . GLN B 1 19  ? 189.120 -1.453  99.204  1.00 40.08 ? 106  GLN B CG    1 
ATOM   4001 C  CD    . GLN B 1 19  ? 188.694 -2.896  99.408  1.00 43.02 ? 106  GLN B CD    1 
ATOM   4002 O  OE1   . GLN B 1 19  ? 187.599 -3.167  99.901  1.00 45.08 ? 106  GLN B OE1   1 
ATOM   4003 N  NE2   . GLN B 1 19  ? 189.568 -3.830  99.046  1.00 43.41 ? 106  GLN B NE2   1 
ATOM   4004 N  N     . GLY B 1 20  ? 188.858 2.517   96.286  1.00 34.85 ? 107  GLY B N     1 
ATOM   4005 C  CA    . GLY B 1 20  ? 189.293 3.202   95.069  1.00 36.26 ? 107  GLY B CA    1 
ATOM   4006 C  C     . GLY B 1 20  ? 188.457 2.894   93.838  1.00 38.79 ? 107  GLY B C     1 
ATOM   4007 O  O     . GLY B 1 20  ? 188.860 3.212   92.720  1.00 37.76 ? 107  GLY B O     1 
ATOM   4008 N  N     . SER B 1 21  ? 187.291 2.280   94.048  1.00 40.04 ? 108  SER B N     1 
ATOM   4009 C  CA    . SER B 1 21  ? 186.423 1.831   92.956  1.00 41.97 ? 108  SER B CA    1 
ATOM   4010 C  C     . SER B 1 21  ? 184.980 2.236   93.195  1.00 43.36 ? 108  SER B C     1 
ATOM   4011 O  O     . SER B 1 21  ? 184.484 2.113   94.315  1.00 43.32 ? 108  SER B O     1 
ATOM   4012 C  CB    . SER B 1 21  ? 186.492 0.312   92.819  1.00 42.36 ? 108  SER B CB    1 
ATOM   4013 O  OG    . SER B 1 21  ? 187.682 -0.074  92.145  1.00 43.69 ? 108  SER B OG    1 
ATOM   4014 N  N     . GLN B 1 22  ? 184.301 2.712   92.150  1.00 44.50 ? 109  GLN B N     1 
ATOM   4015 C  CA    . GLN B 1 22  ? 182.896 3.093   92.292  1.00 47.41 ? 109  GLN B CA    1 
ATOM   4016 C  C     . GLN B 1 22  ? 182.080 1.878   92.707  1.00 49.39 ? 109  GLN B C     1 
ATOM   4017 O  O     . GLN B 1 22  ? 182.251 0.779   92.161  1.00 46.62 ? 109  GLN B O     1 
ATOM   4018 C  CB    . GLN B 1 22  ? 182.328 3.697   91.004  1.00 49.36 ? 109  GLN B CB    1 
ATOM   4019 C  CG    . GLN B 1 22  ? 181.022 4.456   91.226  1.00 51.16 ? 109  GLN B CG    1 
ATOM   4020 C  CD    . GLN B 1 22  ? 180.342 4.896   89.940  1.00 51.77 ? 109  GLN B CD    1 
ATOM   4021 O  OE1   . GLN B 1 22  ? 180.378 4.195   88.925  1.00 53.88 ? 109  GLN B OE1   1 
ATOM   4022 N  NE2   . GLN B 1 22  ? 179.698 6.059   89.986  1.00 49.65 ? 109  GLN B NE2   1 
ATOM   4023 N  N     . ILE B 1 23  ? 181.212 2.068   93.700  1.00 53.37 ? 110  ILE B N     1 
ATOM   4024 C  CA    . ILE B 1 23  ? 180.368 0.960   94.131  1.00 58.33 ? 110  ILE B CA    1 
ATOM   4025 C  C     . ILE B 1 23  ? 178.966 1.060   93.554  1.00 62.97 ? 110  ILE B C     1 
ATOM   4026 O  O     . ILE B 1 23  ? 178.276 2.084   93.725  1.00 64.08 ? 110  ILE B O     1 
ATOM   4027 C  CB    . ILE B 1 23  ? 180.316 0.787   95.667  1.00 56.62 ? 110  ILE B CB    1 
ATOM   4028 C  CG1   . ILE B 1 23  ? 180.222 2.144   96.377  1.00 54.68 ? 110  ILE B CG1   1 
ATOM   4029 C  CG2   . ILE B 1 23  ? 181.528 -0.016  96.143  1.00 56.30 ? 110  ILE B CG2   1 
ATOM   4030 C  CD1   . ILE B 1 23  ? 179.600 2.051   97.767  1.00 54.76 ? 110  ILE B CD1   1 
ATOM   4031 N  N     . HIS B 1 24  ? 178.573 -0.007  92.844  1.00 67.79 ? 111  HIS B N     1 
ATOM   4032 C  CA    . HIS B 1 24  ? 177.221 -0.143  92.334  1.00 74.52 ? 111  HIS B CA    1 
ATOM   4033 C  C     . HIS B 1 24  ? 176.369 -0.630  93.471  1.00 68.75 ? 111  HIS B C     1 
ATOM   4034 O  O     . HIS B 1 24  ? 176.302 -1.866  93.749  1.00 69.20 ? 111  HIS B O     1 
ATOM   4035 C  CB    . HIS B 1 24  ? 177.177 -1.113  91.153  1.00 82.38 ? 111  HIS B CB    1 
ATOM   4036 C  CG    . HIS B 1 24  ? 178.104 -0.728  90.016  1.00 88.44 ? 111  HIS B CG    1 
ATOM   4037 N  ND1   . HIS B 1 24  ? 177.833 0.288   89.171  1.00 85.47 ? 111  HIS B ND1   1 
ATOM   4038 C  CD2   . HIS B 1 24  ? 179.327 -1.267  89.604  1.00 93.34 ? 111  HIS B CD2   1 
ATOM   4039 C  CE1   . HIS B 1 24  ? 178.829 0.398   88.267  1.00 85.66 ? 111  HIS B CE1   1 
ATOM   4040 N  NE2   . HIS B 1 24  ? 179.742 -0.554  88.533  1.00 93.83 ? 111  HIS B NE2   1 
ATOM   4041 N  N     . VAL B 1 25  ? 175.742 0.357   94.167  1.00 68.41 ? 112  VAL B N     1 
ATOM   4042 C  CA    . VAL B 1 25  ? 174.935 0.030   95.343  1.00 67.26 ? 112  VAL B CA    1 
ATOM   4043 C  C     . VAL B 1 25  ? 173.596 -0.555  94.883  1.00 66.58 ? 112  VAL B C     1 
ATOM   4044 O  O     . VAL B 1 25  ? 172.895 0.040   94.051  1.00 67.92 ? 112  VAL B O     1 
ATOM   4045 C  CB    . VAL B 1 25  ? 174.721 1.282   96.268  1.00 66.03 ? 112  VAL B CB    1 
ATOM   4046 C  CG1   . VAL B 1 25  ? 175.956 2.225   96.238  1.00 65.65 ? 112  VAL B CG1   1 
ATOM   4047 C  CG2   . VAL B 1 25  ? 173.478 2.090   95.846  1.00 65.55 ? 112  VAL B CG2   1 
ATOM   4048 N  N     . ASP B 1 26  ? 173.265 -1.746  95.401  1.00 62.23 ? 113  ASP B N     1 
ATOM   4049 C  CA    . ASP B 1 26  ? 172.007 -2.413  95.041  1.00 58.15 ? 113  ASP B CA    1 
ATOM   4050 C  C     . ASP B 1 26  ? 170.901 -1.849  95.904  1.00 55.49 ? 113  ASP B C     1 
ATOM   4051 O  O     . ASP B 1 26  ? 170.792 -2.191  97.085  1.00 57.02 ? 113  ASP B O     1 
ATOM   4052 C  CB    . ASP B 1 26  ? 172.087 -3.938  95.246  1.00 57.84 ? 113  ASP B CB    1 
ATOM   4053 C  CG    . ASP B 1 26  ? 173.265 -4.557  94.489  1.00 59.13 ? 113  ASP B CG    1 
ATOM   4054 O  OD1   . ASP B 1 26  ? 173.795 -5.582  94.983  1.00 60.98 ? 113  ASP B OD1   1 
ATOM   4055 O  OD2   . ASP B 1 26  ? 173.658 -4.032  93.408  1.00 61.96 ? 113  ASP B OD2   1 
ATOM   4056 N  N     . THR B 1 27  ? 170.093 -0.963  95.324  1.00 49.90 ? 114  THR B N     1 
ATOM   4057 C  CA    . THR B 1 27  ? 168.931 -0.445  96.046  1.00 46.60 ? 114  THR B CA    1 
ATOM   4058 C  C     . THR B 1 27  ? 167.917 -1.583  96.219  1.00 40.90 ? 114  THR B C     1 
ATOM   4059 O  O     . THR B 1 27  ? 167.523 -2.217  95.243  1.00 39.71 ? 114  THR B O     1 
ATOM   4060 C  CB    . THR B 1 27  ? 168.305 0.783   95.338  1.00 47.27 ? 114  THR B CB    1 
ATOM   4061 O  OG1   . THR B 1 27  ? 167.348 1.403   96.209  1.00 49.52 ? 114  THR B OG1   1 
ATOM   4062 C  CG2   . THR B 1 27  ? 167.624 0.396   94.009  1.00 45.97 ? 114  THR B CG2   1 
ATOM   4063 N  N     . MET B 1 28  ? 167.543 -1.862  97.468  1.00 39.30 ? 115  MET B N     1 
ATOM   4064 C  CA    . MET B 1 28  ? 166.562 -2.904  97.769  1.00 35.70 ? 115  MET B CA    1 
ATOM   4065 C  C     . MET B 1 28  ? 165.183 -2.281  97.872  1.00 31.23 ? 115  MET B C     1 
ATOM   4066 O  O     . MET B 1 28  ? 165.016 -1.242  98.501  1.00 33.02 ? 115  MET B O     1 
ATOM   4067 C  CB    . MET B 1 28  ? 166.870 -3.584  99.105  1.00 39.23 ? 115  MET B CB    1 
ATOM   4068 C  CG    . MET B 1 28  ? 168.321 -3.984  99.305  1.00 42.96 ? 115  MET B CG    1 
ATOM   4069 S  SD    . MET B 1 28  ? 168.790 -5.370  98.256  1.00 47.86 ? 115  MET B SD    1 
ATOM   4070 C  CE    . MET B 1 28  ? 170.520 -5.551  98.695  1.00 46.38 ? 115  MET B CE    1 
ATOM   4071 N  N     . LYS B 1 29  ? 164.184 -2.917  97.277  1.00 24.90 ? 116  LYS B N     1 
ATOM   4072 C  CA    . LYS B 1 29  ? 162.829 -2.489  97.541  1.00 20.50 ? 116  LYS B CA    1 
ATOM   4073 C  C     . LYS B 1 29  ? 162.357 -3.167  98.809  1.00 17.32 ? 116  LYS B C     1 
ATOM   4074 O  O     . LYS B 1 29  ? 162.702 -4.312  99.072  1.00 18.09 ? 116  LYS B O     1 
ATOM   4075 C  CB    . LYS B 1 29  ? 161.897 -2.834  96.399  1.00 19.50 ? 116  LYS B CB    1 
ATOM   4076 C  CG    . LYS B 1 29  ? 162.113 -1.972  95.178  1.00 22.20 ? 116  LYS B CG    1 
ATOM   4077 C  CD    . LYS B 1 29  ? 160.873 -2.024  94.309  1.00 21.33 ? 116  LYS B CD    1 
ATOM   4078 C  CE    . LYS B 1 29  ? 161.041 -1.140  93.096  1.00 20.94 ? 116  LYS B CE    1 
ATOM   4079 N  NZ    . LYS B 1 29  ? 161.334 0.264   93.497  1.00 19.21 ? 116  LYS B NZ    1 
ATOM   4080 N  N     . VAL B 1 30  ? 161.573 -2.444  99.585  1.00 13.41 ? 117  VAL B N     1 
ATOM   4081 C  CA    . VAL B 1 30  ? 160.966 -3.016  100.777 1.00 11.02 ? 117  VAL B CA    1 
ATOM   4082 C  C     . VAL B 1 30  ? 159.462 -3.158  100.572 1.00 11.29 ? 117  VAL B C     1 
ATOM   4083 O  O     . VAL B 1 30  ? 158.779 -2.247  100.109 1.00 9.70  ? 117  VAL B O     1 
ATOM   4084 C  CB    . VAL B 1 30  ? 161.278 -2.135  102.000 1.00 15.09 ? 117  VAL B CB    1 
ATOM   4085 C  CG1   . VAL B 1 30  ? 160.638 -2.714  103.241 1.00 16.12 ? 117  VAL B CG1   1 
ATOM   4086 C  CG2   . VAL B 1 30  ? 162.787 -2.055  102.207 1.00 16.13 ? 117  VAL B CG2   1 
ATOM   4087 N  N     . ILE B 1 31  ? 158.958 -4.334  100.918 1.00 11.32 ? 118  ILE B N     1 
ATOM   4088 C  CA    . ILE B 1 31  ? 157.539 -4.612  100.847 1.00 10.70 ? 118  ILE B CA    1 
ATOM   4089 C  C     . ILE B 1 31  ? 157.044 -4.947  102.232 1.00 10.78 ? 118  ILE B C     1 
ATOM   4090 O  O     . ILE B 1 31  ? 157.665 -5.758  102.917 1.00 11.55 ? 118  ILE B O     1 
ATOM   4091 C  CB    . ILE B 1 31  ? 157.268 -5.785  99.879  1.00 12.47 ? 118  ILE B CB    1 
ATOM   4092 C  CG1   . ILE B 1 31  ? 157.442 -5.292  98.442  1.00 12.73 ? 118  ILE B CG1   1 
ATOM   4093 C  CG2   . ILE B 1 31  ? 155.879 -6.364  100.089 1.00 13.01 ? 118  ILE B CG2   1 
ATOM   4094 C  CD1   . ILE B 1 31  ? 156.846 -6.203  97.394  1.00 13.61 ? 118  ILE B CD1   1 
ATOM   4095 N  N     . ASN B 1 32  ? 155.940 -4.331  102.638 1.00 8.27  ? 119  ASN B N     1 
ATOM   4096 C  CA    . ASN B 1 32  ? 155.351 -4.632  103.944 1.00 8.96  ? 119  ASN B CA    1 
ATOM   4097 C  C     . ASN B 1 32  ? 154.333 -5.762  103.761 1.00 8.54  ? 119  ASN B C     1 
ATOM   4098 O  O     . ASN B 1 32  ? 153.324 -5.597  103.059 1.00 9.59  ? 119  ASN B O     1 
ATOM   4099 C  CB    . ASN B 1 32  ? 154.673 -3.388  104.520 1.00 8.72  ? 119  ASN B CB    1 
ATOM   4100 C  CG    . ASN B 1 32  ? 154.120 -3.623  105.917 1.00 11.36 ? 119  ASN B CG    1 
ATOM   4101 O  OD1   . ASN B 1 32  ? 154.371 -4.654  106.505 1.00 13.79 ? 119  ASN B OD1   1 
ATOM   4102 N  ND2   . ASN B 1 32  ? 153.387 -2.659  106.452 1.00 13.15 ? 119  ASN B ND2   1 
ATOM   4103 N  N     . ASP B 1 33  ? 154.633 -6.920  104.348 1.00 8.05  ? 120  ASP B N     1 
ATOM   4104 C  CA    . ASP B 1 33  ? 153.722 -8.064  104.291 1.00 7.67  ? 120  ASP B CA    1 
ATOM   4105 C  C     . ASP B 1 33  ? 153.090 -8.282  105.684 1.00 7.20  ? 120  ASP B C     1 
ATOM   4106 O  O     . ASP B 1 33  ? 153.774 -8.177  106.699 1.00 6.85  ? 120  ASP B O     1 
ATOM   4107 C  CB    . ASP B 1 33  ? 154.516 -9.294  103.876 1.00 8.07  ? 120  ASP B CB    1 
ATOM   4108 C  CG    . ASP B 1 33  ? 153.674 -10.539 103.866 1.00 9.89  ? 120  ASP B CG    1 
ATOM   4109 O  OD1   . ASP B 1 33  ? 152.745 -10.618 103.040 1.00 11.70 ? 120  ASP B OD1   1 
ATOM   4110 O  OD2   . ASP B 1 33  ? 153.948 -11.424 104.679 1.00 11.04 ? 120  ASP B OD2   1 
ATOM   4111 N  N     . PRO B 1 34  ? 151.775 -8.559  105.745 1.00 6.87  ? 121  PRO B N     1 
ATOM   4112 C  CA    . PRO B 1 34  ? 151.171 -8.704  107.097 1.00 7.76  ? 121  PRO B CA    1 
ATOM   4113 C  C     . PRO B 1 34  ? 151.720 -9.916  107.864 1.00 8.07  ? 121  PRO B C     1 
ATOM   4114 O  O     . PRO B 1 34  ? 151.694 -9.940  109.107 1.00 8.87  ? 121  PRO B O     1 
ATOM   4115 C  CB    . PRO B 1 34  ? 149.675 -8.886  106.800 1.00 7.65  ? 121  PRO B CB    1 
ATOM   4116 C  CG    . PRO B 1 34  ? 149.623 -9.375  105.401 1.00 7.76  ? 121  PRO B CG    1 
ATOM   4117 C  CD    . PRO B 1 34  ? 150.778 -8.691  104.677 1.00 7.61  ? 121  PRO B CD    1 
ATOM   4118 N  N     . ILE B 1 35  ? 152.254 -10.901 107.149 1.00 6.85  ? 122  ILE B N     1 
ATOM   4119 C  CA    . ILE B 1 35  ? 152.758 -12.094 107.802 1.00 7.15  ? 122  ILE B CA    1 
ATOM   4120 C  C     . ILE B 1 35  ? 154.185 -11.872 108.271 1.00 7.71  ? 122  ILE B C     1 
ATOM   4121 O  O     . ILE B 1 35  ? 154.491 -12.023 109.465 1.00 8.83  ? 122  ILE B O     1 
ATOM   4122 C  CB    . ILE B 1 35  ? 152.709 -13.341 106.874 1.00 7.09  ? 122  ILE B CB    1 
ATOM   4123 C  CG1   . ILE B 1 35  ? 151.311 -13.519 106.299 1.00 7.67  ? 122  ILE B CG1   1 
ATOM   4124 C  CG2   . ILE B 1 35  ? 153.151 -14.582 107.647 1.00 8.97  ? 122  ILE B CG2   1 
ATOM   4125 C  CD1   . ILE B 1 35  ? 150.209 -13.475 107.338 1.00 8.88  ? 122  ILE B CD1   1 
ATOM   4126 N  N     . HIS B 1 36  ? 155.045 -11.464 107.337 1.00 7.48  ? 123  HIS B N     1 
ATOM   4127 C  CA    . HIS B 1 36  ? 156.494 -11.397 107.606 1.00 8.18  ? 123  HIS B CA    1 
ATOM   4128 C  C     . HIS B 1 36  ? 157.022 -10.040 107.963 1.00 8.92  ? 123  HIS B C     1 
ATOM   4129 O  O     . HIS B 1 36  ? 158.176 -9.918  108.387 1.00 10.46 ? 123  HIS B O     1 
ATOM   4130 C  CB    . HIS B 1 36  ? 157.265 -11.987 106.420 1.00 8.35  ? 123  HIS B CB    1 
ATOM   4131 C  CG    . HIS B 1 36  ? 156.872 -13.410 106.127 1.00 8.36  ? 123  HIS B CG    1 
ATOM   4132 N  ND1   . HIS B 1 36  ? 156.981 -14.392 107.051 1.00 8.72  ? 123  HIS B ND1   1 
ATOM   4133 C  CD2   . HIS B 1 36  ? 156.322 -13.991 104.997 1.00 7.78  ? 123  HIS B CD2   1 
ATOM   4134 C  CE1   . HIS B 1 36  ? 156.529 -15.547 106.532 1.00 8.65  ? 123  HIS B CE1   1 
ATOM   4135 N  NE2   . HIS B 1 36  ? 156.135 -15.307 105.275 1.00 7.70  ? 123  HIS B NE2   1 
ATOM   4136 N  N     . GLY B 1 37  ? 156.188 -9.015  107.836 1.00 7.78  ? 124  GLY B N     1 
ATOM   4137 C  CA    . GLY B 1 37  ? 156.609 -7.638  108.115 1.00 9.14  ? 124  GLY B CA    1 
ATOM   4138 C  C     . GLY B 1 37  ? 157.367 -7.101  106.913 1.00 9.51  ? 124  GLY B C     1 
ATOM   4139 O  O     . GLY B 1 37  ? 157.001 -7.373  105.791 1.00 8.84  ? 124  GLY B O     1 
ATOM   4140 N  N     . HIS B 1 38  ? 158.430 -6.342  107.156 1.00 10.99 ? 125  HIS B N     1 
ATOM   4141 C  CA    . HIS B 1 38  ? 159.169 -5.714  106.057 1.00 11.84 ? 125  HIS B CA    1 
ATOM   4142 C  C     . HIS B 1 38  ? 160.181 -6.639  105.417 1.00 15.09 ? 125  HIS B C     1 
ATOM   4143 O  O     . HIS B 1 38  ? 161.159 -7.055  106.056 1.00 18.56 ? 125  HIS B O     1 
ATOM   4144 C  CB    . HIS B 1 38  ? 159.766 -4.395  106.534 1.00 12.60 ? 125  HIS B CB    1 
ATOM   4145 C  CG    . HIS B 1 38  ? 158.723 -3.334  106.785 1.00 12.11 ? 125  HIS B CG    1 
ATOM   4146 N  ND1   . HIS B 1 38  ? 157.853 -3.392  107.826 1.00 12.58 ? 125  HIS B ND1   1 
ATOM   4147 C  CD2   . HIS B 1 38  ? 158.418 -2.179  106.083 1.00 12.93 ? 125  HIS B CD2   1 
ATOM   4148 C  CE1   . HIS B 1 38  ? 157.028 -2.342  107.774 1.00 12.13 ? 125  HIS B CE1   1 
ATOM   4149 N  NE2   . HIS B 1 38  ? 157.372 -1.596  106.701 1.00 12.45 ? 125  HIS B NE2   1 
ATOM   4150 N  N     . ILE B 1 39  ? 159.916 -6.982  104.161 1.00 15.26 ? 126  ILE B N     1 
ATOM   4151 C  CA    . ILE B 1 39  ? 160.716 -7.918  103.371 1.00 16.34 ? 126  ILE B CA    1 
ATOM   4152 C  C     . ILE B 1 39  ? 161.572 -7.077  102.412 1.00 16.85 ? 126  ILE B C     1 
ATOM   4153 O  O     . ILE B 1 39  ? 161.034 -6.240  101.684 1.00 17.43 ? 126  ILE B O     1 
ATOM   4154 C  CB    . ILE B 1 39  ? 159.815 -8.854  102.517 1.00 16.29 ? 126  ILE B CB    1 
ATOM   4155 C  CG1   . ILE B 1 39  ? 158.966 -9.776  103.398 1.00 18.40 ? 126  ILE B CG1   1 
ATOM   4156 C  CG2   . ILE B 1 39  ? 160.654 -9.730  101.582 1.00 18.27 ? 126  ILE B CG2   1 
ATOM   4157 C  CD1   . ILE B 1 39  ? 157.885 -10.506 102.623 1.00 19.64 ? 126  ILE B CD1   1 
ATOM   4158 N  N     . GLU B 1 40  ? 162.887 -7.289  102.419 1.00 15.47 ? 127  GLU B N     1 
ATOM   4159 C  CA    . GLU B 1 40  ? 163.769 -6.632  101.433 1.00 15.80 ? 127  GLU B CA    1 
ATOM   4160 C  C     . GLU B 1 40  ? 163.956 -7.488  100.182 1.00 14.31 ? 127  GLU B C     1 
ATOM   4161 O  O     . GLU B 1 40  ? 164.222 -8.686  100.260 1.00 13.74 ? 127  GLU B O     1 
ATOM   4162 C  CB    . GLU B 1 40  ? 165.127 -6.281  102.041 1.00 20.54 ? 127  GLU B CB    1 
ATOM   4163 C  CG    . GLU B 1 40  ? 165.061 -5.242  103.149 1.00 25.76 ? 127  GLU B CG    1 
ATOM   4164 C  CD    . GLU B 1 40  ? 166.436 -4.732  103.550 1.00 29.54 ? 127  GLU B CD    1 
ATOM   4165 O  OE1   . GLU B 1 40  ? 167.116 -4.109  102.705 1.00 33.98 ? 127  GLU B OE1   1 
ATOM   4166 O  OE2   . GLU B 1 40  ? 166.833 -4.953  104.711 1.00 33.23 ? 127  GLU B OE2   1 
ATOM   4167 N  N     . LEU B 1 41  ? 163.791 -6.855  99.031  1.00 13.21 ? 128  LEU B N     1 
ATOM   4168 C  CA    . LEU B 1 41  ? 163.937 -7.539  97.760  1.00 13.92 ? 128  LEU B CA    1 
ATOM   4169 C  C     . LEU B 1 41  ? 165.122 -6.978  96.977  1.00 14.56 ? 128  LEU B C     1 
ATOM   4170 O  O     . LEU B 1 41  ? 165.142 -5.810  96.582  1.00 14.23 ? 128  LEU B O     1 
ATOM   4171 C  CB    . LEU B 1 41  ? 162.659 -7.420  96.936  1.00 14.29 ? 128  LEU B CB    1 
ATOM   4172 C  CG    . LEU B 1 41  ? 161.425 -8.073  97.581  1.00 16.19 ? 128  LEU B CG    1 
ATOM   4173 C  CD1   . LEU B 1 41  ? 160.170 -7.556  96.893  1.00 16.88 ? 128  LEU B CD1   1 
ATOM   4174 C  CD2   . LEU B 1 41  ? 161.515 -9.587  97.512  1.00 17.42 ? 128  LEU B CD2   1 
ATOM   4175 N  N     . HIS B 1 42  ? 166.107 -7.834  96.770  1.00 14.81 ? 129  HIS B N     1 
ATOM   4176 C  CA    . HIS B 1 42  ? 167.232 -7.554  95.878  1.00 16.50 ? 129  HIS B CA    1 
ATOM   4177 C  C     . HIS B 1 42  ? 166.753 -7.143  94.498  1.00 15.49 ? 129  HIS B C     1 
ATOM   4178 O  O     . HIS B 1 42  ? 165.713 -7.614  94.025  1.00 14.89 ? 129  HIS B O     1 
ATOM   4179 C  CB    . HIS B 1 42  ? 168.085 -8.805  95.815  1.00 17.53 ? 129  HIS B CB    1 
ATOM   4180 C  CG    . HIS B 1 42  ? 169.352 -8.654  95.016  1.00 18.87 ? 129  HIS B CG    1 
ATOM   4181 N  ND1   . HIS B 1 42  ? 169.358 -8.584  93.663  1.00 18.75 ? 129  HIS B ND1   1 
ATOM   4182 C  CD2   . HIS B 1 42  ? 170.679 -8.622  95.420  1.00 19.14 ? 129  HIS B CD2   1 
ATOM   4183 C  CE1   . HIS B 1 42  ? 170.631 -8.488  93.233  1.00 20.33 ? 129  HIS B CE1   1 
ATOM   4184 N  NE2   . HIS B 1 42  ? 171.436 -8.516  94.305  1.00 20.11 ? 129  HIS B NE2   1 
ATOM   4185 N  N     . PRO B 1 43  ? 167.482 -6.229  93.822  1.00 15.94 ? 130  PRO B N     1 
ATOM   4186 C  CA    . PRO B 1 43  ? 167.004 -5.758  92.524  1.00 15.13 ? 130  PRO B CA    1 
ATOM   4187 C  C     . PRO B 1 43  ? 166.738 -6.838  91.480  1.00 13.98 ? 130  PRO B C     1 
ATOM   4188 O  O     . PRO B 1 43  ? 165.859 -6.662  90.641  1.00 14.94 ? 130  PRO B O     1 
ATOM   4189 C  CB    . PRO B 1 43  ? 168.133 -4.810  92.040  1.00 16.87 ? 130  PRO B CB    1 
ATOM   4190 C  CG    . PRO B 1 43  ? 169.248 -4.968  93.018  1.00 17.79 ? 130  PRO B CG    1 
ATOM   4191 C  CD    . PRO B 1 43  ? 168.629 -5.434  94.297  1.00 17.59 ? 130  PRO B CD    1 
ATOM   4192 N  N     . LEU B 1 44  ? 167.483 -7.937  91.522  1.00 14.58 ? 131  LEU B N     1 
ATOM   4193 C  CA    . LEU B 1 44  ? 167.266 -9.039  90.584  1.00 13.84 ? 131  LEU B CA    1 
ATOM   4194 C  C     . LEU B 1 44  ? 165.904 -9.690  90.837  1.00 13.47 ? 131  LEU B C     1 
ATOM   4195 O  O     . LEU B 1 44  ? 165.201 -10.053 89.903  1.00 11.37 ? 131  LEU B O     1 
ATOM   4196 C  CB    . LEU B 1 44  ? 168.389 -10.078 90.699  1.00 14.40 ? 131  LEU B CB    1 
ATOM   4197 C  CG    . LEU B 1 44  ? 168.218 -11.426 89.976  1.00 14.19 ? 131  LEU B CG    1 
ATOM   4198 C  CD1   . LEU B 1 44  ? 167.988 -11.268 88.487  1.00 14.92 ? 131  LEU B CD1   1 
ATOM   4199 C  CD2   . LEU B 1 44  ? 169.381 -12.364 90.241  1.00 15.06 ? 131  LEU B CD2   1 
ATOM   4200 N  N     . LEU B 1 45  ? 165.534 -9.809  92.113  1.00 13.46 ? 132  LEU B N     1 
ATOM   4201 C  CA    . LEU B 1 45  ? 164.228 -10.360 92.469  1.00 13.00 ? 132  LEU B CA    1 
ATOM   4202 C  C     . LEU B 1 45  ? 163.142 -9.404  91.995  1.00 12.25 ? 132  LEU B C     1 
ATOM   4203 O  O     . LEU B 1 45  ? 162.133 -9.836  91.469  1.00 13.20 ? 132  LEU B O     1 
ATOM   4204 C  CB    . LEU B 1 45  ? 164.136 -10.585 93.987  1.00 12.74 ? 132  LEU B CB    1 
ATOM   4205 C  CG    . LEU B 1 45  ? 165.276 -11.403 94.621  1.00 13.98 ? 132  LEU B CG    1 
ATOM   4206 C  CD1   . LEU B 1 45  ? 165.048 -11.615 96.110  1.00 14.55 ? 132  LEU B CD1   1 
ATOM   4207 C  CD2   . LEU B 1 45  ? 165.449 -12.739 93.922  1.00 13.36 ? 132  LEU B CD2   1 
ATOM   4208 N  N     . VAL B 1 46  ? 163.378 -8.093  92.137  1.00 11.49 ? 133  VAL B N     1 
ATOM   4209 C  CA    . VAL B 1 46  ? 162.410 -7.100  91.677  1.00 11.89 ? 133  VAL B CA    1 
ATOM   4210 C  C     . VAL B 1 46  ? 162.174 -7.214  90.163  1.00 12.35 ? 133  VAL B C     1 
ATOM   4211 O  O     . VAL B 1 46  ? 161.032 -7.156  89.699  1.00 11.06 ? 133  VAL B O     1 
ATOM   4212 C  CB    . VAL B 1 46  ? 162.822 -5.656  92.073  1.00 12.38 ? 133  VAL B CB    1 
ATOM   4213 C  CG1   . VAL B 1 46  ? 161.882 -4.630  91.455  1.00 13.42 ? 133  VAL B CG1   1 
ATOM   4214 C  CG2   . VAL B 1 46  ? 162.846 -5.504  93.599  1.00 13.18 ? 133  VAL B CG2   1 
ATOM   4215 N  N     . ARG B 1 47  ? 163.245 -7.392  89.399  1.00 14.30 ? 134  ARG B N     1 
ATOM   4216 C  CA    . ARG B 1 47  ? 163.116 -7.521  87.938  1.00 15.72 ? 134  ARG B CA    1 
ATOM   4217 C  C     . ARG B 1 47  ? 162.246 -8.732  87.563  1.00 14.70 ? 134  ARG B C     1 
ATOM   4218 O  O     . ARG B 1 47  ? 161.458 -8.677  86.624  1.00 15.25 ? 134  ARG B O     1 
ATOM   4219 C  CB    . ARG B 1 47  ? 164.498 -7.630  87.293  1.00 19.22 ? 134  ARG B CB    1 
ATOM   4220 C  CG    . ARG B 1 47  ? 164.503 -7.328  85.806  1.00 23.74 ? 134  ARG B CG    1 
ATOM   4221 C  CD    . ARG B 1 47  ? 164.486 -5.833  85.504  1.00 27.58 ? 134  ARG B CD    1 
ATOM   4222 N  NE    . ARG B 1 47  ? 165.079 -5.600  84.184  1.00 32.57 ? 134  ARG B NE    1 
ATOM   4223 C  CZ    . ARG B 1 47  ? 166.349 -5.259  83.969  1.00 34.18 ? 134  ARG B CZ    1 
ATOM   4224 N  NH1   . ARG B 1 47  ? 167.189 -5.072  84.988  1.00 34.64 ? 134  ARG B NH1   1 
ATOM   4225 N  NH2   . ARG B 1 47  ? 166.782 -5.095  82.727  1.00 36.80 ? 134  ARG B NH2   1 
ATOM   4226 N  N     . ILE B 1 48  ? 162.375 -9.814  88.328  1.00 12.81 ? 135  ILE B N     1 
ATOM   4227 C  CA    . ILE B 1 48  ? 161.575 -11.026 88.089  1.00 12.66 ? 135  ILE B CA    1 
ATOM   4228 C  C     . ILE B 1 48  ? 160.098 -10.819 88.468  1.00 12.13 ? 135  ILE B C     1 
ATOM   4229 O  O     . ILE B 1 48  ? 159.194 -11.207 87.732  1.00 12.03 ? 135  ILE B O     1 
ATOM   4230 C  CB    . ILE B 1 48  ? 162.215 -12.239 88.809  1.00 12.83 ? 135  ILE B CB    1 
ATOM   4231 C  CG1   . ILE B 1 48  ? 163.484 -12.659 88.054  1.00 14.20 ? 135  ILE B CG1   1 
ATOM   4232 C  CG2   . ILE B 1 48  ? 161.241 -13.427 88.914  1.00 12.90 ? 135  ILE B CG2   1 
ATOM   4233 C  CD1   . ILE B 1 48  ? 164.488 -13.433 88.880  1.00 13.82 ? 135  ILE B CD1   1 
ATOM   4234 N  N     . ILE B 1 49  ? 159.871 -10.199 89.621  1.00 12.08 ? 136  ILE B N     1 
ATOM   4235 C  CA    . ILE B 1 49  ? 158.531 -9.876  90.111  1.00 12.45 ? 136  ILE B CA    1 
ATOM   4236 C  C     . ILE B 1 49  ? 157.743 -8.975  89.166  1.00 11.94 ? 136  ILE B C     1 
ATOM   4237 O  O     . ILE B 1 49  ? 156.557 -9.200  88.931  1.00 11.37 ? 136  ILE B O     1 
ATOM   4238 C  CB    . ILE B 1 49  ? 158.618 -9.264  91.533  1.00 12.82 ? 136  ILE B CB    1 
ATOM   4239 C  CG1   . ILE B 1 49  ? 158.970 -10.374 92.534  1.00 12.70 ? 136  ILE B CG1   1 
ATOM   4240 C  CG2   . ILE B 1 49  ? 157.340 -8.543  91.936  1.00 13.56 ? 136  ILE B CG2   1 
ATOM   4241 C  CD1   . ILE B 1 49  ? 159.712 -9.898  93.776  1.00 13.61 ? 136  ILE B CD1   1 
ATOM   4242 N  N     . ASP B 1 50  ? 158.412 -7.981  88.583  1.00 11.87 ? 137  ASP B N     1 
ATOM   4243 C  CA    . ASP B 1 50  ? 157.702 -6.987  87.778  1.00 12.85 ? 137  ASP B CA    1 
ATOM   4244 C  C     . ASP B 1 50  ? 157.594 -7.410  86.306  1.00 13.69 ? 137  ASP B C     1 
ATOM   4245 O  O     . ASP B 1 50  ? 158.095 -6.736  85.409  1.00 13.30 ? 137  ASP B O     1 
ATOM   4246 C  CB    . ASP B 1 50  ? 158.330 -5.593  87.944  1.00 13.62 ? 137  ASP B CB    1 
ATOM   4247 C  CG    . ASP B 1 50  ? 158.076 -5.011  89.325  1.00 14.13 ? 137  ASP B CG    1 
ATOM   4248 O  OD1   . ASP B 1 50  ? 157.065 -5.406  89.960  1.00 13.21 ? 137  ASP B OD1   1 
ATOM   4249 O  OD2   . ASP B 1 50  ? 158.885 -4.187  89.784  1.00 12.56 ? 137  ASP B OD2   1 
ATOM   4250 N  N     . THR B 1 51  ? 156.915 -8.531  86.088  1.00 12.79 ? 138  THR B N     1 
ATOM   4251 C  CA    . THR B 1 51  ? 156.690 -9.099  84.755  1.00 13.64 ? 138  THR B CA    1 
ATOM   4252 C  C     . THR B 1 51  ? 155.251 -9.585  84.700  1.00 14.51 ? 138  THR B C     1 
ATOM   4253 O  O     . THR B 1 51  ? 154.662 -9.878  85.748  1.00 13.33 ? 138  THR B O     1 
ATOM   4254 C  CB    . THR B 1 51  ? 157.603 -10.321 84.498  1.00 15.08 ? 138  THR B CB    1 
ATOM   4255 O  OG1   . THR B 1 51  ? 157.291 -11.374 85.431  1.00 16.00 ? 138  THR B OG1   1 
ATOM   4256 C  CG2   . THR B 1 51  ? 159.076 -9.949  84.607  1.00 14.50 ? 138  THR B CG2   1 
ATOM   4257 N  N     . PRO B 1 52  ? 154.668 -9.707  83.495  1.00 14.55 ? 139  PRO B N     1 
ATOM   4258 C  CA    . PRO B 1 52  ? 153.285 -10.190 83.440  1.00 14.39 ? 139  PRO B CA    1 
ATOM   4259 C  C     . PRO B 1 52  ? 153.161 -11.639 83.933  1.00 14.29 ? 139  PRO B C     1 
ATOM   4260 O  O     . PRO B 1 52  ? 152.112 -12.024 84.434  1.00 12.84 ? 139  PRO B O     1 
ATOM   4261 C  CB    . PRO B 1 52  ? 152.936 -10.100 81.948  1.00 15.47 ? 139  PRO B CB    1 
ATOM   4262 C  CG    . PRO B 1 52  ? 153.891 -9.097  81.392  1.00 15.78 ? 139  PRO B CG    1 
ATOM   4263 C  CD    . PRO B 1 52  ? 155.162 -9.311  82.159  1.00 15.50 ? 139  PRO B CD    1 
ATOM   4264 N  N     . GLN B 1 53  ? 154.227 -12.421 83.802  1.00 14.31 ? 140  GLN B N     1 
ATOM   4265 C  CA    . GLN B 1 53  ? 154.188 -13.831 84.179  1.00 14.38 ? 140  GLN B CA    1 
ATOM   4266 C  C     . GLN B 1 53  ? 154.117 -14.011 85.696  1.00 13.39 ? 140  GLN B C     1 
ATOM   4267 O  O     . GLN B 1 53  ? 153.490 -14.959 86.176  1.00 12.68 ? 140  GLN B O     1 
ATOM   4268 C  CB    . GLN B 1 53  ? 155.394 -14.589 83.622  1.00 15.69 ? 140  GLN B CB    1 
ATOM   4269 C  CG    . GLN B 1 53  ? 155.414 -14.659 82.102  1.00 15.34 ? 140  GLN B CG    1 
ATOM   4270 C  CD    . GLN B 1 53  ? 155.751 -13.327 81.460  1.00 17.73 ? 140  GLN B CD    1 
ATOM   4271 O  OE1   . GLN B 1 53  ? 156.537 -12.541 81.996  1.00 18.53 ? 140  GLN B OE1   1 
ATOM   4272 N  NE2   . GLN B 1 53  ? 155.167 -13.070 80.301  1.00 20.15 ? 140  GLN B NE2   1 
ATOM   4273 N  N     . PHE B 1 54  ? 154.767 -13.106 86.435  1.00 11.94 ? 141  PHE B N     1 
ATOM   4274 C  CA    . PHE B 1 54  ? 154.724 -13.136 87.905  1.00 11.16 ? 141  PHE B CA    1 
ATOM   4275 C  C     . PHE B 1 54  ? 153.477 -12.449 88.454  1.00 10.56 ? 141  PHE B C     1 
ATOM   4276 O  O     . PHE B 1 54  ? 152.796 -12.989 89.331  1.00 9.41  ? 141  PHE B O     1 
ATOM   4277 C  CB    . PHE B 1 54  ? 155.969 -12.494 88.529  1.00 11.71 ? 141  PHE B CB    1 
ATOM   4278 C  CG    . PHE B 1 54  ? 156.204 -12.943 89.943  1.00 11.28 ? 141  PHE B CG    1 
ATOM   4279 C  CD1   . PHE B 1 54  ? 155.534 -12.338 90.996  1.00 11.69 ? 141  PHE B CD1   1 
ATOM   4280 C  CD2   . PHE B 1 54  ? 157.057 -14.015 90.207  1.00 12.69 ? 141  PHE B CD2   1 
ATOM   4281 C  CE1   . PHE B 1 54  ? 155.719 -12.780 92.307  1.00 11.95 ? 141  PHE B CE1   1 
ATOM   4282 C  CE2   . PHE B 1 54  ? 157.260 -14.455 91.508  1.00 13.11 ? 141  PHE B CE2   1 
ATOM   4283 C  CZ    . PHE B 1 54  ? 156.570 -13.846 92.560  1.00 11.44 ? 141  PHE B CZ    1 
ATOM   4284 N  N     . GLN B 1 55  ? 153.169 -11.271 87.918  1.00 9.47  ? 142  GLN B N     1 
ATOM   4285 C  CA    . GLN B 1 55  ? 152.059 -10.461 88.421  1.00 8.52  ? 142  GLN B CA    1 
ATOM   4286 C  C     . GLN B 1 55  ? 150.734 -11.184 88.247  1.00 8.52  ? 142  GLN B C     1 
ATOM   4287 O  O     . GLN B 1 55  ? 149.754 -10.923 88.958  1.00 7.42  ? 142  GLN B O     1 
ATOM   4288 C  CB    . GLN B 1 55  ? 152.047 -9.100  87.729  1.00 8.64  ? 142  GLN B CB    1 
ATOM   4289 C  CG    . GLN B 1 55  ? 153.262 -8.245  88.076  1.00 8.15  ? 142  GLN B CG    1 
ATOM   4290 C  CD    . GLN B 1 55  ? 153.230 -7.740  89.504  1.00 8.16  ? 142  GLN B CD    1 
ATOM   4291 O  OE1   . GLN B 1 55  ? 152.223 -7.177  89.956  1.00 8.74  ? 142  GLN B OE1   1 
ATOM   4292 N  NE2   . GLN B 1 55  ? 154.334 -7.901  90.206  1.00 8.93  ? 142  GLN B NE2   1 
ATOM   4293 N  N     . ARG B 1 56  ? 150.717 -12.106 87.292  1.00 8.98  ? 143  ARG B N     1 
ATOM   4294 C  CA    . ARG B 1 56  ? 149.607 -13.018 87.075  1.00 9.13  ? 143  ARG B CA    1 
ATOM   4295 C  C     . ARG B 1 56  ? 149.077 -13.642 88.386  1.00 8.36  ? 143  ARG B C     1 
ATOM   4296 O  O     . ARG B 1 56  ? 147.876 -13.863 88.536  1.00 8.43  ? 143  ARG B O     1 
ATOM   4297 C  CB    . ARG B 1 56  ? 150.107 -14.133 86.156  1.00 10.20 ? 143  ARG B CB    1 
ATOM   4298 C  CG    . ARG B 1 56  ? 149.125 -15.251 85.915  1.00 10.59 ? 143  ARG B CG    1 
ATOM   4299 C  CD    . ARG B 1 56  ? 149.737 -16.264 84.940  1.00 11.42 ? 143  ARG B CD    1 
ATOM   4300 N  NE    . ARG B 1 56  ? 148.821 -17.384 84.791  1.00 11.48 ? 143  ARG B NE    1 
ATOM   4301 C  CZ    . ARG B 1 56  ? 148.830 -18.467 85.565  1.00 11.09 ? 143  ARG B CZ    1 
ATOM   4302 N  NH1   . ARG B 1 56  ? 149.725 -18.589 86.552  1.00 11.67 ? 143  ARG B NH1   1 
ATOM   4303 N  NH2   . ARG B 1 56  ? 147.937 -19.426 85.352  1.00 10.73 ? 143  ARG B NH2   1 
ATOM   4304 N  N     . LEU B 1 57  ? 149.993 -13.933 89.297  1.00 8.12  ? 144  LEU B N     1 
ATOM   4305 C  CA    . LEU B 1 57  ? 149.635 -14.618 90.538  1.00 7.53  ? 144  LEU B CA    1 
ATOM   4306 C  C     . LEU B 1 57  ? 148.763 -13.771 91.466  1.00 7.49  ? 144  LEU B C     1 
ATOM   4307 O  O     . LEU B 1 57  ? 148.205 -14.302 92.448  1.00 7.06  ? 144  LEU B O     1 
ATOM   4308 C  CB    . LEU B 1 57  ? 150.898 -15.077 91.250  1.00 7.42  ? 144  LEU B CB    1 
ATOM   4309 C  CG    . LEU B 1 57  ? 151.677 -16.160 90.505  1.00 7.44  ? 144  LEU B CG    1 
ATOM   4310 C  CD1   . LEU B 1 57  ? 152.896 -16.541 91.347  1.00 7.61  ? 144  LEU B CD1   1 
ATOM   4311 C  CD2   . LEU B 1 57  ? 150.811 -17.381 90.155  1.00 7.40  ? 144  LEU B CD2   1 
ATOM   4312 N  N     . ARG B 1 58  ? 148.626 -12.475 91.159  1.00 7.01  ? 145  ARG B N     1 
ATOM   4313 C  CA    . ARG B 1 58  ? 147.687 -11.602 91.903  1.00 7.03  ? 145  ARG B CA    1 
ATOM   4314 C  C     . ARG B 1 58  ? 146.245 -11.984 91.651  1.00 7.03  ? 145  ARG B C     1 
ATOM   4315 O  O     . ARG B 1 58  ? 145.347 -11.569 92.398  1.00 7.95  ? 145  ARG B O     1 
ATOM   4316 C  CB    . ARG B 1 58  ? 147.862 -10.125 91.511  1.00 6.84  ? 145  ARG B CB    1 
ATOM   4317 C  CG    . ARG B 1 58  ? 149.150 -9.489  92.013  1.00 6.55  ? 145  ARG B CG    1 
ATOM   4318 C  CD    . ARG B 1 58  ? 149.159 -8.019  91.588  1.00 7.31  ? 145  ARG B CD    1 
ATOM   4319 N  NE    . ARG B 1 58  ? 150.376 -7.323  92.012  1.00 8.14  ? 145  ARG B NE    1 
ATOM   4320 C  CZ    . ARG B 1 58  ? 150.541 -6.759  93.207  1.00 8.53  ? 145  ARG B CZ    1 
ATOM   4321 N  NH1   . ARG B 1 58  ? 149.569 -6.805  94.115  1.00 9.33  ? 145  ARG B NH1   1 
ATOM   4322 N  NH2   . ARG B 1 58  ? 151.681 -6.145  93.494  1.00 8.85  ? 145  ARG B NH2   1 
ATOM   4323 N  N     . TYR B 1 59  ? 146.004 -12.765 90.595  1.00 7.69  ? 146  TYR B N     1 
ATOM   4324 C  CA    . TYR B 1 59  ? 144.644 -13.020 90.138  1.00 7.59  ? 146  TYR B CA    1 
ATOM   4325 C  C     . TYR B 1 59  ? 144.262 -14.489 90.309  1.00 7.48  ? 146  TYR B C     1 
ATOM   4326 O  O     . TYR B 1 59  ? 143.318 -14.960 89.694  1.00 7.98  ? 146  TYR B O     1 
ATOM   4327 C  CB    . TYR B 1 59  ? 144.500 -12.564 88.658  1.00 7.61  ? 146  TYR B CB    1 
ATOM   4328 C  CG    . TYR B 1 59  ? 145.088 -11.176 88.500  1.00 8.43  ? 146  TYR B CG    1 
ATOM   4329 C  CD1   . TYR B 1 59  ? 144.529 -10.102 89.182  1.00 8.87  ? 146  TYR B CD1   1 
ATOM   4330 C  CD2   . TYR B 1 59  ? 146.235 -10.950 87.734  1.00 9.01  ? 146  TYR B CD2   1 
ATOM   4331 C  CE1   . TYR B 1 59  ? 145.063 -8.822  89.096  1.00 9.67  ? 146  TYR B CE1   1 
ATOM   4332 C  CE2   . TYR B 1 59  ? 146.779 -9.654  87.634  1.00 9.90  ? 146  TYR B CE2   1 
ATOM   4333 C  CZ    . TYR B 1 59  ? 146.183 -8.606  88.330  1.00 9.72  ? 146  TYR B CZ    1 
ATOM   4334 O  OH    . TYR B 1 59  ? 146.699 -7.340  88.286  1.00 10.79 ? 146  TYR B OH    1 
ATOM   4335 N  N     . ILE B 1 60  ? 144.974 -15.192 91.191  1.00 6.83  ? 147  ILE B N     1 
ATOM   4336 C  CA    . ILE B 1 60  ? 144.661 -16.599 91.472  1.00 6.93  ? 147  ILE B CA    1 
ATOM   4337 C  C     . ILE B 1 60  ? 144.624 -16.784 92.990  1.00 6.83  ? 147  ILE B C     1 
ATOM   4338 O  O     . ILE B 1 60  ? 145.662 -16.674 93.656  1.00 6.18  ? 147  ILE B O     1 
ATOM   4339 C  CB    . ILE B 1 60  ? 145.708 -17.547 90.851  1.00 7.04  ? 147  ILE B CB    1 
ATOM   4340 C  CG1   . ILE B 1 60  ? 145.659 -17.443 89.314  1.00 7.77  ? 147  ILE B CG1   1 
ATOM   4341 C  CG2   . ILE B 1 60  ? 145.480 -18.997 91.301  1.00 7.76  ? 147  ILE B CG2   1 
ATOM   4342 C  CD1   . ILE B 1 60  ? 146.765 -18.242 88.636  1.00 8.23  ? 147  ILE B CD1   1 
ATOM   4343 N  N     . LYS B 1 61  ? 143.428 -17.035 93.516  1.00 7.69  ? 148  LYS B N     1 
ATOM   4344 C  CA    . LYS B 1 61  ? 143.238 -17.234 94.965  1.00 7.85  ? 148  LYS B CA    1 
ATOM   4345 C  C     . LYS B 1 61  ? 143.987 -18.459 95.442  1.00 6.91  ? 148  LYS B C     1 
ATOM   4346 O  O     . LYS B 1 61  ? 143.908 -19.533 94.830  1.00 7.11  ? 148  LYS B O     1 
ATOM   4347 C  CB    . LYS B 1 61  ? 141.744 -17.348 95.291  1.00 9.87  ? 148  LYS B CB    1 
ATOM   4348 C  CG    . LYS B 1 61  ? 141.052 -16.003 95.389  1.00 12.18 ? 148  LYS B CG    1 
ATOM   4349 C  CD    . LYS B 1 61  ? 139.562 -16.155 95.638  1.00 14.99 ? 148  LYS B CD    1 
ATOM   4350 C  CE    . LYS B 1 61  ? 138.872 -16.861 94.470  1.00 17.22 ? 148  LYS B CE    1 
ATOM   4351 N  NZ    . LYS B 1 61  ? 138.762 -15.951 93.286  1.00 19.33 ? 148  LYS B NZ    1 
ATOM   4352 N  N     . GLN B 1 62  ? 144.735 -18.293 96.536  1.00 5.57  ? 149  GLN B N     1 
ATOM   4353 C  CA    . GLN B 1 62  ? 145.479 -19.382 97.163  1.00 5.46  ? 149  GLN B CA    1 
ATOM   4354 C  C     . GLN B 1 62  ? 144.598 -20.605 97.447  1.00 5.31  ? 149  GLN B C     1 
ATOM   4355 O  O     . GLN B 1 62  ? 144.995 -21.749 97.183  1.00 6.12  ? 149  GLN B O     1 
ATOM   4356 C  CB    . GLN B 1 62  ? 146.097 -18.873 98.480  1.00 4.90  ? 149  GLN B CB    1 
ATOM   4357 C  CG    . GLN B 1 62  ? 146.958 -19.904 99.214  1.00 4.68  ? 149  GLN B CG    1 
ATOM   4358 C  CD    . GLN B 1 62  ? 148.386 -19.934 98.715  1.00 4.84  ? 149  GLN B CD    1 
ATOM   4359 O  OE1   . GLN B 1 62  ? 148.787 -19.130 97.847  1.00 4.69  ? 149  GLN B OE1   1 
ATOM   4360 N  NE2   . GLN B 1 62  ? 149.189 -20.846 99.283  1.00 4.57  ? 149  GLN B NE2   1 
ATOM   4361 N  N     . LEU B 1 63  ? 143.429 -20.357 98.019  1.00 5.72  ? 150  LEU B N     1 
ATOM   4362 C  CA    . LEU B 1 63  ? 142.588 -21.416 98.560  1.00 6.25  ? 150  LEU B CA    1 
ATOM   4363 C  C     . LEU B 1 63  ? 141.366 -21.679 97.675  1.00 7.13  ? 150  LEU B C     1 
ATOM   4364 O  O     . LEU B 1 63  ? 140.498 -22.459 98.028  1.00 7.19  ? 150  LEU B O     1 
ATOM   4365 C  CB    . LEU B 1 63  ? 142.176 -21.094 100.011 1.00 4.99  ? 150  LEU B CB    1 
ATOM   4366 C  CG    . LEU B 1 63  ? 143.309 -20.974 101.040 1.00 5.28  ? 150  LEU B CG    1 
ATOM   4367 C  CD1   . LEU B 1 63  ? 142.747 -20.887 102.476 1.00 5.27  ? 150  LEU B CD1   1 
ATOM   4368 C  CD2   . LEU B 1 63  ? 144.300 -22.113 100.935 1.00 5.31  ? 150  LEU B CD2   1 
ATOM   4369 N  N     . GLY B 1 64  ? 141.344 -21.038 96.503  1.00 8.11  ? 151  GLY B N     1 
ATOM   4370 C  CA    . GLY B 1 64  ? 140.304 -21.305 95.497  1.00 8.83  ? 151  GLY B CA    1 
ATOM   4371 C  C     . GLY B 1 64  ? 138.900 -21.166 96.042  1.00 8.96  ? 151  GLY B C     1 
ATOM   4372 O  O     . GLY B 1 64  ? 138.536 -20.118 96.610  1.00 9.86  ? 151  GLY B O     1 
ATOM   4373 N  N     . GLY B 1 65  ? 138.107 -22.233 95.899  1.00 8.51  ? 152  GLY B N     1 
ATOM   4374 C  CA    . GLY B 1 65  ? 136.743 -22.247 96.443  1.00 7.93  ? 152  GLY B CA    1 
ATOM   4375 C  C     . GLY B 1 65  ? 136.626 -22.013 97.940  1.00 8.31  ? 152  GLY B C     1 
ATOM   4376 O  O     . GLY B 1 65  ? 135.562 -21.648 98.432  1.00 7.90  ? 152  GLY B O     1 
ATOM   4377 N  N     . GLY B 1 66  ? 137.719 -22.200 98.677  1.00 8.08  ? 153  GLY B N     1 
ATOM   4378 C  CA    . GLY B 1 66  ? 137.716 -21.917 100.116 1.00 7.85  ? 153  GLY B CA    1 
ATOM   4379 C  C     . GLY B 1 66  ? 137.233 -20.518 100.513 1.00 7.09  ? 153  GLY B C     1 
ATOM   4380 O  O     . GLY B 1 66  ? 136.629 -20.359 101.573 1.00 7.11  ? 153  GLY B O     1 
ATOM   4381 N  N     . TYR B 1 67  ? 137.478 -19.516 99.662  1.00 6.65  ? 154  TYR B N     1 
ATOM   4382 C  CA    . TYR B 1 67  ? 137.018 -18.142 99.913  1.00 6.11  ? 154  TYR B CA    1 
ATOM   4383 C  C     . TYR B 1 67  ? 135.483 -18.068 100.051 1.00 6.61  ? 154  TYR B C     1 
ATOM   4384 O  O     . TYR B 1 67  ? 134.948 -17.196 100.750 1.00 6.89  ? 154  TYR B O     1 
ATOM   4385 C  CB    . TYR B 1 67  ? 137.494 -17.238 98.750  1.00 6.65  ? 154  TYR B CB    1 
ATOM   4386 C  CG    . TYR B 1 67  ? 137.004 -15.797 98.788  1.00 6.44  ? 154  TYR B CG    1 
ATOM   4387 C  CD1   . TYR B 1 67  ? 137.057 -15.032 99.958  1.00 6.68  ? 154  TYR B CD1   1 
ATOM   4388 C  CD2   . TYR B 1 67  ? 136.539 -15.183 97.618  1.00 6.80  ? 154  TYR B CD2   1 
ATOM   4389 C  CE1   . TYR B 1 67  ? 136.631 -13.702 99.971  1.00 6.58  ? 154  TYR B CE1   1 
ATOM   4390 C  CE2   . TYR B 1 67  ? 136.105 -13.862 97.618  1.00 6.22  ? 154  TYR B CE2   1 
ATOM   4391 C  CZ    . TYR B 1 67  ? 136.139 -13.135 98.800  1.00 6.92  ? 154  TYR B CZ    1 
ATOM   4392 O  OH    . TYR B 1 67  ? 135.723 -11.830 98.809  1.00 7.05  ? 154  TYR B OH    1 
ATOM   4393 N  N     . TYR B 1 68  ? 134.784 -19.007 99.413  1.00 7.38  ? 155  TYR B N     1 
ATOM   4394 C  CA    . TYR B 1 68  ? 133.319 -19.025 99.406  1.00 7.38  ? 155  TYR B CA    1 
ATOM   4395 C  C     . TYR B 1 68  ? 132.751 -19.660 100.689 1.00 7.16  ? 155  TYR B C     1 
ATOM   4396 O  O     . TYR B 1 68  ? 131.541 -19.667 100.902 1.00 7.88  ? 155  TYR B O     1 
ATOM   4397 C  CB    . TYR B 1 68  ? 132.779 -19.712 98.127  1.00 7.95  ? 155  TYR B CB    1 
ATOM   4398 C  CG    . TYR B 1 68  ? 133.073 -18.913 96.890  1.00 7.94  ? 155  TYR B CG    1 
ATOM   4399 C  CD1   . TYR B 1 68  ? 134.294 -19.039 96.233  1.00 8.42  ? 155  TYR B CD1   1 
ATOM   4400 C  CD2   . TYR B 1 68  ? 132.150 -17.977 96.410  1.00 8.77  ? 155  TYR B CD2   1 
ATOM   4401 C  CE1   . TYR B 1 68  ? 134.592 -18.268 95.108  1.00 8.65  ? 155  TYR B CE1   1 
ATOM   4402 C  CE2   . TYR B 1 68  ? 132.429 -17.208 95.275  1.00 8.87  ? 155  TYR B CE2   1 
ATOM   4403 C  CZ    . TYR B 1 68  ? 133.647 -17.372 94.633  1.00 9.28  ? 155  TYR B CZ    1 
ATOM   4404 O  OH    . TYR B 1 68  ? 133.936 -16.612 93.535  1.00 10.46 ? 155  TYR B OH    1 
ATOM   4405 N  N     . VAL B 1 69  ? 133.653 -20.090 101.585 1.00 6.25  ? 156  VAL B N     1 
ATOM   4406 C  CA    . VAL B 1 69  ? 133.277 -20.630 102.903 1.00 6.06  ? 156  VAL B CA    1 
ATOM   4407 C  C     . VAL B 1 69  ? 133.966 -19.828 104.030 1.00 5.81  ? 156  VAL B C     1 
ATOM   4408 O  O     . VAL B 1 69  ? 133.389 -19.604 105.103 1.00 5.43  ? 156  VAL B O     1 
ATOM   4409 C  CB    . VAL B 1 69  ? 133.633 -22.135 102.977 1.00 5.37  ? 156  VAL B CB    1 
ATOM   4410 C  CG1   . VAL B 1 69  ? 133.439 -22.690 104.388 1.00 5.58  ? 156  VAL B CG1   1 
ATOM   4411 C  CG2   . VAL B 1 69  ? 132.798 -22.934 101.959 1.00 5.80  ? 156  VAL B CG2   1 
ATOM   4412 N  N     . PHE B 1 70  ? 135.205 -19.405 103.780 1.00 5.81  ? 157  PHE B N     1 
ATOM   4413 C  CA    . PHE B 1 70  ? 135.956 -18.588 104.730 1.00 5.87  ? 157  PHE B CA    1 
ATOM   4414 C  C     . PHE B 1 70  ? 136.196 -17.204 104.101 1.00 6.43  ? 157  PHE B C     1 
ATOM   4415 O  O     . PHE B 1 70  ? 137.114 -17.033 103.311 1.00 5.71  ? 157  PHE B O     1 
ATOM   4416 C  CB    . PHE B 1 70  ? 137.334 -19.228 105.041 1.00 5.88  ? 157  PHE B CB    1 
ATOM   4417 C  CG    . PHE B 1 70  ? 137.277 -20.502 105.853 1.00 6.23  ? 157  PHE B CG    1 
ATOM   4418 C  CD1   . PHE B 1 70  ? 137.067 -21.737 105.245 1.00 6.26  ? 157  PHE B CD1   1 
ATOM   4419 C  CD2   . PHE B 1 70  ? 137.467 -20.458 107.243 1.00 6.42  ? 157  PHE B CD2   1 
ATOM   4420 C  CE1   . PHE B 1 70  ? 137.050 -22.915 106.004 1.00 6.22  ? 157  PHE B CE1   1 
ATOM   4421 C  CE2   . PHE B 1 70  ? 137.461 -21.618 107.995 1.00 6.61  ? 157  PHE B CE2   1 
ATOM   4422 C  CZ    . PHE B 1 70  ? 137.250 -22.857 107.379 1.00 5.95  ? 157  PHE B CZ    1 
ATOM   4423 N  N     . PRO B 1 71  ? 135.375 -16.194 104.454 1.00 6.92  ? 158  PRO B N     1 
ATOM   4424 C  CA    . PRO B 1 71  ? 135.447 -14.905 103.764 1.00 7.25  ? 158  PRO B CA    1 
ATOM   4425 C  C     . PRO B 1 71  ? 136.762 -14.148 103.937 1.00 7.16  ? 158  PRO B C     1 
ATOM   4426 O  O     . PRO B 1 71  ? 137.042 -13.254 103.143 1.00 7.37  ? 158  PRO B O     1 
ATOM   4427 C  CB    . PRO B 1 71  ? 134.288 -14.113 104.380 1.00 8.38  ? 158  PRO B CB    1 
ATOM   4428 C  CG    . PRO B 1 71  ? 134.155 -14.700 105.760 1.00 8.74  ? 158  PRO B CG    1 
ATOM   4429 C  CD    . PRO B 1 71  ? 134.367 -16.183 105.528 1.00 7.86  ? 158  PRO B CD    1 
ATOM   4430 N  N     . GLY B 1 72  ? 137.561 -14.498 104.942 1.00 6.85  ? 159  GLY B N     1 
ATOM   4431 C  CA    . GLY B 1 72  ? 138.884 -13.885 105.081 1.00 6.96  ? 159  GLY B CA    1 
ATOM   4432 C  C     . GLY B 1 72  ? 139.882 -14.388 104.056 1.00 7.11  ? 159  GLY B C     1 
ATOM   4433 O  O     . GLY B 1 72  ? 140.895 -13.732 103.838 1.00 7.64  ? 159  GLY B O     1 
ATOM   4434 N  N     . ALA B 1 73  ? 139.620 -15.552 103.434 1.00 6.51  ? 160  ALA B N     1 
ATOM   4435 C  CA    . ALA B 1 73  ? 140.603 -16.182 102.531 1.00 6.06  ? 160  ALA B CA    1 
ATOM   4436 C  C     . ALA B 1 73  ? 140.535 -15.624 101.100 1.00 6.26  ? 160  ALA B C     1 
ATOM   4437 O  O     . ALA B 1 73  ? 140.358 -16.378 100.156 1.00 6.58  ? 160  ALA B O     1 
ATOM   4438 C  CB    . ALA B 1 73  ? 140.476 -17.710 102.529 1.00 6.25  ? 160  ALA B CB    1 
ATOM   4439 N  N     . SER B 1 74  ? 140.720 -14.305 101.008 1.00 6.90  ? 161  SER B N     1 
ATOM   4440 C  CA    . SER B 1 74  ? 140.806 -13.515 99.776  1.00 7.50  ? 161  SER B CA    1 
ATOM   4441 C  C     . SER B 1 74  ? 142.222 -13.496 99.183  1.00 6.97  ? 161  SER B C     1 
ATOM   4442 O  O     . SER B 1 74  ? 142.453 -12.956 98.073  1.00 6.77  ? 161  SER B O     1 
ATOM   4443 C  CB    . SER B 1 74  ? 140.409 -12.056 100.124 1.00 8.33  ? 161  SER B CB    1 
ATOM   4444 O  OG    . SER B 1 74  ? 141.279 -11.526 101.175 1.00 10.74 ? 161  SER B OG    1 
ATOM   4445 N  N     . HIS B 1 75  ? 143.180 -14.086 99.900  1.00 6.09  ? 162  HIS B N     1 
ATOM   4446 C  CA    . HIS B 1 75  ? 144.589 -13.968 99.525  1.00 5.55  ? 162  HIS B CA    1 
ATOM   4447 C  C     . HIS B 1 75  ? 144.936 -14.772 98.291  1.00 5.82  ? 162  HIS B C     1 
ATOM   4448 O  O     . HIS B 1 75  ? 144.349 -15.817 98.010  1.00 5.94  ? 162  HIS B O     1 
ATOM   4449 C  CB    . HIS B 1 75  ? 145.526 -14.327 100.691 1.00 5.11  ? 162  HIS B CB    1 
ATOM   4450 C  CG    . HIS B 1 75  ? 145.301 -15.706 101.266 1.00 5.34  ? 162  HIS B CG    1 
ATOM   4451 N  ND1   . HIS B 1 75  ? 144.108 -16.116 101.772 1.00 5.33  ? 162  HIS B ND1   1 
ATOM   4452 C  CD2   . HIS B 1 75  ? 146.189 -16.751 101.465 1.00 5.06  ? 162  HIS B CD2   1 
ATOM   4453 C  CE1   . HIS B 1 75  ? 144.216 -17.376 102.229 1.00 5.03  ? 162  HIS B CE1   1 
ATOM   4454 N  NE2   . HIS B 1 75  ? 145.498 -17.769 102.050 1.00 4.94  ? 162  HIS B NE2   1 
ATOM   4455 N  N     . ASN B 1 76  ? 145.921 -14.257 97.555  1.00 5.25  ? 163  ASN B N     1 
ATOM   4456 C  CA    . ASN B 1 76  ? 146.297 -14.797 96.264  1.00 5.54  ? 163  ASN B CA    1 
ATOM   4457 C  C     . ASN B 1 76  ? 147.698 -15.390 96.277  1.00 5.42  ? 163  ASN B C     1 
ATOM   4458 O  O     . ASN B 1 76  ? 148.484 -15.206 97.218  1.00 5.37  ? 163  ASN B O     1 
ATOM   4459 C  CB    . ASN B 1 76  ? 146.202 -13.679 95.215  1.00 6.24  ? 163  ASN B CB    1 
ATOM   4460 C  CG    . ASN B 1 76  ? 144.806 -13.107 95.136  1.00 6.80  ? 163  ASN B CG    1 
ATOM   4461 O  OD1   . ASN B 1 76  ? 143.864 -13.826 94.835  1.00 7.35  ? 163  ASN B OD1   1 
ATOM   4462 N  ND2   . ASN B 1 76  ? 144.659 -11.818 95.429  1.00 7.46  ? 163  ASN B ND2   1 
ATOM   4463 N  N     . ARG B 1 77  ? 148.030 -16.084 95.204  1.00 5.29  ? 164  ARG B N     1 
ATOM   4464 C  CA    . ARG B 1 77  ? 149.305 -16.775 95.128  1.00 4.89  ? 164  ARG B CA    1 
ATOM   4465 C  C     . ARG B 1 77  ? 150.491 -15.809 95.076  1.00 4.96  ? 164  ARG B C     1 
ATOM   4466 O  O     . ARG B 1 77  ? 151.594 -16.173 95.447  1.00 5.42  ? 164  ARG B O     1 
ATOM   4467 C  CB    . ARG B 1 77  ? 149.315 -17.689 93.890  1.00 5.18  ? 164  ARG B CB    1 
ATOM   4468 C  CG    . ARG B 1 77  ? 148.441 -18.934 94.008  1.00 4.98  ? 164  ARG B CG    1 
ATOM   4469 C  CD    . ARG B 1 77  ? 149.202 -20.056 94.722  1.00 5.41  ? 164  ARG B CD    1 
ATOM   4470 N  NE    . ARG B 1 77  ? 148.275 -21.047 95.257  1.00 5.39  ? 164  ARG B NE    1 
ATOM   4471 C  CZ    . ARG B 1 77  ? 148.597 -22.070 96.045  1.00 5.67  ? 164  ARG B CZ    1 
ATOM   4472 N  NH1   . ARG B 1 77  ? 149.865 -22.323 96.380  1.00 5.71  ? 164  ARG B NH1   1 
ATOM   4473 N  NH2   . ARG B 1 77  ? 147.632 -22.864 96.490  1.00 5.65  ? 164  ARG B NH2   1 
ATOM   4474 N  N     . PHE B 1 78  ? 150.246 -14.582 94.630  1.00 5.61  ? 165  PHE B N     1 
ATOM   4475 C  CA    . PHE B 1 78  ? 151.298 -13.567 94.541  1.00 5.87  ? 165  PHE B CA    1 
ATOM   4476 C  C     . PHE B 1 78  ? 151.950 -13.304 95.902  1.00 5.65  ? 165  PHE B C     1 
ATOM   4477 O  O     . PHE B 1 78  ? 153.165 -13.469 96.070  1.00 5.71  ? 165  PHE B O     1 
ATOM   4478 C  CB    . PHE B 1 78  ? 150.723 -12.288 93.950  1.00 6.52  ? 165  PHE B CB    1 
ATOM   4479 C  CG    . PHE B 1 78  ? 151.680 -11.124 93.958  1.00 6.76  ? 165  PHE B CG    1 
ATOM   4480 C  CD1   . PHE B 1 78  ? 152.597 -10.955 92.924  1.00 7.12  ? 165  PHE B CD1   1 
ATOM   4481 C  CD2   . PHE B 1 78  ? 151.629 -10.176 94.975  1.00 6.75  ? 165  PHE B CD2   1 
ATOM   4482 C  CE1   . PHE B 1 78  ? 153.474 -9.871  92.933  1.00 7.06  ? 165  PHE B CE1   1 
ATOM   4483 C  CE2   . PHE B 1 78  ? 152.502 -9.091  94.977  1.00 6.91  ? 165  PHE B CE2   1 
ATOM   4484 C  CZ    . PHE B 1 78  ? 153.424 -8.941  93.947  1.00 7.43  ? 165  PHE B CZ    1 
ATOM   4485 N  N     . GLU B 1 79  ? 151.147 -12.918 96.886  1.00 5.39  ? 166  GLU B N     1 
ATOM   4486 C  CA    . GLU B 1 79  ? 151.718 -12.588 98.191  1.00 6.06  ? 166  GLU B CA    1 
ATOM   4487 C  C     . GLU B 1 79  ? 152.301 -13.827 98.887  1.00 5.65  ? 166  GLU B C     1 
ATOM   4488 O  O     . GLU B 1 79  ? 153.303 -13.727 99.592  1.00 5.47  ? 166  GLU B O     1 
ATOM   4489 C  CB    . GLU B 1 79  ? 150.686 -11.840 99.051  1.00 6.59  ? 166  GLU B CB    1 
ATOM   4490 C  CG    . GLU B 1 79  ? 149.309 -12.499 99.101  1.00 6.84  ? 166  GLU B CG    1 
ATOM   4491 C  CD    . GLU B 1 79  ? 148.349 -11.958 98.047  1.00 7.31  ? 166  GLU B CD    1 
ATOM   4492 O  OE1   . GLU B 1 79  ? 147.148 -11.877 98.337  1.00 7.51  ? 166  GLU B OE1   1 
ATOM   4493 O  OE2   . GLU B 1 79  ? 148.795 -11.617 96.917  1.00 7.67  ? 166  GLU B OE2   1 
ATOM   4494 N  N     . HIS B 1 80  ? 151.707 -15.003 98.671  1.00 5.11  ? 167  HIS B N     1 
ATOM   4495 C  CA    . HIS B 1 80  ? 152.282 -16.229 99.203  1.00 5.54  ? 167  HIS B CA    1 
ATOM   4496 C  C     . HIS B 1 80  ? 153.659 -16.451 98.614  1.00 5.80  ? 167  HIS B C     1 
ATOM   4497 O  O     . HIS B 1 80  ? 154.626 -16.787 99.321  1.00 5.28  ? 167  HIS B O     1 
ATOM   4498 C  CB    . HIS B 1 80  ? 151.332 -17.411 98.914  1.00 5.23  ? 167  HIS B CB    1 
ATOM   4499 C  CG    . HIS B 1 80  ? 151.993 -18.760 99.000  1.00 5.47  ? 167  HIS B CG    1 
ATOM   4500 N  ND1   . HIS B 1 80  ? 152.463 -19.286 100.157 1.00 5.44  ? 167  HIS B ND1   1 
ATOM   4501 C  CD2   . HIS B 1 80  ? 152.243 -19.694 98.012  1.00 5.81  ? 167  HIS B CD2   1 
ATOM   4502 C  CE1   . HIS B 1 80  ? 152.996 -20.494 99.914  1.00 5.69  ? 167  HIS B CE1   1 
ATOM   4503 N  NE2   . HIS B 1 80  ? 152.850 -20.751 98.600  1.00 5.87  ? 167  HIS B NE2   1 
ATOM   4504 N  N     . SER B 1 81  ? 153.779 -16.197 97.314  1.00 6.11  ? 168  SER B N     1 
ATOM   4505 C  CA    . SER B 1 81  ? 155.055 -16.405 96.626  1.00 6.55  ? 168  SER B CA    1 
ATOM   4506 C  C     . SER B 1 81  ? 156.173 -15.476 97.116  1.00 6.34  ? 168  SER B C     1 
ATOM   4507 O  O     . SER B 1 81  ? 157.317 -15.912 97.303  1.00 6.95  ? 168  SER B O     1 
ATOM   4508 C  CB    . SER B 1 81  ? 154.853 -16.280 95.117  1.00 6.54  ? 168  SER B CB    1 
ATOM   4509 O  OG    . SER B 1 81  ? 154.008 -17.324 94.628  1.00 7.29  ? 168  SER B OG    1 
ATOM   4510 N  N     . LEU B 1 82  ? 155.843 -14.208 97.367  1.00 6.21  ? 169  LEU B N     1 
ATOM   4511 C  CA    . LEU B 1 82  ? 156.798 -13.279 97.975  1.00 6.52  ? 169  LEU B CA    1 
ATOM   4512 C  C     . LEU B 1 82  ? 157.246 -13.840 99.312  1.00 6.84  ? 169  LEU B C     1 
ATOM   4513 O  O     . LEU B 1 82  ? 158.430 -13.780 99.644  1.00 6.81  ? 169  LEU B O     1 
ATOM   4514 C  CB    . LEU B 1 82  ? 156.154 -11.900 98.199  1.00 6.91  ? 169  LEU B CB    1 
ATOM   4515 C  CG    . LEU B 1 82  ? 155.770 -11.101 96.957  1.00 7.24  ? 169  LEU B CG    1 
ATOM   4516 C  CD1   . LEU B 1 82  ? 155.275 -9.716  97.346  1.00 7.86  ? 169  LEU B CD1   1 
ATOM   4517 C  CD2   . LEU B 1 82  ? 156.970 -10.960 96.022  1.00 8.56  ? 169  LEU B CD2   1 
ATOM   4518 N  N     . GLY B 1 83  ? 156.293 -14.390 100.076 1.00 6.51  ? 170  GLY B N     1 
ATOM   4519 C  CA    . GLY B 1 83  ? 156.599 -14.916 101.414 1.00 5.74  ? 170  GLY B CA    1 
ATOM   4520 C  C     . GLY B 1 83  ? 157.545 -16.100 101.343 1.00 6.55  ? 170  GLY B C     1 
ATOM   4521 O  O     . GLY B 1 83  ? 158.443 -16.219 102.172 1.00 7.38  ? 170  GLY B O     1 
ATOM   4522 N  N     . VAL B 1 84  ? 157.328 -16.985 100.369 1.00 4.80  ? 171  VAL B N     1 
ATOM   4523 C  CA    . VAL B 1 84  ? 158.161 -18.166 100.231 1.00 6.33  ? 171  VAL B CA    1 
ATOM   4524 C  C     . VAL B 1 84  ? 159.570 -17.763 99.801  1.00 7.18  ? 171  VAL B C     1 
ATOM   4525 O  O     . VAL B 1 84  ? 160.568 -18.313 100.314 1.00 7.15  ? 171  VAL B O     1 
ATOM   4526 C  CB    . VAL B 1 84  ? 157.517 -19.201 99.285  1.00 6.51  ? 171  VAL B CB    1 
ATOM   4527 C  CG1   . VAL B 1 84  ? 158.435 -20.399 99.046  1.00 6.30  ? 171  VAL B CG1   1 
ATOM   4528 C  CG2   . VAL B 1 84  ? 156.183 -19.709 99.873  1.00 6.10  ? 171  VAL B CG2   1 
ATOM   4529 N  N     . GLY B 1 85  ? 159.651 -16.787 98.894  1.00 8.25  ? 172  GLY B N     1 
ATOM   4530 C  CA    . GLY B 1 85  ? 160.964 -16.214 98.487  1.00 8.68  ? 172  GLY B CA    1 
ATOM   4531 C  C     . GLY B 1 85  ? 161.707 -15.667 99.690  1.00 9.32  ? 172  GLY B C     1 
ATOM   4532 O  O     . GLY B 1 85  ? 162.895 -15.933 99.904  1.00 10.46 ? 172  GLY B O     1 
ATOM   4533 N  N     . TYR B 1 86  ? 160.986 -14.922 100.519 1.00 8.91  ? 173  TYR B N     1 
ATOM   4534 C  CA    . TYR B 1 86  ? 161.571 -14.332 101.705 1.00 9.04  ? 173  TYR B CA    1 
ATOM   4535 C  C     . TYR B 1 86  ? 162.130 -15.384 102.670 1.00 8.95  ? 173  TYR B C     1 
ATOM   4536 O  O     . TYR B 1 86  ? 163.278 -15.282 103.112 1.00 9.55  ? 173  TYR B O     1 
ATOM   4537 C  CB    . TYR B 1 86  ? 160.534 -13.445 102.408 1.00 8.97  ? 173  TYR B CB    1 
ATOM   4538 C  CG    . TYR B 1 86  ? 160.928 -13.049 103.812 1.00 10.99 ? 173  TYR B CG    1 
ATOM   4539 C  CD1   . TYR B 1 86  ? 161.961 -12.133 104.042 1.00 12.10 ? 173  TYR B CD1   1 
ATOM   4540 C  CD2   . TYR B 1 86  ? 160.260 -13.580 104.910 1.00 11.31 ? 173  TYR B CD2   1 
ATOM   4541 C  CE1   . TYR B 1 86  ? 162.322 -11.773 105.329 1.00 13.28 ? 173  TYR B CE1   1 
ATOM   4542 C  CE2   . TYR B 1 86  ? 160.606 -13.225 106.191 1.00 12.68 ? 173  TYR B CE2   1 
ATOM   4543 C  CZ    . TYR B 1 86  ? 161.625 -12.314 106.403 1.00 13.48 ? 173  TYR B CZ    1 
ATOM   4544 O  OH    . TYR B 1 86  ? 161.963 -11.999 107.708 1.00 15.62 ? 173  TYR B OH    1 
ATOM   4545 N  N     . LEU B 1 87  ? 161.314 -16.378 103.014 1.00 9.05  ? 174  LEU B N     1 
ATOM   4546 C  CA    . LEU B 1 87  ? 161.719 -17.394 103.972 1.00 8.80  ? 174  LEU B CA    1 
ATOM   4547 C  C     . LEU B 1 87  ? 162.851 -18.279 103.453 1.00 9.41  ? 174  LEU B C     1 
ATOM   4548 O  O     . LEU B 1 87  ? 163.707 -18.712 104.229 1.00 9.58  ? 174  LEU B O     1 
ATOM   4549 C  CB    . LEU B 1 87  ? 160.528 -18.275 104.341 1.00 9.49  ? 174  LEU B CB    1 
ATOM   4550 C  CG    . LEU B 1 87  ? 159.399 -17.584 105.089 1.00 9.28  ? 174  LEU B CG    1 
ATOM   4551 C  CD1   . LEU B 1 87  ? 158.309 -18.627 105.390 1.00 9.39  ? 174  LEU B CD1   1 
ATOM   4552 C  CD2   . LEU B 1 87  ? 159.908 -16.965 106.382 1.00 9.94  ? 174  LEU B CD2   1 
ATOM   4553 N  N     . ALA B 1 88  ? 162.843 -18.545 102.148 1.00 9.16  ? 175  ALA B N     1 
ATOM   4554 C  CA    . ALA B 1 88  ? 163.910 -19.339 101.527 1.00 9.43  ? 175  ALA B CA    1 
ATOM   4555 C  C     . ALA B 1 88  ? 165.231 -18.613 101.775 1.00 10.12 ? 175  ALA B C     1 
ATOM   4556 O  O     . ALA B 1 88  ? 166.210 -19.210 102.225 1.00 9.77  ? 175  ALA B O     1 
ATOM   4557 C  CB    . ALA B 1 88  ? 163.661 -19.492 100.033 1.00 8.20  ? 175  ALA B CB    1 
ATOM   4558 N  N     . GLY B 1 89  ? 165.250 -17.314 101.476 1.00 10.77 ? 176  GLY B N     1 
ATOM   4559 C  CA    . GLY B 1 89  ? 166.425 -16.499 101.774 1.00 12.22 ? 176  GLY B CA    1 
ATOM   4560 C  C     . GLY B 1 89  ? 166.787 -16.479 103.246 1.00 12.86 ? 176  GLY B C     1 
ATOM   4561 O  O     . GLY B 1 89  ? 167.963 -16.582 103.603 1.00 12.53 ? 176  GLY B O     1 
ATOM   4562 N  N     . CYS B 1 90  ? 165.780 -16.344 104.112 1.00 12.44 ? 177  CYS B N     1 
ATOM   4563 C  CA    . CYS B 1 90  ? 166.000 -16.356 105.557 1.00 13.29 ? 177  CYS B CA    1 
ATOM   4564 C  C     . CYS B 1 90  ? 166.727 -17.614 106.022 1.00 12.50 ? 177  CYS B C     1 
ATOM   4565 O  O     . CYS B 1 90  ? 167.671 -17.542 106.815 1.00 13.45 ? 177  CYS B O     1 
ATOM   4566 C  CB    . CYS B 1 90  ? 164.664 -16.325 106.293 1.00 14.78 ? 177  CYS B CB    1 
ATOM   4567 S  SG    . CYS B 1 90  ? 163.934 -14.713 106.359 1.00 21.56 ? 177  CYS B SG    1 
ATOM   4568 N  N     . LEU B 1 91  ? 166.259 -18.771 105.569 1.00 11.36 ? 178  LEU B N     1 
ATOM   4569 C  CA    . LEU B 1 91  ? 166.811 -20.018 106.061 1.00 11.32 ? 178  LEU B CA    1 
ATOM   4570 C  C     . LEU B 1 91  ? 168.239 -20.211 105.514 1.00 12.84 ? 178  LEU B C     1 
ATOM   4571 O  O     . LEU B 1 91  ? 169.149 -20.565 106.265 1.00 13.23 ? 178  LEU B O     1 
ATOM   4572 C  CB    . LEU B 1 91  ? 165.923 -21.207 105.699 1.00 10.41 ? 178  LEU B CB    1 
ATOM   4573 C  CG    . LEU B 1 91  ? 166.448 -22.615 106.003 1.00 9.26  ? 178  LEU B CG    1 
ATOM   4574 C  CD1   . LEU B 1 91  ? 166.892 -22.816 107.446 1.00 11.11 ? 178  LEU B CD1   1 
ATOM   4575 C  CD2   . LEU B 1 91  ? 165.433 -23.688 105.581 1.00 10.19 ? 178  LEU B CD2   1 
ATOM   4576 N  N     . VAL B 1 92  ? 168.434 -19.954 104.227 1.00 12.98 ? 179  VAL B N     1 
ATOM   4577 C  CA    . VAL B 1 92  ? 169.792 -20.125 103.663 1.00 15.38 ? 179  VAL B CA    1 
ATOM   4578 C  C     . VAL B 1 92  ? 170.768 -19.175 104.345 1.00 15.73 ? 179  VAL B C     1 
ATOM   4579 O  O     . VAL B 1 92  ? 171.875 -19.586 104.699 1.00 16.61 ? 179  VAL B O     1 
ATOM   4580 C  CB    . VAL B 1 92  ? 169.855 -19.938 102.136 1.00 16.52 ? 179  VAL B CB    1 
ATOM   4581 C  CG1   . VAL B 1 92  ? 171.250 -20.284 101.621 1.00 17.25 ? 179  VAL B CG1   1 
ATOM   4582 C  CG2   . VAL B 1 92  ? 168.886 -20.888 101.477 1.00 17.41 ? 179  VAL B CG2   1 
ATOM   4583 N  N     . HIS B 1 93  ? 170.356 -17.922 104.562 1.00 15.27 ? 180  HIS B N     1 
ATOM   4584 C  CA    A HIS B 1 93  ? 171.216 -16.957 105.255 0.50 17.42 ? 180  HIS B CA    1 
ATOM   4585 C  CA    B HIS B 1 93  ? 171.203 -16.949 105.267 0.50 17.27 ? 180  HIS B CA    1 
ATOM   4586 C  C     . HIS B 1 93  ? 171.581 -17.417 106.644 1.00 17.92 ? 180  HIS B C     1 
ATOM   4587 O  O     . HIS B 1 93  ? 172.747 -17.332 107.039 1.00 19.53 ? 180  HIS B O     1 
ATOM   4588 C  CB    A HIS B 1 93  ? 170.574 -15.572 105.307 0.50 18.40 ? 180  HIS B CB    1 
ATOM   4589 C  CB    B HIS B 1 93  ? 170.521 -15.588 105.374 0.50 17.96 ? 180  HIS B CB    1 
ATOM   4590 C  CG    A HIS B 1 93  ? 171.505 -14.486 105.794 0.50 19.86 ? 180  HIS B CG    1 
ATOM   4591 C  CG    B HIS B 1 93  ? 170.911 -14.621 104.289 0.50 19.00 ? 180  HIS B CG    1 
ATOM   4592 N  ND1   A HIS B 1 93  ? 172.403 -13.892 104.992 0.50 20.53 ? 180  HIS B ND1   1 
ATOM   4593 N  ND1   B HIS B 1 93  ? 170.004 -13.898 103.602 0.50 19.93 ? 180  HIS B ND1   1 
ATOM   4594 C  CD2   A HIS B 1 93  ? 171.651 -13.899 107.048 0.50 20.45 ? 180  HIS B CD2   1 
ATOM   4595 C  CD2   B HIS B 1 93  ? 172.163 -14.262 103.789 0.50 19.41 ? 180  HIS B CD2   1 
ATOM   4596 C  CE1   A HIS B 1 93  ? 173.092 -12.972 105.692 0.50 20.56 ? 180  HIS B CE1   1 
ATOM   4597 C  CE1   B HIS B 1 93  ? 170.642 -13.118 102.705 0.50 20.13 ? 180  HIS B CE1   1 
ATOM   4598 N  NE2   A HIS B 1 93  ? 172.632 -12.980 106.951 0.50 20.55 ? 180  HIS B NE2   1 
ATOM   4599 N  NE2   B HIS B 1 93  ? 171.962 -13.345 102.820 0.50 19.78 ? 180  HIS B NE2   1 
ATOM   4600 N  N     . ALA B 1 94  ? 170.597 -17.912 107.399 1.00 16.35 ? 181  ALA B N     1 
ATOM   4601 C  CA    . ALA B 1 94  ? 170.831 -18.385 108.768 1.00 16.50 ? 181  ALA B CA    1 
ATOM   4602 C  C     . ALA B 1 94  ? 171.846 -19.521 108.805 1.00 16.96 ? 181  ALA B C     1 
ATOM   4603 O  O     . ALA B 1 94  ? 172.743 -19.517 109.643 1.00 18.23 ? 181  ALA B O     1 
ATOM   4604 C  CB    . ALA B 1 94  ? 169.538 -18.830 109.433 1.00 16.70 ? 181  ALA B CB    1 
ATOM   4605 N  N     . LEU B 1 95  ? 171.700 -20.484 107.896 1.00 15.84 ? 182  LEU B N     1 
ATOM   4606 C  CA    . LEU B 1 95  ? 172.589 -21.647 107.856 1.00 16.66 ? 182  LEU B CA    1 
ATOM   4607 C  C     . LEU B 1 95  ? 174.016 -21.206 107.545 1.00 17.18 ? 182  LEU B C     1 
ATOM   4608 O  O     . LEU B 1 95  ? 174.970 -21.699 108.150 1.00 18.14 ? 182  LEU B O     1 
ATOM   4609 C  CB    . LEU B 1 95  ? 172.116 -22.676 106.824 1.00 15.87 ? 182  LEU B CB    1 
ATOM   4610 C  CG    . LEU B 1 95  ? 170.785 -23.409 107.083 1.00 14.94 ? 182  LEU B CG    1 
ATOM   4611 C  CD1   . LEU B 1 95  ? 170.410 -24.255 105.869 1.00 14.60 ? 182  LEU B CD1   1 
ATOM   4612 C  CD2   . LEU B 1 95  ? 170.822 -24.258 108.347 1.00 15.01 ? 182  LEU B CD2   1 
ATOM   4613 N  N     . GLY B 1 96  ? 174.143 -20.254 106.628 1.00 18.61 ? 183  GLY B N     1 
ATOM   4614 C  CA    . GLY B 1 96  ? 175.464 -19.769 106.184 1.00 21.09 ? 183  GLY B CA    1 
ATOM   4615 C  C     . GLY B 1 96  ? 176.185 -18.947 107.233 1.00 23.23 ? 183  GLY B C     1 
ATOM   4616 O  O     . GLY B 1 96  ? 177.417 -19.012 107.344 1.00 23.11 ? 183  GLY B O     1 
ATOM   4617 N  N     . GLU B 1 97  ? 175.421 -18.177 108.010 1.00 23.92 ? 184  GLU B N     1 
ATOM   4618 C  CA    . GLU B 1 97  ? 175.997 -17.375 109.090 1.00 25.37 ? 184  GLU B CA    1 
ATOM   4619 C  C     . GLU B 1 97  ? 176.460 -18.256 110.247 1.00 23.93 ? 184  GLU B C     1 
ATOM   4620 O  O     . GLU B 1 97  ? 177.426 -17.929 110.923 1.00 24.24 ? 184  GLU B O     1 
ATOM   4621 C  CB    . GLU B 1 97  ? 175.019 -16.296 109.589 1.00 27.51 ? 184  GLU B CB    1 
ATOM   4622 C  CG    . GLU B 1 97  ? 174.731 -15.177 108.580 1.00 33.22 ? 184  GLU B CG    1 
ATOM   4623 C  CD    . GLU B 1 97  ? 175.989 -14.498 108.035 1.00 36.89 ? 184  GLU B CD    1 
ATOM   4624 O  OE1   . GLU B 1 97  ? 176.104 -14.352 106.795 1.00 38.49 ? 184  GLU B OE1   1 
ATOM   4625 O  OE2   . GLU B 1 97  ? 176.871 -14.113 108.835 1.00 39.82 ? 184  GLU B OE2   1 
ATOM   4626 N  N     . LYS B 1 98  ? 175.769 -19.370 110.470 1.00 21.76 ? 185  LYS B N     1 
ATOM   4627 C  CA    . LYS B 1 98  ? 176.128 -20.270 111.558 1.00 22.06 ? 185  LYS B CA    1 
ATOM   4628 C  C     . LYS B 1 98  ? 177.291 -21.161 111.129 1.00 22.27 ? 185  LYS B C     1 
ATOM   4629 O  O     . LYS B 1 98  ? 178.110 -21.553 111.957 1.00 22.35 ? 185  LYS B O     1 
ATOM   4630 C  CB    . LYS B 1 98  ? 174.943 -21.126 111.976 1.00 24.62 ? 185  LYS B CB    1 
ATOM   4631 C  CG    . LYS B 1 98  ? 174.628 -21.038 113.467 1.00 30.68 ? 185  LYS B CG    1 
ATOM   4632 C  CD    . LYS B 1 98  ? 174.337 -19.598 113.887 1.00 33.70 ? 185  LYS B CD    1 
ATOM   4633 C  CE    . LYS B 1 98  ? 174.365 -19.441 115.399 1.00 36.29 ? 185  LYS B CE    1 
ATOM   4634 N  NZ    . LYS B 1 98  ? 174.645 -18.012 115.768 1.00 39.27 ? 185  LYS B NZ    1 
ATOM   4635 N  N     . GLN B 1 99  ? 177.361 -21.462 109.835 1.00 20.77 ? 186  GLN B N     1 
ATOM   4636 C  CA    . GLN B 1 99  ? 178.355 -22.413 109.321 1.00 22.04 ? 186  GLN B CA    1 
ATOM   4637 C  C     . GLN B 1 99  ? 179.039 -21.903 108.044 1.00 21.89 ? 186  GLN B C     1 
ATOM   4638 O  O     . GLN B 1 99  ? 178.714 -22.340 106.934 1.00 21.76 ? 186  GLN B O     1 
ATOM   4639 C  CB    . GLN B 1 99  ? 177.720 -23.778 109.083 1.00 21.44 ? 186  GLN B CB    1 
ATOM   4640 C  CG    . GLN B 1 99  ? 177.448 -24.571 110.352 1.00 21.17 ? 186  GLN B CG    1 
ATOM   4641 C  CD    . GLN B 1 99  ? 176.664 -25.841 110.084 1.00 21.82 ? 186  GLN B CD    1 
ATOM   4642 O  OE1   . GLN B 1 99  ? 175.441 -25.870 110.227 1.00 21.56 ? 186  GLN B OE1   1 
ATOM   4643 N  NE2   . GLN B 1 99  ? 177.360 -26.898 109.680 1.00 22.72 ? 186  GLN B NE2   1 
ATOM   4644 N  N     . PRO B 1 100 ? 179.987 -20.961 108.204 1.00 25.51 ? 187  PRO B N     1 
ATOM   4645 C  CA    . PRO B 1 100 ? 180.741 -20.401 107.073 1.00 26.31 ? 187  PRO B CA    1 
ATOM   4646 C  C     . PRO B 1 100 ? 181.419 -21.477 106.214 1.00 26.59 ? 187  PRO B C     1 
ATOM   4647 O  O     . PRO B 1 100 ? 181.635 -21.264 105.016 1.00 28.24 ? 187  PRO B O     1 
ATOM   4648 C  CB    . PRO B 1 100 ? 181.799 -19.530 107.757 1.00 27.38 ? 187  PRO B CB    1 
ATOM   4649 C  CG    . PRO B 1 100 ? 181.198 -19.168 109.075 1.00 27.52 ? 187  PRO B CG    1 
ATOM   4650 C  CD    . PRO B 1 100 ? 180.394 -20.367 109.492 1.00 26.39 ? 187  PRO B CD    1 
ATOM   4651 N  N     . GLU B 1 101 ? 181.733 -22.624 106.819 1.00 26.67 ? 188  GLU B N     1 
ATOM   4652 C  CA    . GLU B 1 101 ? 182.392 -23.730 106.117 1.00 27.75 ? 188  GLU B CA    1 
ATOM   4653 C  C     . GLU B 1 101 ? 181.566 -24.327 104.971 1.00 27.33 ? 188  GLU B C     1 
ATOM   4654 O  O     . GLU B 1 101 ? 182.107 -25.032 104.121 1.00 27.36 ? 188  GLU B O     1 
ATOM   4655 C  CB    . GLU B 1 101 ? 182.827 -24.827 107.098 1.00 28.50 ? 188  GLU B CB    1 
ATOM   4656 C  CG    . GLU B 1 101 ? 181.711 -25.750 107.582 1.00 29.24 ? 188  GLU B CG    1 
ATOM   4657 C  CD    . GLU B 1 101 ? 181.045 -25.284 108.868 1.00 29.11 ? 188  GLU B CD    1 
ATOM   4658 O  OE1   . GLU B 1 101 ? 181.255 -24.124 109.287 1.00 28.08 ? 188  GLU B OE1   1 
ATOM   4659 O  OE2   . GLU B 1 101 ? 180.299 -26.093 109.462 1.00 29.84 ? 188  GLU B OE2   1 
ATOM   4660 N  N     . LEU B 1 102 ? 180.263 -24.051 104.947 1.00 24.02 ? 189  LEU B N     1 
ATOM   4661 C  CA    . LEU B 1 102 ? 179.416 -24.510 103.846 1.00 23.95 ? 189  LEU B CA    1 
ATOM   4662 C  C     . LEU B 1 102 ? 179.659 -23.728 102.557 1.00 23.78 ? 189  LEU B C     1 
ATOM   4663 O  O     . LEU B 1 102 ? 179.234 -24.159 101.484 1.00 25.23 ? 189  LEU B O     1 
ATOM   4664 C  CB    . LEU B 1 102 ? 177.925 -24.435 104.222 1.00 23.34 ? 189  LEU B CB    1 
ATOM   4665 C  CG    . LEU B 1 102 ? 177.538 -25.151 105.512 1.00 22.68 ? 189  LEU B CG    1 
ATOM   4666 C  CD1   . LEU B 1 102 ? 176.109 -24.814 105.918 1.00 23.05 ? 189  LEU B CD1   1 
ATOM   4667 C  CD2   . LEU B 1 102 ? 177.724 -26.648 105.367 1.00 20.58 ? 189  LEU B CD2   1 
ATOM   4668 N  N     . GLN B 1 103 ? 180.313 -22.572 102.676 1.00 24.67 ? 190  GLN B N     1 
ATOM   4669 C  CA    . GLN B 1 103 ? 180.649 -21.724 101.524 1.00 27.27 ? 190  GLN B CA    1 
ATOM   4670 C  C     . GLN B 1 103 ? 179.401 -21.282 100.750 1.00 25.68 ? 190  GLN B C     1 
ATOM   4671 O  O     . GLN B 1 103 ? 179.407 -21.212 99.513  1.00 23.62 ? 190  GLN B O     1 
ATOM   4672 C  CB    . GLN B 1 103 ? 181.650 -22.430 100.588 1.00 30.47 ? 190  GLN B CB    1 
ATOM   4673 C  CG    . GLN B 1 103 ? 182.964 -22.831 101.248 1.00 33.74 ? 190  GLN B CG    1 
ATOM   4674 C  CD    . GLN B 1 103 ? 183.917 -21.664 101.414 1.00 37.78 ? 190  GLN B CD    1 
ATOM   4675 O  OE1   . GLN B 1 103 ? 183.698 -20.774 102.237 1.00 41.62 ? 190  GLN B OE1   1 
ATOM   4676 N  NE2   . GLN B 1 103 ? 184.988 -21.666 100.631 1.00 39.62 ? 190  GLN B NE2   1 
ATOM   4677 N  N     . ILE B 1 104 ? 178.326 -20.996 101.487 1.00 22.34 ? 191  ILE B N     1 
ATOM   4678 C  CA    . ILE B 1 104 ? 177.128 -20.456 100.876 1.00 21.67 ? 191  ILE B CA    1 
ATOM   4679 C  C     . ILE B 1 104 ? 177.439 -19.044 100.380 1.00 20.72 ? 191  ILE B C     1 
ATOM   4680 O  O     . ILE B 1 104 ? 177.887 -18.194 101.145 1.00 22.68 ? 191  ILE B O     1 
ATOM   4681 C  CB    . ILE B 1 104 ? 175.931 -20.424 101.865 1.00 20.63 ? 191  ILE B CB    1 
ATOM   4682 C  CG1   . ILE B 1 104 ? 175.562 -21.848 102.296 1.00 20.99 ? 191  ILE B CG1   1 
ATOM   4683 C  CG2   . ILE B 1 104 ? 174.751 -19.692 101.216 1.00 20.59 ? 191  ILE B CG2   1 
ATOM   4684 C  CD1   . ILE B 1 104 ? 174.550 -21.918 103.432 1.00 21.05 ? 191  ILE B CD1   1 
ATOM   4685 N  N     . SER B 1 105 ? 177.214 -18.812 99.092  1.00 21.20 ? 192  SER B N     1 
ATOM   4686 C  CA    . SER B 1 105 ? 177.521 -17.529 98.469  1.00 23.17 ? 192  SER B CA    1 
ATOM   4687 C  C     . SER B 1 105 ? 176.252 -16.708 98.299  1.00 23.69 ? 192  SER B C     1 
ATOM   4688 O  O     . SER B 1 105 ? 175.154 -17.264 98.336  1.00 22.21 ? 192  SER B O     1 
ATOM   4689 C  CB    . SER B 1 105 ? 178.148 -17.764 97.093  1.00 23.12 ? 192  SER B CB    1 
ATOM   4690 O  OG    . SER B 1 105 ? 177.229 -18.398 96.215  1.00 23.26 ? 192  SER B OG    1 
ATOM   4691 N  N     . GLU B 1 106 ? 176.405 -15.395 98.097  1.00 24.05 ? 193  GLU B N     1 
ATOM   4692 C  CA    . GLU B 1 106 ? 175.273 -14.536 97.750  1.00 26.52 ? 193  GLU B CA    1 
ATOM   4693 C  C     . GLU B 1 106 ? 174.586 -15.065 96.480  1.00 24.25 ? 193  GLU B C     1 
ATOM   4694 O  O     . GLU B 1 106 ? 173.364 -14.968 96.336  1.00 23.35 ? 193  GLU B O     1 
ATOM   4695 C  CB    . GLU B 1 106 ? 175.710 -13.064 97.619  1.00 29.42 ? 193  GLU B CB    1 
ATOM   4696 C  CG    . GLU B 1 106 ? 174.774 -12.166 96.813  1.00 35.00 ? 193  GLU B CG    1 
ATOM   4697 C  CD    . GLU B 1 106 ? 173.603 -11.600 97.615  1.00 39.11 ? 193  GLU B CD    1 
ATOM   4698 O  OE1   . GLU B 1 106 ? 173.493 -10.353 97.674  1.00 41.72 ? 193  GLU B OE1   1 
ATOM   4699 O  OE2   . GLU B 1 106 ? 172.784 -12.379 98.170  1.00 40.20 ? 193  GLU B OE2   1 
ATOM   4700 N  N     . ARG B 1 107 ? 175.377 -15.643 95.574  1.00 23.39 ? 194  ARG B N     1 
ATOM   4701 C  CA    . ARG B 1 107 ? 174.839 -16.313 94.391  1.00 20.89 ? 194  ARG B CA    1 
ATOM   4702 C  C     . ARG B 1 107 ? 173.834 -17.420 94.771  1.00 19.38 ? 194  ARG B C     1 
ATOM   4703 O  O     . ARG B 1 107 ? 172.706 -17.442 94.252  1.00 19.46 ? 194  ARG B O     1 
ATOM   4704 C  CB    . ARG B 1 107 ? 175.972 -16.882 93.519  1.00 22.34 ? 194  ARG B CB    1 
ATOM   4705 C  CG    . ARG B 1 107 ? 175.497 -17.641 92.280  1.00 22.26 ? 194  ARG B CG    1 
ATOM   4706 C  CD    . ARG B 1 107 ? 176.663 -18.254 91.508  1.00 22.72 ? 194  ARG B CD    1 
ATOM   4707 N  NE    . ARG B 1 107 ? 176.240 -19.341 90.624  1.00 22.59 ? 194  ARG B NE    1 
ATOM   4708 C  CZ    . ARG B 1 107 ? 177.036 -20.326 90.202  1.00 24.54 ? 194  ARG B CZ    1 
ATOM   4709 N  NH1   . ARG B 1 107 ? 178.312 -20.364 90.575  1.00 25.85 ? 194  ARG B NH1   1 
ATOM   4710 N  NH2   . ARG B 1 107 ? 176.556 -21.278 89.412  1.00 24.44 ? 194  ARG B NH2   1 
ATOM   4711 N  N     . ASP B 1 108 ? 174.244 -18.309 95.675  1.00 17.77 ? 195  ASP B N     1 
ATOM   4712 C  CA    . ASP B 1 108 ? 173.387 -19.399 96.164  1.00 17.30 ? 195  ASP B CA    1 
ATOM   4713 C  C     . ASP B 1 108 ? 172.102 -18.830 96.782  1.00 16.86 ? 195  ASP B C     1 
ATOM   4714 O  O     . ASP B 1 108 ? 171.001 -19.319 96.510  1.00 15.24 ? 195  ASP B O     1 
ATOM   4715 C  CB    . ASP B 1 108 ? 174.105 -20.242 97.223  1.00 18.03 ? 195  ASP B CB    1 
ATOM   4716 C  CG    . ASP B 1 108 ? 175.255 -21.049 96.663  1.00 18.71 ? 195  ASP B CG    1 
ATOM   4717 O  OD1   . ASP B 1 108 ? 175.174 -21.486 95.497  1.00 18.48 ? 195  ASP B OD1   1 
ATOM   4718 O  OD2   . ASP B 1 108 ? 176.232 -21.261 97.409  1.00 19.89 ? 195  ASP B OD2   1 
ATOM   4719 N  N     . VAL B 1 109 ? 172.265 -17.794 97.604  1.00 16.37 ? 196  VAL B N     1 
ATOM   4720 C  CA    . VAL B 1 109 ? 171.152 -17.157 98.314  1.00 15.68 ? 196  VAL B CA    1 
ATOM   4721 C  C     . VAL B 1 109 ? 170.134 -16.621 97.312  1.00 15.80 ? 196  VAL B C     1 
ATOM   4722 O  O     . VAL B 1 109 ? 168.935 -16.900 97.419  1.00 13.90 ? 196  VAL B O     1 
ATOM   4723 C  CB    . VAL B 1 109 ? 171.651 -16.024 99.250  1.00 16.47 ? 196  VAL B CB    1 
ATOM   4724 C  CG1   . VAL B 1 109 ? 170.482 -15.190 99.785  1.00 17.18 ? 196  VAL B CG1   1 
ATOM   4725 C  CG2   . VAL B 1 109 ? 172.471 -16.604 100.395 1.00 17.13 ? 196  VAL B CG2   1 
ATOM   4726 N  N     . LEU B 1 110 ? 170.613 -15.896 96.299  1.00 14.47 ? 197  LEU B N     1 
ATOM   4727 C  CA    . LEU B 1 110 ? 169.719 -15.395 95.259  1.00 15.00 ? 197  LEU B CA    1 
ATOM   4728 C  C     . LEU B 1 110 ? 168.998 -16.516 94.527  1.00 13.55 ? 197  LEU B C     1 
ATOM   4729 O  O     . LEU B 1 110 ? 167.814 -16.394 94.228  1.00 13.01 ? 197  LEU B O     1 
ATOM   4730 C  CB    . LEU B 1 110 ? 170.464 -14.493 94.264  1.00 16.85 ? 197  LEU B CB    1 
ATOM   4731 C  CG    . LEU B 1 110 ? 170.756 -13.068 94.724  1.00 17.88 ? 197  LEU B CG    1 
ATOM   4732 C  CD1   . LEU B 1 110 ? 171.716 -12.397 93.744  1.00 18.62 ? 197  LEU B CD1   1 
ATOM   4733 C  CD2   . LEU B 1 110 ? 169.475 -12.248 94.861  1.00 18.08 ? 197  LEU B CD2   1 
ATOM   4734 N  N     . CYS B 1 111 ? 169.710 -17.608 94.235  1.00 13.41 ? 198  CYS B N     1 
ATOM   4735 C  CA    . CYS B 1 111 ? 169.132 -18.754 93.534  1.00 13.43 ? 198  CYS B CA    1 
ATOM   4736 C  C     . CYS B 1 111 ? 168.001 -19.419 94.343  1.00 12.71 ? 198  CYS B C     1 
ATOM   4737 O  O     . CYS B 1 111 ? 166.964 -19.792 93.792  1.00 11.13 ? 198  CYS B O     1 
ATOM   4738 C  CB    . CYS B 1 111 ? 170.218 -19.788 93.239  1.00 13.30 ? 198  CYS B CB    1 
ATOM   4739 S  SG    . CYS B 1 111 ? 171.278 -19.299 91.836  1.00 17.35 ? 198  CYS B SG    1 
ATOM   4740 N  N     . VAL B 1 112 ? 168.212 -19.547 95.643  1.00 14.45 ? 199  VAL B N     1 
ATOM   4741 C  CA    . VAL B 1 112 ? 167.192 -20.126 96.524  1.00 14.01 ? 199  VAL B CA    1 
ATOM   4742 C  C     . VAL B 1 112 ? 165.992 -19.160 96.655  1.00 13.41 ? 199  VAL B C     1 
ATOM   4743 O  O     . VAL B 1 112 ? 164.824 -19.590 96.612  1.00 12.51 ? 199  VAL B O     1 
ATOM   4744 C  CB    . VAL B 1 112 ? 167.808 -20.510 97.888  1.00 15.55 ? 199  VAL B CB    1 
ATOM   4745 C  CG1   . VAL B 1 112 ? 166.733 -20.944 98.861  1.00 16.74 ? 199  VAL B CG1   1 
ATOM   4746 C  CG2   . VAL B 1 112 ? 168.823 -21.643 97.703  1.00 15.27 ? 199  VAL B CG2   1 
ATOM   4747 N  N     . GLN B 1 113 ? 166.274 -17.869 96.785  1.00 12.54 ? 200  GLN B N     1 
ATOM   4748 C  CA    . GLN B 1 113 ? 165.199 -16.855 96.790  1.00 12.76 ? 200  GLN B CA    1 
ATOM   4749 C  C     . GLN B 1 113 ? 164.384 -16.890 95.512  1.00 12.09 ? 200  GLN B C     1 
ATOM   4750 O  O     . GLN B 1 113 ? 163.157 -16.807 95.541  1.00 11.34 ? 200  GLN B O     1 
ATOM   4751 C  CB    . GLN B 1 113 ? 165.750 -15.443 96.985  1.00 14.17 ? 200  GLN B CB    1 
ATOM   4752 C  CG    . GLN B 1 113 ? 166.211 -15.138 98.398  1.00 15.84 ? 200  GLN B CG    1 
ATOM   4753 C  CD    . GLN B 1 113 ? 166.887 -13.781 98.504  1.00 18.69 ? 200  GLN B CD    1 
ATOM   4754 O  OE1   . GLN B 1 113 ? 167.760 -13.433 97.691  1.00 20.30 ? 200  GLN B OE1   1 
ATOM   4755 N  NE2   . GLN B 1 113 ? 166.497 -13.010 99.500  1.00 19.81 ? 200  GLN B NE2   1 
ATOM   4756 N  N     . ILE B 1 114 ? 165.064 -17.018 94.371  1.00 10.57 ? 201  ILE B N     1 
ATOM   4757 C  CA    . ILE B 1 114 ? 164.344 -17.053 93.107  1.00 9.59  ? 201  ILE B CA    1 
ATOM   4758 C  C     . ILE B 1 114 ? 163.472 -18.283 92.984  1.00 8.40  ? 201  ILE B C     1 
ATOM   4759 O  O     . ILE B 1 114 ? 162.353 -18.212 92.453  1.00 8.88  ? 201  ILE B O     1 
ATOM   4760 C  CB    . ILE B 1 114 ? 165.284 -16.914 91.877  1.00 9.71  ? 201  ILE B CB    1 
ATOM   4761 C  CG1   . ILE B 1 114 ? 165.837 -15.491 91.828  1.00 11.12 ? 201  ILE B CG1   1 
ATOM   4762 C  CG2   . ILE B 1 114 ? 164.490 -17.192 90.609  1.00 9.82  ? 201  ILE B CG2   1 
ATOM   4763 C  CD1   . ILE B 1 114 ? 167.031 -15.329 90.899  1.00 12.16 ? 201  ILE B CD1   1 
ATOM   4764 N  N     . ALA B 1 115 ? 163.968 -19.421 93.459  1.00 9.34  ? 202  ALA B N     1 
ATOM   4765 C  CA    . ALA B 1 115 ? 163.181 -20.640 93.427  1.00 9.47  ? 202  ALA B CA    1 
ATOM   4766 C  C     . ALA B 1 115 ? 161.936 -20.483 94.331  1.00 9.77  ? 202  ALA B C     1 
ATOM   4767 O  O     . ALA B 1 115 ? 160.836 -20.834 93.917  1.00 9.29  ? 202  ALA B O     1 
ATOM   4768 C  CB    . ALA B 1 115 ? 164.013 -21.837 93.860  1.00 9.96  ? 202  ALA B CB    1 
ATOM   4769 N  N     . GLY B 1 116 ? 162.131 -19.912 95.523  1.00 10.78 ? 203  GLY B N     1 
ATOM   4770 C  CA    . GLY B 1 116 ? 161.016 -19.603 96.442  1.00 9.76  ? 203  GLY B CA    1 
ATOM   4771 C  C     . GLY B 1 116 ? 159.991 -18.670 95.806  1.00 9.50  ? 203  GLY B C     1 
ATOM   4772 O  O     . GLY B 1 116 ? 158.785 -18.949 95.828  1.00 9.41  ? 203  GLY B O     1 
ATOM   4773 N  N     . LEU B 1 117 ? 160.456 -17.579 95.185  1.00 8.95  ? 204  LEU B N     1 
ATOM   4774 C  CA    . LEU B 1 117 ? 159.550 -16.656 94.481  1.00 9.42  ? 204  LEU B CA    1 
ATOM   4775 C  C     . LEU B 1 117 ? 158.737 -17.313 93.399  1.00 9.96  ? 204  LEU B C     1 
ATOM   4776 O  O     . LEU B 1 117 ? 157.571 -16.990 93.225  1.00 10.68 ? 204  LEU B O     1 
ATOM   4777 C  CB    . LEU B 1 117 ? 160.304 -15.471 93.858  1.00 9.54  ? 204  LEU B CB    1 
ATOM   4778 C  CG    . LEU B 1 117 ? 160.899 -14.457 94.822  1.00 11.43 ? 204  LEU B CG    1 
ATOM   4779 C  CD1   . LEU B 1 117 ? 161.794 -13.494 94.039  1.00 11.65 ? 204  LEU B CD1   1 
ATOM   4780 C  CD2   . LEU B 1 117 ? 159.769 -13.699 95.514  1.00 11.84 ? 204  LEU B CD2   1 
ATOM   4781 N  N     . CYS B 1 118 ? 159.354 -18.239 92.659  1.00 10.38 ? 205  CYS B N     1 
ATOM   4782 C  CA    . CYS B 1 118 ? 158.752 -18.737 91.435  1.00 10.24 ? 205  CYS B CA    1 
ATOM   4783 C  C     . CYS B 1 118 ? 158.128 -20.126 91.523  1.00 9.41  ? 205  CYS B C     1 
ATOM   4784 O  O     . CYS B 1 118 ? 157.625 -20.622 90.533  1.00 9.29  ? 205  CYS B O     1 
ATOM   4785 C  CB    . CYS B 1 118 ? 159.770 -18.710 90.278  1.00 11.10 ? 205  CYS B CB    1 
ATOM   4786 S  SG    . CYS B 1 118 ? 160.319 -17.044 89.849  1.00 12.80 ? 205  CYS B SG    1 
ATOM   4787 N  N     . HIS B 1 119 ? 158.123 -20.744 92.701  1.00 9.36  ? 206  HIS B N     1 
ATOM   4788 C  CA    . HIS B 1 119 ? 157.739 -22.161 92.804  1.00 8.99  ? 206  HIS B CA    1 
ATOM   4789 C  C     . HIS B 1 119 ? 156.293 -22.403 92.440  1.00 8.59  ? 206  HIS B C     1 
ATOM   4790 O  O     . HIS B 1 119 ? 155.935 -23.516 92.065  1.00 8.75  ? 206  HIS B O     1 
ATOM   4791 C  CB    . HIS B 1 119 ? 158.012 -22.657 94.220  1.00 9.40  ? 206  HIS B CB    1 
ATOM   4792 C  CG    . HIS B 1 119 ? 156.979 -22.164 95.202  1.00 9.51  ? 206  HIS B CG    1 
ATOM   4793 N  ND1   . HIS B 1 119 ? 156.885 -20.867 95.563  1.00 9.06  ? 206  HIS B ND1   1 
ATOM   4794 C  CD2   . HIS B 1 119 ? 155.933 -22.822 95.829  1.00 9.88  ? 206  HIS B CD2   1 
ATOM   4795 C  CE1   . HIS B 1 119 ? 155.853 -20.710 96.399  1.00 9.18  ? 206  HIS B CE1   1 
ATOM   4796 N  NE2   . HIS B 1 119 ? 155.267 -21.898 96.553  1.00 8.34  ? 206  HIS B NE2   1 
ATOM   4797 N  N     . ASP B 1 120 ? 155.445 -21.377 92.561  1.00 8.45  ? 207  ASP B N     1 
ATOM   4798 C  CA    . ASP B 1 120 ? 154.021 -21.500 92.277  1.00 9.29  ? 207  ASP B CA    1 
ATOM   4799 C  C     . ASP B 1 120 ? 153.584 -20.804 90.979  1.00 9.41  ? 207  ASP B C     1 
ATOM   4800 O  O     . ASP B 1 120 ? 152.394 -20.595 90.763  1.00 9.36  ? 207  ASP B O     1 
ATOM   4801 C  CB    . ASP B 1 120 ? 153.163 -20.961 93.468  1.00 9.33  ? 207  ASP B CB    1 
ATOM   4802 C  CG    . ASP B 1 120 ? 152.863 -22.023 94.529  1.00 9.73  ? 207  ASP B CG    1 
ATOM   4803 O  OD1   . ASP B 1 120 ? 153.092 -23.226 94.299  1.00 8.76  ? 207  ASP B OD1   1 
ATOM   4804 O  OD2   . ASP B 1 120 ? 152.344 -21.653 95.622  1.00 9.76  ? 207  ASP B OD2   1 
ATOM   4805 N  N     . LEU B 1 121 ? 154.531 -20.451 90.104  1.00 9.24  ? 208  LEU B N     1 
ATOM   4806 C  CA    . LEU B 1 121 ? 154.165 -19.782 88.838  1.00 9.71  ? 208  LEU B CA    1 
ATOM   4807 C  C     . LEU B 1 121 ? 153.210 -20.611 87.992  1.00 9.58  ? 208  LEU B C     1 
ATOM   4808 O  O     . LEU B 1 121 ? 152.429 -20.059 87.218  1.00 10.14 ? 208  LEU B O     1 
ATOM   4809 C  CB    . LEU B 1 121 ? 155.406 -19.414 88.015  1.00 9.61  ? 208  LEU B CB    1 
ATOM   4810 C  CG    . LEU B 1 121 ? 156.273 -18.221 88.431  1.00 9.94  ? 208  LEU B CG    1 
ATOM   4811 C  CD1   . LEU B 1 121 ? 157.535 -18.208 87.571  1.00 10.08 ? 208  LEU B CD1   1 
ATOM   4812 C  CD2   . LEU B 1 121 ? 155.520 -16.891 88.274  1.00 9.97  ? 208  LEU B CD2   1 
ATOM   4813 N  N     . GLY B 1 122 ? 153.229 -21.929 88.169  1.00 9.59  ? 209  GLY B N     1 
ATOM   4814 C  CA    . GLY B 1 122 ? 152.406 -22.812 87.348  1.00 9.82  ? 209  GLY B CA    1 
ATOM   4815 C  C     . GLY B 1 122 ? 150.984 -23.047 87.805  1.00 9.43  ? 209  GLY B C     1 
ATOM   4816 O  O     . GLY B 1 122 ? 150.226 -23.766 87.161  1.00 9.99  ? 209  GLY B O     1 
ATOM   4817 N  N     . HIS B 1 123 ? 150.592 -22.464 88.935  1.00 9.39  ? 210  HIS B N     1 
ATOM   4818 C  CA    . HIS B 1 123 ? 149.194 -22.604 89.353  1.00 8.90  ? 210  HIS B CA    1 
ATOM   4819 C  C     . HIS B 1 123 ? 148.235 -22.005 88.359  1.00 9.16  ? 210  HIS B C     1 
ATOM   4820 O  O     . HIS B 1 123 ? 148.541 -20.993 87.713  1.00 9.43  ? 210  HIS B O     1 
ATOM   4821 C  CB    . HIS B 1 123 ? 148.973 -22.014 90.754  1.00 8.29  ? 210  HIS B CB    1 
ATOM   4822 C  CG    . HIS B 1 123 ? 149.183 -23.017 91.854  1.00 8.52  ? 210  HIS B CG    1 
ATOM   4823 N  ND1   . HIS B 1 123 ? 148.411 -24.112 91.988  1.00 8.89  ? 210  HIS B ND1   1 
ATOM   4824 C  CD2   . HIS B 1 123 ? 150.134 -23.085 92.858  1.00 9.04  ? 210  HIS B CD2   1 
ATOM   4825 C  CE1   . HIS B 1 123 ? 148.822 -24.823 93.044  1.00 9.39  ? 210  HIS B CE1   1 
ATOM   4826 N  NE2   . HIS B 1 123 ? 149.888 -24.204 93.566  1.00 8.43  ? 210  HIS B NE2   1 
ATOM   4827 N  N     . GLY B 1 124 ? 147.068 -22.629 88.221  1.00 9.25  ? 211  GLY B N     1 
ATOM   4828 C  CA    . GLY B 1 124 ? 145.992 -22.123 87.371  1.00 9.32  ? 211  GLY B CA    1 
ATOM   4829 C  C     . GLY B 1 124 ? 144.838 -21.615 88.204  1.00 9.75  ? 211  GLY B C     1 
ATOM   4830 O  O     . GLY B 1 124 ? 144.957 -21.559 89.441  1.00 9.07  ? 211  GLY B O     1 
ATOM   4831 N  N     . PRO B 1 125 ? 143.706 -21.266 87.544  1.00 9.69  ? 212  PRO B N     1 
ATOM   4832 C  CA    . PRO B 1 125 ? 142.497 -20.752 88.169  1.00 9.75  ? 212  PRO B CA    1 
ATOM   4833 C  C     . PRO B 1 125 ? 142.089 -21.558 89.412  1.00 9.53  ? 212  PRO B C     1 
ATOM   4834 O  O     . PRO B 1 125 ? 141.954 -22.782 89.353  1.00 9.97  ? 212  PRO B O     1 
ATOM   4835 C  CB    . PRO B 1 125 ? 141.441 -20.887 87.056  1.00 10.05 ? 212  PRO B CB    1 
ATOM   4836 C  CG    . PRO B 1 125 ? 142.238 -20.682 85.814  1.00 10.35 ? 212  PRO B CG    1 
ATOM   4837 C  CD    . PRO B 1 125 ? 143.590 -21.279 86.064  1.00 9.99  ? 212  PRO B CD    1 
ATOM   4838 N  N     . PHE B 1 126 ? 141.928 -20.851 90.528  1.00 8.73  ? 213  PHE B N     1 
ATOM   4839 C  CA    . PHE B 1 126 ? 141.504 -21.451 91.802  1.00 9.69  ? 213  PHE B CA    1 
ATOM   4840 C  C     . PHE B 1 126 ? 142.504 -22.459 92.339  1.00 9.32  ? 213  PHE B C     1 
ATOM   4841 O  O     . PHE B 1 126 ? 142.143 -23.328 93.127  1.00 9.62  ? 213  PHE B O     1 
ATOM   4842 C  CB    . PHE B 1 126 ? 140.069 -22.006 91.671  1.00 10.25 ? 213  PHE B CB    1 
ATOM   4843 C  CG    . PHE B 1 126 ? 139.081 -20.941 91.316  1.00 10.76 ? 213  PHE B CG    1 
ATOM   4844 C  CD1   . PHE B 1 126 ? 138.441 -20.236 92.313  1.00 10.90 ? 213  PHE B CD1   1 
ATOM   4845 C  CD2   . PHE B 1 126 ? 138.874 -20.558 89.992  1.00 11.07 ? 213  PHE B CD2   1 
ATOM   4846 C  CE1   . PHE B 1 126 ? 137.569 -19.199 92.010  1.00 11.81 ? 213  PHE B CE1   1 
ATOM   4847 C  CE2   . PHE B 1 126 ? 138.013 -19.511 89.683  1.00 11.23 ? 213  PHE B CE2   1 
ATOM   4848 C  CZ    . PHE B 1 126 ? 137.359 -18.834 90.689  1.00 11.56 ? 213  PHE B CZ    1 
ATOM   4849 N  N     . SER B 1 127 ? 143.765 -22.333 91.941  1.00 7.55  ? 214  SER B N     1 
ATOM   4850 C  CA    . SER B 1 127 ? 144.845 -23.158 92.490  1.00 7.76  ? 214  SER B CA    1 
ATOM   4851 C  C     . SER B 1 127 ? 144.614 -24.684 92.404  1.00 9.56  ? 214  SER B C     1 
ATOM   4852 O  O     . SER B 1 127 ? 144.551 -25.253 91.318  1.00 9.09  ? 214  SER B O     1 
ATOM   4853 C  CB    . SER B 1 127 ? 145.232 -22.700 93.926  1.00 7.38  ? 214  SER B CB    1 
ATOM   4854 O  OG    . SER B 1 127 ? 145.721 -21.358 93.888  1.00 7.23  ? 214  SER B OG    1 
ATOM   4855 N  N     . HIS B 1 128 ? 144.486 -25.335 93.556  1.00 10.28 ? 215  HIS B N     1 
ATOM   4856 C  CA    A HIS B 1 128 ? 144.388 -26.799 93.647  0.50 11.54 ? 215  HIS B CA    1 
ATOM   4857 C  CA    B HIS B 1 128 ? 144.476 -26.782 93.538  0.50 11.67 ? 215  HIS B CA    1 
ATOM   4858 C  C     . HIS B 1 128 ? 143.314 -27.338 92.773  1.00 12.05 ? 215  HIS B C     1 
ATOM   4859 O  O     . HIS B 1 128 ? 143.416 -28.421 92.245  1.00 13.51 ? 215  HIS B O     1 
ATOM   4860 C  CB    A HIS B 1 128 ? 144.104 -27.267 95.071  0.50 12.04 ? 215  HIS B CB    1 
ATOM   4861 C  CB    B HIS B 1 128 ? 144.677 -27.360 94.930  0.50 12.61 ? 215  HIS B CB    1 
ATOM   4862 C  CG    A HIS B 1 128 ? 143.822 -28.745 95.153  0.50 12.69 ? 215  HIS B CG    1 
ATOM   4863 C  CG    B HIS B 1 128 ? 146.120 -27.335 95.360  0.50 13.22 ? 215  HIS B CG    1 
ATOM   4864 N  ND1   A HIS B 1 128 ? 142.573 -29.250 95.104  0.50 12.96 ? 215  HIS B ND1   1 
ATOM   4865 N  ND1   B HIS B 1 128 ? 146.751 -26.198 95.697  0.50 13.56 ? 215  HIS B ND1   1 
ATOM   4866 C  CD2   A HIS B 1 128 ? 144.684 -29.836 95.191  0.50 13.03 ? 215  HIS B CD2   1 
ATOM   4867 C  CD2   B HIS B 1 128 ? 147.070 -28.348 95.431  0.50 13.81 ? 215  HIS B CD2   1 
ATOM   4868 C  CE1   A HIS B 1 128 ? 142.632 -30.593 95.145  0.50 13.10 ? 215  HIS B CE1   1 
ATOM   4869 C  CE1   B HIS B 1 128 ? 148.030 -26.471 95.996  0.50 13.45 ? 215  HIS B CE1   1 
ATOM   4870 N  NE2   A HIS B 1 128 ? 143.924 -30.950 95.199  0.50 13.10 ? 215  HIS B NE2   1 
ATOM   4871 N  NE2   B HIS B 1 128 ? 148.223 -27.786 95.836  0.50 13.74 ? 215  HIS B NE2   1 
ATOM   4872 N  N     . MET B 1 129 ? 142.230 -26.592 92.654  1.00 11.83 ? 216  MET B N     1 
ATOM   4873 C  CA    . MET B 1 129 ? 141.125 -27.032 91.835  1.00 13.06 ? 216  MET B CA    1 
ATOM   4874 C  C     . MET B 1 129 ? 141.577 -27.316 90.390  1.00 12.04 ? 216  MET B C     1 
ATOM   4875 O  O     . MET B 1 129 ? 141.070 -28.238 89.731  1.00 12.28 ? 216  MET B O     1 
ATOM   4876 C  CB    . MET B 1 129 ? 140.065 -25.943 91.827  1.00 14.33 ? 216  MET B CB    1 
ATOM   4877 C  CG    . MET B 1 129 ? 138.747 -26.398 91.263  1.00 16.46 ? 216  MET B CG    1 
ATOM   4878 S  SD    . MET B 1 129 ? 137.967 -25.041 90.408  1.00 18.59 ? 216  MET B SD    1 
ATOM   4879 C  CE    . MET B 1 129 ? 138.880 -25.023 88.866  1.00 17.26 ? 216  MET B CE    1 
ATOM   4880 N  N     . PHE B 1 130 ? 142.534 -26.532 89.901  1.00 10.72 ? 217  PHE B N     1 
ATOM   4881 C  CA    . PHE B 1 130 ? 142.868 -26.581 88.486  1.00 11.03 ? 217  PHE B CA    1 
ATOM   4882 C  C     . PHE B 1 130 ? 143.648 -27.848 88.123  1.00 11.70 ? 217  PHE B C     1 
ATOM   4883 O  O     . PHE B 1 130 ? 143.263 -28.557 87.188  1.00 13.82 ? 217  PHE B O     1 
ATOM   4884 C  CB    . PHE B 1 130 ? 143.617 -25.317 88.052  1.00 10.73 ? 217  PHE B CB    1 
ATOM   4885 C  CG    . PHE B 1 130 ? 143.688 -25.155 86.562  1.00 11.55 ? 217  PHE B CG    1 
ATOM   4886 C  CD1   . PHE B 1 130 ? 142.557 -24.791 85.827  1.00 11.51 ? 217  PHE B CD1   1 
ATOM   4887 C  CD2   . PHE B 1 130 ? 144.884 -25.394 85.896  1.00 11.67 ? 217  PHE B CD2   1 
ATOM   4888 C  CE1   . PHE B 1 130 ? 142.643 -24.645 84.439  1.00 11.26 ? 217  PHE B CE1   1 
ATOM   4889 C  CE2   . PHE B 1 130 ? 144.967 -25.241 84.508  1.00 12.50 ? 217  PHE B CE2   1 
ATOM   4890 C  CZ    . PHE B 1 130 ? 143.844 -24.888 83.793  1.00 11.24 ? 217  PHE B CZ    1 
ATOM   4891 N  N     . ASP B 1 131 ? 144.733 -28.136 88.838  1.00 12.19 ? 218  ASP B N     1 
ATOM   4892 C  CA    . ASP B 1 131 ? 145.511 -29.336 88.542  1.00 13.12 ? 218  ASP B CA    1 
ATOM   4893 C  C     . ASP B 1 131 ? 145.010 -30.563 89.283  1.00 13.33 ? 218  ASP B C     1 
ATOM   4894 O  O     . ASP B 1 131 ? 145.266 -31.695 88.866  1.00 13.73 ? 218  ASP B O     1 
ATOM   4895 C  CB    . ASP B 1 131 ? 147.020 -29.129 88.733  1.00 14.55 ? 218  ASP B CB    1 
ATOM   4896 C  CG    . ASP B 1 131 ? 147.416 -28.849 90.176  1.00 15.30 ? 218  ASP B CG    1 
ATOM   4897 O  OD1   . ASP B 1 131 ? 146.563 -28.424 90.976  1.00 15.35 ? 218  ASP B OD1   1 
ATOM   4898 O  OD2   . ASP B 1 131 ? 148.594 -29.063 90.506  1.00 16.68 ? 218  ASP B OD2   1 
ATOM   4899 N  N     . GLY B 1 132 ? 144.278 -30.336 90.367  1.00 12.89 ? 219  GLY B N     1 
ATOM   4900 C  CA    . GLY B 1 132 ? 143.756 -31.426 91.171  1.00 12.19 ? 219  GLY B CA    1 
ATOM   4901 C  C     . GLY B 1 132 ? 142.467 -32.011 90.634  1.00 12.75 ? 219  GLY B C     1 
ATOM   4902 O  O     . GLY B 1 132 ? 142.223 -33.216 90.789  1.00 13.61 ? 219  GLY B O     1 
ATOM   4903 N  N     . ARG B 1 133 ? 141.630 -31.172 90.024  1.00 11.85 ? 220  ARG B N     1 
ATOM   4904 C  CA    . ARG B 1 133 ? 140.287 -31.589 89.618  1.00 12.45 ? 220  ARG B CA    1 
ATOM   4905 C  C     . ARG B 1 133 ? 140.032 -31.356 88.144  1.00 13.62 ? 220  ARG B C     1 
ATOM   4906 O  O     . ARG B 1 133 ? 139.641 -32.278 87.441  1.00 15.23 ? 220  ARG B O     1 
ATOM   4907 C  CB    . ARG B 1 133 ? 139.175 -30.901 90.424  1.00 13.28 ? 220  ARG B CB    1 
ATOM   4908 C  CG    . ARG B 1 133 ? 139.157 -31.212 91.920  1.00 13.20 ? 220  ARG B CG    1 
ATOM   4909 C  CD    . ARG B 1 133 ? 137.993 -30.502 92.627  1.00 13.74 ? 220  ARG B CD    1 
ATOM   4910 N  NE    . ARG B 1 133 ? 138.065 -30.692 94.080  1.00 13.44 ? 220  ARG B NE    1 
ATOM   4911 C  CZ    . ARG B 1 133 ? 137.505 -31.720 94.724  1.00 14.81 ? 220  ARG B CZ    1 
ATOM   4912 N  NH1   . ARG B 1 133 ? 136.807 -32.628 94.041  1.00 14.88 ? 220  ARG B NH1   1 
ATOM   4913 N  NH2   . ARG B 1 133 ? 137.621 -31.834 96.049  1.00 14.53 ? 220  ARG B NH2   1 
ATOM   4914 N  N     . PHE B 1 134 ? 140.248 -30.127 87.674  1.00 12.05 ? 221  PHE B N     1 
ATOM   4915 C  CA    . PHE B 1 134 ? 139.855 -29.778 86.302  1.00 12.38 ? 221  PHE B CA    1 
ATOM   4916 C  C     . PHE B 1 134 ? 140.688 -30.465 85.200  1.00 12.98 ? 221  PHE B C     1 
ATOM   4917 O  O     . PHE B 1 134 ? 140.133 -31.120 84.313  1.00 12.66 ? 221  PHE B O     1 
ATOM   4918 C  CB    . PHE B 1 134 ? 139.856 -28.257 86.087  1.00 11.81 ? 221  PHE B CB    1 
ATOM   4919 C  CG    . PHE B 1 134 ? 139.533 -27.851 84.669  1.00 12.77 ? 221  PHE B CG    1 
ATOM   4920 C  CD1   . PHE B 1 134 ? 138.236 -27.993 84.171  1.00 12.26 ? 221  PHE B CD1   1 
ATOM   4921 C  CD2   . PHE B 1 134 ? 140.526 -27.341 83.835  1.00 12.97 ? 221  PHE B CD2   1 
ATOM   4922 C  CE1   . PHE B 1 134 ? 137.934 -27.638 82.859  1.00 12.98 ? 221  PHE B CE1   1 
ATOM   4923 C  CE2   . PHE B 1 134 ? 140.230 -26.975 82.520  1.00 13.65 ? 221  PHE B CE2   1 
ATOM   4924 C  CZ    . PHE B 1 134 ? 138.933 -27.127 82.038  1.00 12.57 ? 221  PHE B CZ    1 
ATOM   4925 N  N     . ILE B 1 135 ? 142.001 -30.281 85.224  1.00 12.69 ? 222  ILE B N     1 
ATOM   4926 C  CA    . ILE B 1 135 ? 142.842 -30.837 84.138  1.00 14.37 ? 222  ILE B CA    1 
ATOM   4927 C  C     . ILE B 1 135 ? 142.711 -32.372 84.040  1.00 15.49 ? 222  ILE B C     1 
ATOM   4928 O  O     . ILE B 1 135 ? 142.584 -32.891 82.934  1.00 16.77 ? 222  ILE B O     1 
ATOM   4929 C  CB    . ILE B 1 135 ? 144.317 -30.370 84.176  1.00 14.03 ? 222  ILE B CB    1 
ATOM   4930 C  CG1   . ILE B 1 135 ? 144.430 -28.861 83.882  1.00 14.59 ? 222  ILE B CG1   1 
ATOM   4931 C  CG2   . ILE B 1 135 ? 145.168 -31.145 83.169  1.00 13.59 ? 222  ILE B CG2   1 
ATOM   4932 C  CD1   . ILE B 1 135 ? 143.992 -28.424 82.486  1.00 14.07 ? 222  ILE B CD1   1 
ATOM   4933 N  N     . PRO B 1 136 ? 142.706 -33.097 85.183  1.00 16.03 ? 223  PRO B N     1 
ATOM   4934 C  CA    . PRO B 1 136 ? 142.488 -34.563 85.107  1.00 17.19 ? 223  PRO B CA    1 
ATOM   4935 C  C     . PRO B 1 136 ? 141.164 -34.991 84.459  1.00 18.40 ? 223  PRO B C     1 
ATOM   4936 O  O     . PRO B 1 136 ? 141.093 -36.065 83.850  1.00 19.87 ? 223  PRO B O     1 
ATOM   4937 C  CB    . PRO B 1 136 ? 142.525 -34.989 86.578  1.00 16.89 ? 223  PRO B CB    1 
ATOM   4938 C  CG    . PRO B 1 136 ? 143.454 -33.994 87.205  1.00 17.13 ? 223  PRO B CG    1 
ATOM   4939 C  CD    . PRO B 1 136 ? 143.050 -32.693 86.560  1.00 15.44 ? 223  PRO B CD    1 
ATOM   4940 N  N     . LEU B 1 137 ? 140.126 -34.175 84.590  1.00 17.56 ? 224  LEU B N     1 
ATOM   4941 C  CA    . LEU B 1 137 ? 138.829 -34.482 83.973  1.00 18.40 ? 224  LEU B CA    1 
ATOM   4942 C  C     . LEU B 1 137 ? 138.746 -34.028 82.516  1.00 19.28 ? 224  LEU B C     1 
ATOM   4943 O  O     . LEU B 1 137 ? 138.177 -34.728 81.679  1.00 19.05 ? 224  LEU B O     1 
ATOM   4944 C  CB    . LEU B 1 137 ? 137.681 -33.864 84.768  1.00 17.87 ? 224  LEU B CB    1 
ATOM   4945 C  CG    . LEU B 1 137 ? 137.327 -34.520 86.108  1.00 17.55 ? 224  LEU B CG    1 
ATOM   4946 C  CD1   . LEU B 1 137 ? 136.275 -33.710 86.842  1.00 17.15 ? 224  LEU B CD1   1 
ATOM   4947 C  CD2   . LEU B 1 137 ? 136.858 -35.956 85.905  1.00 18.26 ? 224  LEU B CD2   1 
ATOM   4948 N  N     . ALA B 1 138 ? 139.306 -32.856 82.221  1.00 17.85 ? 225  ALA B N     1 
ATOM   4949 C  CA    . ALA B 1 138 ? 139.266 -32.292 80.871  1.00 19.31 ? 225  ALA B CA    1 
ATOM   4950 C  C     . ALA B 1 138 ? 140.171 -33.021 79.890  1.00 20.71 ? 225  ALA B C     1 
ATOM   4951 O  O     . ALA B 1 138 ? 139.813 -33.171 78.719  1.00 23.70 ? 225  ALA B O     1 
ATOM   4952 C  CB    . ALA B 1 138 ? 139.636 -30.810 80.895  1.00 19.21 ? 225  ALA B CB    1 
ATOM   4953 N  N     . ARG B 1 139 ? 141.357 -33.418 80.358  1.00 19.51 ? 226  ARG B N     1 
ATOM   4954 C  CA    . ARG B 1 139 ? 142.391 -34.023 79.513  1.00 21.96 ? 226  ARG B CA    1 
ATOM   4955 C  C     . ARG B 1 139 ? 143.081 -35.172 80.261  1.00 22.11 ? 226  ARG B C     1 
ATOM   4956 O  O     . ARG B 1 139 ? 144.217 -35.029 80.731  1.00 22.51 ? 226  ARG B O     1 
ATOM   4957 C  CB    . ARG B 1 139 ? 143.414 -32.967 79.054  1.00 21.74 ? 226  ARG B CB    1 
ATOM   4958 C  CG    . ARG B 1 139 ? 142.817 -31.829 78.225  1.00 22.17 ? 226  ARG B CG    1 
ATOM   4959 C  CD    . ARG B 1 139 ? 143.868 -30.786 77.860  1.00 23.08 ? 226  ARG B CD    1 
ATOM   4960 N  NE    . ARG B 1 139 ? 144.882 -31.294 76.930  1.00 22.77 ? 226  ARG B NE    1 
ATOM   4961 C  CZ    . ARG B 1 139 ? 146.036 -30.687 76.660  1.00 23.43 ? 226  ARG B CZ    1 
ATOM   4962 N  NH1   . ARG B 1 139 ? 146.360 -29.543 77.258  1.00 19.40 ? 226  ARG B NH1   1 
ATOM   4963 N  NH2   . ARG B 1 139 ? 146.883 -31.232 75.798  1.00 23.68 ? 226  ARG B NH2   1 
ATOM   4964 N  N     . PRO B 1 140 ? 142.399 -36.332 80.361  1.00 24.87 ? 227  PRO B N     1 
ATOM   4965 C  CA    . PRO B 1 140 ? 142.818 -37.437 81.240  1.00 25.66 ? 227  PRO B CA    1 
ATOM   4966 C  C     . PRO B 1 140 ? 144.175 -38.044 80.930  1.00 26.37 ? 227  PRO B C     1 
ATOM   4967 O  O     . PRO B 1 140 ? 144.768 -38.695 81.794  1.00 28.08 ? 227  PRO B O     1 
ATOM   4968 C  CB    . PRO B 1 140 ? 141.720 -38.492 81.035  1.00 26.15 ? 227  PRO B CB    1 
ATOM   4969 C  CG    . PRO B 1 140 ? 140.542 -37.735 80.532  1.00 25.92 ? 227  PRO B CG    1 
ATOM   4970 C  CD    . PRO B 1 140 ? 141.095 -36.601 79.720  1.00 24.86 ? 227  PRO B CD    1 
ATOM   4971 N  N     . GLU B 1 141 ? 144.662 -37.848 79.711  1.00 25.12 ? 228  GLU B N     1 
ATOM   4972 C  CA    . GLU B 1 141 ? 145.920 -38.459 79.307  1.00 28.43 ? 228  GLU B CA    1 
ATOM   4973 C  C     . GLU B 1 141 ? 147.153 -37.584 79.471  1.00 29.13 ? 228  GLU B C     1 
ATOM   4974 O  O     . GLU B 1 141 ? 148.273 -38.096 79.419  1.00 29.92 ? 228  GLU B O     1 
ATOM   4975 C  CB    . GLU B 1 141 ? 145.819 -38.990 77.879  1.00 30.18 ? 228  GLU B CB    1 
ATOM   4976 C  CG    . GLU B 1 141 ? 144.795 -40.106 77.776  1.00 31.35 ? 228  GLU B CG    1 
ATOM   4977 C  CD    . GLU B 1 141 ? 144.633 -40.643 76.374  1.00 32.33 ? 228  GLU B CD    1 
ATOM   4978 O  OE1   . GLU B 1 141 ? 145.483 -40.357 75.506  1.00 32.79 ? 228  GLU B OE1   1 
ATOM   4979 O  OE2   . GLU B 1 141 ? 143.643 -41.367 76.159  1.00 36.22 ? 228  GLU B OE2   1 
ATOM   4980 N  N     . VAL B 1 142 ? 146.965 -36.278 79.673  1.00 27.75 ? 229  VAL B N     1 
ATOM   4981 C  CA    . VAL B 1 142 ? 148.113 -35.405 79.932  1.00 27.64 ? 229  VAL B CA    1 
ATOM   4982 C  C     . VAL B 1 142 ? 148.586 -35.634 81.361  1.00 28.97 ? 229  VAL B C     1 
ATOM   4983 O  O     . VAL B 1 142 ? 147.799 -35.999 82.231  1.00 32.06 ? 229  VAL B O     1 
ATOM   4984 C  CB    . VAL B 1 142 ? 147.817 -33.903 79.676  1.00 27.99 ? 229  VAL B CB    1 
ATOM   4985 C  CG1   . VAL B 1 142 ? 147.140 -33.709 78.326  1.00 27.13 ? 229  VAL B CG1   1 
ATOM   4986 C  CG2   . VAL B 1 142 ? 146.964 -33.301 80.788  1.00 28.19 ? 229  VAL B CG2   1 
ATOM   4987 N  N     . LYS B 1 143 ? 149.877 -35.467 81.593  1.00 31.76 ? 230  LYS B N     1 
ATOM   4988 C  CA    . LYS B 1 143 ? 150.400 -35.530 82.948  1.00 32.27 ? 230  LYS B CA    1 
ATOM   4989 C  C     . LYS B 1 143 ? 150.825 -34.120 83.324  1.00 29.80 ? 230  LYS B C     1 
ATOM   4990 O  O     . LYS B 1 143 ? 151.888 -33.646 82.920  1.00 32.41 ? 230  LYS B O     1 
ATOM   4991 C  CB    . LYS B 1 143 ? 151.553 -36.531 83.046  1.00 35.04 ? 230  LYS B CB    1 
ATOM   4992 C  CG    . LYS B 1 143 ? 151.107 -37.980 82.903  1.00 40.38 ? 230  LYS B CG    1 
ATOM   4993 C  CD    . LYS B 1 143 ? 152.293 -38.906 82.672  1.00 47.98 ? 230  LYS B CD    1 
ATOM   4994 C  CE    . LYS B 1 143 ? 151.824 -40.317 82.364  1.00 60.28 ? 230  LYS B CE    1 
ATOM   4995 N  NZ    . LYS B 1 143 ? 152.974 -41.241 82.162  1.00 63.83 ? 230  LYS B NZ    1 
ATOM   4996 N  N     . TRP B 1 144 ? 149.955 -33.438 84.061  1.00 25.23 ? 231  TRP B N     1 
ATOM   4997 C  CA    . TRP B 1 144 ? 150.152 -32.033 84.377  1.00 21.43 ? 231  TRP B CA    1 
ATOM   4998 C  C     . TRP B 1 144 ? 150.162 -31.861 85.866  1.00 19.80 ? 231  TRP B C     1 
ATOM   4999 O  O     . TRP B 1 144 ? 149.317 -32.425 86.568  1.00 17.75 ? 231  TRP B O     1 
ATOM   5000 C  CB    . TRP B 1 144 ? 149.038 -31.183 83.764  1.00 19.15 ? 231  TRP B CB    1 
ATOM   5001 C  CG    . TRP B 1 144 ? 149.031 -29.743 84.240  1.00 19.43 ? 231  TRP B CG    1 
ATOM   5002 C  CD1   . TRP B 1 144 ? 148.222 -29.165 85.230  1.00 18.69 ? 231  TRP B CD1   1 
ATOM   5003 C  CD2   . TRP B 1 144 ? 149.887 -28.666 83.764  1.00 19.66 ? 231  TRP B CD2   1 
ATOM   5004 N  NE1   . TRP B 1 144 ? 148.510 -27.828 85.375  1.00 19.23 ? 231  TRP B NE1   1 
ATOM   5005 C  CE2   . TRP B 1 144 ? 149.510 -27.467 84.526  1.00 17.92 ? 231  TRP B CE2   1 
ATOM   5006 C  CE3   . TRP B 1 144 ? 150.887 -28.569 82.802  1.00 20.07 ? 231  TRP B CE3   1 
ATOM   5007 C  CZ2   . TRP B 1 144 ? 150.121 -26.247 84.316  1.00 18.12 ? 231  TRP B CZ2   1 
ATOM   5008 C  CZ3   . TRP B 1 144 ? 151.496 -27.328 82.598  1.00 20.76 ? 231  TRP B CZ3   1 
ATOM   5009 C  CH2   . TRP B 1 144 ? 151.112 -26.191 83.329  1.00 20.18 ? 231  TRP B CH2   1 
ATOM   5010 N  N     . THR B 1 145 ? 151.134 -31.097 86.359  1.00 17.91 ? 232  THR B N     1 
ATOM   5011 C  CA    . THR B 1 145 ? 151.125 -30.657 87.754  1.00 16.99 ? 232  THR B CA    1 
ATOM   5012 C  C     . THR B 1 145 ? 151.430 -29.173 87.765  1.00 15.55 ? 232  THR B C     1 
ATOM   5013 O  O     . THR B 1 145 ? 151.997 -28.637 86.808  1.00 13.88 ? 232  THR B O     1 
ATOM   5014 C  CB    . THR B 1 145 ? 152.162 -31.389 88.624  1.00 17.85 ? 232  THR B CB    1 
ATOM   5015 O  OG1   . THR B 1 145 ? 153.479 -31.073 88.161  1.00 17.34 ? 232  THR B OG1   1 
ATOM   5016 C  CG2   . THR B 1 145 ? 151.957 -32.904 88.583  1.00 19.17 ? 232  THR B CG2   1 
ATOM   5017 N  N     . HIS B 1 146 ? 151.067 -28.484 88.839  1.00 13.55 ? 233  HIS B N     1 
ATOM   5018 C  CA    . HIS B 1 146 ? 151.383 -27.068 88.849  1.00 13.19 ? 233  HIS B CA    1 
ATOM   5019 C  C     . HIS B 1 146 ? 152.877 -26.865 88.884  1.00 12.12 ? 233  HIS B C     1 
ATOM   5020 O  O     . HIS B 1 146 ? 153.366 -25.871 88.346  1.00 11.84 ? 233  HIS B O     1 
ATOM   5021 C  CB    . HIS B 1 146 ? 150.652 -26.311 89.971  1.00 13.47 ? 233  HIS B CB    1 
ATOM   5022 C  CG    . HIS B 1 146 ? 151.089 -26.699 91.357  1.00 13.77 ? 233  HIS B CG    1 
ATOM   5023 N  ND1   . HIS B 1 146 ? 150.474 -27.666 92.072  1.00 13.90 ? 233  HIS B ND1   1 
ATOM   5024 C  CD2   . HIS B 1 146 ? 152.109 -26.202 92.161  1.00 13.65 ? 233  HIS B CD2   1 
ATOM   5025 C  CE1   . HIS B 1 146 ? 151.091 -27.794 93.260  1.00 14.30 ? 233  HIS B CE1   1 
ATOM   5026 N  NE2   . HIS B 1 146 ? 152.085 -26.899 93.312  1.00 13.78 ? 233  HIS B NE2   1 
ATOM   5027 N  N     . GLU B 1 147 ? 153.618 -27.811 89.485  1.00 12.41 ? 234  GLU B N     1 
ATOM   5028 C  CA    . GLU B 1 147 ? 155.079 -27.704 89.579  1.00 14.44 ? 234  GLU B CA    1 
ATOM   5029 C  C     . GLU B 1 147 ? 155.725 -27.721 88.201  1.00 14.78 ? 234  GLU B C     1 
ATOM   5030 O  O     . GLU B 1 147 ? 156.650 -26.945 87.938  1.00 13.00 ? 234  GLU B O     1 
ATOM   5031 C  CB    . GLU B 1 147 ? 155.701 -28.810 90.437  1.00 16.65 ? 234  GLU B CB    1 
ATOM   5032 C  CG    . GLU B 1 147 ? 155.381 -28.735 91.918  1.00 18.21 ? 234  GLU B CG    1 
ATOM   5033 C  CD    . GLU B 1 147 ? 154.180 -29.581 92.309  1.00 18.72 ? 234  GLU B CD    1 
ATOM   5034 O  OE1   . GLU B 1 147 ? 153.266 -29.802 91.478  1.00 16.16 ? 234  GLU B OE1   1 
ATOM   5035 O  OE2   . GLU B 1 147 ? 154.148 -30.020 93.476  1.00 20.46 ? 234  GLU B OE2   1 
ATOM   5036 N  N     . GLN B 1 148 ? 155.234 -28.605 87.335  1.00 15.29 ? 235  GLN B N     1 
ATOM   5037 C  CA    . GLN B 1 148 ? 155.661 -28.626 85.928  1.00 16.43 ? 235  GLN B CA    1 
ATOM   5038 C  C     . GLN B 1 148 ? 155.367 -27.296 85.251  1.00 15.94 ? 235  GLN B C     1 
ATOM   5039 O  O     . GLN B 1 148 ? 156.200 -26.777 84.494  1.00 16.99 ? 235  GLN B O     1 
ATOM   5040 C  CB    . GLN B 1 148 ? 154.930 -29.730 85.156  1.00 19.43 ? 235  GLN B CB    1 
ATOM   5041 C  CG    . GLN B 1 148 ? 155.395 -31.146 85.446  1.00 24.32 ? 235  GLN B CG    1 
ATOM   5042 C  CD    . GLN B 1 148 ? 154.396 -32.168 84.928  1.00 27.23 ? 235  GLN B CD    1 
ATOM   5043 O  OE1   . GLN B 1 148 ? 153.943 -33.039 85.671  1.00 30.68 ? 235  GLN B OE1   1 
ATOM   5044 N  NE2   . GLN B 1 148 ? 154.022 -32.041 83.654  1.00 29.64 ? 235  GLN B NE2   1 
ATOM   5045 N  N     . GLY B 1 149 ? 154.171 -26.766 85.512  1.00 13.78 ? 236  GLY B N     1 
ATOM   5046 C  CA    . GLY B 1 149 ? 153.771 -25.439 85.050  1.00 13.31 ? 236  GLY B CA    1 
ATOM   5047 C  C     . GLY B 1 149 ? 154.696 -24.331 85.534  1.00 12.63 ? 236  GLY B C     1 
ATOM   5048 O  O     . GLY B 1 149 ? 154.976 -23.390 84.787  1.00 12.88 ? 236  GLY B O     1 
ATOM   5049 N  N     . SER B 1 150 ? 155.182 -24.436 86.780  1.00 12.20 ? 237  SER B N     1 
ATOM   5050 C  CA    . SER B 1 150 ? 156.111 -23.437 87.302  1.00 12.19 ? 237  SER B CA    1 
ATOM   5051 C  C     . SER B 1 150 ? 157.430 -23.414 86.524  1.00 13.57 ? 237  SER B C     1 
ATOM   5052 O  O     . SER B 1 150 ? 157.946 -22.340 86.203  1.00 11.91 ? 237  SER B O     1 
ATOM   5053 C  CB    . SER B 1 150 ? 156.360 -23.652 88.787  1.00 12.84 ? 237  SER B CB    1 
ATOM   5054 O  OG    . SER B 1 150 ? 155.120 -23.600 89.491  1.00 11.66 ? 237  SER B OG    1 
ATOM   5055 N  N     . VAL B 1 151 ? 157.954 -24.595 86.219  1.00 14.47 ? 238  VAL B N     1 
ATOM   5056 C  CA    . VAL B 1 151 ? 159.182 -24.697 85.414  1.00 14.87 ? 238  VAL B CA    1 
ATOM   5057 C  C     . VAL B 1 151 ? 158.999 -24.057 84.031  1.00 15.23 ? 238  VAL B C     1 
ATOM   5058 O  O     . VAL B 1 151 ? 159.832 -23.259 83.597  1.00 14.89 ? 238  VAL B O     1 
ATOM   5059 C  CB    . VAL B 1 151 ? 159.677 -26.160 85.292  1.00 15.91 ? 238  VAL B CB    1 
ATOM   5060 C  CG1   . VAL B 1 151 ? 160.724 -26.288 84.189  1.00 16.16 ? 238  VAL B CG1   1 
ATOM   5061 C  CG2   . VAL B 1 151 ? 160.250 -26.635 86.617  1.00 16.13 ? 238  VAL B CG2   1 
ATOM   5062 N  N     . MET B 1 152 ? 157.903 -24.389 83.362  1.00 15.66 ? 239  MET B N     1 
ATOM   5063 C  CA    . MET B 1 152 ? 157.608 -23.840 82.038  1.00 16.97 ? 239  MET B CA    1 
ATOM   5064 C  C     . MET B 1 152 ? 157.367 -22.340 82.071  1.00 16.78 ? 239  MET B C     1 
ATOM   5065 O  O     . MET B 1 152 ? 157.872 -21.602 81.210  1.00 16.38 ? 239  MET B O     1 
ATOM   5066 C  CB    . MET B 1 152 ? 156.406 -24.540 81.414  1.00 18.44 ? 239  MET B CB    1 
ATOM   5067 C  CG    . MET B 1 152 ? 156.653 -25.995 81.063  1.00 23.03 ? 239  MET B CG    1 
ATOM   5068 S  SD    . MET B 1 152 ? 155.108 -26.814 80.633  1.00 29.80 ? 239  MET B SD    1 
ATOM   5069 C  CE    . MET B 1 152 ? 154.567 -25.857 79.225  1.00 27.62 ? 239  MET B CE    1 
ATOM   5070 N  N     . MET B 1 153 ? 156.618 -21.880 83.072  1.00 15.14 ? 240  MET B N     1 
ATOM   5071 C  CA    . MET B 1 153 ? 156.355 -20.452 83.202  1.00 13.78 ? 240  MET B CA    1 
ATOM   5072 C  C     . MET B 1 153 ? 157.619 -19.669 83.570  1.00 12.39 ? 240  MET B C     1 
ATOM   5073 O  O     . MET B 1 153 ? 157.796 -18.538 83.133  1.00 12.63 ? 240  MET B O     1 
ATOM   5074 C  CB    . MET B 1 153 ? 155.224 -20.184 84.223  1.00 13.55 ? 240  MET B CB    1 
ATOM   5075 C  CG    . MET B 1 153 ? 154.795 -18.714 84.274  1.00 15.11 ? 240  MET B CG    1 
ATOM   5076 S  SD    . MET B 1 153 ? 154.123 -18.054 82.721  1.00 16.46 ? 240  MET B SD    1 
ATOM   5077 C  CE    . MET B 1 153 ? 152.499 -18.813 82.705  1.00 14.53 ? 240  MET B CE    1 
ATOM   5078 N  N     . PHE B 1 154 ? 158.491 -20.269 84.382  1.00 11.51 ? 241  PHE B N     1 
ATOM   5079 C  CA    . PHE B 1 154 ? 159.733 -19.619 84.771  1.00 13.12 ? 241  PHE B CA    1 
ATOM   5080 C  C     . PHE B 1 154 ? 160.640 -19.448 83.545  1.00 15.04 ? 241  PHE B C     1 
ATOM   5081 O  O     . PHE B 1 154 ? 161.208 -18.378 83.330  1.00 15.81 ? 241  PHE B O     1 
ATOM   5082 C  CB    . PHE B 1 154 ? 160.449 -20.441 85.832  1.00 12.77 ? 241  PHE B CB    1 
ATOM   5083 C  CG    . PHE B 1 154 ? 161.785 -19.880 86.260  1.00 13.38 ? 241  PHE B CG    1 
ATOM   5084 C  CD1   . PHE B 1 154 ? 161.885 -18.620 86.846  1.00 13.87 ? 241  PHE B CD1   1 
ATOM   5085 C  CD2   . PHE B 1 154 ? 162.946 -20.640 86.102  1.00 14.10 ? 241  PHE B CD2   1 
ATOM   5086 C  CE1   . PHE B 1 154 ? 163.118 -18.121 87.272  1.00 13.73 ? 241  PHE B CE1   1 
ATOM   5087 C  CE2   . PHE B 1 154 ? 164.184 -20.152 86.522  1.00 13.98 ? 241  PHE B CE2   1 
ATOM   5088 C  CZ    . PHE B 1 154 ? 164.274 -18.880 87.101  1.00 14.59 ? 241  PHE B CZ    1 
ATOM   5089 N  N     . GLU B 1 155 ? 160.773 -20.523 82.765  1.00 16.07 ? 242  GLU B N     1 
ATOM   5090 C  CA    . GLU B 1 155 ? 161.543 -20.465 81.505  1.00 17.92 ? 242  GLU B CA    1 
ATOM   5091 C  C     . GLU B 1 155 ? 160.989 -19.364 80.594  1.00 17.37 ? 242  GLU B C     1 
ATOM   5092 O  O     . GLU B 1 155 ? 161.748 -18.563 80.037  1.00 18.47 ? 242  GLU B O     1 
ATOM   5093 C  CB    . GLU B 1 155 ? 161.530 -21.828 80.813  1.00 18.81 ? 242  GLU B CB    1 
ATOM   5094 C  CG    . GLU B 1 155 ? 162.152 -21.857 79.411  1.00 21.80 ? 242  GLU B CG    1 
ATOM   5095 C  CD    . GLU B 1 155 ? 163.665 -21.752 79.401  1.00 23.79 ? 242  GLU B CD    1 
ATOM   5096 O  OE1   . GLU B 1 155 ? 164.239 -21.623 78.295  1.00 25.31 ? 242  GLU B OE1   1 
ATOM   5097 O  OE2   . GLU B 1 155 ? 164.298 -21.799 80.472  1.00 24.49 ? 242  GLU B OE2   1 
ATOM   5098 N  N     . HIS B 1 156 ? 159.667 -19.317 80.462  1.00 16.76 ? 243  HIS B N     1 
ATOM   5099 C  CA    . HIS B 1 156 ? 159.007 -18.267 79.698  1.00 16.92 ? 243  HIS B CA    1 
ATOM   5100 C  C     . HIS B 1 156 ? 159.221 -16.876 80.249  1.00 16.45 ? 243  HIS B C     1 
ATOM   5101 O  O     . HIS B 1 156 ? 159.437 -15.919 79.495  1.00 17.10 ? 243  HIS B O     1 
ATOM   5102 C  CB    . HIS B 1 156 ? 157.534 -18.575 79.558  1.00 16.73 ? 243  HIS B CB    1 
ATOM   5103 C  CG    . HIS B 1 156 ? 156.795 -17.584 78.701  1.00 19.14 ? 243  HIS B CG    1 
ATOM   5104 N  ND1   . HIS B 1 156 ? 155.742 -16.873 79.148  1.00 19.69 ? 243  HIS B ND1   1 
ATOM   5105 C  CD2   . HIS B 1 156 ? 156.997 -17.200 77.378  1.00 19.15 ? 243  HIS B CD2   1 
ATOM   5106 C  CE1   . HIS B 1 156 ? 155.287 -16.075 78.157  1.00 19.37 ? 243  HIS B CE1   1 
ATOM   5107 N  NE2   . HIS B 1 156 ? 156.055 -16.274 77.078  1.00 21.03 ? 243  HIS B NE2   1 
ATOM   5108 N  N     . LEU B 1 157 ? 159.165 -16.738 81.574  1.00 13.52 ? 244  LEU B N     1 
ATOM   5109 C  CA    . LEU B 1 157 ? 159.408 -15.452 82.210  1.00 14.82 ? 244  LEU B CA    1 
ATOM   5110 C  C     . LEU B 1 157 ? 160.837 -14.962 81.902  1.00 15.99 ? 244  LEU B C     1 
ATOM   5111 O  O     . LEU B 1 157 ? 161.055 -13.788 81.534  1.00 16.44 ? 244  LEU B O     1 
ATOM   5112 C  CB    . LEU B 1 157 ? 159.170 -15.584 83.732  1.00 13.22 ? 244  LEU B CB    1 
ATOM   5113 C  CG    . LEU B 1 157 ? 159.231 -14.350 84.639  1.00 12.42 ? 244  LEU B CG    1 
ATOM   5114 C  CD1   . LEU B 1 157 ? 158.617 -14.701 86.007  1.00 11.30 ? 244  LEU B CD1   1 
ATOM   5115 C  CD2   . LEU B 1 157 ? 160.651 -13.825 84.832  1.00 13.34 ? 244  LEU B CD2   1 
ATOM   5116 N  N     . ILE B 1 158 ? 161.806 -15.864 82.041  1.00 17.15 ? 245  ILE B N     1 
ATOM   5117 C  CA    . ILE B 1 158 ? 163.210 -15.522 81.846  1.00 19.22 ? 245  ILE B CA    1 
ATOM   5118 C  C     . ILE B 1 158 ? 163.424 -15.037 80.409  1.00 20.43 ? 245  ILE B C     1 
ATOM   5119 O  O     . ILE B 1 158 ? 164.042 -13.989 80.186  1.00 21.57 ? 245  ILE B O     1 
ATOM   5120 C  CB    . ILE B 1 158 ? 164.146 -16.724 82.119  1.00 20.35 ? 245  ILE B CB    1 
ATOM   5121 C  CG1   . ILE B 1 158 ? 164.094 -17.154 83.596  1.00 21.84 ? 245  ILE B CG1   1 
ATOM   5122 C  CG2   . ILE B 1 158 ? 165.580 -16.418 81.672  1.00 21.84 ? 245  ILE B CG2   1 
ATOM   5123 C  CD1   . ILE B 1 158 ? 164.528 -16.102 84.605  1.00 23.35 ? 245  ILE B CD1   1 
ATOM   5124 N  N     . ASN B 1 159 ? 162.887 -15.791 79.459  1.00 23.49 ? 246  ASN B N     1 
ATOM   5125 C  CA    . ASN B 1 159 ? 163.130 -15.544 78.038  1.00 25.73 ? 246  ASN B CA    1 
ATOM   5126 C  C     . ASN B 1 159 ? 162.403 -14.332 77.478  1.00 26.13 ? 246  ASN B C     1 
ATOM   5127 O  O     . ASN B 1 159 ? 162.930 -13.645 76.596  1.00 28.93 ? 246  ASN B O     1 
ATOM   5128 C  CB    . ASN B 1 159 ? 162.828 -16.804 77.218  1.00 26.46 ? 246  ASN B CB    1 
ATOM   5129 C  CG    . ASN B 1 159 ? 163.840 -17.903 77.465  1.00 28.79 ? 246  ASN B CG    1 
ATOM   5130 O  OD1   . ASN B 1 159 ? 165.019 -17.634 77.717  1.00 30.64 ? 246  ASN B OD1   1 
ATOM   5131 N  ND2   . ASN B 1 159 ? 163.390 -19.149 77.399  1.00 30.32 ? 246  ASN B ND2   1 
ATOM   5132 N  N     . SER B 1 160 ? 161.211 -14.059 77.997  1.00 23.56 ? 247  SER B N     1 
ATOM   5133 C  CA    . SER B 1 160 ? 160.401 -12.931 77.531  1.00 24.33 ? 247  SER B CA    1 
ATOM   5134 C  C     . SER B 1 160 ? 160.790 -11.600 78.152  1.00 24.13 ? 247  SER B C     1 
ATOM   5135 O  O     . SER B 1 160 ? 160.301 -10.558 77.721  1.00 26.31 ? 247  SER B O     1 
ATOM   5136 C  CB    . SER B 1 160 ? 158.918 -13.169 77.796  1.00 23.92 ? 247  SER B CB    1 
ATOM   5137 O  OG    . SER B 1 160 ? 158.524 -14.451 77.357  1.00 28.89 ? 247  SER B OG    1 
ATOM   5138 N  N     . ASN B 1 161 ? 161.648 -11.622 79.169  1.00 21.60 ? 248  ASN B N     1 
ATOM   5139 C  CA    . ASN B 1 161 ? 161.952 -10.388 79.880  1.00 21.38 ? 248  ASN B CA    1 
ATOM   5140 C  C     . ASN B 1 161 ? 163.438 -10.067 79.968  1.00 21.14 ? 248  ASN B C     1 
ATOM   5141 O  O     . ASN B 1 161 ? 163.837 -9.145  80.685  1.00 22.66 ? 248  ASN B O     1 
ATOM   5142 C  CB    . ASN B 1 161 ? 161.276 -10.391 81.264  1.00 19.26 ? 248  ASN B CB    1 
ATOM   5143 C  CG    . ASN B 1 161 ? 159.767 -10.421 81.169  1.00 18.17 ? 248  ASN B CG    1 
ATOM   5144 O  OD1   . ASN B 1 161 ? 159.115 -9.391  80.978  1.00 18.66 ? 248  ASN B OD1   1 
ATOM   5145 N  ND2   . ASN B 1 161 ? 159.193 -11.606 81.320  1.00 18.59 ? 248  ASN B ND2   1 
ATOM   5146 N  N     . GLY B 1 162 ? 164.252 -10.837 79.240  1.00 21.27 ? 249  GLY B N     1 
ATOM   5147 C  CA    . GLY B 1 162 ? 165.695 -10.645 79.228  1.00 22.00 ? 249  GLY B CA    1 
ATOM   5148 C  C     . GLY B 1 162 ? 166.375 -10.709 80.581  1.00 22.10 ? 249  GLY B C     1 
ATOM   5149 O  O     . GLY B 1 162 ? 167.219 -9.881  80.888  1.00 21.65 ? 249  GLY B O     1 
ATOM   5150 N  N     . ILE B 1 163 ? 166.026 -11.708 81.391  1.00 20.45 ? 250  ILE B N     1 
ATOM   5151 C  CA    . ILE B 1 163 ? 166.570 -11.819 82.748  1.00 20.50 ? 250  ILE B CA    1 
ATOM   5152 C  C     . ILE B 1 163 ? 168.021 -12.315 82.803  1.00 18.11 ? 250  ILE B C     1 
ATOM   5153 O  O     . ILE B 1 163 ? 168.744 -12.021 83.757  1.00 19.93 ? 250  ILE B O     1 
ATOM   5154 C  CB    . ILE B 1 163 ? 165.651 -12.704 83.639  1.00 19.81 ? 250  ILE B CB    1 
ATOM   5155 C  CG1   . ILE B 1 163 ? 164.191 -12.237 83.541  1.00 19.67 ? 250  ILE B CG1   1 
ATOM   5156 C  CG2   . ILE B 1 163 ? 166.156 -12.770 85.079  1.00 21.40 ? 250  ILE B CG2   1 
ATOM   5157 C  CD1   . ILE B 1 163 ? 163.919 -10.852 84.100  1.00 19.39 ? 250  ILE B CD1   1 
ATOM   5158 N  N     . LYS B 1 164 ? 168.469 -13.074 81.798  1.00 20.41 ? 251  LYS B N     1 
ATOM   5159 C  CA    . LYS B 1 164 ? 169.810 -13.691 81.897  1.00 20.82 ? 251  LYS B CA    1 
ATOM   5160 C  C     . LYS B 1 164 ? 170.980 -12.709 82.085  1.00 19.76 ? 251  LYS B C     1 
ATOM   5161 O  O     . LYS B 1 164 ? 171.838 -12.946 82.947  1.00 21.19 ? 251  LYS B O     1 
ATOM   5162 C  CB    . LYS B 1 164 ? 170.095 -14.698 80.764  1.00 23.12 ? 251  LYS B CB    1 
ATOM   5163 C  CG    . LYS B 1 164 ? 169.178 -15.904 80.753  1.00 24.26 ? 251  LYS B CG    1 
ATOM   5164 C  CD    . LYS B 1 164 ? 169.764 -17.046 79.936  1.00 26.81 ? 251  LYS B CD    1 
ATOM   5165 C  CE    . LYS B 1 164 ? 168.671 -17.985 79.447  1.00 26.63 ? 251  LYS B CE    1 
ATOM   5166 N  NZ    . LYS B 1 164 ? 169.251 -19.081 78.617  1.00 30.07 ? 251  LYS B NZ    1 
ATOM   5167 N  N     . PRO B 1 165 ? 171.020 -11.595 81.309  1.00 22.44 ? 252  PRO B N     1 
ATOM   5168 C  CA    . PRO B 1 165 ? 172.031 -10.551 81.569  1.00 22.32 ? 252  PRO B CA    1 
ATOM   5169 C  C     . PRO B 1 165 ? 171.957 -9.975  82.977  1.00 23.61 ? 252  PRO B C     1 
ATOM   5170 O  O     . PRO B 1 165 ? 172.990 -9.656  83.563  1.00 21.51 ? 252  PRO B O     1 
ATOM   5171 C  CB    . PRO B 1 165 ? 171.664 -9.441  80.575  1.00 23.63 ? 252  PRO B CB    1 
ATOM   5172 C  CG    . PRO B 1 165 ? 170.942 -10.122 79.477  1.00 22.91 ? 252  PRO B CG    1 
ATOM   5173 C  CD    . PRO B 1 165 ? 170.248 -11.315 80.082  1.00 22.36 ? 252  PRO B CD    1 
ATOM   5174 N  N     . VAL B 1 166 ? 170.742 -9.829  83.509  1.00 23.88 ? 253  VAL B N     1 
ATOM   5175 C  CA    . VAL B 1 166 ? 170.572 -9.272  84.850  1.00 23.20 ? 253  VAL B CA    1 
ATOM   5176 C  C     . VAL B 1 166 ? 171.155 -10.241 85.873  1.00 21.60 ? 253  VAL B C     1 
ATOM   5177 O  O     . VAL B 1 166 ? 171.883 -9.837  86.782  1.00 25.05 ? 253  VAL B O     1 
ATOM   5178 C  CB    . VAL B 1 166 ? 169.097 -8.950  85.166  1.00 22.32 ? 253  VAL B CB    1 
ATOM   5179 C  CG1   . VAL B 1 166 ? 168.999 -8.150  86.457  1.00 23.46 ? 253  VAL B CG1   1 
ATOM   5180 C  CG2   . VAL B 1 166 ? 168.466 -8.177  84.017  1.00 22.64 ? 253  VAL B CG2   1 
ATOM   5181 N  N     . MET B 1 167 ? 170.864 -11.526 85.691  1.00 21.10 ? 254  MET B N     1 
ATOM   5182 C  CA    . MET B 1 167 ? 171.474 -12.580 86.494  1.00 20.93 ? 254  MET B CA    1 
ATOM   5183 C  C     . MET B 1 167 ? 172.993 -12.507 86.501  1.00 22.25 ? 254  MET B C     1 
ATOM   5184 O  O     . MET B 1 167 ? 173.612 -12.606 87.559  1.00 21.80 ? 254  MET B O     1 
ATOM   5185 C  CB    . MET B 1 167 ? 171.033 -13.951 85.996  1.00 21.13 ? 254  MET B CB    1 
ATOM   5186 C  CG    . MET B 1 167 ? 169.605 -14.304 86.361  1.00 19.75 ? 254  MET B CG    1 
ATOM   5187 S  SD    . MET B 1 167 ? 169.094 -15.874 85.660  1.00 20.09 ? 254  MET B SD    1 
ATOM   5188 C  CE    . MET B 1 167 ? 167.734 -16.291 86.764  1.00 21.77 ? 254  MET B CE    1 
ATOM   5189 N  N     . GLU B 1 168 ? 173.594 -12.332 85.321  1.00 24.25 ? 255  GLU B N     1 
ATOM   5190 C  CA    . GLU B 1 168 ? 175.056 -12.265 85.220  1.00 24.76 ? 255  GLU B CA    1 
ATOM   5191 C  C     . GLU B 1 168 ? 175.604 -11.051 85.941  1.00 22.92 ? 255  GLU B C     1 
ATOM   5192 O  O     . GLU B 1 168 ? 176.616 -11.139 86.625  1.00 26.32 ? 255  GLU B O     1 
ATOM   5193 C  CB    . GLU B 1 168 ? 175.511 -12.265 83.764  1.00 25.96 ? 255  GLU B CB    1 
ATOM   5194 C  CG    . GLU B 1 168 ? 175.408 -13.622 83.103  1.00 28.79 ? 255  GLU B CG    1 
ATOM   5195 C  CD    . GLU B 1 168 ? 176.218 -13.721 81.821  1.00 30.80 ? 255  GLU B CD    1 
ATOM   5196 O  OE1   . GLU B 1 168 ? 176.654 -12.671 81.302  1.00 32.47 ? 255  GLU B OE1   1 
ATOM   5197 O  OE2   . GLU B 1 168 ? 176.407 -14.858 81.333  1.00 30.98 ? 255  GLU B OE2   1 
ATOM   5198 N  N     . GLN B 1 169 ? 174.895 -9.933  85.814  1.00 24.24 ? 256  GLN B N     1 
ATOM   5199 C  CA    . GLN B 1 169 ? 175.257 -8.692  86.469  1.00 26.24 ? 256  GLN B CA    1 
ATOM   5200 C  C     . GLN B 1 169 ? 175.395 -8.876  87.980  1.00 26.59 ? 256  GLN B C     1 
ATOM   5201 O  O     . GLN B 1 169 ? 176.226 -8.226  88.613  1.00 25.61 ? 256  GLN B O     1 
ATOM   5202 C  CB    . GLN B 1 169 ? 174.215 -7.629  86.133  1.00 29.35 ? 256  GLN B CB    1 
ATOM   5203 C  CG    . GLN B 1 169 ? 174.325 -6.329  86.906  1.00 31.90 ? 256  GLN B CG    1 
ATOM   5204 C  CD    . GLN B 1 169 ? 173.253 -5.344  86.490  1.00 34.53 ? 256  GLN B CD    1 
ATOM   5205 O  OE1   . GLN B 1 169 ? 172.465 -5.612  85.571  1.00 34.87 ? 256  GLN B OE1   1 
ATOM   5206 N  NE2   . GLN B 1 169 ? 173.216 -4.194  87.159  1.00 36.44 ? 256  GLN B NE2   1 
ATOM   5207 N  N     . TYR B 1 170 ? 174.607 -9.787  88.555  1.00 25.22 ? 257  TYR B N     1 
ATOM   5208 C  CA    . TYR B 1 170 ? 174.672 -10.010 89.995  1.00 27.08 ? 257  TYR B CA    1 
ATOM   5209 C  C     . TYR B 1 170 ? 175.378 -11.306 90.403  1.00 28.14 ? 257  TYR B C     1 
ATOM   5210 O  O     . TYR B 1 170 ? 175.205 -11.797 91.517  1.00 30.83 ? 257  TYR B O     1 
ATOM   5211 C  CB    . TYR B 1 170 ? 173.284 -9.861  90.628  1.00 25.29 ? 257  TYR B CB    1 
ATOM   5212 C  CG    . TYR B 1 170 ? 172.699 -8.473  90.469  1.00 23.91 ? 257  TYR B CG    1 
ATOM   5213 C  CD1   . TYR B 1 170 ? 173.162 -7.400  91.241  1.00 24.82 ? 257  TYR B CD1   1 
ATOM   5214 C  CD2   . TYR B 1 170 ? 171.674 -8.234  89.565  1.00 23.12 ? 257  TYR B CD2   1 
ATOM   5215 C  CE1   . TYR B 1 170 ? 172.619 -6.132  91.102  1.00 24.78 ? 257  TYR B CE1   1 
ATOM   5216 C  CE2   . TYR B 1 170 ? 171.127 -6.972  89.420  1.00 23.20 ? 257  TYR B CE2   1 
ATOM   5217 C  CZ    . TYR B 1 170 ? 171.604 -5.923  90.189  1.00 24.04 ? 257  TYR B CZ    1 
ATOM   5218 O  OH    . TYR B 1 170 ? 171.052 -4.673  90.034  1.00 27.28 ? 257  TYR B OH    1 
ATOM   5219 N  N     . GLY B 1 171 ? 176.193 -11.845 89.498  1.00 28.61 ? 258  GLY B N     1 
ATOM   5220 C  CA    . GLY B 1 171 ? 177.102 -12.939 89.833  1.00 27.26 ? 258  GLY B CA    1 
ATOM   5221 C  C     . GLY B 1 171 ? 176.577 -14.342 89.597  1.00 27.16 ? 258  GLY B C     1 
ATOM   5222 O  O     . GLY B 1 171 ? 177.229 -15.326 89.957  1.00 29.46 ? 258  GLY B O     1 
ATOM   5223 N  N     . LEU B 1 172 ? 175.402 -14.447 88.992  1.00 24.64 ? 259  LEU B N     1 
ATOM   5224 C  CA    . LEU B 1 172 ? 174.852 -15.758 88.661  1.00 23.85 ? 259  LEU B CA    1 
ATOM   5225 C  C     . LEU B 1 172 ? 175.444 -16.301 87.362  1.00 25.89 ? 259  LEU B C     1 
ATOM   5226 O  O     . LEU B 1 172 ? 175.877 -15.537 86.496  1.00 29.57 ? 259  LEU B O     1 
ATOM   5227 C  CB    . LEU B 1 172 ? 173.321 -15.706 88.568  1.00 21.03 ? 259  LEU B CB    1 
ATOM   5228 C  CG    . LEU B 1 172 ? 172.581 -15.971 89.902  1.00 20.58 ? 259  LEU B CG    1 
ATOM   5229 C  CD1   . LEU B 1 172 ? 172.844 -14.855 90.905  1.00 21.37 ? 259  LEU B CD1   1 
ATOM   5230 C  CD2   . LEU B 1 172 ? 171.097 -16.134 89.629  1.00 21.04 ? 259  LEU B CD2   1 
ATOM   5231 N  N     . ILE B 1 173 ? 175.471 -17.624 87.255  1.00 25.73 ? 260  ILE B N     1 
ATOM   5232 C  CA    . ILE B 1 173 ? 175.828 -18.306 86.014  1.00 26.36 ? 260  ILE B CA    1 
ATOM   5233 C  C     . ILE B 1 173 ? 174.566 -18.963 85.444  1.00 25.39 ? 260  ILE B C     1 
ATOM   5234 O  O     . ILE B 1 173 ? 174.243 -20.110 85.789  1.00 26.57 ? 260  ILE B O     1 
ATOM   5235 C  CB    . ILE B 1 173 ? 176.960 -19.335 86.224  1.00 26.21 ? 260  ILE B CB    1 
ATOM   5236 C  CG1   . ILE B 1 173 ? 178.172 -18.665 86.883  1.00 27.14 ? 260  ILE B CG1   1 
ATOM   5237 C  CG2   . ILE B 1 173 ? 177.341 -19.978 84.896  1.00 26.73 ? 260  ILE B CG2   1 
ATOM   5238 C  CD1   . ILE B 1 173 ? 179.312 -19.609 87.231  1.00 27.82 ? 260  ILE B CD1   1 
ATOM   5239 N  N     . PRO B 1 174 ? 173.848 -18.230 84.570  1.00 24.75 ? 261  PRO B N     1 
ATOM   5240 C  CA    . PRO B 1 174 ? 172.480 -18.539 84.162  1.00 25.39 ? 261  PRO B CA    1 
ATOM   5241 C  C     . PRO B 1 174 ? 172.215 -19.966 83.728  1.00 27.32 ? 261  PRO B C     1 
ATOM   5242 O  O     . PRO B 1 174 ? 171.199 -20.525 84.121  1.00 25.91 ? 261  PRO B O     1 
ATOM   5243 C  CB    . PRO B 1 174 ? 172.215 -17.553 83.027  1.00 24.74 ? 261  PRO B CB    1 
ATOM   5244 C  CG    . PRO B 1 174 ? 173.038 -16.379 83.400  1.00 24.62 ? 261  PRO B CG    1 
ATOM   5245 C  CD    . PRO B 1 174 ? 174.298 -16.953 83.986  1.00 25.11 ? 261  PRO B CD    1 
ATOM   5246 N  N     . GLU B 1 175 ? 173.102 -20.569 82.943  1.00 28.63 ? 262  GLU B N     1 
ATOM   5247 C  CA    . GLU B 1 175 ? 172.864 -21.940 82.501  1.00 29.79 ? 262  GLU B CA    1 
ATOM   5248 C  C     . GLU B 1 175 ? 172.845 -22.933 83.665  1.00 28.40 ? 262  GLU B C     1 
ATOM   5249 O  O     . GLU B 1 175 ? 171.948 -23.768 83.750  1.00 31.51 ? 262  GLU B O     1 
ATOM   5250 C  CB    . GLU B 1 175 ? 173.840 -22.356 81.391  1.00 32.22 ? 262  GLU B CB    1 
ATOM   5251 C  CG    . GLU B 1 175 ? 173.644 -21.570 80.095  1.00 34.59 ? 262  GLU B CG    1 
ATOM   5252 C  CD    . GLU B 1 175 ? 172.177 -21.281 79.781  1.00 36.45 ? 262  GLU B CD    1 
ATOM   5253 O  OE1   . GLU B 1 175 ? 171.426 -22.229 79.458  1.00 42.79 ? 262  GLU B OE1   1 
ATOM   5254 O  OE2   . GLU B 1 175 ? 171.767 -20.101 79.842  1.00 37.49 ? 262  GLU B OE2   1 
ATOM   5255 N  N     . GLU B 1 176 ? 173.815 -22.814 84.568  1.00 25.54 ? 263  GLU B N     1 
ATOM   5256 C  CA    . GLU B 1 176 ? 173.854 -23.631 85.774  1.00 24.86 ? 263  GLU B CA    1 
ATOM   5257 C  C     . GLU B 1 176 ? 172.666 -23.301 86.689  1.00 22.89 ? 263  GLU B C     1 
ATOM   5258 O  O     . GLU B 1 176 ? 171.958 -24.196 87.160  1.00 23.12 ? 263  GLU B O     1 
ATOM   5259 C  CB    . GLU B 1 176 ? 175.131 -23.350 86.549  1.00 26.21 ? 263  GLU B CB    1 
ATOM   5260 C  CG    . GLU B 1 176 ? 176.307 -24.232 86.185  1.00 31.00 ? 263  GLU B CG    1 
ATOM   5261 C  CD    . GLU B 1 176 ? 177.583 -23.731 86.813  1.00 32.74 ? 263  GLU B CD    1 
ATOM   5262 O  OE1   . GLU B 1 176 ? 177.597 -23.466 88.037  1.00 33.34 ? 263  GLU B OE1   1 
ATOM   5263 O  OE2   . GLU B 1 176 ? 178.574 -23.596 86.073  1.00 35.66 ? 263  GLU B OE2   1 
ATOM   5264 N  N     . ASP B 1 177 ? 172.469 -22.009 86.916  1.00 21.69 ? 264  ASP B N     1 
ATOM   5265 C  CA    . ASP B 1 177 ? 171.561 -21.509 87.965  1.00 20.48 ? 264  ASP B CA    1 
ATOM   5266 C  C     . ASP B 1 177 ? 170.089 -21.630 87.622  1.00 19.66 ? 264  ASP B C     1 
ATOM   5267 O  O     . ASP B 1 177 ? 169.273 -21.954 88.487  1.00 19.76 ? 264  ASP B O     1 
ATOM   5268 C  CB    . ASP B 1 177 ? 171.942 -20.070 88.325  1.00 20.00 ? 264  ASP B CB    1 
ATOM   5269 C  CG    . ASP B 1 177 ? 173.268 -19.996 89.057  1.00 20.23 ? 264  ASP B CG    1 
ATOM   5270 O  OD1   . ASP B 1 177 ? 173.715 -21.045 89.582  1.00 20.62 ? 264  ASP B OD1   1 
ATOM   5271 O  OD2   . ASP B 1 177 ? 173.858 -18.902 89.143  1.00 22.14 ? 264  ASP B OD2   1 
ATOM   5272 N  N     . ILE B 1 178 ? 169.730 -21.391 86.367  1.00 18.55 ? 265  ILE B N     1 
ATOM   5273 C  CA    . ILE B 1 178 ? 168.365 -21.656 85.920  1.00 18.10 ? 265  ILE B CA    1 
ATOM   5274 C  C     . ILE B 1 178 ? 167.982 -23.135 86.083  1.00 18.45 ? 265  ILE B C     1 
ATOM   5275 O  O     . ILE B 1 178 ? 166.879 -23.468 86.538  1.00 17.63 ? 265  ILE B O     1 
ATOM   5276 C  CB    . ILE B 1 178 ? 168.142 -21.145 84.479  1.00 16.87 ? 265  ILE B CB    1 
ATOM   5277 C  CG1   . ILE B 1 178 ? 168.034 -19.613 84.479  1.00 17.75 ? 265  ILE B CG1   1 
ATOM   5278 C  CG2   . ILE B 1 178 ? 166.887 -21.750 83.859  1.00 16.46 ? 265  ILE B CG2   1 
ATOM   5279 C  CD1   . ILE B 1 178 ? 168.085 -18.975 83.099  1.00 19.88 ? 265  ILE B CD1   1 
ATOM   5280 N  N     . TYR B 1 179 ? 168.901 -24.020 85.713  1.00 17.10 ? 266  TYR B N     1 
ATOM   5281 C  CA    . TYR B 1 179 ? 168.735 -25.444 85.913  1.00 18.65 ? 266  TYR B CA    1 
ATOM   5282 C  C     . TYR B 1 179 ? 168.533 -25.768 87.413  1.00 17.15 ? 266  TYR B C     1 
ATOM   5283 O  O     . TYR B 1 179 ? 167.624 -26.518 87.767  1.00 16.94 ? 266  TYR B O     1 
ATOM   5284 C  CB    . TYR B 1 179 ? 169.968 -26.162 85.361  1.00 21.31 ? 266  TYR B CB    1 
ATOM   5285 C  CG    . TYR B 1 179 ? 169.737 -27.585 84.943  1.00 23.01 ? 266  TYR B CG    1 
ATOM   5286 C  CD1   . TYR B 1 179 ? 169.931 -28.634 85.839  1.00 22.87 ? 266  TYR B CD1   1 
ATOM   5287 C  CD2   . TYR B 1 179 ? 169.359 -27.889 83.631  1.00 24.73 ? 266  TYR B CD2   1 
ATOM   5288 C  CE1   . TYR B 1 179 ? 169.721 -29.944 85.455  1.00 25.96 ? 266  TYR B CE1   1 
ATOM   5289 C  CE2   . TYR B 1 179 ? 169.157 -29.200 83.233  1.00 26.08 ? 266  TYR B CE2   1 
ATOM   5290 C  CZ    . TYR B 1 179 ? 169.346 -30.222 84.145  1.00 26.74 ? 266  TYR B CZ    1 
ATOM   5291 O  OH    . TYR B 1 179 ? 169.139 -31.523 83.759  1.00 28.30 ? 266  TYR B OH    1 
ATOM   5292 N  N     . PHE B 1 180 ? 169.379 -25.190 88.264  1.00 16.97 ? 267  PHE B N     1 
ATOM   5293 C  CA    . PHE B 1 180 ? 169.302 -25.363 89.721  1.00 16.82 ? 267  PHE B CA    1 
ATOM   5294 C  C     . PHE B 1 180 ? 167.950 -24.891 90.254  1.00 15.75 ? 267  PHE B C     1 
ATOM   5295 O  O     . PHE B 1 180 ? 167.315 -25.575 91.071  1.00 15.52 ? 267  PHE B O     1 
ATOM   5296 C  CB    . PHE B 1 180 ? 170.441 -24.575 90.366  1.00 16.27 ? 267  PHE B CB    1 
ATOM   5297 C  CG    . PHE B 1 180 ? 170.403 -24.521 91.872  1.00 16.18 ? 267  PHE B CG    1 
ATOM   5298 C  CD1   . PHE B 1 180 ? 170.072 -25.638 92.626  1.00 17.18 ? 267  PHE B CD1   1 
ATOM   5299 C  CD2   . PHE B 1 180 ? 170.751 -23.350 92.529  1.00 16.23 ? 267  PHE B CD2   1 
ATOM   5300 C  CE1   . PHE B 1 180 ? 170.055 -25.566 94.012  1.00 16.69 ? 267  PHE B CE1   1 
ATOM   5301 C  CE2   . PHE B 1 180 ? 170.750 -23.274 93.913  1.00 16.07 ? 267  PHE B CE2   1 
ATOM   5302 C  CZ    . PHE B 1 180 ? 170.407 -24.388 94.648  1.00 15.67 ? 267  PHE B CZ    1 
ATOM   5303 N  N     . ILE B 1 181 ? 167.534 -23.715 89.815  1.00 16.02 ? 268  ILE B N     1 
ATOM   5304 C  CA    . ILE B 1 181 ? 166.240 -23.162 90.217  1.00 15.41 ? 268  ILE B CA    1 
ATOM   5305 C  C     . ILE B 1 181 ? 165.112 -24.097 89.802  1.00 15.45 ? 268  ILE B C     1 
ATOM   5306 O  O     . ILE B 1 181 ? 164.228 -24.416 90.597  1.00 13.70 ? 268  ILE B O     1 
ATOM   5307 C  CB    . ILE B 1 181 ? 166.057 -21.754 89.648  1.00 15.00 ? 268  ILE B CB    1 
ATOM   5308 C  CG1   . ILE B 1 181 ? 167.079 -20.807 90.295  1.00 14.87 ? 268  ILE B CG1   1 
ATOM   5309 C  CG2   . ILE B 1 181 ? 164.612 -21.289 89.826  1.00 15.72 ? 268  ILE B CG2   1 
ATOM   5310 C  CD1   . ILE B 1 181 ? 167.202 -19.458 89.609  1.00 14.93 ? 268  ILE B CD1   1 
ATOM   5311 N  N     . LYS B 1 182 ? 165.147 -24.573 88.560  1.00 14.43 ? 269  LYS B N     1 
ATOM   5312 C  CA    . LYS B 1 182 ? 164.128 -25.513 88.114  1.00 15.27 ? 269  LYS B CA    1 
ATOM   5313 C  C     . LYS B 1 182 ? 164.097 -26.807 88.939  1.00 15.02 ? 269  LYS B C     1 
ATOM   5314 O  O     . LYS B 1 182 ? 163.012 -27.309 89.248  1.00 14.96 ? 269  LYS B O     1 
ATOM   5315 C  CB    . LYS B 1 182 ? 164.278 -25.828 86.625  1.00 16.17 ? 269  LYS B CB    1 
ATOM   5316 C  CG    . LYS B 1 182 ? 163.854 -24.690 85.714  1.00 17.83 ? 269  LYS B CG    1 
ATOM   5317 C  CD    . LYS B 1 182 ? 164.267 -24.952 84.270  1.00 18.85 ? 269  LYS B CD    1 
ATOM   5318 C  CE    . LYS B 1 182 ? 163.897 -23.766 83.389  1.00 21.10 ? 269  LYS B CE    1 
ATOM   5319 N  NZ    . LYS B 1 182 ? 164.460 -23.936 82.009  1.00 23.01 ? 269  LYS B NZ    1 
ATOM   5320 N  N     . GLU B 1 183 ? 165.274 -27.345 89.275  1.00 13.04 ? 270  GLU B N     1 
ATOM   5321 C  CA    . GLU B 1 183 ? 165.388 -28.540 90.105  1.00 13.15 ? 270  GLU B CA    1 
ATOM   5322 C  C     . GLU B 1 183 ? 164.775 -28.296 91.495  1.00 12.66 ? 270  GLU B C     1 
ATOM   5323 O  O     . GLU B 1 183 ? 164.144 -29.188 92.049  1.00 12.32 ? 270  GLU B O     1 
ATOM   5324 C  CB    . GLU B 1 183 ? 166.848 -28.957 90.277  1.00 14.05 ? 270  GLU B CB    1 
ATOM   5325 C  CG    . GLU B 1 183 ? 167.536 -29.430 88.988  1.00 15.67 ? 270  GLU B CG    1 
ATOM   5326 C  CD    . GLU B 1 183 ? 168.999 -29.779 89.187  1.00 17.51 ? 270  GLU B CD    1 
ATOM   5327 O  OE1   . GLU B 1 183 ? 169.720 -28.996 89.835  1.00 19.01 ? 270  GLU B OE1   1 
ATOM   5328 O  OE2   . GLU B 1 183 ? 169.436 -30.843 88.684  1.00 20.47 ? 270  GLU B OE2   1 
ATOM   5329 N  N     . GLN B 1 184 ? 164.999 -27.112 92.052  1.00 13.66 ? 271  GLN B N     1 
ATOM   5330 C  CA    . GLN B 1 184 ? 164.452 -26.779 93.375  1.00 14.25 ? 271  GLN B CA    1 
ATOM   5331 C  C     . GLN B 1 184 ? 162.936 -26.852 93.372  1.00 14.67 ? 271  GLN B C     1 
ATOM   5332 O  O     . GLN B 1 184 ? 162.312 -27.188 94.393  1.00 16.52 ? 271  GLN B O     1 
ATOM   5333 C  CB    . GLN B 1 184 ? 164.874 -25.380 93.806  1.00 13.48 ? 271  GLN B CB    1 
ATOM   5334 C  CG    . GLN B 1 184 ? 166.351 -25.228 94.106  1.00 15.18 ? 271  GLN B CG    1 
ATOM   5335 C  CD    . GLN B 1 184 ? 166.687 -23.812 94.524  1.00 15.23 ? 271  GLN B CD    1 
ATOM   5336 O  OE1   . GLN B 1 184 ? 166.304 -23.367 95.613  1.00 14.75 ? 271  GLN B OE1   1 
ATOM   5337 N  NE2   . GLN B 1 184 ? 167.397 -23.082 93.656  1.00 14.36 ? 271  GLN B NE2   1 
ATOM   5338 N  N     . ILE B 1 185 ? 162.347 -26.528 92.226  1.00 14.39 ? 272  ILE B N     1 
ATOM   5339 C  CA    . ILE B 1 185 ? 160.913 -26.388 92.132  1.00 15.46 ? 272  ILE B CA    1 
ATOM   5340 C  C     . ILE B 1 185 ? 160.259 -27.726 91.872  1.00 16.53 ? 272  ILE B C     1 
ATOM   5341 O  O     . ILE B 1 185 ? 159.269 -28.072 92.519  1.00 16.27 ? 272  ILE B O     1 
ATOM   5342 C  CB    . ILE B 1 185 ? 160.523 -25.382 91.030  1.00 13.34 ? 272  ILE B CB    1 
ATOM   5343 C  CG1   . ILE B 1 185 ? 160.956 -23.962 91.448  1.00 14.72 ? 272  ILE B CG1   1 
ATOM   5344 C  CG2   . ILE B 1 185 ? 159.037 -25.469 90.737  1.00 14.77 ? 272  ILE B CG2   1 
ATOM   5345 C  CD1   . ILE B 1 185 ? 160.854 -22.910 90.371  1.00 14.69 ? 272  ILE B CD1   1 
ATOM   5346 N  N     . VAL B 1 186 ? 160.817 -28.482 90.925  1.00 16.09 ? 273  VAL B N     1 
ATOM   5347 C  CA    . VAL B 1 186 ? 160.156 -29.690 90.460  1.00 17.24 ? 273  VAL B CA    1 
ATOM   5348 C  C     . VAL B 1 186 ? 160.890 -30.982 90.850  1.00 17.94 ? 273  VAL B C     1 
ATOM   5349 O  O     . VAL B 1 186 ? 160.337 -32.072 90.712  1.00 19.90 ? 273  VAL B O     1 
ATOM   5350 C  CB    . VAL B 1 186 ? 159.915 -29.619 88.928  1.00 17.95 ? 273  VAL B CB    1 
ATOM   5351 C  CG1   . VAL B 1 186 ? 161.156 -30.059 88.160  1.00 16.72 ? 273  VAL B CG1   1 
ATOM   5352 C  CG2   . VAL B 1 186 ? 158.688 -30.429 88.525  1.00 19.18 ? 273  VAL B CG2   1 
ATOM   5353 N  N     . GLY B 1 187 ? 162.114 -30.860 91.344  1.00 18.47 ? 274  GLY B N     1 
ATOM   5354 C  CA    . GLY B 1 187 ? 162.920 -32.040 91.650  1.00 19.29 ? 274  GLY B CA    1 
ATOM   5355 C  C     . GLY B 1 187 ? 163.836 -32.387 90.481  1.00 21.42 ? 274  GLY B C     1 
ATOM   5356 O  O     . GLY B 1 187 ? 164.005 -31.578 89.557  1.00 19.28 ? 274  GLY B O     1 
ATOM   5357 N  N     . PRO B 1 188 ? 164.423 -33.599 90.501  1.00 23.45 ? 275  PRO B N     1 
ATOM   5358 C  CA    . PRO B 1 188 ? 165.323 -34.046 89.414  1.00 25.24 ? 275  PRO B CA    1 
ATOM   5359 C  C     . PRO B 1 188 ? 164.680 -33.890 88.034  1.00 28.32 ? 275  PRO B C     1 
ATOM   5360 O  O     . PRO B 1 188 ? 163.484 -34.172 87.865  1.00 28.88 ? 275  PRO B O     1 
ATOM   5361 C  CB    . PRO B 1 188 ? 165.536 -35.530 89.728  1.00 25.98 ? 275  PRO B CB    1 
ATOM   5362 C  CG    . PRO B 1 188 ? 165.302 -35.647 91.196  1.00 25.09 ? 275  PRO B CG    1 
ATOM   5363 C  CD    . PRO B 1 188 ? 164.226 -34.647 91.520  1.00 24.23 ? 275  PRO B CD    1 
ATOM   5364 N  N     . LEU B 1 189 ? 165.472 -33.436 87.064  1.00 32.58 ? 276  LEU B N     1 
ATOM   5365 C  CA    . LEU B 1 189 ? 164.977 -33.128 85.722  1.00 36.25 ? 276  LEU B CA    1 
ATOM   5366 C  C     . LEU B 1 189 ? 165.175 -34.291 84.745  1.00 43.64 ? 276  LEU B C     1 
ATOM   5367 O  O     . LEU B 1 189 ? 165.014 -34.129 83.531  1.00 46.88 ? 276  LEU B O     1 
ATOM   5368 C  CB    . LEU B 1 189 ? 165.622 -31.843 85.188  1.00 33.20 ? 276  LEU B CB    1 
ATOM   5369 C  CG    . LEU B 1 189 ? 165.388 -30.544 85.973  1.00 30.62 ? 276  LEU B CG    1 
ATOM   5370 C  CD1   . LEU B 1 189 ? 166.196 -29.395 85.389  1.00 29.58 ? 276  LEU B CD1   1 
ATOM   5371 C  CD2   . LEU B 1 189 ? 163.916 -30.185 85.997  1.00 30.32 ? 276  LEU B CD2   1 
ATOM   5372 N  N     . GLU B 1 190 ? 165.522 -35.457 85.289  1.00 50.53 ? 277  GLU B N     1 
ATOM   5373 C  CA    . GLU B 1 190 ? 165.639 -36.698 84.516  1.00 56.41 ? 277  GLU B CA    1 
ATOM   5374 C  C     . GLU B 1 190 ? 165.009 -37.859 85.298  1.00 59.67 ? 277  GLU B C     1 
ATOM   5375 O  O     . GLU B 1 190 ? 164.267 -37.628 86.261  1.00 61.00 ? 277  GLU B O     1 
ATOM   5376 C  CB    . GLU B 1 190 ? 167.107 -36.992 84.179  1.00 59.05 ? 277  GLU B CB    1 
ATOM   5377 C  CG    . GLU B 1 190 ? 167.766 -35.933 83.275  1.00 63.40 ? 277  GLU B CG    1 
ATOM   5378 C  CD    . GLU B 1 190 ? 169.073 -36.435 82.672  1.00 71.17 ? 277  GLU B CD    1 
ATOM   5379 O  OE1   . GLU B 1 190 ? 169.053 -37.474 81.964  1.00 76.61 ? 277  GLU B OE1   1 
ATOM   5380 O  OE2   . GLU B 1 190 ? 170.121 -35.780 82.896  1.00 69.05 ? 277  GLU B OE2   1 
ATOM   5381 N  N     . SER B 1 191 ? 165.296 -39.098 84.872  1.00 63.72 ? 278  SER B N     1 
ATOM   5382 C  CA    . SER B 1 191 ? 164.825 -40.299 85.572  1.00 64.90 ? 278  SER B CA    1 
ATOM   5383 C  C     . SER B 1 191 ? 165.968 -41.279 85.847  1.00 65.42 ? 278  SER B C     1 
ATOM   5384 O  O     . SER B 1 191 ? 166.931 -41.356 85.081  1.00 69.22 ? 278  SER B O     1 
ATOM   5385 C  CB    . SER B 1 191 ? 163.707 -40.995 84.783  1.00 64.97 ? 278  SER B CB    1 
ATOM   5386 O  OG    . SER B 1 191 ? 162.448 -40.348 84.996  1.00 66.00 ? 278  SER B OG    1 
ATOM   5387 N  N     . LEU B 1 197 ? 172.607 -42.851 92.359  1.00 45.75 ? 284  LEU B N     1 
ATOM   5388 C  CA    . LEU B 1 197 ? 173.553 -41.741 92.270  1.00 45.69 ? 284  LEU B CA    1 
ATOM   5389 C  C     . LEU B 1 197 ? 172.896 -40.394 92.592  1.00 43.73 ? 284  LEU B C     1 
ATOM   5390 O  O     . LEU B 1 197 ? 171.671 -40.302 92.704  1.00 45.73 ? 284  LEU B O     1 
ATOM   5391 C  CB    . LEU B 1 197 ? 174.189 -41.690 90.873  1.00 48.52 ? 284  LEU B CB    1 
ATOM   5392 C  CG    . LEU B 1 197 ? 175.422 -42.550 90.573  1.00 50.20 ? 284  LEU B CG    1 
ATOM   5393 C  CD1   . LEU B 1 197 ? 175.085 -44.037 90.515  1.00 51.80 ? 284  LEU B CD1   1 
ATOM   5394 C  CD2   . LEU B 1 197 ? 176.072 -42.095 89.271  1.00 52.17 ? 284  LEU B CD2   1 
ATOM   5395 N  N     . TRP B 1 198 ? 173.731 -39.363 92.741  1.00 40.21 ? 285  TRP B N     1 
ATOM   5396 C  CA    . TRP B 1 198 ? 173.295 -37.977 92.920  1.00 35.49 ? 285  TRP B CA    1 
ATOM   5397 C  C     . TRP B 1 198 ? 172.569 -37.485 91.690  1.00 33.65 ? 285  TRP B C     1 
ATOM   5398 O  O     . TRP B 1 198 ? 173.172 -37.383 90.616  1.00 35.29 ? 285  TRP B O     1 
ATOM   5399 C  CB    . TRP B 1 198 ? 174.508 -37.110 93.229  1.00 34.17 ? 285  TRP B CB    1 
ATOM   5400 C  CG    . TRP B 1 198 ? 174.210 -35.652 93.477  1.00 32.41 ? 285  TRP B CG    1 
ATOM   5401 C  CD1   . TRP B 1 198 ? 174.664 -34.554 92.746  1.00 31.53 ? 285  TRP B CD1   1 
ATOM   5402 C  CD2   . TRP B 1 198 ? 173.384 -35.083 94.549  1.00 31.01 ? 285  TRP B CD2   1 
ATOM   5403 N  NE1   . TRP B 1 198 ? 174.193 -33.382 93.283  1.00 30.00 ? 285  TRP B NE1   1 
ATOM   5404 C  CE2   . TRP B 1 198 ? 173.416 -33.627 94.364  1.00 29.93 ? 285  TRP B CE2   1 
ATOM   5405 C  CE3   . TRP B 1 198 ? 172.646 -35.614 95.607  1.00 30.28 ? 285  TRP B CE3   1 
ATOM   5406 C  CZ2   . TRP B 1 198 ? 172.730 -32.764 95.207  1.00 28.45 ? 285  TRP B CZ2   1 
ATOM   5407 C  CZ3   . TRP B 1 198 ? 171.957 -34.733 96.451  1.00 30.31 ? 285  TRP B CZ3   1 
ATOM   5408 C  CH2   . TRP B 1 198 ? 172.000 -33.342 96.254  1.00 28.94 ? 285  TRP B CH2   1 
ATOM   5409 N  N     . PRO B 1 199 ? 171.260 -37.172 91.827  1.00 29.82 ? 286  PRO B N     1 
ATOM   5410 C  CA    . PRO B 1 199 ? 170.380 -36.908 90.683  1.00 28.31 ? 286  PRO B CA    1 
ATOM   5411 C  C     . PRO B 1 199 ? 170.301 -35.452 90.222  1.00 27.16 ? 286  PRO B C     1 
ATOM   5412 O  O     . PRO B 1 199 ? 169.529 -35.145 89.312  1.00 28.95 ? 286  PRO B O     1 
ATOM   5413 C  CB    . PRO B 1 199 ? 169.011 -37.340 91.211  1.00 28.62 ? 286  PRO B CB    1 
ATOM   5414 C  CG    . PRO B 1 199 ? 169.068 -37.025 92.670  1.00 28.25 ? 286  PRO B CG    1 
ATOM   5415 C  CD    . PRO B 1 199 ? 170.508 -37.173 93.100  1.00 28.18 ? 286  PRO B CD    1 
ATOM   5416 N  N     . TYR B 1 200 ? 171.067 -34.571 90.853  1.00 27.77 ? 287  TYR B N     1 
ATOM   5417 C  CA    . TYR B 1 200 ? 170.990 -33.142 90.576  1.00 26.21 ? 287  TYR B CA    1 
ATOM   5418 C  C     . TYR B 1 200 ? 172.227 -32.629 89.862  1.00 26.12 ? 287  TYR B C     1 
ATOM   5419 O  O     . TYR B 1 200 ? 173.338 -33.060 90.164  1.00 27.98 ? 287  TYR B O     1 
ATOM   5420 C  CB    . TYR B 1 200 ? 170.826 -32.360 91.876  1.00 24.78 ? 287  TYR B CB    1 
ATOM   5421 C  CG    . TYR B 1 200 ? 169.469 -32.494 92.514  1.00 23.35 ? 287  TYR B CG    1 
ATOM   5422 C  CD1   . TYR B 1 200 ? 168.335 -31.987 91.886  1.00 24.02 ? 287  TYR B CD1   1 
ATOM   5423 C  CD2   . TYR B 1 200 ? 169.321 -33.092 93.765  1.00 25.17 ? 287  TYR B CD2   1 
ATOM   5424 C  CE1   . TYR B 1 200 ? 167.084 -32.097 92.475  1.00 24.28 ? 287  TYR B CE1   1 
ATOM   5425 C  CE2   . TYR B 1 200 ? 168.070 -33.202 94.366  1.00 24.84 ? 287  TYR B CE2   1 
ATOM   5426 C  CZ    . TYR B 1 200 ? 166.959 -32.696 93.718  1.00 23.83 ? 287  TYR B CZ    1 
ATOM   5427 O  OH    . TYR B 1 200 ? 165.712 -32.794 94.295  1.00 24.78 ? 287  TYR B OH    1 
ATOM   5428 N  N     . LYS B 1 201 ? 172.028 -31.673 88.958  1.00 26.51 ? 288  LYS B N     1 
ATOM   5429 C  CA    . LYS B 1 201 ? 173.131 -31.059 88.212  1.00 28.09 ? 288  LYS B CA    1 
ATOM   5430 C  C     . LYS B 1 201 ? 173.401 -29.627 88.652  1.00 26.88 ? 288  LYS B C     1 
ATOM   5431 O  O     . LYS B 1 201 ? 174.530 -29.163 88.574  1.00 27.97 ? 288  LYS B O     1 
ATOM   5432 C  CB    . LYS B 1 201 ? 172.866 -31.088 86.698  1.00 30.39 ? 288  LYS B CB    1 
ATOM   5433 C  CG    . LYS B 1 201 ? 172.405 -32.423 86.114  1.00 34.11 ? 288  LYS B CG    1 
ATOM   5434 C  CD    . LYS B 1 201 ? 173.529 -33.450 86.027  1.00 36.65 ? 288  LYS B CD    1 
ATOM   5435 C  CE    . LYS B 1 201 ? 173.269 -34.495 84.945  1.00 37.86 ? 288  LYS B CE    1 
ATOM   5436 N  NZ    . LYS B 1 201 ? 172.096 -35.375 85.222  1.00 40.06 ? 288  LYS B NZ    1 
ATOM   5437 N  N     . GLY B 1 202 ? 172.370 -28.923 89.118  1.00 23.77 ? 289  GLY B N     1 
ATOM   5438 C  CA    . GLY B 1 202 ? 172.535 -27.528 89.512  1.00 19.77 ? 289  GLY B CA    1 
ATOM   5439 C  C     . GLY B 1 202 ? 173.580 -27.279 90.580  1.00 20.03 ? 289  GLY B C     1 
ATOM   5440 O  O     . GLY B 1 202 ? 174.305 -26.284 90.530  1.00 19.73 ? 289  GLY B O     1 
ATOM   5441 N  N     . ARG B 1 203 ? 173.640 -28.174 91.566  1.00 21.21 ? 290  ARG B N     1 
ATOM   5442 C  CA    . ARG B 1 203 ? 174.589 -28.059 92.667  1.00 22.69 ? 290  ARG B CA    1 
ATOM   5443 C  C     . ARG B 1 203 ? 175.041 -29.457 93.081  1.00 23.25 ? 290  ARG B C     1 
ATOM   5444 O  O     . ARG B 1 203 ? 174.274 -30.409 92.946  1.00 23.79 ? 290  ARG B O     1 
ATOM   5445 C  CB    . ARG B 1 203 ? 173.958 -27.322 93.865  1.00 21.92 ? 290  ARG B CB    1 
ATOM   5446 C  CG    . ARG B 1 203 ? 173.689 -25.832 93.655  1.00 19.76 ? 290  ARG B CG    1 
ATOM   5447 C  CD    . ARG B 1 203 ? 174.981 -25.016 93.539  1.00 20.96 ? 290  ARG B CD    1 
ATOM   5448 N  NE    . ARG B 1 203 ? 174.724 -23.580 93.552  1.00 20.27 ? 290  ARG B NE    1 
ATOM   5449 C  CZ    . ARG B 1 203 ? 174.241 -22.877 92.529  1.00 19.86 ? 290  ARG B CZ    1 
ATOM   5450 N  NH1   . ARG B 1 203 ? 173.961 -23.456 91.365  1.00 20.46 ? 290  ARG B NH1   1 
ATOM   5451 N  NH2   . ARG B 1 203 ? 174.040 -21.574 92.681  1.00 19.31 ? 290  ARG B NH2   1 
ATOM   5452 N  N     . PRO B 1 204 ? 176.285 -29.587 93.592  1.00 24.66 ? 291  PRO B N     1 
ATOM   5453 C  CA    . PRO B 1 204 ? 176.800 -30.905 93.985  1.00 25.05 ? 291  PRO B CA    1 
ATOM   5454 C  C     . PRO B 1 204 ? 176.409 -31.310 95.410  1.00 26.95 ? 291  PRO B C     1 
ATOM   5455 O  O     . PRO B 1 204 ? 175.717 -30.551 96.105  1.00 25.81 ? 291  PRO B O     1 
ATOM   5456 C  CB    . PRO B 1 204 ? 178.314 -30.733 93.863  1.00 25.70 ? 291  PRO B CB    1 
ATOM   5457 C  CG    . PRO B 1 204 ? 178.548 -29.281 94.156  1.00 25.94 ? 291  PRO B CG    1 
ATOM   5458 C  CD    . PRO B 1 204 ? 177.311 -28.531 93.709  1.00 24.64 ? 291  PRO B CD    1 
ATOM   5459 N  N     . GLU B 1 205 ? 176.862 -32.490 95.836  1.00 26.11 ? 292  GLU B N     1 
ATOM   5460 C  CA    . GLU B 1 205 ? 176.456 -33.085 97.115  1.00 27.02 ? 292  GLU B CA    1 
ATOM   5461 C  C     . GLU B 1 205 ? 176.798 -32.258 98.352  1.00 25.57 ? 292  GLU B C     1 
ATOM   5462 O  O     . GLU B 1 205 ? 176.123 -32.377 99.383  1.00 25.11 ? 292  GLU B O     1 
ATOM   5463 C  CB    . GLU B 1 205 ? 177.048 -34.494 97.288  1.00 29.14 ? 292  GLU B CB    1 
ATOM   5464 C  CG    . GLU B 1 205 ? 176.555 -35.534 96.296  1.00 31.73 ? 292  GLU B CG    1 
ATOM   5465 C  CD    . GLU B 1 205 ? 177.515 -35.728 95.127  1.00 33.96 ? 292  GLU B CD    1 
ATOM   5466 O  OE1   . GLU B 1 205 ? 177.632 -36.878 94.655  1.00 36.06 ? 292  GLU B OE1   1 
ATOM   5467 O  OE2   . GLU B 1 205 ? 178.153 -34.741 94.685  1.00 33.54 ? 292  GLU B OE2   1 
ATOM   5468 N  N     . ASN B 1 206 ? 177.855 -31.450 98.289  1.00 24.55 ? 293  ASN B N     1 
ATOM   5469 C  CA    . ASN B 1 206 ? 178.219 -30.658 99.460  1.00 26.98 ? 293  ASN B CA    1 
ATOM   5470 C  C     . ASN B 1 206 ? 177.317 -29.428 99.632  1.00 25.64 ? 293  ASN B C     1 
ATOM   5471 O  O     . ASN B 1 206 ? 177.524 -28.615 100.529 1.00 23.65 ? 293  ASN B O     1 
ATOM   5472 C  CB    . ASN B 1 206 ? 179.710 -30.289 99.469  1.00 29.11 ? 293  ASN B CB    1 
ATOM   5473 C  CG    . ASN B 1 206 ? 180.127 -29.456 98.268  1.00 31.24 ? 293  ASN B CG    1 
ATOM   5474 O  OD1   . ASN B 1 206 ? 179.307 -29.070 97.436  1.00 32.72 ? 293  ASN B OD1   1 
ATOM   5475 N  ND2   . ASN B 1 206 ? 181.420 -29.194 98.166  1.00 33.06 ? 293  ASN B ND2   1 
ATOM   5476 N  N     . LYS B 1 207 ? 176.330 -29.306 98.744  1.00 24.85 ? 294  LYS B N     1 
ATOM   5477 C  CA    . LYS B 1 207 ? 175.298 -28.277 98.849  1.00 24.14 ? 294  LYS B CA    1 
ATOM   5478 C  C     . LYS B 1 207 ? 173.897 -28.884 98.726  1.00 22.29 ? 294  LYS B C     1 
ATOM   5479 O  O     . LYS B 1 207 ? 172.940 -28.217 98.300  1.00 21.93 ? 294  LYS B O     1 
ATOM   5480 C  CB    . LYS B 1 207 ? 175.549 -27.171 97.816  1.00 24.31 ? 294  LYS B CB    1 
ATOM   5481 C  CG    . LYS B 1 207 ? 176.719 -26.286 98.218  1.00 25.48 ? 294  LYS B CG    1 
ATOM   5482 C  CD    . LYS B 1 207 ? 176.862 -25.042 97.359  1.00 26.34 ? 294  LYS B CD    1 
ATOM   5483 C  CE    . LYS B 1 207 ? 177.909 -24.117 97.963  1.00 25.71 ? 294  LYS B CE    1 
ATOM   5484 N  NZ    . LYS B 1 207 ? 178.226 -22.952 97.095  1.00 23.97 ? 294  LYS B NZ    1 
ATOM   5485 N  N     . SER B 1 208 ? 173.790 -30.154 99.117  1.00 19.90 ? 295  SER B N     1 
ATOM   5486 C  CA    . SER B 1 208 ? 172.540 -30.905 99.037  1.00 19.14 ? 295  SER B CA    1 
ATOM   5487 C  C     . SER B 1 208 ? 171.435 -30.200 99.818  1.00 19.03 ? 295  SER B C     1 
ATOM   5488 O  O     . SER B 1 208 ? 170.294 -30.174 99.375  1.00 16.56 ? 295  SER B O     1 
ATOM   5489 C  CB    . SER B 1 208 ? 172.714 -32.311 99.603  1.00 19.90 ? 295  SER B CB    1 
ATOM   5490 O  OG    . SER B 1 208 ? 171.503 -33.042 99.504  1.00 21.53 ? 295  SER B OG    1 
ATOM   5491 N  N     . PHE B 1 209 ? 171.800 -29.637 100.971 1.00 18.78 ? 296  PHE B N     1 
ATOM   5492 C  CA    . PHE B 1 209 ? 170.854 -28.925 101.841 1.00 18.40 ? 296  PHE B CA    1 
ATOM   5493 C  C     . PHE B 1 209 ? 170.095 -27.806 101.131 1.00 17.74 ? 296  PHE B C     1 
ATOM   5494 O  O     . PHE B 1 209 ? 168.994 -27.440 101.540 1.00 17.38 ? 296  PHE B O     1 
ATOM   5495 C  CB    . PHE B 1 209 ? 171.587 -28.357 103.059 1.00 18.87 ? 296  PHE B CB    1 
ATOM   5496 C  CG    . PHE B 1 209 ? 172.692 -27.398 102.717 1.00 19.54 ? 296  PHE B CG    1 
ATOM   5497 C  CD1   . PHE B 1 209 ? 172.440 -26.035 102.597 1.00 19.39 ? 296  PHE B CD1   1 
ATOM   5498 C  CD2   . PHE B 1 209 ? 173.996 -27.858 102.527 1.00 19.33 ? 296  PHE B CD2   1 
ATOM   5499 C  CE1   . PHE B 1 209 ? 173.462 -25.144 102.294 1.00 20.22 ? 296  PHE B CE1   1 
ATOM   5500 C  CE2   . PHE B 1 209 ? 175.018 -26.973 102.222 1.00 20.03 ? 296  PHE B CE2   1 
ATOM   5501 C  CZ    . PHE B 1 209 ? 174.754 -25.616 102.106 1.00 19.89 ? 296  PHE B CZ    1 
ATOM   5502 N  N     . LEU B 1 210 ? 170.682 -27.261 100.060 1.00 15.79 ? 297  LEU B N     1 
ATOM   5503 C  CA    . LEU B 1 210 ? 170.042 -26.199 99.296  1.00 14.50 ? 297  LEU B CA    1 
ATOM   5504 C  C     . LEU B 1 210 ? 168.774 -26.675 98.612  1.00 13.85 ? 297  LEU B C     1 
ATOM   5505 O  O     . LEU B 1 210 ? 167.856 -25.888 98.372  1.00 15.96 ? 297  LEU B O     1 
ATOM   5506 C  CB    . LEU B 1 210 ? 171.009 -25.593 98.258  1.00 13.93 ? 297  LEU B CB    1 
ATOM   5507 C  CG    . LEU B 1 210 ? 172.144 -24.705 98.762  1.00 14.48 ? 297  LEU B CG    1 
ATOM   5508 C  CD1   . LEU B 1 210 ? 172.902 -24.098 97.576  1.00 15.50 ? 297  LEU B CD1   1 
ATOM   5509 C  CD2   . LEU B 1 210 ? 171.658 -23.583 99.685  1.00 15.39 ? 297  LEU B CD2   1 
ATOM   5510 N  N     . TYR B 1 211 ? 168.718 -27.963 98.306  1.00 13.48 ? 298  TYR B N     1 
ATOM   5511 C  CA    . TYR B 1 211 ? 167.524 -28.568 97.723  1.00 14.48 ? 298  TYR B CA    1 
ATOM   5512 C  C     . TYR B 1 211 ? 166.435 -28.918 98.768  1.00 13.37 ? 298  TYR B C     1 
ATOM   5513 O  O     . TYR B 1 211 ? 165.374 -29.434 98.408  1.00 14.83 ? 298  TYR B O     1 
ATOM   5514 C  CB    . TYR B 1 211 ? 167.904 -29.825 96.955  1.00 16.26 ? 298  TYR B CB    1 
ATOM   5515 C  CG    . TYR B 1 211 ? 168.680 -29.555 95.679  1.00 17.26 ? 298  TYR B CG    1 
ATOM   5516 C  CD1   . TYR B 1 211 ? 168.028 -29.133 94.523  1.00 17.94 ? 298  TYR B CD1   1 
ATOM   5517 C  CD2   . TYR B 1 211 ? 170.069 -29.723 95.630  1.00 18.46 ? 298  TYR B CD2   1 
ATOM   5518 C  CE1   . TYR B 1 211 ? 168.732 -28.885 93.353  1.00 18.52 ? 298  TYR B CE1   1 
ATOM   5519 C  CE2   . TYR B 1 211 ? 170.783 -29.477 94.458  1.00 18.27 ? 298  TYR B CE2   1 
ATOM   5520 C  CZ    . TYR B 1 211 ? 170.111 -29.067 93.322  1.00 18.87 ? 298  TYR B CZ    1 
ATOM   5521 O  OH    . TYR B 1 211 ? 170.799 -28.826 92.143  1.00 19.49 ? 298  TYR B OH    1 
ATOM   5522 N  N     . GLU B 1 212 ? 166.723 -28.659 100.033 1.00 13.24 ? 299  GLU B N     1 
ATOM   5523 C  CA    . GLU B 1 212 ? 165.817 -29.002 101.141 1.00 14.44 ? 299  GLU B CA    1 
ATOM   5524 C  C     . GLU B 1 212 ? 165.030 -27.779 101.626 1.00 14.62 ? 299  GLU B C     1 
ATOM   5525 O  O     . GLU B 1 212 ? 164.304 -27.847 102.628 1.00 16.12 ? 299  GLU B O     1 
ATOM   5526 C  CB    . GLU B 1 212 ? 166.607 -29.635 102.292 1.00 16.65 ? 299  GLU B CB    1 
ATOM   5527 C  CG    . GLU B 1 212 ? 167.064 -31.062 101.990 1.00 18.42 ? 299  GLU B CG    1 
ATOM   5528 C  CD    . GLU B 1 212 ? 167.872 -31.680 103.113 1.00 22.48 ? 299  GLU B CD    1 
ATOM   5529 O  OE1   . GLU B 1 212 ? 168.860 -31.059 103.556 1.00 24.62 ? 299  GLU B OE1   1 
ATOM   5530 O  OE2   . GLU B 1 212 ? 167.538 -32.808 103.526 1.00 27.30 ? 299  GLU B OE2   1 
ATOM   5531 N  N     . ILE B 1 213 ? 165.165 -26.671 100.905 1.00 12.28 ? 300  ILE B N     1 
ATOM   5532 C  CA    . ILE B 1 213 ? 164.625 -25.385 101.379 1.00 12.22 ? 300  ILE B CA    1 
ATOM   5533 C  C     . ILE B 1 213 ? 163.241 -25.060 100.809 1.00 11.94 ? 300  ILE B C     1 
ATOM   5534 O  O     . ILE B 1 213 ? 162.280 -24.867 101.576 1.00 10.19 ? 300  ILE B O     1 
ATOM   5535 C  CB    . ILE B 1 213 ? 165.637 -24.229 101.185 1.00 12.65 ? 300  ILE B CB    1 
ATOM   5536 C  CG1   . ILE B 1 213 ? 166.833 -24.429 102.127 1.00 12.85 ? 300  ILE B CG1   1 
ATOM   5537 C  CG2   . ILE B 1 213 ? 165.005 -22.865 101.473 1.00 11.59 ? 300  ILE B CG2   1 
ATOM   5538 C  CD1   . ILE B 1 213 ? 168.144 -24.040 101.504 1.00 16.08 ? 300  ILE B CD1   1 
ATOM   5539 N  N     . VAL B 1 214 ? 163.122 -25.018 99.484  1.00 10.70 ? 301  VAL B N     1 
ATOM   5540 C  CA    . VAL B 1 214 ? 161.871 -24.577 98.855  1.00 10.34 ? 301  VAL B CA    1 
ATOM   5541 C  C     . VAL B 1 214 ? 160.845 -25.701 98.752  1.00 11.25 ? 301  VAL B C     1 
ATOM   5542 O  O     . VAL B 1 214 ? 159.675 -25.520 99.083  1.00 12.15 ? 301  VAL B O     1 
ATOM   5543 C  CB    . VAL B 1 214 ? 162.141 -23.937 97.468  1.00 9.06  ? 301  VAL B CB    1 
ATOM   5544 C  CG1   . VAL B 1 214 ? 160.855 -23.651 96.716  1.00 9.00  ? 301  VAL B CG1   1 
ATOM   5545 C  CG2   . VAL B 1 214 ? 162.936 -22.654 97.646  1.00 9.29  ? 301  VAL B CG2   1 
ATOM   5546 N  N     . SER B 1 215 ? 161.285 -26.853 98.271  1.00 13.22 ? 302  SER B N     1 
ATOM   5547 C  CA    . SER B 1 215 ? 160.415 -28.009 98.127  1.00 16.11 ? 302  SER B CA    1 
ATOM   5548 C  C     . SER B 1 215 ? 161.189 -29.245 98.513  1.00 16.75 ? 302  SER B C     1 
ATOM   5549 O  O     . SER B 1 215 ? 161.956 -29.786 97.728  1.00 19.54 ? 302  SER B O     1 
ATOM   5550 C  CB    . SER B 1 215 ? 159.890 -28.125 96.692  1.00 18.44 ? 302  SER B CB    1 
ATOM   5551 O  OG    . SER B 1 215 ? 159.064 -29.270 96.551  1.00 22.29 ? 302  SER B OG    1 
ATOM   5552 N  N     . ASN B 1 216 ? 160.968 -29.699 99.735  1.00 15.11 ? 303  ASN B N     1 
ATOM   5553 C  CA    . ASN B 1 216 ? 161.749 -30.769 100.297 1.00 14.69 ? 303  ASN B CA    1 
ATOM   5554 C  C     . ASN B 1 216 ? 161.092 -32.092 99.968  1.00 17.06 ? 303  ASN B C     1 
ATOM   5555 O  O     . ASN B 1 216 ? 160.079 -32.447 100.555 1.00 14.66 ? 303  ASN B O     1 
ATOM   5556 C  CB    . ASN B 1 216 ? 161.860 -30.553 101.808 1.00 12.33 ? 303  ASN B CB    1 
ATOM   5557 C  CG    . ASN B 1 216 ? 162.773 -31.544 102.483 1.00 12.21 ? 303  ASN B CG    1 
ATOM   5558 O  OD1   . ASN B 1 216 ? 162.822 -32.720 102.128 1.00 12.62 ? 303  ASN B OD1   1 
ATOM   5559 N  ND2   . ASN B 1 216 ? 163.443 -31.085 103.524 1.00 12.59 ? 303  ASN B ND2   1 
ATOM   5560 N  N     . LYS B 1 217 ? 161.672 -32.810 99.008  1.00 20.31 ? 304  LYS B N     1 
ATOM   5561 C  CA    . LYS B 1 217 ? 161.121 -34.087 98.565  1.00 23.15 ? 304  LYS B CA    1 
ATOM   5562 C  C     . LYS B 1 217 ? 161.480 -35.244 99.506  1.00 22.78 ? 304  LYS B C     1 
ATOM   5563 O  O     . LYS B 1 217 ? 160.878 -36.306 99.444  1.00 25.16 ? 304  LYS B O     1 
ATOM   5564 C  CB    . LYS B 1 217 ? 161.564 -34.399 97.121  1.00 25.70 ? 304  LYS B CB    1 
ATOM   5565 C  CG    . LYS B 1 217 ? 161.316 -33.289 96.087  1.00 28.19 ? 304  LYS B CG    1 
ATOM   5566 C  CD    . LYS B 1 217 ? 159.899 -32.706 96.125  1.00 29.64 ? 304  LYS B CD    1 
ATOM   5567 C  CE    . LYS B 1 217 ? 158.824 -33.748 95.841  1.00 32.04 ? 304  LYS B CE    1 
ATOM   5568 N  NZ    . LYS B 1 217 ? 157.490 -33.336 96.362  1.00 34.80 ? 304  LYS B NZ    1 
ATOM   5569 N  N     . ARG B 1 218 ? 162.455 -35.026 100.380 1.00 20.97 ? 305  ARG B N     1 
ATOM   5570 C  CA    . ARG B 1 218 ? 162.925 -36.079 101.280 1.00 19.65 ? 305  ARG B CA    1 
ATOM   5571 C  C     . ARG B 1 218 ? 161.966 -36.281 102.453 1.00 18.17 ? 305  ARG B C     1 
ATOM   5572 O  O     . ARG B 1 218 ? 161.676 -37.415 102.842 1.00 17.43 ? 305  ARG B O     1 
ATOM   5573 C  CB    . ARG B 1 218 ? 164.332 -35.755 101.783 1.00 21.94 ? 305  ARG B CB    1 
ATOM   5574 C  CG    . ARG B 1 218 ? 164.917 -36.775 102.749 1.00 25.01 ? 305  ARG B CG    1 
ATOM   5575 C  CD    . ARG B 1 218 ? 166.367 -36.448 103.076 1.00 28.89 ? 305  ARG B CD    1 
ATOM   5576 N  NE    . ARG B 1 218 ? 167.123 -36.070 101.876 1.00 32.74 ? 305  ARG B NE    1 
ATOM   5577 C  CZ    . ARG B 1 218 ? 167.629 -36.928 100.992 1.00 34.45 ? 305  ARG B CZ    1 
ATOM   5578 N  NH1   . ARG B 1 218 ? 167.477 -38.237 101.160 1.00 37.41 ? 305  ARG B NH1   1 
ATOM   5579 N  NH2   . ARG B 1 218 ? 168.293 -36.473 99.936  1.00 33.49 ? 305  ARG B NH2   1 
ATOM   5580 N  N     . ASN B 1 219 ? 161.454 -35.179 103.000 1.00 14.74 ? 306  ASN B N     1 
ATOM   5581 C  CA    . ASN B 1 219 ? 160.634 -35.269 104.209 1.00 13.77 ? 306  ASN B CA    1 
ATOM   5582 C  C     . ASN B 1 219 ? 159.542 -34.201 104.321 1.00 13.73 ? 306  ASN B C     1 
ATOM   5583 O  O     . ASN B 1 219 ? 158.770 -34.203 105.273 1.00 15.16 ? 306  ASN B O     1 
ATOM   5584 C  CB    . ASN B 1 219 ? 161.510 -35.267 105.456 1.00 14.06 ? 306  ASN B CB    1 
ATOM   5585 C  CG    . ASN B 1 219 ? 162.384 -34.023 105.577 1.00 13.85 ? 306  ASN B CG    1 
ATOM   5586 O  OD1   . ASN B 1 219 ? 161.949 -32.888 105.328 1.00 13.51 ? 306  ASN B OD1   1 
ATOM   5587 N  ND2   . ASN B 1 219 ? 163.622 -34.231 105.979 1.00 13.38 ? 306  ASN B ND2   1 
ATOM   5588 N  N     . GLY B 1 220 ? 159.486 -33.295 103.356 1.00 12.13 ? 307  GLY B N     1 
ATOM   5589 C  CA    . GLY B 1 220 ? 158.402 -32.308 103.306 1.00 11.15 ? 307  GLY B CA    1 
ATOM   5590 C  C     . GLY B 1 220 ? 158.574 -31.117 104.237 1.00 11.32 ? 307  GLY B C     1 
ATOM   5591 O  O     . GLY B 1 220 ? 157.694 -30.252 104.311 1.00 11.63 ? 307  GLY B O     1 
ATOM   5592 N  N     . ILE B 1 221 ? 159.698 -31.028 104.926 1.00 10.15 ? 308  ILE B N     1 
ATOM   5593 C  CA    . ILE B 1 221 ? 159.929 -29.868 105.786 1.00 11.48 ? 308  ILE B CA    1 
ATOM   5594 C  C     . ILE B 1 221 ? 160.515 -28.741 104.926 1.00 10.85 ? 308  ILE B C     1 
ATOM   5595 O  O     . ILE B 1 221 ? 161.711 -28.709 104.659 1.00 10.50 ? 308  ILE B O     1 
ATOM   5596 C  CB    . ILE B 1 221 ? 160.840 -30.200 106.977 1.00 12.91 ? 308  ILE B CB    1 
ATOM   5597 C  CG1   . ILE B 1 221 ? 160.212 -31.306 107.838 1.00 14.18 ? 308  ILE B CG1   1 
ATOM   5598 C  CG2   . ILE B 1 221 ? 161.106 -28.951 107.814 1.00 13.99 ? 308  ILE B CG2   1 
ATOM   5599 C  CD1   . ILE B 1 221 ? 161.086 -31.770 108.981 1.00 14.53 ? 308  ILE B CD1   1 
ATOM   5600 N  N     . ASP B 1 222 ? 159.674 -27.810 104.488 1.00 9.71  ? 309  ASP B N     1 
ATOM   5601 C  CA    . ASP B 1 222 ? 160.187 -26.727 103.645 1.00 9.77  ? 309  ASP B CA    1 
ATOM   5602 C  C     . ASP B 1 222 ? 159.525 -25.394 103.934 1.00 9.31  ? 309  ASP B C     1 
ATOM   5603 O  O     . ASP B 1 222 ? 158.549 -25.340 104.675 1.00 7.94  ? 309  ASP B O     1 
ATOM   5604 C  CB    . ASP B 1 222 ? 160.091 -27.106 102.162 1.00 10.38 ? 309  ASP B CB    1 
ATOM   5605 C  CG    . ASP B 1 222 ? 158.710 -27.535 101.755 1.00 11.50 ? 309  ASP B CG    1 
ATOM   5606 O  OD1   . ASP B 1 222 ? 157.745 -26.818 102.060 1.00 11.81 ? 309  ASP B OD1   1 
ATOM   5607 O  OD2   . ASP B 1 222 ? 158.585 -28.589 101.107 1.00 11.93 ? 309  ASP B OD2   1 
ATOM   5608 N  N     . VAL B 1 223 ? 160.060 -24.318 103.351 1.00 8.08  ? 310  VAL B N     1 
ATOM   5609 C  CA    . VAL B 1 223 ? 159.573 -22.969 103.673 1.00 7.38  ? 310  VAL B CA    1 
ATOM   5610 C  C     . VAL B 1 223 ? 158.225 -22.656 103.019 1.00 7.24  ? 310  VAL B C     1 
ATOM   5611 O  O     . VAL B 1 223 ? 157.568 -21.667 103.390 1.00 7.44  ? 310  VAL B O     1 
ATOM   5612 C  CB    . VAL B 1 223 ? 160.587 -21.864 103.299 1.00 7.78  ? 310  VAL B CB    1 
ATOM   5613 C  CG1   . VAL B 1 223 ? 161.926 -22.032 104.057 1.00 7.76  ? 310  VAL B CG1   1 
ATOM   5614 C  CG2   . VAL B 1 223 ? 160.807 -21.830 101.786 1.00 7.89  ? 310  VAL B CG2   1 
ATOM   5615 N  N     . ASP B 1 224 ? 157.844 -23.452 102.019 1.00 7.61  ? 311  ASP B N     1 
ATOM   5616 C  CA    . ASP B 1 224 ? 156.549 -23.331 101.361 1.00 7.50  ? 311  ASP B CA    1 
ATOM   5617 C  C     . ASP B 1 224 ? 155.454 -23.533 102.432 1.00 7.36  ? 311  ASP B C     1 
ATOM   5618 O  O     . ASP B 1 224 ? 154.566 -22.685 102.603 1.00 6.59  ? 311  ASP B O     1 
ATOM   5619 C  CB    . ASP B 1 224 ? 156.440 -24.389 100.242 1.00 9.10  ? 311  ASP B CB    1 
ATOM   5620 C  CG    . ASP B 1 224 ? 155.237 -24.195 99.353  1.00 11.26 ? 311  ASP B CG    1 
ATOM   5621 O  OD1   . ASP B 1 224 ? 154.615 -23.107 99.351  1.00 9.86  ? 311  ASP B OD1   1 
ATOM   5622 O  OD2   . ASP B 1 224 ? 154.949 -25.108 98.568  1.00 15.82 ? 311  ASP B OD2   1 
ATOM   5623 N  N     . LYS B 1 225 ? 155.542 -24.649 103.156 1.00 7.10  ? 312  LYS B N     1 
ATOM   5624 C  CA    . LYS B 1 225 ? 154.621 -24.965 104.271 1.00 7.42  ? 312  LYS B CA    1 
ATOM   5625 C  C     . LYS B 1 225 ? 154.632 -23.858 105.307 1.00 7.00  ? 312  LYS B C     1 
ATOM   5626 O  O     . LYS B 1 225 ? 153.565 -23.455 105.817 1.00 6.83  ? 312  LYS B O     1 
ATOM   5627 C  CB    . LYS B 1 225 ? 155.027 -26.294 104.948 1.00 8.86  ? 312  LYS B CB    1 
ATOM   5628 C  CG    . LYS B 1 225 ? 154.588 -27.548 104.221 1.00 11.35 ? 312  LYS B CG    1 
ATOM   5629 C  CD    . LYS B 1 225 ? 154.972 -28.801 105.016 1.00 12.26 ? 312  LYS B CD    1 
ATOM   5630 C  CE    . LYS B 1 225 ? 154.569 -30.067 104.286 1.00 13.58 ? 312  LYS B CE    1 
ATOM   5631 N  NZ    . LYS B 1 225 ? 155.314 -30.252 103.015 1.00 15.50 ? 312  LYS B NZ    1 
ATOM   5632 N  N     . TRP B 1 226 ? 155.829 -23.369 105.647 1.00 6.28  ? 313  TRP B N     1 
ATOM   5633 C  CA    . TRP B 1 226 ? 155.922 -22.361 106.697 1.00 6.13  ? 313  TRP B CA    1 
ATOM   5634 C  C     . TRP B 1 226 ? 155.147 -21.121 106.325 1.00 5.95  ? 313  TRP B C     1 
ATOM   5635 O  O     . TRP B 1 226 ? 154.444 -20.559 107.144 1.00 5.95  ? 313  TRP B O     1 
ATOM   5636 C  CB    . TRP B 1 226 ? 157.354 -22.026 107.041 1.00 6.79  ? 313  TRP B CB    1 
ATOM   5637 C  CG    . TRP B 1 226 ? 158.138 -23.239 107.471 1.00 7.22  ? 313  TRP B CG    1 
ATOM   5638 C  CD1   . TRP B 1 226 ? 157.661 -24.510 107.783 1.00 6.94  ? 313  TRP B CD1   1 
ATOM   5639 C  CD2   . TRP B 1 226 ? 159.578 -23.313 107.617 1.00 7.55  ? 313  TRP B CD2   1 
ATOM   5640 N  NE1   . TRP B 1 226 ? 158.710 -25.338 108.123 1.00 7.96  ? 313  TRP B NE1   1 
ATOM   5641 C  CE2   . TRP B 1 226 ? 159.884 -24.667 108.042 1.00 8.05  ? 313  TRP B CE2   1 
ATOM   5642 C  CE3   . TRP B 1 226 ? 160.614 -22.397 107.455 1.00 7.89  ? 313  TRP B CE3   1 
ATOM   5643 C  CZ2   . TRP B 1 226 ? 161.197 -25.089 108.270 1.00 8.57  ? 313  TRP B CZ2   1 
ATOM   5644 C  CZ3   . TRP B 1 226 ? 161.928 -22.818 107.716 1.00 8.60  ? 313  TRP B CZ3   1 
ATOM   5645 C  CH2   . TRP B 1 226 ? 162.207 -24.134 108.094 1.00 8.18  ? 313  TRP B CH2   1 
ATOM   5646 N  N     . ASP B 1 227 ? 155.285 -20.664 105.082 1.00 5.50  ? 314  ASP B N     1 
ATOM   5647 C  CA    . ASP B 1 227 ? 154.511 -19.490 104.693 1.00 5.59  ? 314  ASP B CA    1 
ATOM   5648 C  C     . ASP B 1 227 ? 153.022 -19.784 104.675 1.00 5.39  ? 314  ASP B C     1 
ATOM   5649 O  O     . ASP B 1 227 ? 152.241 -18.996 105.179 1.00 4.53  ? 314  ASP B O     1 
ATOM   5650 C  CB    . ASP B 1 227 ? 154.905 -18.948 103.326 1.00 5.43  ? 314  ASP B CB    1 
ATOM   5651 C  CG    . ASP B 1 227 ? 154.160 -17.649 103.000 1.00 5.71  ? 314  ASP B CG    1 
ATOM   5652 O  OD1   . ASP B 1 227 ? 154.573 -16.580 103.477 1.00 6.13  ? 314  ASP B OD1   1 
ATOM   5653 O  OD2   . ASP B 1 227 ? 153.107 -17.718 102.347 1.00 5.83  ? 314  ASP B OD2   1 
ATOM   5654 N  N     . TYR B 1 228 ? 152.612 -20.886 104.056 1.00 5.10  ? 315  TYR B N     1 
ATOM   5655 C  CA    . TYR B 1 228 ? 151.184 -21.097 103.928 1.00 5.77  ? 315  TYR B CA    1 
ATOM   5656 C  C     . TYR B 1 228 ? 150.483 -21.392 105.272 1.00 5.70  ? 315  TYR B C     1 
ATOM   5657 O  O     . TYR B 1 228 ? 149.346 -20.963 105.470 1.00 4.79  ? 315  TYR B O     1 
ATOM   5658 C  CB    . TYR B 1 228 ? 150.791 -22.031 102.767 1.00 6.36  ? 315  TYR B CB    1 
ATOM   5659 C  CG    . TYR B 1 228 ? 150.803 -23.525 103.000 1.00 7.21  ? 315  TYR B CG    1 
ATOM   5660 C  CD1   . TYR B 1 228 ? 149.916 -24.119 103.916 1.00 7.32  ? 315  TYR B CD1   1 
ATOM   5661 C  CD2   . TYR B 1 228 ? 151.643 -24.360 102.255 1.00 8.32  ? 315  TYR B CD2   1 
ATOM   5662 C  CE1   . TYR B 1 228 ? 149.890 -25.494 104.102 1.00 8.84  ? 315  TYR B CE1   1 
ATOM   5663 C  CE2   . TYR B 1 228 ? 151.627 -25.736 102.448 1.00 9.09  ? 315  TYR B CE2   1 
ATOM   5664 C  CZ    . TYR B 1 228 ? 150.750 -26.289 103.371 1.00 9.44  ? 315  TYR B CZ    1 
ATOM   5665 O  OH    . TYR B 1 228 ? 150.699 -27.650 103.590 1.00 11.06 ? 315  TYR B OH    1 
ATOM   5666 N  N     . PHE B 1 229 ? 151.160 -22.084 106.194 1.00 5.81  ? 316  PHE B N     1 
ATOM   5667 C  CA    . PHE B 1 229 ? 150.601 -22.243 107.550 1.00 6.06  ? 316  PHE B CA    1 
ATOM   5668 C  C     . PHE B 1 229 ? 150.258 -20.859 108.120 1.00 5.57  ? 316  PHE B C     1 
ATOM   5669 O  O     . PHE B 1 229 ? 149.137 -20.601 108.553 1.00 6.28  ? 316  PHE B O     1 
ATOM   5670 C  CB    . PHE B 1 229 ? 151.626 -22.870 108.501 1.00 6.80  ? 316  PHE B CB    1 
ATOM   5671 C  CG    . PHE B 1 229 ? 151.808 -24.357 108.343 1.00 8.20  ? 316  PHE B CG    1 
ATOM   5672 C  CD1   . PHE B 1 229 ? 151.173 -25.079 107.347 1.00 8.31  ? 316  PHE B CD1   1 
ATOM   5673 C  CD2   . PHE B 1 229 ? 152.642 -25.031 109.229 1.00 9.83  ? 316  PHE B CD2   1 
ATOM   5674 C  CE1   . PHE B 1 229 ? 151.382 -26.441 107.218 1.00 8.99  ? 316  PHE B CE1   1 
ATOM   5675 C  CE2   . PHE B 1 229 ? 152.841 -26.401 109.116 1.00 10.83 ? 316  PHE B CE2   1 
ATOM   5676 C  CZ    . PHE B 1 229 ? 152.217 -27.100 108.104 1.00 10.44 ? 316  PHE B CZ    1 
ATOM   5677 N  N     . ALA B 1 230 ? 151.264 -19.973 108.155 1.00 4.59  ? 317  ALA B N     1 
ATOM   5678 C  CA    . ALA B 1 230 ? 151.099 -18.634 108.732 1.00 4.52  ? 317  ALA B CA    1 
ATOM   5679 C  C     . ALA B 1 230 ? 150.078 -17.780 107.980 1.00 4.31  ? 317  ALA B C     1 
ATOM   5680 O  O     . ALA B 1 230 ? 149.208 -17.139 108.592 1.00 3.96  ? 317  ALA B O     1 
ATOM   5681 C  CB    . ALA B 1 230 ? 152.457 -17.919 108.820 1.00 4.59  ? 317  ALA B CB    1 
ATOM   5682 N  N     . ARG B 1 231 ? 150.178 -17.776 106.653 1.00 3.81  ? 318  ARG B N     1 
ATOM   5683 C  CA    . ARG B 1 231 ? 149.356 -16.887 105.846 1.00 3.69  ? 318  ARG B CA    1 
ATOM   5684 C  C     . ARG B 1 231 ? 147.904 -17.393 105.781 1.00 3.67  ? 318  ARG B C     1 
ATOM   5685 O  O     . ARG B 1 231 ? 146.966 -16.598 105.930 1.00 3.85  ? 318  ARG B O     1 
ATOM   5686 C  CB    . ARG B 1 231 ? 149.967 -16.782 104.441 1.00 3.31  ? 318  ARG B CB    1 
ATOM   5687 C  CG    . ARG B 1 231 ? 149.343 -15.706 103.551 1.00 3.68  ? 318  ARG B CG    1 
ATOM   5688 C  CD    . ARG B 1 231 ? 150.125 -15.534 102.226 1.00 3.58  ? 318  ARG B CD    1 
ATOM   5689 N  NE    . ARG B 1 231 ? 151.552 -15.289 102.535 1.00 3.69  ? 318  ARG B NE    1 
ATOM   5690 C  CZ    . ARG B 1 231 ? 152.043 -14.085 102.829 1.00 3.74  ? 318  ARG B CZ    1 
ATOM   5691 N  NH1   . ARG B 1 231 ? 151.256 -12.993 102.825 1.00 3.83  ? 318  ARG B NH1   1 
ATOM   5692 N  NH2   . ARG B 1 231 ? 153.322 -13.964 103.135 1.00 3.86  ? 318  ARG B NH2   1 
ATOM   5693 N  N     . ASP B 1 232 ? 147.716 -18.696 105.550 1.00 3.48  ? 319  ASP B N     1 
ATOM   5694 C  CA    . ASP B 1 232 ? 146.333 -19.224 105.464 1.00 3.51  ? 319  ASP B CA    1 
ATOM   5695 C  C     . ASP B 1 232 ? 145.657 -19.001 106.807 1.00 3.61  ? 319  ASP B C     1 
ATOM   5696 O  O     . ASP B 1 232 ? 144.509 -18.554 106.871 1.00 4.32  ? 319  ASP B O     1 
ATOM   5697 C  CB    . ASP B 1 232 ? 146.310 -20.718 105.109 1.00 3.39  ? 319  ASP B CB    1 
ATOM   5698 C  CG    . ASP B 1 232 ? 146.822 -20.995 103.691 1.00 3.80  ? 319  ASP B CG    1 
ATOM   5699 O  OD1   . ASP B 1 232 ? 146.933 -20.046 102.878 1.00 4.34  ? 319  ASP B OD1   1 
ATOM   5700 O  OD2   . ASP B 1 232 ? 147.074 -22.173 103.373 1.00 4.28  ? 319  ASP B OD2   1 
ATOM   5701 N  N     . CYS B 1 233 ? 146.385 -19.253 107.897 1.00 4.42  ? 320  CYS B N     1 
ATOM   5702 C  CA    . CYS B 1 233 ? 145.791 -19.063 109.227 1.00 5.13  ? 320  CYS B CA    1 
ATOM   5703 C  C     . CYS B 1 233 ? 145.367 -17.601 109.477 1.00 5.30  ? 320  CYS B C     1 
ATOM   5704 O  O     . CYS B 1 233 ? 144.259 -17.332 109.939 1.00 4.86  ? 320  CYS B O     1 
ATOM   5705 C  CB    . CYS B 1 233 ? 146.751 -19.537 110.314 1.00 5.27  ? 320  CYS B CB    1 
ATOM   5706 S  SG    . CYS B 1 233 ? 146.666 -21.312 110.528 1.00 7.61  ? 320  CYS B SG    1 
ATOM   5707 N  N     . HIS B 1 234 ? 146.260 -16.661 109.149 1.00 5.12  ? 321  HIS B N     1 
ATOM   5708 C  CA    . HIS B 1 234 ? 145.978 -15.225 109.243 1.00 5.98  ? 321  HIS B CA    1 
ATOM   5709 C  C     . HIS B 1 234 ? 144.668 -14.873 108.556 1.00 6.12  ? 321  HIS B C     1 
ATOM   5710 O  O     . HIS B 1 234 ? 143.845 -14.104 109.082 1.00 6.86  ? 321  HIS B O     1 
ATOM   5711 C  CB    . HIS B 1 234 ? 147.146 -14.463 108.622 1.00 6.28  ? 321  HIS B CB    1 
ATOM   5712 C  CG    . HIS B 1 234 ? 147.060 -12.972 108.771 1.00 7.35  ? 321  HIS B CG    1 
ATOM   5713 N  ND1   . HIS B 1 234 ? 147.354 -12.347 109.929 1.00 7.49  ? 321  HIS B ND1   1 
ATOM   5714 C  CD2   . HIS B 1 234 ? 146.739 -11.990 107.863 1.00 7.84  ? 321  HIS B CD2   1 
ATOM   5715 C  CE1   . HIS B 1 234 ? 147.217 -11.022 109.762 1.00 8.07  ? 321  HIS B CE1   1 
ATOM   5716 N  NE2   . HIS B 1 234 ? 146.826 -10.805 108.504 1.00 7.98  ? 321  HIS B NE2   1 
ATOM   5717 N  N     . HIS B 1 235 ? 144.433 -15.462 107.390 1.00 6.36  ? 322  HIS B N     1 
ATOM   5718 C  CA    . HIS B 1 235 ? 143.268 -15.097 106.586 1.00 7.29  ? 322  HIS B CA    1 
ATOM   5719 C  C     . HIS B 1 235 ? 142.033 -15.879 106.907 1.00 7.38  ? 322  HIS B C     1 
ATOM   5720 O  O     . HIS B 1 235 ? 140.925 -15.363 106.862 1.00 7.96  ? 322  HIS B O     1 
ATOM   5721 C  CB    . HIS B 1 235 ? 143.619 -15.224 105.101 1.00 8.83  ? 322  HIS B CB    1 
ATOM   5722 C  CG    . HIS B 1 235 ? 144.482 -14.106 104.597 1.00 11.35 ? 322  HIS B CG    1 
ATOM   5723 N  ND1   . HIS B 1 235 ? 145.825 -14.123 104.681 1.00 12.48 ? 322  HIS B ND1   1 
ATOM   5724 C  CD2   . HIS B 1 235 ? 144.141 -12.909 103.966 1.00 13.93 ? 322  HIS B CD2   1 
ATOM   5725 C  CE1   . HIS B 1 235 ? 146.320 -12.979 104.153 1.00 13.07 ? 322  HIS B CE1   1 
ATOM   5726 N  NE2   . HIS B 1 235 ? 145.286 -12.248 103.712 1.00 15.68 ? 322  HIS B NE2   1 
ATOM   5727 N  N     . LEU B 1 236 ? 142.216 -17.140 107.261 1.00 6.84  ? 323  LEU B N     1 
ATOM   5728 C  CA    . LEU B 1 236 ? 141.101 -18.013 107.548 1.00 6.72  ? 323  LEU B CA    1 
ATOM   5729 C  C     . LEU B 1 236 ? 140.434 -17.664 108.875 1.00 7.77  ? 323  LEU B C     1 
ATOM   5730 O  O     . LEU B 1 236 ? 139.242 -17.863 109.033 1.00 9.60  ? 323  LEU B O     1 
ATOM   5731 C  CB    . LEU B 1 236 ? 141.575 -19.458 107.614 1.00 5.68  ? 323  LEU B CB    1 
ATOM   5732 C  CG    . LEU B 1 236 ? 141.926 -20.144 106.283 1.00 4.84  ? 323  LEU B CG    1 
ATOM   5733 C  CD1   . LEU B 1 236 ? 142.720 -21.397 106.609 1.00 4.94  ? 323  LEU B CD1   1 
ATOM   5734 C  CD2   . LEU B 1 236 ? 140.645 -20.507 105.519 1.00 5.52  ? 323  LEU B CD2   1 
ATOM   5735 N  N     . GLY B 1 237 ? 141.226 -17.184 109.828 1.00 7.05  ? 324  GLY B N     1 
ATOM   5736 C  CA    . GLY B 1 237 ? 140.732 -16.965 111.178 1.00 8.26  ? 324  GLY B CA    1 
ATOM   5737 C  C     . GLY B 1 237 ? 140.864 -18.207 112.048 1.00 10.01 ? 324  GLY B C     1 
ATOM   5738 O  O     . GLY B 1 237 ? 140.061 -18.418 112.954 1.00 9.84  ? 324  GLY B O     1 
ATOM   5739 N  N     . ILE B 1 238 ? 141.882 -19.026 111.757 1.00 10.60 ? 325  ILE B N     1 
ATOM   5740 C  CA    . ILE B 1 238 ? 142.310 -20.154 112.604 1.00 11.34 ? 325  ILE B CA    1 
ATOM   5741 C  C     . ILE B 1 238 ? 143.750 -19.855 112.999 1.00 13.92 ? 325  ILE B C     1 
ATOM   5742 O  O     . ILE B 1 238 ? 144.493 -19.293 112.207 1.00 13.57 ? 325  ILE B O     1 
ATOM   5743 C  CB    . ILE B 1 238 ? 142.402 -21.462 111.794 1.00 14.18 ? 325  ILE B CB    1 
ATOM   5744 C  CG1   . ILE B 1 238 ? 141.055 -21.903 111.258 1.00 15.22 ? 325  ILE B CG1   1 
ATOM   5745 C  CG2   . ILE B 1 238 ? 143.087 -22.571 112.614 1.00 15.47 ? 325  ILE B CG2   1 
ATOM   5746 C  CD1   . ILE B 1 238 ? 141.230 -22.927 110.142 1.00 14.27 ? 325  ILE B CD1   1 
ATOM   5747 N  N     . GLN B 1 239 ? 144.182 -20.262 114.190 1.00 14.87 ? 326  GLN B N     1 
ATOM   5748 C  CA    . GLN B 1 239 ? 145.514 -19.842 114.649 1.00 14.80 ? 326  GLN B CA    1 
ATOM   5749 C  C     . GLN B 1 239 ? 146.630 -20.826 114.360 1.00 17.27 ? 326  GLN B C     1 
ATOM   5750 O  O     . GLN B 1 239 ? 146.463 -22.007 114.507 1.00 14.89 ? 326  GLN B O     1 
ATOM   5751 C  CB    . GLN B 1 239 ? 145.543 -19.478 116.132 1.00 20.54 ? 326  GLN B CB    1 
ATOM   5752 C  CG    . GLN B 1 239 ? 145.178 -18.029 116.421 1.00 24.78 ? 326  GLN B CG    1 
ATOM   5753 C  CD    . GLN B 1 239 ? 146.211 -17.290 117.277 1.00 26.70 ? 326  GLN B CD    1 
ATOM   5754 O  OE1   . GLN B 1 239 ? 146.769 -17.823 118.257 1.00 33.11 ? 326  GLN B OE1   1 
ATOM   5755 N  NE2   . GLN B 1 239 ? 146.481 -16.051 116.893 1.00 31.33 ? 326  GLN B NE2   1 
ATOM   5756 N  N     . ASN B 1 240 ? 147.776 -20.303 113.944 1.00 18.63 ? 327  ASN B N     1 
ATOM   5757 C  CA    . ASN B 1 240 ? 148.903 -21.174 113.664 1.00 18.16 ? 327  ASN B CA    1 
ATOM   5758 C  C     . ASN B 1 240 ? 149.607 -21.583 114.972 1.00 16.26 ? 327  ASN B C     1 
ATOM   5759 O  O     . ASN B 1 240 ? 149.925 -20.726 115.754 1.00 19.39 ? 327  ASN B O     1 
ATOM   5760 C  CB    . ASN B 1 240 ? 149.846 -20.463 112.701 1.00 18.10 ? 327  ASN B CB    1 
ATOM   5761 C  CG    . ASN B 1 240 ? 150.989 -21.334 112.270 1.00 17.82 ? 327  ASN B CG    1 
ATOM   5762 O  OD1   . ASN B 1 240 ? 150.989 -22.545 112.539 1.00 16.87 ? 327  ASN B OD1   1 
ATOM   5763 N  ND2   . ASN B 1 240 ? 152.007 -20.711 111.635 1.00 12.84 ? 327  ASN B ND2   1 
ATOM   5764 N  N     . ASN B 1 241 ? 149.812 -22.878 115.188 1.00 14.51 ? 328  ASN B N     1 
ATOM   5765 C  CA    . ASN B 1 241 ? 150.568 -23.389 116.345 1.00 13.59 ? 328  ASN B CA    1 
ATOM   5766 C  C     . ASN B 1 241 ? 152.048 -23.869 116.060 1.00 14.38 ? 328  ASN B C     1 
ATOM   5767 O  O     . ASN B 1 241 ? 152.809 -24.241 116.960 1.00 14.77 ? 328  ASN B O     1 
ATOM   5768 C  CB    . ASN B 1 241 ? 149.658 -24.374 117.082 1.00 19.71 ? 328  ASN B CB    1 
ATOM   5769 C  CG    . ASN B 1 241 ? 149.824 -25.805 116.635 1.00 23.41 ? 328  ASN B CG    1 
ATOM   5770 O  OD1   . ASN B 1 241 ? 150.756 -26.492 117.103 1.00 24.62 ? 328  ASN B OD1   1 
ATOM   5771 N  ND2   . ASN B 1 241 ? 148.869 -26.306 115.794 1.00 24.25 ? 328  ASN B ND2   1 
ATOM   5772 N  N     . PHE B 1 242 ? 152.480 -23.771 114.815 1.00 11.21 ? 329  PHE B N     1 
ATOM   5773 C  CA    . PHE B 1 242 ? 153.875 -24.131 114.448 1.00 9.80  ? 329  PHE B CA    1 
ATOM   5774 C  C     . PHE B 1 242 ? 154.775 -22.906 114.453 1.00 8.81  ? 329  PHE B C     1 
ATOM   5775 O  O     . PHE B 1 242 ? 154.395 -21.856 113.958 1.00 9.09  ? 329  PHE B O     1 
ATOM   5776 C  CB    . PHE B 1 242 ? 153.923 -24.784 113.049 1.00 9.35  ? 329  PHE B CB    1 
ATOM   5777 C  CG    . PHE B 1 242 ? 155.324 -25.093 112.586 1.00 9.13  ? 329  PHE B CG    1 
ATOM   5778 C  CD1   . PHE B 1 242 ? 156.051 -26.077 113.228 1.00 9.69  ? 329  PHE B CD1   1 
ATOM   5779 C  CD2   . PHE B 1 242 ? 155.930 -24.374 111.559 1.00 8.84  ? 329  PHE B CD2   1 
ATOM   5780 C  CE1   . PHE B 1 242 ? 157.352 -26.373 112.854 1.00 10.02 ? 329  PHE B CE1   1 
ATOM   5781 C  CE2   . PHE B 1 242 ? 157.238 -24.659 111.173 1.00 9.26  ? 329  PHE B CE2   1 
ATOM   5782 C  CZ    . PHE B 1 242 ? 157.949 -25.669 111.823 1.00 9.35  ? 329  PHE B CZ    1 
ATOM   5783 N  N     . ASP B 1 243 ? 155.979 -23.020 114.991 1.00 7.26  ? 330  ASP B N     1 
ATOM   5784 C  CA    . ASP B 1 243 ? 156.853 -21.845 115.054 1.00 7.22  ? 330  ASP B CA    1 
ATOM   5785 C  C     . ASP B 1 243 ? 158.026 -22.050 114.126 1.00 7.95  ? 330  ASP B C     1 
ATOM   5786 O  O     . ASP B 1 243 ? 158.973 -22.725 114.515 1.00 7.19  ? 330  ASP B O     1 
ATOM   5787 C  CB    . ASP B 1 243 ? 157.359 -21.685 116.498 1.00 8.45  ? 330  ASP B CB    1 
ATOM   5788 C  CG    . ASP B 1 243 ? 158.190 -20.423 116.710 1.00 9.31  ? 330  ASP B CG    1 
ATOM   5789 O  OD1   . ASP B 1 243 ? 158.841 -19.903 115.796 1.00 8.92  ? 330  ASP B OD1   1 
ATOM   5790 O  OD2   . ASP B 1 243 ? 158.234 -19.959 117.854 1.00 10.01 ? 330  ASP B OD2   1 
ATOM   5791 N  N     . TYR B 1 244 ? 157.982 -21.490 112.920 1.00 8.40  ? 331  TYR B N     1 
ATOM   5792 C  CA    . TYR B 1 244 ? 159.068 -21.756 111.954 1.00 9.43  ? 331  TYR B CA    1 
ATOM   5793 C  C     . TYR B 1 244 ? 160.368 -21.070 112.366 1.00 9.76  ? 331  TYR B C     1 
ATOM   5794 O  O     . TYR B 1 244 ? 161.475 -21.568 112.073 1.00 10.00 ? 331  TYR B O     1 
ATOM   5795 C  CB    . TYR B 1 244 ? 158.668 -21.344 110.523 1.00 9.64  ? 331  TYR B CB    1 
ATOM   5796 C  CG    . TYR B 1 244 ? 158.934 -19.868 110.237 1.00 10.68 ? 331  TYR B CG    1 
ATOM   5797 C  CD1   . TYR B 1 244 ? 160.223 -19.427 109.920 1.00 11.18 ? 331  TYR B CD1   1 
ATOM   5798 C  CD2   . TYR B 1 244 ? 157.912 -18.930 110.290 1.00 12.42 ? 331  TYR B CD2   1 
ATOM   5799 C  CE1   . TYR B 1 244 ? 160.486 -18.089 109.671 1.00 13.38 ? 331  TYR B CE1   1 
ATOM   5800 C  CE2   . TYR B 1 244 ? 158.161 -17.587 110.042 1.00 13.11 ? 331  TYR B CE2   1 
ATOM   5801 C  CZ    . TYR B 1 244 ? 159.457 -17.175 109.735 1.00 13.57 ? 331  TYR B CZ    1 
ATOM   5802 O  OH    . TYR B 1 244 ? 159.752 -15.844 109.493 1.00 16.37 ? 331  TYR B OH    1 
ATOM   5803 N  N     . LYS B 1 245 ? 160.251 -19.914 113.032 1.00 8.87  ? 332  LYS B N     1 
ATOM   5804 C  CA    . LYS B 1 245 ? 161.447 -19.161 113.411 1.00 10.42 ? 332  LYS B CA    1 
ATOM   5805 C  C     . LYS B 1 245 ? 162.255 -19.963 114.412 1.00 11.01 ? 332  LYS B C     1 
ATOM   5806 O  O     . LYS B 1 245 ? 163.487 -19.956 114.372 1.00 11.29 ? 332  LYS B O     1 
ATOM   5807 C  CB    . LYS B 1 245 ? 161.083 -17.804 114.008 1.00 12.54 ? 332  LYS B CB    1 
ATOM   5808 C  CG    . LYS B 1 245 ? 160.527 -16.811 112.999 1.00 16.27 ? 332  LYS B CG    1 
ATOM   5809 C  CD    . LYS B 1 245 ? 160.337 -15.468 113.681 1.00 19.65 ? 332  LYS B CD    1 
ATOM   5810 C  CE    . LYS B 1 245 ? 159.468 -14.531 112.857 1.00 22.58 ? 332  LYS B CE    1 
ATOM   5811 N  NZ    . LYS B 1 245 ? 159.512 -13.160 113.442 1.00 26.23 ? 332  LYS B NZ    1 
ATOM   5812 N  N     . ARG B 1 246 ? 161.561 -20.672 115.303 1.00 9.06  ? 333  ARG B N     1 
ATOM   5813 C  CA    . ARG B 1 246 ? 162.243 -21.565 116.234 1.00 10.23 ? 333  ARG B CA    1 
ATOM   5814 C  C     . ARG B 1 246 ? 162.997 -22.662 115.484 1.00 10.69 ? 333  ARG B C     1 
ATOM   5815 O  O     . ARG B 1 246 ? 164.162 -22.960 115.801 1.00 11.90 ? 333  ARG B O     1 
ATOM   5816 C  CB    . ARG B 1 246 ? 161.263 -22.214 117.225 1.00 9.01  ? 333  ARG B CB    1 
ATOM   5817 C  CG    . ARG B 1 246 ? 161.974 -23.116 118.234 1.00 8.77  ? 333  ARG B CG    1 
ATOM   5818 C  CD    . ARG B 1 246 ? 161.043 -23.695 119.309 1.00 8.31  ? 333  ARG B CD    1 
ATOM   5819 N  NE    . ARG B 1 246 ? 161.785 -24.645 120.149 1.00 8.08  ? 333  ARG B NE    1 
ATOM   5820 C  CZ    . ARG B 1 246 ? 162.478 -24.324 121.245 1.00 8.58  ? 333  ARG B CZ    1 
ATOM   5821 N  NH1   . ARG B 1 246 ? 162.528 -23.061 121.694 1.00 8.09  ? 333  ARG B NH1   1 
ATOM   5822 N  NH2   . ARG B 1 246 ? 163.128 -25.281 121.896 1.00 8.82  ? 333  ARG B NH2   1 
ATOM   5823 N  N     . PHE B 1 247 ? 162.335 -23.283 114.512 1.00 10.56 ? 334  PHE B N     1 
ATOM   5824 C  CA    . PHE B 1 247 ? 162.981 -24.326 113.722 1.00 11.59 ? 334  PHE B CA    1 
ATOM   5825 C  C     . PHE B 1 247 ? 164.264 -23.782 113.092 1.00 12.35 ? 334  PHE B C     1 
ATOM   5826 O  O     . PHE B 1 247 ? 165.313 -24.432 113.167 1.00 13.11 ? 334  PHE B O     1 
ATOM   5827 C  CB    . PHE B 1 247 ? 162.065 -24.889 112.625 1.00 11.82 ? 334  PHE B CB    1 
ATOM   5828 C  CG    . PHE B 1 247 ? 162.710 -25.991 111.823 1.00 12.63 ? 334  PHE B CG    1 
ATOM   5829 C  CD1   . PHE B 1 247 ? 163.579 -25.691 110.779 1.00 13.56 ? 334  PHE B CD1   1 
ATOM   5830 C  CD2   . PHE B 1 247 ? 162.499 -27.319 112.156 1.00 14.71 ? 334  PHE B CD2   1 
ATOM   5831 C  CE1   . PHE B 1 247 ? 164.197 -26.705 110.046 1.00 14.46 ? 334  PHE B CE1   1 
ATOM   5832 C  CE2   . PHE B 1 247 ? 163.115 -28.340 111.434 1.00 15.94 ? 334  PHE B CE2   1 
ATOM   5833 C  CZ    . PHE B 1 247 ? 163.966 -28.030 110.384 1.00 15.50 ? 334  PHE B CZ    1 
ATOM   5834 N  N     . ILE B 1 248 ? 164.175 -22.597 112.488 1.00 11.98 ? 335  ILE B N     1 
ATOM   5835 C  CA    . ILE B 1 248 ? 165.346 -21.975 111.846 1.00 14.02 ? 335  ILE B CA    1 
ATOM   5836 C  C     . ILE B 1 248 ? 166.484 -21.805 112.843 1.00 15.53 ? 335  ILE B C     1 
ATOM   5837 O  O     . ILE B 1 248 ? 167.627 -22.139 112.537 1.00 16.72 ? 335  ILE B O     1 
ATOM   5838 C  CB    . ILE B 1 248 ? 165.014 -20.648 111.141 1.00 14.37 ? 335  ILE B CB    1 
ATOM   5839 C  CG1   . ILE B 1 248 ? 164.176 -20.905 109.881 1.00 13.21 ? 335  ILE B CG1   1 
ATOM   5840 C  CG2   . ILE B 1 248 ? 166.313 -19.896 110.792 1.00 16.03 ? 335  ILE B CG2   1 
ATOM   5841 C  CD1   . ILE B 1 248 ? 163.784 -19.648 109.114 1.00 15.86 ? 335  ILE B CD1   1 
ATOM   5842 N  N     . LYS B 1 249 ? 166.169 -21.349 114.053 1.00 15.33 ? 336  LYS B N     1 
ATOM   5843 C  CA    . LYS B 1 249 ? 167.185 -21.190 115.093 1.00 17.37 ? 336  LYS B CA    1 
ATOM   5844 C  C     . LYS B 1 249 ? 167.915 -22.482 115.420 1.00 16.85 ? 336  LYS B C     1 
ATOM   5845 O  O     . LYS B 1 249 ? 169.098 -22.458 115.755 1.00 19.16 ? 336  LYS B O     1 
ATOM   5846 C  CB    . LYS B 1 249 ? 166.576 -20.637 116.387 1.00 19.14 ? 336  LYS B CB    1 
ATOM   5847 C  CG    . LYS B 1 249 ? 166.224 -19.167 116.301 1.00 22.56 ? 336  LYS B CG    1 
ATOM   5848 C  CD    . LYS B 1 249 ? 167.437 -18.309 116.594 1.00 24.85 ? 336  LYS B CD    1 
ATOM   5849 C  CE    . LYS B 1 249 ? 167.045 -16.847 116.647 1.00 26.63 ? 336  LYS B CE    1 
ATOM   5850 N  NZ    . LYS B 1 249 ? 167.063 -16.246 115.292 1.00 28.74 ? 336  LYS B NZ    1 
ATOM   5851 N  N     . PHE B 1 250 ? 167.207 -23.604 115.338 1.00 14.48 ? 337  PHE B N     1 
ATOM   5852 C  CA    . PHE B 1 250 ? 167.765 -24.887 115.710 1.00 15.33 ? 337  PHE B CA    1 
ATOM   5853 C  C     . PHE B 1 250 ? 168.247 -25.738 114.530 1.00 15.34 ? 337  PHE B C     1 
ATOM   5854 O  O     . PHE B 1 250 ? 168.707 -26.856 114.730 1.00 18.78 ? 337  PHE B O     1 
ATOM   5855 C  CB    . PHE B 1 250 ? 166.773 -25.646 116.606 1.00 15.32 ? 337  PHE B CB    1 
ATOM   5856 C  CG    . PHE B 1 250 ? 166.655 -25.056 117.986 1.00 16.49 ? 337  PHE B CG    1 
ATOM   5857 C  CD1   . PHE B 1 250 ? 167.574 -25.381 118.978 1.00 18.15 ? 337  PHE B CD1   1 
ATOM   5858 C  CD2   . PHE B 1 250 ? 165.654 -24.143 118.281 1.00 14.06 ? 337  PHE B CD2   1 
ATOM   5859 C  CE1   . PHE B 1 250 ? 167.476 -24.818 120.244 1.00 18.81 ? 337  PHE B CE1   1 
ATOM   5860 C  CE2   . PHE B 1 250 ? 165.555 -23.576 119.543 1.00 15.60 ? 337  PHE B CE2   1 
ATOM   5861 C  CZ    . PHE B 1 250 ? 166.456 -23.913 120.526 1.00 17.80 ? 337  PHE B CZ    1 
ATOM   5862 N  N     . ALA B 1 251 ? 168.170 -25.201 113.320 1.00 13.19 ? 338  ALA B N     1 
ATOM   5863 C  CA    . ALA B 1 251 ? 168.592 -25.932 112.127 1.00 13.70 ? 338  ALA B CA    1 
ATOM   5864 C  C     . ALA B 1 251 ? 170.105 -25.768 111.928 1.00 14.51 ? 338  ALA B C     1 
ATOM   5865 O  O     . ALA B 1 251 ? 170.657 -24.700 112.165 1.00 14.66 ? 338  ALA B O     1 
ATOM   5866 C  CB    . ALA B 1 251 ? 167.849 -25.450 110.899 1.00 13.89 ? 338  ALA B CB    1 
ATOM   5867 N  N     . ARG B 1 252 ? 170.754 -26.852 111.518 1.00 15.99 ? 339  ARG B N     1 
ATOM   5868 C  CA    . ARG B 1 252 ? 172.173 -26.834 111.149 1.00 16.89 ? 339  ARG B CA    1 
ATOM   5869 C  C     . ARG B 1 252 ? 172.339 -27.689 109.901 1.00 17.45 ? 339  ARG B C     1 
ATOM   5870 O  O     . ARG B 1 252 ? 171.361 -28.219 109.375 1.00 18.34 ? 339  ARG B O     1 
ATOM   5871 C  CB    . ARG B 1 252 ? 173.027 -27.418 112.284 1.00 18.06 ? 339  ARG B CB    1 
ATOM   5872 C  CG    . ARG B 1 252 ? 173.064 -26.587 113.559 1.00 19.74 ? 339  ARG B CG    1 
ATOM   5873 C  CD    . ARG B 1 252 ? 174.025 -27.180 114.584 1.00 21.69 ? 339  ARG B CD    1 
ATOM   5874 N  NE    . ARG B 1 252 ? 175.374 -27.345 114.038 1.00 23.05 ? 339  ARG B NE    1 
ATOM   5875 C  CZ    . ARG B 1 252 ? 176.295 -26.384 114.000 1.00 24.55 ? 339  ARG B CZ    1 
ATOM   5876 N  NH1   . ARG B 1 252 ? 177.489 -26.640 113.481 1.00 25.22 ? 339  ARG B NH1   1 
ATOM   5877 N  NH2   . ARG B 1 252 ? 176.036 -25.172 114.486 1.00 25.42 ? 339  ARG B NH2   1 
ATOM   5878 N  N     . VAL B 1 253 ? 173.577 -27.827 109.425 1.00 17.28 ? 340  VAL B N     1 
ATOM   5879 C  CA    . VAL B 1 253 ? 173.872 -28.736 108.309 1.00 16.62 ? 340  VAL B CA    1 
ATOM   5880 C  C     . VAL B 1 253 ? 174.848 -29.830 108.778 1.00 15.95 ? 340  VAL B C     1 
ATOM   5881 O  O     . VAL B 1 253 ? 175.849 -29.538 109.424 1.00 17.05 ? 340  VAL B O     1 
ATOM   5882 C  CB    . VAL B 1 253 ? 174.366 -27.981 107.055 1.00 17.42 ? 340  VAL B CB    1 
ATOM   5883 C  CG1   . VAL B 1 253 ? 174.750 -28.961 105.948 1.00 16.94 ? 340  VAL B CG1   1 
ATOM   5884 C  CG2   . VAL B 1 253 ? 173.273 -27.044 106.524 1.00 16.77 ? 340  VAL B CG2   1 
ATOM   5885 N  N     . CYS B 1 254 ? 174.513 -31.081 108.478 1.00 17.15 ? 341  CYS B N     1 
ATOM   5886 C  CA    . CYS B 1 254 ? 175.251 -32.244 108.958 1.00 18.74 ? 341  CYS B CA    1 
ATOM   5887 C  C     . CYS B 1 254 ? 175.595 -33.152 107.791 1.00 19.27 ? 341  CYS B C     1 
ATOM   5888 O  O     . CYS B 1 254 ? 174.835 -33.250 106.836 1.00 18.12 ? 341  CYS B O     1 
ATOM   5889 C  CB    . CYS B 1 254 ? 174.386 -33.045 109.934 1.00 18.55 ? 341  CYS B CB    1 
ATOM   5890 S  SG    . CYS B 1 254 ? 174.081 -32.249 111.526 1.00 19.60 ? 341  CYS B SG    1 
ATOM   5891 N  N     . GLU B 1 255 ? 176.727 -33.845 107.875 1.00 19.12 ? 342  GLU B N     1 
ATOM   5892 C  CA    . GLU B 1 255 ? 177.036 -34.827 106.854 1.00 20.82 ? 342  GLU B CA    1 
ATOM   5893 C  C     . GLU B 1 255 ? 176.156 -36.061 107.018 1.00 22.61 ? 342  GLU B C     1 
ATOM   5894 O  O     . GLU B 1 255 ? 176.077 -36.636 108.098 1.00 24.30 ? 342  GLU B O     1 
ATOM   5895 C  CB    . GLU B 1 255 ? 178.514 -35.219 106.920 1.00 24.99 ? 342  GLU B CB    1 
ATOM   5896 C  CG    . GLU B 1 255 ? 178.949 -36.120 105.777 1.00 28.70 ? 342  GLU B CG    1 
ATOM   5897 C  CD    . GLU B 1 255 ? 180.441 -36.394 105.770 1.00 32.44 ? 342  GLU B CD    1 
ATOM   5898 O  OE1   . GLU B 1 255 ? 181.137 -36.014 106.740 1.00 36.19 ? 342  GLU B OE1   1 
ATOM   5899 O  OE2   . GLU B 1 255 ? 180.917 -36.994 104.788 1.00 35.72 ? 342  GLU B OE2   1 
ATOM   5900 N  N     . VAL B 1 256 ? 175.487 -36.455 105.942 1.00 23.07 ? 343  VAL B N     1 
ATOM   5901 C  CA    . VAL B 1 256 ? 174.657 -37.666 105.929 1.00 27.37 ? 343  VAL B CA    1 
ATOM   5902 C  C     . VAL B 1 256 ? 174.834 -38.367 104.582 1.00 30.19 ? 343  VAL B C     1 
ATOM   5903 O  O     . VAL B 1 256 ? 174.483 -37.805 103.548 1.00 31.20 ? 343  VAL B O     1 
ATOM   5904 C  CB    . VAL B 1 256 ? 173.149 -37.347 106.090 1.00 27.43 ? 343  VAL B CB    1 
ATOM   5905 C  CG1   . VAL B 1 256 ? 172.336 -38.630 106.249 1.00 28.81 ? 343  VAL B CG1   1 
ATOM   5906 C  CG2   . VAL B 1 256 ? 172.901 -36.406 107.258 1.00 27.37 ? 343  VAL B CG2   1 
ATOM   5907 N  N     . ASP B 1 257 ? 175.363 -39.589 104.594 1.00 34.08 ? 344  ASP B N     1 
ATOM   5908 C  CA    . ASP B 1 257 ? 175.545 -40.383 103.359 1.00 36.30 ? 344  ASP B CA    1 
ATOM   5909 C  C     . ASP B 1 257 ? 176.156 -39.582 102.206 1.00 35.02 ? 344  ASP B C     1 
ATOM   5910 O  O     . ASP B 1 257 ? 175.546 -39.458 101.138 1.00 36.39 ? 344  ASP B O     1 
ATOM   5911 C  CB    . ASP B 1 257 ? 174.216 -41.003 102.896 1.00 40.26 ? 344  ASP B CB    1 
ATOM   5912 C  CG    . ASP B 1 257 ? 173.602 -41.929 103.927 1.00 42.79 ? 344  ASP B CG    1 
ATOM   5913 O  OD1   . ASP B 1 257 ? 174.308 -42.356 104.864 1.00 45.75 ? 344  ASP B OD1   1 
ATOM   5914 O  OD2   . ASP B 1 257 ? 172.399 -42.236 103.792 1.00 45.33 ? 344  ASP B OD2   1 
ATOM   5915 N  N     . ASN B 1 258 ? 177.348 -39.029 102.434 1.00 32.41 ? 345  ASN B N     1 
ATOM   5916 C  CA    . ASN B 1 258 ? 178.084 -38.269 101.407 1.00 32.59 ? 345  ASN B CA    1 
ATOM   5917 C  C     . ASN B 1 258 ? 177.423 -36.975 100.933 1.00 30.52 ? 345  ASN B C     1 
ATOM   5918 O  O     . ASN B 1 258 ? 177.793 -36.419 99.895  1.00 30.41 ? 345  ASN B O     1 
ATOM   5919 C  CB    . ASN B 1 258 ? 178.437 -39.156 100.202 1.00 35.51 ? 345  ASN B CB    1 
ATOM   5920 C  CG    . ASN B 1 258 ? 179.706 -39.953 100.419 1.00 37.28 ? 345  ASN B CG    1 
ATOM   5921 O  OD1   . ASN B 1 258 ? 180.103 -40.222 101.560 1.00 37.74 ? 345  ASN B OD1   1 
ATOM   5922 N  ND2   . ASN B 1 258 ? 180.355 -40.330 99.322  1.00 39.33 ? 345  ASN B ND2   1 
ATOM   5923 N  N     . GLU B 1 259 ? 176.445 -36.503 101.697 1.00 25.57 ? 346  GLU B N     1 
ATOM   5924 C  CA    . GLU B 1 259 ? 175.796 -35.238 101.404 1.00 24.19 ? 346  GLU B CA    1 
ATOM   5925 C  C     . GLU B 1 259 ? 175.893 -34.352 102.630 1.00 22.80 ? 346  GLU B C     1 
ATOM   5926 O  O     . GLU B 1 259 ? 176.103 -34.838 103.738 1.00 22.17 ? 346  GLU B O     1 
ATOM   5927 C  CB    . GLU B 1 259 ? 174.325 -35.456 101.071 1.00 24.86 ? 346  GLU B CB    1 
ATOM   5928 C  CG    . GLU B 1 259 ? 174.072 -36.066 99.714  1.00 25.68 ? 346  GLU B CG    1 
ATOM   5929 C  CD    . GLU B 1 259 ? 172.630 -36.475 99.545  1.00 27.53 ? 346  GLU B CD    1 
ATOM   5930 O  OE1   . GLU B 1 259 ? 171.729 -35.769 100.054 1.00 26.70 ? 346  GLU B OE1   1 
ATOM   5931 O  OE2   . GLU B 1 259 ? 172.397 -37.507 98.898  1.00 28.23 ? 346  GLU B OE2   1 
ATOM   5932 N  N     . LEU B 1 260 ? 175.769 -33.052 102.420 1.00 20.31 ? 347  LEU B N     1 
ATOM   5933 C  CA    . LEU B 1 260 ? 175.564 -32.134 103.522 1.00 20.60 ? 347  LEU B CA    1 
ATOM   5934 C  C     . LEU B 1 260 ? 174.071 -31.783 103.510 1.00 18.96 ? 347  LEU B C     1 
ATOM   5935 O  O     . LEU B 1 260 ? 173.582 -31.172 102.562 1.00 19.62 ? 347  LEU B O     1 
ATOM   5936 C  CB    . LEU B 1 260 ? 176.443 -30.901 103.363 1.00 20.31 ? 347  LEU B CB    1 
ATOM   5937 C  CG    . LEU B 1 260 ? 177.934 -31.123 103.660 1.00 20.87 ? 347  LEU B CG    1 
ATOM   5938 C  CD1   . LEU B 1 260 ? 178.674 -29.805 103.532 1.00 21.77 ? 347  LEU B CD1   1 
ATOM   5939 C  CD2   . LEU B 1 260 ? 178.129 -31.726 105.044 1.00 21.06 ? 347  LEU B CD2   1 
ATOM   5940 N  N     . ARG B 1 261 ? 173.360 -32.196 104.551 1.00 18.87 ? 348  ARG B N     1 
ATOM   5941 C  CA    . ARG B 1 261 ? 171.909 -32.065 104.594 1.00 18.21 ? 348  ARG B CA    1 
ATOM   5942 C  C     . ARG B 1 261 ? 171.471 -31.236 105.790 1.00 16.71 ? 348  ARG B C     1 
ATOM   5943 O  O     . ARG B 1 261 ? 172.239 -31.061 106.728 1.00 16.05 ? 348  ARG B O     1 
ATOM   5944 C  CB    . ARG B 1 261 ? 171.277 -33.439 104.703 1.00 20.17 ? 348  ARG B CB    1 
ATOM   5945 C  CG    . ARG B 1 261 ? 171.346 -34.272 103.443 1.00 21.81 ? 348  ARG B CG    1 
ATOM   5946 C  CD    . ARG B 1 261 ? 170.574 -35.547 103.688 1.00 24.35 ? 348  ARG B CD    1 
ATOM   5947 N  NE    . ARG B 1 261 ? 170.822 -36.573 102.683 1.00 28.16 ? 348  ARG B NE    1 
ATOM   5948 C  CZ    . ARG B 1 261 ? 170.434 -37.840 102.815 1.00 29.47 ? 348  ARG B CZ    1 
ATOM   5949 N  NH1   . ARG B 1 261 ? 169.785 -38.230 103.910 1.00 28.20 ? 348  ARG B NH1   1 
ATOM   5950 N  NH2   . ARG B 1 261 ? 170.696 -38.720 101.856 1.00 31.10 ? 348  ARG B NH2   1 
ATOM   5951 N  N     . ILE B 1 262 ? 170.232 -30.739 105.766 1.00 14.22 ? 349  ILE B N     1 
ATOM   5952 C  CA    . ILE B 1 262 ? 169.715 -30.037 106.941 1.00 13.84 ? 349  ILE B CA    1 
ATOM   5953 C  C     . ILE B 1 262 ? 169.503 -31.015 108.094 1.00 13.54 ? 349  ILE B C     1 
ATOM   5954 O  O     . ILE B 1 262 ? 169.003 -32.142 107.896 1.00 14.33 ? 349  ILE B O     1 
ATOM   5955 C  CB    . ILE B 1 262 ? 168.443 -29.219 106.604 1.00 13.57 ? 349  ILE B CB    1 
ATOM   5956 C  CG1   . ILE B 1 262 ? 168.856 -28.034 105.715 1.00 14.00 ? 349  ILE B CG1   1 
ATOM   5957 C  CG2   . ILE B 1 262 ? 167.776 -28.694 107.876 1.00 14.75 ? 349  ILE B CG2   1 
ATOM   5958 C  CD1   . ILE B 1 262 ? 167.709 -27.268 105.070 1.00 15.62 ? 349  ILE B CD1   1 
ATOM   5959 N  N     . CYS B 1 263 ? 169.924 -30.602 109.285 1.00 13.54 ? 350  CYS B N     1 
ATOM   5960 C  CA    . CYS B 1 263 ? 169.707 -31.412 110.491 1.00 14.61 ? 350  CYS B CA    1 
ATOM   5961 C  C     . CYS B 1 263 ? 169.106 -30.546 111.601 1.00 14.14 ? 350  CYS B C     1 
ATOM   5962 O  O     . CYS B 1 263 ? 169.574 -29.434 111.850 1.00 14.94 ? 350  CYS B O     1 
ATOM   5963 C  CB    . CYS B 1 263 ? 171.006 -32.123 110.956 1.00 17.58 ? 350  CYS B CB    1 
ATOM   5964 S  SG    . CYS B 1 263 ? 172.448 -31.033 111.151 1.00 21.07 ? 350  CYS B SG    1 
ATOM   5965 N  N     . ALA B 1 264 ? 168.065 -31.067 112.244 1.00 13.47 ? 351  ALA B N     1 
ATOM   5966 C  CA    . ALA B 1 264 ? 167.341 -30.340 113.299 1.00 13.84 ? 351  ALA B CA    1 
ATOM   5967 C  C     . ALA B 1 264 ? 167.822 -30.800 114.665 1.00 13.59 ? 351  ALA B C     1 
ATOM   5968 O  O     . ALA B 1 264 ? 168.160 -31.958 114.833 1.00 12.23 ? 351  ALA B O     1 
ATOM   5969 C  CB    . ALA B 1 264 ? 165.850 -30.608 113.172 1.00 13.07 ? 351  ALA B CB    1 
ATOM   5970 N  N     . ARG B 1 265 ? 167.817 -29.908 115.650 1.00 12.96 ? 352  ARG B N     1 
ATOM   5971 C  CA    . ARG B 1 265 ? 168.123 -30.305 117.025 1.00 13.76 ? 352  ARG B CA    1 
ATOM   5972 C  C     . ARG B 1 265 ? 167.197 -31.446 117.497 1.00 12.90 ? 352  ARG B C     1 
ATOM   5973 O  O     . ARG B 1 265 ? 165.989 -31.413 117.239 1.00 12.24 ? 352  ARG B O     1 
ATOM   5974 C  CB    . ARG B 1 265 ? 168.019 -29.082 117.934 1.00 13.93 ? 352  ARG B CB    1 
ATOM   5975 C  CG    . ARG B 1 265 ? 168.290 -29.339 119.396 1.00 16.14 ? 352  ARG B CG    1 
ATOM   5976 C  CD    . ARG B 1 265 ? 169.738 -29.727 119.737 1.00 15.95 ? 352  ARG B CD    1 
ATOM   5977 N  NE    . ARG B 1 265 ? 169.674 -30.281 121.078 1.00 16.52 ? 352  ARG B NE    1 
ATOM   5978 C  CZ    . ARG B 1 265 ? 169.676 -29.546 122.183 1.00 15.38 ? 352  ARG B CZ    1 
ATOM   5979 N  NH1   . ARG B 1 265 ? 169.842 -28.231 122.099 1.00 14.76 ? 352  ARG B NH1   1 
ATOM   5980 N  NH2   . ARG B 1 265 ? 169.552 -30.126 123.357 1.00 16.51 ? 352  ARG B NH2   1 
ATOM   5981 N  N     . ASP B 1 266 ? 167.762 -32.436 118.197 1.00 11.61 ? 353  ASP B N     1 
ATOM   5982 C  CA    . ASP B 1 266 ? 167.016 -33.632 118.603 1.00 13.23 ? 353  ASP B CA    1 
ATOM   5983 C  C     . ASP B 1 266 ? 165.695 -33.307 119.311 1.00 14.27 ? 353  ASP B C     1 
ATOM   5984 O  O     . ASP B 1 266 ? 164.660 -33.892 119.001 1.00 13.51 ? 353  ASP B O     1 
ATOM   5985 C  CB    . ASP B 1 266 ? 167.855 -34.583 119.480 1.00 13.40 ? 353  ASP B CB    1 
ATOM   5986 C  CG    . ASP B 1 266 ? 168.530 -33.885 120.681 1.00 15.51 ? 353  ASP B CG    1 
ATOM   5987 O  OD1   . ASP B 1 266 ? 168.303 -32.689 120.947 1.00 14.70 ? 353  ASP B OD1   1 
ATOM   5988 O  OD2   . ASP B 1 266 ? 169.330 -34.556 121.352 1.00 18.60 ? 353  ASP B OD2   1 
ATOM   5989 N  N     . LYS B 1 267 ? 165.738 -32.343 120.215 1.00 16.07 ? 354  LYS B N     1 
ATOM   5990 C  CA    . LYS B 1 267 ? 164.589 -32.045 121.062 1.00 17.47 ? 354  LYS B CA    1 
ATOM   5991 C  C     . LYS B 1 267 ? 163.480 -31.328 120.305 1.00 16.87 ? 354  LYS B C     1 
ATOM   5992 O  O     . LYS B 1 267 ? 162.402 -31.105 120.868 1.00 18.64 ? 354  LYS B O     1 
ATOM   5993 C  CB    . LYS B 1 267 ? 165.023 -31.208 122.259 1.00 19.14 ? 354  LYS B CB    1 
ATOM   5994 C  CG    . LYS B 1 267 ? 165.484 -29.842 121.857 1.00 19.04 ? 354  LYS B CG    1 
ATOM   5995 C  CD    . LYS B 1 267 ? 165.820 -29.007 123.076 1.00 23.25 ? 354  LYS B CD    1 
ATOM   5996 C  CE    . LYS B 1 267 ? 165.612 -27.553 122.725 1.00 22.25 ? 354  LYS B CE    1 
ATOM   5997 N  NZ    . LYS B 1 267 ? 166.867 -26.853 122.305 1.00 27.02 ? 354  LYS B NZ    1 
ATOM   5998 N  N     . GLU B 1 268 ? 163.746 -30.962 119.050 1.00 14.15 ? 355  GLU B N     1 
ATOM   5999 C  CA    . GLU B 1 268 ? 162.714 -30.413 118.167 1.00 13.42 ? 355  GLU B CA    1 
ATOM   6000 C  C     . GLU B 1 268 ? 161.807 -31.483 117.575 1.00 11.05 ? 355  GLU B C     1 
ATOM   6001 O  O     . GLU B 1 268 ? 160.856 -31.152 116.871 1.00 9.47  ? 355  GLU B O     1 
ATOM   6002 C  CB    . GLU B 1 268 ? 163.324 -29.620 117.011 1.00 15.18 ? 355  GLU B CB    1 
ATOM   6003 C  CG    . GLU B 1 268 ? 163.840 -28.252 117.412 1.00 19.05 ? 355  GLU B CG    1 
ATOM   6004 C  CD    . GLU B 1 268 ? 162.719 -27.364 117.950 1.00 20.94 ? 355  GLU B CD    1 
ATOM   6005 O  OE1   . GLU B 1 268 ? 162.730 -27.123 119.164 1.00 22.79 ? 355  GLU B OE1   1 
ATOM   6006 O  OE2   . GLU B 1 268 ? 161.833 -26.955 117.157 1.00 25.88 ? 355  GLU B OE2   1 
ATOM   6007 N  N     . VAL B 1 269 ? 162.097 -32.763 117.833 1.00 9.02  ? 356  VAL B N     1 
ATOM   6008 C  CA    . VAL B 1 269 ? 161.316 -33.823 117.188 1.00 8.22  ? 356  VAL B CA    1 
ATOM   6009 C  C     . VAL B 1 269 ? 159.806 -33.738 117.465 1.00 7.55  ? 356  VAL B C     1 
ATOM   6010 O  O     . VAL B 1 269 ? 158.990 -33.935 116.550 1.00 6.71  ? 356  VAL B O     1 
ATOM   6011 C  CB    . VAL B 1 269 ? 161.900 -35.236 117.492 1.00 7.91  ? 356  VAL B CB    1 
ATOM   6012 C  CG1   . VAL B 1 269 ? 161.882 -35.538 118.998 1.00 7.55  ? 356  VAL B CG1   1 
ATOM   6013 C  CG2   . VAL B 1 269 ? 161.205 -36.333 116.674 1.00 7.82  ? 356  VAL B CG2   1 
ATOM   6014 N  N     . GLY B 1 270 ? 159.435 -33.452 118.713 1.00 7.03  ? 357  GLY B N     1 
ATOM   6015 C  CA    . GLY B 1 270 ? 158.016 -33.238 119.061 1.00 7.46  ? 357  GLY B CA    1 
ATOM   6016 C  C     . GLY B 1 270 ? 157.365 -32.131 118.242 1.00 6.95  ? 357  GLY B C     1 
ATOM   6017 O  O     . GLY B 1 270 ? 156.231 -32.284 117.742 1.00 7.40  ? 357  GLY B O     1 
ATOM   6018 N  N     . ASN B 1 271 ? 158.082 -31.031 118.065 1.00 6.93  ? 358  ASN B N     1 
ATOM   6019 C  CA    . ASN B 1 271 ? 157.583 -29.923 117.264 1.00 7.26  ? 358  ASN B CA    1 
ATOM   6020 C  C     . ASN B 1 271 ? 157.402 -30.330 115.800 1.00 7.00  ? 358  ASN B C     1 
ATOM   6021 O  O     . ASN B 1 271 ? 156.532 -29.795 115.105 1.00 6.37  ? 358  ASN B O     1 
ATOM   6022 C  CB    . ASN B 1 271 ? 158.509 -28.692 117.350 1.00 6.86  ? 358  ASN B CB    1 
ATOM   6023 C  CG    . ASN B 1 271 ? 158.444 -28.006 118.702 1.00 9.68  ? 358  ASN B CG    1 
ATOM   6024 O  OD1   . ASN B 1 271 ? 157.475 -28.166 119.461 1.00 10.70 ? 358  ASN B OD1   1 
ATOM   6025 N  ND2   . ASN B 1 271 ? 159.472 -27.221 119.009 1.00 11.14 ? 358  ASN B ND2   1 
ATOM   6026 N  N     . LEU B 1 272 ? 158.243 -31.255 115.313 1.00 7.22  ? 359  LEU B N     1 
ATOM   6027 C  CA    . LEU B 1 272 ? 158.118 -31.675 113.904 1.00 7.79  ? 359  LEU B CA    1 
ATOM   6028 C  C     . LEU B 1 272 ? 156.927 -32.590 113.697 1.00 7.45  ? 359  LEU B C     1 
ATOM   6029 O  O     . LEU B 1 272 ? 156.213 -32.450 112.716 1.00 6.66  ? 359  LEU B O     1 
ATOM   6030 C  CB    . LEU B 1 272 ? 159.385 -32.354 113.388 1.00 8.69  ? 359  LEU B CB    1 
ATOM   6031 C  CG    . LEU B 1 272 ? 160.589 -31.406 113.310 1.00 10.18 ? 359  LEU B CG    1 
ATOM   6032 C  CD1   . LEU B 1 272 ? 161.767 -32.154 112.681 1.00 10.92 ? 359  LEU B CD1   1 
ATOM   6033 C  CD2   . LEU B 1 272 ? 160.249 -30.165 112.494 1.00 11.81 ? 359  LEU B CD2   1 
ATOM   6034 N  N     . TYR B 1 273 ? 156.712 -33.520 114.628 1.00 7.55  ? 360  TYR B N     1 
ATOM   6035 C  CA    . TYR B 1 273 ? 155.458 -34.275 114.610 1.00 8.79  ? 360  TYR B CA    1 
ATOM   6036 C  C     . TYR B 1 273 ? 154.257 -33.310 114.623 1.00 9.22  ? 360  TYR B C     1 
ATOM   6037 O  O     . TYR B 1 273 ? 153.296 -33.492 113.851 1.00 9.03  ? 360  TYR B O     1 
ATOM   6038 C  CB    . TYR B 1 273 ? 155.377 -35.291 115.756 1.00 8.51  ? 360  TYR B CB    1 
ATOM   6039 C  CG    . TYR B 1 273 ? 156.047 -36.607 115.438 1.00 9.04  ? 360  TYR B CG    1 
ATOM   6040 C  CD1   . TYR B 1 273 ? 155.419 -37.561 114.634 1.00 9.54  ? 360  TYR B CD1   1 
ATOM   6041 C  CD2   . TYR B 1 273 ? 157.318 -36.897 115.932 1.00 9.19  ? 360  TYR B CD2   1 
ATOM   6042 C  CE1   . TYR B 1 273 ? 156.042 -38.772 114.335 1.00 9.89  ? 360  TYR B CE1   1 
ATOM   6043 C  CE2   . TYR B 1 273 ? 157.953 -38.092 115.640 1.00 10.06 ? 360  TYR B CE2   1 
ATOM   6044 C  CZ    . TYR B 1 273 ? 157.314 -39.027 114.840 1.00 10.33 ? 360  TYR B CZ    1 
ATOM   6045 O  OH    . TYR B 1 273 ? 157.960 -40.216 114.547 1.00 11.74 ? 360  TYR B OH    1 
ATOM   6046 N  N     . ASP B 1 274 ? 154.311 -32.298 115.489 1.00 9.62  ? 361  ASP B N     1 
ATOM   6047 C  CA    . ASP B 1 274 ? 153.218 -31.303 115.569 1.00 9.53  ? 361  ASP B CA    1 
ATOM   6048 C  C     . ASP B 1 274 ? 153.054 -30.469 114.283 1.00 8.76  ? 361  ASP B C     1 
ATOM   6049 O  O     . ASP B 1 274 ? 151.947 -30.037 113.960 1.00 8.15  ? 361  ASP B O     1 
ATOM   6050 C  CB    . ASP B 1 274 ? 153.371 -30.372 116.785 1.00 9.71  ? 361  ASP B CB    1 
ATOM   6051 C  CG    . ASP B 1 274 ? 152.837 -30.996 118.085 1.00 14.20 ? 361  ASP B CG    1 
ATOM   6052 O  OD1   . ASP B 1 274 ? 152.210 -32.070 118.024 1.00 17.01 ? 361  ASP B OD1   1 
ATOM   6053 O  OD2   . ASP B 1 274 ? 153.027 -30.395 119.168 1.00 17.42 ? 361  ASP B OD2   1 
ATOM   6054 N  N     . MET B 1 275 ? 154.148 -30.218 113.568 1.00 8.03  ? 362  MET B N     1 
ATOM   6055 C  CA    . MET B 1 275 ? 154.062 -29.514 112.270 1.00 7.59  ? 362  MET B CA    1 
ATOM   6056 C  C     . MET B 1 275 ? 153.155 -30.271 111.297 1.00 7.23  ? 362  MET B C     1 
ATOM   6057 O  O     . MET B 1 275 ? 152.336 -29.669 110.600 1.00 6.62  ? 362  MET B O     1 
ATOM   6058 C  CB    . MET B 1 275 ? 155.451 -29.354 111.631 1.00 8.34  ? 362  MET B CB    1 
ATOM   6059 C  CG    . MET B 1 275 ? 155.464 -28.351 110.480 1.00 9.28  ? 362  MET B CG    1 
ATOM   6060 S  SD    . MET B 1 275 ? 156.901 -28.492 109.381 1.00 11.50 ? 362  MET B SD    1 
ATOM   6061 C  CE    . MET B 1 275 ? 156.385 -29.897 108.386 1.00 10.63 ? 362  MET B CE    1 
ATOM   6062 N  N     . PHE B 1 276 ? 153.316 -31.593 111.233 1.00 7.08  ? 363  PHE B N     1 
ATOM   6063 C  CA    . PHE B 1 276 ? 152.507 -32.392 110.294 1.00 7.31  ? 363  PHE B CA    1 
ATOM   6064 C  C     . PHE B 1 276 ? 151.110 -32.545 110.841 1.00 7.26  ? 363  PHE B C     1 
ATOM   6065 O  O     . PHE B 1 276 ? 150.134 -32.613 110.091 1.00 6.52  ? 363  PHE B O     1 
ATOM   6066 C  CB    . PHE B 1 276 ? 153.160 -33.743 110.028 1.00 7.32  ? 363  PHE B CB    1 
ATOM   6067 C  CG    . PHE B 1 276 ? 154.365 -33.629 109.146 1.00 7.10  ? 363  PHE B CG    1 
ATOM   6068 C  CD1   . PHE B 1 276 ? 154.204 -33.492 107.765 1.00 7.93  ? 363  PHE B CD1   1 
ATOM   6069 C  CD2   . PHE B 1 276 ? 155.645 -33.602 109.696 1.00 7.47  ? 363  PHE B CD2   1 
ATOM   6070 C  CE1   . PHE B 1 276 ? 155.303 -33.327 106.944 1.00 8.66  ? 363  PHE B CE1   1 
ATOM   6071 C  CE2   . PHE B 1 276 ? 156.770 -33.441 108.863 1.00 8.55  ? 363  PHE B CE2   1 
ATOM   6072 C  CZ    . PHE B 1 276 ? 156.581 -33.311 107.496 1.00 8.51  ? 363  PHE B CZ    1 
ATOM   6073 N  N     . HIS B 1 277 ? 151.004 -32.560 112.164 1.00 8.02  ? 364  HIS B N     1 
ATOM   6074 C  CA    . HIS B 1 277 ? 149.670 -32.527 112.777 1.00 9.07  ? 364  HIS B CA    1 
ATOM   6075 C  C     . HIS B 1 277 ? 148.943 -31.246 112.415 1.00 8.72  ? 364  HIS B C     1 
ATOM   6076 O  O     . HIS B 1 277 ? 147.781 -31.277 112.004 1.00 8.78  ? 364  HIS B O     1 
ATOM   6077 C  CB    . HIS B 1 277 ? 149.761 -32.723 114.290 1.00 10.56 ? 364  HIS B CB    1 
ATOM   6078 C  CG    . HIS B 1 277 ? 148.421 -32.755 114.966 1.00 13.22 ? 364  HIS B CG    1 
ATOM   6079 N  ND1   . HIS B 1 277 ? 147.853 -33.898 115.390 1.00 15.48 ? 364  HIS B ND1   1 
ATOM   6080 C  CD2   . HIS B 1 277 ? 147.542 -31.739 115.278 1.00 13.47 ? 364  HIS B CD2   1 
ATOM   6081 C  CE1   . HIS B 1 277 ? 146.647 -33.611 115.934 1.00 14.61 ? 364  HIS B CE1   1 
ATOM   6082 N  NE2   . HIS B 1 277 ? 146.468 -32.291 115.858 1.00 14.94 ? 364  HIS B NE2   1 
ATOM   6083 N  N     . THR B 1 278 ? 149.633 -30.115 112.482 1.00 7.44  ? 365  THR B N     1 
ATOM   6084 C  CA    . THR B 1 278 ? 149.049 -28.832 112.043 1.00 8.22  ? 365  THR B CA    1 
ATOM   6085 C  C     . THR B 1 278 ? 148.579 -28.866 110.591 1.00 7.24  ? 365  THR B C     1 
ATOM   6086 O  O     . THR B 1 278 ? 147.484 -28.398 110.275 1.00 7.49  ? 365  THR B O     1 
ATOM   6087 C  CB    . THR B 1 278 ? 150.080 -27.716 112.173 1.00 8.76  ? 365  THR B CB    1 
ATOM   6088 O  OG1   . THR B 1 278 ? 150.371 -27.533 113.559 1.00 9.69  ? 365  THR B OG1   1 
ATOM   6089 C  CG2   . THR B 1 278 ? 149.558 -26.393 111.549 1.00 8.84  ? 365  THR B CG2   1 
ATOM   6090 N  N     . ARG B 1 279 ? 149.430 -29.381 109.703 1.00 6.41  ? 366  ARG B N     1 
ATOM   6091 C  CA    . ARG B 1 279 ? 149.079 -29.487 108.284 1.00 6.82  ? 366  ARG B CA    1 
ATOM   6092 C  C     . ARG B 1 279 ? 147.791 -30.294 108.123 1.00 7.16  ? 366  ARG B C     1 
ATOM   6093 O  O     . ARG B 1 279 ? 146.877 -29.865 107.417 1.00 6.36  ? 366  ARG B O     1 
ATOM   6094 C  CB    . ARG B 1 279 ? 150.216 -30.146 107.512 1.00 7.23  ? 366  ARG B CB    1 
ATOM   6095 C  CG    . ARG B 1 279 ? 149.919 -30.356 106.025 1.00 8.08  ? 366  ARG B CG    1 
ATOM   6096 C  CD    . ARG B 1 279 ? 151.144 -30.960 105.367 1.00 9.98  ? 366  ARG B CD    1 
ATOM   6097 N  NE    . ARG B 1 279 ? 150.876 -31.305 103.976 1.00 11.33 ? 366  ARG B NE    1 
ATOM   6098 C  CZ    . ARG B 1 279 ? 150.351 -32.466 103.585 1.00 13.20 ? 366  ARG B CZ    1 
ATOM   6099 N  NH1   . ARG B 1 279 ? 150.040 -33.403 104.473 1.00 14.74 ? 366  ARG B NH1   1 
ATOM   6100 N  NH2   . ARG B 1 279 ? 150.140 -32.693 102.296 1.00 13.60 ? 366  ARG B NH2   1 
ATOM   6101 N  N     . ASN B 1 280 ? 147.709 -31.431 108.813 1.00 6.63  ? 367  ASN B N     1 
ATOM   6102 C  CA    . ASN B 1 280 ? 146.504 -32.278 108.747 1.00 8.01  ? 367  ASN B CA    1 
ATOM   6103 C  C     . ASN B 1 280 ? 145.262 -31.555 109.309 1.00 7.40  ? 367  ASN B C     1 
ATOM   6104 O  O     . ASN B 1 280 ? 144.155 -31.649 108.735 1.00 6.80  ? 367  ASN B O     1 
ATOM   6105 C  CB    . ASN B 1 280 ? 146.753 -33.598 109.486 1.00 9.75  ? 367  ASN B CB    1 
ATOM   6106 C  CG    . ASN B 1 280 ? 145.597 -34.572 109.352 1.00 12.45 ? 367  ASN B CG    1 
ATOM   6107 O  OD1   . ASN B 1 280 ? 145.373 -35.145 108.284 1.00 15.22 ? 367  ASN B OD1   1 
ATOM   6108 N  ND2   . ASN B 1 280 ? 144.846 -34.750 110.433 1.00 13.97 ? 367  ASN B ND2   1 
ATOM   6109 N  N     . SER B 1 281 ? 145.455 -30.793 110.380 1.00 8.05  ? 368  SER B N     1 
ATOM   6110 C  CA    . SER B 1 281 ? 144.340 -30.000 110.961 1.00 8.57  ? 368  SER B CA    1 
ATOM   6111 C  C     . SER B 1 281 ? 143.849 -28.934 109.994 1.00 7.85  ? 368  SER B C     1 
ATOM   6112 O  O     . SER B 1 281 ? 142.634 -28.696 109.899 1.00 7.90  ? 368  SER B O     1 
ATOM   6113 C  CB    . SER B 1 281 ? 144.714 -29.354 112.292 1.00 10.52 ? 368  SER B CB    1 
ATOM   6114 O  OG    . SER B 1 281 ? 145.007 -30.355 113.248 1.00 15.15 ? 368  SER B OG    1 
ATOM   6115 N  N     . LEU B 1 282 ? 144.777 -28.300 109.285 1.00 6.56  ? 369  LEU B N     1 
ATOM   6116 C  CA    . LEU B 1 282 ? 144.405 -27.245 108.314 1.00 7.37  ? 369  LEU B CA    1 
ATOM   6117 C  C     . LEU B 1 282 ? 143.645 -27.860 107.137 1.00 7.67  ? 369  LEU B C     1 
ATOM   6118 O  O     . LEU B 1 282 ? 142.677 -27.285 106.651 1.00 6.59  ? 369  LEU B O     1 
ATOM   6119 C  CB    . LEU B 1 282 ? 145.630 -26.451 107.852 1.00 7.68  ? 369  LEU B CB    1 
ATOM   6120 C  CG    . LEU B 1 282 ? 146.287 -25.610 108.969 1.00 9.50  ? 369  LEU B CG    1 
ATOM   6121 C  CD1   . LEU B 1 282 ? 147.534 -24.901 108.470 1.00 9.67  ? 369  LEU B CD1   1 
ATOM   6122 C  CD2   . LEU B 1 282 ? 145.296 -24.601 109.547 1.00 10.55 ? 369  LEU B CD2   1 
ATOM   6123 N  N     . HIS B 1 283 ? 144.073 -29.045 106.688 1.00 7.63  ? 370  HIS B N     1 
ATOM   6124 C  CA    . HIS B 1 283 ? 143.295 -29.783 105.692 1.00 8.42  ? 370  HIS B CA    1 
ATOM   6125 C  C     . HIS B 1 283 ? 141.924 -30.164 106.203 1.00 8.87  ? 370  HIS B C     1 
ATOM   6126 O  O     . HIS B 1 283 ? 140.925 -29.987 105.503 1.00 8.48  ? 370  HIS B O     1 
ATOM   6127 C  CB    . HIS B 1 283 ? 144.064 -31.014 105.199 1.00 8.60  ? 370  HIS B CB    1 
ATOM   6128 C  CG    . HIS B 1 283 ? 145.022 -30.690 104.099 1.00 9.05  ? 370  HIS B CG    1 
ATOM   6129 N  ND1   . HIS B 1 283 ? 144.636 -30.602 102.809 1.00 9.94  ? 370  HIS B ND1   1 
ATOM   6130 C  CD2   . HIS B 1 283 ? 146.366 -30.333 104.137 1.00 9.35  ? 370  HIS B CD2   1 
ATOM   6131 C  CE1   . HIS B 1 283 ? 145.691 -30.253 102.053 1.00 10.20 ? 370  HIS B CE1   1 
ATOM   6132 N  NE2   . HIS B 1 283 ? 146.754 -30.102 102.864 1.00 9.56  ? 370  HIS B NE2   1 
ATOM   6133 N  N     . ARG B 1 284 ? 141.839 -30.663 107.437 1.00 8.86  ? 371  ARG B N     1 
ATOM   6134 C  CA    . ARG B 1 284 ? 140.536 -31.038 107.988 1.00 10.74 ? 371  ARG B CA    1 
ATOM   6135 C  C     . ARG B 1 284 ? 139.599 -29.847 108.190 1.00 9.71  ? 371  ARG B C     1 
ATOM   6136 O  O     . ARG B 1 284 ? 138.418 -29.907 107.846 1.00 9.47  ? 371  ARG B O     1 
ATOM   6137 C  CB    . ARG B 1 284 ? 140.698 -31.770 109.327 1.00 13.02 ? 371  ARG B CB    1 
ATOM   6138 C  CG    . ARG B 1 284 ? 141.262 -33.189 109.202 1.00 17.37 ? 371  ARG B CG    1 
ATOM   6139 C  CD    . ARG B 1 284 ? 140.173 -34.126 108.684 1.00 21.06 ? 371  ARG B CD    1 
ATOM   6140 N  NE    . ARG B 1 284 ? 140.475 -35.546 108.854 1.00 24.90 ? 371  ARG B NE    1 
ATOM   6141 C  CZ    . ARG B 1 284 ? 139.566 -36.443 109.224 1.00 25.98 ? 371  ARG B CZ    1 
ATOM   6142 N  NH1   . ARG B 1 284 ? 138.323 -36.047 109.479 1.00 25.41 ? 371  ARG B NH1   1 
ATOM   6143 N  NH2   . ARG B 1 284 ? 139.897 -37.729 109.353 1.00 25.57 ? 371  ARG B NH2   1 
ATOM   6144 N  N     . ARG B 1 285 ? 140.117 -28.764 108.751 1.00 8.85  ? 372  ARG B N     1 
ATOM   6145 C  CA    . ARG B 1 285 ? 139.243 -27.616 109.064 1.00 8.93  ? 372  ARG B CA    1 
ATOM   6146 C  C     . ARG B 1 285 ? 138.866 -26.786 107.852 1.00 8.96  ? 372  ARG B C     1 
ATOM   6147 O  O     . ARG B 1 285 ? 137.726 -26.333 107.731 1.00 9.42  ? 372  ARG B O     1 
ATOM   6148 C  CB    . ARG B 1 285 ? 139.904 -26.708 110.091 1.00 9.45  ? 372  ARG B CB    1 
ATOM   6149 C  CG    . ARG B 1 285 ? 140.094 -27.387 111.418 1.00 11.18 ? 372  ARG B CG    1 
ATOM   6150 C  CD    . ARG B 1 285 ? 140.707 -26.436 112.407 1.00 13.40 ? 372  ARG B CD    1 
ATOM   6151 N  NE    . ARG B 1 285 ? 141.062 -27.166 113.605 1.00 17.72 ? 372  ARG B NE    1 
ATOM   6152 C  CZ    . ARG B 1 285 ? 141.721 -26.631 114.620 1.00 20.05 ? 372  ARG B CZ    1 
ATOM   6153 N  NH1   . ARG B 1 285 ? 142.089 -25.353 114.556 1.00 22.13 ? 372  ARG B NH1   1 
ATOM   6154 N  NH2   . ARG B 1 285 ? 142.010 -27.372 115.685 1.00 21.27 ? 372  ARG B NH2   1 
ATOM   6155 N  N     . ALA B 1 286 ? 139.833 -26.582 106.958 1.00 7.48  ? 373  ALA B N     1 
ATOM   6156 C  CA    . ALA B 1 286 ? 139.683 -25.582 105.902 1.00 6.93  ? 373  ALA B CA    1 
ATOM   6157 C  C     . ALA B 1 286 ? 139.841 -26.131 104.476 1.00 6.87  ? 373  ALA B C     1 
ATOM   6158 O  O     . ALA B 1 286 ? 138.893 -26.046 103.678 1.00 6.43  ? 373  ALA B O     1 
ATOM   6159 C  CB    . ALA B 1 286 ? 140.643 -24.414 106.151 1.00 6.59  ? 373  ALA B CB    1 
ATOM   6160 N  N     . TYR B 1 287 ? 141.002 -26.706 104.148 1.00 6.44  ? 374  TYR B N     1 
ATOM   6161 C  CA    . TYR B 1 287 ? 141.291 -26.997 102.736 1.00 6.30  ? 374  TYR B CA    1 
ATOM   6162 C  C     . TYR B 1 287 ? 140.367 -28.065 102.168 1.00 6.86  ? 374  TYR B C     1 
ATOM   6163 O  O     . TYR B 1 287 ? 140.021 -28.024 100.981 1.00 7.68  ? 374  TYR B O     1 
ATOM   6164 C  CB    . TYR B 1 287 ? 142.745 -27.420 102.496 1.00 6.02  ? 374  TYR B CB    1 
ATOM   6165 C  CG    . TYR B 1 287 ? 143.801 -26.527 103.143 1.00 5.65  ? 374  TYR B CG    1 
ATOM   6166 C  CD1   . TYR B 1 287 ? 143.645 -25.151 103.208 1.00 5.21  ? 374  TYR B CD1   1 
ATOM   6167 C  CD2   . TYR B 1 287 ? 144.940 -27.102 103.701 1.00 5.59  ? 374  TYR B CD2   1 
ATOM   6168 C  CE1   . TYR B 1 287 ? 144.606 -24.345 103.817 1.00 5.23  ? 374  TYR B CE1   1 
ATOM   6169 C  CE2   . TYR B 1 287 ? 145.922 -26.322 104.289 1.00 5.16  ? 374  TYR B CE2   1 
ATOM   6170 C  CZ    . TYR B 1 287 ? 145.748 -24.953 104.355 1.00 5.43  ? 374  TYR B CZ    1 
ATOM   6171 O  OH    . TYR B 1 287 ? 146.713 -24.168 104.945 1.00 5.06  ? 374  TYR B OH    1 
ATOM   6172 N  N     . GLN B 1 288 ? 140.002 -29.036 103.011 1.00 7.03  ? 375  GLN B N     1 
ATOM   6173 C  CA    . GLN B 1 288 ? 139.050 -30.074 102.605 1.00 6.65  ? 375  GLN B CA    1 
ATOM   6174 C  C     . GLN B 1 288 ? 137.665 -29.868 103.178 1.00 6.71  ? 375  GLN B C     1 
ATOM   6175 O  O     . GLN B 1 288 ? 136.898 -30.812 103.246 1.00 6.41  ? 375  GLN B O     1 
ATOM   6176 C  CB    . GLN B 1 288 ? 139.557 -31.470 103.011 1.00 7.22  ? 375  GLN B CB    1 
ATOM   6177 C  CG    . GLN B 1 288 ? 140.977 -31.764 102.564 1.00 8.10  ? 375  GLN B CG    1 
ATOM   6178 C  CD    . GLN B 1 288 ? 141.180 -31.612 101.073 1.00 9.19  ? 375  GLN B CD    1 
ATOM   6179 O  OE1   . GLN B 1 288 ? 140.284 -31.873 100.275 1.00 9.35  ? 375  GLN B OE1   1 
ATOM   6180 N  NE2   . GLN B 1 288 ? 142.380 -31.174 100.686 1.00 10.38 ? 375  GLN B NE2   1 
ATOM   6181 N  N     . HIS B 1 289 ? 137.325 -28.632 103.548 1.00 6.59  ? 376  HIS B N     1 
ATOM   6182 C  CA    . HIS B 1 289 ? 135.973 -28.344 104.033 1.00 6.66  ? 376  HIS B CA    1 
ATOM   6183 C  C     . HIS B 1 289 ? 134.965 -28.875 103.023 1.00 6.76  ? 376  HIS B C     1 
ATOM   6184 O  O     . HIS B 1 289 ? 135.090 -28.601 101.818 1.00 6.32  ? 376  HIS B O     1 
ATOM   6185 C  CB    . HIS B 1 289 ? 135.773 -26.845 104.220 1.00 6.62  ? 376  HIS B CB    1 
ATOM   6186 C  CG    . HIS B 1 289 ? 134.451 -26.504 104.865 1.00 6.73  ? 376  HIS B CG    1 
ATOM   6187 N  ND1   . HIS B 1 289 ? 133.305 -26.376 104.158 1.00 6.21  ? 376  HIS B ND1   1 
ATOM   6188 C  CD2   . HIS B 1 289 ? 134.116 -26.319 106.198 1.00 6.52  ? 376  HIS B CD2   1 
ATOM   6189 C  CE1   . HIS B 1 289 ? 132.286 -26.117 105.004 1.00 6.85  ? 376  HIS B CE1   1 
ATOM   6190 N  NE2   . HIS B 1 289 ? 132.793 -26.049 106.250 1.00 7.24  ? 376  HIS B NE2   1 
ATOM   6191 N  N     . LYS B 1 290 ? 133.971 -29.629 103.496 1.00 8.39  ? 377  LYS B N     1 
ATOM   6192 C  CA    . LYS B 1 290 ? 133.006 -30.320 102.604 1.00 10.29 ? 377  LYS B CA    1 
ATOM   6193 C  C     . LYS B 1 290 ? 132.364 -29.375 101.598 1.00 9.72  ? 377  LYS B C     1 
ATOM   6194 O  O     . LYS B 1 290 ? 132.127 -29.758 100.439 1.00 10.38 ? 377  LYS B O     1 
ATOM   6195 C  CB    . LYS B 1 290 ? 131.882 -31.001 103.428 1.00 11.92 ? 377  LYS B CB    1 
ATOM   6196 C  CG    . LYS B 1 290 ? 131.438 -30.164 104.630 1.00 14.81 ? 377  LYS B CG    1 
ATOM   6197 C  CD    . LYS B 1 290 ? 130.082 -30.543 105.184 1.00 16.70 ? 377  LYS B CD    1 
ATOM   6198 C  CE    . LYS B 1 290 ? 129.551 -29.471 106.130 1.00 17.72 ? 377  LYS B CE    1 
ATOM   6199 N  NZ    . LYS B 1 290 ? 130.569 -29.021 107.131 1.00 19.17 ? 377  LYS B NZ    1 
ATOM   6200 N  N     . VAL B 1 291 ? 132.061 -28.149 102.034 1.00 8.97  ? 378  VAL B N     1 
ATOM   6201 C  CA    . VAL B 1 291 ? 131.383 -27.190 101.159 1.00 9.04  ? 378  VAL B CA    1 
ATOM   6202 C  C     . VAL B 1 291 ? 132.395 -26.491 100.243 1.00 8.06  ? 378  VAL B C     1 
ATOM   6203 O  O     . VAL B 1 291 ? 132.122 -26.246 99.079  1.00 7.97  ? 378  VAL B O     1 
ATOM   6204 C  CB    . VAL B 1 291 ? 130.491 -26.177 101.943 1.00 9.47  ? 378  VAL B CB    1 
ATOM   6205 C  CG1   . VAL B 1 291 ? 129.722 -25.268 100.983 1.00 9.99  ? 378  VAL B CG1   1 
ATOM   6206 C  CG2   . VAL B 1 291 ? 129.501 -26.918 102.841 1.00 9.53  ? 378  VAL B CG2   1 
ATOM   6207 N  N     . GLY B 1 292 ? 133.573 -26.164 100.765 1.00 7.93  ? 379  GLY B N     1 
ATOM   6208 C  CA    . GLY B 1 292 ? 134.626 -25.624 99.922  1.00 7.97  ? 379  GLY B CA    1 
ATOM   6209 C  C     . GLY B 1 292 ? 134.915 -26.578 98.771  1.00 8.15  ? 379  GLY B C     1 
ATOM   6210 O  O     . GLY B 1 292 ? 135.056 -26.148 97.611  1.00 7.97  ? 379  GLY B O     1 
ATOM   6211 N  N     . ASN B 1 293 ? 134.980 -27.872 99.088  1.00 8.03  ? 380  ASN B N     1 
ATOM   6212 C  CA    . ASN B 1 293 ? 135.209 -28.894 98.056  1.00 8.90  ? 380  ASN B CA    1 
ATOM   6213 C  C     . ASN B 1 293 ? 134.086 -28.985 97.034  1.00 9.35  ? 380  ASN B C     1 
ATOM   6214 O  O     . ASN B 1 293 ? 134.363 -29.133 95.845  1.00 9.31  ? 380  ASN B O     1 
ATOM   6215 C  CB    . ASN B 1 293 ? 135.467 -30.273 98.668  1.00 8.95  ? 380  ASN B CB    1 
ATOM   6216 C  CG    . ASN B 1 293 ? 136.878 -30.413 99.203  1.00 10.42 ? 380  ASN B CG    1 
ATOM   6217 O  OD1   . ASN B 1 293 ? 137.631 -29.440 99.256  1.00 11.15 ? 380  ASN B OD1   1 
ATOM   6218 N  ND2   . ASN B 1 293 ? 137.244 -31.623 99.605  1.00 9.74  ? 380  ASN B ND2   1 
ATOM   6219 N  N     . ILE B 1 294 ? 132.838 -28.903 97.483  1.00 9.85  ? 381  ILE B N     1 
ATOM   6220 C  CA    . ILE B 1 294 ? 131.718 -28.961 96.524  1.00 11.00 ? 381  ILE B CA    1 
ATOM   6221 C  C     . ILE B 1 294 ? 131.660 -27.717 95.644  1.00 10.99 ? 381  ILE B C     1 
ATOM   6222 O  O     . ILE B 1 294 ? 131.265 -27.798 94.484  1.00 10.90 ? 381  ILE B O     1 
ATOM   6223 C  CB    . ILE B 1 294 ? 130.352 -29.282 97.178  1.00 11.44 ? 381  ILE B CB    1 
ATOM   6224 C  CG1   . ILE B 1 294 ? 129.457 -30.054 96.185  1.00 12.11 ? 381  ILE B CG1   1 
ATOM   6225 C  CG2   . ILE B 1 294 ? 129.628 -28.035 97.650  1.00 12.10 ? 381  ILE B CG2   1 
ATOM   6226 C  CD1   . ILE B 1 294 ? 130.058 -31.359 95.698  1.00 12.85 ? 381  ILE B CD1   1 
ATOM   6227 N  N     . ILE B 1 295 ? 132.079 -26.575 96.191  1.00 9.77  ? 382  ILE B N     1 
ATOM   6228 C  CA    . ILE B 1 295 ? 132.195 -25.360 95.391  1.00 10.88 ? 382  ILE B CA    1 
ATOM   6229 C  C     . ILE B 1 295 ? 133.292 -25.493 94.329  1.00 10.44 ? 382  ILE B C     1 
ATOM   6230 O  O     . ILE B 1 295 ? 133.059 -25.168 93.163  1.00 10.48 ? 382  ILE B O     1 
ATOM   6231 C  CB    . ILE B 1 295 ? 132.327 -24.090 96.274  1.00 11.51 ? 382  ILE B CB    1 
ATOM   6232 C  CG1   . ILE B 1 295 ? 130.987 -23.841 96.985  1.00 12.68 ? 382  ILE B CG1   1 
ATOM   6233 C  CG2   . ILE B 1 295 ? 132.678 -22.858 95.430  1.00 11.33 ? 382  ILE B CG2   1 
ATOM   6234 C  CD1   . ILE B 1 295 ? 130.989 -22.718 97.996  1.00 13.40 ? 382  ILE B CD1   1 
ATOM   6235 N  N     . ASP B 1 296 ? 134.475 -25.978 94.710  1.00 9.66  ? 383  ASP B N     1 
ATOM   6236 C  CA    . ASP B 1 296 ? 135.503 -26.333 93.726  1.00 10.56 ? 383  ASP B CA    1 
ATOM   6237 C  C     . ASP B 1 296 ? 134.962 -27.302 92.656  1.00 9.39  ? 383  ASP B C     1 
ATOM   6238 O  O     . ASP B 1 296 ? 135.261 -27.157 91.472  1.00 10.33 ? 383  ASP B O     1 
ATOM   6239 C  CB    . ASP B 1 296 ? 136.724 -26.972 94.396  1.00 11.59 ? 383  ASP B CB    1 
ATOM   6240 C  CG    . ASP B 1 296 ? 137.685 -25.944 94.967  1.00 12.33 ? 383  ASP B CG    1 
ATOM   6241 O  OD1   . ASP B 1 296 ? 137.515 -24.737 94.692  1.00 12.36 ? 383  ASP B OD1   1 
ATOM   6242 O  OD2   . ASP B 1 296 ? 138.622 -26.335 95.691  1.00 16.07 ? 383  ASP B OD2   1 
ATOM   6243 N  N     . THR B 1 297 ? 134.178 -28.291 93.088  1.00 10.28 ? 384  THR B N     1 
ATOM   6244 C  CA    . THR B 1 297 ? 133.590 -29.275 92.176  1.00 10.50 ? 384  THR B CA    1 
ATOM   6245 C  C     . THR B 1 297 ? 132.648 -28.598 91.180  1.00 10.16 ? 384  THR B C     1 
ATOM   6246 O  O     . THR B 1 297 ? 132.712 -28.877 89.985  1.00 11.33 ? 384  THR B O     1 
ATOM   6247 C  CB    . THR B 1 297 ? 132.831 -30.359 92.967  1.00 11.31 ? 384  THR B CB    1 
ATOM   6248 O  OG1   . THR B 1 297 ? 133.759 -31.048 93.800  1.00 11.08 ? 384  THR B OG1   1 
ATOM   6249 C  CG2   . THR B 1 297 ? 132.161 -31.383 92.038  1.00 11.25 ? 384  THR B CG2   1 
ATOM   6250 N  N     . MET B 1 298 ? 131.799 -27.704 91.667  1.00 10.50 ? 385  MET B N     1 
ATOM   6251 C  CA    . MET B 1 298 ? 130.865 -26.972 90.781  1.00 10.88 ? 385  MET B CA    1 
ATOM   6252 C  C     . MET B 1 298 ? 131.574 -26.038 89.812  1.00 11.35 ? 385  MET B C     1 
ATOM   6253 O  O     . MET B 1 298 ? 131.207 -25.962 88.636  1.00 12.02 ? 385  MET B O     1 
ATOM   6254 C  CB    . MET B 1 298 ? 129.816 -26.228 91.580  1.00 10.88 ? 385  MET B CB    1 
ATOM   6255 C  CG    . MET B 1 298 ? 128.900 -27.148 92.370  1.00 11.28 ? 385  MET B CG    1 
ATOM   6256 S  SD    . MET B 1 298 ? 127.725 -26.337 93.460  1.00 13.51 ? 385  MET B SD    1 
ATOM   6257 C  CE    . MET B 1 298 ? 126.497 -25.736 92.283  1.00 13.69 ? 385  MET B CE    1 
ATOM   6258 N  N     . ILE B 1 299 ? 132.601 -25.338 90.291  1.00 10.63 ? 386  ILE B N     1 
ATOM   6259 C  CA    . ILE B 1 299 ? 133.389 -24.487 89.401  1.00 10.71 ? 386  ILE B CA    1 
ATOM   6260 C  C     . ILE B 1 299 ? 134.070 -25.329 88.313  1.00 11.16 ? 386  ILE B C     1 
ATOM   6261 O  O     . ILE B 1 299 ? 134.086 -24.952 87.130  1.00 10.95 ? 386  ILE B O     1 
ATOM   6262 C  CB    . ILE B 1 299 ? 134.419 -23.649 90.172  1.00 10.16 ? 386  ILE B CB    1 
ATOM   6263 C  CG1   . ILE B 1 299 ? 133.689 -22.663 91.106  1.00 9.41  ? 386  ILE B CG1   1 
ATOM   6264 C  CG2   . ILE B 1 299 ? 135.353 -22.927 89.209  1.00 10.87 ? 386  ILE B CG2   1 
ATOM   6265 C  CD1   . ILE B 1 299 ? 134.627 -21.956 92.085  1.00 9.80  ? 386  ILE B CD1   1 
ATOM   6266 N  N     . THR B 1 300 ? 134.599 -26.476 88.713  1.00 11.65 ? 387  THR B N     1 
ATOM   6267 C  CA    . THR B 1 300 ? 135.207 -27.421 87.777  1.00 12.56 ? 387  THR B CA    1 
ATOM   6268 C  C     . THR B 1 300 ? 134.195 -27.868 86.702  1.00 13.02 ? 387  THR B C     1 
ATOM   6269 O  O     . THR B 1 300 ? 134.550 -27.935 85.508  1.00 13.95 ? 387  THR B O     1 
ATOM   6270 C  CB    . THR B 1 300 ? 135.805 -28.629 88.519  1.00 12.86 ? 387  THR B CB    1 
ATOM   6271 O  OG1   . THR B 1 300 ? 136.971 -28.200 89.244  1.00 13.44 ? 387  THR B OG1   1 
ATOM   6272 C  CG2   . THR B 1 300 ? 136.222 -29.754 87.549  1.00 13.14 ? 387  THR B CG2   1 
ATOM   6273 N  N     . ASP B 1 301 ? 132.967 -28.152 87.131  1.00 14.60 ? 388  ASP B N     1 
ATOM   6274 C  CA    . ASP B 1 301 ? 131.867 -28.551 86.233  1.00 16.50 ? 388  ASP B CA    1 
ATOM   6275 C  C     . ASP B 1 301 ? 131.548 -27.462 85.220  1.00 16.44 ? 388  ASP B C     1 
ATOM   6276 O  O     . ASP B 1 301 ? 131.354 -27.753 84.036  1.00 16.38 ? 388  ASP B O     1 
ATOM   6277 C  CB    . ASP B 1 301 ? 130.594 -28.860 87.022  1.00 18.20 ? 388  ASP B CB    1 
ATOM   6278 C  CG    . ASP B 1 301 ? 130.658 -30.188 87.771  1.00 22.22 ? 388  ASP B CG    1 
ATOM   6279 O  OD1   . ASP B 1 301 ? 131.624 -30.955 87.574  1.00 24.57 ? 388  ASP B OD1   1 
ATOM   6280 O  OD2   . ASP B 1 301 ? 129.725 -30.466 88.562  1.00 25.36 ? 388  ASP B OD2   1 
ATOM   6281 N  N     . ALA B 1 302 ? 131.485 -26.215 85.694  1.00 15.25 ? 389  ALA B N     1 
ATOM   6282 C  CA    . ALA B 1 302 ? 131.306 -25.049 84.819  1.00 14.36 ? 389  ALA B CA    1 
ATOM   6283 C  C     . ALA B 1 302 ? 132.426 -24.910 83.805  1.00 15.14 ? 389  ALA B C     1 
ATOM   6284 O  O     . ALA B 1 302 ? 132.175 -24.703 82.604  1.00 15.81 ? 389  ALA B O     1 
ATOM   6285 C  CB    . ALA B 1 302 ? 131.150 -23.767 85.637  1.00 12.65 ? 389  ALA B CB    1 
ATOM   6286 N  N     . PHE B 1 303 ? 133.665 -25.039 84.268  1.00 13.79 ? 390  PHE B N     1 
ATOM   6287 C  CA    . PHE B 1 303 ? 134.815 -24.951 83.372  1.00 14.25 ? 390  PHE B CA    1 
ATOM   6288 C  C     . PHE B 1 303 ? 134.753 -26.044 82.294  1.00 14.25 ? 390  PHE B C     1 
ATOM   6289 O  O     . PHE B 1 303 ? 135.050 -25.773 81.131  1.00 16.45 ? 390  PHE B O     1 
ATOM   6290 C  CB    . PHE B 1 303 ? 136.124 -25.067 84.150  1.00 14.74 ? 390  PHE B CB    1 
ATOM   6291 C  CG    . PHE B 1 303 ? 136.528 -23.809 84.890  1.00 13.85 ? 390  PHE B CG    1 
ATOM   6292 C  CD1   . PHE B 1 303 ? 135.608 -22.813 85.176  1.00 14.32 ? 390  PHE B CD1   1 
ATOM   6293 C  CD2   . PHE B 1 303 ? 137.840 -23.654 85.317  1.00 16.35 ? 390  PHE B CD2   1 
ATOM   6294 C  CE1   . PHE B 1 303 ? 135.988 -21.671 85.873  1.00 14.24 ? 390  PHE B CE1   1 
ATOM   6295 C  CE2   . PHE B 1 303 ? 138.229 -22.517 86.012  1.00 16.37 ? 390  PHE B CE2   1 
ATOM   6296 C  CZ    . PHE B 1 303 ? 137.291 -21.535 86.291  1.00 13.90 ? 390  PHE B CZ    1 
ATOM   6297 N  N     . LEU B 1 304 ? 134.373 -27.261 82.678  1.00 13.68 ? 391  LEU B N     1 
ATOM   6298 C  CA    . LEU B 1 304 ? 134.218 -28.361 81.700  1.00 15.82 ? 391  LEU B CA    1 
ATOM   6299 C  C     . LEU B 1 304 ? 133.175 -28.004 80.646  1.00 17.41 ? 391  LEU B C     1 
ATOM   6300 O  O     . LEU B 1 304 ? 133.398 -28.214 79.451  1.00 19.64 ? 391  LEU B O     1 
ATOM   6301 C  CB    . LEU B 1 304 ? 133.844 -29.679 82.396  1.00 15.26 ? 391  LEU B CB    1 
ATOM   6302 C  CG    . LEU B 1 304 ? 134.990 -30.262 83.216  1.00 14.49 ? 391  LEU B CG    1 
ATOM   6303 C  CD1   . LEU B 1 304 ? 134.515 -31.356 84.164  1.00 15.68 ? 391  LEU B CD1   1 
ATOM   6304 C  CD2   . LEU B 1 304 ? 136.116 -30.762 82.305  1.00 15.28 ? 391  LEU B CD2   1 
ATOM   6305 N  N     . LYS B 1 305 ? 132.055 -27.444 81.096  1.00 17.64 ? 392  LYS B N     1 
ATOM   6306 C  CA    . LYS B 1 305 ? 130.966 -27.016 80.210  1.00 19.06 ? 392  LYS B CA    1 
ATOM   6307 C  C     . LYS B 1 305 ? 131.355 -25.851 79.306  1.00 19.50 ? 392  LYS B C     1 
ATOM   6308 O  O     . LYS B 1 305 ? 130.801 -25.695 78.225  1.00 21.07 ? 392  LYS B O     1 
ATOM   6309 C  CB    . LYS B 1 305 ? 129.756 -26.576 81.029  1.00 20.29 ? 392  LYS B CB    1 
ATOM   6310 C  CG    . LYS B 1 305 ? 128.550 -27.485 80.953  1.00 24.37 ? 392  LYS B CG    1 
ATOM   6311 C  CD    . LYS B 1 305 ? 128.578 -28.538 82.034  1.00 26.94 ? 392  LYS B CD    1 
ATOM   6312 C  CE    . LYS B 1 305 ? 127.158 -28.937 82.453  1.00 30.02 ? 392  LYS B CE    1 
ATOM   6313 N  NZ    . LYS B 1 305 ? 127.164 -29.869 83.618  1.00 32.87 ? 392  LYS B NZ    1 
ATOM   6314 N  N     . ALA B 1 306 ? 132.287 -25.019 79.761  1.00 15.95 ? 393  ALA B N     1 
ATOM   6315 C  CA    . ALA B 1 306 ? 132.710 -23.858 78.996  1.00 16.28 ? 393  ALA B CA    1 
ATOM   6316 C  C     . ALA B 1 306 ? 133.898 -24.156 78.108  1.00 15.27 ? 393  ALA B C     1 
ATOM   6317 O  O     . ALA B 1 306 ? 134.219 -23.356 77.228  1.00 18.56 ? 393  ALA B O     1 
ATOM   6318 C  CB    . ALA B 1 306 ? 133.046 -22.698 79.938  1.00 14.34 ? 393  ALA B CB    1 
ATOM   6319 N  N     . ASP B 1 307 ? 134.573 -25.280 78.359  1.00 16.64 ? 394  ASP B N     1 
ATOM   6320 C  CA    . ASP B 1 307 ? 135.916 -25.521 77.815  1.00 17.75 ? 394  ASP B CA    1 
ATOM   6321 C  C     . ASP B 1 307 ? 135.995 -25.459 76.284  1.00 20.92 ? 394  ASP B C     1 
ATOM   6322 O  O     . ASP B 1 307 ? 136.954 -24.931 75.734  1.00 20.12 ? 394  ASP B O     1 
ATOM   6323 C  CB    . ASP B 1 307 ? 136.466 -26.860 78.301  1.00 19.83 ? 394  ASP B CB    1 
ATOM   6324 C  CG    . ASP B 1 307 ? 137.951 -26.989 78.086  1.00 22.11 ? 394  ASP B CG    1 
ATOM   6325 O  OD1   . ASP B 1 307 ? 138.661 -25.978 78.234  1.00 23.20 ? 394  ASP B OD1   1 
ATOM   6326 O  OD2   . ASP B 1 307 ? 138.423 -28.101 77.765  1.00 24.40 ? 394  ASP B OD2   1 
ATOM   6327 N  N     . ASP B 1 308 ? 134.987 -25.994 75.608  1.00 22.94 ? 395  ASP B N     1 
ATOM   6328 C  CA    . ASP B 1 308 ? 134.959 -25.971 74.133  1.00 26.89 ? 395  ASP B CA    1 
ATOM   6329 C  C     . ASP B 1 308 ? 134.741 -24.587 73.530  1.00 26.97 ? 395  ASP B C     1 
ATOM   6330 O  O     . ASP B 1 308 ? 135.001 -24.382 72.339  1.00 27.67 ? 395  ASP B O     1 
ATOM   6331 C  CB    . ASP B 1 308 ? 133.879 -26.918 73.596  1.00 30.20 ? 395  ASP B CB    1 
ATOM   6332 C  CG    . ASP B 1 308 ? 134.181 -28.378 73.868  1.00 32.89 ? 395  ASP B CG    1 
ATOM   6333 O  OD1   . ASP B 1 308 ? 135.353 -28.720 74.135  1.00 35.15 ? 395  ASP B OD1   1 
ATOM   6334 O  OD2   . ASP B 1 308 ? 133.234 -29.187 73.813  1.00 35.72 ? 395  ASP B OD2   1 
ATOM   6335 N  N     . TYR B 1 309 ? 134.265 -23.645 74.341  1.00 26.62 ? 396  TYR B N     1 
ATOM   6336 C  CA    . TYR B 1 309 ? 133.783 -22.363 73.833  1.00 27.04 ? 396  TYR B CA    1 
ATOM   6337 C  C     . TYR B 1 309 ? 134.636 -21.147 74.212  1.00 28.64 ? 396  TYR B C     1 
ATOM   6338 O  O     . TYR B 1 309 ? 134.474 -20.067 73.638  1.00 28.16 ? 396  TYR B O     1 
ATOM   6339 C  CB    . TYR B 1 309 ? 132.321 -22.168 74.226  1.00 28.15 ? 396  TYR B CB    1 
ATOM   6340 C  CG    . TYR B 1 309 ? 131.479 -23.379 73.905  1.00 29.88 ? 396  TYR B CG    1 
ATOM   6341 C  CD1   . TYR B 1 309 ? 131.246 -23.757 72.577  1.00 31.78 ? 396  TYR B CD1   1 
ATOM   6342 C  CD2   . TYR B 1 309 ? 130.925 -24.158 74.919  1.00 31.46 ? 396  TYR B CD2   1 
ATOM   6343 C  CE1   . TYR B 1 309 ? 130.482 -24.872 72.273  1.00 32.76 ? 396  TYR B CE1   1 
ATOM   6344 C  CE2   . TYR B 1 309 ? 130.154 -25.279 74.623  1.00 34.89 ? 396  TYR B CE2   1 
ATOM   6345 C  CZ    . TYR B 1 309 ? 129.937 -25.630 73.297  1.00 35.12 ? 396  TYR B CZ    1 
ATOM   6346 O  OH    . TYR B 1 309 ? 129.173 -26.735 72.992  1.00 37.48 ? 396  TYR B OH    1 
ATOM   6347 N  N     . ILE B 1 310 ? 135.550 -21.313 75.164  1.00 28.22 ? 397  ILE B N     1 
ATOM   6348 C  CA    . ILE B 1 310 ? 136.446 -20.218 75.522  1.00 29.14 ? 397  ILE B CA    1 
ATOM   6349 C  C     . ILE B 1 310 ? 137.687 -20.293 74.647  1.00 29.26 ? 397  ILE B C     1 
ATOM   6350 O  O     . ILE B 1 310 ? 138.258 -21.368 74.446  1.00 28.66 ? 397  ILE B O     1 
ATOM   6351 C  CB    . ILE B 1 310 ? 136.832 -20.228 77.024  1.00 29.87 ? 397  ILE B CB    1 
ATOM   6352 C  CG1   . ILE B 1 310 ? 135.583 -20.264 77.923  1.00 30.03 ? 397  ILE B CG1   1 
ATOM   6353 C  CG2   . ILE B 1 310 ? 137.750 -19.055 77.364  1.00 30.24 ? 397  ILE B CG2   1 
ATOM   6354 C  CD1   . ILE B 1 310 ? 134.958 -18.922 78.237  1.00 27.54 ? 397  ILE B CD1   1 
ATOM   6355 N  N     . GLU B 1 311 ? 138.082 -19.139 74.110  1.00 30.46 ? 398  GLU B N     1 
ATOM   6356 C  CA    . GLU B 1 311 ? 139.289 -19.035 73.304  1.00 32.43 ? 398  GLU B CA    1 
ATOM   6357 C  C     . GLU B 1 311 ? 140.263 -18.108 74.014  1.00 30.72 ? 398  GLU B C     1 
ATOM   6358 O  O     . GLU B 1 311 ? 139.904 -17.004 74.416  1.00 33.51 ? 398  GLU B O     1 
ATOM   6359 C  CB    . GLU B 1 311 ? 138.996 -18.483 71.900  1.00 35.42 ? 398  GLU B CB    1 
ATOM   6360 C  CG    . GLU B 1 311 ? 137.668 -18.922 71.276  1.00 39.60 ? 398  GLU B CG    1 
ATOM   6361 C  CD    . GLU B 1 311 ? 137.413 -18.230 69.947  1.00 41.30 ? 398  GLU B CD    1 
ATOM   6362 O  OE1   . GLU B 1 311 ? 136.356 -17.577 69.800  1.00 43.33 ? 398  GLU B OE1   1 
ATOM   6363 O  OE2   . GLU B 1 311 ? 138.280 -18.328 69.053  1.00 43.51 ? 398  GLU B OE2   1 
ATOM   6364 N  N     . ILE B 1 312 ? 141.492 -18.573 74.185  1.00 28.54 ? 399  ILE B N     1 
ATOM   6365 C  CA    . ILE B 1 312 ? 142.541 -17.756 74.774  1.00 26.71 ? 399  ILE B CA    1 
ATOM   6366 C  C     . ILE B 1 312 ? 143.697 -17.689 73.787  1.00 26.12 ? 399  ILE B C     1 
ATOM   6367 O  O     . ILE B 1 312 ? 144.268 -18.713 73.415  1.00 23.56 ? 399  ILE B O     1 
ATOM   6368 C  CB    . ILE B 1 312 ? 142.988 -18.317 76.144  1.00 27.23 ? 399  ILE B CB    1 
ATOM   6369 C  CG1   . ILE B 1 312 ? 141.803 -18.341 77.114  1.00 27.72 ? 399  ILE B CG1   1 
ATOM   6370 C  CG2   . ILE B 1 312 ? 144.140 -17.502 76.720  1.00 24.46 ? 399  ILE B CG2   1 
ATOM   6371 C  CD1   . ILE B 1 312 ? 141.797 -19.544 78.037  1.00 28.63 ? 399  ILE B CD1   1 
ATOM   6372 N  N     . THR B 1 313 ? 144.035 -16.473 73.362  1.00 28.45 ? 400  THR B N     1 
ATOM   6373 C  CA    . THR B 1 313 ? 145.082 -16.276 72.370  1.00 29.15 ? 400  THR B CA    1 
ATOM   6374 C  C     . THR B 1 313 ? 146.481 -16.508 72.946  1.00 28.65 ? 400  THR B C     1 
ATOM   6375 O  O     . THR B 1 313 ? 146.862 -15.902 73.938  1.00 30.35 ? 400  THR B O     1 
ATOM   6376 C  CB    . THR B 1 313 ? 144.967 -14.890 71.695  1.00 31.30 ? 400  THR B CB    1 
ATOM   6377 O  OG1   . THR B 1 313 ? 143.691 -14.781 71.061  1.00 34.66 ? 400  THR B OG1   1 
ATOM   6378 C  CG2   . THR B 1 313 ? 146.037 -14.712 70.638  1.00 31.22 ? 400  THR B CG2   1 
ATOM   6379 N  N     . GLY B 1 314 ? 147.238 -17.400 72.320  1.00 27.05 ? 401  GLY B N     1 
ATOM   6380 C  CA    . GLY B 1 314 ? 148.610 -17.659 72.724  1.00 26.80 ? 401  GLY B CA    1 
ATOM   6381 C  C     . GLY B 1 314 ? 149.595 -17.112 71.705  1.00 29.54 ? 401  GLY B C     1 
ATOM   6382 O  O     . GLY B 1 314 ? 149.290 -16.151 70.997  1.00 30.61 ? 401  GLY B O     1 
ATOM   6383 N  N     . ALA B 1 315 ? 150.773 -17.727 71.635  1.00 27.85 ? 402  ALA B N     1 
ATOM   6384 C  CA    . ALA B 1 315 ? 151.841 -17.273 70.746  1.00 31.29 ? 402  ALA B CA    1 
ATOM   6385 C  C     . ALA B 1 315 ? 151.473 -17.533 69.291  1.00 34.43 ? 402  ALA B C     1 
ATOM   6386 O  O     . ALA B 1 315 ? 150.763 -18.494 68.988  1.00 33.52 ? 402  ALA B O     1 
ATOM   6387 C  CB    . ALA B 1 315 ? 153.155 -17.948 71.096  1.00 31.56 ? 402  ALA B CB    1 
ATOM   6388 N  N     . GLY B 1 316 ? 151.934 -16.656 68.402  1.00 36.38 ? 403  GLY B N     1 
ATOM   6389 C  CA    . GLY B 1 316 ? 151.597 -16.737 66.980  1.00 38.74 ? 403  GLY B CA    1 
ATOM   6390 C  C     . GLY B 1 316 ? 150.109 -16.577 66.716  1.00 40.84 ? 403  GLY B C     1 
ATOM   6391 O  O     . GLY B 1 316 ? 149.617 -16.973 65.661  1.00 44.01 ? 403  GLY B O     1 
ATOM   6392 N  N     . GLY B 1 317 ? 149.392 -16.007 67.683  1.00 40.68 ? 404  GLY B N     1 
ATOM   6393 C  CA    . GLY B 1 317 ? 147.941 -15.836 67.591  1.00 38.55 ? 404  GLY B CA    1 
ATOM   6394 C  C     . GLY B 1 317 ? 147.102 -17.111 67.622  1.00 39.00 ? 404  GLY B C     1 
ATOM   6395 O  O     . GLY B 1 317 ? 145.897 -17.056 67.370  1.00 40.06 ? 404  GLY B O     1 
ATOM   6396 N  N     . LYS B 1 318 ? 147.726 -18.255 67.917  1.00 37.68 ? 405  LYS B N     1 
ATOM   6397 C  CA    . LYS B 1 318 ? 147.000 -19.521 68.095  1.00 37.60 ? 405  LYS B CA    1 
ATOM   6398 C  C     . LYS B 1 318 ? 145.950 -19.408 69.200  1.00 37.55 ? 405  LYS B C     1 
ATOM   6399 O  O     . LYS B 1 318 ? 146.158 -18.711 70.196  1.00 35.44 ? 405  LYS B O     1 
ATOM   6400 C  CB    . LYS B 1 318 ? 147.963 -20.658 68.444  1.00 40.32 ? 405  LYS B CB    1 
ATOM   6401 C  CG    . LYS B 1 318 ? 148.453 -21.488 67.267  1.00 42.63 ? 405  LYS B CG    1 
ATOM   6402 C  CD    . LYS B 1 318 ? 149.274 -22.679 67.755  1.00 43.69 ? 405  LYS B CD    1 
ATOM   6403 C  CE    . LYS B 1 318 ? 148.389 -23.812 68.270  1.00 44.88 ? 405  LYS B CE    1 
ATOM   6404 N  NZ    . LYS B 1 318 ? 149.192 -24.917 68.876  1.00 45.84 ? 405  LYS B NZ    1 
ATOM   6405 N  N     . LYS B 1 319 ? 144.826 -20.094 69.022  1.00 36.72 ? 406  LYS B N     1 
ATOM   6406 C  CA    . LYS B 1 319 ? 143.757 -20.074 70.014  1.00 35.50 ? 406  LYS B CA    1 
ATOM   6407 C  C     . LYS B 1 319 ? 143.816 -21.310 70.909  1.00 32.70 ? 406  LYS B C     1 
ATOM   6408 O  O     . LYS B 1 319 ? 144.092 -22.421 70.448  1.00 33.73 ? 406  LYS B O     1 
ATOM   6409 C  CB    . LYS B 1 319 ? 142.382 -19.941 69.347  1.00 38.50 ? 406  LYS B CB    1 
ATOM   6410 C  CG    . LYS B 1 319 ? 141.942 -18.504 69.075  1.00 41.90 ? 406  LYS B CG    1 
ATOM   6411 C  CD    . LYS B 1 319 ? 142.781 -17.830 67.998  1.00 44.41 ? 406  LYS B CD    1 
ATOM   6412 C  CE    . LYS B 1 319 ? 142.382 -16.372 67.787  1.00 45.90 ? 406  LYS B CE    1 
ATOM   6413 N  NZ    . LYS B 1 319 ? 141.086 -16.230 67.053  1.00 47.87 ? 406  LYS B NZ    1 
ATOM   6414 N  N     . TYR B 1 320 ? 143.570 -21.105 72.200  1.00 28.21 ? 407  TYR B N     1 
ATOM   6415 C  CA    . TYR B 1 320 ? 143.617 -22.202 73.157  1.00 24.85 ? 407  TYR B CA    1 
ATOM   6416 C  C     . TYR B 1 320 ? 142.344 -22.248 73.965  1.00 22.64 ? 407  TYR B C     1 
ATOM   6417 O  O     . TYR B 1 320 ? 141.610 -21.270 74.042  1.00 24.00 ? 407  TYR B O     1 
ATOM   6418 C  CB    . TYR B 1 320 ? 144.845 -22.075 74.070  1.00 25.16 ? 407  TYR B CB    1 
ATOM   6419 C  CG    . TYR B 1 320 ? 146.138 -22.309 73.325  1.00 23.01 ? 407  TYR B CG    1 
ATOM   6420 C  CD1   . TYR B 1 320 ? 146.792 -21.260 72.687  1.00 24.93 ? 407  TYR B CD1   1 
ATOM   6421 C  CD2   . TYR B 1 320 ? 146.690 -23.585 73.235  1.00 24.96 ? 407  TYR B CD2   1 
ATOM   6422 C  CE1   . TYR B 1 320 ? 147.965 -21.468 71.984  1.00 26.47 ? 407  TYR B CE1   1 
ATOM   6423 C  CE2   . TYR B 1 320 ? 147.869 -23.805 72.535  1.00 26.72 ? 407  TYR B CE2   1 
ATOM   6424 C  CZ    . TYR B 1 320 ? 148.495 -22.741 71.909  1.00 27.25 ? 407  TYR B CZ    1 
ATOM   6425 O  OH    . TYR B 1 320 ? 149.666 -22.943 71.216  1.00 30.38 ? 407  TYR B OH    1 
ATOM   6426 N  N     . ARG B 1 321 ? 142.083 -23.409 74.548  1.00 20.66 ? 408  ARG B N     1 
ATOM   6427 C  CA    . ARG B 1 321 ? 140.974 -23.597 75.454  1.00 19.14 ? 408  ARG B CA    1 
ATOM   6428 C  C     . ARG B 1 321 ? 141.512 -23.430 76.876  1.00 17.01 ? 408  ARG B C     1 
ATOM   6429 O  O     . ARG B 1 321 ? 142.735 -23.409 77.070  1.00 17.28 ? 408  ARG B O     1 
ATOM   6430 C  CB    . ARG B 1 321 ? 140.423 -25.012 75.297  1.00 19.48 ? 408  ARG B CB    1 
ATOM   6431 C  CG    . ARG B 1 321 ? 139.876 -25.300 73.909  1.00 24.90 ? 408  ARG B CG    1 
ATOM   6432 C  CD    . ARG B 1 321 ? 139.505 -26.764 73.778  1.00 27.69 ? 408  ARG B CD    1 
ATOM   6433 N  NE    . ARG B 1 321 ? 138.490 -26.942 72.742  1.00 33.29 ? 408  ARG B NE    1 
ATOM   6434 C  CZ    . ARG B 1 321 ? 137.881 -28.092 72.478  1.00 35.34 ? 408  ARG B CZ    1 
ATOM   6435 N  NH1   . ARG B 1 321 ? 138.180 -29.187 73.172  1.00 37.30 ? 408  ARG B NH1   1 
ATOM   6436 N  NH2   . ARG B 1 321 ? 136.969 -28.148 71.516  1.00 37.27 ? 408  ARG B NH2   1 
ATOM   6437 N  N     . ILE B 1 322 ? 140.603 -23.324 77.846  1.00 17.12 ? 409  ILE B N     1 
ATOM   6438 C  CA    . ILE B 1 322 ? 140.966 -23.390 79.278  1.00 16.60 ? 409  ILE B CA    1 
ATOM   6439 C  C     . ILE B 1 322 ? 141.900 -24.580 79.530  1.00 16.75 ? 409  ILE B C     1 
ATOM   6440 O  O     . ILE B 1 322 ? 142.952 -24.435 80.149  1.00 16.96 ? 409  ILE B O     1 
ATOM   6441 C  CB    . ILE B 1 322 ? 139.714 -23.518 80.182  1.00 16.20 ? 409  ILE B CB    1 
ATOM   6442 C  CG1   . ILE B 1 322 ? 138.754 -22.346 79.948  1.00 16.66 ? 409  ILE B CG1   1 
ATOM   6443 C  CG2   . ILE B 1 322 ? 140.103 -23.550 81.665  1.00 16.18 ? 409  ILE B CG2   1 
ATOM   6444 C  CD1   . ILE B 1 322 ? 137.414 -22.510 80.631  1.00 16.40 ? 409  ILE B CD1   1 
ATOM   6445 N  N     . SER B 1 323 ? 141.528 -25.754 79.015  1.00 16.48 ? 410  SER B N     1 
ATOM   6446 C  CA    . SER B 1 323 ? 142.314 -26.966 79.239  1.00 16.75 ? 410  SER B CA    1 
ATOM   6447 C  C     . SER B 1 323 ? 143.584 -27.082 78.406  1.00 17.34 ? 410  SER B C     1 
ATOM   6448 O  O     . SER B 1 323 ? 144.503 -27.825 78.773  1.00 16.80 ? 410  SER B O     1 
ATOM   6449 C  CB    . SER B 1 323 ? 141.443 -28.203 79.024  1.00 17.70 ? 410  SER B CB    1 
ATOM   6450 O  OG    . SER B 1 323 ? 140.953 -28.239 77.689  1.00 16.95 ? 410  SER B OG    1 
ATOM   6451 N  N     . THR B 1 324 ? 143.648 -26.373 77.281  1.00 18.12 ? 411  THR B N     1 
ATOM   6452 C  CA    . THR B 1 324 ? 144.862 -26.436 76.465  1.00 18.73 ? 411  THR B CA    1 
ATOM   6453 C  C     . THR B 1 324 ? 145.832 -25.266 76.681  1.00 19.53 ? 411  THR B C     1 
ATOM   6454 O  O     . THR B 1 324 ? 146.980 -25.337 76.245  1.00 19.22 ? 411  THR B O     1 
ATOM   6455 C  CB    . THR B 1 324 ? 144.561 -26.659 74.956  1.00 19.36 ? 411  THR B CB    1 
ATOM   6456 O  OG1   . THR B 1 324 ? 143.822 -25.547 74.431  1.00 19.79 ? 411  THR B OG1   1 
ATOM   6457 C  CG2   . THR B 1 324 ? 143.743 -27.956 74.764  1.00 20.37 ? 411  THR B CG2   1 
ATOM   6458 N  N     . ALA B 1 325 ? 145.402 -24.226 77.406  1.00 18.77 ? 412  ALA B N     1 
ATOM   6459 C  CA    . ALA B 1 325 ? 146.289 -23.089 77.693  1.00 17.06 ? 412  ALA B CA    1 
ATOM   6460 C  C     . ALA B 1 325 ? 147.563 -23.520 78.400  1.00 16.98 ? 412  ALA B C     1 
ATOM   6461 O  O     . ALA B 1 325 ? 148.577 -22.837 78.303  1.00 17.62 ? 412  ALA B O     1 
ATOM   6462 C  CB    . ALA B 1 325 ? 145.567 -21.995 78.493  1.00 17.22 ? 412  ALA B CB    1 
ATOM   6463 N  N     . ILE B 1 326 ? 147.522 -24.671 79.082  1.00 16.71 ? 413  ILE B N     1 
ATOM   6464 C  CA    . ILE B 1 326 ? 148.694 -25.201 79.778  1.00 17.23 ? 413  ILE B CA    1 
ATOM   6465 C  C     . ILE B 1 326 ? 149.827 -25.598 78.832  1.00 17.94 ? 413  ILE B C     1 
ATOM   6466 O  O     . ILE B 1 326 ? 150.958 -25.834 79.271  1.00 17.71 ? 413  ILE B O     1 
ATOM   6467 C  CB    . ILE B 1 326 ? 148.336 -26.415 80.675  1.00 18.11 ? 413  ILE B CB    1 
ATOM   6468 C  CG1   . ILE B 1 326 ? 147.789 -27.575 79.825  1.00 18.02 ? 413  ILE B CG1   1 
ATOM   6469 C  CG2   . ILE B 1 326 ? 147.361 -25.998 81.770  1.00 17.74 ? 413  ILE B CG2   1 
ATOM   6470 C  CD1   . ILE B 1 326 ? 147.663 -28.892 80.557  1.00 18.48 ? 413  ILE B CD1   1 
ATOM   6471 N  N     . ASP B 1 327 ? 149.509 -25.681 77.541  1.00 20.53 ? 414  ASP B N     1 
ATOM   6472 C  CA    . ASP B 1 327 ? 150.473 -26.080 76.522  1.00 22.64 ? 414  ASP B CA    1 
ATOM   6473 C  C     . ASP B 1 327 ? 151.207 -24.888 75.912  1.00 22.40 ? 414  ASP B C     1 
ATOM   6474 O  O     . ASP B 1 327 ? 152.191 -25.070 75.191  1.00 22.78 ? 414  ASP B O     1 
ATOM   6475 C  CB    . ASP B 1 327 ? 149.770 -26.875 75.407  1.00 25.99 ? 414  ASP B CB    1 
ATOM   6476 C  CG    . ASP B 1 327 ? 149.224 -28.219 75.885  1.00 28.21 ? 414  ASP B CG    1 
ATOM   6477 O  OD1   . ASP B 1 327 ? 149.718 -28.752 76.893  1.00 31.35 ? 414  ASP B OD1   1 
ATOM   6478 O  OD2   . ASP B 1 327 ? 148.304 -28.753 75.232  1.00 30.68 ? 414  ASP B OD2   1 
ATOM   6479 N  N     . ASP B 1 328 ? 150.723 -23.675 76.191  1.00 19.98 ? 415  ASP B N     1 
ATOM   6480 C  CA    . ASP B 1 328 ? 151.338 -22.456 75.665  1.00 19.89 ? 415  ASP B CA    1 
ATOM   6481 C  C     . ASP B 1 328 ? 151.400 -21.370 76.739  1.00 18.30 ? 415  ASP B C     1 
ATOM   6482 O  O     . ASP B 1 328 ? 150.368 -20.813 77.107  1.00 18.94 ? 415  ASP B O     1 
ATOM   6483 C  CB    . ASP B 1 328 ? 150.541 -21.932 74.464  1.00 21.52 ? 415  ASP B CB    1 
ATOM   6484 C  CG    . ASP B 1 328 ? 151.180 -20.706 73.829  1.00 25.10 ? 415  ASP B CG    1 
ATOM   6485 O  OD1   . ASP B 1 328 ? 152.124 -20.878 73.035  1.00 26.91 ? 415  ASP B OD1   1 
ATOM   6486 O  OD2   . ASP B 1 328 ? 150.749 -19.568 74.122  1.00 25.91 ? 415  ASP B OD2   1 
ATOM   6487 N  N     . MET B 1 329 ? 152.602 -21.045 77.196  1.00 18.08 ? 416  MET B N     1 
ATOM   6488 C  CA    . MET B 1 329 ? 152.759 -20.105 78.321  1.00 18.61 ? 416  MET B CA    1 
ATOM   6489 C  C     . MET B 1 329 ? 152.273 -18.684 78.050  1.00 19.05 ? 416  MET B C     1 
ATOM   6490 O  O     . MET B 1 329 ? 151.838 -17.998 78.968  1.00 16.95 ? 416  MET B O     1 
ATOM   6491 C  CB    . MET B 1 329 ? 154.184 -20.130 78.858  1.00 18.26 ? 416  MET B CB    1 
ATOM   6492 C  CG    . MET B 1 329 ? 154.555 -21.439 79.550  1.00 18.62 ? 416  MET B CG    1 
ATOM   6493 S  SD    . MET B 1 329 ? 153.532 -21.851 80.982  1.00 18.99 ? 416  MET B SD    1 
ATOM   6494 C  CE    . MET B 1 329 ? 152.350 -23.021 80.315  1.00 17.19 ? 416  MET B CE    1 
ATOM   6495 N  N     . GLU B 1 330 ? 152.293 -18.241 76.792  1.00 18.83 ? 417  GLU B N     1 
ATOM   6496 C  CA    . GLU B 1 330 ? 151.723 -16.929 76.487  1.00 19.15 ? 417  GLU B CA    1 
ATOM   6497 C  C     . GLU B 1 330 ? 150.225 -16.923 76.746  1.00 17.31 ? 417  GLU B C     1 
ATOM   6498 O  O     . GLU B 1 330 ? 149.696 -15.958 77.298  1.00 17.71 ? 417  GLU B O     1 
ATOM   6499 C  CB    . GLU B 1 330 ? 152.019 -16.508 75.040  1.00 22.69 ? 417  GLU B CB    1 
ATOM   6500 C  CG    . GLU B 1 330 ? 152.169 -15.004 74.873  1.00 27.10 ? 417  GLU B CG    1 
ATOM   6501 C  CD    . GLU B 1 330 ? 152.364 -14.581 73.426  1.00 30.36 ? 417  GLU B CD    1 
ATOM   6502 O  OE1   . GLU B 1 330 ? 151.426 -14.008 72.839  1.00 33.70 ? 417  GLU B OE1   1 
ATOM   6503 O  OE2   . GLU B 1 330 ? 153.452 -14.819 72.873  1.00 32.68 ? 417  GLU B OE2   1 
ATOM   6504 N  N     . ALA B 1 331 ? 149.538 -17.998 76.357  1.00 15.09 ? 418  ALA B N     1 
ATOM   6505 C  CA    . ALA B 1 331 ? 148.105 -18.129 76.636  1.00 13.54 ? 418  ALA B CA    1 
ATOM   6506 C  C     . ALA B 1 331 ? 147.844 -18.364 78.130  1.00 12.92 ? 418  ALA B C     1 
ATOM   6507 O  O     . ALA B 1 331 ? 146.896 -17.816 78.670  1.00 13.20 ? 418  ALA B O     1 
ATOM   6508 C  CB    . ALA B 1 331 ? 147.493 -19.277 75.848  1.00 15.22 ? 418  ALA B CB    1 
ATOM   6509 N  N     . TYR B 1 332 ? 148.649 -19.225 78.747  1.00 12.36 ? 419  TYR B N     1 
ATOM   6510 C  CA    . TYR B 1 332 ? 148.473 -19.558 80.175  1.00 12.65 ? 419  TYR B CA    1 
ATOM   6511 C  C     . TYR B 1 332 ? 148.660 -18.318 81.054  1.00 13.51 ? 419  TYR B C     1 
ATOM   6512 O  O     . TYR B 1 332 ? 147.995 -18.172 82.085  1.00 12.37 ? 419  TYR B O     1 
ATOM   6513 C  CB    . TYR B 1 332 ? 149.452 -20.651 80.599  1.00 11.15 ? 419  TYR B CB    1 
ATOM   6514 C  CG    . TYR B 1 332 ? 149.080 -21.350 81.898  1.00 10.98 ? 419  TYR B CG    1 
ATOM   6515 C  CD1   . TYR B 1 332 ? 147.814 -21.886 82.074  1.00 11.71 ? 419  TYR B CD1   1 
ATOM   6516 C  CD2   . TYR B 1 332 ? 150.015 -21.495 82.924  1.00 11.71 ? 419  TYR B CD2   1 
ATOM   6517 C  CE1   . TYR B 1 332 ? 147.471 -22.546 83.247  1.00 11.62 ? 419  TYR B CE1   1 
ATOM   6518 C  CE2   . TYR B 1 332 ? 149.684 -22.144 84.104  1.00 10.97 ? 419  TYR B CE2   1 
ATOM   6519 C  CZ    . TYR B 1 332 ? 148.421 -22.666 84.256  1.00 11.14 ? 419  TYR B CZ    1 
ATOM   6520 O  OH    . TYR B 1 332 ? 148.090 -23.314 85.434  1.00 10.20 ? 419  TYR B OH    1 
ATOM   6521 N  N     . THR B 1 333 ? 149.540 -17.415 80.628  1.00 14.25 ? 420  THR B N     1 
ATOM   6522 C  CA    . THR B 1 333 ? 149.724 -16.125 81.299  1.00 13.98 ? 420  THR B CA    1 
ATOM   6523 C  C     . THR B 1 333 ? 148.392 -15.407 81.519  1.00 14.22 ? 420  THR B C     1 
ATOM   6524 O  O     . THR B 1 333 ? 148.204 -14.745 82.546  1.00 14.67 ? 420  THR B O     1 
ATOM   6525 C  CB    . THR B 1 333 ? 150.700 -15.214 80.513  1.00 13.76 ? 420  THR B CB    1 
ATOM   6526 O  OG1   . THR B 1 333 ? 152.023 -15.775 80.563  1.00 13.97 ? 420  THR B OG1   1 
ATOM   6527 C  CG2   . THR B 1 333 ? 150.712 -13.783 81.091  1.00 14.57 ? 420  THR B CG2   1 
ATOM   6528 N  N     . LYS B 1 334 ? 147.458 -15.568 80.577  1.00 14.67 ? 421  LYS B N     1 
ATOM   6529 C  CA    . LYS B 1 334 ? 146.163 -14.888 80.617  1.00 14.59 ? 421  LYS B CA    1 
ATOM   6530 C  C     . LYS B 1 334 ? 145.016 -15.712 81.191  1.00 13.91 ? 421  LYS B C     1 
ATOM   6531 O  O     . LYS B 1 334 ? 143.856 -15.333 81.064  1.00 15.10 ? 421  LYS B O     1 
ATOM   6532 C  CB    . LYS B 1 334 ? 145.777 -14.406 79.201  1.00 17.20 ? 421  LYS B CB    1 
ATOM   6533 C  CG    . LYS B 1 334 ? 146.771 -13.407 78.627  1.00 21.72 ? 421  LYS B CG    1 
ATOM   6534 C  CD    . LYS B 1 334 ? 146.367 -12.944 77.233  1.00 24.32 ? 421  LYS B CD    1 
ATOM   6535 C  CE    . LYS B 1 334 ? 146.910 -13.890 76.175  1.00 27.39 ? 421  LYS B CE    1 
ATOM   6536 N  NZ    . LYS B 1 334 ? 146.717 -13.379 74.785  1.00 30.19 ? 421  LYS B NZ    1 
ATOM   6537 N  N     . LEU B 1 335 ? 145.347 -16.820 81.843  1.00 12.70 ? 422  LEU B N     1 
ATOM   6538 C  CA    . LEU B 1 335 ? 144.339 -17.726 82.372  1.00 10.84 ? 422  LEU B CA    1 
ATOM   6539 C  C     . LEU B 1 335 ? 144.426 -17.686 83.893  1.00 11.35 ? 422  LEU B C     1 
ATOM   6540 O  O     . LEU B 1 335 ? 145.356 -18.242 84.485  1.00 12.17 ? 422  LEU B O     1 
ATOM   6541 C  CB    . LEU B 1 335 ? 144.595 -19.151 81.868  1.00 12.05 ? 422  LEU B CB    1 
ATOM   6542 C  CG    . LEU B 1 335 ? 143.577 -20.196 82.342  1.00 12.82 ? 422  LEU B CG    1 
ATOM   6543 C  CD1   . LEU B 1 335 ? 142.140 -19.828 82.012  1.00 14.76 ? 422  LEU B CD1   1 
ATOM   6544 C  CD2   . LEU B 1 335 ? 143.920 -21.582 81.827  1.00 13.99 ? 422  LEU B CD2   1 
ATOM   6545 N  N     . THR B 1 336 ? 143.461 -17.017 84.500  1.00 10.55 ? 423  THR B N     1 
ATOM   6546 C  CA    . THR B 1 336 ? 143.454 -16.803 85.959  1.00 10.39 ? 423  THR B CA    1 
ATOM   6547 C  C     . THR B 1 336 ? 142.045 -16.967 86.500  1.00 11.16 ? 423  THR B C     1 
ATOM   6548 O  O     . THR B 1 336 ? 141.177 -17.445 85.792  1.00 11.68 ? 423  THR B O     1 
ATOM   6549 C  CB    . THR B 1 336 ? 143.996 -15.400 86.306  1.00 9.85  ? 423  THR B CB    1 
ATOM   6550 O  OG1   . THR B 1 336 ? 143.115 -14.395 85.782  1.00 10.52 ? 423  THR B OG1   1 
ATOM   6551 C  CG2   . THR B 1 336 ? 145.380 -15.216 85.757  1.00 9.33  ? 423  THR B CG2   1 
ATOM   6552 N  N     . ASP B 1 337 ? 141.787 -16.557 87.750  1.00 10.74 ? 424  ASP B N     1 
ATOM   6553 C  CA    . ASP B 1 337 ? 140.432 -16.669 88.278  1.00 10.63 ? 424  ASP B CA    1 
ATOM   6554 C  C     . ASP B 1 337 ? 139.444 -15.838 87.471  1.00 11.79 ? 424  ASP B C     1 
ATOM   6555 O  O     . ASP B 1 337 ? 138.241 -16.012 87.601  1.00 12.70 ? 424  ASP B O     1 
ATOM   6556 C  CB    . ASP B 1 337 ? 140.344 -16.242 89.751  1.00 11.11 ? 424  ASP B CB    1 
ATOM   6557 C  CG    . ASP B 1 337 ? 141.125 -17.151 90.677  1.00 11.65 ? 424  ASP B CG    1 
ATOM   6558 O  OD1   . ASP B 1 337 ? 141.812 -18.093 90.208  1.00 10.37 ? 424  ASP B OD1   1 
ATOM   6559 O  OD2   . ASP B 1 337 ? 141.072 -16.882 91.893  1.00 13.13 ? 424  ASP B OD2   1 
ATOM   6560 N  N     . ASN B 1 338 ? 139.959 -14.919 86.659  1.00 12.60 ? 425  ASN B N     1 
ATOM   6561 C  CA    . ASN B 1 338 ? 139.100 -14.118 85.795  1.00 14.15 ? 425  ASN B CA    1 
ATOM   6562 C  C     . ASN B 1 338 ? 138.175 -14.948 84.903  1.00 14.05 ? 425  ASN B C     1 
ATOM   6563 O  O     . ASN B 1 338 ? 137.100 -14.492 84.534  1.00 13.93 ? 425  ASN B O     1 
ATOM   6564 C  CB    . ASN B 1 338 ? 139.914 -13.166 84.932  1.00 15.40 ? 425  ASN B CB    1 
ATOM   6565 C  CG    . ASN B 1 338 ? 139.042 -12.155 84.225  1.00 18.37 ? 425  ASN B CG    1 
ATOM   6566 O  OD1   . ASN B 1 338 ? 139.000 -12.125 83.002  1.00 19.08 ? 425  ASN B OD1   1 
ATOM   6567 N  ND2   . ASN B 1 338 ? 138.317 -11.335 84.998  1.00 20.30 ? 425  ASN B ND2   1 
ATOM   6568 N  N     . ILE B 1 339 ? 138.584 -16.173 84.589  1.00 13.46 ? 426  ILE B N     1 
ATOM   6569 C  CA    . ILE B 1 339 ? 137.759 -17.058 83.757  1.00 13.48 ? 426  ILE B CA    1 
ATOM   6570 C  C     . ILE B 1 339 ? 136.382 -17.344 84.402  1.00 12.58 ? 426  ILE B C     1 
ATOM   6571 O  O     . ILE B 1 339 ? 135.377 -17.453 83.707  1.00 12.45 ? 426  ILE B O     1 
ATOM   6572 C  CB    . ILE B 1 339 ? 138.573 -18.312 83.312  1.00 15.08 ? 426  ILE B CB    1 
ATOM   6573 C  CG1   . ILE B 1 339 ? 137.990 -18.923 82.042  1.00 18.29 ? 426  ILE B CG1   1 
ATOM   6574 C  CG2   . ILE B 1 339 ? 138.701 -19.332 84.426  1.00 15.73 ? 426  ILE B CG2   1 
ATOM   6575 C  CD1   . ILE B 1 339 ? 138.493 -18.217 80.801  1.00 20.31 ? 426  ILE B CD1   1 
ATOM   6576 N  N     . PHE B 1 340 ? 136.328 -17.423 85.741  1.00 11.59 ? 427  PHE B N     1 
ATOM   6577 C  CA    . PHE B 1 340 ? 135.058 -17.546 86.468  1.00 10.78 ? 427  PHE B CA    1 
ATOM   6578 C  C     . PHE B 1 340 ? 134.115 -16.389 86.117  1.00 10.93 ? 427  PHE B C     1 
ATOM   6579 O  O     . PHE B 1 340 ? 132.949 -16.600 85.821  1.00 11.67 ? 427  PHE B O     1 
ATOM   6580 C  CB    . PHE B 1 340 ? 135.340 -17.567 87.990  1.00 10.12 ? 427  PHE B CB    1 
ATOM   6581 C  CG    . PHE B 1 340 ? 134.121 -17.640 88.875  1.00 9.32  ? 427  PHE B CG    1 
ATOM   6582 C  CD1   . PHE B 1 340 ? 133.394 -16.489 89.208  1.00 9.36  ? 427  PHE B CD1   1 
ATOM   6583 C  CD2   . PHE B 1 340 ? 133.746 -18.860 89.466  1.00 9.34  ? 427  PHE B CD2   1 
ATOM   6584 C  CE1   . PHE B 1 340 ? 132.290 -16.554 90.060  1.00 9.84  ? 427  PHE B CE1   1 
ATOM   6585 C  CE2   . PHE B 1 340 ? 132.646 -18.926 90.325  1.00 9.19  ? 427  PHE B CE2   1 
ATOM   6586 C  CZ    . PHE B 1 340 ? 131.923 -17.774 90.632  1.00 9.76  ? 427  PHE B CZ    1 
ATOM   6587 N  N     . LEU B 1 341 ? 134.606 -15.158 86.189  1.00 11.30 ? 428  LEU B N     1 
ATOM   6588 C  CA    . LEU B 1 341 ? 133.738 -14.023 85.924  1.00 11.71 ? 428  LEU B CA    1 
ATOM   6589 C  C     . LEU B 1 341 ? 133.437 -13.875 84.417  1.00 13.10 ? 428  LEU B C     1 
ATOM   6590 O  O     . LEU B 1 341 ? 132.338 -13.434 84.047  1.00 13.79 ? 428  LEU B O     1 
ATOM   6591 C  CB    . LEU B 1 341 ? 134.335 -12.731 86.498  1.00 12.07 ? 428  LEU B CB    1 
ATOM   6592 C  CG    . LEU B 1 341 ? 134.398 -12.725 88.032  1.00 12.00 ? 428  LEU B CG    1 
ATOM   6593 C  CD1   . LEU B 1 341 ? 135.045 -11.442 88.507  1.00 12.19 ? 428  LEU B CD1   1 
ATOM   6594 C  CD2   . LEU B 1 341 ? 133.000 -12.889 88.630  1.00 11.55 ? 428  LEU B CD2   1 
ATOM   6595 N  N     . GLU B 1 342 ? 134.387 -14.256 83.566  1.00 14.01 ? 429  GLU B N     1 
ATOM   6596 C  CA    . GLU B 1 342 ? 134.124 -14.246 82.115  1.00 16.00 ? 429  GLU B CA    1 
ATOM   6597 C  C     . GLU B 1 342 ? 132.927 -15.151 81.810  1.00 16.58 ? 429  GLU B C     1 
ATOM   6598 O  O     . GLU B 1 342 ? 132.039 -14.774 81.051  1.00 15.70 ? 429  GLU B O     1 
ATOM   6599 C  CB    . GLU B 1 342 ? 135.354 -14.660 81.299  1.00 18.97 ? 429  GLU B CB    1 
ATOM   6600 C  CG    . GLU B 1 342 ? 135.127 -14.548 79.790  1.00 22.91 ? 429  GLU B CG    1 
ATOM   6601 C  CD    . GLU B 1 342 ? 136.299 -15.018 78.943  1.00 26.01 ? 429  GLU B CD    1 
ATOM   6602 O  OE1   . GLU B 1 342 ? 137.393 -15.265 79.489  1.00 28.82 ? 429  GLU B OE1   1 
ATOM   6603 O  OE2   . GLU B 1 342 ? 136.124 -15.136 77.709  1.00 28.60 ? 429  GLU B OE2   1 
ATOM   6604 N  N     . ILE B 1 343 ? 132.887 -16.326 82.437  1.00 15.64 ? 430  ILE B N     1 
ATOM   6605 C  CA    . ILE B 1 343 ? 131.754 -17.237 82.287  1.00 15.18 ? 430  ILE B CA    1 
ATOM   6606 C  C     . ILE B 1 343 ? 130.474 -16.663 82.910  1.00 15.94 ? 430  ILE B C     1 
ATOM   6607 O  O     . ILE B 1 343 ? 129.422 -16.656 82.276  1.00 14.90 ? 430  ILE B O     1 
ATOM   6608 C  CB    . ILE B 1 343 ? 132.074 -18.642 82.852  1.00 14.88 ? 430  ILE B CB    1 
ATOM   6609 C  CG1   . ILE B 1 343 ? 133.172 -19.316 82.027  1.00 14.91 ? 430  ILE B CG1   1 
ATOM   6610 C  CG2   . ILE B 1 343 ? 130.824 -19.509 82.913  1.00 15.08 ? 430  ILE B CG2   1 
ATOM   6611 C  CD1   . ILE B 1 343 ? 133.898 -20.449 82.739  1.00 15.72 ? 430  ILE B CD1   1 
ATOM   6612 N  N     . LEU B 1 344 ? 130.559 -16.177 84.150  1.00 14.89 ? 431  LEU B N     1 
ATOM   6613 C  CA    . LEU B 1 344 ? 129.390 -15.639 84.837  1.00 14.28 ? 431  LEU B CA    1 
ATOM   6614 C  C     . LEU B 1 344 ? 128.757 -14.454 84.109  1.00 15.53 ? 431  LEU B C     1 
ATOM   6615 O  O     . LEU B 1 344 ? 127.536 -14.313 84.100  1.00 16.18 ? 431  LEU B O     1 
ATOM   6616 C  CB    . LEU B 1 344 ? 129.773 -15.205 86.265  1.00 14.17 ? 431  LEU B CB    1 
ATOM   6617 C  CG    . LEU B 1 344 ? 128.690 -14.676 87.200  1.00 13.11 ? 431  LEU B CG    1 
ATOM   6618 C  CD1   . LEU B 1 344 ? 127.720 -15.786 87.573  1.00 14.55 ? 431  LEU B CD1   1 
ATOM   6619 C  CD2   . LEU B 1 344 ? 129.338 -14.091 88.451  1.00 13.09 ? 431  LEU B CD2   1 
ATOM   6620 N  N     . TYR B 1 345 ? 129.584 -13.599 83.521  1.00 15.92 ? 432  TYR B N     1 
ATOM   6621 C  CA    . TYR B 1 345 ? 129.082 -12.371 82.898  1.00 17.30 ? 432  TYR B CA    1 
ATOM   6622 C  C     . TYR B 1 345 ? 128.702 -12.595 81.435  1.00 18.91 ? 432  TYR B C     1 
ATOM   6623 O  O     . TYR B 1 345 ? 128.155 -11.689 80.800  1.00 19.57 ? 432  TYR B O     1 
ATOM   6624 C  CB    . TYR B 1 345 ? 130.108 -11.225 83.000  1.00 15.68 ? 432  TYR B CB    1 
ATOM   6625 C  CG    . TYR B 1 345 ? 130.455 -10.775 84.425  1.00 15.26 ? 432  TYR B CG    1 
ATOM   6626 C  CD1   . TYR B 1 345 ? 129.564 -10.955 85.483  1.00 15.35 ? 432  TYR B CD1   1 
ATOM   6627 C  CD2   . TYR B 1 345 ? 131.668 -10.149 84.689  1.00 15.05 ? 432  TYR B CD2   1 
ATOM   6628 C  CE1   . TYR B 1 345 ? 129.886 -10.544 86.780  1.00 14.77 ? 432  TYR B CE1   1 
ATOM   6629 C  CE2   . TYR B 1 345 ? 131.997 -9.730  85.973  1.00 15.28 ? 432  TYR B CE2   1 
ATOM   6630 C  CZ    . TYR B 1 345 ? 131.103 -9.919  87.009  1.00 14.69 ? 432  TYR B CZ    1 
ATOM   6631 O  OH    . TYR B 1 345 ? 131.457 -9.511  88.287  1.00 14.75 ? 432  TYR B OH    1 
ATOM   6632 N  N     . SER B 1 346 ? 128.973 -13.795 80.913  1.00 18.15 ? 433  SER B N     1 
ATOM   6633 C  CA    . SER B 1 346 ? 128.812 -14.073 79.475  1.00 19.17 ? 433  SER B CA    1 
ATOM   6634 C  C     . SER B 1 346 ? 127.369 -13.953 78.985  1.00 19.30 ? 433  SER B C     1 
ATOM   6635 O  O     . SER B 1 346 ? 126.432 -14.025 79.768  1.00 18.32 ? 433  SER B O     1 
ATOM   6636 C  CB    . SER B 1 346 ? 129.403 -15.438 79.104  1.00 17.22 ? 433  SER B CB    1 
ATOM   6637 O  OG    . SER B 1 346 ? 128.673 -16.493 79.711  1.00 17.61 ? 433  SER B OG    1 
ATOM   6638 N  N     . THR B 1 347 ? 127.212 -13.735 77.680  1.00 23.60 ? 434  THR B N     1 
ATOM   6639 C  CA    . THR B 1 347 ? 125.884 -13.699 77.052  1.00 25.92 ? 434  THR B CA    1 
ATOM   6640 C  C     . THR B 1 347 ? 125.722 -14.782 75.991  1.00 26.11 ? 434  THR B C     1 
ATOM   6641 O  O     . THR B 1 347 ? 124.596 -15.123 75.619  1.00 28.35 ? 434  THR B O     1 
ATOM   6642 C  CB    . THR B 1 347 ? 125.591 -12.332 76.406  1.00 25.72 ? 434  THR B CB    1 
ATOM   6643 O  OG1   . THR B 1 347 ? 126.722 -11.927 75.633  1.00 27.79 ? 434  THR B OG1   1 
ATOM   6644 C  CG2   . THR B 1 347 ? 125.288 -11.277 77.479  1.00 27.67 ? 434  THR B CG2   1 
ATOM   6645 N  N     . ASP B 1 348 ? 126.844 -15.308 75.507  1.00 26.15 ? 435  ASP B N     1 
ATOM   6646 C  CA    . ASP B 1 348 ? 126.855 -16.383 74.508  1.00 26.90 ? 435  ASP B CA    1 
ATOM   6647 C  C     . ASP B 1 348 ? 125.956 -17.565 74.896  1.00 26.45 ? 435  ASP B C     1 
ATOM   6648 O  O     . ASP B 1 348 ? 126.120 -18.142 75.977  1.00 25.24 ? 435  ASP B O     1 
ATOM   6649 C  CB    . ASP B 1 348 ? 128.291 -16.862 74.301  1.00 28.94 ? 435  ASP B CB    1 
ATOM   6650 C  CG    . ASP B 1 348 ? 128.492 -17.584 72.978  1.00 30.91 ? 435  ASP B CG    1 
ATOM   6651 O  OD1   . ASP B 1 348 ? 127.572 -18.294 72.506  1.00 30.62 ? 435  ASP B OD1   1 
ATOM   6652 O  OD2   . ASP B 1 348 ? 129.599 -17.454 72.422  1.00 33.33 ? 435  ASP B OD2   1 
ATOM   6653 N  N     . PRO B 1 349 ? 125.011 -17.953 74.008  1.00 24.14 ? 436  PRO B N     1 
ATOM   6654 C  CA    . PRO B 1 349 ? 124.142 -19.093 74.342  1.00 24.13 ? 436  PRO B CA    1 
ATOM   6655 C  C     . PRO B 1 349 ? 124.915 -20.401 74.497  1.00 22.32 ? 436  PRO B C     1 
ATOM   6656 O  O     . PRO B 1 349 ? 124.433 -21.313 75.160  1.00 23.26 ? 436  PRO B O     1 
ATOM   6657 C  CB    . PRO B 1 349 ? 123.189 -19.190 73.134  1.00 25.18 ? 436  PRO B CB    1 
ATOM   6658 C  CG    . PRO B 1 349 ? 123.278 -17.864 72.458  1.00 26.02 ? 436  PRO B CG    1 
ATOM   6659 C  CD    . PRO B 1 349 ? 124.670 -17.369 72.693  1.00 25.50 ? 436  PRO B CD    1 
ATOM   6660 N  N     . LYS B 1 350 ? 126.096 -20.489 73.887  1.00 20.99 ? 437  LYS B N     1 
ATOM   6661 C  CA    . LYS B 1 350 ? 126.930 -21.689 74.005  1.00 21.12 ? 437  LYS B CA    1 
ATOM   6662 C  C     . LYS B 1 350 ? 127.475 -21.821 75.424  1.00 20.77 ? 437  LYS B C     1 
ATOM   6663 O  O     . LYS B 1 350 ? 127.791 -22.926 75.871  1.00 20.69 ? 437  LYS B O     1 
ATOM   6664 C  CB    . LYS B 1 350 ? 128.097 -21.649 73.020  1.00 24.43 ? 437  LYS B CB    1 
ATOM   6665 C  CG    . LYS B 1 350 ? 127.701 -21.804 71.553  1.00 27.82 ? 437  LYS B CG    1 
ATOM   6666 C  CD    . LYS B 1 350 ? 128.947 -21.813 70.670  1.00 30.55 ? 437  LYS B CD    1 
ATOM   6667 C  CE    . LYS B 1 350 ? 128.637 -22.238 69.244  1.00 32.71 ? 437  LYS B CE    1 
ATOM   6668 N  NZ    . LYS B 1 350 ? 127.656 -21.309 68.616  1.00 35.35 ? 437  LYS B NZ    1 
ATOM   6669 N  N     . LEU B 1 351 ? 127.563 -20.687 76.115  1.00 20.88 ? 438  LEU B N     1 
ATOM   6670 C  CA    . LEU B 1 351 ? 128.056 -20.650 77.501  1.00 20.83 ? 438  LEU B CA    1 
ATOM   6671 C  C     . LEU B 1 351 ? 126.955 -20.728 78.553  1.00 21.98 ? 438  LEU B C     1 
ATOM   6672 O  O     . LEU B 1 351 ? 127.235 -20.655 79.755  1.00 21.82 ? 438  LEU B O     1 
ATOM   6673 C  CB    . LEU B 1 351 ? 128.929 -19.401 77.720  1.00 20.58 ? 438  LEU B CB    1 
ATOM   6674 C  CG    . LEU B 1 351 ? 130.345 -19.450 77.132  1.00 19.95 ? 438  LEU B CG    1 
ATOM   6675 C  CD1   . LEU B 1 351 ? 131.084 -18.139 77.340  1.00 21.62 ? 438  LEU B CD1   1 
ATOM   6676 C  CD2   . LEU B 1 351 ? 131.136 -20.619 77.705  1.00 20.50 ? 438  LEU B CD2   1 
ATOM   6677 N  N     . LYS B 1 352 ? 125.709 -20.915 78.118  1.00 21.71 ? 439  LYS B N     1 
ATOM   6678 C  CA    . LYS B 1 352 ? 124.567 -20.876 79.039  1.00 22.79 ? 439  LYS B CA    1 
ATOM   6679 C  C     . LYS B 1 352 ? 124.625 -21.940 80.133  1.00 21.78 ? 439  LYS B C     1 
ATOM   6680 O  O     . LYS B 1 352 ? 124.300 -21.653 81.287  1.00 21.10 ? 439  LYS B O     1 
ATOM   6681 C  CB    . LYS B 1 352 ? 123.224 -20.968 78.295  1.00 25.07 ? 439  LYS B CB    1 
ATOM   6682 C  CG    . LYS B 1 352 ? 122.010 -21.051 79.226  1.00 28.64 ? 439  LYS B CG    1 
ATOM   6683 C  CD    . LYS B 1 352 ? 120.697 -21.103 78.420  1.00 31.97 ? 439  LYS B CD    1 
ATOM   6684 C  CE    . LYS B 1 352 ? 119.486 -20.976 79.335  1.00 34.17 ? 439  LYS B CE    1 
ATOM   6685 N  NZ    . LYS B 1 352 ? 119.055 -19.519 79.470  1.00 37.03 ? 439  LYS B NZ    1 
ATOM   6686 N  N     . ASP B 1 353 ? 125.002 -23.162 79.763  1.00 21.40 ? 440  ASP B N     1 
ATOM   6687 C  CA    . ASP B 1 353 ? 125.099 -24.260 80.723  1.00 21.81 ? 440  ASP B CA    1 
ATOM   6688 C  C     . ASP B 1 353 ? 126.182 -24.005 81.776  1.00 19.70 ? 440  ASP B C     1 
ATOM   6689 O  O     . ASP B 1 353 ? 125.944 -24.208 82.964  1.00 19.63 ? 440  ASP B O     1 
ATOM   6690 C  CB    . ASP B 1 353 ? 125.363 -25.583 80.018  1.00 24.06 ? 440  ASP B CB    1 
ATOM   6691 C  CG    . ASP B 1 353 ? 124.146 -26.092 79.263  1.00 27.72 ? 440  ASP B CG    1 
ATOM   6692 O  OD1   . ASP B 1 353 ? 123.008 -25.659 79.572  1.00 29.80 ? 440  ASP B OD1   1 
ATOM   6693 O  OD2   . ASP B 1 353 ? 124.337 -26.928 78.361  1.00 30.58 ? 440  ASP B OD2   1 
ATOM   6694 N  N     . ALA B 1 354 ? 127.353 -23.564 81.328  1.00 18.85 ? 441  ALA B N     1 
ATOM   6695 C  CA    . ALA B 1 354 ? 128.445 -23.194 82.239  1.00 19.01 ? 441  ALA B CA    1 
ATOM   6696 C  C     . ALA B 1 354 ? 128.000 -22.058 83.153  1.00 19.32 ? 441  ALA B C     1 
ATOM   6697 O  O     . ALA B 1 354 ? 128.138 -22.131 84.390  1.00 19.01 ? 441  ALA B O     1 
ATOM   6698 C  CB    . ALA B 1 354 ? 129.669 -22.788 81.442  1.00 19.23 ? 441  ALA B CB    1 
ATOM   6699 N  N     . ARG B 1 355 ? 127.444 -21.018 82.538  1.00 17.39 ? 442  ARG B N     1 
ATOM   6700 C  CA    . ARG B 1 355 ? 126.964 -19.830 83.244  1.00 18.93 ? 442  ARG B CA    1 
ATOM   6701 C  C     . ARG B 1 355 ? 125.910 -20.175 84.284  1.00 19.00 ? 442  ARG B C     1 
ATOM   6702 O  O     . ARG B 1 355 ? 125.919 -19.616 85.388  1.00 19.23 ? 442  ARG B O     1 
ATOM   6703 C  CB    . ARG B 1 355 ? 126.421 -18.819 82.223  1.00 20.38 ? 442  ARG B CB    1 
ATOM   6704 C  CG    . ARG B 1 355 ? 125.797 -17.556 82.785  1.00 22.74 ? 442  ARG B CG    1 
ATOM   6705 C  CD    . ARG B 1 355 ? 125.635 -16.521 81.672  1.00 23.33 ? 442  ARG B CD    1 
ATOM   6706 N  NE    . ARG B 1 355 ? 124.589 -16.872 80.703  1.00 23.74 ? 442  ARG B NE    1 
ATOM   6707 C  CZ    . ARG B 1 355 ? 124.778 -17.121 79.399  1.00 24.87 ? 442  ARG B CZ    1 
ATOM   6708 N  NH1   . ARG B 1 355 ? 125.987 -17.088 78.841  1.00 22.00 ? 442  ARG B NH1   1 
ATOM   6709 N  NH2   . ARG B 1 355 ? 123.729 -17.410 78.633  1.00 27.35 ? 442  ARG B NH2   1 
ATOM   6710 N  N     . GLU B 1 356 ? 125.009 -21.103 83.942  1.00 18.87 ? 443  GLU B N     1 
ATOM   6711 C  CA    . GLU B 1 356 ? 123.961 -21.539 84.860  1.00 19.43 ? 443  GLU B CA    1 
ATOM   6712 C  C     . GLU B 1 356 ? 124.531 -22.148 86.152  1.00 17.74 ? 443  GLU B C     1 
ATOM   6713 O  O     . GLU B 1 356 ? 123.991 -21.942 87.234  1.00 17.52 ? 443  GLU B O     1 
ATOM   6714 C  CB    . GLU B 1 356 ? 123.044 -22.556 84.178  1.00 23.74 ? 443  GLU B CB    1 
ATOM   6715 C  CG    . GLU B 1 356 ? 121.709 -22.743 84.877  1.00 28.86 ? 443  GLU B CG    1 
ATOM   6716 C  CD    . GLU B 1 356 ? 120.843 -21.499 84.798  1.00 32.83 ? 443  GLU B CD    1 
ATOM   6717 O  OE1   . GLU B 1 356 ? 120.030 -21.287 85.727  1.00 38.10 ? 443  GLU B OE1   1 
ATOM   6718 O  OE2   . GLU B 1 356 ? 120.980 -20.729 83.813  1.00 35.36 ? 443  GLU B OE2   1 
ATOM   6719 N  N     . ILE B 1 357 ? 125.609 -22.913 86.024  1.00 15.30 ? 444  ILE B N     1 
ATOM   6720 C  CA    . ILE B 1 357 ? 126.229 -23.530 87.192  1.00 15.49 ? 444  ILE B CA    1 
ATOM   6721 C  C     . ILE B 1 357 ? 126.798 -22.446 88.131  1.00 13.58 ? 444  ILE B C     1 
ATOM   6722 O  O     . ILE B 1 357 ? 126.577 -22.498 89.352  1.00 15.20 ? 444  ILE B O     1 
ATOM   6723 C  CB    . ILE B 1 357 ? 127.316 -24.536 86.785  1.00 15.58 ? 444  ILE B CB    1 
ATOM   6724 C  CG1   . ILE B 1 357 ? 126.692 -25.700 86.002  1.00 18.17 ? 444  ILE B CG1   1 
ATOM   6725 C  CG2   . ILE B 1 357 ? 128.024 -25.099 88.024  1.00 15.45 ? 444  ILE B CG2   1 
ATOM   6726 C  CD1   . ILE B 1 357 ? 127.708 -26.601 85.315  1.00 19.48 ? 444  ILE B CD1   1 
ATOM   6727 N  N     . LEU B 1 358 ? 127.492 -21.463 87.566  1.00 12.93 ? 445  LEU B N     1 
ATOM   6728 C  CA    . LEU B 1 358 ? 128.059 -20.383 88.395  1.00 13.36 ? 445  LEU B CA    1 
ATOM   6729 C  C     . LEU B 1 358 ? 126.986 -19.538 89.045  1.00 14.07 ? 445  LEU B C     1 
ATOM   6730 O  O     . LEU B 1 358 ? 127.135 -19.081 90.181  1.00 13.08 ? 445  LEU B O     1 
ATOM   6731 C  CB    . LEU B 1 358 ? 129.037 -19.501 87.610  1.00 12.41 ? 445  LEU B CB    1 
ATOM   6732 C  CG    . LEU B 1 358 ? 130.247 -20.226 87.004  1.00 12.92 ? 445  LEU B CG    1 
ATOM   6733 C  CD1   . LEU B 1 358 ? 131.231 -19.225 86.429  1.00 12.75 ? 445  LEU B CD1   1 
ATOM   6734 C  CD2   . LEU B 1 358 ? 130.959 -21.150 87.982  1.00 11.70 ? 445  LEU B CD2   1 
ATOM   6735 N  N     . LYS B 1 359 ? 125.874 -19.351 88.341  1.00 14.54 ? 446  LYS B N     1 
ATOM   6736 C  CA    . LYS B 1 359 ? 124.757 -18.634 88.912  1.00 16.27 ? 446  LYS B CA    1 
ATOM   6737 C  C     . LYS B 1 359 ? 124.170 -19.385 90.100  1.00 15.85 ? 446  LYS B C     1 
ATOM   6738 O  O     . LYS B 1 359 ? 123.773 -18.772 91.103  1.00 16.96 ? 446  LYS B O     1 
ATOM   6739 C  CB    . LYS B 1 359 ? 123.715 -18.298 87.821  1.00 19.29 ? 446  LYS B CB    1 
ATOM   6740 C  CG    . LYS B 1 359 ? 124.226 -17.217 86.870  1.00 23.20 ? 446  LYS B CG    1 
ATOM   6741 C  CD    . LYS B 1 359 ? 123.185 -16.722 85.870  1.00 26.95 ? 446  LYS B CD    1 
ATOM   6742 C  CE    . LYS B 1 359 ? 123.726 -15.518 85.104  1.00 29.94 ? 446  LYS B CE    1 
ATOM   6743 N  NZ    . LYS B 1 359 ? 122.822 -15.068 84.005  1.00 32.45 ? 446  LYS B NZ    1 
ATOM   6744 N  N     . GLN B 1 360 ? 124.144 -20.715 90.029  1.00 15.35 ? 447  GLN B N     1 
ATOM   6745 C  CA    . GLN B 1 360 ? 123.614 -21.486 91.145  1.00 16.35 ? 447  GLN B CA    1 
ATOM   6746 C  C     . GLN B 1 360 ? 124.508 -21.340 92.380  1.00 15.33 ? 447  GLN B C     1 
ATOM   6747 O  O     . GLN B 1 360 ? 124.009 -21.279 93.492  1.00 15.17 ? 447  GLN B O     1 
ATOM   6748 C  CB    . GLN B 1 360 ? 123.372 -22.957 90.787  1.00 19.48 ? 447  GLN B CB    1 
ATOM   6749 C  CG    . GLN B 1 360 ? 122.211 -23.180 89.800  1.00 21.66 ? 447  GLN B CG    1 
ATOM   6750 C  CD    . GLN B 1 360 ? 121.125 -22.118 89.887  1.00 23.60 ? 447  GLN B CD    1 
ATOM   6751 O  OE1   . GLN B 1 360 ? 120.447 -21.968 90.913  1.00 24.30 ? 447  GLN B OE1   1 
ATOM   6752 N  NE2   . GLN B 1 360 ? 120.954 -21.364 88.796  1.00 26.99 ? 447  GLN B NE2   1 
ATOM   6753 N  N     . ILE B 1 361 ? 125.817 -21.243 92.166  1.00 14.03 ? 448  ILE B N     1 
ATOM   6754 C  CA    . ILE B 1 361 ? 126.749 -20.920 93.277  1.00 12.27 ? 448  ILE B CA    1 
ATOM   6755 C  C     . ILE B 1 361 ? 126.387 -19.582 93.943  1.00 12.04 ? 448  ILE B C     1 
ATOM   6756 O  O     . ILE B 1 361 ? 126.320 -19.493 95.174  1.00 11.19 ? 448  ILE B O     1 
ATOM   6757 C  CB    . ILE B 1 361 ? 128.221 -20.909 92.815  1.00 12.52 ? 448  ILE B CB    1 
ATOM   6758 C  CG1   . ILE B 1 361 ? 128.640 -22.290 92.291  1.00 12.50 ? 448  ILE B CG1   1 
ATOM   6759 C  CG2   . ILE B 1 361 ? 129.133 -20.452 93.966  1.00 12.43 ? 448  ILE B CG2   1 
ATOM   6760 C  CD1   . ILE B 1 361 ? 130.041 -22.348 91.710  1.00 11.54 ? 448  ILE B CD1   1 
ATOM   6761 N  N     . GLU B 1 362 ? 126.141 -18.542 93.148  1.00 13.07 ? 449  GLU B N     1 
ATOM   6762 C  CA    . GLU B 1 362 ? 125.816 -17.219 93.693  1.00 13.94 ? 449  GLU B CA    1 
ATOM   6763 C  C     . GLU B 1 362 ? 124.542 -17.221 94.526  1.00 13.70 ? 449  GLU B C     1 
ATOM   6764 O  O     . GLU B 1 362 ? 124.454 -16.535 95.540  1.00 13.48 ? 449  GLU B O     1 
ATOM   6765 C  CB    . GLU B 1 362 ? 125.653 -16.190 92.576  1.00 14.85 ? 449  GLU B CB    1 
ATOM   6766 C  CG    . GLU B 1 362 ? 126.904 -15.889 91.789  1.00 16.42 ? 449  GLU B CG    1 
ATOM   6767 C  CD    . GLU B 1 362 ? 126.865 -14.479 91.242  1.00 17.48 ? 449  GLU B CD    1 
ATOM   6768 O  OE1   . GLU B 1 362 ? 127.730 -13.650 91.636  1.00 15.55 ? 449  GLU B OE1   1 
ATOM   6769 O  OE2   . GLU B 1 362 ? 125.943 -14.208 90.435  1.00 16.90 ? 449  GLU B OE2   1 
ATOM   6770 N  N     . TYR B 1 363 ? 123.540 -17.974 94.076  1.00 13.11 ? 450  TYR B N     1 
ATOM   6771 C  CA    . TYR B 1 363 ? 122.294 -18.115 94.830  1.00 13.33 ? 450  TYR B CA    1 
ATOM   6772 C  C     . TYR B 1 363 ? 122.415 -19.107 95.980  1.00 11.82 ? 450  TYR B C     1 
ATOM   6773 O  O     . TYR B 1 363 ? 121.483 -19.271 96.769  1.00 12.50 ? 450  TYR B O     1 
ATOM   6774 C  CB    . TYR B 1 363 ? 121.152 -18.544 93.899  1.00 16.06 ? 450  TYR B CB    1 
ATOM   6775 C  CG    . TYR B 1 363 ? 120.678 -17.448 92.972  1.00 17.63 ? 450  TYR B CG    1 
ATOM   6776 C  CD1   . TYR B 1 363 ? 119.918 -16.389 93.452  1.00 19.21 ? 450  TYR B CD1   1 
ATOM   6777 C  CD2   . TYR B 1 363 ? 120.979 -17.488 91.613  1.00 20.25 ? 450  TYR B CD2   1 
ATOM   6778 C  CE1   . TYR B 1 363 ? 119.473 -15.384 92.607  1.00 20.33 ? 450  TYR B CE1   1 
ATOM   6779 C  CE2   . TYR B 1 363 ? 120.546 -16.486 90.755  1.00 21.35 ? 450  TYR B CE2   1 
ATOM   6780 C  CZ    . TYR B 1 363 ? 119.796 -15.440 91.258  1.00 21.07 ? 450  TYR B CZ    1 
ATOM   6781 O  OH    . TYR B 1 363 ? 119.363 -14.452 90.403  1.00 21.84 ? 450  TYR B OH    1 
ATOM   6782 N  N     . ARG B 1 364 ? 123.569 -19.772 96.072  1.00 11.78 ? 451  ARG B N     1 
ATOM   6783 C  CA    . ARG B 1 364 ? 123.847 -20.769 97.117  1.00 11.27 ? 451  ARG B CA    1 
ATOM   6784 C  C     . ARG B 1 364 ? 122.898 -21.962 96.997  1.00 12.70 ? 451  ARG B C     1 
ATOM   6785 O  O     . ARG B 1 364 ? 122.439 -22.539 97.993  1.00 12.90 ? 451  ARG B O     1 
ATOM   6786 C  CB    . ARG B 1 364 ? 123.816 -20.145 98.524  1.00 10.67 ? 451  ARG B CB    1 
ATOM   6787 C  CG    . ARG B 1 364 ? 124.762 -20.816 99.535  1.00 10.13 ? 451  ARG B CG    1 
ATOM   6788 C  CD    . ARG B 1 364 ? 126.214 -20.364 99.309  1.00 8.99  ? 451  ARG B CD    1 
ATOM   6789 N  NE    . ARG B 1 364 ? 127.113 -20.901 100.343 1.00 8.75  ? 451  ARG B NE    1 
ATOM   6790 C  CZ    . ARG B 1 364 ? 128.392 -20.575 100.475 1.00 8.21  ? 451  ARG B CZ    1 
ATOM   6791 N  NH1   . ARG B 1 364 ? 128.974 -19.741 99.604  1.00 8.63  ? 451  ARG B NH1   1 
ATOM   6792 N  NH2   . ARG B 1 364 ? 129.102 -21.106 101.472 1.00 8.12  ? 451  ARG B NH2   1 
ATOM   6793 N  N     . ASN B 1 365 ? 122.582 -22.292 95.752  1.00 12.85 ? 452  ASN B N     1 
ATOM   6794 C  CA    . ASN B 1 365 ? 121.898 -23.525 95.415  1.00 13.90 ? 452  ASN B CA    1 
ATOM   6795 C  C     . ASN B 1 365 ? 122.966 -24.567 95.103  1.00 13.27 ? 452  ASN B C     1 
ATOM   6796 O  O     . ASN B 1 365 ? 123.196 -24.932 93.945  1.00 14.36 ? 452  ASN B O     1 
ATOM   6797 C  CB    . ASN B 1 365 ? 120.997 -23.263 94.201  1.00 16.14 ? 452  ASN B CB    1 
ATOM   6798 C  CG    . ASN B 1 365 ? 120.223 -24.491 93.764  1.00 19.80 ? 452  ASN B CG    1 
ATOM   6799 O  OD1   . ASN B 1 365 ? 119.994 -25.411 94.551  1.00 22.97 ? 452  ASN B OD1   1 
ATOM   6800 N  ND2   . ASN B 1 365 ? 119.813 -24.510 92.490  1.00 21.37 ? 452  ASN B ND2   1 
ATOM   6801 N  N     . LEU B 1 366 ? 123.675 -25.009 96.144  1.00 12.65 ? 453  LEU B N     1 
ATOM   6802 C  CA    . LEU B 1 366 ? 124.781 -25.943 95.970  1.00 11.55 ? 453  LEU B CA    1 
ATOM   6803 C  C     . LEU B 1 366 ? 124.301 -27.396 96.037  1.00 12.49 ? 453  LEU B C     1 
ATOM   6804 O  O     . LEU B 1 366 ? 123.265 -27.685 96.633  1.00 13.83 ? 453  LEU B O     1 
ATOM   6805 C  CB    . LEU B 1 366 ? 125.816 -25.717 97.087  1.00 10.99 ? 453  LEU B CB    1 
ATOM   6806 C  CG    . LEU B 1 366 ? 126.198 -24.254 97.332  1.00 9.99  ? 453  LEU B CG    1 
ATOM   6807 C  CD1   . LEU B 1 366 ? 127.210 -24.159 98.483  1.00 10.36 ? 453  LEU B CD1   1 
ATOM   6808 C  CD2   . LEU B 1 366 ? 126.792 -23.645 96.059  1.00 10.68 ? 453  LEU B CD2   1 
ATOM   6809 N  N     . PHE B 1 367 ? 125.090 -28.304 95.484  1.00 12.58 ? 454  PHE B N     1 
ATOM   6810 C  CA    . PHE B 1 367 ? 124.847 -29.737 95.690  1.00 13.06 ? 454  PHE B CA    1 
ATOM   6811 C  C     . PHE B 1 367 ? 124.850 -30.002 97.183  1.00 13.47 ? 454  PHE B C     1 
ATOM   6812 O  O     . PHE B 1 367 ? 125.592 -29.349 97.929  1.00 13.22 ? 454  PHE B O     1 
ATOM   6813 C  CB    . PHE B 1 367 ? 125.902 -30.572 94.995  1.00 13.81 ? 454  PHE B CB    1 
ATOM   6814 C  CG    . PHE B 1 367 ? 126.008 -30.307 93.512  1.00 14.22 ? 454  PHE B CG    1 
ATOM   6815 C  CD1   . PHE B 1 367 ? 124.904 -29.866 92.783  1.00 16.04 ? 454  PHE B CD1   1 
ATOM   6816 C  CD2   . PHE B 1 367 ? 127.194 -30.536 92.841  1.00 15.69 ? 454  PHE B CD2   1 
ATOM   6817 C  CE1   . PHE B 1 367 ? 124.998 -29.636 91.419  1.00 16.61 ? 454  PHE B CE1   1 
ATOM   6818 C  CE2   . PHE B 1 367 ? 127.295 -30.313 91.477  1.00 17.08 ? 454  PHE B CE2   1 
ATOM   6819 C  CZ    . PHE B 1 367 ? 126.194 -29.863 90.766  1.00 16.90 ? 454  PHE B CZ    1 
ATOM   6820 N  N     . LYS B 1 368 ? 124.017 -30.936 97.625  1.00 13.60 ? 455  LYS B N     1 
ATOM   6821 C  CA    . LYS B 1 368 ? 123.844 -31.173 99.050  1.00 14.60 ? 455  LYS B CA    1 
ATOM   6822 C  C     . LYS B 1 368 ? 124.816 -32.201 99.593  1.00 13.88 ? 455  LYS B C     1 
ATOM   6823 O  O     . LYS B 1 368 ? 124.978 -33.278 99.035  1.00 14.15 ? 455  LYS B O     1 
ATOM   6824 C  CB    . LYS B 1 368 ? 122.405 -31.630 99.367  1.00 17.00 ? 455  LYS B CB    1 
ATOM   6825 C  CG    . LYS B 1 368 ? 121.305 -30.633 99.009  1.00 19.16 ? 455  LYS B CG    1 
ATOM   6826 C  CD    . LYS B 1 368 ? 121.557 -29.227 99.548  1.00 19.76 ? 455  LYS B CD    1 
ATOM   6827 C  CE    . LYS B 1 368 ? 121.650 -29.196 101.068 1.00 21.35 ? 455  LYS B CE    1 
ATOM   6828 N  NZ    . LYS B 1 368 ? 121.894 -27.806 101.547 1.00 21.91 ? 455  LYS B NZ    1 
ATOM   6829 N  N     . TYR B 1 369 ? 125.443 -31.878 100.714 1.00 12.46 ? 456  TYR B N     1 
ATOM   6830 C  CA    . TYR B 1 369 ? 126.288 -32.827 101.392 1.00 12.55 ? 456  TYR B CA    1 
ATOM   6831 C  C     . TYR B 1 369 ? 125.439 -33.889 102.094 1.00 13.12 ? 456  TYR B C     1 
ATOM   6832 O  O     . TYR B 1 369 ? 124.508 -33.567 102.830 1.00 13.84 ? 456  TYR B O     1 
ATOM   6833 C  CB    . TYR B 1 369 ? 127.136 -32.067 102.400 1.00 12.51 ? 456  TYR B CB    1 
ATOM   6834 C  CG    . TYR B 1 369 ? 128.001 -32.902 103.292 1.00 13.22 ? 456  TYR B CG    1 
ATOM   6835 C  CD1   . TYR B 1 369 ? 129.113 -33.572 102.792 1.00 12.94 ? 456  TYR B CD1   1 
ATOM   6836 C  CD2   . TYR B 1 369 ? 127.743 -32.975 104.654 1.00 14.09 ? 456  TYR B CD2   1 
ATOM   6837 C  CE1   . TYR B 1 369 ? 129.923 -34.324 103.623 1.00 14.64 ? 456  TYR B CE1   1 
ATOM   6838 C  CE2   . TYR B 1 369 ? 128.558 -33.715 105.500 1.00 15.62 ? 456  TYR B CE2   1 
ATOM   6839 C  CZ    . TYR B 1 369 ? 129.648 -34.381 104.976 1.00 15.58 ? 456  TYR B CZ    1 
ATOM   6840 O  OH    . TYR B 1 369 ? 130.459 -35.103 105.811 1.00 18.88 ? 456  TYR B OH    1 
ATOM   6841 N  N     . VAL B 1 370 ? 125.773 -35.151 101.845 1.00 12.35 ? 457  VAL B N     1 
ATOM   6842 C  CA    . VAL B 1 370 ? 125.027 -36.277 102.382 1.00 12.94 ? 457  VAL B CA    1 
ATOM   6843 C  C     . VAL B 1 370 ? 125.766 -36.872 103.566 1.00 14.19 ? 457  VAL B C     1 
ATOM   6844 O  O     . VAL B 1 370 ? 125.179 -37.109 104.624 1.00 15.59 ? 457  VAL B O     1 
ATOM   6845 C  CB    . VAL B 1 370 ? 124.773 -37.349 101.299 1.00 13.40 ? 457  VAL B CB    1 
ATOM   6846 C  CG1   . VAL B 1 370 ? 123.977 -38.498 101.888 1.00 14.16 ? 457  VAL B CG1   1 
ATOM   6847 C  CG2   . VAL B 1 370 ? 124.029 -36.729 100.107 1.00 13.02 ? 457  VAL B CG2   1 
ATOM   6848 N  N     . GLY B 1 371 ? 127.063 -37.106 103.399 1.00 13.52 ? 458  GLY B N     1 
ATOM   6849 C  CA    . GLY B 1 371 ? 127.869 -37.504 104.537 1.00 14.49 ? 458  GLY B CA    1 
ATOM   6850 C  C     . GLY B 1 371 ? 129.269 -37.939 104.229 1.00 13.89 ? 458  GLY B C     1 
ATOM   6851 O  O     . GLY B 1 371 ? 129.727 -37.850 103.094 1.00 13.76 ? 458  GLY B O     1 
ATOM   6852 N  N     . GLU B 1 372 ? 129.950 -38.411 105.268 1.00 14.48 ? 459  GLU B N     1 
ATOM   6853 C  CA    . GLU B 1 372 ? 131.331 -38.841 105.167 1.00 14.22 ? 459  GLU B CA    1 
ATOM   6854 C  C     . GLU B 1 372 ? 131.490 -40.206 105.816 1.00 13.27 ? 459  GLU B C     1 
ATOM   6855 O  O     . GLU B 1 372 ? 130.850 -40.505 106.819 1.00 13.92 ? 459  GLU B O     1 
ATOM   6856 C  CB    . GLU B 1 372 ? 132.244 -37.822 105.871 1.00 16.97 ? 459  GLU B CB    1 
ATOM   6857 C  CG    . GLU B 1 372 ? 133.726 -38.167 105.848 1.00 19.55 ? 459  GLU B CG    1 
ATOM   6858 C  CD    . GLU B 1 372 ? 134.561 -37.162 106.622 1.00 21.90 ? 459  GLU B CD    1 
ATOM   6859 O  OE1   . GLU B 1 372 ? 134.517 -37.177 107.873 1.00 25.64 ? 459  GLU B OE1   1 
ATOM   6860 O  OE2   . GLU B 1 372 ? 135.268 -36.362 105.972 1.00 19.49 ? 459  GLU B OE2   1 
ATOM   6861 N  N     . THR B 1 373 ? 132.348 -41.025 105.236 1.00 12.15 ? 460  THR B N     1 
ATOM   6862 C  CA    . THR B 1 373 ? 132.670 -42.324 105.797 1.00 12.35 ? 460  THR B CA    1 
ATOM   6863 C  C     . THR B 1 373 ? 134.119 -42.614 105.469 1.00 12.73 ? 460  THR B C     1 
ATOM   6864 O  O     . THR B 1 373 ? 134.764 -41.825 104.771 1.00 13.52 ? 460  THR B O     1 
ATOM   6865 C  CB    . THR B 1 373 ? 131.726 -43.429 105.251 1.00 11.83 ? 460  THR B CB    1 
ATOM   6866 O  OG1   . THR B 1 373 ? 131.986 -44.667 105.930 1.00 12.33 ? 460  THR B OG1   1 
ATOM   6867 C  CG2   . THR B 1 373 ? 131.925 -43.612 103.740 1.00 11.98 ? 460  THR B CG2   1 
ATOM   6868 N  N     . GLN B 1 374 ? 134.630 -43.731 105.979 1.00 12.24 ? 461  GLN B N     1 
ATOM   6869 C  CA    . GLN B 1 374 ? 135.974 -44.193 105.677 1.00 14.09 ? 461  GLN B CA    1 
ATOM   6870 C  C     . GLN B 1 374 ? 135.978 -45.708 105.505 1.00 15.47 ? 461  GLN B C     1 
ATOM   6871 O  O     . GLN B 1 374 ? 135.116 -46.397 106.066 1.00 15.39 ? 461  GLN B O     1 
ATOM   6872 C  CB    . GLN B 1 374 ? 136.921 -43.887 106.836 1.00 15.88 ? 461  GLN B CB    1 
ATOM   6873 C  CG    . GLN B 1 374 ? 137.129 -42.415 107.175 1.00 17.18 ? 461  GLN B CG    1 
ATOM   6874 C  CD    . GLN B 1 374 ? 138.264 -42.270 108.171 1.00 18.91 ? 461  GLN B CD    1 
ATOM   6875 O  OE1   . GLN B 1 374 ? 138.040 -42.209 109.371 1.00 19.56 ? 461  GLN B OE1   1 
ATOM   6876 N  NE2   . GLN B 1 374 ? 139.494 -42.278 107.674 1.00 20.76 ? 461  GLN B NE2   1 
ATOM   6877 N  N     . PRO B 1 375 ? 136.960 -46.235 104.756 1.00 17.86 ? 462  PRO B N     1 
ATOM   6878 C  CA    . PRO B 1 375 ? 137.156 -47.683 104.699 1.00 20.55 ? 462  PRO B CA    1 
ATOM   6879 C  C     . PRO B 1 375 ? 137.548 -48.234 106.067 1.00 22.96 ? 462  PRO B C     1 
ATOM   6880 O  O     . PRO B 1 375 ? 138.022 -47.479 106.922 1.00 20.86 ? 462  PRO B O     1 
ATOM   6881 C  CB    . PRO B 1 375 ? 138.333 -47.844 103.727 1.00 21.12 ? 462  PRO B CB    1 
ATOM   6882 C  CG    . PRO B 1 375 ? 138.384 -46.586 102.950 1.00 20.52 ? 462  PRO B CG    1 
ATOM   6883 C  CD    . PRO B 1 375 ? 137.905 -45.517 103.881 1.00 18.24 ? 462  PRO B CD    1 
ATOM   6884 N  N     . THR B 1 376 ? 137.328 -49.536 106.273 1.00 26.75 ? 463  THR B N     1 
ATOM   6885 C  CA    . THR B 1 376 ? 137.760 -50.223 107.494 1.00 28.18 ? 463  THR B CA    1 
ATOM   6886 C  C     . THR B 1 376 ? 138.879 -51.209 107.158 1.00 33.64 ? 463  THR B C     1 
ATOM   6887 O  O     . THR B 1 376 ? 139.164 -51.450 105.983 1.00 35.09 ? 463  THR B O     1 
ATOM   6888 C  CB    . THR B 1 376 ? 136.595 -50.960 108.190 1.00 30.21 ? 463  THR B CB    1 
ATOM   6889 O  OG1   . THR B 1 376 ? 135.925 -51.804 107.241 1.00 32.36 ? 463  THR B OG1   1 
ATOM   6890 C  CG2   . THR B 1 376 ? 135.594 -49.960 108.772 1.00 28.48 ? 463  THR B CG2   1 
ATOM   6891 N  N     . GLY B 1 377 ? 139.509 -51.773 108.188 1.00 37.54 ? 464  GLY B N     1 
ATOM   6892 C  CA    . GLY B 1 377 ? 140.683 -52.630 108.010 1.00 41.91 ? 464  GLY B CA    1 
ATOM   6893 C  C     . GLY B 1 377 ? 141.831 -51.852 107.382 1.00 45.96 ? 464  GLY B C     1 
ATOM   6894 O  O     . GLY B 1 377 ? 142.018 -50.665 107.668 1.00 48.03 ? 464  GLY B O     1 
ATOM   6895 N  N     . GLN B 1 378 ? 142.602 -52.522 106.526 1.00 49.08 ? 465  GLN B N     1 
ATOM   6896 C  CA    . GLN B 1 378 ? 143.632 -51.850 105.731 1.00 50.06 ? 465  GLN B CA    1 
ATOM   6897 C  C     . GLN B 1 378 ? 143.202 -51.703 104.276 1.00 49.04 ? 465  GLN B C     1 
ATOM   6898 O  O     . GLN B 1 378 ? 144.040 -51.531 103.391 1.00 50.78 ? 465  GLN B O     1 
ATOM   6899 C  CB    . GLN B 1 378 ? 144.983 -52.569 105.844 1.00 52.22 ? 465  GLN B CB    1 
ATOM   6900 C  CG    . GLN B 1 378 ? 145.966 -51.908 106.806 1.00 54.38 ? 465  GLN B CG    1 
ATOM   6901 C  CD    . GLN B 1 378 ? 145.438 -51.812 108.233 1.00 56.08 ? 465  GLN B CD    1 
ATOM   6902 O  OE1   . GLN B 1 378 ? 145.426 -50.729 108.830 1.00 58.07 ? 465  GLN B OE1   1 
ATOM   6903 N  NE2   . GLN B 1 378 ? 144.994 -52.944 108.786 1.00 56.23 ? 465  GLN B NE2   1 
ATOM   6904 N  N     . ILE B 1 379 ? 141.889 -51.765 104.047 1.00 46.53 ? 466  ILE B N     1 
ATOM   6905 C  CA    . ILE B 1 379 ? 141.301 -51.579 102.717 1.00 44.04 ? 466  ILE B CA    1 
ATOM   6906 C  C     . ILE B 1 379 ? 141.532 -50.145 102.238 1.00 41.05 ? 466  ILE B C     1 
ATOM   6907 O  O     . ILE B 1 379 ? 141.250 -49.186 102.964 1.00 39.85 ? 466  ILE B O     1 
ATOM   6908 C  CB    . ILE B 1 379 ? 139.789 -51.925 102.714 1.00 43.63 ? 466  ILE B CB    1 
ATOM   6909 C  CG1   . ILE B 1 379 ? 139.580 -53.442 102.700 1.00 45.64 ? 466  ILE B CG1   1 
ATOM   6910 C  CG2   . ILE B 1 379 ? 139.061 -51.311 101.520 1.00 44.47 ? 466  ILE B CG2   1 
ATOM   6911 C  CD1   . ILE B 1 379 ? 139.308 -54.053 104.061 1.00 45.54 ? 466  ILE B CD1   1 
ATOM   6912 N  N     . LYS B 1 380 ? 142.085 -50.011 101.035 1.00 37.83 ? 467  LYS B N     1 
ATOM   6913 C  CA    . LYS B 1 380 ? 142.272 -48.705 100.415 1.00 36.27 ? 467  LYS B CA    1 
ATOM   6914 C  C     . LYS B 1 380 ? 141.459 -48.624 99.133  1.00 34.17 ? 467  LYS B C     1 
ATOM   6915 O  O     . LYS B 1 380 ? 141.397 -49.595 98.383  1.00 36.96 ? 467  LYS B O     1 
ATOM   6916 C  CB    . LYS B 1 380 ? 143.748 -48.440 100.111 1.00 37.18 ? 467  LYS B CB    1 
ATOM   6917 C  CG    . LYS B 1 380 ? 144.068 -46.957 99.993  1.00 38.95 ? 467  LYS B CG    1 
ATOM   6918 C  CD    . LYS B 1 380 ? 145.451 -46.667 99.428  1.00 40.63 ? 467  LYS B CD    1 
ATOM   6919 C  CE    . LYS B 1 380 ? 145.622 -45.169 99.201  1.00 40.47 ? 467  LYS B CE    1 
ATOM   6920 N  NZ    . LYS B 1 380 ? 146.856 -44.840 98.437  1.00 41.73 ? 467  LYS B NZ    1 
ATOM   6921 N  N     . ILE B 1 381 ? 140.831 -47.472 98.892  1.00 29.01 ? 468  ILE B N     1 
ATOM   6922 C  CA    . ILE B 1 381 ? 140.120 -47.235 97.636  1.00 27.77 ? 468  ILE B CA    1 
ATOM   6923 C  C     . ILE B 1 381 ? 141.128 -46.843 96.565  1.00 28.38 ? 468  ILE B C     1 
ATOM   6924 O  O     . ILE B 1 381 ? 141.863 -45.872 96.731  1.00 27.28 ? 468  ILE B O     1 
ATOM   6925 C  CB    . ILE B 1 381 ? 139.035 -46.130 97.764  1.00 26.76 ? 468  ILE B CB    1 
ATOM   6926 C  CG1   . ILE B 1 381 ? 138.081 -46.410 98.934  1.00 25.13 ? 468  ILE B CG1   1 
ATOM   6927 C  CG2   . ILE B 1 381 ? 138.256 -45.979 96.465  1.00 24.94 ? 468  ILE B CG2   1 
ATOM   6928 C  CD1   . ILE B 1 381 ? 137.349 -47.739 98.869  1.00 27.24 ? 468  ILE B CD1   1 
ATOM   6929 N  N     . LYS B 1 382 ? 141.160 -47.602 95.470  1.00 29.00 ? 469  LYS B N     1 
ATOM   6930 C  CA    . LYS B 1 382 ? 142.095 -47.338 94.365  1.00 31.36 ? 469  LYS B CA    1 
ATOM   6931 C  C     . LYS B 1 382 ? 141.597 -46.196 93.479  1.00 30.27 ? 469  LYS B C     1 
ATOM   6932 O  O     . LYS B 1 382 ? 140.392 -46.077 93.248  1.00 29.14 ? 469  LYS B O     1 
ATOM   6933 C  CB    . LYS B 1 382 ? 142.304 -48.606 93.525  1.00 32.49 ? 469  LYS B CB    1 
ATOM   6934 C  CG    . LYS B 1 382 ? 142.423 -49.880 94.347  1.00 35.11 ? 469  LYS B CG    1 
ATOM   6935 C  CD    . LYS B 1 382 ? 143.119 -50.997 93.587  1.00 38.05 ? 469  LYS B CD    1 
ATOM   6936 C  CE    . LYS B 1 382 ? 142.936 -52.323 94.316  1.00 39.50 ? 469  LYS B CE    1 
ATOM   6937 N  NZ    . LYS B 1 382 ? 143.899 -53.359 93.838  1.00 41.35 ? 469  LYS B NZ    1 
ATOM   6938 N  N     . ARG B 1 383 ? 142.523 -45.368 92.983  1.00 32.35 ? 470  ARG B N     1 
ATOM   6939 C  CA    . ARG B 1 383 ? 142.194 -44.214 92.131  1.00 35.57 ? 470  ARG B CA    1 
ATOM   6940 C  C     . ARG B 1 383 ? 141.426 -44.623 90.878  1.00 35.86 ? 470  ARG B C     1 
ATOM   6941 O  O     . ARG B 1 383 ? 140.557 -43.887 90.396  1.00 33.26 ? 470  ARG B O     1 
ATOM   6942 C  CB    . ARG B 1 383 ? 143.460 -43.456 91.715  1.00 38.62 ? 470  ARG B CB    1 
ATOM   6943 C  CG    . ARG B 1 383 ? 144.332 -43.002 92.877  1.00 42.92 ? 470  ARG B CG    1 
ATOM   6944 C  CD    . ARG B 1 383 ? 145.427 -42.049 92.416  1.00 46.13 ? 470  ARG B CD    1 
ATOM   6945 N  NE    . ARG B 1 383 ? 145.657 -41.001 93.411  1.00 48.41 ? 470  ARG B NE    1 
ATOM   6946 C  CZ    . ARG B 1 383 ? 145.003 -39.841 93.443  1.00 49.32 ? 470  ARG B CZ    1 
ATOM   6947 N  NH1   . ARG B 1 383 ? 144.079 -39.560 92.530  1.00 49.41 ? 470  ARG B NH1   1 
ATOM   6948 N  NH2   . ARG B 1 383 ? 145.275 -38.956 94.391  1.00 49.30 ? 470  ARG B NH2   1 
ATOM   6949 N  N     . GLU B 1 384 ? 141.761 -45.802 90.359  1.00 37.86 ? 471  GLU B N     1 
ATOM   6950 C  CA    . GLU B 1 384 ? 141.122 -46.343 89.166  1.00 39.20 ? 471  GLU B CA    1 
ATOM   6951 C  C     . GLU B 1 384 ? 139.654 -46.703 89.416  1.00 37.76 ? 471  GLU B C     1 
ATOM   6952 O  O     . GLU B 1 384 ? 138.892 -46.893 88.466  1.00 39.02 ? 471  GLU B O     1 
ATOM   6953 C  CB    . GLU B 1 384 ? 141.916 -47.540 88.603  1.00 42.18 ? 471  GLU B CB    1 
ATOM   6954 C  CG    . GLU B 1 384 ? 142.281 -48.636 89.608  1.00 45.80 ? 471  GLU B CG    1 
ATOM   6955 C  CD    . GLU B 1 384 ? 143.625 -48.417 90.304  1.00 48.29 ? 471  GLU B CD    1 
ATOM   6956 O  OE1   . GLU B 1 384 ? 143.976 -47.260 90.631  1.00 50.39 ? 471  GLU B OE1   1 
ATOM   6957 O  OE2   . GLU B 1 384 ? 144.334 -49.418 90.549  1.00 50.75 ? 471  GLU B OE2   1 
ATOM   6958 N  N     . ASP B 1 385 ? 139.261 -46.778 90.689  1.00 35.02 ? 472  ASP B N     1 
ATOM   6959 C  CA    . ASP B 1 385 ? 137.894 -47.150 91.056  1.00 30.85 ? 472  ASP B CA    1 
ATOM   6960 C  C     . ASP B 1 385 ? 137.007 -45.981 91.490  1.00 28.15 ? 472  ASP B C     1 
ATOM   6961 O  O     . ASP B 1 385 ? 135.816 -46.181 91.740  1.00 25.23 ? 472  ASP B O     1 
ATOM   6962 C  CB    . ASP B 1 385 ? 137.895 -48.248 92.130  1.00 32.77 ? 472  ASP B CB    1 
ATOM   6963 C  CG    . ASP B 1 385 ? 138.568 -49.533 91.655  1.00 35.69 ? 472  ASP B CG    1 
ATOM   6964 O  OD1   . ASP B 1 385 ? 138.632 -49.767 90.425  1.00 36.49 ? 472  ASP B OD1   1 
ATOM   6965 O  OD2   . ASP B 1 385 ? 139.041 -50.309 92.514  1.00 36.32 ? 472  ASP B OD2   1 
ATOM   6966 N  N     . TYR B 1 386 ? 137.567 -44.770 91.562  1.00 27.52 ? 473  TYR B N     1 
ATOM   6967 C  CA    . TYR B 1 386 ? 136.783 -43.595 92.001  1.00 27.82 ? 473  TYR B CA    1 
ATOM   6968 C  C     . TYR B 1 386 ? 135.557 -43.374 91.131  1.00 28.00 ? 473  TYR B C     1 
ATOM   6969 O  O     . TYR B 1 386 ? 134.458 -43.137 91.641  1.00 25.57 ? 473  TYR B O     1 
ATOM   6970 C  CB    . TYR B 1 386 ? 137.600 -42.299 91.989  1.00 28.44 ? 473  TYR B CB    1 
ATOM   6971 C  CG    . TYR B 1 386 ? 138.739 -42.199 92.981  1.00 29.87 ? 473  TYR B CG    1 
ATOM   6972 C  CD1   . TYR B 1 386 ? 138.992 -43.208 93.914  1.00 29.01 ? 473  TYR B CD1   1 
ATOM   6973 C  CD2   . TYR B 1 386 ? 139.549 -41.061 93.005  1.00 29.61 ? 473  TYR B CD2   1 
ATOM   6974 C  CE1   . TYR B 1 386 ? 140.045 -43.102 94.814  1.00 29.62 ? 473  TYR B CE1   1 
ATOM   6975 C  CE2   . TYR B 1 386 ? 140.593 -40.942 93.909  1.00 29.22 ? 473  TYR B CE2   1 
ATOM   6976 C  CZ    . TYR B 1 386 ? 140.837 -41.963 94.808  1.00 29.64 ? 473  TYR B CZ    1 
ATOM   6977 O  OH    . TYR B 1 386 ? 141.882 -41.843 95.700  1.00 30.70 ? 473  TYR B OH    1 
ATOM   6978 N  N     . GLU B 1 387 ? 135.767 -43.446 89.814  1.00 28.98 ? 474  GLU B N     1 
ATOM   6979 C  CA    . GLU B 1 387 ? 134.714 -43.257 88.815  1.00 30.28 ? 474  GLU B CA    1 
ATOM   6980 C  C     . GLU B 1 387 ? 133.524 -44.188 88.975  1.00 27.36 ? 474  GLU B C     1 
ATOM   6981 O  O     . GLU B 1 387 ? 132.414 -43.839 88.578  1.00 28.36 ? 474  GLU B O     1 
ATOM   6982 C  CB    . GLU B 1 387 ? 135.287 -43.433 87.409  1.00 35.37 ? 474  GLU B CB    1 
ATOM   6983 C  CG    . GLU B 1 387 ? 135.950 -42.166 86.837  1.00 40.49 ? 474  GLU B CG    1 
ATOM   6984 C  CD    . GLU B 1 387 ? 136.473 -42.411 85.423  1.00 43.92 ? 474  GLU B CD    1 
ATOM   6985 O  OE1   . GLU B 1 387 ? 137.074 -43.487 85.176  1.00 47.45 ? 474  GLU B OE1   1 
ATOM   6986 O  OE2   . GLU B 1 387 ? 136.285 -41.527 84.558  1.00 47.22 ? 474  GLU B OE2   1 
ATOM   6987 N  N     . SER B 1 388 ? 133.757 -45.365 89.554  1.00 25.36 ? 475  SER B N     1 
ATOM   6988 C  CA    . SER B 1 388 ? 132.715 -46.383 89.717  1.00 23.91 ? 475  SER B CA    1 
ATOM   6989 C  C     . SER B 1 388 ? 131.859 -46.188 90.970  1.00 23.74 ? 475  SER B C     1 
ATOM   6990 O  O     . SER B 1 388 ? 130.851 -46.874 91.151  1.00 23.21 ? 475  SER B O     1 
ATOM   6991 C  CB    . SER B 1 388 ? 133.348 -47.775 89.770  1.00 26.56 ? 475  SER B CB    1 
ATOM   6992 O  OG    . SER B 1 388 ? 133.888 -48.045 91.062  1.00 27.61 ? 475  SER B OG    1 
ATOM   6993 N  N     . LEU B 1 389 ? 132.259 -45.270 91.850  1.00 22.02 ? 476  LEU B N     1 
ATOM   6994 C  CA    . LEU B 1 389 ? 131.576 -45.133 93.141  1.00 19.40 ? 476  LEU B CA    1 
ATOM   6995 C  C     . LEU B 1 389 ? 130.157 -44.544 93.123  1.00 17.76 ? 476  LEU B C     1 
ATOM   6996 O  O     . LEU B 1 389 ? 129.302 -45.032 93.857  1.00 17.07 ? 476  LEU B O     1 
ATOM   6997 C  CB    . LEU B 1 389 ? 132.475 -44.424 94.170  1.00 19.94 ? 476  LEU B CB    1 
ATOM   6998 C  CG    . LEU B 1 389 ? 133.809 -45.139 94.384  1.00 20.47 ? 476  LEU B CG    1 
ATOM   6999 C  CD1   . LEU B 1 389 ? 134.713 -44.312 95.287  1.00 21.80 ? 476  LEU B CD1   1 
ATOM   7000 C  CD2   . LEU B 1 389 ? 133.622 -46.548 94.950  1.00 20.98 ? 476  LEU B CD2   1 
ATOM   7001 N  N     . PRO B 1 390 ? 129.893 -43.487 92.320  1.00 16.09 ? 477  PRO B N     1 
ATOM   7002 C  CA    . PRO B 1 390 ? 128.505 -43.008 92.299  1.00 18.06 ? 477  PRO B CA    1 
ATOM   7003 C  C     . PRO B 1 390 ? 127.514 -44.082 91.817  1.00 18.44 ? 477  PRO B C     1 
ATOM   7004 O  O     . PRO B 1 390 ? 126.400 -44.177 92.358  1.00 17.67 ? 477  PRO B O     1 
ATOM   7005 C  CB    . PRO B 1 390 ? 128.544 -41.836 91.314  1.00 18.44 ? 477  PRO B CB    1 
ATOM   7006 C  CG    . PRO B 1 390 ? 129.955 -41.349 91.364  1.00 18.66 ? 477  PRO B CG    1 
ATOM   7007 C  CD    . PRO B 1 390 ? 130.806 -42.571 91.606  1.00 18.22 ? 477  PRO B CD    1 
ATOM   7008 N  N     . LYS B 1 391 ? 127.928 -44.880 90.832  1.00 20.84 ? 478  LYS B N     1 
ATOM   7009 C  CA    . LYS B 1 391 ? 127.151 -46.057 90.409  1.00 22.86 ? 478  LYS B CA    1 
ATOM   7010 C  C     . LYS B 1 391 ? 126.830 -46.970 91.597  1.00 21.87 ? 478  LYS B C     1 
ATOM   7011 O  O     . LYS B 1 391 ? 125.674 -47.385 91.776  1.00 22.02 ? 478  LYS B O     1 
ATOM   7012 C  CB    . LYS B 1 391 ? 127.900 -46.826 89.312  1.00 26.71 ? 478  LYS B CB    1 
ATOM   7013 C  CG    . LYS B 1 391 ? 127.612 -46.343 87.899  1.00 30.93 ? 478  LYS B CG    1 
ATOM   7014 C  CD    . LYS B 1 391 ? 128.811 -46.489 86.964  1.00 34.82 ? 478  LYS B CD    1 
ATOM   7015 C  CE    . LYS B 1 391 ? 129.283 -47.930 86.826  1.00 37.42 ? 478  LYS B CE    1 
ATOM   7016 N  NZ    . LYS B 1 391 ? 130.587 -48.007 86.117  1.00 39.45 ? 478  LYS B NZ    1 
ATOM   7017 N  N     . GLU B 1 392 ? 127.842 -47.256 92.423  1.00 19.64 ? 479  GLU B N     1 
ATOM   7018 C  CA    . GLU B 1 392 ? 127.654 -48.131 93.596  1.00 19.77 ? 479  GLU B CA    1 
ATOM   7019 C  C     . GLU B 1 392 ? 126.630 -47.569 94.584  1.00 18.91 ? 479  GLU B C     1 
ATOM   7020 O  O     . GLU B 1 392 ? 125.745 -48.283 95.056  1.00 16.84 ? 479  GLU B O     1 
ATOM   7021 C  CB    . GLU B 1 392 ? 128.973 -48.380 94.327  1.00 21.41 ? 479  GLU B CB    1 
ATOM   7022 C  CG    . GLU B 1 392 ? 129.984 -49.257 93.613  1.00 23.34 ? 479  GLU B CG    1 
ATOM   7023 C  CD    . GLU B 1 392 ? 131.166 -49.597 94.500  1.00 24.96 ? 479  GLU B CD    1 
ATOM   7024 O  OE1   . GLU B 1 392 ? 131.087 -49.319 95.715  1.00 23.65 ? 479  GLU B OE1   1 
ATOM   7025 O  OE2   . GLU B 1 392 ? 132.171 -50.139 93.992  1.00 26.42 ? 479  GLU B OE2   1 
ATOM   7026 N  N     . VAL B 1 393 ? 126.748 -46.281 94.904  1.00 17.55 ? 480  VAL B N     1 
ATOM   7027 C  CA    . VAL B 1 393 ? 125.791 -45.644 95.799  1.00 17.05 ? 480  VAL B CA    1 
ATOM   7028 C  C     . VAL B 1 393 ? 124.381 -45.733 95.234  1.00 19.03 ? 480  VAL B C     1 
ATOM   7029 O  O     . VAL B 1 393 ? 123.435 -46.022 95.963  1.00 19.68 ? 480  VAL B O     1 
ATOM   7030 C  CB    . VAL B 1 393 ? 126.154 -44.168 96.079  1.00 16.75 ? 480  VAL B CB    1 
ATOM   7031 C  CG1   . VAL B 1 393 ? 125.095 -43.514 96.962  1.00 16.54 ? 480  VAL B CG1   1 
ATOM   7032 C  CG2   . VAL B 1 393 ? 127.532 -44.084 96.724  1.00 16.34 ? 480  VAL B CG2   1 
ATOM   7033 N  N     . ALA B 1 394 ? 124.246 -45.490 93.933  1.00 19.26 ? 481  ALA B N     1 
ATOM   7034 C  CA    . ALA B 1 394 ? 122.935 -45.523 93.294  1.00 20.68 ? 481  ALA B CA    1 
ATOM   7035 C  C     . ALA B 1 394 ? 122.383 -46.954 93.196  1.00 21.81 ? 481  ALA B C     1 
ATOM   7036 O  O     . ALA B 1 394 ? 121.178 -47.140 93.084  1.00 23.71 ? 481  ALA B O     1 
ATOM   7037 C  CB    . ALA B 1 394 ? 123.009 -44.889 91.915  1.00 20.21 ? 481  ALA B CB    1 
ATOM   7038 N  N     . SER B 1 395 ? 123.269 -47.943 93.268  1.00 22.23 ? 482  SER B N     1 
ATOM   7039 C  CA    . SER B 1 395 ? 122.879 -49.362 93.216  1.00 24.91 ? 482  SER B CA    1 
ATOM   7040 C  C     . SER B 1 395 ? 122.583 -49.953 94.594  1.00 26.06 ? 482  SER B C     1 
ATOM   7041 O  O     . SER B 1 395 ? 122.272 -51.145 94.709  1.00 25.11 ? 482  SER B O     1 
ATOM   7042 C  CB    . SER B 1 395 ? 123.964 -50.189 92.536  1.00 24.76 ? 482  SER B CB    1 
ATOM   7043 O  OG    . SER B 1 395 ? 124.138 -49.793 91.187  1.00 27.28 ? 482  SER B OG    1 
ATOM   7044 N  N     . ALA B 1 396 ? 122.678 -49.132 95.644  1.00 25.07 ? 483  ALA B N     1 
ATOM   7045 C  CA    . ALA B 1 396 ? 122.324 -49.596 96.985  1.00 24.72 ? 483  ALA B CA    1 
ATOM   7046 C  C     . ALA B 1 396 ? 120.814 -49.767 97.082  1.00 24.73 ? 483  ALA B C     1 
ATOM   7047 O  O     . ALA B 1 396 ? 120.051 -49.090 96.375  1.00 26.74 ? 483  ALA B O     1 
ATOM   7048 C  CB    . ALA B 1 396 ? 122.831 -48.624 98.054  1.00 24.27 ? 483  ALA B CB    1 
ATOM   7049 N  N     . LYS B 1 397 ? 120.376 -50.663 97.962  1.00 26.62 ? 484  LYS B N     1 
ATOM   7050 C  CA    . LYS B 1 397 ? 118.955 -50.969 98.084  1.00 27.29 ? 484  LYS B CA    1 
ATOM   7051 C  C     . LYS B 1 397 ? 118.453 -50.768 99.504  1.00 26.54 ? 484  LYS B C     1 
ATOM   7052 O  O     . LYS B 1 397 ? 118.218 -51.747 100.219 1.00 27.60 ? 484  LYS B O     1 
ATOM   7053 C  CB    . LYS B 1 397 ? 118.673 -52.407 97.619  1.00 29.54 ? 484  LYS B CB    1 
ATOM   7054 C  CG    . LYS B 1 397 ? 119.125 -52.708 96.197  1.00 31.43 ? 484  LYS B CG    1 
ATOM   7055 C  CD    . LYS B 1 397 ? 118.388 -53.918 95.637  1.00 35.67 ? 484  LYS B CD    1 
ATOM   7056 C  CE    . LYS B 1 397 ? 118.808 -54.215 94.205  1.00 37.26 ? 484  LYS B CE    1 
ATOM   7057 N  NZ    . LYS B 1 397 ? 120.173 -54.813 94.138  1.00 40.74 ? 484  LYS B NZ    1 
ATOM   7058 N  N     . PRO B 1 398 ? 118.283 -49.495 99.921  1.00 26.02 ? 485  PRO B N     1 
ATOM   7059 C  CA    . PRO B 1 398 ? 117.798 -49.205 101.256 1.00 25.44 ? 485  PRO B CA    1 
ATOM   7060 C  C     . PRO B 1 398 ? 116.387 -49.739 101.447 1.00 27.27 ? 485  PRO B C     1 
ATOM   7061 O  O     . PRO B 1 398 ? 115.515 -49.473 100.615 1.00 27.55 ? 485  PRO B O     1 
ATOM   7062 C  CB    . PRO B 1 398 ? 117.782 -47.669 101.304 1.00 25.53 ? 485  PRO B CB    1 
ATOM   7063 C  CG    . PRO B 1 398 ? 117.759 -47.227 99.886  1.00 25.00 ? 485  PRO B CG    1 
ATOM   7064 C  CD    . PRO B 1 398 ? 118.560 -48.261 99.162  1.00 24.75 ? 485  PRO B CD    1 
ATOM   7065 N  N     . LYS B 1 399 ? 116.166 -50.468 102.536 1.00 29.45 ? 486  LYS B N     1 
ATOM   7066 C  CA    . LYS B 1 399 ? 114.819 -50.896 102.918 1.00 30.52 ? 486  LYS B CA    1 
ATOM   7067 C  C     . LYS B 1 399 ? 114.038 -49.737 103.518 1.00 29.45 ? 486  LYS B C     1 
ATOM   7068 O  O     . LYS B 1 399 ? 113.609 -49.786 104.672 1.00 28.55 ? 486  LYS B O     1 
ATOM   7069 C  CB    . LYS B 1 399 ? 114.872 -52.072 103.895 1.00 32.95 ? 486  LYS B CB    1 
ATOM   7070 C  CG    . LYS B 1 399 ? 115.348 -53.371 103.269 1.00 34.96 ? 486  LYS B CG    1 
ATOM   7071 C  CD    . LYS B 1 399 ? 115.359 -54.493 104.295 1.00 37.54 ? 486  LYS B CD    1 
ATOM   7072 C  CE    . LYS B 1 399 ? 115.844 -55.796 103.685 1.00 38.93 ? 486  LYS B CE    1 
ATOM   7073 N  NZ    . LYS B 1 399 ? 115.988 -56.846 104.726 1.00 41.07 ? 486  LYS B NZ    1 
ATOM   7074 N  N     . VAL B 1 400 ? 113.863 -48.685 102.727 1.00 26.96 ? 487  VAL B N     1 
ATOM   7075 C  CA    . VAL B 1 400 ? 113.120 -47.514 103.156 1.00 28.19 ? 487  VAL B CA    1 
ATOM   7076 C  C     . VAL B 1 400 ? 112.123 -47.144 102.069 1.00 29.14 ? 487  VAL B C     1 
ATOM   7077 O  O     . VAL B 1 400 ? 112.460 -47.145 100.875 1.00 28.32 ? 487  VAL B O     1 
ATOM   7078 C  CB    . VAL B 1 400 ? 114.058 -46.303 103.427 1.00 29.12 ? 487  VAL B CB    1 
ATOM   7079 C  CG1   . VAL B 1 400 ? 113.273 -45.118 103.960 1.00 28.61 ? 487  VAL B CG1   1 
ATOM   7080 C  CG2   . VAL B 1 400 ? 115.149 -46.671 104.418 1.00 28.07 ? 487  VAL B CG2   1 
ATOM   7081 N  N     . LEU B 1 401 ? 110.902 -46.821 102.479 1.00 31.67 ? 488  LEU B N     1 
ATOM   7082 C  CA    . LEU B 1 401 ? 109.911 -46.303 101.550 1.00 33.95 ? 488  LEU B CA    1 
ATOM   7083 C  C     . LEU B 1 401 ? 110.244 -44.857 101.189 1.00 33.98 ? 488  LEU B C     1 
ATOM   7084 O  O     . LEU B 1 401 ? 110.223 -43.972 102.049 1.00 36.10 ? 488  LEU B O     1 
ATOM   7085 C  CB    . LEU B 1 401 ? 108.500 -46.410 102.141 1.00 35.98 ? 488  LEU B CB    1 
ATOM   7086 C  CG    . LEU B 1 401 ? 107.337 -46.406 101.144 1.00 36.71 ? 488  LEU B CG    1 
ATOM   7087 C  CD1   . LEU B 1 401 ? 107.437 -47.578 100.177 1.00 37.95 ? 488  LEU B CD1   1 
ATOM   7088 C  CD2   . LEU B 1 401 ? 106.000 -46.414 101.868 1.00 36.99 ? 488  LEU B CD2   1 
ATOM   7089 N  N     . LEU B 1 402 ? 110.553 -44.630 99.912  1.00 32.86 ? 489  LEU B N     1 
ATOM   7090 C  CA    . LEU B 1 402 ? 110.969 -43.307 99.425  1.00 32.72 ? 489  LEU B CA    1 
ATOM   7091 C  C     . LEU B 1 402 ? 110.087 -42.787 98.298  1.00 34.00 ? 489  LEU B C     1 
ATOM   7092 O  O     . LEU B 1 402 ? 109.546 -43.568 97.518  1.00 33.08 ? 489  LEU B O     1 
ATOM   7093 C  CB    . LEU B 1 402 ? 112.427 -43.355 98.944  1.00 30.28 ? 489  LEU B CB    1 
ATOM   7094 C  CG    . LEU B 1 402 ? 113.477 -43.804 99.965  1.00 27.70 ? 489  LEU B CG    1 
ATOM   7095 C  CD1   . LEU B 1 402 ? 114.838 -43.955 99.303  1.00 25.74 ? 489  LEU B CD1   1 
ATOM   7096 C  CD2   . LEU B 1 402 ? 113.540 -42.848 101.146 1.00 27.55 ? 489  LEU B CD2   1 
ATOM   7097 N  N     . ASP B 1 403 ? 109.966 -41.462 98.219  1.00 36.29 ? 490  ASP B N     1 
ATOM   7098 C  CA    . ASP B 1 403 ? 109.238 -40.793 97.139  1.00 38.56 ? 490  ASP B CA    1 
ATOM   7099 C  C     . ASP B 1 403 ? 110.007 -40.753 95.823  1.00 38.69 ? 490  ASP B C     1 
ATOM   7100 O  O     . ASP B 1 403 ? 109.405 -40.608 94.755  1.00 38.63 ? 490  ASP B O     1 
ATOM   7101 C  CB    . ASP B 1 403 ? 108.871 -39.365 97.545  1.00 41.23 ? 490  ASP B CB    1 
ATOM   7102 C  CG    . ASP B 1 403 ? 107.851 -39.320 98.666  1.00 43.91 ? 490  ASP B CG    1 
ATOM   7103 O  OD1   . ASP B 1 403 ? 107.261 -40.373 98.995  1.00 46.64 ? 490  ASP B OD1   1 
ATOM   7104 O  OD2   . ASP B 1 403 ? 107.636 -38.226 99.223  1.00 44.91 ? 490  ASP B OD2   1 
ATOM   7105 N  N     . VAL B 1 404 ? 111.332 -40.870 95.896  1.00 37.74 ? 491  VAL B N     1 
ATOM   7106 C  CA    . VAL B 1 404 ? 112.179 -40.696 94.713  1.00 35.89 ? 491  VAL B CA    1 
ATOM   7107 C  C     . VAL B 1 404 ? 113.185 -41.825 94.530  1.00 33.12 ? 491  VAL B C     1 
ATOM   7108 O  O     . VAL B 1 404 ? 113.509 -42.542 95.467  1.00 34.62 ? 491  VAL B O     1 
ATOM   7109 C  CB    . VAL B 1 404 ? 112.926 -39.337 94.722  1.00 36.60 ? 491  VAL B CB    1 
ATOM   7110 C  CG1   . VAL B 1 404 ? 111.963 -38.181 94.487  1.00 38.23 ? 491  VAL B CG1   1 
ATOM   7111 C  CG2   . VAL B 1 404 ? 113.696 -39.144 96.020  1.00 36.15 ? 491  VAL B CG2   1 
ATOM   7112 N  N     . LYS B 1 405 ? 113.673 -41.964 93.304  1.00 32.62 ? 492  LYS B N     1 
ATOM   7113 C  CA    . LYS B 1 405 ? 114.706 -42.929 92.960  1.00 29.50 ? 492  LYS B CA    1 
ATOM   7114 C  C     . LYS B 1 405 ? 115.867 -42.110 92.412  1.00 28.54 ? 492  LYS B C     1 
ATOM   7115 O  O     . LYS B 1 405 ? 115.658 -41.222 91.587  1.00 27.74 ? 492  LYS B O     1 
ATOM   7116 C  CB    . LYS B 1 405 ? 114.172 -43.884 91.890  1.00 30.95 ? 492  LYS B CB    1 
ATOM   7117 C  CG    . LYS B 1 405 ? 115.092 -45.022 91.475  1.00 31.07 ? 492  LYS B CG    1 
ATOM   7118 C  CD    . LYS B 1 405 ? 114.737 -45.484 90.067  1.00 33.82 ? 492  LYS B CD    1 
ATOM   7119 C  CE    . LYS B 1 405 ? 115.229 -46.893 89.775  1.00 34.95 ? 492  LYS B CE    1 
ATOM   7120 N  NZ    . LYS B 1 405 ? 116.714 -46.986 89.656  1.00 36.76 ? 492  LYS B NZ    1 
ATOM   7121 N  N     . LEU B 1 406 ? 117.079 -42.399 92.873  1.00 25.31 ? 493  LEU B N     1 
ATOM   7122 C  CA    . LEU B 1 406 ? 118.261 -41.630 92.464  1.00 24.15 ? 493  LEU B CA    1 
ATOM   7123 C  C     . LEU B 1 406 ? 119.191 -42.489 91.616  1.00 23.88 ? 493  LEU B C     1 
ATOM   7124 O  O     . LEU B 1 406 ? 119.356 -43.675 91.890  1.00 26.12 ? 493  LEU B O     1 
ATOM   7125 C  CB    . LEU B 1 406 ? 118.996 -41.093 93.706  1.00 21.69 ? 493  LEU B CB    1 
ATOM   7126 C  CG    . LEU B 1 406 ? 118.188 -40.145 94.609  1.00 21.09 ? 493  LEU B CG    1 
ATOM   7127 C  CD1   . LEU B 1 406 ? 118.866 -39.967 95.962  1.00 20.20 ? 493  LEU B CD1   1 
ATOM   7128 C  CD2   . LEU B 1 406 ? 117.966 -38.784 93.951  1.00 20.08 ? 493  LEU B CD2   1 
ATOM   7129 N  N     . LYS B 1 407 ? 119.795 -41.895 90.591  1.00 24.24 ? 494  LYS B N     1 
ATOM   7130 C  CA    . LYS B 1 407 ? 120.705 -42.621 89.703  1.00 23.37 ? 494  LYS B CA    1 
ATOM   7131 C  C     . LYS B 1 407 ? 122.143 -42.182 89.926  1.00 23.92 ? 494  LYS B C     1 
ATOM   7132 O  O     . LYS B 1 407 ? 122.387 -41.173 90.577  1.00 23.21 ? 494  LYS B O     1 
ATOM   7133 C  CB    . LYS B 1 407 ? 120.336 -42.372 88.231  1.00 28.13 ? 494  LYS B CB    1 
ATOM   7134 C  CG    . LYS B 1 407 ? 118.833 -42.390 87.912  1.00 31.48 ? 494  LYS B CG    1 
ATOM   7135 C  CD    . LYS B 1 407 ? 118.617 -42.764 86.446  1.00 34.24 ? 494  LYS B CD    1 
ATOM   7136 C  CE    . LYS B 1 407 ? 117.141 -42.888 86.075  1.00 35.91 ? 494  LYS B CE    1 
ATOM   7137 N  NZ    . LYS B 1 407 ? 116.588 -41.648 85.427  1.00 37.74 ? 494  LYS B NZ    1 
ATOM   7138 N  N     . ALA B 1 408 ? 123.086 -42.923 89.349  1.00 20.79 ? 495  ALA B N     1 
ATOM   7139 C  CA    . ALA B 1 408 ? 124.508 -42.624 89.488  1.00 21.60 ? 495  ALA B CA    1 
ATOM   7140 C  C     . ALA B 1 408 ? 124.833 -41.147 89.226  1.00 21.31 ? 495  ALA B C     1 
ATOM   7141 O  O     . ALA B 1 408 ? 125.654 -40.558 89.922  1.00 19.83 ? 495  ALA B O     1 
ATOM   7142 C  CB    . ALA B 1 408 ? 125.323 -43.514 88.567  1.00 21.85 ? 495  ALA B CB    1 
ATOM   7143 N  N     . GLU B 1 409 ? 124.176 -40.547 88.238  1.00 22.29 ? 496  GLU B N     1 
ATOM   7144 C  CA    . GLU B 1 409 ? 124.467 -39.154 87.888  1.00 23.87 ? 496  GLU B CA    1 
ATOM   7145 C  C     . GLU B 1 409 ? 124.041 -38.142 88.961  1.00 22.32 ? 496  GLU B C     1 
ATOM   7146 O  O     . GLU B 1 409 ? 124.475 -36.993 88.929  1.00 22.49 ? 496  GLU B O     1 
ATOM   7147 C  CB    . GLU B 1 409 ? 123.847 -38.788 86.535  1.00 27.55 ? 496  GLU B CB    1 
ATOM   7148 C  CG    . GLU B 1 409 ? 122.328 -38.693 86.553  1.00 31.63 ? 496  GLU B CG    1 
ATOM   7149 C  CD    . GLU B 1 409 ? 121.728 -38.619 85.158  1.00 36.28 ? 496  GLU B CD    1 
ATOM   7150 O  OE1   . GLU B 1 409 ? 120.528 -38.283 85.044  1.00 39.69 ? 496  GLU B OE1   1 
ATOM   7151 O  OE2   . GLU B 1 409 ? 122.454 -38.897 84.176  1.00 39.81 ? 496  GLU B OE2   1 
ATOM   7152 N  N     . ASP B 1 410 ? 123.189 -38.563 89.892  1.00 18.57 ? 497  ASP B N     1 
ATOM   7153 C  CA    . ASP B 1 410 ? 122.713 -37.696 90.965  1.00 17.78 ? 497  ASP B CA    1 
ATOM   7154 C  C     . ASP B 1 410 ? 123.693 -37.652 92.139  1.00 16.08 ? 497  ASP B C     1 
ATOM   7155 O  O     . ASP B 1 410 ? 123.510 -36.861 93.061  1.00 16.34 ? 497  ASP B O     1 
ATOM   7156 C  CB    . ASP B 1 410 ? 121.377 -38.200 91.503  1.00 18.87 ? 497  ASP B CB    1 
ATOM   7157 C  CG    . ASP B 1 410 ? 120.283 -38.208 90.450  1.00 21.90 ? 497  ASP B CG    1 
ATOM   7158 O  OD1   . ASP B 1 410 ? 120.305 -37.350 89.545  1.00 22.97 ? 497  ASP B OD1   1 
ATOM   7159 O  OD2   . ASP B 1 410 ? 119.398 -39.077 90.541  1.00 22.23 ? 497  ASP B OD2   1 
ATOM   7160 N  N     . PHE B 1 411 ? 124.693 -38.527 92.125  1.00 15.40 ? 498  PHE B N     1 
ATOM   7161 C  CA    . PHE B 1 411 ? 125.636 -38.616 93.256  1.00 15.29 ? 498  PHE B CA    1 
ATOM   7162 C  C     . PHE B 1 411 ? 127.023 -38.155 92.865  1.00 15.08 ? 498  PHE B C     1 
ATOM   7163 O  O     . PHE B 1 411 ? 127.497 -38.425 91.764  1.00 16.38 ? 498  PHE B O     1 
ATOM   7164 C  CB    . PHE B 1 411 ? 125.748 -40.048 93.809  1.00 15.94 ? 498  PHE B CB    1 
ATOM   7165 C  CG    . PHE B 1 411 ? 124.505 -40.539 94.501  1.00 16.85 ? 498  PHE B CG    1 
ATOM   7166 C  CD1   . PHE B 1 411 ? 124.150 -40.063 95.765  1.00 16.33 ? 498  PHE B CD1   1 
ATOM   7167 C  CD2   . PHE B 1 411 ? 123.686 -41.493 93.892  1.00 18.14 ? 498  PHE B CD2   1 
ATOM   7168 C  CE1   . PHE B 1 411 ? 123.005 -40.517 96.406  1.00 18.10 ? 498  PHE B CE1   1 
ATOM   7169 C  CE2   . PHE B 1 411 ? 122.536 -41.950 94.529  1.00 18.69 ? 498  PHE B CE2   1 
ATOM   7170 C  CZ    . PHE B 1 411 ? 122.191 -41.466 95.785  1.00 18.36 ? 498  PHE B CZ    1 
ATOM   7171 N  N     . ILE B 1 412 ? 127.682 -37.478 93.800  1.00 13.51 ? 499  ILE B N     1 
ATOM   7172 C  CA    . ILE B 1 412 ? 129.101 -37.165 93.674  1.00 14.50 ? 499  ILE B CA    1 
ATOM   7173 C  C     . ILE B 1 412 ? 129.818 -37.894 94.798  1.00 13.77 ? 499  ILE B C     1 
ATOM   7174 O  O     . ILE B 1 412 ? 129.380 -37.828 95.944  1.00 12.74 ? 499  ILE B O     1 
ATOM   7175 C  CB    . ILE B 1 412 ? 129.344 -35.655 93.834  1.00 15.96 ? 499  ILE B CB    1 
ATOM   7176 C  CG1   . ILE B 1 412 ? 128.871 -34.922 92.578  1.00 17.70 ? 499  ILE B CG1   1 
ATOM   7177 C  CG2   . ILE B 1 412 ? 130.819 -35.372 94.111  1.00 16.65 ? 499  ILE B CG2   1 
ATOM   7178 C  CD1   . ILE B 1 412 ? 128.681 -33.437 92.792  1.00 18.48 ? 499  ILE B CD1   1 
ATOM   7179 N  N     . VAL B 1 413 ? 130.905 -38.588 94.475  1.00 13.52 ? 500  VAL B N     1 
ATOM   7180 C  CA    . VAL B 1 413 ? 131.706 -39.252 95.500  1.00 14.49 ? 500  VAL B CA    1 
ATOM   7181 C  C     . VAL B 1 413 ? 133.142 -38.733 95.449  1.00 14.78 ? 500  VAL B C     1 
ATOM   7182 O  O     . VAL B 1 413 ? 133.869 -38.968 94.496  1.00 15.15 ? 500  VAL B O     1 
ATOM   7183 C  CB    . VAL B 1 413 ? 131.656 -40.796 95.397  1.00 15.34 ? 500  VAL B CB    1 
ATOM   7184 C  CG1   . VAL B 1 413 ? 132.399 -41.431 96.564  1.00 14.91 ? 500  VAL B CG1   1 
ATOM   7185 C  CG2   . VAL B 1 413 ? 130.218 -41.280 95.394  1.00 15.95 ? 500  VAL B CG2   1 
ATOM   7186 N  N     . ASP B 1 414 ? 133.534 -38.011 96.493  1.00 14.40 ? 501  ASP B N     1 
ATOM   7187 C  CA    . ASP B 1 414 ? 134.829 -37.329 96.539  1.00 14.31 ? 501  ASP B CA    1 
ATOM   7188 C  C     . ASP B 1 414 ? 135.697 -38.100 97.530  1.00 14.02 ? 501  ASP B C     1 
ATOM   7189 O  O     . ASP B 1 414 ? 135.371 -38.153 98.717  1.00 14.41 ? 501  ASP B O     1 
ATOM   7190 C  CB    . ASP B 1 414 ? 134.598 -35.887 97.031  1.00 15.51 ? 501  ASP B CB    1 
ATOM   7191 C  CG    . ASP B 1 414 ? 135.705 -34.911 96.623  1.00 17.10 ? 501  ASP B CG    1 
ATOM   7192 O  OD1   . ASP B 1 414 ? 136.466 -35.208 95.681  1.00 17.71 ? 501  ASP B OD1   1 
ATOM   7193 O  OD2   . ASP B 1 414 ? 135.792 -33.815 97.238  1.00 18.24 ? 501  ASP B OD2   1 
ATOM   7194 N  N     . VAL B 1 415 ? 136.771 -38.716 97.049  1.00 13.32 ? 502  VAL B N     1 
ATOM   7195 C  CA    . VAL B 1 415 ? 137.661 -39.492 97.910  1.00 13.43 ? 502  VAL B CA    1 
ATOM   7196 C  C     . VAL B 1 415 ? 138.865 -38.604 98.224  1.00 14.09 ? 502  VAL B C     1 
ATOM   7197 O  O     . VAL B 1 415 ? 139.538 -38.120 97.316  1.00 14.53 ? 502  VAL B O     1 
ATOM   7198 C  CB    . VAL B 1 415 ? 138.111 -40.813 97.241  1.00 15.03 ? 502  VAL B CB    1 
ATOM   7199 C  CG1   . VAL B 1 415 ? 139.135 -41.538 98.104  1.00 15.41 ? 502  VAL B CG1   1 
ATOM   7200 C  CG2   . VAL B 1 415 ? 136.907 -41.715 96.961  1.00 14.52 ? 502  VAL B CG2   1 
ATOM   7201 N  N     . ILE B 1 416 ? 139.118 -38.378 99.510  1.00 13.58 ? 503  ILE B N     1 
ATOM   7202 C  CA    . ILE B 1 416 ? 140.172 -37.458 99.939  1.00 14.99 ? 503  ILE B CA    1 
ATOM   7203 C  C     . ILE B 1 416 ? 141.293 -38.261 100.599 1.00 15.05 ? 503  ILE B C     1 
ATOM   7204 O  O     . ILE B 1 416 ? 141.063 -38.977 101.560 1.00 13.06 ? 503  ILE B O     1 
ATOM   7205 C  CB    . ILE B 1 416 ? 139.634 -36.406 100.950 1.00 15.37 ? 503  ILE B CB    1 
ATOM   7206 C  CG1   . ILE B 1 416 ? 138.444 -35.618 100.364 1.00 16.08 ? 503  ILE B CG1   1 
ATOM   7207 C  CG2   . ILE B 1 416 ? 140.752 -35.444 101.382 1.00 15.47 ? 503  ILE B CG2   1 
ATOM   7208 C  CD1   . ILE B 1 416 ? 138.714 -35.000 99.002  1.00 17.00 ? 503  ILE B CD1   1 
ATOM   7209 N  N     . ASN B 1 417 ? 142.505 -38.137 100.083 1.00 15.38 ? 504  ASN B N     1 
ATOM   7210 C  CA    . ASN B 1 417 ? 143.660 -38.798 100.697 1.00 17.30 ? 504  ASN B CA    1 
ATOM   7211 C  C     . ASN B 1 417 ? 144.317 -37.862 101.719 1.00 17.11 ? 504  ASN B C     1 
ATOM   7212 O  O     . ASN B 1 417 ? 144.793 -36.794 101.360 1.00 19.81 ? 504  ASN B O     1 
ATOM   7213 C  CB    . ASN B 1 417 ? 144.646 -39.258 99.622  1.00 19.83 ? 504  ASN B CB    1 
ATOM   7214 C  CG    . ASN B 1 417 ? 144.067 -40.334 98.722  1.00 23.46 ? 504  ASN B CG    1 
ATOM   7215 O  OD1   . ASN B 1 417 ? 143.838 -41.461 99.155  1.00 24.95 ? 504  ASN B OD1   1 
ATOM   7216 N  ND2   . ASN B 1 417 ? 143.812 -39.983 97.461  1.00 26.42 ? 504  ASN B ND2   1 
ATOM   7217 N  N     . MET B 1 418 ? 144.290 -38.244 102.995 1.00 15.06 ? 505  MET B N     1 
ATOM   7218 C  CA    . MET B 1 418 ? 144.853 -37.413 104.070 1.00 14.80 ? 505  MET B CA    1 
ATOM   7219 C  C     . MET B 1 418 ? 146.088 -38.134 104.559 1.00 15.10 ? 505  MET B C     1 
ATOM   7220 O  O     . MET B 1 418 ? 145.992 -39.254 105.020 1.00 15.46 ? 505  MET B O     1 
ATOM   7221 C  CB    . MET B 1 418 ? 143.863 -37.270 105.229 1.00 15.28 ? 505  MET B CB    1 
ATOM   7222 C  CG    . MET B 1 418 ? 142.527 -36.649 104.868 1.00 17.78 ? 505  MET B CG    1 
ATOM   7223 S  SD    . MET B 1 418 ? 142.715 -34.880 104.575 1.00 20.92 ? 505  MET B SD    1 
ATOM   7224 C  CE    . MET B 1 418 ? 142.988 -34.273 106.235 1.00 21.35 ? 505  MET B CE    1 
ATOM   7225 N  N     . ASP B 1 419 ? 147.261 -37.515 104.439 1.00 14.65 ? 506  ASP B N     1 
ATOM   7226 C  CA    . ASP B 1 419 ? 148.471 -38.188 104.921 1.00 14.05 ? 506  ASP B CA    1 
ATOM   7227 C  C     . ASP B 1 419 ? 149.494 -37.183 105.418 1.00 14.68 ? 506  ASP B C     1 
ATOM   7228 O  O     . ASP B 1 419 ? 149.236 -35.986 105.402 1.00 16.96 ? 506  ASP B O     1 
ATOM   7229 C  CB    . ASP B 1 419 ? 149.085 -39.091 103.839 1.00 15.09 ? 506  ASP B CB    1 
ATOM   7230 C  CG    . ASP B 1 419 ? 149.471 -38.341 102.571 1.00 17.92 ? 506  ASP B CG    1 
ATOM   7231 O  OD1   . ASP B 1 419 ? 150.062 -37.254 102.660 1.00 18.16 ? 506  ASP B OD1   1 
ATOM   7232 O  OD2   . ASP B 1 419 ? 149.202 -38.863 101.461 1.00 20.91 ? 506  ASP B OD2   1 
ATOM   7233 N  N     . TYR B 1 420 ? 150.658 -37.678 105.832 1.00 13.91 ? 507  TYR B N     1 
ATOM   7234 C  CA    . TYR B 1 420 ? 151.734 -36.804 106.280 1.00 14.01 ? 507  TYR B CA    1 
ATOM   7235 C  C     . TYR B 1 420 ? 152.699 -36.452 105.152 1.00 14.85 ? 507  TYR B C     1 
ATOM   7236 O  O     . TYR B 1 420 ? 153.853 -36.090 105.406 1.00 16.57 ? 507  TYR B O     1 
ATOM   7237 C  CB    . TYR B 1 420 ? 152.468 -37.413 107.490 1.00 13.37 ? 507  TYR B CB    1 
ATOM   7238 C  CG    . TYR B 1 420 ? 151.839 -37.096 108.825 1.00 13.60 ? 507  TYR B CG    1 
ATOM   7239 C  CD1   . TYR B 1 420 ? 150.481 -36.745 108.931 1.00 13.77 ? 507  TYR B CD1   1 
ATOM   7240 C  CD2   . TYR B 1 420 ? 152.594 -37.142 109.992 1.00 12.73 ? 507  TYR B CD2   1 
ATOM   7241 C  CE1   . TYR B 1 420 ? 149.907 -36.448 110.162 1.00 15.05 ? 507  TYR B CE1   1 
ATOM   7242 C  CE2   . TYR B 1 420 ? 152.029 -36.846 111.230 1.00 13.08 ? 507  TYR B CE2   1 
ATOM   7243 C  CZ    . TYR B 1 420 ? 150.686 -36.502 111.311 1.00 15.28 ? 507  TYR B CZ    1 
ATOM   7244 O  OH    . TYR B 1 420 ? 150.121 -36.202 112.539 1.00 15.04 ? 507  TYR B OH    1 
ATOM   7245 N  N     . GLY B 1 421 ? 152.229 -36.551 103.911 1.00 14.08 ? 508  GLY B N     1 
ATOM   7246 C  CA    . GLY B 1 421 ? 152.990 -36.041 102.766 1.00 15.73 ? 508  GLY B CA    1 
ATOM   7247 C  C     . GLY B 1 421 ? 153.846 -37.067 102.047 1.00 17.24 ? 508  GLY B C     1 
ATOM   7248 O  O     . GLY B 1 421 ? 154.456 -36.759 101.032 1.00 18.52 ? 508  GLY B O     1 
ATOM   7249 N  N     . MET B 1 422 ? 153.878 -38.289 102.563 1.00 17.45 ? 509  MET B N     1 
ATOM   7250 C  CA    . MET B 1 422 ? 154.721 -39.343 101.999 1.00 20.59 ? 509  MET B CA    1 
ATOM   7251 C  C     . MET B 1 422 ? 153.965 -40.648 102.031 1.00 20.73 ? 509  MET B C     1 
ATOM   7252 O  O     . MET B 1 422 ? 154.503 -41.676 102.433 1.00 22.02 ? 509  MET B O     1 
ATOM   7253 C  CB    . MET B 1 422 ? 156.033 -39.482 102.775 1.00 21.33 ? 509  MET B CB    1 
ATOM   7254 C  CG    . MET B 1 422 ? 156.894 -38.230 102.788 1.00 23.76 ? 509  MET B CG    1 
ATOM   7255 S  SD    . MET B 1 422 ? 158.464 -38.510 103.626 1.00 24.83 ? 509  MET B SD    1 
ATOM   7256 C  CE    . MET B 1 422 ? 158.193 -40.139 104.299 1.00 21.33 ? 509  MET B CE    1 
ATOM   7257 N  N     . GLN B 1 423 ? 152.709 -40.595 101.591 1.00 22.40 ? 510  GLN B N     1 
ATOM   7258 C  CA    . GLN B 1 423 ? 151.843 -41.762 101.536 1.00 23.66 ? 510  GLN B CA    1 
ATOM   7259 C  C     . GLN B 1 423 ? 151.777 -42.418 102.919 1.00 22.45 ? 510  GLN B C     1 
ATOM   7260 O  O     . GLN B 1 423 ? 151.455 -41.751 103.914 1.00 21.07 ? 510  GLN B O     1 
ATOM   7261 C  CB    . GLN B 1 423 ? 152.306 -42.748 100.443 1.00 27.72 ? 510  GLN B CB    1 
ATOM   7262 C  CG    . GLN B 1 423 ? 152.698 -42.098 99.113  1.00 31.84 ? 510  GLN B CG    1 
ATOM   7263 C  CD    . GLN B 1 423 ? 154.167 -41.684 99.047  1.00 34.87 ? 510  GLN B CD    1 
ATOM   7264 O  OE1   . GLN B 1 423 ? 155.049 -42.357 99.596  1.00 38.39 ? 510  GLN B OE1   1 
ATOM   7265 N  NE2   . GLN B 1 423 ? 154.437 -40.569 98.372  1.00 35.99 ? 510  GLN B NE2   1 
ATOM   7266 N  N     . GLU B 1 424 ? 152.101 -43.708 102.986 1.00 19.81 ? 511  GLU B N     1 
ATOM   7267 C  CA    . GLU B 1 424 ? 152.002 -44.477 104.220 1.00 20.27 ? 511  GLU B CA    1 
ATOM   7268 C  C     . GLU B 1 424 ? 153.150 -44.199 105.179 1.00 17.96 ? 511  GLU B C     1 
ATOM   7269 O  O     . GLU B 1 424 ? 153.129 -44.650 106.318 1.00 19.40 ? 511  GLU B O     1 
ATOM   7270 C  CB    . GLU B 1 424 ? 151.980 -45.982 103.909 1.00 24.52 ? 511  GLU B CB    1 
ATOM   7271 C  CG    . GLU B 1 424 ? 150.707 -46.478 103.234 1.00 29.34 ? 511  GLU B CG    1 
ATOM   7272 C  CD    . GLU B 1 424 ? 149.496 -46.492 104.159 1.00 32.84 ? 511  GLU B CD    1 
ATOM   7273 O  OE1   . GLU B 1 424 ? 148.356 -46.536 103.641 1.00 35.91 ? 511  GLU B OE1   1 
ATOM   7274 O  OE2   . GLU B 1 424 ? 149.670 -46.459 105.397 1.00 34.13 ? 511  GLU B OE2   1 
ATOM   7275 N  N     . LYS B 1 425 ? 154.149 -43.465 104.718 1.00 17.05 ? 512  LYS B N     1 
ATOM   7276 C  CA    . LYS B 1 425 ? 155.406 -43.349 105.447 1.00 17.60 ? 512  LYS B CA    1 
ATOM   7277 C  C     . LYS B 1 425 ? 155.411 -42.207 106.457 1.00 15.49 ? 512  LYS B C     1 
ATOM   7278 O  O     . LYS B 1 425 ? 154.788 -41.166 106.244 1.00 14.22 ? 512  LYS B O     1 
ATOM   7279 C  CB    . LYS B 1 425 ? 156.573 -43.157 104.495 1.00 18.74 ? 512  LYS B CB    1 
ATOM   7280 C  CG    . LYS B 1 425 ? 156.775 -44.256 103.463 1.00 23.17 ? 512  LYS B CG    1 
ATOM   7281 C  CD    . LYS B 1 425 ? 157.990 -43.894 102.629 1.00 26.41 ? 512  LYS B CD    1 
ATOM   7282 C  CE    . LYS B 1 425 ? 157.668 -43.929 101.140 1.00 29.18 ? 512  LYS B CE    1 
ATOM   7283 N  NZ    . LYS B 1 425 ? 158.594 -43.019 100.403 1.00 31.89 ? 512  LYS B NZ    1 
ATOM   7284 N  N     . ASN B 1 426 ? 156.139 -42.431 107.549 1.00 13.85 ? 513  ASN B N     1 
ATOM   7285 C  CA    . ASN B 1 426 ? 156.374 -41.419 108.575 1.00 12.84 ? 513  ASN B CA    1 
ATOM   7286 C  C     . ASN B 1 426 ? 157.510 -40.494 108.132 1.00 11.81 ? 513  ASN B C     1 
ATOM   7287 O  O     . ASN B 1 426 ? 158.662 -40.915 108.075 1.00 11.79 ? 513  ASN B O     1 
ATOM   7288 C  CB    . ASN B 1 426 ? 156.696 -42.127 109.902 1.00 13.12 ? 513  ASN B CB    1 
ATOM   7289 C  CG    . ASN B 1 426 ? 156.964 -41.164 111.059 1.00 12.88 ? 513  ASN B CG    1 
ATOM   7290 O  OD1   . ASN B 1 426 ? 157.006 -39.952 110.875 1.00 11.87 ? 513  ASN B OD1   1 
ATOM   7291 N  ND2   . ASN B 1 426 ? 157.153 -41.718 112.262 1.00 12.82 ? 513  ASN B ND2   1 
ATOM   7292 N  N     . PRO B 1 427 ? 157.206 -39.211 107.834 1.00 10.57 ? 514  PRO B N     1 
ATOM   7293 C  CA    . PRO B 1 427 ? 158.284 -38.329 107.355 1.00 10.53 ? 514  PRO B CA    1 
ATOM   7294 C  C     . PRO B 1 427 ? 159.381 -38.073 108.378 1.00 10.57 ? 514  PRO B C     1 
ATOM   7295 O  O     . PRO B 1 427 ? 160.495 -37.722 107.985 1.00 10.60 ? 514  PRO B O     1 
ATOM   7296 C  CB    . PRO B 1 427 ? 157.550 -37.010 107.008 1.00 11.61 ? 514  PRO B CB    1 
ATOM   7297 C  CG    . PRO B 1 427 ? 156.284 -37.072 107.793 1.00 11.51 ? 514  PRO B CG    1 
ATOM   7298 C  CD    . PRO B 1 427 ? 155.897 -38.527 107.829 1.00 11.83 ? 514  PRO B CD    1 
ATOM   7299 N  N     . ILE B 1 428 ? 159.088 -38.244 109.670 1.00 10.55 ? 515  ILE B N     1 
ATOM   7300 C  CA    . ILE B 1 428 ? 160.103 -37.995 110.701 1.00 10.51 ? 515  ILE B CA    1 
ATOM   7301 C  C     . ILE B 1 428 ? 161.201 -39.069 110.648 1.00 13.20 ? 515  ILE B C     1 
ATOM   7302 O  O     . ILE B 1 428 ? 162.340 -38.811 111.052 1.00 13.92 ? 515  ILE B O     1 
ATOM   7303 C  CB    . ILE B 1 428 ? 159.487 -37.874 112.121 1.00 11.48 ? 515  ILE B CB    1 
ATOM   7304 C  CG1   . ILE B 1 428 ? 158.291 -36.915 112.093 1.00 10.45 ? 515  ILE B CG1   1 
ATOM   7305 C  CG2   . ILE B 1 428 ? 160.504 -37.338 113.116 1.00 12.05 ? 515  ILE B CG2   1 
ATOM   7306 C  CD1   . ILE B 1 428 ? 158.590 -35.535 111.507 1.00 9.73  ? 515  ILE B CD1   1 
ATOM   7307 N  N     . ASP B 1 429 ? 160.863 -40.243 110.108 1.00 14.47 ? 516  ASP B N     1 
ATOM   7308 C  CA    . ASP B 1 429 ? 161.879 -41.276 109.811 1.00 16.98 ? 516  ASP B CA    1 
ATOM   7309 C  C     . ASP B 1 429 ? 162.878 -40.828 108.742 1.00 17.79 ? 516  ASP B C     1 
ATOM   7310 O  O     . ASP B 1 429 ? 163.918 -41.469 108.555 1.00 20.46 ? 516  ASP B O     1 
ATOM   7311 C  CB    . ASP B 1 429 ? 161.234 -42.597 109.369 1.00 17.97 ? 516  ASP B CB    1 
ATOM   7312 C  CG    . ASP B 1 429 ? 160.483 -43.295 110.489 1.00 19.90 ? 516  ASP B CG    1 
ATOM   7313 O  OD1   . ASP B 1 429 ? 160.750 -43.007 111.678 1.00 20.47 ? 516  ASP B OD1   1 
ATOM   7314 O  OD2   . ASP B 1 429 ? 159.609 -44.139 110.174 1.00 20.50 ? 516  ASP B OD2   1 
ATOM   7315 N  N     . HIS B 1 430 ? 162.576 -39.727 108.051 1.00 16.04 ? 517  HIS B N     1 
ATOM   7316 C  CA    . HIS B 1 430 ? 163.467 -39.195 107.022 1.00 16.31 ? 517  HIS B CA    1 
ATOM   7317 C  C     . HIS B 1 430 ? 164.030 -37.846 107.364 1.00 15.44 ? 517  HIS B C     1 
ATOM   7318 O  O     . HIS B 1 430 ? 164.451 -37.086 106.486 1.00 14.71 ? 517  HIS B O     1 
ATOM   7319 C  CB    . HIS B 1 430 ? 162.756 -39.192 105.674 1.00 19.02 ? 517  HIS B CB    1 
ATOM   7320 C  CG    . HIS B 1 430 ? 162.218 -40.551 105.280 1.00 21.96 ? 517  HIS B CG    1 
ATOM   7321 N  ND1   . HIS B 1 430 ? 162.914 -41.409 104.507 1.00 24.10 ? 517  HIS B ND1   1 
ATOM   7322 C  CD2   . HIS B 1 430 ? 161.037 -41.199 105.621 1.00 23.38 ? 517  HIS B CD2   1 
ATOM   7323 C  CE1   . HIS B 1 430 ? 162.200 -42.537 104.341 1.00 24.75 ? 517  HIS B CE1   1 
ATOM   7324 N  NE2   . HIS B 1 430 ? 161.052 -42.408 105.021 1.00 24.59 ? 517  HIS B NE2   1 
ATOM   7325 N  N     . VAL B 1 431 ? 164.040 -37.534 108.661 1.00 14.05 ? 518  VAL B N     1 
ATOM   7326 C  CA    . VAL B 1 431 ? 164.628 -36.298 109.172 1.00 13.05 ? 518  VAL B CA    1 
ATOM   7327 C  C     . VAL B 1 431 ? 165.936 -36.656 109.891 1.00 13.84 ? 518  VAL B C     1 
ATOM   7328 O  O     . VAL B 1 431 ? 166.007 -37.662 110.580 1.00 14.60 ? 518  VAL B O     1 
ATOM   7329 C  CB    . VAL B 1 431 ? 163.666 -35.592 110.176 1.00 12.27 ? 518  VAL B CB    1 
ATOM   7330 C  CG1   . VAL B 1 431 ? 164.328 -34.372 110.804 1.00 11.61 ? 518  VAL B CG1   1 
ATOM   7331 C  CG2   . VAL B 1 431 ? 162.373 -35.164 109.476 1.00 12.26 ? 518  VAL B CG2   1 
ATOM   7332 N  N     . SER B 1 432 ? 166.965 -35.839 109.708 1.00 13.00 ? 519  SER B N     1 
ATOM   7333 C  CA    . SER B 1 432 ? 168.220 -36.032 110.429 1.00 13.87 ? 519  SER B CA    1 
ATOM   7334 C  C     . SER B 1 432 ? 168.253 -35.058 111.593 1.00 13.38 ? 519  SER B C     1 
ATOM   7335 O  O     . SER B 1 432 ? 167.846 -33.916 111.438 1.00 11.43 ? 519  SER B O     1 
ATOM   7336 C  CB    . SER B 1 432 ? 169.410 -35.773 109.501 1.00 15.31 ? 519  SER B CB    1 
ATOM   7337 O  OG    . SER B 1 432 ? 169.506 -36.804 108.537 1.00 17.44 ? 519  SER B OG    1 
ATOM   7338 N  N     . PHE B 1 433 ? 168.747 -35.517 112.742 1.00 13.70 ? 520  PHE B N     1 
ATOM   7339 C  CA    . PHE B 1 433 ? 168.794 -34.703 113.960 1.00 14.35 ? 520  PHE B CA    1 
ATOM   7340 C  C     . PHE B 1 433 ? 170.232 -34.583 114.455 1.00 15.21 ? 520  PHE B C     1 
ATOM   7341 O  O     . PHE B 1 433 ? 171.089 -35.383 114.074 1.00 15.57 ? 520  PHE B O     1 
ATOM   7342 C  CB    . PHE B 1 433 ? 167.911 -35.320 115.062 1.00 13.44 ? 520  PHE B CB    1 
ATOM   7343 C  CG    . PHE B 1 433 ? 166.433 -35.289 114.760 1.00 14.10 ? 520  PHE B CG    1 
ATOM   7344 C  CD1   . PHE B 1 433 ? 165.669 -34.151 115.070 1.00 13.43 ? 520  PHE B CD1   1 
ATOM   7345 C  CD2   . PHE B 1 433 ? 165.792 -36.392 114.189 1.00 13.44 ? 520  PHE B CD2   1 
ATOM   7346 C  CE1   . PHE B 1 433 ? 164.304 -34.116 114.803 1.00 13.00 ? 520  PHE B CE1   1 
ATOM   7347 C  CE2   . PHE B 1 433 ? 164.429 -36.360 113.915 1.00 13.85 ? 520  PHE B CE2   1 
ATOM   7348 C  CZ    . PHE B 1 433 ? 163.682 -35.216 114.224 1.00 12.86 ? 520  PHE B CZ    1 
ATOM   7349 N  N     . TYR B 1 434 ? 170.500 -33.579 115.288 1.00 14.27 ? 521  TYR B N     1 
ATOM   7350 C  CA    . TYR B 1 434 ? 171.760 -33.520 116.013 1.00 14.18 ? 521  TYR B CA    1 
ATOM   7351 C  C     . TYR B 1 434 ? 171.502 -33.312 117.493 1.00 14.86 ? 521  TYR B C     1 
ATOM   7352 O  O     . TYR B 1 434 ? 170.422 -32.851 117.892 1.00 12.66 ? 521  TYR B O     1 
ATOM   7353 C  CB    . TYR B 1 434 ? 172.695 -32.432 115.471 1.00 14.50 ? 521  TYR B CB    1 
ATOM   7354 C  CG    . TYR B 1 434 ? 172.217 -31.023 115.719 1.00 14.58 ? 521  TYR B CG    1 
ATOM   7355 C  CD1   . TYR B 1 434 ? 171.339 -30.409 114.829 1.00 15.60 ? 521  TYR B CD1   1 
ATOM   7356 C  CD2   . TYR B 1 434 ? 172.631 -30.306 116.847 1.00 14.70 ? 521  TYR B CD2   1 
ATOM   7357 C  CE1   . TYR B 1 434 ? 170.893 -29.117 115.048 1.00 16.47 ? 521  TYR B CE1   1 
ATOM   7358 C  CE2   . TYR B 1 434 ? 172.188 -29.014 117.070 1.00 16.22 ? 521  TYR B CE2   1 
ATOM   7359 C  CZ    . TYR B 1 434 ? 171.314 -28.429 116.159 1.00 17.30 ? 521  TYR B CZ    1 
ATOM   7360 O  OH    . TYR B 1 434 ? 170.854 -27.149 116.367 1.00 17.46 ? 521  TYR B OH    1 
ATOM   7361 N  N     . CYS B 1 435 ? 172.505 -33.650 118.292 1.00 14.44 ? 522  CYS B N     1 
ATOM   7362 C  CA    . CYS B 1 435 ? 172.454 -33.534 119.748 1.00 14.94 ? 522  CYS B CA    1 
ATOM   7363 C  C     . CYS B 1 435 ? 173.409 -32.452 120.216 1.00 16.16 ? 522  CYS B C     1 
ATOM   7364 O  O     . CYS B 1 435 ? 174.407 -32.158 119.549 1.00 16.69 ? 522  CYS B O     1 
ATOM   7365 C  CB    . CYS B 1 435 ? 172.825 -34.872 120.397 1.00 17.46 ? 522  CYS B CB    1 
ATOM   7366 S  SG    . CYS B 1 435 ? 171.831 -36.244 119.791 1.00 20.85 ? 522  CYS B SG    1 
ATOM   7367 N  N     . LYS B 1 436 ? 173.084 -31.870 121.368 1.00 17.82 ? 523  LYS B N     1 
ATOM   7368 C  CA    . LYS B 1 436 ? 173.772 -30.725 121.951 1.00 21.17 ? 523  LYS B CA    1 
ATOM   7369 C  C     . LYS B 1 436 ? 175.282 -30.925 122.011 1.00 21.67 ? 523  LYS B C     1 
ATOM   7370 O  O     . LYS B 1 436 ? 176.059 -30.035 121.643 1.00 22.47 ? 523  LYS B O     1 
ATOM   7371 C  CB    . LYS B 1 436 ? 173.229 -30.533 123.374 1.00 22.80 ? 523  LYS B CB    1 
ATOM   7372 C  CG    . LYS B 1 436 ? 173.541 -29.228 124.068 1.00 25.00 ? 523  LYS B CG    1 
ATOM   7373 C  CD    . LYS B 1 436 ? 173.017 -29.347 125.488 1.00 25.16 ? 523  LYS B CD    1 
ATOM   7374 C  CE    . LYS B 1 436 ? 173.174 -28.074 126.303 1.00 26.48 ? 523  LYS B CE    1 
ATOM   7375 N  NZ    . LYS B 1 436 ? 172.466 -28.267 127.604 1.00 24.01 ? 523  LYS B NZ    1 
ATOM   7376 N  N     . THR B 1 437 ? 175.691 -32.099 122.468 1.00 21.87 ? 524  THR B N     1 
ATOM   7377 C  CA    . THR B 1 437 ? 177.109 -32.353 122.708 1.00 23.58 ? 524  THR B CA    1 
ATOM   7378 C  C     . THR B 1 437 ? 177.888 -32.807 121.465 1.00 23.45 ? 524  THR B C     1 
ATOM   7379 O  O     . THR B 1 437 ? 179.090 -33.041 121.557 1.00 25.68 ? 524  THR B O     1 
ATOM   7380 C  CB    . THR B 1 437 ? 177.327 -33.355 123.852 1.00 23.99 ? 524  THR B CB    1 
ATOM   7381 O  OG1   . THR B 1 437 ? 176.910 -34.661 123.439 1.00 24.70 ? 524  THR B OG1   1 
ATOM   7382 C  CG2   . THR B 1 437 ? 176.561 -32.926 125.103 1.00 24.37 ? 524  THR B CG2   1 
ATOM   7383 N  N     . ALA B 1 438 ? 177.212 -32.934 120.319 1.00 21.53 ? 525  ALA B N     1 
ATOM   7384 C  CA    . ALA B 1 438 ? 177.902 -33.212 119.043 1.00 20.69 ? 525  ALA B CA    1 
ATOM   7385 C  C     . ALA B 1 438 ? 177.119 -32.666 117.854 1.00 19.47 ? 525  ALA B C     1 
ATOM   7386 O  O     . ALA B 1 438 ? 176.517 -33.434 117.096 1.00 18.70 ? 525  ALA B O     1 
ATOM   7387 C  CB    . ALA B 1 438 ? 178.171 -34.705 118.878 1.00 21.00 ? 525  ALA B CB    1 
ATOM   7388 N  N     . PRO B 1 439 ? 177.136 -31.332 117.674 1.00 20.54 ? 526  PRO B N     1 
ATOM   7389 C  CA    . PRO B 1 439 ? 176.235 -30.672 116.725 1.00 22.65 ? 526  PRO B CA    1 
ATOM   7390 C  C     . PRO B 1 439 ? 176.496 -30.995 115.261 1.00 23.92 ? 526  PRO B C     1 
ATOM   7391 O  O     . PRO B 1 439 ? 175.653 -30.706 114.420 1.00 24.35 ? 526  PRO B O     1 
ATOM   7392 C  CB    . PRO B 1 439 ? 176.453 -29.175 117.003 1.00 23.62 ? 526  PRO B CB    1 
ATOM   7393 C  CG    . PRO B 1 439 ? 177.787 -29.095 117.655 1.00 23.86 ? 526  PRO B CG    1 
ATOM   7394 C  CD    . PRO B 1 439 ? 177.927 -30.359 118.447 1.00 22.28 ? 526  PRO B CD    1 
ATOM   7395 N  N     . ASN B 1 440 ? 177.643 -31.594 114.957 1.00 25.75 ? 527  ASN B N     1 
ATOM   7396 C  CA    . ASN B 1 440 ? 177.950 -31.949 113.574 1.00 27.38 ? 527  ASN B CA    1 
ATOM   7397 C  C     . ASN B 1 440 ? 177.656 -33.401 113.224 1.00 27.14 ? 527  ASN B C     1 
ATOM   7398 O  O     . ASN B 1 440 ? 177.859 -33.827 112.091 1.00 29.27 ? 527  ASN B O     1 
ATOM   7399 C  CB    . ASN B 1 440 ? 179.390 -31.566 113.236 1.00 30.61 ? 527  ASN B CB    1 
ATOM   7400 C  CG    . ASN B 1 440 ? 179.634 -30.074 113.385 1.00 33.08 ? 527  ASN B CG    1 
ATOM   7401 O  OD1   . ASN B 1 440 ? 179.046 -29.255 112.667 1.00 35.45 ? 527  ASN B OD1   1 
ATOM   7402 N  ND2   . ASN B 1 440 ? 180.482 -29.710 114.338 1.00 33.64 ? 527  ASN B ND2   1 
ATOM   7403 N  N     . ARG B 1 441 ? 177.152 -34.157 114.197 1.00 25.96 ? 528  ARG B N     1 
ATOM   7404 C  CA    . ARG B 1 441 ? 176.861 -35.563 113.967 1.00 24.79 ? 528  ARG B CA    1 
ATOM   7405 C  C     . ARG B 1 441 ? 175.365 -35.889 113.831 1.00 23.72 ? 528  ARG B C     1 
ATOM   7406 O  O     . ARG B 1 441 ? 174.570 -35.732 114.777 1.00 23.86 ? 528  ARG B O     1 
ATOM   7407 C  CB    . ARG B 1 441 ? 177.540 -36.429 115.026 1.00 27.24 ? 528  ARG B CB    1 
ATOM   7408 C  CG    . ARG B 1 441 ? 176.651 -37.555 115.512 1.00 31.14 ? 528  ARG B CG    1 
ATOM   7409 C  CD    . ARG B 1 441 ? 177.283 -38.911 115.303 1.00 35.53 ? 528  ARG B CD    1 
ATOM   7410 N  NE    . ARG B 1 441 ? 177.759 -39.458 116.564 1.00 38.23 ? 528  ARG B NE    1 
ATOM   7411 C  CZ    . ARG B 1 441 ? 177.496 -40.693 116.985 1.00 39.50 ? 528  ARG B CZ    1 
ATOM   7412 N  NH1   . ARG B 1 441 ? 176.746 -41.504 116.248 1.00 39.09 ? 528  ARG B NH1   1 
ATOM   7413 N  NH2   . ARG B 1 441 ? 177.969 -41.110 118.155 1.00 40.05 ? 528  ARG B NH2   1 
ATOM   7414 N  N     . ALA B 1 442 ? 174.996 -36.366 112.648 1.00 20.62 ? 529  ALA B N     1 
ATOM   7415 C  CA    . ALA B 1 442 ? 173.607 -36.694 112.354 1.00 19.61 ? 529  ALA B CA    1 
ATOM   7416 C  C     . ALA B 1 442 ? 173.164 -37.979 113.049 1.00 19.92 ? 529  ALA B C     1 
ATOM   7417 O  O     . ALA B 1 442 ? 173.906 -38.960 113.084 1.00 20.37 ? 529  ALA B O     1 
ATOM   7418 C  CB    . ALA B 1 442 ? 173.403 -36.794 110.853 1.00 18.86 ? 529  ALA B CB    1 
ATOM   7419 N  N     . ILE B 1 443 ? 171.957 -37.965 113.615 1.00 17.29 ? 530  ILE B N     1 
ATOM   7420 C  CA    . ILE B 1 443 ? 171.338 -39.158 114.199 1.00 16.58 ? 530  ILE B CA    1 
ATOM   7421 C  C     . ILE B 1 443 ? 169.891 -39.304 113.708 1.00 16.59 ? 530  ILE B C     1 
ATOM   7422 O  O     . ILE B 1 443 ? 169.344 -38.387 113.094 1.00 16.64 ? 530  ILE B O     1 
ATOM   7423 C  CB    . ILE B 1 443 ? 171.334 -39.139 115.746 1.00 17.61 ? 530  ILE B CB    1 
ATOM   7424 C  CG1   . ILE B 1 443 ? 170.568 -37.921 116.278 1.00 16.16 ? 530  ILE B CG1   1 
ATOM   7425 C  CG2   . ILE B 1 443 ? 172.745 -39.226 116.315 1.00 18.52 ? 530  ILE B CG2   1 
ATOM   7426 C  CD1   . ILE B 1 443 ? 169.951 -38.141 117.647 1.00 16.84 ? 530  ILE B CD1   1 
ATOM   7427 N  N     . ARG B 1 444 ? 169.287 -40.452 113.988 1.00 17.31 ? 531  ARG B N     1 
ATOM   7428 C  CA    . ARG B 1 444 ? 167.882 -40.698 113.674 1.00 17.58 ? 531  ARG B CA    1 
ATOM   7429 C  C     . ARG B 1 444 ? 167.115 -40.892 114.977 1.00 16.43 ? 531  ARG B C     1 
ATOM   7430 O  O     . ARG B 1 444 ? 167.678 -41.358 115.967 1.00 16.25 ? 531  ARG B O     1 
ATOM   7431 C  CB    . ARG B 1 444 ? 167.722 -41.945 112.796 1.00 20.84 ? 531  ARG B CB    1 
ATOM   7432 C  CG    . ARG B 1 444 ? 168.423 -41.871 111.444 1.00 24.75 ? 531  ARG B CG    1 
ATOM   7433 C  CD    . ARG B 1 444 ? 167.675 -41.007 110.447 1.00 29.39 ? 531  ARG B CD    1 
ATOM   7434 N  NE    . ARG B 1 444 ? 168.268 -41.121 109.114 1.00 34.27 ? 531  ARG B NE    1 
ATOM   7435 C  CZ    . ARG B 1 444 ? 167.984 -40.334 108.079 1.00 36.53 ? 531  ARG B CZ    1 
ATOM   7436 N  NH1   . ARG B 1 444 ? 167.106 -39.346 108.200 1.00 37.54 ? 531  ARG B NH1   1 
ATOM   7437 N  NH2   . ARG B 1 444 ? 168.591 -40.530 106.913 1.00 37.32 ? 531  ARG B NH2   1 
ATOM   7438 N  N     . ILE B 1 445 ? 165.841 -40.505 114.977 1.00 13.32 ? 532  ILE B N     1 
ATOM   7439 C  CA    . ILE B 1 445 ? 164.972 -40.683 116.148 1.00 13.49 ? 532  ILE B CA    1 
ATOM   7440 C  C     . ILE B 1 445 ? 163.720 -41.403 115.653 1.00 15.05 ? 532  ILE B C     1 
ATOM   7441 O  O     . ILE B 1 445 ? 163.093 -40.935 114.689 1.00 14.85 ? 532  ILE B O     1 
ATOM   7442 C  CB    . ILE B 1 445 ? 164.606 -39.324 116.785 1.00 13.20 ? 532  ILE B CB    1 
ATOM   7443 C  CG1   . ILE B 1 445 ? 165.878 -38.573 117.233 1.00 12.94 ? 532  ILE B CG1   1 
ATOM   7444 C  CG2   . ILE B 1 445 ? 163.685 -39.522 117.975 1.00 13.07 ? 532  ILE B CG2   1 
ATOM   7445 C  CD1   . ILE B 1 445 ? 165.634 -37.165 117.755 1.00 13.10 ? 532  ILE B CD1   1 
ATOM   7446 N  N     . THR B 1 446 ? 163.365 -42.522 116.293 1.00 16.75 ? 533  THR B N     1 
ATOM   7447 C  CA    . THR B 1 446 ? 162.194 -43.322 115.905 1.00 18.29 ? 533  THR B CA    1 
ATOM   7448 C  C     . THR B 1 446 ? 160.946 -42.855 116.649 1.00 17.31 ? 533  THR B C     1 
ATOM   7449 O  O     . THR B 1 446 ? 161.047 -42.177 117.666 1.00 16.48 ? 533  THR B O     1 
ATOM   7450 C  CB    . THR B 1 446 ? 162.404 -44.827 116.183 1.00 20.37 ? 533  THR B CB    1 
ATOM   7451 O  OG1   . THR B 1 446 ? 162.378 -45.065 117.593 1.00 21.65 ? 533  THR B OG1   1 
ATOM   7452 C  CG2   . THR B 1 446 ? 163.728 -45.327 115.610 1.00 21.34 ? 533  THR B CG2   1 
ATOM   7453 N  N     . LYS B 1 447 ? 159.764 -43.224 116.149 1.00 18.00 ? 534  LYS B N     1 
ATOM   7454 C  CA    . LYS B 1 447 ? 158.500 -42.778 116.756 1.00 17.41 ? 534  LYS B CA    1 
ATOM   7455 C  C     . LYS B 1 447 ? 158.391 -43.189 118.227 1.00 18.74 ? 534  LYS B C     1 
ATOM   7456 O  O     . LYS B 1 447 ? 157.967 -42.397 119.081 1.00 17.30 ? 534  LYS B O     1 
ATOM   7457 C  CB    . LYS B 1 447 ? 157.302 -43.310 115.963 1.00 19.07 ? 534  LYS B CB    1 
ATOM   7458 C  CG    . LYS B 1 447 ? 155.981 -42.621 116.284 1.00 20.35 ? 534  LYS B CG    1 
ATOM   7459 C  CD    . LYS B 1 447 ? 154.849 -43.195 115.429 1.00 21.91 ? 534  LYS B CD    1 
ATOM   7460 C  CE    . LYS B 1 447 ? 154.259 -44.450 116.049 1.00 24.42 ? 534  LYS B CE    1 
ATOM   7461 N  NZ    . LYS B 1 447 ? 153.308 -45.133 115.132 1.00 27.17 ? 534  LYS B NZ    1 
ATOM   7462 N  N     . ASN B 1 448 ? 158.803 -44.421 118.526 1.00 19.23 ? 535  ASN B N     1 
ATOM   7463 C  CA    . ASN B 1 448 ? 158.675 -44.929 119.892 1.00 21.26 ? 535  ASN B CA    1 
ATOM   7464 C  C     . ASN B 1 448 ? 159.643 -44.281 120.883 1.00 19.15 ? 535  ASN B C     1 
ATOM   7465 O  O     . ASN B 1 448 ? 159.414 -44.351 122.088 1.00 18.47 ? 535  ASN B O     1 
ATOM   7466 C  CB    . ASN B 1 448 ? 158.763 -46.463 119.926 1.00 26.02 ? 535  ASN B CB    1 
ATOM   7467 C  CG    . ASN B 1 448 ? 157.637 -47.132 119.137 1.00 29.82 ? 535  ASN B CG    1 
ATOM   7468 O  OD1   . ASN B 1 448 ? 156.477 -46.689 119.153 1.00 33.18 ? 535  ASN B OD1   1 
ATOM   7469 N  ND2   . ASN B 1 448 ? 157.980 -48.201 118.428 1.00 32.50 ? 535  ASN B ND2   1 
ATOM   7470 N  N     . GLN B 1 449 ? 160.697 -43.631 120.371 1.00 16.72 ? 536  GLN B N     1 
ATOM   7471 C  CA    . GLN B 1 449 ? 161.592 -42.811 121.200 1.00 15.21 ? 536  GLN B CA    1 
ATOM   7472 C  C     . GLN B 1 449 ? 160.959 -41.461 121.547 1.00 15.78 ? 536  GLN B C     1 
ATOM   7473 O  O     . GLN B 1 449 ? 161.548 -40.662 122.284 1.00 16.70 ? 536  GLN B O     1 
ATOM   7474 C  CB    . GLN B 1 449 ? 162.914 -42.530 120.477 1.00 14.71 ? 536  GLN B CB    1 
ATOM   7475 C  CG    . GLN B 1 449 ? 163.891 -43.707 120.323 1.00 14.40 ? 536  GLN B CG    1 
ATOM   7476 C  CD    . GLN B 1 449 ? 165.142 -43.279 119.580 1.00 14.13 ? 536  GLN B CD    1 
ATOM   7477 O  OE1   . GLN B 1 449 ? 165.162 -43.211 118.350 1.00 14.80 ? 536  GLN B OE1   1 
ATOM   7478 N  NE2   . GLN B 1 449 ? 166.198 -42.949 120.329 1.00 12.76 ? 536  GLN B NE2   1 
ATOM   7479 N  N     . VAL B 1 450 ? 159.779 -41.178 121.002 1.00 15.09 ? 537  VAL B N     1 
ATOM   7480 C  CA    . VAL B 1 450 ? 159.183 -39.848 121.216 1.00 14.56 ? 537  VAL B CA    1 
ATOM   7481 C  C     . VAL B 1 450 ? 157.953 -39.883 122.115 1.00 15.42 ? 537  VAL B C     1 
ATOM   7482 O  O     . VAL B 1 450 ? 157.928 -39.263 123.189 1.00 15.84 ? 537  VAL B O     1 
ATOM   7483 C  CB    . VAL B 1 450 ? 158.852 -39.127 119.885 1.00 14.74 ? 537  VAL B CB    1 
ATOM   7484 C  CG1   . VAL B 1 450 ? 158.241 -37.753 120.161 1.00 13.69 ? 537  VAL B CG1   1 
ATOM   7485 C  CG2   . VAL B 1 450 ? 160.107 -38.974 119.030 1.00 13.48 ? 537  VAL B CG2   1 
ATOM   7486 N  N     . SER B 1 451 ? 156.930 -40.612 121.689 1.00 15.23 ? 538  SER B N     1 
ATOM   7487 C  CA    . SER B 1 451 ? 155.675 -40.615 122.427 1.00 14.69 ? 538  SER B CA    1 
ATOM   7488 C  C     . SER B 1 451 ? 154.816 -41.760 121.961 1.00 15.50 ? 538  SER B C     1 
ATOM   7489 O  O     . SER B 1 451 ? 154.815 -42.090 120.783 1.00 16.83 ? 538  SER B O     1 
ATOM   7490 C  CB    . SER B 1 451 ? 154.923 -39.299 122.220 1.00 14.18 ? 538  SER B CB    1 
ATOM   7491 O  OG    . SER B 1 451 ? 153.607 -39.345 122.776 1.00 13.25 ? 538  SER B OG    1 
ATOM   7492 N  N     . GLN B 1 452 ? 154.071 -42.337 122.894 1.00 14.47 ? 539  GLN B N     1 
ATOM   7493 C  CA    . GLN B 1 452 ? 153.145 -43.409 122.594 1.00 16.88 ? 539  GLN B CA    1 
ATOM   7494 C  C     . GLN B 1 452 ? 151.793 -42.839 122.161 1.00 16.24 ? 539  GLN B C     1 
ATOM   7495 O  O     . GLN B 1 452 ? 150.890 -43.596 121.824 1.00 16.80 ? 539  GLN B O     1 
ATOM   7496 C  CB    . GLN B 1 452 ? 152.965 -44.305 123.824 1.00 20.29 ? 539  GLN B CB    1 
ATOM   7497 C  CG    . GLN B 1 452 ? 154.234 -45.028 124.261 1.00 24.60 ? 539  GLN B CG    1 
ATOM   7498 C  CD    . GLN B 1 452 ? 154.189 -45.477 125.719 1.00 28.32 ? 539  GLN B CD    1 
ATOM   7499 O  OE1   . GLN B 1 452 ? 153.131 -45.457 126.366 1.00 33.00 ? 539  GLN B OE1   1 
ATOM   7500 N  NE2   . GLN B 1 452 ? 155.341 -45.890 126.246 1.00 31.98 ? 539  GLN B NE2   1 
ATOM   7501 N  N     . LEU B 1 453 ? 151.651 -41.512 122.190 1.00 14.81 ? 540  LEU B N     1 
ATOM   7502 C  CA    . LEU B 1 453 ? 150.392 -40.864 121.813 1.00 15.10 ? 540  LEU B CA    1 
ATOM   7503 C  C     . LEU B 1 453 ? 150.363 -40.374 120.357 1.00 15.33 ? 540  LEU B C     1 
ATOM   7504 O  O     . LEU B 1 453 ? 149.408 -39.720 119.947 1.00 17.14 ? 540  LEU B O     1 
ATOM   7505 C  CB    . LEU B 1 453 ? 150.065 -39.696 122.764 1.00 15.69 ? 540  LEU B CB    1 
ATOM   7506 C  CG    . LEU B 1 453 ? 150.043 -39.925 124.294 1.00 17.89 ? 540  LEU B CG    1 
ATOM   7507 C  CD1   . LEU B 1 453 ? 149.356 -38.765 125.010 1.00 17.59 ? 540  LEU B CD1   1 
ATOM   7508 C  CD2   . LEU B 1 453 ? 149.413 -41.243 124.704 1.00 17.74 ? 540  LEU B CD2   1 
ATOM   7509 N  N     . LEU B 1 454 ? 151.394 -40.704 119.581 1.00 13.73 ? 541  LEU B N     1 
ATOM   7510 C  CA    . LEU B 1 454 ? 151.491 -40.260 118.194 1.00 13.51 ? 541  LEU B CA    1 
ATOM   7511 C  C     . LEU B 1 454 ? 150.668 -41.189 117.287 1.00 14.07 ? 541  LEU B C     1 
ATOM   7512 O  O     . LEU B 1 454 ? 150.257 -42.263 117.727 1.00 16.25 ? 541  LEU B O     1 
ATOM   7513 C  CB    . LEU B 1 454 ? 152.961 -40.213 117.754 1.00 11.60 ? 541  LEU B CB    1 
ATOM   7514 C  CG    . LEU B 1 454 ? 153.818 -39.168 118.497 1.00 12.96 ? 541  LEU B CG    1 
ATOM   7515 C  CD1   . LEU B 1 454 ? 155.302 -39.307 118.157 1.00 13.30 ? 541  LEU B CD1   1 
ATOM   7516 C  CD2   . LEU B 1 454 ? 153.331 -37.741 118.243 1.00 13.49 ? 541  LEU B CD2   1 
ATOM   7517 N  N     . PRO B 1 455 ? 150.399 -40.775 116.036 1.00 13.78 ? 542  PRO B N     1 
ATOM   7518 C  CA    . PRO B 1 455 ? 149.596 -41.622 115.120 1.00 13.78 ? 542  PRO B CA    1 
ATOM   7519 C  C     . PRO B 1 455 ? 150.189 -43.033 114.913 1.00 15.70 ? 542  PRO B C     1 
ATOM   7520 O  O     . PRO B 1 455 ? 151.401 -43.165 114.816 1.00 15.96 ? 542  PRO B O     1 
ATOM   7521 C  CB    . PRO B 1 455 ? 149.648 -40.839 113.802 1.00 15.19 ? 542  PRO B CB    1 
ATOM   7522 C  CG    . PRO B 1 455 ? 149.820 -39.416 114.222 1.00 14.67 ? 542  PRO B CG    1 
ATOM   7523 C  CD    . PRO B 1 455 ? 150.727 -39.471 115.436 1.00 13.47 ? 542  PRO B CD    1 
ATOM   7524 N  N     . GLU B 1 456 ? 149.354 -44.070 114.829 1.00 18.87 ? 543  GLU B N     1 
ATOM   7525 C  CA    . GLU B 1 456 ? 149.880 -45.409 114.515 1.00 22.56 ? 543  GLU B CA    1 
ATOM   7526 C  C     . GLU B 1 456 ? 150.083 -45.609 113.019 1.00 22.38 ? 543  GLU B C     1 
ATOM   7527 O  O     . GLU B 1 456 ? 150.884 -46.448 112.591 1.00 23.51 ? 543  GLU B O     1 
ATOM   7528 C  CB    . GLU B 1 456 ? 149.004 -46.516 115.090 1.00 27.28 ? 543  GLU B CB    1 
ATOM   7529 C  CG    . GLU B 1 456 ? 149.787 -47.853 115.170 1.00 30.59 ? 543  GLU B CG    1 
ATOM   7530 C  CD    . GLU B 1 456 ? 149.023 -48.879 115.982 1.00 34.93 ? 543  GLU B CD    1 
ATOM   7531 O  OE1   . GLU B 1 456 ? 149.055 -48.892 117.266 1.00 60.03 ? 543  GLU B OE1   1 
ATOM   7532 O  OE2   . GLU B 1 456 ? 148.207 -49.630 115.356 1.00 42.10 ? 543  GLU B OE2   1 
ATOM   7533 N  N     . LYS B 1 457 ? 149.356 -44.833 112.223 1.00 20.52 ? 544  LYS B N     1 
ATOM   7534 C  CA    . LYS B 1 457 ? 149.588 -44.813 110.783 1.00 19.73 ? 544  LYS B CA    1 
ATOM   7535 C  C     . LYS B 1 457 ? 149.525 -43.385 110.258 1.00 17.06 ? 544  LYS B C     1 
ATOM   7536 O  O     . LYS B 1 457 ? 149.082 -42.477 110.962 1.00 16.25 ? 544  LYS B O     1 
ATOM   7537 C  CB    . LYS B 1 457 ? 148.617 -45.730 110.035 1.00 23.38 ? 544  LYS B CB    1 
ATOM   7538 C  CG    . LYS B 1 457 ? 147.149 -45.376 110.201 1.00 26.27 ? 544  LYS B CG    1 
ATOM   7539 C  CD    . LYS B 1 457 ? 146.276 -46.263 109.314 1.00 28.72 ? 544  LYS B CD    1 
ATOM   7540 C  CE    . LYS B 1 457 ? 146.166 -47.678 109.867 1.00 32.48 ? 544  LYS B CE    1 
ATOM   7541 N  NZ    . LYS B 1 457 ? 145.221 -47.763 111.021 1.00 36.07 ? 544  LYS B NZ    1 
ATOM   7542 N  N     . PHE B 1 458 ? 149.970 -43.200 109.026 1.00 14.40 ? 545  PHE B N     1 
ATOM   7543 C  CA    . PHE B 1 458 ? 150.243 -41.854 108.519 1.00 13.02 ? 545  PHE B CA    1 
ATOM   7544 C  C     . PHE B 1 458 ? 149.500 -41.465 107.263 1.00 12.16 ? 545  PHE B C     1 
ATOM   7545 O  O     . PHE B 1 458 ? 149.813 -40.441 106.660 1.00 10.74 ? 545  PHE B O     1 
ATOM   7546 C  CB    . PHE B 1 458 ? 151.739 -41.662 108.371 1.00 12.96 ? 545  PHE B CB    1 
ATOM   7547 C  CG    . PHE B 1 458 ? 152.455 -41.692 109.694 1.00 13.77 ? 545  PHE B CG    1 
ATOM   7548 C  CD1   . PHE B 1 458 ? 152.597 -40.534 110.437 1.00 14.69 ? 545  PHE B CD1   1 
ATOM   7549 C  CD2   . PHE B 1 458 ? 152.928 -42.894 110.218 1.00 15.62 ? 545  PHE B CD2   1 
ATOM   7550 C  CE1   . PHE B 1 458 ? 153.226 -40.553 111.674 1.00 15.78 ? 545  PHE B CE1   1 
ATOM   7551 C  CE2   . PHE B 1 458 ? 153.563 -42.927 111.451 1.00 16.19 ? 545  PHE B CE2   1 
ATOM   7552 C  CZ    . PHE B 1 458 ? 153.710 -41.756 112.182 1.00 15.73 ? 545  PHE B CZ    1 
ATOM   7553 N  N     . ALA B 1 459 ? 148.514 -42.282 106.892 1.00 11.47 ? 546  ALA B N     1 
ATOM   7554 C  CA    . ALA B 1 459 ? 147.646 -42.000 105.749 1.00 11.05 ? 546  ALA B CA    1 
ATOM   7555 C  C     . ALA B 1 459 ? 146.278 -42.611 105.979 1.00 11.28 ? 546  ALA B C     1 
ATOM   7556 O  O     . ALA B 1 459 ? 146.145 -43.672 106.604 1.00 11.58 ? 546  ALA B O     1 
ATOM   7557 C  CB    . ALA B 1 459 ? 148.251 -42.528 104.451 1.00 11.66 ? 546  ALA B CB    1 
ATOM   7558 N  N     . GLU B 1 460 ? 145.253 -41.942 105.481 1.00 10.41 ? 547  GLU B N     1 
ATOM   7559 C  CA    . GLU B 1 460 ? 143.901 -42.498 105.530 1.00 10.75 ? 547  GLU B CA    1 
ATOM   7560 C  C     . GLU B 1 460 ? 143.090 -41.884 104.399 1.00 11.15 ? 547  GLU B C     1 
ATOM   7561 O  O     . GLU B 1 460 ? 143.548 -40.942 103.733 1.00 12.07 ? 547  GLU B O     1 
ATOM   7562 C  CB    . GLU B 1 460 ? 143.246 -42.209 106.881 1.00 10.38 ? 547  GLU B CB    1 
ATOM   7563 C  CG    . GLU B 1 460 ? 142.989 -40.722 107.147 1.00 11.19 ? 547  GLU B CG    1 
ATOM   7564 C  CD    . GLU B 1 460 ? 142.321 -40.476 108.493 1.00 12.97 ? 547  GLU B CD    1 
ATOM   7565 O  OE1   . GLU B 1 460 ? 141.656 -41.394 109.012 1.00 15.20 ? 547  GLU B OE1   1 
ATOM   7566 O  OE2   . GLU B 1 460 ? 142.461 -39.361 109.050 1.00 14.23 ? 547  GLU B OE2   1 
ATOM   7567 N  N     . GLN B 1 461 ? 141.892 -42.415 104.178 1.00 11.05 ? 548  GLN B N     1 
ATOM   7568 C  CA    . GLN B 1 461 ? 141.029 -41.891 103.138 1.00 11.90 ? 548  GLN B CA    1 
ATOM   7569 C  C     . GLN B 1 461 ? 139.720 -41.462 103.738 1.00 12.83 ? 548  GLN B C     1 
ATOM   7570 O  O     . GLN B 1 461 ? 139.158 -42.161 104.609 1.00 13.39 ? 548  GLN B O     1 
ATOM   7571 C  CB    . GLN B 1 461 ? 140.804 -42.944 102.047 1.00 13.97 ? 548  GLN B CB    1 
ATOM   7572 C  CG    . GLN B 1 461 ? 142.040 -43.205 101.220 1.00 16.42 ? 548  GLN B CG    1 
ATOM   7573 C  CD    . GLN B 1 461 ? 141.785 -44.261 100.170 1.00 18.80 ? 548  GLN B CD    1 
ATOM   7574 O  OE1   . GLN B 1 461 ? 141.275 -45.334 100.482 1.00 20.80 ? 548  GLN B OE1   1 
ATOM   7575 N  NE2   . GLN B 1 461 ? 142.124 -43.958 98.920  1.00 20.24 ? 548  GLN B NE2   1 
ATOM   7576 N  N     . LEU B 1 462 ? 139.256 -40.292 103.307 1.00 12.66 ? 549  LEU B N     1 
ATOM   7577 C  CA    . LEU B 1 462 ? 137.924 -39.812 103.668 1.00 12.74 ? 549  LEU B CA    1 
ATOM   7578 C  C     . LEU B 1 462 ? 137.059 -39.866 102.420 1.00 13.45 ? 549  LEU B C     1 
ATOM   7579 O  O     . LEU B 1 462 ? 137.487 -39.447 101.334 1.00 13.51 ? 549  LEU B O     1 
ATOM   7580 C  CB    . LEU B 1 462 ? 137.961 -38.374 104.196 1.00 14.98 ? 549  LEU B CB    1 
ATOM   7581 C  CG    . LEU B 1 462 ? 138.780 -38.102 105.451 1.00 18.30 ? 549  LEU B CG    1 
ATOM   7582 C  CD1   . LEU B 1 462 ? 138.646 -36.629 105.826 1.00 20.29 ? 549  LEU B CD1   1 
ATOM   7583 C  CD2   . LEU B 1 462 ? 138.324 -39.002 106.595 1.00 19.01 ? 549  LEU B CD2   1 
ATOM   7584 N  N     . ILE B 1 463 ? 135.844 -40.379 102.580 1.00 12.14 ? 550  ILE B N     1 
ATOM   7585 C  CA    . ILE B 1 463 ? 134.937 -40.499 101.444 1.00 12.29 ? 550  ILE B CA    1 
ATOM   7586 C  C     . ILE B 1 463 ? 133.728 -39.622 101.690 1.00 12.11 ? 550  ILE B C     1 
ATOM   7587 O  O     . ILE B 1 463 ? 132.938 -39.899 102.606 1.00 11.58 ? 550  ILE B O     1 
ATOM   7588 C  CB    . ILE B 1 463 ? 134.473 -41.954 101.225 1.00 12.94 ? 550  ILE B CB    1 
ATOM   7589 C  CG1   . ILE B 1 463 ? 135.679 -42.878 101.021 1.00 13.62 ? 550  ILE B CG1   1 
ATOM   7590 C  CG2   . ILE B 1 463 ? 133.523 -42.003 100.025 1.00 13.20 ? 550  ILE B CG2   1 
ATOM   7591 C  CD1   . ILE B 1 463 ? 135.378 -44.356 101.189 1.00 15.32 ? 550  ILE B CD1   1 
ATOM   7592 N  N     . ARG B 1 464 ? 133.571 -38.572 100.880 1.00 10.49 ? 551  ARG B N     1 
ATOM   7593 C  CA    . ARG B 1 464 ? 132.411 -37.694 101.011 1.00 10.88 ? 551  ARG B CA    1 
ATOM   7594 C  C     . ARG B 1 464 ? 131.401 -37.959 99.907  1.00 11.90 ? 551  ARG B C     1 
ATOM   7595 O  O     . ARG B 1 464 ? 131.766 -38.160 98.750  1.00 12.93 ? 551  ARG B O     1 
ATOM   7596 C  CB    . ARG B 1 464 ? 132.796 -36.209 100.977 1.00 12.29 ? 551  ARG B CB    1 
ATOM   7597 C  CG    . ARG B 1 464 ? 133.416 -35.692 102.271 1.00 13.00 ? 551  ARG B CG    1 
ATOM   7598 C  CD    . ARG B 1 464 ? 134.905 -35.991 102.309 1.00 13.96 ? 551  ARG B CD    1 
ATOM   7599 N  NE    . ARG B 1 464 ? 135.554 -35.356 103.460 1.00 14.91 ? 551  ARG B NE    1 
ATOM   7600 C  CZ    . ARG B 1 464 ? 135.991 -34.094 103.481 1.00 15.66 ? 551  ARG B CZ    1 
ATOM   7601 N  NH1   . ARG B 1 464 ? 135.835 -33.298 102.432 1.00 13.86 ? 551  ARG B NH1   1 
ATOM   7602 N  NH2   . ARG B 1 464 ? 136.575 -33.620 104.575 1.00 15.30 ? 551  ARG B NH2   1 
ATOM   7603 N  N     . VAL B 1 465 ? 130.126 -37.935 100.274 1.00 11.27 ? 552  VAL B N     1 
ATOM   7604 C  CA    . VAL B 1 465 ? 129.075 -38.147 99.284  1.00 10.79 ? 552  VAL B CA    1 
ATOM   7605 C  C     . VAL B 1 465 ? 128.129 -36.943 99.260  1.00 10.76 ? 552  VAL B C     1 
ATOM   7606 O  O     . VAL B 1 465 ? 127.720 -36.440 100.307 1.00 11.60 ? 552  VAL B O     1 
ATOM   7607 C  CB    . VAL B 1 465 ? 128.299 -39.459 99.549  1.00 11.17 ? 552  VAL B CB    1 
ATOM   7608 C  CG1   . VAL B 1 465 ? 127.113 -39.592 98.589  1.00 11.99 ? 552  VAL B CG1   1 
ATOM   7609 C  CG2   . VAL B 1 465 ? 129.230 -40.660 99.420  1.00 11.74 ? 552  VAL B CG2   1 
ATOM   7610 N  N     . TYR B 1 466 ? 127.797 -36.485 98.052  1.00 10.64 ? 553  TYR B N     1 
ATOM   7611 C  CA    . TYR B 1 466 ? 126.872 -35.390 97.863  1.00 10.83 ? 553  TYR B CA    1 
ATOM   7612 C  C     . TYR B 1 466 ? 125.763 -35.796 96.889  1.00 12.01 ? 553  TYR B C     1 
ATOM   7613 O  O     . TYR B 1 466 ? 125.926 -36.740 96.120  1.00 13.13 ? 553  TYR B O     1 
ATOM   7614 C  CB    . TYR B 1 466 ? 127.582 -34.191 97.238  1.00 10.62 ? 553  TYR B CB    1 
ATOM   7615 C  CG    . TYR B 1 466 ? 128.823 -33.688 97.963  1.00 10.32 ? 553  TYR B CG    1 
ATOM   7616 C  CD1   . TYR B 1 466 ? 130.054 -34.312 97.782  1.00 10.29 ? 553  TYR B CD1   1 
ATOM   7617 C  CD2   . TYR B 1 466 ? 128.767 -32.555 98.768  1.00 10.93 ? 553  TYR B CD2   1 
ATOM   7618 C  CE1   . TYR B 1 466 ? 131.207 -33.819 98.405  1.00 10.54 ? 553  TYR B CE1   1 
ATOM   7619 C  CE2   . TYR B 1 466 ? 129.911 -32.068 99.412  1.00 10.83 ? 553  TYR B CE2   1 
ATOM   7620 C  CZ    . TYR B 1 466 ? 131.116 -32.701 99.218  1.00 10.55 ? 553  TYR B CZ    1 
ATOM   7621 O  OH    . TYR B 1 466 ? 132.267 -32.226 99.834  1.00 10.90 ? 553  TYR B OH    1 
ATOM   7622 N  N     . CYS B 1 467 ? 124.666 -35.051 96.915  1.00 12.86 ? 554  CYS B N     1 
ATOM   7623 C  CA    . CYS B 1 467 ? 123.559 -35.271 95.984  1.00 14.42 ? 554  CYS B CA    1 
ATOM   7624 C  C     . CYS B 1 467 ? 123.287 -34.000 95.174  1.00 15.54 ? 554  CYS B C     1 
ATOM   7625 O  O     . CYS B 1 467 ? 123.136 -32.913 95.734  1.00 15.52 ? 554  CYS B O     1 
ATOM   7626 C  CB    . CYS B 1 467 ? 122.297 -35.680 96.734  1.00 15.54 ? 554  CYS B CB    1 
ATOM   7627 S  SG    . CYS B 1 467 ? 120.954 -36.231 95.617  1.00 18.37 ? 554  CYS B SG    1 
ATOM   7628 N  N     . LYS B 1 468 ? 123.212 -34.154 93.854  1.00 17.38 ? 555  LYS B N     1 
ATOM   7629 C  CA    . LYS B 1 468 ? 122.955 -33.036 92.947  1.00 19.74 ? 555  LYS B CA    1 
ATOM   7630 C  C     . LYS B 1 468 ? 121.483 -32.638 92.898  1.00 21.44 ? 555  LYS B C     1 
ATOM   7631 O  O     . LYS B 1 468 ? 121.131 -31.610 92.320  1.00 23.65 ? 555  LYS B O     1 
ATOM   7632 C  CB    . LYS B 1 468 ? 123.465 -33.379 91.543  1.00 20.52 ? 555  LYS B CB    1 
ATOM   7633 C  CG    . LYS B 1 468 ? 124.967 -33.566 91.511  1.00 22.63 ? 555  LYS B CG    1 
ATOM   7634 C  CD    . LYS B 1 468 ? 125.445 -34.281 90.264  1.00 24.82 ? 555  LYS B CD    1 
ATOM   7635 C  CE    . LYS B 1 468 ? 125.745 -33.310 89.138  1.00 26.13 ? 555  LYS B CE    1 
ATOM   7636 N  NZ    . LYS B 1 468 ? 126.757 -33.889 88.210  1.00 29.32 ? 555  LYS B NZ    1 
ATOM   7637 N  N     . LYS B 1 469 ? 120.628 -33.463 93.493  1.00 23.89 ? 556  LYS B N     1 
ATOM   7638 C  CA    . LYS B 1 469 ? 119.222 -33.145 93.663  1.00 26.51 ? 556  LYS B CA    1 
ATOM   7639 C  C     . LYS B 1 469 ? 119.039 -32.638 95.077  1.00 27.76 ? 556  LYS B C     1 
ATOM   7640 O  O     . LYS B 1 469 ? 119.345 -33.339 96.040  1.00 28.49 ? 556  LYS B O     1 
ATOM   7641 C  CB    . LYS B 1 469 ? 118.352 -34.379 93.412  1.00 28.65 ? 556  LYS B CB    1 
ATOM   7642 C  CG    . LYS B 1 469 ? 118.369 -34.873 91.965  1.00 30.94 ? 556  LYS B CG    1 
ATOM   7643 C  CD    . LYS B 1 469 ? 117.233 -35.843 91.688  1.00 33.77 ? 556  LYS B CD    1 
ATOM   7644 C  CE    . LYS B 1 469 ? 115.875 -35.167 91.844  1.00 36.08 ? 556  LYS B CE    1 
ATOM   7645 N  NZ    . LYS B 1 469 ? 114.903 -36.043 92.571  1.00 38.46 ? 556  LYS B NZ    1 
ATOM   7646 N  N     . VAL B 1 470 ? 118.517 -31.423 95.200  1.00 28.96 ? 557  VAL B N     1 
ATOM   7647 C  CA    . VAL B 1 470 ? 118.670 -30.645 96.433  1.00 28.57 ? 557  VAL B CA    1 
ATOM   7648 C  C     . VAL B 1 470 ? 117.392 -30.459 97.246  1.00 30.89 ? 557  VAL B C     1 
ATOM   7649 O  O     . VAL B 1 470 ? 117.410 -29.853 98.324  1.00 30.90 ? 557  VAL B O     1 
ATOM   7650 C  CB    . VAL B 1 470 ? 119.337 -29.279 96.134  1.00 28.72 ? 557  VAL B CB    1 
ATOM   7651 C  CG1   . VAL B 1 470 ? 120.616 -29.488 95.324  1.00 28.56 ? 557  VAL B CG1   1 
ATOM   7652 C  CG2   . VAL B 1 470 ? 118.382 -28.358 95.386  1.00 27.99 ? 557  VAL B CG2   1 
ATOM   7653 N  N     . ASP B 1 471 ? 116.284 -30.990 96.735  1.00 31.69 ? 558  ASP B N     1 
ATOM   7654 C  CA    . ASP B 1 471 ? 115.004 -30.885 97.425  1.00 33.16 ? 558  ASP B CA    1 
ATOM   7655 C  C     . ASP B 1 471 ? 114.951 -31.818 98.639  1.00 34.00 ? 558  ASP B C     1 
ATOM   7656 O  O     . ASP B 1 471 ? 115.707 -32.788 98.719  1.00 33.58 ? 558  ASP B O     1 
ATOM   7657 C  CB    . ASP B 1 471 ? 113.853 -31.180 96.460  1.00 34.29 ? 558  ASP B CB    1 
ATOM   7658 C  CG    . ASP B 1 471 ? 113.896 -32.591 95.927  1.00 35.50 ? 558  ASP B CG    1 
ATOM   7659 O  OD1   . ASP B 1 471 ? 114.672 -32.847 94.977  1.00 35.64 ? 558  ASP B OD1   1 
ATOM   7660 O  OD2   . ASP B 1 471 ? 113.159 -33.447 96.467  1.00 37.78 ? 558  ASP B OD2   1 
ATOM   7661 N  N     . ARG B 1 472 ? 114.057 -31.509 99.578  1.00 35.76 ? 559  ARG B N     1 
ATOM   7662 C  CA    . ARG B 1 472 ? 113.938 -32.244 100.841 1.00 36.55 ? 559  ARG B CA    1 
ATOM   7663 C  C     . ARG B 1 472 ? 113.753 -33.753 100.644 1.00 35.18 ? 559  ARG B C     1 
ATOM   7664 O  O     . ARG B 1 472 ? 114.360 -34.562 101.354 1.00 33.36 ? 559  ARG B O     1 
ATOM   7665 C  CB    . ARG B 1 472 ? 112.783 -31.678 101.680 1.00 40.03 ? 559  ARG B CB    1 
ATOM   7666 C  CG    . ARG B 1 472 ? 112.911 -31.958 103.192 1.00 43.26 ? 559  ARG B CG    1 
ATOM   7667 C  CD    . ARG B 1 472 ? 111.602 -31.681 103.926 1.00 46.41 ? 559  ARG B CD    1 
ATOM   7668 N  NE    . ARG B 1 472 ? 110.796 -32.896 104.084 1.00 49.15 ? 559  ARG B NE    1 
ATOM   7669 C  CZ    . ARG B 1 472 ? 109.779 -33.246 103.295 1.00 50.37 ? 559  ARG B CZ    1 
ATOM   7670 N  NH1   . ARG B 1 472 ? 109.124 -34.378 103.531 1.00 52.09 ? 559  ARG B NH1   1 
ATOM   7671 N  NH2   . ARG B 1 472 ? 109.410 -32.474 102.278 1.00 50.38 ? 559  ARG B NH2   1 
ATOM   7672 N  N     . LYS B 1 473 ? 112.919 -34.128 99.677  1.00 33.24 ? 560  LYS B N     1 
ATOM   7673 C  CA    . LYS B 1 473 ? 112.634 -35.536 99.409  1.00 31.89 ? 560  LYS B CA    1 
ATOM   7674 C  C     . LYS B 1 473 ? 113.854 -36.253 98.846  1.00 29.56 ? 560  LYS B C     1 
ATOM   7675 O  O     . LYS B 1 473 ? 114.110 -37.411 99.183  1.00 28.63 ? 560  LYS B O     1 
ATOM   7676 C  CB    . LYS B 1 473 ? 111.449 -35.688 98.440  1.00 35.64 ? 560  LYS B CB    1 
ATOM   7677 C  CG    . LYS B 1 473 ? 110.135 -35.076 98.926  1.00 38.21 ? 560  LYS B CG    1 
ATOM   7678 C  CD    . LYS B 1 473 ? 108.928 -35.532 98.099  1.00 40.83 ? 560  LYS B CD    1 
ATOM   7679 C  CE    . LYS B 1 473 ? 108.593 -34.592 96.942  1.00 42.45 ? 560  LYS B CE    1 
ATOM   7680 N  NZ    . LYS B 1 473 ? 109.207 -35.018 95.618  1.00 43.77 ? 560  LYS B NZ    1 
ATOM   7681 N  N     . SER B 1 474 ? 114.605 -35.575 97.977  1.00 25.84 ? 561  SER B N     1 
ATOM   7682 C  CA    . SER B 1 474 ? 115.767 -36.190 97.344  1.00 25.06 ? 561  SER B CA    1 
ATOM   7683 C  C     . SER B 1 474 ? 116.930 -36.369 98.318  1.00 23.92 ? 561  SER B C     1 
ATOM   7684 O  O     . SER B 1 474 ? 117.648 -37.366 98.244  1.00 21.01 ? 561  SER B O     1 
ATOM   7685 C  CB    . SER B 1 474 ? 116.221 -35.366 96.146  1.00 27.62 ? 561  SER B CB    1 
ATOM   7686 O  OG    . SER B 1 474 ? 115.189 -35.297 95.173  1.00 29.65 ? 561  SER B OG    1 
ATOM   7687 N  N     . LEU B 1 475 ? 117.108 -35.394 99.209  1.00 24.04 ? 562  LEU B N     1 
ATOM   7688 C  CA    . LEU B 1 475 ? 118.140 -35.462 100.238 1.00 23.96 ? 562  LEU B CA    1 
ATOM   7689 C  C     . LEU B 1 475 ? 117.837 -36.562 101.249 1.00 23.21 ? 562  LEU B C     1 
ATOM   7690 O  O     . LEU B 1 475 ? 118.727 -37.336 101.607 1.00 21.45 ? 562  LEU B O     1 
ATOM   7691 C  CB    . LEU B 1 475 ? 118.317 -34.112 100.936 1.00 24.57 ? 562  LEU B CB    1 
ATOM   7692 C  CG    . LEU B 1 475 ? 119.436 -34.056 101.989 1.00 24.05 ? 562  LEU B CG    1 
ATOM   7693 C  CD1   . LEU B 1 475 ? 120.783 -34.404 101.367 1.00 24.42 ? 562  LEU B CD1   1 
ATOM   7694 C  CD2   . LEU B 1 475 ? 119.488 -32.688 102.656 1.00 25.55 ? 562  LEU B CD2   1 
ATOM   7695 N  N     . TYR B 1 476 ? 116.582 -36.652 101.695 1.00 22.01 ? 563  TYR B N     1 
ATOM   7696 C  CA    . TYR B 1 476 ? 116.182 -37.759 102.571 1.00 22.61 ? 563  TYR B CA    1 
ATOM   7697 C  C     . TYR B 1 476 ? 116.534 -39.104 101.930 1.00 19.83 ? 563  TYR B C     1 
ATOM   7698 O  O     . TYR B 1 476 ? 117.098 -39.990 102.580 1.00 18.49 ? 563  TYR B O     1 
ATOM   7699 C  CB    . TYR B 1 476 ? 114.682 -37.691 102.907 1.00 25.52 ? 563  TYR B CB    1 
ATOM   7700 C  CG    . TYR B 1 476 ? 114.197 -38.857 103.748 1.00 27.59 ? 563  TYR B CG    1 
ATOM   7701 C  CD1   . TYR B 1 476 ? 114.639 -39.030 105.059 1.00 28.74 ? 563  TYR B CD1   1 
ATOM   7702 C  CD2   . TYR B 1 476 ? 113.302 -39.794 103.228 1.00 29.54 ? 563  TYR B CD2   1 
ATOM   7703 C  CE1   . TYR B 1 476 ? 114.209 -40.105 105.829 1.00 28.23 ? 563  TYR B CE1   1 
ATOM   7704 C  CE2   . TYR B 1 476 ? 112.857 -40.868 103.995 1.00 30.17 ? 563  TYR B CE2   1 
ATOM   7705 C  CZ    . TYR B 1 476 ? 113.313 -41.019 105.289 1.00 29.75 ? 563  TYR B CZ    1 
ATOM   7706 O  OH    . TYR B 1 476 ? 112.876 -42.089 106.046 1.00 30.26 ? 563  TYR B OH    1 
ATOM   7707 N  N     . ALA B 1 477 ? 116.211 -39.244 100.644 1.00 18.57 ? 564  ALA B N     1 
ATOM   7708 C  CA    . ALA B 1 477 ? 116.520 -40.458 99.896  1.00 17.93 ? 564  ALA B CA    1 
ATOM   7709 C  C     . ALA B 1 477 ? 118.021 -40.694 99.773  1.00 17.68 ? 564  ALA B C     1 
ATOM   7710 O  O     . ALA B 1 477 ? 118.481 -41.812 99.989  1.00 16.17 ? 564  ALA B O     1 
ATOM   7711 C  CB    . ALA B 1 477 ? 115.868 -40.432 98.513  1.00 18.66 ? 564  ALA B CB    1 
ATOM   7712 N  N     . ALA B 1 478 ? 118.779 -39.644 99.433  1.00 15.90 ? 565  ALA B N     1 
ATOM   7713 C  CA    . ALA B 1 478 ? 120.233 -39.770 99.301  1.00 16.14 ? 565  ALA B CA    1 
ATOM   7714 C  C     . ALA B 1 478 ? 120.857 -40.275 100.588 1.00 15.66 ? 565  ALA B C     1 
ATOM   7715 O  O     . ALA B 1 478 ? 121.792 -41.065 100.549 1.00 15.44 ? 565  ALA B O     1 
ATOM   7716 C  CB    . ALA B 1 478 ? 120.858 -38.442 98.910  1.00 15.22 ? 565  ALA B CB    1 
ATOM   7717 N  N     . ARG B 1 479 ? 120.336 -39.813 101.721 1.00 16.34 ? 566  ARG B N     1 
ATOM   7718 C  CA    . ARG B 1 479 ? 120.843 -40.264 103.021 1.00 16.94 ? 566  ARG B CA    1 
ATOM   7719 C  C     . ARG B 1 479 ? 120.663 -41.772 103.212 1.00 17.13 ? 566  ARG B C     1 
ATOM   7720 O  O     . ARG B 1 479 ? 121.537 -42.450 103.745 1.00 15.52 ? 566  ARG B O     1 
ATOM   7721 C  CB    . ARG B 1 479 ? 120.213 -39.468 104.146 1.00 19.83 ? 566  ARG B CB    1 
ATOM   7722 C  CG    . ARG B 1 479 ? 120.748 -38.047 104.216 1.00 22.50 ? 566  ARG B CG    1 
ATOM   7723 C  CD    . ARG B 1 479 ? 119.829 -37.133 104.999 1.00 24.71 ? 566  ARG B CD    1 
ATOM   7724 N  NE    . ARG B 1 479 ? 120.531 -35.904 105.367 1.00 28.35 ? 566  ARG B NE    1 
ATOM   7725 C  CZ    . ARG B 1 479 ? 119.944 -34.802 105.824 1.00 29.49 ? 566  ARG B CZ    1 
ATOM   7726 N  NH1   . ARG B 1 479 ? 118.626 -34.755 105.988 1.00 28.79 ? 566  ARG B NH1   1 
ATOM   7727 N  NH2   . ARG B 1 479 ? 120.684 -33.741 106.124 1.00 30.84 ? 566  ARG B NH2   1 
ATOM   7728 N  N     . GLN B 1 480 ? 119.545 -42.301 102.734 1.00 17.23 ? 567  GLN B N     1 
ATOM   7729 C  CA    . GLN B 1 480 ? 119.309 -43.737 102.824 1.00 17.41 ? 567  GLN B CA    1 
ATOM   7730 C  C     . GLN B 1 480 ? 120.218 -44.538 101.914 1.00 15.90 ? 567  GLN B C     1 
ATOM   7731 O  O     . GLN B 1 480 ? 120.766 -45.560 102.346 1.00 16.41 ? 567  GLN B O     1 
ATOM   7732 C  CB    . GLN B 1 480 ? 117.832 -44.068 102.556 1.00 18.33 ? 567  GLN B CB    1 
ATOM   7733 C  CG    . GLN B 1 480 ? 116.863 -43.162 103.299 1.00 18.75 ? 567  GLN B CG    1 
ATOM   7734 C  CD    . GLN B 1 480 ? 117.162 -43.048 104.784 1.00 20.81 ? 567  GLN B CD    1 
ATOM   7735 O  OE1   . GLN B 1 480 ? 117.309 -44.054 105.481 1.00 21.31 ? 567  GLN B OE1   1 
ATOM   7736 N  NE2   . GLN B 1 480 ? 117.267 -41.813 105.273 1.00 21.12 ? 567  GLN B NE2   1 
ATOM   7737 N  N     . TYR B 1 481 ? 120.365 -44.104 100.655 1.00 16.14 ? 568  TYR B N     1 
ATOM   7738 C  CA    . TYR B 1 481 ? 121.277 -44.777 99.726  1.00 15.66 ? 568  TYR B CA    1 
ATOM   7739 C  C     . TYR B 1 481 ? 122.694 -44.771 100.294 1.00 15.58 ? 568  TYR B C     1 
ATOM   7740 O  O     . TYR B 1 481 ? 123.412 -45.772 100.218 1.00 15.62 ? 568  TYR B O     1 
ATOM   7741 C  CB    . TYR B 1 481 ? 121.313 -44.083 98.359  1.00 17.68 ? 568  TYR B CB    1 
ATOM   7742 C  CG    . TYR B 1 481 ? 120.145 -44.372 97.422  1.00 18.95 ? 568  TYR B CG    1 
ATOM   7743 C  CD1   . TYR B 1 481 ? 119.002 -43.574 97.442  1.00 19.64 ? 568  TYR B CD1   1 
ATOM   7744 C  CD2   . TYR B 1 481 ? 120.212 -45.405 96.489  1.00 20.53 ? 568  TYR B CD2   1 
ATOM   7745 C  CE1   . TYR B 1 481 ? 117.941 -43.817 96.576  1.00 20.42 ? 568  TYR B CE1   1 
ATOM   7746 C  CE2   . TYR B 1 481 ? 119.159 -45.650 95.616  1.00 20.86 ? 568  TYR B CE2   1 
ATOM   7747 C  CZ    . TYR B 1 481 ? 118.026 -44.852 95.666  1.00 21.47 ? 568  TYR B CZ    1 
ATOM   7748 O  OH    . TYR B 1 481 ? 116.964 -45.078 94.798  1.00 21.25 ? 568  TYR B OH    1 
ATOM   7749 N  N     . PHE B 1 482 ? 123.092 -43.626 100.860 1.00 14.49 ? 569  PHE B N     1 
ATOM   7750 C  CA    . PHE B 1 482 ? 124.452 -43.463 101.374 1.00 13.90 ? 569  PHE B CA    1 
ATOM   7751 C  C     . PHE B 1 482 ? 124.743 -44.404 102.538 1.00 13.46 ? 569  PHE B C     1 
ATOM   7752 O  O     . PHE B 1 482 ? 125.698 -45.174 102.504 1.00 13.94 ? 569  PHE B O     1 
ATOM   7753 C  CB    . PHE B 1 482 ? 124.685 -42.000 101.807 1.00 13.97 ? 569  PHE B CB    1 
ATOM   7754 C  CG    . PHE B 1 482 ? 125.973 -41.797 102.560 1.00 13.79 ? 569  PHE B CG    1 
ATOM   7755 C  CD1   . PHE B 1 482 ? 127.184 -42.141 101.987 1.00 12.78 ? 569  PHE B CD1   1 
ATOM   7756 C  CD2   . PHE B 1 482 ? 125.961 -41.279 103.853 1.00 14.47 ? 569  PHE B CD2   1 
ATOM   7757 C  CE1   . PHE B 1 482 ? 128.381 -41.958 102.670 1.00 13.87 ? 569  PHE B CE1   1 
ATOM   7758 C  CE2   . PHE B 1 482 ? 127.150 -41.106 104.555 1.00 13.54 ? 569  PHE B CE2   1 
ATOM   7759 C  CZ    . PHE B 1 482 ? 128.359 -41.449 103.965 1.00 13.57 ? 569  PHE B CZ    1 
ATOM   7760 N  N     . VAL B 1 483 ? 123.912 -44.346 103.571 1.00 13.73 ? 570  VAL B N     1 
ATOM   7761 C  CA    . VAL B 1 483 ? 124.124 -45.209 104.732 1.00 14.39 ? 570  VAL B CA    1 
ATOM   7762 C  C     . VAL B 1 483 ? 124.023 -46.694 104.371 1.00 14.83 ? 570  VAL B C     1 
ATOM   7763 O  O     . VAL B 1 483 ? 124.820 -47.503 104.845 1.00 13.95 ? 570  VAL B O     1 
ATOM   7764 C  CB    . VAL B 1 483 ? 123.214 -44.825 105.911 1.00 13.50 ? 570  VAL B CB    1 
ATOM   7765 C  CG1   . VAL B 1 483 ? 123.503 -45.715 107.110 1.00 12.95 ? 570  VAL B CG1   1 
ATOM   7766 C  CG2   . VAL B 1 483 ? 123.456 -43.356 106.273 1.00 12.45 ? 570  VAL B CG2   1 
ATOM   7767 N  N     . GLN B 1 484 ? 123.079 -47.052 103.495 1.00 17.03 ? 571  GLN B N     1 
ATOM   7768 C  CA    . GLN B 1 484 ? 123.012 -48.438 103.000 1.00 17.35 ? 571  GLN B CA    1 
ATOM   7769 C  C     . GLN B 1 484 ? 124.320 -48.870 102.361 1.00 17.23 ? 571  GLN B C     1 
ATOM   7770 O  O     . GLN B 1 484 ? 124.823 -49.973 102.622 1.00 17.69 ? 571  GLN B O     1 
ATOM   7771 C  CB    . GLN B 1 484 ? 121.880 -48.631 101.982 1.00 18.33 ? 571  GLN B CB    1 
ATOM   7772 C  CG    . GLN B 1 484 ? 121.649 -50.100 101.634 1.00 19.30 ? 571  GLN B CG    1 
ATOM   7773 C  CD    . GLN B 1 484 ? 121.284 -50.911 102.868 1.00 18.34 ? 571  GLN B CD    1 
ATOM   7774 O  OE1   . GLN B 1 484 ? 120.430 -50.506 103.646 1.00 20.10 ? 571  GLN B OE1   1 
ATOM   7775 N  NE2   . GLN B 1 484 ? 121.970 -52.028 103.077 1.00 20.12 ? 571  GLN B NE2   1 
ATOM   7776 N  N     . TRP B 1 485 ? 124.864 -48.004 101.510 1.00 16.44 ? 572  TRP B N     1 
ATOM   7777 C  CA    . TRP B 1 485 ? 126.140 -48.258 100.846 1.00 16.09 ? 572  TRP B CA    1 
ATOM   7778 C  C     . TRP B 1 485 ? 127.258 -48.440 101.840 1.00 16.26 ? 572  TRP B C     1 
ATOM   7779 O  O     . TRP B 1 485 ? 128.094 -49.340 101.688 1.00 15.78 ? 572  TRP B O     1 
ATOM   7780 C  CB    . TRP B 1 485 ? 126.439 -47.105 99.890  1.00 16.08 ? 572  TRP B CB    1 
ATOM   7781 C  CG    . TRP B 1 485 ? 127.733 -47.208 99.127  1.00 16.73 ? 572  TRP B CG    1 
ATOM   7782 C  CD1   . TRP B 1 485 ? 128.088 -48.146 98.168  1.00 17.16 ? 572  TRP B CD1   1 
ATOM   7783 C  CD2   . TRP B 1 485 ? 128.866 -46.291 99.213  1.00 17.21 ? 572  TRP B CD2   1 
ATOM   7784 N  NE1   . TRP B 1 485 ? 129.346 -47.895 97.682  1.00 18.58 ? 572  TRP B NE1   1 
ATOM   7785 C  CE2   . TRP B 1 485 ? 129.867 -46.784 98.266  1.00 18.09 ? 572  TRP B CE2   1 
ATOM   7786 C  CE3   . TRP B 1 485 ? 129.144 -45.149 99.965  1.00 17.66 ? 572  TRP B CE3   1 
ATOM   7787 C  CZ2   . TRP B 1 485 ? 131.082 -46.144 98.083  1.00 18.11 ? 572  TRP B CZ2   1 
ATOM   7788 C  CZ3   . TRP B 1 485 ? 130.370 -44.509 99.767  1.00 17.08 ? 572  TRP B CZ3   1 
ATOM   7789 C  CH2   . TRP B 1 485 ? 131.323 -45.001 98.862  1.00 18.11 ? 572  TRP B CH2   1 
ATOM   7790 N  N     . CYS B 1 486 ? 127.288 -47.587 102.868 1.00 15.58 ? 573  CYS B N     1 
ATOM   7791 C  CA    . CYS B 1 486 ? 128.297 -47.707 103.932 1.00 16.59 ? 573  CYS B CA    1 
ATOM   7792 C  C     . CYS B 1 486 ? 128.201 -49.069 104.611 1.00 18.88 ? 573  CYS B C     1 
ATOM   7793 O  O     . CYS B 1 486 ? 129.211 -49.737 104.811 1.00 20.14 ? 573  CYS B O     1 
ATOM   7794 C  CB    . CYS B 1 486 ? 128.145 -46.583 104.960 1.00 16.82 ? 573  CYS B CB    1 
ATOM   7795 S  SG    . CYS B 1 486 ? 128.611 -44.939 104.347 1.00 15.35 ? 573  CYS B SG    1 
ATOM   7796 N  N     . ALA B 1 487 ? 126.975 -49.483 104.936 1.00 20.64 ? 574  ALA B N     1 
ATOM   7797 C  CA    . ALA B 1 487 ? 126.738 -50.797 105.543 1.00 21.88 ? 574  ALA B CA    1 
ATOM   7798 C  C     . ALA B 1 487 ? 127.195 -51.921 104.614 1.00 22.31 ? 574  ALA B C     1 
ATOM   7799 O  O     . ALA B 1 487 ? 127.932 -52.812 105.038 1.00 24.55 ? 574  ALA B O     1 
ATOM   7800 C  CB    . ALA B 1 487 ? 125.271 -50.961 105.912 1.00 22.45 ? 574  ALA B CB    1 
ATOM   7801 N  N     . ASP B 1 488 ? 126.779 -51.853 103.345 1.00 21.77 ? 575  ASP B N     1 
ATOM   7802 C  CA    . ASP B 1 488 ? 127.126 -52.857 102.324 1.00 21.70 ? 575  ASP B CA    1 
ATOM   7803 C  C     . ASP B 1 488 ? 128.630 -53.039 102.171 1.00 22.46 ? 575  ASP B C     1 
ATOM   7804 O  O     . ASP B 1 488 ? 129.107 -54.160 101.986 1.00 23.12 ? 575  ASP B O     1 
ATOM   7805 C  CB    . ASP B 1 488 ? 126.577 -52.469 100.944 1.00 22.78 ? 575  ASP B CB    1 
ATOM   7806 C  CG    . ASP B 1 488 ? 125.055 -52.519 100.850 1.00 23.33 ? 575  ASP B CG    1 
ATOM   7807 O  OD1   . ASP B 1 488 ? 124.362 -53.070 101.744 1.00 24.42 ? 575  ASP B OD1   1 
ATOM   7808 O  OD2   . ASP B 1 488 ? 124.545 -51.972 99.849  1.00 24.78 ? 575  ASP B OD2   1 
ATOM   7809 N  N     . ARG B 1 489 ? 129.374 -51.932 102.224 1.00 21.26 ? 576  ARG B N     1 
ATOM   7810 C  CA    . ARG B 1 489 ? 130.814 -51.964 101.963 1.00 21.06 ? 576  ARG B CA    1 
ATOM   7811 C  C     . ARG B 1 489 ? 131.612 -52.114 103.250 1.00 20.81 ? 576  ARG B C     1 
ATOM   7812 O  O     . ARG B 1 489 ? 132.833 -52.140 103.228 1.00 18.99 ? 576  ARG B O     1 
ATOM   7813 C  CB    . ARG B 1 489 ? 131.246 -50.703 101.203 1.00 21.05 ? 576  ARG B CB    1 
ATOM   7814 C  CG    . ARG B 1 489 ? 130.513 -50.569 99.877  1.00 22.64 ? 576  ARG B CG    1 
ATOM   7815 C  CD    . ARG B 1 489 ? 131.435 -50.306 98.705  1.00 23.63 ? 576  ARG B CD    1 
ATOM   7816 N  NE    . ARG B 1 489 ? 132.777 -50.857 98.865  1.00 22.73 ? 576  ARG B NE    1 
ATOM   7817 C  CZ    . ARG B 1 489 ? 133.820 -50.461 98.143  1.00 23.61 ? 576  ARG B CZ    1 
ATOM   7818 N  NH1   . ARG B 1 489 ? 133.669 -49.541 97.196  1.00 23.96 ? 576  ARG B NH1   1 
ATOM   7819 N  NH2   . ARG B 1 489 ? 135.011 -50.986 98.354  1.00 25.20 ? 576  ARG B NH2   1 
ATOM   7820 N  N     . ASN B 1 490 ? 130.895 -52.212 104.365 1.00 20.21 ? 577  ASN B N     1 
ATOM   7821 C  CA    . ASN B 1 490 ? 131.496 -52.226 105.694 1.00 22.79 ? 577  ASN B CA    1 
ATOM   7822 C  C     . ASN B 1 490 ? 132.427 -51.062 105.941 1.00 21.37 ? 577  ASN B C     1 
ATOM   7823 O  O     . ASN B 1 490 ? 133.510 -51.216 106.500 1.00 21.83 ? 577  ASN B O     1 
ATOM   7824 C  CB    . ASN B 1 490 ? 132.186 -53.553 106.004 1.00 27.03 ? 577  ASN B CB    1 
ATOM   7825 C  CG    . ASN B 1 490 ? 131.497 -54.290 107.120 1.00 31.38 ? 577  ASN B CG    1 
ATOM   7826 O  OD1   . ASN B 1 490 ? 130.715 -55.212 106.875 1.00 34.92 ? 577  ASN B OD1   1 
ATOM   7827 N  ND2   . ASN B 1 490 ? 131.726 -53.847 108.355 1.00 33.22 ? 577  ASN B ND2   1 
ATOM   7828 N  N     . PHE B 1 491 ? 131.978 -49.895 105.507 1.00 18.84 ? 578  PHE B N     1 
ATOM   7829 C  CA    . PHE B 1 491 ? 132.660 -48.641 105.804 1.00 18.55 ? 578  PHE B CA    1 
ATOM   7830 C  C     . PHE B 1 491 ? 132.277 -48.226 107.212 1.00 17.90 ? 578  PHE B C     1 
ATOM   7831 O  O     . PHE B 1 491 ? 131.419 -48.859 107.831 1.00 19.05 ? 578  PHE B O     1 
ATOM   7832 C  CB    . PHE B 1 491 ? 132.248 -47.578 104.788 1.00 16.29 ? 578  PHE B CB    1 
ATOM   7833 C  CG    . PHE B 1 491 ? 132.837 -47.783 103.429 1.00 17.08 ? 578  PHE B CG    1 
ATOM   7834 C  CD1   . PHE B 1 491 ? 133.898 -48.656 103.236 1.00 17.40 ? 578  PHE B CD1   1 
ATOM   7835 C  CD2   . PHE B 1 491 ? 132.336 -47.075 102.331 1.00 17.85 ? 578  PHE B CD2   1 
ATOM   7836 C  CE1   . PHE B 1 491 ? 134.459 -48.821 101.983 1.00 18.95 ? 578  PHE B CE1   1 
ATOM   7837 C  CE2   . PHE B 1 491 ? 132.889 -47.242 101.072 1.00 18.44 ? 578  PHE B CE2   1 
ATOM   7838 C  CZ    . PHE B 1 491 ? 133.953 -48.117 100.901 1.00 17.19 ? 578  PHE B CZ    1 
ATOM   7839 N  N     . THR B 1 492 ? 132.903 -47.173 107.730 1.00 15.44 ? 579  THR B N     1 
ATOM   7840 C  CA    . THR B 1 492 ? 132.608 -46.743 109.096 1.00 14.84 ? 579  THR B CA    1 
ATOM   7841 C  C     . THR B 1 492 ? 131.223 -46.098 109.152 1.00 16.00 ? 579  THR B C     1 
ATOM   7842 O  O     . THR B 1 492 ? 130.731 -45.537 108.160 1.00 16.78 ? 579  THR B O     1 
ATOM   7843 C  CB    . THR B 1 492 ? 133.673 -45.768 109.646 1.00 15.11 ? 579  THR B CB    1 
ATOM   7844 O  OG1   . THR B 1 492 ? 133.691 -44.604 108.827 1.00 13.93 ? 579  THR B OG1   1 
ATOM   7845 C  CG2   . THR B 1 492 ? 135.055 -46.387 109.632 1.00 14.43 ? 579  THR B CG2   1 
ATOM   7846 N  N     . LYS B 1 493 ? 130.576 -46.225 110.304 1.00 15.24 ? 580  LYS B N     1 
ATOM   7847 C  CA    . LYS B 1 493 ? 129.291 -45.604 110.548 1.00 16.62 ? 580  LYS B CA    1 
ATOM   7848 C  C     . LYS B 1 493 ? 129.409 -44.081 110.453 1.00 17.20 ? 580  LYS B C     1 
ATOM   7849 O  O     . LYS B 1 493 ? 130.197 -43.472 111.200 1.00 17.62 ? 580  LYS B O     1 
ATOM   7850 C  CB    . LYS B 1 493 ? 128.804 -45.975 111.952 1.00 17.79 ? 580  LYS B CB    1 
ATOM   7851 C  CG    . LYS B 1 493 ? 127.482 -45.337 112.354 1.00 18.66 ? 580  LYS B CG    1 
ATOM   7852 C  CD    . LYS B 1 493 ? 127.293 -45.453 113.862 1.00 21.98 ? 580  LYS B CD    1 
ATOM   7853 C  CE    . LYS B 1 493 ? 126.023 -44.771 114.326 1.00 24.17 ? 580  LYS B CE    1 
ATOM   7854 N  NZ    . LYS B 1 493 ? 125.871 -44.889 115.804 1.00 25.73 ? 580  LYS B NZ    1 
ATOM   7855 N  N     . PRO B 1 494 ? 128.629 -43.455 109.549 1.00 16.04 ? 581  PRO B N     1 
ATOM   7856 C  CA    . PRO B 1 494 ? 128.591 -41.991 109.483 1.00 15.95 ? 581  PRO B CA    1 
ATOM   7857 C  C     . PRO B 1 494 ? 128.214 -41.416 110.844 1.00 16.75 ? 581  PRO B C     1 
ATOM   7858 O  O     . PRO B 1 494 ? 127.417 -42.015 111.575 1.00 16.71 ? 581  PRO B O     1 
ATOM   7859 C  CB    . PRO B 1 494 ? 127.475 -41.719 108.455 1.00 15.59 ? 581  PRO B CB    1 
ATOM   7860 C  CG    . PRO B 1 494 ? 127.501 -42.916 107.569 1.00 14.87 ? 581  PRO B CG    1 
ATOM   7861 C  CD    . PRO B 1 494 ? 127.811 -44.073 108.482 1.00 14.16 ? 581  PRO B CD    1 
ATOM   7862 N  N     . GLN B 1 495 ? 128.782 -40.270 111.192 1.00 15.80 ? 582  GLN B N     1 
ATOM   7863 C  CA    . GLN B 1 495 ? 128.624 -39.746 112.546 1.00 17.38 ? 582  GLN B CA    1 
ATOM   7864 C  C     . GLN B 1 495 ? 127.179 -39.421 112.889 1.00 17.88 ? 582  GLN B C     1 
ATOM   7865 O  O     . GLN B 1 495 ? 126.780 -39.541 114.048 1.00 18.14 ? 582  GLN B O     1 
ATOM   7866 C  CB    . GLN B 1 495 ? 129.511 -38.517 112.755 1.00 18.03 ? 582  GLN B CB    1 
ATOM   7867 C  CG    . GLN B 1 495 ? 130.978 -38.826 112.541 1.00 19.63 ? 582  GLN B CG    1 
ATOM   7868 C  CD    . GLN B 1 495 ? 131.871 -37.603 112.651 1.00 21.09 ? 582  GLN B CD    1 
ATOM   7869 O  OE1   . GLN B 1 495 ? 131.402 -36.465 112.661 1.00 23.02 ? 582  GLN B OE1   1 
ATOM   7870 N  NE2   . GLN B 1 495 ? 133.167 -37.839 112.720 1.00 21.15 ? 582  GLN B NE2   1 
ATOM   7871 N  N     . ASP B 1 496 ? 126.399 -39.006 111.892 1.00 16.74 ? 583  ASP B N     1 
ATOM   7872 C  CA    . ASP B 1 496 ? 124.992 -38.696 112.119 1.00 17.64 ? 583  ASP B CA    1 
ATOM   7873 C  C     . ASP B 1 496 ? 124.081 -39.861 111.730 1.00 18.03 ? 583  ASP B C     1 
ATOM   7874 O  O     . ASP B 1 496 ? 122.870 -39.681 111.628 1.00 19.53 ? 583  ASP B O     1 
ATOM   7875 C  CB    . ASP B 1 496 ? 124.567 -37.439 111.349 1.00 18.70 ? 583  ASP B CB    1 
ATOM   7876 C  CG    . ASP B 1 496 ? 124.849 -37.528 109.861 1.00 20.86 ? 583  ASP B CG    1 
ATOM   7877 O  OD1   . ASP B 1 496 ? 125.304 -38.587 109.382 1.00 21.03 ? 583  ASP B OD1   1 
ATOM   7878 O  OD2   . ASP B 1 496 ? 124.614 -36.522 109.168 1.00 22.10 ? 583  ASP B OD2   1 
ATOM   7879 N  N     . GLY B 1 497 ? 124.665 -41.045 111.549 1.00 17.65 ? 584  GLY B N     1 
ATOM   7880 C  CA    . GLY B 1 497 ? 123.919 -42.227 111.078 1.00 20.91 ? 584  GLY B CA    1 
ATOM   7881 C  C     . GLY B 1 497 ? 122.643 -42.557 111.845 1.00 23.26 ? 584  GLY B C     1 
ATOM   7882 O  O     . GLY B 1 497 ? 121.620 -42.895 111.237 1.00 24.13 ? 584  GLY B O     1 
ATOM   7883 N  N     . ASP B 1 498 ? 122.695 -42.457 113.173 1.00 25.12 ? 585  ASP B N     1 
ATOM   7884 C  CA    . ASP B 1 498 ? 121.531 -42.732 114.035 1.00 27.23 ? 585  ASP B CA    1 
ATOM   7885 C  C     . ASP B 1 498 ? 120.361 -41.799 113.727 1.00 26.37 ? 585  ASP B C     1 
ATOM   7886 O  O     . ASP B 1 498 ? 119.194 -42.183 113.849 1.00 27.08 ? 585  ASP B O     1 
ATOM   7887 C  CB    . ASP B 1 498 ? 121.887 -42.572 115.521 1.00 30.45 ? 585  ASP B CB    1 
ATOM   7888 C  CG    . ASP B 1 498 ? 123.055 -43.442 115.962 1.00 32.35 ? 585  ASP B CG    1 
ATOM   7889 O  OD1   . ASP B 1 498 ? 123.062 -44.656 115.665 1.00 32.33 ? 585  ASP B OD1   1 
ATOM   7890 O  OD2   . ASP B 1 498 ? 123.967 -42.903 116.636 1.00 34.99 ? 585  ASP B OD2   1 
ATOM   7891 N  N     . VAL B 1 499 ? 120.687 -40.570 113.334 1.00 22.82 ? 586  VAL B N     1 
ATOM   7892 C  CA    . VAL B 1 499 ? 119.696 -39.532 113.124 1.00 22.31 ? 586  VAL B CA    1 
ATOM   7893 C  C     . VAL B 1 499 ? 119.227 -39.483 111.675 1.00 22.52 ? 586  VAL B C     1 
ATOM   7894 O  O     . VAL B 1 499 ? 118.029 -39.340 111.425 1.00 22.80 ? 586  VAL B O     1 
ATOM   7895 C  CB    . VAL B 1 499 ? 120.220 -38.147 113.566 1.00 23.00 ? 586  VAL B CB    1 
ATOM   7896 C  CG1   . VAL B 1 499 ? 119.179 -37.064 113.337 1.00 22.95 ? 586  VAL B CG1   1 
ATOM   7897 C  CG2   . VAL B 1 499 ? 120.629 -38.177 115.032 1.00 23.55 ? 586  VAL B CG2   1 
ATOM   7898 N  N     . ILE B 1 500 ? 120.152 -39.612 110.723 1.00 22.28 ? 587  ILE B N     1 
ATOM   7899 C  CA    . ILE B 1 500 ? 119.768 -39.499 109.311 1.00 22.61 ? 587  ILE B CA    1 
ATOM   7900 C  C     . ILE B 1 500 ? 119.153 -40.768 108.719 1.00 23.14 ? 587  ILE B C     1 
ATOM   7901 O  O     . ILE B 1 500 ? 118.434 -40.700 107.723 1.00 23.12 ? 587  ILE B O     1 
ATOM   7902 C  CB    . ILE B 1 500 ? 120.905 -38.988 108.393 1.00 22.50 ? 587  ILE B CB    1 
ATOM   7903 C  CG1   . ILE B 1 500 ? 122.105 -39.940 108.389 1.00 21.43 ? 587  ILE B CG1   1 
ATOM   7904 C  CG2   . ILE B 1 500 ? 121.306 -37.570 108.783 1.00 23.34 ? 587  ILE B CG2   1 
ATOM   7905 C  CD1   . ILE B 1 500 ? 123.033 -39.746 107.209 1.00 21.24 ? 587  ILE B CD1   1 
ATOM   7906 N  N     . ALA B 1 501 ? 119.438 -41.921 109.320 1.00 21.96 ? 588  ALA B N     1 
ATOM   7907 C  CA    . ALA B 1 501 ? 118.996 -43.190 108.742 1.00 21.20 ? 588  ALA B CA    1 
ATOM   7908 C  C     . ALA B 1 501 ? 118.609 -44.185 109.824 1.00 20.41 ? 588  ALA B C     1 
ATOM   7909 O  O     . ALA B 1 501 ? 119.206 -45.262 109.910 1.00 21.27 ? 588  ALA B O     1 
ATOM   7910 C  CB    . ALA B 1 501 ? 120.082 -43.779 107.850 1.00 20.41 ? 588  ALA B CB    1 
ATOM   7911 N  N     . PRO B 1 502 ? 117.608 -43.835 110.649 1.00 22.30 ? 589  PRO B N     1 
ATOM   7912 C  CA    . PRO B 1 502 ? 117.241 -44.705 111.779 1.00 23.96 ? 589  PRO B CA    1 
ATOM   7913 C  C     . PRO B 1 502 ? 116.695 -46.060 111.343 1.00 24.71 ? 589  PRO B C     1 
ATOM   7914 O  O     . PRO B 1 502 ? 116.691 -46.998 112.136 1.00 26.55 ? 589  PRO B O     1 
ATOM   7915 C  CB    . PRO B 1 502 ? 116.161 -43.901 112.514 1.00 24.74 ? 589  PRO B CB    1 
ATOM   7916 C  CG    . PRO B 1 502 ? 115.585 -42.996 111.473 1.00 24.54 ? 589  PRO B CG    1 
ATOM   7917 C  CD    . PRO B 1 502 ? 116.746 -42.638 110.578 1.00 23.54 ? 589  PRO B CD    1 
ATOM   7918 N  N     . LEU B 1 503 ? 116.255 -46.169 110.091 1.00 25.78 ? 590  LEU B N     1 
ATOM   7919 C  CA    . LEU B 1 503 ? 115.735 -47.440 109.577 1.00 26.09 ? 590  LEU B CA    1 
ATOM   7920 C  C     . LEU B 1 503 ? 116.843 -48.363 109.072 1.00 25.61 ? 590  LEU B C     1 
ATOM   7921 O  O     . LEU B 1 503 ? 116.609 -49.537 108.799 1.00 24.71 ? 590  LEU B O     1 
ATOM   7922 C  CB    . LEU B 1 503 ? 114.681 -47.193 108.484 1.00 26.41 ? 590  LEU B CB    1 
ATOM   7923 C  CG    . LEU B 1 503 ? 113.426 -46.408 108.890 1.00 28.58 ? 590  LEU B CG    1 
ATOM   7924 C  CD1   . LEU B 1 503 ? 112.555 -46.125 107.676 1.00 29.81 ? 590  LEU B CD1   1 
ATOM   7925 C  CD2   . LEU B 1 503 ? 112.629 -47.147 109.962 1.00 29.99 ? 590  LEU B CD2   1 
ATOM   7926 N  N     . ILE B 1 504 ? 118.060 -47.830 108.981 1.00 24.89 ? 591  ILE B N     1 
ATOM   7927 C  CA    . ILE B 1 504 ? 119.190 -48.569 108.420 1.00 25.03 ? 591  ILE B CA    1 
ATOM   7928 C  C     . ILE B 1 504 ? 120.263 -48.865 109.468 1.00 26.24 ? 591  ILE B C     1 
ATOM   7929 O  O     . ILE B 1 504 ? 120.675 -50.010 109.633 1.00 27.74 ? 591  ILE B O     1 
ATOM   7930 C  CB    . ILE B 1 504 ? 119.811 -47.820 107.208 1.00 24.86 ? 591  ILE B CB    1 
ATOM   7931 C  CG1   . ILE B 1 504 ? 118.741 -47.567 106.133 1.00 24.83 ? 591  ILE B CG1   1 
ATOM   7932 C  CG2   . ILE B 1 504 ? 120.996 -48.583 106.627 1.00 23.80 ? 591  ILE B CG2   1 
ATOM   7933 C  CD1   . ILE B 1 504 ? 119.242 -46.791 104.936 1.00 24.65 ? 591  ILE B CD1   1 
ATOM   7934 N  N     . THR B 1 505 ? 120.706 -47.822 110.167 1.00 26.34 ? 592  THR B N     1 
ATOM   7935 C  CA    . THR B 1 505 ? 121.852 -47.890 111.088 1.00 30.75 ? 592  THR B CA    1 
ATOM   7936 C  C     . THR B 1 505 ? 121.766 -48.971 112.183 1.00 34.59 ? 592  THR B C     1 
ATOM   7937 O  O     . THR B 1 505 ? 122.730 -49.714 112.368 1.00 34.31 ? 592  THR B O     1 
ATOM   7938 C  CB    . THR B 1 505 ? 122.143 -46.503 111.712 1.00 29.73 ? 592  THR B CB    1 
ATOM   7939 O  OG1   . THR B 1 505 ? 122.333 -45.543 110.665 1.00 25.45 ? 592  THR B OG1   1 
ATOM   7940 C  CG2   . THR B 1 505 ? 123.385 -46.537 112.604 1.00 29.54 ? 592  THR B CG2   1 
ATOM   7941 N  N     . PRO B 1 506 ? 120.619 -49.075 112.897 1.00 38.29 ? 593  PRO B N     1 
ATOM   7942 C  CA    . PRO B 1 506 ? 120.526 -50.074 113.979 1.00 39.83 ? 593  PRO B CA    1 
ATOM   7943 C  C     . PRO B 1 506 ? 120.639 -51.537 113.523 1.00 41.66 ? 593  PRO B C     1 
ATOM   7944 O  O     . PRO B 1 506 ? 120.825 -52.426 114.357 1.00 44.14 ? 593  PRO B O     1 
ATOM   7945 C  CB    . PRO B 1 506 ? 119.137 -49.809 114.578 1.00 39.84 ? 593  PRO B CB    1 
ATOM   7946 C  CG    . PRO B 1 506 ? 118.824 -48.397 114.203 1.00 40.32 ? 593  PRO B CG    1 
ATOM   7947 C  CD    . PRO B 1 506 ? 119.395 -48.255 112.826 1.00 38.89 ? 593  PRO B CD    1 
ATOM   7948 N  N     . GLN B 1 507 ? 120.548 -51.772 112.217 1.00 42.88 ? 594  GLN B N     1 
ATOM   7949 C  CA    . GLN B 1 507 ? 120.558 -53.124 111.644 1.00 42.67 ? 594  GLN B CA    1 
ATOM   7950 C  C     . GLN B 1 507 ? 121.956 -53.630 111.262 1.00 42.23 ? 594  GLN B C     1 
ATOM   7951 O  O     . GLN B 1 507 ? 122.115 -54.776 110.832 1.00 41.34 ? 594  GLN B O     1 
ATOM   7952 C  CB    . GLN B 1 507 ? 119.635 -53.186 110.417 1.00 45.29 ? 594  GLN B CB    1 
ATOM   7953 C  CG    . GLN B 1 507 ? 118.294 -52.473 110.579 1.00 47.15 ? 594  GLN B CG    1 
ATOM   7954 C  CD    . GLN B 1 507 ? 117.285 -53.259 111.398 1.00 48.57 ? 594  GLN B CD    1 
ATOM   7955 O  OE1   . GLN B 1 507 ? 117.508 -53.557 112.572 1.00 49.47 ? 594  GLN B OE1   1 
ATOM   7956 N  NE2   . GLN B 1 507 ? 116.153 -53.581 110.783 1.00 49.89 ? 594  GLN B NE2   1 
ATOM   7957 N  N     . LYS B 1 508 ? 122.962 -52.770 111.402 1.00 39.46 ? 595  LYS B N     1 
ATOM   7958 C  CA    . LYS B 1 508 ? 124.345 -53.146 111.106 1.00 39.54 ? 595  LYS B CA    1 
ATOM   7959 C  C     . LYS B 1 508 ? 125.043 -53.459 112.426 1.00 41.73 ? 595  LYS B C     1 
ATOM   7960 O  O     . LYS B 1 508 ? 125.347 -52.555 113.213 1.00 42.53 ? 595  LYS B O     1 
ATOM   7961 C  CB    . LYS B 1 508 ? 125.053 -52.017 110.343 1.00 36.01 ? 595  LYS B CB    1 
ATOM   7962 C  CG    . LYS B 1 508 ? 126.530 -52.248 110.070 1.00 36.57 ? 595  LYS B CG    1 
ATOM   7963 C  CD    . LYS B 1 508 ? 126.742 -53.128 108.860 1.00 37.08 ? 595  LYS B CD    1 
ATOM   7964 C  CE    . LYS B 1 508 ? 128.210 -53.178 108.479 1.00 36.20 ? 595  LYS B CE    1 
ATOM   7965 N  NZ    . LYS B 1 508 ? 128.407 -54.251 107.473 1.00 37.32 ? 595  LYS B NZ    1 
ATOM   7966 N  N     . LYS B 1 509 ? 125.281 -54.744 112.673 1.00 44.31 ? 596  LYS B N     1 
ATOM   7967 C  CA    . LYS B 1 509 ? 125.734 -55.189 113.997 1.00 45.64 ? 596  LYS B CA    1 
ATOM   7968 C  C     . LYS B 1 509 ? 127.108 -54.654 114.414 1.00 44.34 ? 596  LYS B C     1 
ATOM   7969 O  O     . LYS B 1 509 ? 127.333 -54.392 115.596 1.00 44.57 ? 596  LYS B O     1 
ATOM   7970 C  CB    . LYS B 1 509 ? 125.658 -56.719 114.142 1.00 48.41 ? 596  LYS B CB    1 
ATOM   7971 C  CG    . LYS B 1 509 ? 126.548 -57.521 113.203 1.00 50.90 ? 596  LYS B CG    1 
ATOM   7972 C  CD    . LYS B 1 509 ? 126.771 -58.938 113.751 1.00 52.25 ? 596  LYS B CD    1 
ATOM   7973 C  CE    . LYS B 1 509 ? 127.782 -59.704 112.908 1.00 53.17 ? 596  LYS B CE    1 
ATOM   7974 N  NZ    . LYS B 1 509 ? 127.161 -60.279 111.657 1.00 54.22 ? 596  LYS B NZ    1 
ATOM   7975 N  N     . GLU B 1 510 ? 128.011 -54.467 113.453 1.00 43.30 ? 597  GLU B N     1 
ATOM   7976 C  CA    . GLU B 1 510 ? 129.323 -53.875 113.765 1.00 41.25 ? 597  GLU B CA    1 
ATOM   7977 C  C     . GLU B 1 510 ? 129.296 -52.362 114.030 1.00 38.62 ? 597  GLU B C     1 
ATOM   7978 O  O     . GLU B 1 510 ? 130.327 -51.778 114.354 1.00 39.92 ? 597  GLU B O     1 
ATOM   7979 C  CB    . GLU B 1 510 ? 130.400 -54.239 112.728 1.00 41.83 ? 597  GLU B CB    1 
ATOM   7980 C  CG    . GLU B 1 510 ? 129.924 -54.359 111.294 1.00 46.38 ? 597  GLU B CG    1 
ATOM   7981 C  CD    . GLU B 1 510 ? 129.461 -55.769 110.959 1.00 48.16 ? 597  GLU B CD    1 
ATOM   7982 O  OE1   . GLU B 1 510 ? 128.244 -55.963 110.759 1.00 48.40 ? 597  GLU B OE1   1 
ATOM   7983 O  OE2   . GLU B 1 510 ? 130.315 -56.686 110.905 1.00 51.59 ? 597  GLU B OE2   1 
ATOM   7984 N  N     . TRP B 1 511 ? 128.124 -51.739 113.908 1.00 35.35 ? 598  TRP B N     1 
ATOM   7985 C  CA    . TRP B 1 511 ? 127.959 -50.320 114.260 1.00 34.02 ? 598  TRP B CA    1 
ATOM   7986 C  C     . TRP B 1 511 ? 127.404 -50.107 115.645 1.00 37.15 ? 598  TRP B C     1 
ATOM   7987 O  O     . TRP B 1 511 ? 127.174 -48.964 116.063 1.00 35.65 ? 598  TRP B O     1 
ATOM   7988 C  CB    . TRP B 1 511 ? 127.078 -49.588 113.246 1.00 27.25 ? 598  TRP B CB    1 
ATOM   7989 C  CG    . TRP B 1 511 ? 127.688 -49.429 111.878 1.00 24.03 ? 598  TRP B CG    1 
ATOM   7990 C  CD1   . TRP B 1 511 ? 128.995 -49.713 111.480 1.00 22.10 ? 598  TRP B CD1   1 
ATOM   7991 C  CD2   . TRP B 1 511 ? 127.027 -48.899 110.681 1.00 21.62 ? 598  TRP B CD2   1 
ATOM   7992 N  NE1   . TRP B 1 511 ? 129.169 -49.423 110.151 1.00 21.61 ? 598  TRP B NE1   1 
ATOM   7993 C  CE2   . TRP B 1 511 ? 128.023 -48.923 109.616 1.00 19.94 ? 598  TRP B CE2   1 
ATOM   7994 C  CE3   . TRP B 1 511 ? 125.741 -48.430 110.397 1.00 21.04 ? 598  TRP B CE3   1 
ATOM   7995 C  CZ2   . TRP B 1 511 ? 127.730 -48.501 108.325 1.00 19.61 ? 598  TRP B CZ2   1 
ATOM   7996 C  CZ3   . TRP B 1 511 ? 125.460 -47.997 109.094 1.00 20.12 ? 598  TRP B CZ3   1 
ATOM   7997 C  CH2   . TRP B 1 511 ? 126.433 -48.037 108.083 1.00 17.58 ? 598  TRP B CH2   1 
ATOM   7998 N  N     . ASN B 1 512 ? 127.177 -51.200 116.371 1.00 41.58 ? 599  ASN B N     1 
ATOM   7999 C  CA    . ASN B 1 512 ? 126.632 -51.124 117.730 1.00 45.58 ? 599  ASN B CA    1 
ATOM   8000 C  C     . ASN B 1 512 ? 126.955 -52.342 118.595 1.00 47.12 ? 599  ASN B C     1 
ATOM   8001 O  O     . ASN B 1 512 ? 126.273 -53.371 118.515 1.00 50.17 ? 599  ASN B O     1 
ATOM   8002 C  CB    . ASN B 1 512 ? 125.121 -50.840 117.706 1.00 47.52 ? 599  ASN B CB    1 
ATOM   8003 C  CG    . ASN B 1 512 ? 124.413 -51.514 116.542 1.00 49.47 ? 599  ASN B CG    1 
ATOM   8004 O  OD1   . ASN B 1 512 ? 124.322 -52.744 116.483 1.00 51.20 ? 599  ASN B OD1   1 
ATOM   8005 N  ND2   . ASN B 1 512 ? 123.902 -50.703 115.609 1.00 48.85 ? 599  ASN B ND2   1 
HETATM 8006 ZN ZN    . ZN  C 2 .   ? 132.043 0.368   104.416 1.00 14.59 ? 701  ZN  A ZN    1 
HETATM 8007 P  PG    . DGT D 3 .   ? 132.651 6.229   106.884 1.00 47.35 ? 702  DGT A PG    1 
HETATM 8008 O  O1G   . DGT D 3 .   ? 132.258 6.167   108.348 1.00 38.85 ? 702  DGT A O1G   1 
HETATM 8009 O  O2G   . DGT D 3 .   ? 133.551 5.065   106.497 1.00 43.05 ? 702  DGT A O2G   1 
HETATM 8010 O  O3G   . DGT D 3 .   ? 131.517 6.509   105.907 1.00 45.24 ? 702  DGT A O3G   1 
HETATM 8011 O  O3B   . DGT D 3 .   ? 133.536 7.569   106.711 1.00 37.25 ? 702  DGT A O3B   1 
HETATM 8012 P  PB    . DGT D 3 .   ? 135.036 7.564   106.139 1.00 34.23 ? 702  DGT A PB    1 
HETATM 8013 O  O1B   . DGT D 3 .   ? 135.973 7.274   107.285 1.00 29.92 ? 702  DGT A O1B   1 
HETATM 8014 O  O2B   . DGT D 3 .   ? 135.292 8.863   105.404 1.00 30.56 ? 702  DGT A O2B   1 
HETATM 8015 O  O3A   . DGT D 3 .   ? 135.186 6.353   105.051 1.00 33.71 ? 702  DGT A O3A   1 
HETATM 8016 P  PA    . DGT D 3 .   ? 136.448 6.350   104.030 1.00 36.28 ? 702  DGT A PA    1 
HETATM 8017 O  O1A   . DGT D 3 .   ? 137.576 7.186   104.620 1.00 34.61 ? 702  DGT A O1A   1 
HETATM 8018 O  O2A   . DGT D 3 .   ? 135.908 6.744   102.667 1.00 37.57 ? 702  DGT A O2A   1 
HETATM 8019 O  "O5'" . DGT D 3 .   ? 137.033 4.827   103.951 1.00 28.75 ? 702  DGT A "O5'" 1 
HETATM 8020 C  "C5'" . DGT D 3 .   ? 136.260 3.659   103.679 1.00 18.96 ? 702  DGT A "C5'" 1 
HETATM 8021 C  "C4'" . DGT D 3 .   ? 137.112 2.505   103.114 1.00 14.14 ? 702  DGT A "C4'" 1 
HETATM 8022 O  "O4'" . DGT D 3 .   ? 137.606 2.781   101.795 1.00 13.49 ? 702  DGT A "O4'" 1 
HETATM 8023 C  "C3'" . DGT D 3 .   ? 138.347 2.185   103.940 1.00 12.73 ? 702  DGT A "C3'" 1 
HETATM 8024 O  "O3'" . DGT D 3 .   ? 138.586 0.773   103.816 1.00 10.47 ? 702  DGT A "O3'" 1 
HETATM 8025 C  "C2'" . DGT D 3 .   ? 139.473 2.917   103.249 1.00 12.52 ? 702  DGT A "C2'" 1 
HETATM 8026 C  "C1'" . DGT D 3 .   ? 139.024 2.937   101.782 1.00 13.51 ? 702  DGT A "C1'" 1 
HETATM 8027 N  N9    . DGT D 3 .   ? 139.406 4.211   101.127 1.00 15.35 ? 702  DGT A N9    1 
HETATM 8028 C  C8    . DGT D 3 .   ? 138.792 5.409   101.281 1.00 16.19 ? 702  DGT A C8    1 
HETATM 8029 N  N7    . DGT D 3 .   ? 139.415 6.361   100.535 1.00 16.64 ? 702  DGT A N7    1 
HETATM 8030 C  C5    . DGT D 3 .   ? 140.427 5.760   99.899  1.00 16.90 ? 702  DGT A C5    1 
HETATM 8031 C  C6    . DGT D 3 .   ? 141.460 6.190   98.951  1.00 17.77 ? 702  DGT A C6    1 
HETATM 8032 O  O6    . DGT D 3 .   ? 141.483 7.401   98.618  1.00 20.05 ? 702  DGT A O6    1 
HETATM 8033 N  N1    . DGT D 3 .   ? 142.347 5.272   98.510  1.00 17.92 ? 702  DGT A N1    1 
HETATM 8034 C  C2    . DGT D 3 .   ? 142.312 3.975   98.896  1.00 17.20 ? 702  DGT A C2    1 
HETATM 8035 N  N2    . DGT D 3 .   ? 143.239 3.092   98.418  1.00 16.76 ? 702  DGT A N2    1 
HETATM 8036 N  N3    . DGT D 3 .   ? 141.367 3.524   99.760  1.00 15.43 ? 702  DGT A N3    1 
HETATM 8037 C  C4    . DGT D 3 .   ? 140.414 4.344   100.275 1.00 15.15 ? 702  DGT A C4    1 
HETATM 8038 P  PG    . DGT E 3 .   ? 160.402 5.217   97.861  1.00 14.37 ? 703  DGT A PG    1 
HETATM 8039 O  O1G   . DGT E 3 .   ? 161.410 4.593   98.782  1.00 13.49 ? 703  DGT A O1G   1 
HETATM 8040 O  O2G   . DGT E 3 .   ? 160.487 6.714   97.970  1.00 15.91 ? 703  DGT A O2G   1 
HETATM 8041 O  O3G   . DGT E 3 .   ? 160.496 4.744   96.440  1.00 15.23 ? 703  DGT A O3G   1 
HETATM 8042 O  O3B   . DGT E 3 .   ? 158.944 4.913   98.470  1.00 14.70 ? 703  DGT A O3B   1 
HETATM 8043 P  PB    . DGT E 3 .   ? 157.972 3.698   98.111  1.00 11.55 ? 703  DGT A PB    1 
HETATM 8044 O  O1B   . DGT E 3 .   ? 156.619 4.280   97.957  1.00 11.58 ? 703  DGT A O1B   1 
HETATM 8045 O  O2B   . DGT E 3 .   ? 158.448 2.842   97.018  1.00 12.33 ? 703  DGT A O2B   1 
HETATM 8046 O  O3A   . DGT E 3 .   ? 158.052 2.735   99.410  1.00 11.34 ? 703  DGT A O3A   1 
HETATM 8047 P  PA    . DGT E 3 .   ? 157.338 2.843   100.831 1.00 9.74  ? 703  DGT A PA    1 
HETATM 8048 O  O1A   . DGT E 3 .   ? 158.400 2.795   101.881 1.00 10.63 ? 703  DGT A O1A   1 
HETATM 8049 O  O2A   . DGT E 3 .   ? 156.329 3.936   100.959 1.00 10.23 ? 703  DGT A O2A   1 
HETATM 8050 O  "O5'" . DGT E 3 .   ? 156.529 1.450   100.864 1.00 9.12  ? 703  DGT A "O5'" 1 
HETATM 8051 C  "C5'" . DGT E 3 .   ? 157.209 0.220   101.032 1.00 8.80  ? 703  DGT A "C5'" 1 
HETATM 8052 C  "C4'" . DGT E 3 .   ? 156.258 -0.808  101.635 1.00 8.26  ? 703  DGT A "C4'" 1 
HETATM 8053 O  "O4'" . DGT E 3 .   ? 155.855 -0.384  102.939 1.00 8.41  ? 703  DGT A "O4'" 1 
HETATM 8054 C  "C3'" . DGT E 3 .   ? 154.996 -0.957  100.834 1.00 8.26  ? 703  DGT A "C3'" 1 
HETATM 8055 O  "O3'" . DGT E 3 .   ? 154.583 -2.318  100.955 1.00 8.56  ? 703  DGT A "O3'" 1 
HETATM 8056 C  "C2'" . DGT E 3 .   ? 153.940 -0.123  101.531 1.00 8.53  ? 703  DGT A "C2'" 1 
HETATM 8057 C  "C1'" . DGT E 3 .   ? 154.440 -0.115  102.971 1.00 9.03  ? 703  DGT A "C1'" 1 
HETATM 8058 N  N9    . DGT E 3 .   ? 154.308 1.150   103.690 1.00 10.13 ? 703  DGT A N9    1 
HETATM 8059 C  C8    . DGT E 3 .   ? 154.342 2.421   103.218 1.00 10.33 ? 703  DGT A C8    1 
HETATM 8060 N  N7    . DGT E 3 .   ? 154.242 3.289   104.263 1.00 11.15 ? 703  DGT A N7    1 
HETATM 8061 C  C5    . DGT E 3 .   ? 154.134 2.578   105.386 1.00 11.61 ? 703  DGT A C5    1 
HETATM 8062 C  C6    . DGT E 3 .   ? 154.012 2.891   106.817 1.00 12.88 ? 703  DGT A C6    1 
HETATM 8063 O  O6    . DGT E 3 .   ? 153.982 4.097   107.163 1.00 14.68 ? 703  DGT A O6    1 
HETATM 8064 N  N1    . DGT E 3 .   ? 153.948 1.856   107.677 1.00 13.92 ? 703  DGT A N1    1 
HETATM 8065 C  C2    . DGT E 3 .   ? 154.004 0.565   107.274 1.00 14.31 ? 703  DGT A C2    1 
HETATM 8066 N  N2    . DGT E 3 .   ? 153.945 -0.446  108.184 1.00 17.14 ? 703  DGT A N2    1 
HETATM 8067 N  N3    . DGT E 3 .   ? 154.111 0.228   105.961 1.00 12.50 ? 703  DGT A N3    1 
HETATM 8068 C  C4    . DGT E 3 .   ? 154.184 1.177   105.010 1.00 11.37 ? 703  DGT A C4    1 
HETATM 8069 P  PG    . DGT F 3 .   ? 123.104 -25.774 104.259 1.00 15.55 ? 704  DGT A PG    1 
HETATM 8070 O  O1G   . DGT F 3 .   ? 122.397 -27.107 104.250 1.00 16.01 ? 704  DGT A O1G   1 
HETATM 8071 O  O2G   . DGT F 3 .   ? 123.702 -25.517 105.608 1.00 14.03 ? 704  DGT A O2G   1 
HETATM 8072 O  O3G   . DGT F 3 .   ? 122.234 -24.632 103.826 1.00 15.12 ? 704  DGT A O3G   1 
HETATM 8073 O  O3B   . DGT F 3 .   ? 124.183 -25.879 103.073 1.00 14.29 ? 704  DGT A O3B   1 
HETATM 8074 P  PB    . DGT F 3 .   ? 125.738 -26.193 103.134 1.00 12.57 ? 704  DGT A PB    1 
HETATM 8075 O  O1B   . DGT F 3 .   ? 126.191 -26.571 104.499 1.00 10.38 ? 704  DGT A O1B   1 
HETATM 8076 O  O2B   . DGT F 3 .   ? 126.087 -27.224 102.107 1.00 11.97 ? 704  DGT A O2B   1 
HETATM 8077 O  O3A   . DGT F 3 .   ? 126.435 -24.836 102.612 1.00 10.72 ? 704  DGT A O3A   1 
HETATM 8078 P  PA    . DGT F 3 .   ? 126.377 -23.423 103.367 1.00 10.25 ? 704  DGT A PA    1 
HETATM 8079 O  O1A   . DGT F 3 .   ? 125.907 -23.544 104.768 1.00 8.60  ? 704  DGT A O1A   1 
HETATM 8080 O  O2A   . DGT F 3 .   ? 125.558 -22.439 102.583 1.00 9.53  ? 704  DGT A O2A   1 
HETATM 8081 O  "O5'" . DGT F 3 .   ? 127.900 -22.881 103.333 1.00 9.30  ? 704  DGT A "O5'" 1 
HETATM 8082 C  "C5'" . DGT F 3 .   ? 128.893 -23.402 104.216 1.00 8.51  ? 704  DGT A "C5'" 1 
HETATM 8083 C  "C4'" . DGT F 3 .   ? 129.385 -22.290 105.120 1.00 8.34  ? 704  DGT A "C4'" 1 
HETATM 8084 O  "O4'" . DGT F 3 .   ? 129.961 -21.260 104.349 1.00 8.31  ? 704  DGT A "O4'" 1 
HETATM 8085 C  "C3'" . DGT F 3 .   ? 128.257 -21.574 105.840 1.00 8.58  ? 704  DGT A "C3'" 1 
HETATM 8086 O  "O3'" . DGT F 3 .   ? 128.024 -22.240 107.066 1.00 8.46  ? 704  DGT A "O3'" 1 
HETATM 8087 C  "C2'" . DGT F 3 .   ? 128.751 -20.165 106.095 1.00 8.64  ? 704  DGT A "C2'" 1 
HETATM 8088 C  "C1'" . DGT F 3 .   ? 129.906 -20.035 105.118 1.00 8.58  ? 704  DGT A "C1'" 1 
HETATM 8089 N  N9    . DGT F 3 .   ? 129.789 -18.928 104.164 1.00 9.17  ? 704  DGT A N9    1 
HETATM 8090 C  C8    . DGT F 3 .   ? 130.794 -18.112 103.792 1.00 9.50  ? 704  DGT A C8    1 
HETATM 8091 N  N7    . DGT F 3 .   ? 130.363 -17.227 102.865 1.00 9.75  ? 704  DGT A N7    1 
HETATM 8092 C  C5    . DGT F 3 .   ? 129.080 -17.500 102.609 1.00 10.01 ? 704  DGT A C5    1 
HETATM 8093 C  C6    . DGT F 3 .   ? 128.059 -16.921 101.728 1.00 10.25 ? 704  DGT A C6    1 
HETATM 8094 O  O6    . DGT F 3 .   ? 128.361 -15.967 100.973 1.00 9.83  ? 704  DGT A O6    1 
HETATM 8095 N  N1    . DGT F 3 .   ? 126.829 -17.473 101.769 1.00 9.89  ? 704  DGT A N1    1 
HETATM 8096 C  C2    . DGT F 3 .   ? 126.496 -18.511 102.579 1.00 9.63  ? 704  DGT A C2    1 
HETATM 8097 N  N2    . DGT F 3 .   ? 125.220 -19.005 102.540 1.00 9.49  ? 704  DGT A N2    1 
HETATM 8098 N  N3    . DGT F 3 .   ? 127.415 -19.079 103.410 1.00 10.12 ? 704  DGT A N3    1 
HETATM 8099 C  C4    . DGT F 3 .   ? 128.691 -18.611 103.462 1.00 9.82  ? 704  DGT A C4    1 
HETATM 8100 MG MG    . MG  G 4 .   ? 125.669 -25.268 106.208 1.00 16.55 ? 705  MG  A MG    1 
HETATM 8101 P  PG    . DGT H 3 .   ? 160.838 3.537   92.428  1.00 20.25 ? 801  DGT B PG    1 
HETATM 8102 O  O1G   . DGT H 3 .   ? 161.456 4.854   92.031  1.00 22.50 ? 801  DGT B O1G   1 
HETATM 8103 O  O2G   . DGT H 3 .   ? 161.017 3.284   93.896  1.00 20.16 ? 801  DGT B O2G   1 
HETATM 8104 O  O3G   . DGT H 3 .   ? 161.383 2.372   91.659  1.00 19.62 ? 801  DGT B O3G   1 
HETATM 8105 O  O3B   . DGT H 3 .   ? 159.283 3.619   92.007  1.00 19.11 ? 801  DGT B O3B   1 
HETATM 8106 P  PB    . DGT H 3 .   ? 158.028 4.021   92.914  1.00 17.82 ? 801  DGT B PB    1 
HETATM 8107 O  O1B   . DGT H 3 .   ? 158.441 4.380   94.286  1.00 14.65 ? 801  DGT B O1B   1 
HETATM 8108 O  O2B   . DGT H 3 .   ? 157.215 5.098   92.259  1.00 19.19 ? 801  DGT B O2B   1 
HETATM 8109 O  O3A   . DGT H 3 .   ? 157.089 2.710   92.943  1.00 15.44 ? 801  DGT B O3A   1 
HETATM 8110 P  PA    . DGT H 3 .   ? 157.548 1.318   93.572  1.00 13.60 ? 801  DGT B PA    1 
HETATM 8111 O  O1A   . DGT H 3 .   ? 158.763 1.412   94.405  1.00 12.30 ? 801  DGT B O1A   1 
HETATM 8112 O  O2A   . DGT H 3 .   ? 157.751 0.317   92.463  1.00 13.69 ? 801  DGT B O2A   1 
HETATM 8113 O  "O5'" . DGT H 3 .   ? 156.240 0.813   94.400  1.00 10.86 ? 801  DGT B "O5'" 1 
HETATM 8114 C  "C5'" . DGT H 3 .   ? 155.974 1.281   95.711  1.00 9.69  ? 801  DGT B "C5'" 1 
HETATM 8115 C  "C4'" . DGT H 3 .   ? 156.093 0.131   96.713  1.00 9.97  ? 801  DGT B "C4'" 1 
HETATM 8116 O  "O4'" . DGT H 3 .   ? 155.183 -0.892  96.380  1.00 9.71  ? 801  DGT B "O4'" 1 
HETATM 8117 C  "C3'" . DGT H 3 .   ? 157.432 -0.567  96.659  1.00 10.34 ? 801  DGT B "C3'" 1 
HETATM 8118 O  "O3'" . DGT H 3 .   ? 158.313 0.099   97.546  1.00 10.23 ? 801  DGT B "O3'" 1 
HETATM 8119 C  "C2'" . DGT H 3 .   ? 157.190 -1.989  97.139  1.00 9.58  ? 801  DGT B "C2'" 1 
HETATM 8120 C  "C1'" . DGT H 3 .   ? 155.684 -2.121  96.982  1.00 10.02 ? 801  DGT B "C1'" 1 
HETATM 8121 N  N9    . DGT H 3 .   ? 155.237 -3.220  96.120  1.00 11.02 ? 801  DGT B N9    1 
HETATM 8122 C  C8    . DGT H 3 .   ? 154.178 -4.026  96.371  1.00 11.39 ? 801  DGT B C8    1 
HETATM 8123 N  N7    . DGT H 3 .   ? 153.991 -4.894  95.363  1.00 11.47 ? 801  DGT B N7    1 
HETATM 8124 C  C5    . DGT H 3 .   ? 154.910 -4.626  94.427  1.00 10.90 ? 801  DGT B C5    1 
HETATM 8125 C  C6    . DGT H 3 .   ? 155.246 -5.197  93.123  1.00 11.25 ? 801  DGT B C6    1 
HETATM 8126 O  O6    . DGT H 3 .   ? 154.561 -6.134  92.652  1.00 10.23 ? 801  DGT B O6    1 
HETATM 8127 N  N1    . DGT H 3 .   ? 156.281 -4.642  92.464  1.00 11.04 ? 801  DGT B N1    1 
HETATM 8128 C  C2    . DGT H 3 .   ? 157.013 -3.616  92.954  1.00 11.24 ? 801  DGT B C2    1 
HETATM 8129 N  N2    . DGT H 3 .   ? 158.061 -3.106  92.230  1.00 12.21 ? 801  DGT B N2    1 
HETATM 8130 N  N3    . DGT H 3 .   ? 156.739 -3.064  94.161  1.00 11.18 ? 801  DGT B N3    1 
HETATM 8131 C  C4    . DGT H 3 .   ? 155.731 -3.530  94.922  1.00 11.13 ? 801  DGT B C4    1 
HETATM 8132 MG MG    . MG  I 4 .   ? 159.690 3.137   95.413  1.00 19.26 ? 802  MG  B MG    1 
HETATM 8133 ZN ZN    . ZN  J 2 .   ? 153.539 -22.443 97.623  1.00 11.04 ? 803  ZN  B ZN    1 
HETATM 8134 P  PG    . DGT K 3 .   ? 154.617 -28.336 100.146 1.00 39.08 ? 804  DGT B PG    1 
HETATM 8135 O  O1G   . DGT K 3 .   ? 155.563 -28.425 101.321 1.00 34.69 ? 804  DGT B O1G   1 
HETATM 8136 O  O2G   . DGT K 3 .   ? 153.744 -27.094 100.224 1.00 38.75 ? 804  DGT B O2G   1 
HETATM 8137 O  O3G   . DGT K 3 .   ? 155.316 -28.519 98.812  1.00 39.24 ? 804  DGT B O3G   1 
HETATM 8138 O  O3B   . DGT K 3 .   ? 153.609 -29.619 100.215 1.00 28.88 ? 804  DGT B O3B   1 
HETATM 8139 P  PB    . DGT K 3 .   ? 152.088 -29.604 100.749 1.00 25.32 ? 804  DGT B PB    1 
HETATM 8140 O  O1B   . DGT K 3 .   ? 152.114 -29.324 102.229 1.00 19.77 ? 804  DGT B O1B   1 
HETATM 8141 O  O2B   . DGT K 3 .   ? 151.418 -30.910 100.344 1.00 23.51 ? 804  DGT B O2B   1 
HETATM 8142 O  O3A   . DGT K 3 .   ? 151.270 -28.413 100.003 1.00 26.58 ? 804  DGT B O3A   1 
HETATM 8143 P  PA    . DGT K 3 .   ? 149.647 -28.461 99.979  1.00 29.03 ? 804  DGT B PA    1 
HETATM 8144 O  O1A   . DGT K 3 .   ? 149.106 -29.262 101.167 1.00 27.62 ? 804  DGT B O1A   1 
HETATM 8145 O  O2A   . DGT K 3 .   ? 149.242 -28.880 98.586  1.00 29.15 ? 804  DGT B O2A   1 
HETATM 8146 O  "O5'" . DGT K 3 .   ? 149.115 -26.938 100.219 1.00 22.56 ? 804  DGT B "O5'" 1 
HETATM 8147 C  "C5'" . DGT K 3 .   ? 149.576 -25.807 99.487  1.00 14.57 ? 804  DGT B "C5'" 1 
HETATM 8148 C  "C4'" . DGT K 3 .   ? 148.600 -24.623 99.512  1.00 9.95  ? 804  DGT B "C4'" 1 
HETATM 8149 O  "O4'" . DGT K 3 .   ? 147.470 -24.908 98.703  1.00 10.00 ? 804  DGT B "O4'" 1 
HETATM 8150 C  "C3'" . DGT K 3 .   ? 148.036 -24.294 100.898 1.00 9.10  ? 804  DGT B "C3'" 1 
HETATM 8151 O  "O3'" . DGT K 3 .   ? 147.837 -22.881 100.944 1.00 7.88  ? 804  DGT B "O3'" 1 
HETATM 8152 C  "C2'" . DGT K 3 .   ? 146.713 -25.003 100.938 1.00 9.27  ? 804  DGT B "C2'" 1 
HETATM 8153 C  "C1'" . DGT K 3 .   ? 146.279 -25.039 99.467  1.00 10.13 ? 804  DGT B "C1'" 1 
HETATM 8154 N  N9    . DGT K 3 .   ? 145.635 -26.309 99.135  1.00 11.54 ? 804  DGT B N9    1 
HETATM 8155 C  C8    . DGT K 3 .   ? 146.243 -27.494 98.902  1.00 12.33 ? 804  DGT B C8    1 
HETATM 8156 N  N7    . DGT K 3 .   ? 145.294 -28.435 98.637  1.00 13.90 ? 804  DGT B N7    1 
HETATM 8157 C  C5    . DGT K 3 .   ? 144.092 -27.840 98.708  1.00 12.57 ? 804  DGT B C5    1 
HETATM 8158 C  C6    . DGT K 3 .   ? 142.704 -28.279 98.522  1.00 13.85 ? 804  DGT B C6    1 
HETATM 8159 O  O6    . DGT K 3 .   ? 142.521 -29.493 98.252  1.00 15.65 ? 804  DGT B O6    1 
HETATM 8160 N  N1    . DGT K 3 .   ? 141.713 -27.376 98.679  1.00 12.92 ? 804  DGT B N1    1 
HETATM 8161 C  C2    . DGT K 3 .   ? 141.972 -26.074 98.966  1.00 12.77 ? 804  DGT B C2    1 
HETATM 8162 N  N2    . DGT K 3 .   ? 140.941 -25.184 99.117  1.00 12.01 ? 804  DGT B N2    1 
HETATM 8163 N  N3    . DGT K 3 .   ? 143.251 -25.617 99.136  1.00 12.10 ? 804  DGT B N3    1 
HETATM 8164 C  C4    . DGT K 3 .   ? 144.321 -26.441 99.015  1.00 12.06 ? 804  DGT B C4    1 
HETATM 8165 P  PG    . DTP L 5 .   ? 126.575 -27.335 108.603 1.00 11.07 ? 805  DTP B PG    1 
HETATM 8166 O  O1G   . DTP L 5 .   ? 125.689 -26.803 107.525 1.00 10.24 ? 805  DTP B O1G   1 
HETATM 8167 O  O2G   . DTP L 5 .   ? 126.289 -26.694 109.924 1.00 12.19 ? 805  DTP B O2G   1 
HETATM 8168 O  O3G   . DTP L 5 .   ? 126.466 -28.821 108.680 1.00 11.57 ? 805  DTP B O3G   1 
HETATM 8169 P  PB    . DTP L 5 .   ? 128.652 -25.821 107.386 1.00 9.07  ? 805  DTP B PB    1 
HETATM 8170 O  O1B   . DTP L 5 .   ? 129.684 -26.257 106.433 1.00 9.63  ? 805  DTP B O1B   1 
HETATM 8171 O  O2B   . DTP L 5 .   ? 127.601 -24.919 106.870 1.00 8.60  ? 805  DTP B O2B   1 
HETATM 8172 O  O3B   . DTP L 5 .   ? 128.111 -27.100 108.181 1.00 10.98 ? 805  DTP B O3B   1 
HETATM 8173 P  PA    . DTP L 5 .   ? 130.758 -24.939 109.213 1.00 7.55  ? 805  DTP B PA    1 
HETATM 8174 O  O1A   . DTP L 5 .   ? 131.613 -26.051 108.709 1.00 8.23  ? 805  DTP B O1A   1 
HETATM 8175 O  O2A   . DTP L 5 .   ? 130.464 -24.877 110.682 1.00 7.62  ? 805  DTP B O2A   1 
HETATM 8176 O  O3A   . DTP L 5 .   ? 129.348 -24.836 108.440 1.00 8.88  ? 805  DTP B O3A   1 
HETATM 8177 O  "O5'" . DTP L 5 .   ? 131.425 -23.570 108.790 1.00 7.76  ? 805  DTP B "O5'" 1 
HETATM 8178 C  "C5'" . DTP L 5 .   ? 130.955 -22.326 109.292 1.00 7.42  ? 805  DTP B "C5'" 1 
HETATM 8179 C  "C4'" . DTP L 5 .   ? 132.056 -21.274 109.286 1.00 6.96  ? 805  DTP B "C4'" 1 
HETATM 8180 O  "O4'" . DTP L 5 .   ? 133.125 -21.724 110.129 1.00 7.66  ? 805  DTP B "O4'" 1 
HETATM 8181 C  "C3'" . DTP L 5 .   ? 132.625 -21.130 107.897 1.00 6.63  ? 805  DTP B "C3'" 1 
HETATM 8182 O  "O3'" . DTP L 5 .   ? 132.999 -19.757 107.728 1.00 6.93  ? 805  DTP B "O3'" 1 
HETATM 8183 C  "C2'" . DTP L 5 .   ? 133.878 -21.984 107.873 1.00 6.70  ? 805  DTP B "C2'" 1 
HETATM 8184 C  "C1'" . DTP L 5 .   ? 134.306 -21.996 109.333 1.00 7.26  ? 805  DTP B "C1'" 1 
HETATM 8185 N  N9    . DTP L 5 .   ? 134.833 -23.265 109.847 1.00 7.51  ? 805  DTP B N9    1 
HETATM 8186 C  C8    . DTP L 5 .   ? 134.515 -24.542 109.539 1.00 7.10  ? 805  DTP B C8    1 
HETATM 8187 N  N7    . DTP L 5 .   ? 135.224 -25.386 110.345 1.00 7.35  ? 805  DTP B N7    1 
HETATM 8188 C  C5    . DTP L 5 .   ? 135.972 -24.641 111.171 1.00 8.01  ? 805  DTP B C5    1 
HETATM 8189 C  C6    . DTP L 5 .   ? 136.910 -24.910 112.256 1.00 8.59  ? 805  DTP B C6    1 
HETATM 8190 N  N6    . DTP L 5 .   ? 137.163 -26.194 112.575 1.00 9.41  ? 805  DTP B N6    1 
HETATM 8191 N  N1    . DTP L 5 .   ? 137.490 -23.847 112.856 1.00 9.10  ? 805  DTP B N1    1 
HETATM 8192 C  C2    . DTP L 5 .   ? 137.210 -22.578 112.528 1.00 9.37  ? 805  DTP B C2    1 
HETATM 8193 N  N3    . DTP L 5 .   ? 136.342 -22.282 111.540 1.00 8.82  ? 805  DTP B N3    1 
HETATM 8194 C  C4    . DTP L 5 .   ? 135.720 -23.258 110.843 1.00 8.05  ? 805  DTP B C4    1 
HETATM 8195 O  O     . HOH M 6 .   ? 139.438 -11.082 103.089 1.00 6.71  ? 801  HOH A O     1 
HETATM 8196 O  O     . HOH M 6 .   ? 137.472 -16.539 107.008 1.00 5.12  ? 802  HOH A O     1 
HETATM 8197 O  O     . HOH M 6 .   ? 141.824 -4.309  99.147  1.00 7.90  ? 803  HOH A O     1 
HETATM 8198 O  O     . HOH M 6 .   ? 126.560 -22.179 109.408 1.00 9.87  ? 804  HOH A O     1 
HETATM 8199 O  O     . HOH M 6 .   ? 122.959 7.569   109.859 1.00 8.24  ? 805  HOH A O     1 
HETATM 8200 O  O     . HOH M 6 .   ? 133.053 2.982   94.379  1.00 12.87 ? 806  HOH A O     1 
HETATM 8201 O  O     . HOH M 6 .   ? 152.522 -3.512  89.255  1.00 11.06 ? 807  HOH A O     1 
HETATM 8202 O  O     . HOH M 6 .   ? 126.000 -16.987 97.752  1.00 11.02 ? 808  HOH A O     1 
HETATM 8203 O  O     . HOH M 6 .   ? 154.588 -5.036  88.670  1.00 13.16 ? 809  HOH A O     1 
HETATM 8204 O  O     . HOH M 6 .   ? 137.971 -3.251  105.377 1.00 7.93  ? 810  HOH A O     1 
HETATM 8205 O  O     . HOH M 6 .   ? 143.115 -5.565  113.247 1.00 11.17 ? 811  HOH A O     1 
HETATM 8206 O  O     . HOH M 6 .   ? 142.807 5.226   118.377 1.00 14.40 ? 812  HOH A O     1 
HETATM 8207 O  O     . HOH M 6 .   ? 141.154 5.537   120.629 1.00 12.46 ? 813  HOH A O     1 
HETATM 8208 O  O     . HOH M 6 .   ? 129.028 -16.486 95.238  1.00 9.86  ? 814  HOH A O     1 
HETATM 8209 O  O     . HOH M 6 .   ? 140.248 3.182   121.991 1.00 11.16 ? 815  HOH A O     1 
HETATM 8210 O  O     . HOH M 6 .   ? 133.618 -11.157 106.789 1.00 10.95 ? 816  HOH A O     1 
HETATM 8211 O  O     . HOH M 6 .   ? 138.977 2.340   98.108  1.00 14.62 ? 817  HOH A O     1 
HETATM 8212 O  O     . HOH M 6 .   ? 135.362 -7.800  116.660 1.00 14.85 ? 818  HOH A O     1 
HETATM 8213 O  O     . HOH M 6 .   ? 127.568 -3.601  101.452 1.00 13.29 ? 819  HOH A O     1 
HETATM 8214 O  O     . HOH M 6 .   ? 147.339 -12.751 84.302  1.00 11.84 ? 820  HOH A O     1 
HETATM 8215 O  O     . HOH M 6 .   ? 129.756 -15.139 92.887  1.00 14.77 ? 821  HOH A O     1 
HETATM 8216 O  O     . HOH M 6 .   ? 127.036 -4.750  94.908  1.00 12.21 ? 822  HOH A O     1 
HETATM 8217 O  O     . HOH M 6 .   ? 122.131 3.026   111.418 1.00 14.72 ? 823  HOH A O     1 
HETATM 8218 O  O     . HOH M 6 .   ? 140.266 11.472  110.604 1.00 14.01 ? 824  HOH A O     1 
HETATM 8219 O  O     . HOH M 6 .   ? 122.242 -12.271 112.884 1.00 17.44 ? 825  HOH A O     1 
HETATM 8220 O  O     . HOH M 6 .   ? 123.190 -23.132 101.513 1.00 14.44 ? 826  HOH A O     1 
HETATM 8221 O  O     . HOH M 6 .   ? 138.802 -1.836  117.485 1.00 16.34 ? 827  HOH A O     1 
HETATM 8222 O  O     . HOH M 6 .   ? 148.514 11.500  95.432  1.00 18.28 ? 828  HOH A O     1 
HETATM 8223 O  O     . HOH M 6 .   ? 137.723 3.217   122.628 1.00 15.15 ? 829  HOH A O     1 
HETATM 8224 O  O     . HOH M 6 .   ? 160.988 2.404   100.306 1.00 14.34 ? 830  HOH A O     1 
HETATM 8225 O  O     . HOH M 6 .   ? 141.219 -7.291  88.497  1.00 17.48 ? 831  HOH A O     1 
HETATM 8226 O  O     . HOH M 6 .   ? 153.601 2.040   110.418 1.00 15.25 ? 832  HOH A O     1 
HETATM 8227 O  O     . HOH M 6 .   ? 133.177 -6.321  85.308  1.00 15.62 ? 833  HOH A O     1 
HETATM 8228 O  O     . HOH M 6 .   ? 130.598 3.995   93.325  1.00 18.46 ? 834  HOH A O     1 
HETATM 8229 O  O     . HOH M 6 .   ? 139.890 11.298  127.862 1.00 17.83 ? 835  HOH A O     1 
HETATM 8230 O  O     . HOH M 6 .   ? 138.134 -16.709 114.004 1.00 16.62 ? 836  HOH A O     1 
HETATM 8231 O  O     . HOH M 6 .   ? 136.654 17.465  110.007 1.00 20.71 ? 837  HOH A O     1 
HETATM 8232 O  O     . HOH M 6 .   ? 148.596 -7.611  110.059 1.00 18.05 ? 838  HOH A O     1 
HETATM 8233 O  O     . HOH M 6 .   ? 138.412 -0.755  114.873 1.00 14.01 ? 839  HOH A O     1 
HETATM 8234 O  O     . HOH M 6 .   ? 125.374 -8.921  114.849 1.00 19.12 ? 840  HOH A O     1 
HETATM 8235 O  O     . HOH M 6 .   ? 139.896 8.325   126.610 1.00 19.68 ? 841  HOH A O     1 
HETATM 8236 O  O     . HOH M 6 .   ? 123.066 5.106   109.759 1.00 18.70 ? 842  HOH A O     1 
HETATM 8237 O  O     . HOH M 6 .   ? 124.449 -27.444 99.930  1.00 18.59 ? 843  HOH A O     1 
HETATM 8238 O  O     . HOH M 6 .   ? 141.909 -4.034  115.439 1.00 21.03 ? 844  HOH A O     1 
HETATM 8239 O  O     . HOH M 6 .   ? 146.414 22.802  103.990 1.00 20.61 ? 845  HOH A O     1 
HETATM 8240 O  O     . HOH M 6 .   ? 132.552 10.780  135.102 1.00 20.59 ? 846  HOH A O     1 
HETATM 8241 O  O     . HOH M 6 .   ? 120.787 -18.896 100.889 1.00 20.12 ? 847  HOH A O     1 
HETATM 8242 O  O     . HOH M 6 .   ? 126.610 4.241   104.223 1.00 19.08 ? 848  HOH A O     1 
HETATM 8243 O  O     . HOH M 6 .   ? 149.291 -10.021 81.328  1.00 21.92 ? 849  HOH A O     1 
HETATM 8244 O  O     . HOH M 6 .   ? 139.579 -9.577  77.297  1.00 19.76 ? 850  HOH A O     1 
HETATM 8245 O  O     . HOH M 6 .   ? 133.643 12.920  111.149 1.00 21.94 ? 851  HOH A O     1 
HETATM 8246 O  O     . HOH M 6 .   ? 143.517 8.176   124.431 1.00 21.82 ? 852  HOH A O     1 
HETATM 8247 O  O     . HOH M 6 .   ? 151.988 -0.720  112.969 1.00 17.96 ? 853  HOH A O     1 
HETATM 8248 O  O     . HOH M 6 .   ? 124.731 -29.638 102.330 1.00 17.94 ? 854  HOH A O     1 
HETATM 8249 O  O     . HOH M 6 .   ? 131.007 5.088   124.181 1.00 18.05 ? 855  HOH A O     1 
HETATM 8250 O  O     . HOH M 6 .   ? 137.271 5.523   128.975 1.00 29.40 ? 856  HOH A O     1 
HETATM 8251 O  O     . HOH M 6 .   ? 115.782 -1.630  124.492 1.00 24.28 ? 857  HOH A O     1 
HETATM 8252 O  O     . HOH M 6 .   ? 119.320 -10.452 114.423 1.00 22.56 ? 858  HOH A O     1 
HETATM 8253 O  O     . HOH M 6 .   ? 153.392 -1.335  110.279 1.00 22.77 ? 859  HOH A O     1 
HETATM 8254 O  O     . HOH M 6 .   ? 127.151 9.629   118.148 1.00 23.54 ? 860  HOH A O     1 
HETATM 8255 O  O     . HOH M 6 .   ? 148.431 21.564  119.808 1.00 26.82 ? 861  HOH A O     1 
HETATM 8256 O  O     . HOH M 6 .   ? 143.085 -1.603  118.560 1.00 20.53 ? 862  HOH A O     1 
HETATM 8257 O  O     . HOH M 6 .   ? 117.197 0.280   91.684  1.00 24.82 ? 863  HOH A O     1 
HETATM 8258 O  O     . HOH M 6 .   ? 131.049 17.523  122.907 1.00 20.66 ? 864  HOH A O     1 
HETATM 8259 O  O     . HOH M 6 .   ? 121.251 7.994   108.445 1.00 21.73 ? 865  HOH A O     1 
HETATM 8260 O  O     . HOH M 6 .   ? 139.053 -4.614  124.335 1.00 27.44 ? 866  HOH A O     1 
HETATM 8261 O  O     . HOH M 6 .   ? 141.866 2.066   74.176  1.00 22.45 ? 867  HOH A O     1 
HETATM 8262 O  O     . HOH M 6 .   ? 139.401 -8.208  72.693  1.00 28.91 ? 868  HOH A O     1 
HETATM 8263 O  O     . HOH M 6 .   ? 120.204 14.084  128.852 1.00 26.91 ? 869  HOH A O     1 
HETATM 8264 O  O     . HOH M 6 .   ? 123.170 9.728   110.856 1.00 25.41 ? 870  HOH A O     1 
HETATM 8265 O  O     . HOH M 6 .   ? 126.624 -29.193 104.766 1.00 23.14 ? 871  HOH A O     1 
HETATM 8266 O  O     . HOH M 6 .   ? 130.478 12.521  90.585  1.00 26.57 ? 872  HOH A O     1 
HETATM 8267 O  O     . HOH M 6 .   ? 133.767 22.481  115.307 1.00 23.41 ? 873  HOH A O     1 
HETATM 8268 O  O     . HOH M 6 .   ? 137.611 12.955  105.131 1.00 26.25 ? 874  HOH A O     1 
HETATM 8269 O  O     . HOH M 6 .   ? 118.546 10.723  129.035 1.00 29.61 ? 875  HOH A O     1 
HETATM 8270 O  O     . HOH M 6 .   ? 158.113 3.091   88.431  1.00 25.27 ? 876  HOH A O     1 
HETATM 8271 O  O     . HOH M 6 .   ? 129.146 14.961  80.296  1.00 25.16 ? 877  HOH A O     1 
HETATM 8272 O  O     . HOH M 6 .   ? 142.984 -5.834  89.919  1.00 20.10 ? 878  HOH A O     1 
HETATM 8273 O  O     . HOH M 6 .   ? 145.078 4.710   96.473  1.00 22.59 ? 879  HOH A O     1 
HETATM 8274 O  O     . HOH M 6 .   ? 131.803 19.646  130.225 1.00 24.57 ? 880  HOH A O     1 
HETATM 8275 O  O     . HOH M 6 .   ? 139.519 23.462  111.316 1.00 27.39 ? 881  HOH A O     1 
HETATM 8276 O  O     . HOH M 6 .   ? 126.225 13.198  132.992 1.00 24.81 ? 882  HOH A O     1 
HETATM 8277 O  O     . HOH M 6 .   ? 127.043 -13.331 116.278 1.00 25.33 ? 883  HOH A O     1 
HETATM 8278 O  O     . HOH M 6 .   ? 150.821 9.856   102.252 1.00 26.14 ? 884  HOH A O     1 
HETATM 8279 O  O     . HOH M 6 .   ? 138.430 19.274  104.095 1.00 28.19 ? 885  HOH A O     1 
HETATM 8280 O  O     . HOH M 6 .   ? 127.303 -29.179 100.419 1.00 24.19 ? 886  HOH A O     1 
HETATM 8281 O  O     . HOH M 6 .   ? 127.249 11.197  120.673 1.00 25.22 ? 887  HOH A O     1 
HETATM 8282 O  O     . HOH M 6 .   ? 142.831 8.927   126.478 1.00 24.27 ? 888  HOH A O     1 
HETATM 8283 O  O     . HOH M 6 .   ? 155.720 6.045   103.127 1.00 24.78 ? 889  HOH A O     1 
HETATM 8284 O  O     . HOH M 6 .   ? 147.135 11.261  112.004 1.00 26.30 ? 890  HOH A O     1 
HETATM 8285 O  O     . HOH M 6 .   ? 131.338 22.546  114.444 1.00 26.66 ? 891  HOH A O     1 
HETATM 8286 O  O     . HOH M 6 .   ? 147.165 14.641  107.370 1.00 32.02 ? 892  HOH A O     1 
HETATM 8287 O  O     . HOH M 6 .   ? 143.249 13.875  117.378 1.00 25.98 ? 893  HOH A O     1 
HETATM 8288 O  O     . HOH M 6 .   ? 132.329 1.961   133.261 1.00 25.53 ? 894  HOH A O     1 
HETATM 8289 O  O     . HOH M 6 .   ? 146.591 14.498  124.264 1.00 25.89 ? 895  HOH A O     1 
HETATM 8290 O  O     . HOH M 6 .   ? 143.492 12.027  122.555 1.00 26.10 ? 896  HOH A O     1 
HETATM 8291 O  O     . HOH M 6 .   ? 151.920 -6.346  80.927  1.00 23.09 ? 897  HOH A O     1 
HETATM 8292 O  O     . HOH M 6 .   ? 114.863 3.695   96.287  1.00 32.11 ? 898  HOH A O     1 
HETATM 8293 O  O     . HOH M 6 .   ? 131.677 15.990  88.733  1.00 40.36 ? 899  HOH A O     1 
HETATM 8294 O  O     . HOH M 6 .   ? 163.359 3.143   97.545  1.00 24.61 ? 900  HOH A O     1 
HETATM 8295 O  O     . HOH M 6 .   ? 129.280 -13.736 117.496 1.00 27.80 ? 901  HOH A O     1 
HETATM 8296 O  O     . HOH M 6 .   ? 130.343 13.244  87.899  1.00 31.90 ? 902  HOH A O     1 
HETATM 8297 O  O     . HOH M 6 .   ? 117.786 -18.078 104.686 1.00 26.08 ? 903  HOH A O     1 
HETATM 8298 O  O     . HOH M 6 .   ? 126.410 -6.959  121.571 1.00 26.33 ? 904  HOH A O     1 
HETATM 8299 O  O     . HOH M 6 .   ? 115.634 -4.257  124.038 1.00 30.92 ? 905  HOH A O     1 
HETATM 8300 O  O     . HOH M 6 .   ? 148.145 -5.664  111.965 1.00 23.42 ? 906  HOH A O     1 
HETATM 8301 O  O     . HOH M 6 .   ? 146.811 3.085   98.144  1.00 20.43 ? 907  HOH A O     1 
HETATM 8302 O  O     . HOH M 6 .   ? 136.325 8.295   78.182  1.00 31.57 ? 908  HOH A O     1 
HETATM 8303 O  O     . HOH M 6 .   ? 129.256 -4.971  125.057 1.00 27.68 ? 909  HOH A O     1 
HETATM 8304 O  O     . HOH M 6 .   ? 131.227 10.048  91.312  1.00 25.26 ? 910  HOH A O     1 
HETATM 8305 O  O     . HOH M 6 .   ? 148.322 6.721   114.658 1.00 28.16 ? 911  HOH A O     1 
HETATM 8306 O  O     . HOH M 6 .   ? 155.830 6.142   105.891 1.00 26.41 ? 912  HOH A O     1 
HETATM 8307 O  O     . HOH M 6 .   ? 130.869 4.470   132.590 1.00 29.64 ? 913  HOH A O     1 
HETATM 8308 O  O     . HOH M 6 .   ? 110.544 -7.422  116.839 1.00 29.48 ? 914  HOH A O     1 
HETATM 8309 O  O     . HOH M 6 .   ? 137.934 -11.266 93.890  1.00 24.34 ? 915  HOH A O     1 
HETATM 8310 O  O     . HOH M 6 .   ? 122.512 1.200   126.583 1.00 23.32 ? 916  HOH A O     1 
HETATM 8311 O  O     . HOH M 6 .   ? 141.905 -11.949 106.009 1.00 19.54 ? 917  HOH A O     1 
HETATM 8312 O  O     . HOH M 6 .   ? 125.790 -11.674 114.935 1.00 26.09 ? 918  HOH A O     1 
HETATM 8313 O  O     . HOH M 6 .   ? 144.614 12.445  119.959 1.00 27.54 ? 919  HOH A O     1 
HETATM 8314 O  O     . HOH M 6 .   ? 123.740 -9.194  117.041 1.00 30.38 ? 920  HOH A O     1 
HETATM 8315 O  O     . HOH M 6 .   ? 133.933 -15.929 117.669 1.00 23.13 ? 921  HOH A O     1 
HETATM 8316 O  O     . HOH M 6 .   ? 128.479 3.924   106.465 1.00 25.16 ? 922  HOH A O     1 
HETATM 8317 O  O     . HOH M 6 .   ? 143.360 7.774   96.811  1.00 29.60 ? 923  HOH A O     1 
HETATM 8318 O  O     . HOH M 6 .   ? 140.937 2.952   95.528  1.00 26.56 ? 924  HOH A O     1 
HETATM 8319 O  O     . HOH M 6 .   ? 104.818 -2.953  103.967 1.00 36.93 ? 925  HOH A O     1 
HETATM 8320 O  O     . HOH M 6 .   ? 118.669 7.623   129.159 1.00 27.75 ? 926  HOH A O     1 
HETATM 8321 O  O     . HOH M 6 .   ? 130.377 -7.382  82.651  1.00 22.60 ? 927  HOH A O     1 
HETATM 8322 O  O     . HOH M 6 .   ? 120.011 6.519   95.103  1.00 31.77 ? 928  HOH A O     1 
HETATM 8323 O  O     . HOH M 6 .   ? 145.904 -9.033  75.887  1.00 28.43 ? 929  HOH A O     1 
HETATM 8324 O  O     . HOH M 6 .   ? 119.680 -19.700 106.130 1.00 30.53 ? 930  HOH A O     1 
HETATM 8325 O  O     . HOH M 6 .   ? 133.813 -10.306 117.794 1.00 21.47 ? 931  HOH A O     1 
HETATM 8326 O  O     . HOH M 6 .   ? 156.489 20.478  102.426 1.00 27.35 ? 932  HOH A O     1 
HETATM 8327 O  O     . HOH M 6 .   ? 145.829 7.254   117.280 1.00 25.60 ? 933  HOH A O     1 
HETATM 8328 O  O     . HOH M 6 .   ? 145.128 18.457  88.394  1.00 34.21 ? 934  HOH A O     1 
HETATM 8329 O  O     . HOH M 6 .   ? 149.213 28.599  83.932  1.00 32.42 ? 935  HOH A O     1 
HETATM 8330 O  O     . HOH M 6 .   ? 119.671 -27.087 104.994 1.00 28.90 ? 936  HOH A O     1 
HETATM 8331 O  O     . HOH M 6 .   ? 150.464 19.869  77.382  1.00 37.13 ? 937  HOH A O     1 
HETATM 8332 O  O     . HOH M 6 .   ? 153.021 8.087   100.363 1.00 27.90 ? 938  HOH A O     1 
HETATM 8333 O  O     . HOH M 6 .   ? 121.952 -22.919 107.898 1.00 27.82 ? 939  HOH A O     1 
HETATM 8334 O  O     . HOH M 6 .   ? 116.535 3.476   94.278  1.00 31.88 ? 940  HOH A O     1 
HETATM 8335 O  O     . HOH M 6 .   ? 134.583 -4.681  73.930  1.00 38.16 ? 941  HOH A O     1 
HETATM 8336 O  O     . HOH M 6 .   ? 146.410 16.299  87.314  1.00 28.71 ? 942  HOH A O     1 
HETATM 8337 O  O     . HOH M 6 .   ? 157.970 25.322  104.544 1.00 33.91 ? 943  HOH A O     1 
HETATM 8338 O  O     . HOH M 6 .   ? 132.724 0.980   78.459  1.00 29.57 ? 944  HOH A O     1 
HETATM 8339 O  O     . HOH M 6 .   ? 132.176 -4.558  123.720 1.00 29.08 ? 945  HOH A O     1 
HETATM 8340 O  O     . HOH M 6 .   ? 113.882 10.777  105.262 1.00 33.29 ? 946  HOH A O     1 
HETATM 8341 O  O     . HOH M 6 .   ? 129.913 8.014   79.124  1.00 27.29 ? 947  HOH A O     1 
HETATM 8342 O  O     . HOH M 6 .   ? 142.209 6.605   94.557  1.00 27.29 ? 948  HOH A O     1 
HETATM 8343 O  O     . HOH M 6 .   ? 136.748 5.801   75.649  1.00 27.62 ? 949  HOH A O     1 
HETATM 8344 O  O     . HOH M 6 .   ? 148.302 17.445  82.540  1.00 37.83 ? 950  HOH A O     1 
HETATM 8345 O  O     . HOH M 6 .   ? 137.898 -11.748 117.069 1.00 28.40 ? 951  HOH A O     1 
HETATM 8346 O  O     . HOH M 6 .   ? 111.481 -9.320  113.612 1.00 36.46 ? 952  HOH A O     1 
HETATM 8347 O  O     . HOH M 6 .   ? 126.501 -0.745  125.450 1.00 30.10 ? 953  HOH A O     1 
HETATM 8348 O  O     . HOH M 6 .   ? 110.310 -8.511  96.984  1.00 28.69 ? 954  HOH A O     1 
HETATM 8349 O  O     . HOH M 6 .   ? 140.793 19.553  103.373 1.00 29.34 ? 955  HOH A O     1 
HETATM 8350 O  O     . HOH M 6 .   ? 157.743 17.228  100.687 1.00 31.22 ? 956  HOH A O     1 
HETATM 8351 O  O     . HOH M 6 .   ? 125.280 3.718   77.572  1.00 35.06 ? 957  HOH A O     1 
HETATM 8352 O  O     . HOH M 6 .   ? 128.442 14.206  82.525  1.00 28.35 ? 958  HOH A O     1 
HETATM 8353 O  O     . HOH M 6 .   ? 113.107 4.696   122.578 1.00 28.29 ? 959  HOH A O     1 
HETATM 8354 O  O     . HOH M 6 .   ? 140.254 14.719  98.563  1.00 33.75 ? 960  HOH A O     1 
HETATM 8355 O  O     . HOH M 6 .   ? 140.358 -9.425  89.825  1.00 31.07 ? 961  HOH A O     1 
HETATM 8356 O  O     . HOH M 6 .   ? 127.570 20.387  128.657 1.00 31.88 ? 962  HOH A O     1 
HETATM 8357 O  O     . HOH M 6 .   ? 118.742 -15.520 98.082  1.00 27.08 ? 963  HOH A O     1 
HETATM 8358 O  O     . HOH M 6 .   ? 131.934 -6.688  79.375  1.00 36.79 ? 964  HOH A O     1 
HETATM 8359 O  O     . HOH M 6 .   ? 141.291 5.177   73.433  1.00 29.77 ? 965  HOH A O     1 
HETATM 8360 O  O     . HOH M 6 .   ? 142.599 12.999  95.012  1.00 36.36 ? 966  HOH A O     1 
HETATM 8361 O  O     . HOH M 6 .   ? 127.645 6.187   117.169 1.00 34.65 ? 967  HOH A O     1 
HETATM 8362 O  O     . HOH M 6 .   ? 125.075 -4.503  126.922 1.00 28.35 ? 968  HOH A O     1 
HETATM 8363 O  O     . HOH M 6 .   ? 112.047 2.903   99.716  1.00 31.96 ? 969  HOH A O     1 
HETATM 8364 O  O     . HOH M 6 .   ? 109.967 -14.474 97.859  1.00 31.67 ? 970  HOH A O     1 
HETATM 8365 O  O     . HOH M 6 .   ? 112.853 5.123   125.461 1.00 34.38 ? 971  HOH A O     1 
HETATM 8366 O  O     . HOH M 6 .   ? 141.352 -8.578  92.869  1.00 31.10 ? 972  HOH A O     1 
HETATM 8367 O  O     . HOH M 6 .   ? 128.172 3.566   102.319 1.00 22.64 ? 973  HOH A O     1 
HETATM 8368 O  O     . HOH M 6 .   ? 153.056 5.908   103.495 1.00 27.41 ? 974  HOH A O     1 
HETATM 8369 O  O     . HOH M 6 .   ? 140.913 12.539  89.322  1.00 34.77 ? 975  HOH A O     1 
HETATM 8370 O  O     . HOH M 6 .   ? 146.050 -8.899  112.985 1.00 28.97 ? 976  HOH A O     1 
HETATM 8371 O  O     . HOH M 6 .   ? 133.768 10.861  109.353 1.00 33.62 ? 977  HOH A O     1 
HETATM 8372 O  O     . HOH M 6 .   ? 150.442 30.241  85.550  1.00 33.53 ? 978  HOH A O     1 
HETATM 8373 O  O     . HOH M 6 .   ? 106.007 0.488   112.773 1.00 43.71 ? 979  HOH A O     1 
HETATM 8374 O  O     . HOH M 6 .   ? 127.518 -3.283  126.709 1.00 33.56 ? 980  HOH A O     1 
HETATM 8375 O  O     . HOH M 6 .   ? 144.952 0.440   67.700  1.00 31.16 ? 981  HOH A O     1 
HETATM 8376 O  O     . HOH M 6 .   ? 116.708 6.040   128.555 1.00 33.09 ? 982  HOH A O     1 
HETATM 8377 O  O     . HOH M 6 .   ? 123.616 -23.131 111.926 1.00 29.33 ? 983  HOH A O     1 
HETATM 8378 O  O     . HOH M 6 .   ? 142.783 10.698  88.829  1.00 31.36 ? 984  HOH A O     1 
HETATM 8379 O  O     . HOH M 6 .   ? 109.581 -2.827  116.933 1.00 33.55 ? 985  HOH A O     1 
HETATM 8380 O  O     . HOH M 6 .   ? 110.938 5.060   98.448  1.00 36.74 ? 986  HOH A O     1 
HETATM 8381 O  O     . HOH M 6 .   ? 117.710 -9.465  118.565 1.00 38.37 ? 987  HOH A O     1 
HETATM 8382 O  O     . HOH M 6 .   ? 135.969 22.520  121.287 1.00 35.97 ? 988  HOH A O     1 
HETATM 8383 O  O     . HOH M 6 .   ? 122.953 6.506   88.133  1.00 37.95 ? 989  HOH A O     1 
HETATM 8384 O  O     . HOH M 6 .   ? 147.676 15.170  119.182 1.00 29.86 ? 990  HOH A O     1 
HETATM 8385 O  O     . HOH M 6 .   ? 138.084 -3.721  120.152 1.00 23.46 ? 991  HOH A O     1 
HETATM 8386 O  O     . HOH M 6 .   ? 141.147 -12.244 90.367  1.00 25.71 ? 992  HOH A O     1 
HETATM 8387 O  O     . HOH M 6 .   ? 112.175 10.600  125.061 1.00 35.82 ? 993  HOH A O     1 
HETATM 8388 O  O     . HOH M 6 .   ? 142.146 -16.603 115.114 1.00 28.42 ? 994  HOH A O     1 
HETATM 8389 O  O     . HOH M 6 .   ? 132.882 -8.386  81.568  1.00 33.81 ? 995  HOH A O     1 
HETATM 8390 O  O     . HOH M 6 .   ? 165.813 19.061  101.477 1.00 37.14 ? 996  HOH A O     1 
HETATM 8391 O  O     . HOH M 6 .   ? 118.682 -19.066 102.527 1.00 29.68 ? 997  HOH A O     1 
HETATM 8392 O  O     . HOH M 6 .   ? 111.335 12.967  126.731 1.00 42.79 ? 998  HOH A O     1 
HETATM 8393 O  O     . HOH M 6 .   ? 109.397 -0.451  99.564  1.00 35.94 ? 999  HOH A O     1 
HETATM 8394 O  O     . HOH M 6 .   ? 140.832 -17.645 116.738 1.00 30.23 ? 1000 HOH A O     1 
HETATM 8395 O  O     . HOH M 6 .   ? 148.338 3.918   76.094  1.00 27.61 ? 1001 HOH A O     1 
HETATM 8396 O  O     . HOH M 6 .   ? 123.606 18.338  125.677 1.00 36.28 ? 1002 HOH A O     1 
HETATM 8397 O  O     . HOH M 6 .   ? 124.614 14.353  119.943 1.00 35.23 ? 1003 HOH A O     1 
HETATM 8398 O  O     . HOH M 6 .   ? 145.603 13.642  113.657 1.00 36.83 ? 1004 HOH A O     1 
HETATM 8399 O  O     . HOH M 6 .   ? 118.166 -2.919  85.921  1.00 39.43 ? 1005 HOH A O     1 
HETATM 8400 O  O     . HOH M 6 .   ? 125.195 16.640  124.563 1.00 36.81 ? 1006 HOH A O     1 
HETATM 8401 O  O     . HOH M 6 .   ? 155.424 14.169  105.734 1.00 29.22 ? 1007 HOH A O     1 
HETATM 8402 O  O     . HOH M 6 .   ? 134.593 9.961   103.407 1.00 36.54 ? 1008 HOH A O     1 
HETATM 8403 O  O     . HOH M 6 .   ? 160.049 13.382  97.911  1.00 41.45 ? 1009 HOH A O     1 
HETATM 8404 O  O     . HOH M 6 .   ? 150.326 -10.991 78.861  1.00 34.12 ? 1010 HOH A O     1 
HETATM 8405 O  O     . HOH M 6 .   ? 137.489 -9.511  90.632  1.00 32.52 ? 1011 HOH A O     1 
HETATM 8406 O  O     . HOH M 6 .   ? 114.128 6.331   127.845 1.00 34.72 ? 1012 HOH A O     1 
HETATM 8407 O  O     . HOH M 6 .   ? 120.747 12.199  102.064 1.00 35.16 ? 1013 HOH A O     1 
HETATM 8408 O  O     . HOH M 6 .   ? 139.252 -14.596 114.294 1.00 28.08 ? 1014 HOH A O     1 
HETATM 8409 O  O     . HOH M 6 .   ? 122.585 -8.713  86.409  1.00 35.54 ? 1015 HOH A O     1 
HETATM 8410 O  O     . HOH M 6 .   ? 145.493 13.719  118.048 1.00 28.16 ? 1016 HOH A O     1 
HETATM 8411 O  O     . HOH M 6 .   ? 127.291 15.680  78.859  1.00 25.78 ? 1017 HOH A O     1 
HETATM 8412 O  O     . HOH M 6 .   ? 125.793 -23.627 112.943 1.00 31.65 ? 1018 HOH A O     1 
HETATM 8413 O  O     . HOH M 6 .   ? 151.766 31.974  83.680  1.00 35.22 ? 1019 HOH A O     1 
HETATM 8414 O  O     . HOH M 6 .   ? 143.214 9.590   86.205  1.00 28.34 ? 1020 HOH A O     1 
HETATM 8415 O  O     . HOH M 6 .   ? 168.124 23.066  91.176  1.00 38.58 ? 1021 HOH A O     1 
HETATM 8416 O  O     . HOH M 6 .   ? 109.871 1.707   101.268 1.00 36.93 ? 1022 HOH A O     1 
HETATM 8417 O  O     . HOH M 6 .   ? 124.788 11.615  119.744 1.00 31.72 ? 1023 HOH A O     1 
HETATM 8418 O  O     . HOH M 6 .   ? 125.103 0.654   127.088 1.00 33.22 ? 1024 HOH A O     1 
HETATM 8419 O  O     . HOH M 6 .   ? 160.274 8.796   96.554  1.00 27.37 ? 1025 HOH A O     1 
HETATM 8420 O  O     . HOH M 6 .   ? 139.408 -4.538  118.195 1.00 31.42 ? 1026 HOH A O     1 
HETATM 8421 O  O     . HOH M 6 .   ? 136.654 23.421  96.853  1.00 39.85 ? 1027 HOH A O     1 
HETATM 8422 O  O     . HOH M 6 .   ? 140.912 12.542  105.771 1.00 31.36 ? 1028 HOH A O     1 
HETATM 8423 O  O     . HOH M 6 .   ? 137.079 22.501  118.358 1.00 30.15 ? 1029 HOH A O     1 
HETATM 8424 O  O     . HOH M 6 .   ? 151.968 23.701  78.813  1.00 31.58 ? 1030 HOH A O     1 
HETATM 8425 O  O     . HOH M 6 .   ? 122.808 2.870   77.267  1.00 42.52 ? 1031 HOH A O     1 
HETATM 8426 O  O     . HOH M 6 .   ? 130.565 12.707  79.465  1.00 33.44 ? 1032 HOH A O     1 
HETATM 8427 O  O     . HOH M 6 .   ? 127.450 1.599   129.048 1.00 31.72 ? 1033 HOH A O     1 
HETATM 8428 O  O     . HOH M 6 .   ? 138.465 13.004  88.945  1.00 33.76 ? 1034 HOH A O     1 
HETATM 8429 O  O     . HOH M 6 .   ? 152.115 12.314  103.218 1.00 39.26 ? 1035 HOH A O     1 
HETATM 8430 O  O     . HOH M 6 .   ? 125.227 -9.580  118.926 1.00 35.23 ? 1036 HOH A O     1 
HETATM 8431 O  O     . HOH M 6 .   ? 120.880 -7.963  88.379  1.00 25.91 ? 1037 HOH A O     1 
HETATM 8432 O  O     . HOH M 6 .   ? 124.943 -23.751 107.540 1.00 6.26  ? 1038 HOH A O     1 
HETATM 8433 O  O     . HOH M 6 .   ? 136.564 -11.044 81.149  1.00 23.01 ? 1039 HOH A O     1 
HETATM 8434 O  O     . HOH M 6 .   ? 125.121 18.086  116.764 1.00 36.47 ? 1040 HOH A O     1 
HETATM 8435 O  O     . HOH M 6 .   ? 140.890 9.275   77.537  1.00 35.12 ? 1041 HOH A O     1 
HETATM 8436 O  O     . HOH M 6 .   ? 129.532 0.548   74.606  1.00 40.99 ? 1042 HOH A O     1 
HETATM 8437 O  O     . HOH M 6 .   ? 129.209 6.775   106.512 1.00 30.99 ? 1043 HOH A O     1 
HETATM 8438 O  O     . HOH M 6 .   ? 130.758 8.108   108.446 1.00 29.18 ? 1044 HOH A O     1 
HETATM 8439 O  O     . HOH M 6 .   ? 153.733 4.477   81.713  1.00 30.16 ? 1045 HOH A O     1 
HETATM 8440 O  O     . HOH M 6 .   ? 151.801 4.061   80.513  1.00 33.21 ? 1046 HOH A O     1 
HETATM 8441 O  O     . HOH M 6 .   ? 129.577 12.360  137.471 1.00 38.00 ? 1047 HOH A O     1 
HETATM 8442 O  O     . HOH M 6 .   ? 143.324 1.939   71.079  1.00 28.62 ? 1048 HOH A O     1 
HETATM 8443 O  O     . HOH M 6 .   ? 132.746 -16.147 102.066 1.00 20.88 ? 1049 HOH A O     1 
HETATM 8444 O  O     . HOH M 6 .   ? 135.020 15.930  105.384 1.00 36.61 ? 1050 HOH A O     1 
HETATM 8445 O  O     . HOH M 6 .   ? 144.564 10.043  125.422 1.00 32.76 ? 1051 HOH A O     1 
HETATM 8446 O  O     . HOH M 6 .   ? 143.505 -3.103  97.037  1.00 21.31 ? 1052 HOH A O     1 
HETATM 8447 O  O     . HOH M 6 .   ? 141.627 -14.433 113.606 1.00 30.84 ? 1053 HOH A O     1 
HETATM 8448 O  O     . HOH M 6 .   ? 133.767 -10.524 80.434  1.00 32.84 ? 1054 HOH A O     1 
HETATM 8449 O  O     . HOH M 6 .   ? 106.817 -1.773  99.679  1.00 36.82 ? 1055 HOH A O     1 
HETATM 8450 O  O     . HOH M 6 .   ? 138.515 -5.965  119.721 1.00 37.57 ? 1056 HOH A O     1 
HETATM 8451 O  O     . HOH M 6 .   ? 155.962 -2.370  77.790  1.00 42.75 ? 1057 HOH A O     1 
HETATM 8452 O  O     . HOH M 6 .   ? 121.098 1.175   132.377 1.00 31.72 ? 1058 HOH A O     1 
HETATM 8453 O  O     . HOH M 6 .   ? 151.484 -5.830  96.209  1.00 21.81 ? 1059 HOH A O     1 
HETATM 8454 O  O     . HOH M 6 .   ? 123.982 19.116  130.402 1.00 36.44 ? 1060 HOH A O     1 
HETATM 8455 O  O     . HOH M 6 .   ? 137.770 22.227  104.592 1.00 37.69 ? 1061 HOH A O     1 
HETATM 8456 O  O     . HOH M 6 .   ? 132.818 5.893   125.350 1.00 31.76 ? 1062 HOH A O     1 
HETATM 8457 O  O     . HOH M 6 .   ? 159.390 -3.514  80.080  1.00 35.93 ? 1063 HOH A O     1 
HETATM 8458 O  O     . HOH M 6 .   ? 112.720 11.433  121.917 1.00 33.28 ? 1064 HOH A O     1 
HETATM 8459 O  O     . HOH M 6 .   ? 133.713 8.138   78.346  1.00 39.74 ? 1065 HOH A O     1 
HETATM 8460 O  O     . HOH M 6 .   ? 142.342 10.326  128.344 1.00 34.56 ? 1066 HOH A O     1 
HETATM 8461 O  O     . HOH M 6 .   ? 161.332 14.433  94.112  1.00 40.20 ? 1067 HOH A O     1 
HETATM 8462 O  O     . HOH M 6 .   ? 167.782 20.385  103.134 1.00 37.52 ? 1068 HOH A O     1 
HETATM 8463 O  O     . HOH M 6 .   ? 133.146 12.124  93.952  1.00 38.42 ? 1069 HOH A O     1 
HETATM 8464 O  O     . HOH M 6 .   ? 163.951 12.382  96.866  1.00 36.30 ? 1070 HOH A O     1 
HETATM 8465 O  O     . HOH M 6 .   ? 140.039 -8.899  115.814 1.00 25.31 ? 1071 HOH A O     1 
HETATM 8466 O  O     . HOH M 6 .   ? 109.545 -2.497  95.631  1.00 38.38 ? 1072 HOH A O     1 
HETATM 8467 O  O     . HOH M 6 .   ? 133.140 10.777  106.432 1.00 38.46 ? 1073 HOH A O     1 
HETATM 8468 O  O     . HOH M 6 .   ? 113.284 -7.241  89.325  1.00 40.59 ? 1074 HOH A O     1 
HETATM 8469 O  O     . HOH M 6 .   ? 111.627 -8.449  119.738 1.00 33.90 ? 1075 HOH A O     1 
HETATM 8470 O  O     . HOH M 6 .   ? 146.960 16.207  84.208  1.00 40.33 ? 1076 HOH A O     1 
HETATM 8471 O  O     . HOH M 6 .   ? 128.222 7.647   104.065 1.00 35.21 ? 1077 HOH A O     1 
HETATM 8472 O  O     . HOH M 6 .   ? 120.420 10.566  115.333 1.00 37.51 ? 1078 HOH A O     1 
HETATM 8473 O  O     . HOH M 6 .   ? 146.428 11.224  83.951  1.00 35.00 ? 1079 HOH A O     1 
HETATM 8474 O  O     . HOH M 6 .   ? 115.829 2.577   91.855  1.00 39.99 ? 1080 HOH A O     1 
HETATM 8475 O  O     . HOH M 6 .   ? 160.413 9.336   91.667  1.00 33.32 ? 1081 HOH A O     1 
HETATM 8476 O  O     . HOH M 6 .   ? 140.049 8.362   75.464  1.00 37.14 ? 1082 HOH A O     1 
HETATM 8477 O  O     . HOH M 6 .   ? 122.020 -1.038  73.284  1.00 41.04 ? 1083 HOH A O     1 
HETATM 8478 O  O     . HOH M 6 .   ? 139.434 21.533  97.418  1.00 42.32 ? 1084 HOH A O     1 
HETATM 8479 O  O     . HOH M 6 .   ? 153.845 29.608  89.295  1.00 41.06 ? 1085 HOH A O     1 
HETATM 8480 O  O     . HOH M 6 .   ? 138.623 -8.390  68.317  1.00 44.73 ? 1086 HOH A O     1 
HETATM 8481 O  O     . HOH M 6 .   ? 122.262 10.853  113.176 1.00 37.12 ? 1087 HOH A O     1 
HETATM 8482 O  O     . HOH M 6 .   ? 132.163 -7.594  119.728 1.00 31.35 ? 1088 HOH A O     1 
HETATM 8483 O  O     . HOH M 6 .   ? 132.119 22.368  128.285 1.00 37.42 ? 1089 HOH A O     1 
HETATM 8484 O  O     . HOH M 6 .   ? 127.318 -8.045  79.409  1.00 40.51 ? 1090 HOH A O     1 
HETATM 8485 O  O     . HOH M 6 .   ? 144.744 24.201  102.461 1.00 39.16 ? 1091 HOH A O     1 
HETATM 8486 O  O     . HOH M 6 .   ? 115.367 -7.525  88.079  1.00 37.80 ? 1092 HOH A O     1 
HETATM 8487 O  O     . HOH M 6 .   ? 152.898 -4.371  116.761 1.00 34.30 ? 1093 HOH A O     1 
HETATM 8488 O  O     . HOH M 6 .   ? 142.262 10.764  97.600  1.00 34.14 ? 1094 HOH A O     1 
HETATM 8489 O  O     . HOH M 6 .   ? 115.186 -3.992  89.842  1.00 35.56 ? 1095 HOH A O     1 
HETATM 8490 O  O     . HOH M 6 .   ? 114.569 16.221  116.843 1.00 39.47 ? 1096 HOH A O     1 
HETATM 8491 O  O     . HOH M 6 .   ? 125.066 15.881  80.497  1.00 34.57 ? 1097 HOH A O     1 
HETATM 8492 O  O     . HOH M 6 .   ? 108.241 5.336   99.527  1.00 41.59 ? 1098 HOH A O     1 
HETATM 8493 O  O     . HOH M 6 .   ? 125.822 10.354  99.035  1.00 37.25 ? 1099 HOH A O     1 
HETATM 8494 O  O     . HOH M 6 .   ? 130.216 0.758   131.472 1.00 32.44 ? 1100 HOH A O     1 
HETATM 8495 O  O     . HOH M 6 .   ? 135.652 16.201  86.024  1.00 33.24 ? 1101 HOH A O     1 
HETATM 8496 O  O     . HOH M 6 .   ? 137.741 -9.467  70.678  1.00 40.63 ? 1102 HOH A O     1 
HETATM 8497 O  O     . HOH M 6 .   ? 110.498 17.556  101.571 1.00 47.77 ? 1103 HOH A O     1 
HETATM 8498 O  O     . HOH M 6 .   ? 129.175 -11.732 118.972 1.00 39.53 ? 1104 HOH A O     1 
HETATM 8499 O  O     . HOH M 6 .   ? 121.852 -14.459 115.047 1.00 37.51 ? 1105 HOH A O     1 
HETATM 8500 O  O     . HOH M 6 .   ? 140.003 11.067  99.128  1.00 38.04 ? 1106 HOH A O     1 
HETATM 8501 O  O     . HOH M 6 .   ? 143.188 8.360   79.723  1.00 33.25 ? 1107 HOH A O     1 
HETATM 8502 O  O     . HOH M 6 .   ? 160.379 1.625   86.239  1.00 40.94 ? 1108 HOH A O     1 
HETATM 8503 O  O     . HOH M 6 .   ? 157.377 -1.751  79.969  1.00 38.44 ? 1109 HOH A O     1 
HETATM 8504 O  O     . HOH M 6 .   ? 134.277 23.750  93.275  1.00 46.13 ? 1110 HOH A O     1 
HETATM 8505 O  O     . HOH M 6 .   ? 157.952 30.954  87.334  1.00 47.74 ? 1111 HOH A O     1 
HETATM 8506 O  O     . HOH M 6 .   ? 127.183 1.842   75.087  1.00 43.19 ? 1112 HOH A O     1 
HETATM 8507 O  O     . HOH M 6 .   ? 137.502 10.805  78.218  1.00 40.51 ? 1113 HOH A O     1 
HETATM 8508 O  O     . HOH M 6 .   ? 124.488 18.458  114.362 1.00 42.83 ? 1114 HOH A O     1 
HETATM 8509 O  O     . HOH M 6 .   ? 117.996 1.837   132.067 1.00 45.73 ? 1115 HOH A O     1 
HETATM 8510 O  O     . HOH M 6 .   ? 120.182 8.218   96.948  1.00 40.92 ? 1116 HOH A O     1 
HETATM 8511 O  O     . HOH M 6 .   ? 120.251 11.445  99.075  1.00 42.25 ? 1117 HOH A O     1 
HETATM 8512 O  O     . HOH M 6 .   ? 103.537 -0.340  113.437 1.00 43.58 ? 1118 HOH A O     1 
HETATM 8513 O  O     . HOH M 6 .   ? 143.166 -8.382  113.268 1.00 29.17 ? 1119 HOH A O     1 
HETATM 8514 O  O     . HOH M 6 .   ? 132.985 -5.397  76.150  1.00 42.06 ? 1120 HOH A O     1 
HETATM 8515 O  O     . HOH M 6 .   ? 145.547 -4.989  113.931 1.00 25.75 ? 1121 HOH A O     1 
HETATM 8516 O  O     . HOH M 6 .   ? 130.940 9.477   98.940  1.00 26.63 ? 1122 HOH A O     1 
HETATM 8517 O  O     . HOH M 6 .   ? 142.232 12.229  108.120 1.00 25.48 ? 1123 HOH A O     1 
HETATM 8518 O  O     . HOH M 6 .   ? 137.563 -7.964  75.351  1.00 40.54 ? 1124 HOH A O     1 
HETATM 8519 O  O     . HOH M 6 .   ? 149.445 7.096   79.856  1.00 42.81 ? 1125 HOH A O     1 
HETATM 8520 O  O     . HOH M 6 .   ? 135.254 18.827  121.697 1.00 31.16 ? 1126 HOH A O     1 
HETATM 8521 O  O     . HOH M 6 .   ? 118.464 0.293   87.487  1.00 32.52 ? 1127 HOH A O     1 
HETATM 8522 O  O     . HOH M 6 .   ? 121.104 9.416   135.693 1.00 36.44 ? 1128 HOH A O     1 
HETATM 8523 O  O     . HOH M 6 .   ? 107.774 18.602  102.611 1.00 39.90 ? 1129 HOH A O     1 
HETATM 8524 O  O     . HOH M 6 .   ? 119.864 -24.672 103.213 1.00 30.30 ? 1130 HOH A O     1 
HETATM 8525 O  O     . HOH M 6 .   ? 136.304 -6.240  73.199  1.00 44.75 ? 1131 HOH A O     1 
HETATM 8526 O  O     . HOH M 6 .   ? 113.783 -2.299  91.235  1.00 40.62 ? 1132 HOH A O     1 
HETATM 8527 O  O     . HOH M 6 .   ? 147.261 8.318   80.845  1.00 41.79 ? 1133 HOH A O     1 
HETATM 8528 O  O     . HOH M 6 .   ? 105.399 -7.913  99.842  1.00 36.90 ? 1134 HOH A O     1 
HETATM 8529 O  O     . HOH M 6 .   ? 102.863 -2.788  113.476 1.00 46.75 ? 1135 HOH A O     1 
HETATM 8530 O  O     . HOH M 6 .   ? 114.680 -15.312 97.936  1.00 40.60 ? 1136 HOH A O     1 
HETATM 8531 O  O     . HOH M 6 .   ? 156.101 15.149  73.868  1.00 49.55 ? 1137 HOH A O     1 
HETATM 8532 O  O     . HOH M 6 .   ? 140.144 9.204   130.858 1.00 35.59 ? 1138 HOH A O     1 
HETATM 8533 O  O     . HOH M 6 .   ? 115.479 -0.266  77.124  1.00 49.77 ? 1139 HOH A O     1 
HETATM 8534 O  O     . HOH M 6 .   ? 117.050 -5.886  127.085 1.00 37.10 ? 1140 HOH A O     1 
HETATM 8535 O  O     . HOH M 6 .   ? 121.840 -9.751  83.899  1.00 40.28 ? 1141 HOH A O     1 
HETATM 8536 O  O     . HOH M 6 .   ? 134.101 12.918  104.929 1.00 40.80 ? 1142 HOH A O     1 
HETATM 8537 O  O     . HOH M 6 .   ? 147.711 9.761   76.919  1.00 43.52 ? 1143 HOH A O     1 
HETATM 8538 O  O     . HOH M 6 .   ? 102.845 -1.242  105.451 1.00 45.11 ? 1144 HOH A O     1 
HETATM 8539 O  O     . HOH M 6 .   ? 139.064 -9.727  105.580 1.00 14.50 ? 1145 HOH A O     1 
HETATM 8540 O  O     . HOH M 6 .   ? 157.760 -3.885  78.131  1.00 34.22 ? 1146 HOH A O     1 
HETATM 8541 O  O     . HOH M 6 .   ? 152.735 -7.617  78.120  1.00 31.94 ? 1147 HOH A O     1 
HETATM 8542 O  O     . HOH N 6 .   ? 142.531 -17.717 98.911  1.00 5.69  ? 901  HOH B O     1 
HETATM 8543 O  O     . HOH N 6 .   ? 128.117 -18.620 97.038  1.00 8.30  ? 902  HOH B O     1 
HETATM 8544 O  O     . HOH N 6 .   ? 152.703 -27.269 115.247 1.00 10.57 ? 903  HOH B O     1 
HETATM 8545 O  O     . HOH N 6 .   ? 146.794 -25.042 89.933  1.00 10.37 ? 904  HOH B O     1 
HETATM 8546 O  O     . HOH N 6 .   ? 163.917 -29.745 96.728  1.00 7.44  ? 905  HOH B O     1 
HETATM 8547 O  O     . HOH N 6 .   ? 156.899 -25.243 116.730 1.00 8.93  ? 906  HOH B O     1 
HETATM 8548 O  O     . HOH N 6 .   ? 155.432 -18.539 92.639  1.00 9.42  ? 907  HOH B O     1 
HETATM 8549 O  O     . HOH N 6 .   ? 150.568 -5.531  102.866 1.00 5.69  ? 908  HOH B O     1 
HETATM 8550 O  O     . HOH N 6 .   ? 155.237 -27.623 116.148 1.00 8.83  ? 909  HOH B O     1 
HETATM 8551 O  O     . HOH N 6 .   ? 149.214 -18.850 101.758 1.00 5.77  ? 910  HOH B O     1 
HETATM 8552 O  O     . HOH N 6 .   ? 134.808 -33.538 99.608  1.00 10.90 ? 911  HOH B O     1 
HETATM 8553 O  O     . HOH N 6 .   ? 152.863 -39.662 104.918 1.00 12.47 ? 912  HOH B O     1 
HETATM 8554 O  O     . HOH N 6 .   ? 149.603 -16.387 111.212 1.00 10.18 ? 913  HOH B O     1 
HETATM 8555 O  O     . HOH N 6 .   ? 165.423 -25.213 97.578  1.00 11.33 ? 914  HOH B O     1 
HETATM 8556 O  O     . HOH N 6 .   ? 143.958 -24.388 96.374  1.00 10.96 ? 915  HOH B O     1 
HETATM 8557 O  O     . HOH N 6 .   ? 160.804 0.142   98.664  1.00 12.56 ? 916  HOH B O     1 
HETATM 8558 O  O     . HOH N 6 .   ? 163.770 -27.362 96.831  1.00 10.82 ? 917  HOH B O     1 
HETATM 8559 O  O     . HOH N 6 .   ? 159.352 -25.204 115.912 1.00 11.96 ? 918  HOH B O     1 
HETATM 8560 O  O     . HOH N 6 .   ? 155.548 -20.235 112.247 1.00 11.63 ? 919  HOH B O     1 
HETATM 8561 O  O     . HOH N 6 .   ? 150.169 -33.653 107.370 1.00 8.92  ? 920  HOH B O     1 
HETATM 8562 O  O     . HOH N 6 .   ? 129.466 -9.310  89.871  1.00 12.26 ? 921  HOH B O     1 
HETATM 8563 O  O     . HOH N 6 .   ? 152.195 -17.326 86.930  1.00 11.21 ? 922  HOH B O     1 
HETATM 8564 O  O     . HOH N 6 .   ? 139.198 -24.142 114.977 1.00 14.12 ? 923  HOH B O     1 
HETATM 8565 O  O     . HOH N 6 .   ? 150.799 -5.589  88.401  1.00 9.69  ? 924  HOH B O     1 
HETATM 8566 O  O     . HOH N 6 .   ? 156.098 -35.007 104.122 1.00 13.92 ? 925  HOH B O     1 
HETATM 8567 O  O     . HOH N 6 .   ? 170.817 -32.914 122.877 1.00 15.49 ? 926  HOH B O     1 
HETATM 8568 O  O     . HOH N 6 .   ? 157.972 -14.226 109.593 1.00 13.68 ? 927  HOH B O     1 
HETATM 8569 O  O     . HOH N 6 .   ? 174.666 -35.290 117.485 1.00 16.24 ? 928  HOH B O     1 
HETATM 8570 O  O     . HOH N 6 .   ? 148.826 -6.866  86.816  1.00 13.37 ? 929  HOH B O     1 
HETATM 8571 O  O     . HOH N 6 .   ? 136.918 -14.706 89.859  1.00 18.46 ? 930  HOH B O     1 
HETATM 8572 O  O     . HOH N 6 .   ? 127.435 -11.123 90.975  1.00 15.52 ? 931  HOH B O     1 
HETATM 8573 O  O     . HOH N 6 .   ? 132.262 -42.393 110.074 1.00 16.86 ? 932  HOH B O     1 
HETATM 8574 O  O     . HOH N 6 .   ? 151.013 -45.398 107.610 1.00 19.80 ? 933  HOH B O     1 
HETATM 8575 O  O     . HOH N 6 .   ? 149.670 -10.945 83.977  1.00 16.29 ? 934  HOH B O     1 
HETATM 8576 O  O     . HOH N 6 .   ? 137.128 -31.873 106.549 1.00 18.14 ? 935  HOH B O     1 
HETATM 8577 O  O     . HOH N 6 .   ? 157.858 -26.371 94.375  1.00 16.91 ? 936  HOH B O     1 
HETATM 8578 O  O     . HOH N 6 .   ? 159.835 -30.375 120.251 1.00 14.16 ? 937  HOH B O     1 
HETATM 8579 O  O     . HOH N 6 .   ? 166.492 -9.929  98.874  1.00 17.09 ? 938  HOH B O     1 
HETATM 8580 O  O     . HOH N 6 .   ? 168.213 -41.687 118.669 1.00 16.33 ? 939  HOH B O     1 
HETATM 8581 O  O     . HOH N 6 .   ? 160.412 -33.462 121.500 1.00 13.66 ? 940  HOH B O     1 
HETATM 8582 O  O     . HOH N 6 .   ? 141.527 -15.598 82.677  1.00 12.35 ? 941  HOH B O     1 
HETATM 8583 O  O     . HOH N 6 .   ? 127.398 -24.463 110.999 1.00 18.14 ? 942  HOH B O     1 
HETATM 8584 O  O     . HOH N 6 .   ? 178.264 -20.741 104.449 1.00 20.19 ? 943  HOH B O     1 
HETATM 8585 O  O     . HOH N 6 .   ? 138.441 -26.669 98.556  1.00 15.72 ? 944  HOH B O     1 
HETATM 8586 O  O     . HOH N 6 .   ? 153.683 -10.863 100.399 1.00 13.45 ? 945  HOH B O     1 
HETATM 8587 O  O     . HOH N 6 .   ? 154.348 -21.314 109.854 1.00 10.72 ? 946  HOH B O     1 
HETATM 8588 O  O     . HOH N 6 .   ? 155.533 -30.079 120.597 1.00 17.33 ? 947  HOH B O     1 
HETATM 8589 O  O     . HOH N 6 .   ? 158.253 -22.332 78.572  1.00 22.98 ? 948  HOH B O     1 
HETATM 8590 O  O     . HOH N 6 .   ? 141.409 -44.895 105.521 1.00 17.11 ? 949  HOH B O     1 
HETATM 8591 O  O     . HOH N 6 .   ? 143.391 -14.447 111.812 1.00 16.95 ? 950  HOH B O     1 
HETATM 8592 O  O     . HOH N 6 .   ? 159.467 -17.438 117.625 1.00 23.92 ? 951  HOH B O     1 
HETATM 8593 O  O     . HOH N 6 .   ? 165.224 -31.836 105.933 1.00 18.18 ? 952  HOH B O     1 
HETATM 8594 O  O     . HOH N 6 .   ? 165.127 -13.309 102.202 1.00 18.91 ? 953  HOH B O     1 
HETATM 8595 O  O     . HOH N 6 .   ? 146.709 -32.098 86.437  1.00 15.96 ? 954  HOH B O     1 
HETATM 8596 O  O     . HOH N 6 .   ? 154.678 -34.134 119.171 1.00 17.47 ? 955  HOH B O     1 
HETATM 8597 O  O     . HOH N 6 .   ? 132.090 -47.332 112.539 1.00 18.26 ? 956  HOH B O     1 
HETATM 8598 O  O     . HOH N 6 .   ? 149.136 -43.662 119.645 1.00 19.38 ? 957  HOH B O     1 
HETATM 8599 O  O     . HOH N 6 .   ? 164.872 -39.540 112.329 1.00 16.26 ? 958  HOH B O     1 
HETATM 8600 O  O     . HOH N 6 .   ? 130.493 -39.162 109.151 1.00 19.32 ? 959  HOH B O     1 
HETATM 8601 O  O     . HOH N 6 .   ? 142.204 -21.148 116.219 1.00 16.46 ? 960  HOH B O     1 
HETATM 8602 O  O     . HOH N 6 .   ? 152.596 -20.429 115.566 1.00 16.20 ? 961  HOH B O     1 
HETATM 8603 O  O     . HOH N 6 .   ? 131.892 -38.367 91.676  1.00 19.15 ? 962  HOH B O     1 
HETATM 8604 O  O     . HOH N 6 .   ? 177.008 -36.444 110.616 1.00 25.16 ? 963  HOH B O     1 
HETATM 8605 O  O     . HOH N 6 .   ? 151.851 -35.937 114.614 1.00 14.51 ? 964  HOH B O     1 
HETATM 8606 O  O     . HOH N 6 .   ? 145.490 -33.349 112.678 1.00 19.08 ? 965  HOH B O     1 
HETATM 8607 O  O     . HOH N 6 .   ? 147.442 -34.338 106.543 1.00 20.17 ? 966  HOH B O     1 
HETATM 8608 O  O     . HOH N 6 .   ? 148.188 -25.997 87.614  1.00 15.46 ? 967  HOH B O     1 
HETATM 8609 O  O     . HOH N 6 .   ? 164.491 -30.408 94.698  1.00 15.11 ? 968  HOH B O     1 
HETATM 8610 O  O     . HOH N 6 .   ? 152.046 -17.733 112.353 1.00 18.64 ? 969  HOH B O     1 
HETATM 8611 O  O     . HOH N 6 .   ? 135.816 -28.095 108.659 1.00 18.43 ? 970  HOH B O     1 
HETATM 8612 O  O     . HOH N 6 .   ? 152.988 -36.695 122.306 1.00 18.79 ? 971  HOH B O     1 
HETATM 8613 O  O     . HOH N 6 .   ? 170.957 -26.403 119.987 1.00 26.20 ? 972  HOH B O     1 
HETATM 8614 O  O     . HOH N 6 .   ? 171.031 -42.509 114.936 1.00 19.75 ? 973  HOH B O     1 
HETATM 8615 O  O     . HOH N 6 .   ? 124.329 -40.718 114.817 1.00 23.15 ? 974  HOH B O     1 
HETATM 8616 O  O     . HOH N 6 .   ? 114.375 -45.118 95.834  1.00 26.01 ? 975  HOH B O     1 
HETATM 8617 O  O     . HOH N 6 .   ? 147.897 -41.367 100.848 1.00 24.73 ? 976  HOH B O     1 
HETATM 8618 O  O     . HOH N 6 .   ? 178.721 -33.043 109.583 1.00 26.47 ? 977  HOH B O     1 
HETATM 8619 O  O     . HOH N 6 .   ? 159.379 0.915   90.258  1.00 20.58 ? 978  HOH B O     1 
HETATM 8620 O  O     . HOH N 6 .   ? 145.598 -41.677 101.806 1.00 24.49 ? 979  HOH B O     1 
HETATM 8621 O  O     . HOH N 6 .   ? 130.175 -44.298 88.544  1.00 26.07 ? 980  HOH B O     1 
HETATM 8622 O  O     . HOH N 6 .   ? 167.250 -44.422 117.136 1.00 20.95 ? 981  HOH B O     1 
HETATM 8623 O  O     . HOH N 6 .   ? 141.153 -25.001 95.436  1.00 19.18 ? 982  HOH B O     1 
HETATM 8624 O  O     . HOH N 6 .   ? 162.877 -28.088 124.173 1.00 18.86 ? 983  HOH B O     1 
HETATM 8625 O  O     . HOH N 6 .   ? 146.191 -28.864 115.351 1.00 22.04 ? 984  HOH B O     1 
HETATM 8626 O  O     . HOH N 6 .   ? 154.218 -5.216  109.040 1.00 21.75 ? 985  HOH B O     1 
HETATM 8627 O  O     . HOH N 6 .   ? 149.195 -35.132 101.284 1.00 24.53 ? 986  HOH B O     1 
HETATM 8628 O  O     . HOH N 6 .   ? 134.468 -31.092 106.016 1.00 15.41 ? 987  HOH B O     1 
HETATM 8629 O  O     . HOH N 6 .   ? 157.916 -28.805 83.017  1.00 22.64 ? 988  HOH B O     1 
HETATM 8630 O  O     . HOH N 6 .   ? 131.737 -12.401 79.665  1.00 20.07 ? 989  HOH B O     1 
HETATM 8631 O  O     . HOH N 6 .   ? 143.067 -36.793 108.531 1.00 21.26 ? 990  HOH B O     1 
HETATM 8632 O  O     . HOH N 6 .   ? 144.495 -16.594 113.160 1.00 21.20 ? 991  HOH B O     1 
HETATM 8633 O  O     . HOH N 6 .   ? 116.061 -44.336 107.846 1.00 23.19 ? 992  HOH B O     1 
HETATM 8634 O  O     . HOH N 6 .   ? 164.130 -32.050 97.454  1.00 24.99 ? 993  HOH B O     1 
HETATM 8635 O  O     . HOH N 6 .   ? 173.061 -13.529 79.187  1.00 25.35 ? 994  HOH B O     1 
HETATM 8636 O  O     . HOH N 6 .   ? 152.123 -34.480 117.745 1.00 21.47 ? 995  HOH B O     1 
HETATM 8637 O  O     . HOH N 6 .   ? 151.323 -31.609 92.293  1.00 21.51 ? 996  HOH B O     1 
HETATM 8638 O  O     . HOH N 6 .   ? 165.673 -27.224 113.493 1.00 18.56 ? 997  HOH B O     1 
HETATM 8639 O  O     . HOH N 6 .   ? 166.546 -33.509 108.002 1.00 24.34 ? 998  HOH B O     1 
HETATM 8640 O  O     . HOH N 6 .   ? 126.146 -12.026 88.552  1.00 21.65 ? 999  HOH B O     1 
HETATM 8641 O  O     . HOH N 6 .   ? 137.881 -25.356 101.055 1.00 19.69 ? 1000 HOH B O     1 
HETATM 8642 O  O     . HOH N 6 .   ? 128.035 -23.982 78.425  1.00 24.09 ? 1001 HOH B O     1 
HETATM 8643 O  O     . HOH N 6 .   ? 178.255 -14.817 94.964  1.00 30.46 ? 1002 HOH B O     1 
HETATM 8644 O  O     . HOH N 6 .   ? 159.356 -6.150  109.745 1.00 19.32 ? 1003 HOH B O     1 
HETATM 8645 O  O     . HOH N 6 .   ? 160.531 -40.787 113.790 1.00 21.05 ? 1004 HOH B O     1 
HETATM 8646 O  O     . HOH N 6 .   ? 158.194 -44.541 107.585 1.00 25.05 ? 1005 HOH B O     1 
HETATM 8647 O  O     . HOH N 6 .   ? 142.055 -14.554 78.950  1.00 24.99 ? 1006 HOH B O     1 
HETATM 8648 O  O     . HOH N 6 .   ? 139.417 -28.749 95.423  1.00 20.03 ? 1007 HOH B O     1 
HETATM 8649 O  O     . HOH N 6 .   ? 147.012 -34.772 103.686 1.00 18.09 ? 1008 HOH B O     1 
HETATM 8650 O  O     . HOH N 6 .   ? 167.685 -13.232 79.250  1.00 26.31 ? 1009 HOH B O     1 
HETATM 8651 O  O     . HOH N 6 .   ? 135.793 -32.670 91.025  1.00 20.60 ? 1010 HOH B O     1 
HETATM 8652 O  O     . HOH N 6 .   ? 123.252 -25.060 99.419  1.00 20.96 ? 1011 HOH B O     1 
HETATM 8653 O  O     . HOH N 6 .   ? 119.125 -49.133 93.838  1.00 25.54 ? 1012 HOH B O     1 
HETATM 8654 O  O     . HOH N 6 .   ? 122.579 -26.713 91.644  1.00 23.23 ? 1013 HOH B O     1 
HETATM 8655 O  O     . HOH N 6 .   ? 160.683 -2.996  88.482  1.00 24.34 ? 1014 HOH B O     1 
HETATM 8656 O  O     . HOH N 6 .   ? 191.340 4.906   92.792  1.00 29.50 ? 1015 HOH B O     1 
HETATM 8657 O  O     . HOH N 6 .   ? 178.128 -34.053 91.764  1.00 33.50 ? 1016 HOH B O     1 
HETATM 8658 O  O     . HOH N 6 .   ? 157.563 -30.837 121.912 1.00 22.67 ? 1017 HOH B O     1 
HETATM 8659 O  O     . HOH N 6 .   ? 156.470 -20.715 119.752 1.00 20.90 ? 1018 HOH B O     1 
HETATM 8660 O  O     . HOH N 6 .   ? 174.046 -23.750 110.194 1.00 22.46 ? 1019 HOH B O     1 
HETATM 8661 O  O     . HOH N 6 .   ? 135.291 -36.025 111.988 1.00 25.92 ? 1020 HOH B O     1 
HETATM 8662 O  O     . HOH N 6 .   ? 168.184 -33.208 87.675  1.00 31.46 ? 1021 HOH B O     1 
HETATM 8663 O  O     . HOH N 6 .   ? 146.609 -34.340 85.095  1.00 23.89 ? 1022 HOH B O     1 
HETATM 8664 O  O     . HOH N 6 .   ? 173.785 -15.806 80.257  1.00 28.67 ? 1023 HOH B O     1 
HETATM 8665 O  O     . HOH N 6 .   ? 123.459 -34.275 109.642 1.00 29.05 ? 1024 HOH B O     1 
HETATM 8666 O  O     . HOH N 6 .   ? 148.872 -44.075 101.109 1.00 30.73 ? 1025 HOH B O     1 
HETATM 8667 O  O     . HOH N 6 .   ? 168.197 -15.258 108.395 1.00 27.28 ? 1026 HOH B O     1 
HETATM 8668 O  O     . HOH N 6 .   ? 157.437 -26.155 97.375  1.00 20.47 ? 1027 HOH B O     1 
HETATM 8669 O  O     . HOH N 6 .   ? 136.134 -16.194 92.108  1.00 19.12 ? 1028 HOH B O     1 
HETATM 8670 O  O     . HOH N 6 .   ? 146.304 -9.982  104.600 1.00 19.74 ? 1029 HOH B O     1 
HETATM 8671 O  O     . HOH N 6 .   ? 155.343 -25.672 93.518  1.00 18.67 ? 1030 HOH B O     1 
HETATM 8672 O  O     . HOH N 6 .   ? 158.597 -30.283 94.098  1.00 27.01 ? 1031 HOH B O     1 
HETATM 8673 O  O     . HOH N 6 .   ? 137.534 -34.627 90.441  1.00 29.91 ? 1032 HOH B O     1 
HETATM 8674 O  O     . HOH N 6 .   ? 158.067 7.004   94.718  1.00 30.73 ? 1033 HOH B O     1 
HETATM 8675 O  O     . HOH N 6 .   ? 139.147 -49.662 95.109  1.00 29.52 ? 1034 HOH B O     1 
HETATM 8676 O  O     . HOH N 6 .   ? 149.346 -31.561 91.160  1.00 27.99 ? 1035 HOH B O     1 
HETATM 8677 O  O     . HOH N 6 .   ? 157.348 -44.713 123.505 1.00 27.31 ? 1036 HOH B O     1 
HETATM 8678 O  O     . HOH N 6 .   ? 151.526 -38.018 100.082 1.00 27.93 ? 1037 HOH B O     1 
HETATM 8679 O  O     . HOH N 6 .   ? 110.192 -46.442 105.212 1.00 29.70 ? 1038 HOH B O     1 
HETATM 8680 O  O     . HOH N 6 .   ? 159.925 -44.676 113.642 1.00 22.79 ? 1039 HOH B O     1 
HETATM 8681 O  O     . HOH N 6 .   ? 145.404 -35.473 83.282  1.00 26.60 ? 1040 HOH B O     1 
HETATM 8682 O  O     . HOH N 6 .   ? 132.033 -51.113 109.651 1.00 29.20 ? 1041 HOH B O     1 
HETATM 8683 O  O     . HOH N 6 .   ? 164.313 -8.899  104.247 1.00 24.11 ? 1042 HOH B O     1 
HETATM 8684 O  O     . HOH N 6 .   ? 147.111 -13.257 112.795 1.00 28.03 ? 1043 HOH B O     1 
HETATM 8685 O  O     . HOH N 6 .   ? 147.500 -36.082 113.354 1.00 29.81 ? 1044 HOH B O     1 
HETATM 8686 O  O     . HOH N 6 .   ? 133.924 -31.566 89.040  1.00 27.42 ? 1045 HOH B O     1 
HETATM 8687 O  O     . HOH N 6 .   ? 164.840 -10.526 102.462 1.00 25.83 ? 1046 HOH B O     1 
HETATM 8688 O  O     . HOH N 6 .   ? 153.762 -45.593 101.259 1.00 27.75 ? 1047 HOH B O     1 
HETATM 8689 O  O     . HOH N 6 .   ? 149.271 -30.298 96.720  1.00 30.92 ? 1048 HOH B O     1 
HETATM 8690 O  O     . HOH N 6 .   ? 164.792 -17.640 113.505 1.00 25.21 ? 1049 HOH B O     1 
HETATM 8691 O  O     . HOH N 6 .   ? 155.982 -29.744 95.228  1.00 32.19 ? 1050 HOH B O     1 
HETATM 8692 O  O     . HOH N 6 .   ? 165.347 -4.034  89.831  1.00 22.64 ? 1051 HOH B O     1 
HETATM 8693 O  O     . HOH N 6 .   ? 122.195 -45.574 88.154  1.00 23.90 ? 1052 HOH B O     1 
HETATM 8694 O  O     . HOH N 6 .   ? 159.703 -11.860 109.413 1.00 22.56 ? 1053 HOH B O     1 
HETATM 8695 O  O     . HOH N 6 .   ? 137.868 -22.934 76.711  1.00 25.74 ? 1054 HOH B O     1 
HETATM 8696 O  O     . HOH N 6 .   ? 178.719 -24.867 94.568  1.00 32.45 ? 1055 HOH B O     1 
HETATM 8697 O  O     . HOH N 6 .   ? 174.283 -34.426 123.196 1.00 28.32 ? 1056 HOH B O     1 
HETATM 8698 O  O     . HOH N 6 .   ? 122.538 -25.686 86.787  1.00 35.72 ? 1057 HOH B O     1 
HETATM 8699 O  O     . HOH N 6 .   ? 169.713 -11.837 98.387  1.00 29.69 ? 1058 HOH B O     1 
HETATM 8700 O  O     . HOH N 6 .   ? 170.318 -21.375 111.986 1.00 28.38 ? 1059 HOH B O     1 
HETATM 8701 O  O     . HOH N 6 .   ? 179.570 -27.029 101.005 1.00 28.78 ? 1060 HOH B O     1 
HETATM 8702 O  O     . HOH N 6 .   ? 158.410 7.547   91.535  1.00 25.05 ? 1061 HOH B O     1 
HETATM 8703 O  O     . HOH N 6 .   ? 133.082 -33.556 105.956 1.00 25.22 ? 1062 HOH B O     1 
HETATM 8704 O  O     . HOH N 6 .   ? 126.905 -36.413 88.204  1.00 33.70 ? 1063 HOH B O     1 
HETATM 8705 O  O     . HOH N 6 .   ? 125.723 -13.191 82.337  1.00 29.74 ? 1064 HOH B O     1 
HETATM 8706 O  O     . HOH N 6 .   ? 168.505 -36.670 106.075 1.00 27.67 ? 1065 HOH B O     1 
HETATM 8707 O  O     . HOH N 6 .   ? 136.298 -49.331 95.537  1.00 29.75 ? 1066 HOH B O     1 
HETATM 8708 O  O     . HOH N 6 .   ? 159.675 -44.801 105.649 1.00 27.44 ? 1067 HOH B O     1 
HETATM 8709 O  O     . HOH N 6 .   ? 133.845 -40.455 91.984  1.00 29.35 ? 1068 HOH B O     1 
HETATM 8710 O  O     . HOH N 6 .   ? 136.246 -37.312 110.056 1.00 26.30 ? 1069 HOH B O     1 
HETATM 8711 O  O     . HOH N 6 .   ? 153.522 -32.991 100.079 1.00 28.24 ? 1070 HOH B O     1 
HETATM 8712 O  O     . HOH N 6 .   ? 123.765 -25.546 110.084 1.00 27.02 ? 1071 HOH B O     1 
HETATM 8713 O  O     . HOH N 6 .   ? 178.296 -18.155 103.947 1.00 29.94 ? 1072 HOH B O     1 
HETATM 8714 O  O     . HOH N 6 .   ? 178.303 -39.790 104.975 1.00 36.92 ? 1073 HOH B O     1 
HETATM 8715 O  O     . HOH N 6 .   ? 169.743 -24.071 82.346  1.00 31.84 ? 1074 HOH B O     1 
HETATM 8716 O  O     . HOH N 6 .   ? 139.190 -13.472 93.775  1.00 27.49 ? 1075 HOH B O     1 
HETATM 8717 O  O     . HOH N 6 .   ? 143.161 -36.432 97.884  1.00 28.68 ? 1076 HOH B O     1 
HETATM 8718 O  O     . HOH N 6 .   ? 157.706 -18.371 114.029 1.00 23.25 ? 1077 HOH B O     1 
HETATM 8719 O  O     . HOH N 6 .   ? 130.380 -49.297 89.687  1.00 29.41 ? 1078 HOH B O     1 
HETATM 8720 O  O     . HOH N 6 .   ? 128.421 -38.003 107.827 1.00 23.46 ? 1079 HOH B O     1 
HETATM 8721 O  O     . HOH N 6 .   ? 164.832 1.191   99.074  1.00 27.48 ? 1080 HOH B O     1 
HETATM 8722 O  O     . HOH N 6 .   ? 145.704 -31.125 98.215  1.00 29.02 ? 1081 HOH B O     1 
HETATM 8723 O  O     . HOH N 6 .   ? 134.808 -30.328 78.565  1.00 33.72 ? 1082 HOH B O     1 
HETATM 8724 O  O     . HOH N 6 .   ? 118.935 -21.652 96.192  1.00 38.36 ? 1083 HOH B O     1 
HETATM 8725 O  O     . HOH N 6 .   ? 127.572 -50.727 90.713  1.00 30.17 ? 1084 HOH B O     1 
HETATM 8726 O  O     . HOH N 6 .   ? 121.104 -21.654 100.995 1.00 28.38 ? 1085 HOH B O     1 
HETATM 8727 O  O     . HOH N 6 .   ? 176.080 -32.088 90.624  1.00 32.27 ? 1086 HOH B O     1 
HETATM 8728 O  O     . HOH N 6 .   ? 116.636 -38.646 107.907 1.00 32.86 ? 1087 HOH B O     1 
HETATM 8729 O  O     . HOH N 6 .   ? 181.411 -27.571 102.886 1.00 32.70 ? 1088 HOH B O     1 
HETATM 8730 O  O     . HOH N 6 .   ? 170.541 -38.789 109.993 1.00 24.38 ? 1089 HOH B O     1 
HETATM 8731 O  O     . HOH N 6 .   ? 172.642 -22.907 112.303 1.00 33.13 ? 1090 HOH B O     1 
HETATM 8732 O  O     . HOH N 6 .   ? 141.136 -32.870 97.882  1.00 26.11 ? 1091 HOH B O     1 
HETATM 8733 O  O     . HOH N 6 .   ? 157.274 -44.668 112.060 1.00 23.59 ? 1092 HOH B O     1 
HETATM 8734 O  O     . HOH N 6 .   ? 175.158 -8.865  82.054  1.00 29.28 ? 1093 HOH B O     1 
HETATM 8735 O  O     . HOH N 6 .   ? 165.933 -40.123 103.330 1.00 36.70 ? 1094 HOH B O     1 
HETATM 8736 O  O     . HOH N 6 .   ? 160.422 -25.704 80.637  1.00 33.69 ? 1095 HOH B O     1 
HETATM 8737 O  O     . HOH N 6 .   ? 140.855 -30.018 75.700  1.00 30.72 ? 1096 HOH B O     1 
HETATM 8738 O  O     . HOH N 6 .   ? 164.395 -28.735 105.390 1.00 28.49 ? 1097 HOH B O     1 
HETATM 8739 O  O     . HOH N 6 .   ? 124.122 -26.013 83.726  1.00 29.31 ? 1098 HOH B O     1 
HETATM 8740 O  O     . HOH N 6 .   ? 152.873 -32.461 121.267 1.00 29.14 ? 1099 HOH B O     1 
HETATM 8741 O  O     . HOH N 6 .   ? 180.190 -32.085 96.697  1.00 28.59 ? 1100 HOH B O     1 
HETATM 8742 O  O     . HOH N 6 .   ? 117.770 -51.691 107.036 1.00 33.00 ? 1101 HOH B O     1 
HETATM 8743 O  O     . HOH N 6 .   ? 129.430 -37.962 89.565  1.00 29.41 ? 1102 HOH B O     1 
HETATM 8744 O  O     . HOH N 6 .   ? 139.531 -13.573 79.547  1.00 29.93 ? 1103 HOH B O     1 
HETATM 8745 O  O     . HOH N 6 .   ? 155.304 -35.533 121.244 1.00 25.15 ? 1104 HOH B O     1 
HETATM 8746 O  O     . HOH N 6 .   ? 132.972 -50.097 111.627 1.00 31.94 ? 1105 HOH B O     1 
HETATM 8747 O  O     . HOH N 6 .   ? 133.126 -34.437 111.665 1.00 33.04 ? 1106 HOH B O     1 
HETATM 8748 O  O     . HOH N 6 .   ? 167.891 -17.089 113.040 1.00 27.46 ? 1107 HOH B O     1 
HETATM 8749 O  O     . HOH N 6 .   ? 118.611 -44.397 115.224 1.00 32.17 ? 1108 HOH B O     1 
HETATM 8750 O  O     . HOH N 6 .   ? 177.617 -21.875 94.080  1.00 28.66 ? 1109 HOH B O     1 
HETATM 8751 O  O     . HOH N 6 .   ? 126.281 -50.986 95.227  1.00 33.82 ? 1110 HOH B O     1 
HETATM 8752 O  O     . HOH N 6 .   ? 157.446 -32.800 99.771  1.00 28.19 ? 1111 HOH B O     1 
HETATM 8753 O  O     . HOH N 6 .   ? 139.413 -34.945 88.787  1.00 25.88 ? 1112 HOH B O     1 
HETATM 8754 O  O     . HOH N 6 .   ? 120.104 -30.776 106.123 1.00 34.92 ? 1113 HOH B O     1 
HETATM 8755 O  O     . HOH N 6 .   ? 161.114 -34.404 89.267  1.00 30.58 ? 1114 HOH B O     1 
HETATM 8756 O  O     . HOH N 6 .   ? 120.877 -26.448 97.197  1.00 25.27 ? 1115 HOH B O     1 
HETATM 8757 O  O     . HOH N 6 .   ? 119.442 -22.820 99.140  1.00 38.42 ? 1116 HOH B O     1 
HETATM 8758 O  O     . HOH N 6 .   ? 124.306 -10.837 87.131  1.00 30.41 ? 1117 HOH B O     1 
HETATM 8759 O  O     . HOH N 6 .   ? 164.048 5.398   91.245  1.00 29.32 ? 1118 HOH B O     1 
HETATM 8760 O  O     . HOH N 6 .   ? 141.986 -13.887 76.640  1.00 32.66 ? 1119 HOH B O     1 
HETATM 8761 O  O     . HOH N 6 .   ? 115.380 -34.059 103.849 1.00 34.08 ? 1120 HOH B O     1 
HETATM 8762 O  O     . HOH N 6 .   ? 122.821 -53.539 96.300  1.00 34.56 ? 1121 HOH B O     1 
HETATM 8763 O  O     . HOH N 6 .   ? 149.074 -37.476 118.521 1.00 25.12 ? 1122 HOH B O     1 
HETATM 8764 O  O     . HOH N 6 .   ? 132.165 -34.314 90.055  1.00 31.75 ? 1123 HOH B O     1 
HETATM 8765 O  O     . HOH N 6 .   ? 151.484 -5.927  111.980 1.00 29.66 ? 1124 HOH B O     1 
HETATM 8766 O  O     . HOH N 6 .   ? 179.005 -19.897 94.611  1.00 30.13 ? 1125 HOH B O     1 
HETATM 8767 O  O     . HOH N 6 .   ? 116.064 -49.599 112.579 1.00 36.18 ? 1126 HOH B O     1 
HETATM 8768 O  O     . HOH N 6 .   ? 144.650 -45.288 103.287 1.00 26.88 ? 1127 HOH B O     1 
HETATM 8769 O  O     . HOH N 6 .   ? 162.955 -25.816 81.133  1.00 31.33 ? 1128 HOH B O     1 
HETATM 8770 O  O     . HOH N 6 .   ? 137.012 -38.955 94.197  1.00 31.04 ? 1129 HOH B O     1 
HETATM 8771 O  O     . HOH N 6 .   ? 133.246 -27.678 76.747  1.00 25.12 ? 1130 HOH B O     1 
HETATM 8772 O  O     . HOH N 6 .   ? 133.285 -29.566 108.029 1.00 25.57 ? 1131 HOH B O     1 
HETATM 8773 O  O     . HOH N 6 .   ? 176.107 -29.267 112.232 1.00 26.83 ? 1132 HOH B O     1 
HETATM 8774 O  O     . HOH N 6 .   ? 155.627 -32.486 89.880  1.00 29.73 ? 1133 HOH B O     1 
HETATM 8775 O  O     . HOH N 6 .   ? 138.438 -12.524 90.475  1.00 29.49 ? 1134 HOH B O     1 
HETATM 8776 O  O     . HOH N 6 .   ? 141.261 -11.132 96.431  1.00 25.27 ? 1135 HOH B O     1 
HETATM 8777 O  O     . HOH N 6 .   ? 163.452 -8.500  106.933 1.00 29.06 ? 1136 HOH B O     1 
HETATM 8778 O  O     . HOH N 6 .   ? 154.676 -30.893 97.915  1.00 33.27 ? 1137 HOH B O     1 
HETATM 8779 O  O     . HOH N 6 .   ? 131.804 -51.128 91.298  1.00 33.16 ? 1138 HOH B O     1 
HETATM 8780 O  O     . HOH N 6 .   ? 129.527 -27.848 77.031  1.00 29.30 ? 1139 HOH B O     1 
HETATM 8781 O  O     . HOH N 6 .   ? 138.584 -10.944 87.654  1.00 29.16 ? 1140 HOH B O     1 
HETATM 8782 O  O     . HOH N 6 .   ? 157.425 5.531   89.479  1.00 29.37 ? 1141 HOH B O     1 
HETATM 8783 O  O     . HOH N 6 .   ? 142.068 -46.347 103.124 1.00 30.58 ? 1142 HOH B O     1 
HETATM 8784 O  O     . HOH N 6 .   ? 154.957 -44.353 119.256 1.00 26.41 ? 1143 HOH B O     1 
HETATM 8785 O  O     . HOH N 6 .   ? 119.590 -17.977 98.278  1.00 29.84 ? 1144 HOH B O     1 
HETATM 8786 O  O     . HOH N 6 .   ? 162.220 -14.881 109.673 1.00 37.00 ? 1145 HOH B O     1 
HETATM 8787 O  O     . HOH N 6 .   ? 155.305 -17.640 112.833 1.00 30.58 ? 1146 HOH B O     1 
HETATM 8788 O  O     . HOH N 6 .   ? 147.777 -32.086 100.083 1.00 33.04 ? 1147 HOH B O     1 
HETATM 8789 O  O     . HOH N 6 .   ? 113.820 -42.434 108.398 1.00 31.51 ? 1148 HOH B O     1 
HETATM 8790 O  O     . HOH N 6 .   ? 117.971 -51.386 104.301 1.00 31.58 ? 1149 HOH B O     1 
HETATM 8791 O  O     . HOH N 6 .   ? 155.233 6.812   91.504  1.00 29.82 ? 1150 HOH B O     1 
HETATM 8792 O  O     . HOH N 6 .   ? 111.993 -39.327 99.491  1.00 34.65 ? 1151 HOH B O     1 
HETATM 8793 O  O     . HOH N 6 .   ? 127.221 -52.135 92.846  1.00 35.71 ? 1152 HOH B O     1 
HETATM 8794 O  O     . HOH N 6 .   ? 121.765 -25.561 82.555  1.00 33.88 ? 1153 HOH B O     1 
HETATM 8795 O  O     . HOH N 6 .   ? 121.870 -52.561 99.286  1.00 28.80 ? 1154 HOH B O     1 
HETATM 8796 O  O     . HOH N 6 .   ? 175.501 -11.858 79.312  1.00 28.59 ? 1155 HOH B O     1 
HETATM 8797 O  O     . HOH N 6 .   ? 171.502 -23.717 114.871 1.00 30.75 ? 1156 HOH B O     1 
HETATM 8798 O  O     . HOH N 6 .   ? 142.800 -10.685 92.567  1.00 22.29 ? 1157 HOH B O     1 
HETATM 8799 O  O     . HOH N 6 .   ? 159.405 -30.215 84.381  1.00 35.20 ? 1158 HOH B O     1 
HETATM 8800 O  O     . HOH N 6 .   ? 146.641 -11.205 114.436 1.00 40.05 ? 1159 HOH B O     1 
HETATM 8801 O  O     . HOH N 6 .   ? 167.251 -25.318 82.458  1.00 31.80 ? 1160 HOH B O     1 
HETATM 8802 O  O     . HOH N 6 .   ? 172.280 -17.813 111.980 1.00 30.99 ? 1161 HOH B O     1 
HETATM 8803 O  O     . HOH N 6 .   ? 123.555 -26.122 89.465  1.00 36.20 ? 1162 HOH B O     1 
HETATM 8804 O  O     . HOH N 6 .   ? 178.354 -30.277 109.628 1.00 27.25 ? 1163 HOH B O     1 
HETATM 8805 O  O     . HOH N 6 .   ? 124.932 -32.867 107.215 1.00 32.15 ? 1164 HOH B O     1 
HETATM 8806 O  O     . HOH N 6 .   ? 128.030 -39.510 88.626  1.00 30.51 ? 1165 HOH B O     1 
HETATM 8807 O  O     . HOH N 6 .   ? 177.358 -17.080 82.529  1.00 33.19 ? 1166 HOH B O     1 
HETATM 8808 O  O     . HOH N 6 .   ? 121.434 -34.800 88.707  1.00 33.50 ? 1167 HOH B O     1 
HETATM 8809 O  O     . HOH N 6 .   ? 166.405 -20.332 80.265  1.00 37.47 ? 1168 HOH B O     1 
HETATM 8810 O  O     . HOH N 6 .   ? 126.124 -38.827 106.878 1.00 27.72 ? 1169 HOH B O     1 
HETATM 8811 O  O     . HOH N 6 .   ? 162.010 -27.979 121.606 1.00 27.22 ? 1170 HOH B O     1 
HETATM 8812 O  O     . HOH N 6 .   ? 143.441 -43.989 96.233  1.00 33.27 ? 1171 HOH B O     1 
HETATM 8813 O  O     . HOH N 6 .   ? 140.013 -34.491 76.314  1.00 35.66 ? 1172 HOH B O     1 
HETATM 8814 O  O     . HOH N 6 .   ? 137.335 -37.354 81.863  1.00 33.09 ? 1173 HOH B O     1 
HETATM 8815 O  O     . HOH N 6 .   ? 162.102 -40.475 124.652 1.00 29.76 ? 1174 HOH B O     1 
HETATM 8816 O  O     . HOH N 6 .   ? 180.857 -35.030 109.488 1.00 39.78 ? 1175 HOH B O     1 
HETATM 8817 O  O     . HOH N 6 .   ? 139.763 -38.244 84.373  1.00 38.33 ? 1176 HOH B O     1 
HETATM 8818 O  O     . HOH N 6 .   ? 170.104 -18.670 113.647 1.00 34.84 ? 1177 HOH B O     1 
HETATM 8819 O  O     . HOH N 6 .   ? 168.850 -32.989 99.267  1.00 30.08 ? 1178 HOH B O     1 
HETATM 8820 O  O     . HOH N 6 .   ? 110.530 -43.486 104.982 1.00 37.18 ? 1179 HOH B O     1 
HETATM 8821 O  O     . HOH N 6 .   ? 144.026 -32.822 98.004  1.00 35.89 ? 1180 HOH B O     1 
HETATM 8822 O  O     . HOH N 6 .   ? 169.268 -33.509 85.061  1.00 41.49 ? 1181 HOH B O     1 
HETATM 8823 O  O     . HOH N 6 .   ? 154.874 -32.858 102.380 1.00 27.18 ? 1182 HOH B O     1 
HETATM 8824 O  O     . HOH N 6 .   ? 150.148 -9.506  111.391 1.00 33.35 ? 1183 HOH B O     1 
HETATM 8825 O  O     . HOH N 6 .   ? 163.474 -3.651  87.869  1.00 39.26 ? 1184 HOH B O     1 
HETATM 8826 O  O     . HOH N 6 .   ? 180.326 -28.880 108.082 1.00 39.16 ? 1185 HOH B O     1 
HETATM 8827 O  O     . HOH N 6 .   ? 133.908 -15.308 76.262  1.00 32.49 ? 1186 HOH B O     1 
HETATM 8828 O  O     . HOH N 6 .   ? 176.918 -25.273 90.219  1.00 35.47 ? 1187 HOH B O     1 
HETATM 8829 O  O     . HOH N 6 .   ? 153.080 -7.539  110.120 1.00 31.47 ? 1188 HOH B O     1 
HETATM 8830 O  O     . HOH N 6 .   ? 168.140 -35.912 123.532 1.00 32.11 ? 1189 HOH B O     1 
HETATM 8831 O  O     . HOH N 6 .   ? 144.759 -35.764 113.736 1.00 29.10 ? 1190 HOH B O     1 
HETATM 8832 O  O     . HOH N 6 .   ? 177.603 -15.258 79.171  1.00 33.36 ? 1191 HOH B O     1 
HETATM 8833 O  O     . HOH N 6 .   ? 170.394 -38.082 97.621  1.00 33.76 ? 1192 HOH B O     1 
HETATM 8834 O  O     . HOH N 6 .   ? 153.964 -19.526 74.598  1.00 35.56 ? 1193 HOH B O     1 
HETATM 8835 O  O     . HOH N 6 .   ? 177.881 -23.902 92.266  1.00 34.54 ? 1194 HOH B O     1 
HETATM 8836 O  O     . HOH N 6 .   ? 135.974 -51.122 104.456 1.00 34.11 ? 1195 HOH B O     1 
HETATM 8837 O  O     . HOH N 6 .   ? 159.981 -24.625 78.263  1.00 38.34 ? 1196 HOH B O     1 
HETATM 8838 O  O     . HOH N 6 .   ? 159.153 -46.574 116.584 1.00 26.20 ? 1197 HOH B O     1 
HETATM 8839 O  O     . HOH N 6 .   ? 136.622 -16.318 75.169  1.00 32.00 ? 1198 HOH B O     1 
HETATM 8840 O  O     . HOH N 6 .   ? 129.965 -33.271 89.193  1.00 32.50 ? 1199 HOH B O     1 
HETATM 8841 O  O     . HOH N 6 .   ? 144.600 -37.987 84.717  1.00 37.50 ? 1200 HOH B O     1 
HETATM 8842 O  O     . HOH N 6 .   ? 122.178 -22.376 74.873  1.00 34.89 ? 1201 HOH B O     1 
HETATM 8843 O  O     . HOH N 6 .   ? 169.037 -21.667 80.597  1.00 36.51 ? 1202 HOH B O     1 
HETATM 8844 O  O     . HOH N 6 .   ? 144.513 -12.085 74.739  1.00 33.50 ? 1203 HOH B O     1 
HETATM 8845 O  O     . HOH N 6 .   ? 130.995 -32.298 85.126  1.00 34.75 ? 1204 HOH B O     1 
HETATM 8846 O  O     . HOH N 6 .   ? 129.675 -13.950 75.837  1.00 23.58 ? 1205 HOH B O     1 
HETATM 8847 O  O     . HOH N 6 .   ? 136.079 -28.039 112.073 1.00 26.34 ? 1206 HOH B O     1 
HETATM 8848 O  O     . HOH N 6 .   ? 125.287 -28.882 87.451  1.00 32.55 ? 1207 HOH B O     1 
HETATM 8849 O  O     . HOH N 6 .   ? 122.868 -41.854 85.887  1.00 24.23 ? 1208 HOH B O     1 
HETATM 8850 O  O     . HOH N 6 .   ? 150.136 -36.002 116.628 1.00 27.23 ? 1209 HOH B O     1 
HETATM 8851 O  O     . HOH N 6 .   ? 180.178 -32.840 116.391 1.00 30.05 ? 1210 HOH B O     1 
HETATM 8852 O  O     . HOH N 6 .   ? 152.526 -43.369 119.238 1.00 30.20 ? 1211 HOH B O     1 
HETATM 8853 O  O     . HOH N 6 .   ? 167.840 -33.969 105.767 1.00 29.79 ? 1212 HOH B O     1 
HETATM 8854 O  O     . HOH N 6 .   ? 125.364 -53.988 92.283  1.00 35.19 ? 1213 HOH B O     1 
HETATM 8855 O  O     . HOH N 6 .   ? 142.962 -13.974 74.303  1.00 35.61 ? 1214 HOH B O     1 
HETATM 8856 O  O     . HOH N 6 .   ? 157.651 -32.018 91.679  1.00 34.42 ? 1215 HOH B O     1 
HETATM 8857 O  O     . HOH N 6 .   ? 150.609 -32.217 98.279  1.00 33.21 ? 1216 HOH B O     1 
HETATM 8858 O  O     . HOH N 6 .   ? 121.576 -24.596 76.909  1.00 34.97 ? 1217 HOH B O     1 
HETATM 8859 O  O     . HOH N 6 .   ? 180.060 -21.047 82.408  1.00 36.67 ? 1218 HOH B O     1 
HETATM 8860 O  O     . HOH N 6 .   ? 153.896 -46.210 112.893 1.00 33.73 ? 1219 HOH B O     1 
HETATM 8861 O  O     . HOH N 6 .   ? 127.164 -30.700 87.333  1.00 35.37 ? 1220 HOH B O     1 
HETATM 8862 O  O     . HOH N 6 .   ? 130.312 -30.238 83.703  1.00 32.75 ? 1221 HOH B O     1 
HETATM 8863 O  O     . HOH N 6 .   ? 175.766 -9.287  79.346  1.00 35.60 ? 1222 HOH B O     1 
HETATM 8864 O  O     . HOH N 6 .   ? 126.696 -35.409 108.171 1.00 34.45 ? 1223 HOH B O     1 
HETATM 8865 O  O     . HOH N 6 .   ? 150.567 -13.501 77.380  1.00 33.02 ? 1224 HOH B O     1 
HETATM 8866 O  O     . HOH N 6 .   ? 179.321 -14.590 98.121  1.00 32.98 ? 1225 HOH B O     1 
HETATM 8867 O  O     . HOH N 6 .   ? 176.473 -29.661 89.987  1.00 34.31 ? 1226 HOH B O     1 
HETATM 8868 O  O     . HOH N 6 .   ? 177.758 -20.563 81.195  1.00 31.52 ? 1227 HOH B O     1 
HETATM 8869 O  O     . HOH N 6 .   ? 180.219 -26.755 96.232  1.00 32.79 ? 1228 HOH B O     1 
HETATM 8870 O  O     . HOH N 6 .   ? 127.140 -56.687 108.548 1.00 42.57 ? 1229 HOH B O     1 
HETATM 8871 O  O     . HOH N 6 .   ? 131.260 -47.521 115.162 1.00 35.01 ? 1230 HOH B O     1 
HETATM 8872 O  O     . HOH N 6 .   ? 145.302 -45.758 94.107  1.00 37.84 ? 1231 HOH B O     1 
HETATM 8873 O  O     . HOH N 6 .   ? 166.887 -38.644 105.628 1.00 33.34 ? 1232 HOH B O     1 
HETATM 8874 O  O     . HOH N 6 .   ? 147.235 -32.768 92.790  1.00 39.30 ? 1233 HOH B O     1 
HETATM 8875 O  O     . HOH N 6 .   ? 157.125 -47.049 124.803 1.00 31.54 ? 1234 HOH B O     1 
HETATM 8876 O  O     . HOH N 6 .   ? 175.176 -16.227 104.439 1.00 37.26 ? 1235 HOH B O     1 
HETATM 8877 O  O     . HOH N 6 .   ? 162.247 -39.629 101.468 1.00 33.11 ? 1236 HOH B O     1 
HETATM 8878 O  O     . HOH N 6 .   ? 147.311 -39.779 74.063  1.00 35.90 ? 1237 HOH B O     1 
HETATM 8879 O  O     . HOH N 6 .   ? 139.768 -34.915 92.650  1.00 28.57 ? 1238 HOH B O     1 
HETATM 8880 O  O     . HOH N 6 .   ? 124.308 -30.478 105.128 1.00 36.67 ? 1239 HOH B O     1 
HETATM 8881 O  O     . HOH N 6 .   ? 146.717 -10.988 100.813 1.00 8.92  ? 1240 HOH B O     1 
HETATM 8882 O  O     . HOH N 6 .   ? 161.116 1.651   96.275  1.00 9.30  ? 1241 HOH B O     1 
HETATM 8883 O  O     . HOH N 6 .   ? 151.074 -46.288 121.078 1.00 30.81 ? 1242 HOH B O     1 
HETATM 8884 O  O     . HOH N 6 .   ? 145.955 -29.361 118.378 1.00 19.66 ? 1243 HOH B O     1 
HETATM 8885 O  O     . HOH N 6 .   ? 126.495 -42.379 85.391  1.00 34.02 ? 1244 HOH B O     1 
HETATM 8886 O  O     . HOH N 6 .   ? 175.684 -19.183 81.890  1.00 27.11 ? 1245 HOH B O     1 
HETATM 8887 O  O     . HOH N 6 .   ? 155.489 -31.964 122.101 1.00 29.85 ? 1246 HOH B O     1 
HETATM 8888 O  O     . HOH N 6 .   ? 173.818 -18.335 80.052  1.00 29.53 ? 1247 HOH B O     1 
HETATM 8889 O  O     . HOH N 6 .   ? 156.071 -10.684 111.458 1.00 24.96 ? 1248 HOH B O     1 
HETATM 8890 O  O     . HOH N 6 .   ? 156.799 -30.225 100.296 1.00 25.58 ? 1249 HOH B O     1 
HETATM 8891 O  O     . HOH N 6 .   ? 147.389 -46.093 106.150 1.00 31.52 ? 1250 HOH B O     1 
HETATM 8892 O  O     . HOH N 6 .   ? 164.798 -2.525  92.207  1.00 32.12 ? 1251 HOH B O     1 
HETATM 8893 O  O     . HOH N 6 .   ? 146.382 -30.679 93.266  1.00 28.26 ? 1252 HOH B O     1 
HETATM 8894 O  O     . HOH N 6 .   ? 125.023 -23.895 76.894  1.00 27.90 ? 1253 HOH B O     1 
HETATM 8895 O  O     . HOH N 6 .   ? 125.963 -30.682 107.072 1.00 29.95 ? 1254 HOH B O     1 
HETATM 8896 O  O     . HOH N 6 .   ? 141.472 -13.104 95.032  1.00 29.20 ? 1255 HOH B O     1 
HETATM 8897 O  O     . HOH N 6 .   ? 147.151 -24.229 113.337 1.00 29.62 ? 1256 HOH B O     1 
HETATM 8898 O  O     . HOH N 6 .   ? 153.453 -13.245 111.670 1.00 26.90 ? 1257 HOH B O     1 
HETATM 8899 O  O     . HOH N 6 .   ? 163.837 2.978   94.914  1.00 34.84 ? 1258 HOH B O     1 
HETATM 8900 O  O     . HOH N 6 .   ? 187.560 4.509   97.922  1.00 30.80 ? 1259 HOH B O     1 
HETATM 8901 O  O     . HOH N 6 .   ? 142.955 -26.109 72.048  1.00 32.77 ? 1260 HOH B O     1 
HETATM 8902 O  O     . HOH N 6 .   ? 167.632 -13.193 102.863 1.00 32.22 ? 1261 HOH B O     1 
HETATM 8903 O  O     . HOH N 6 .   ? 121.946 -52.248 108.044 1.00 38.29 ? 1262 HOH B O     1 
HETATM 8904 O  O     . HOH N 6 .   ? 174.733 -41.382 114.420 1.00 33.33 ? 1263 HOH B O     1 
HETATM 8905 O  O     . HOH N 6 .   ? 167.665 0.904   98.923  1.00 38.13 ? 1264 HOH B O     1 
HETATM 8906 O  O     . HOH N 6 .   ? 134.638 -49.804 93.178  1.00 37.29 ? 1265 HOH B O     1 
HETATM 8907 O  O     . HOH N 6 .   ? 136.553 -33.699 108.585 1.00 33.23 ? 1266 HOH B O     1 
HETATM 8908 O  O     . HOH N 6 .   ? 168.307 -36.632 96.286  1.00 37.35 ? 1267 HOH B O     1 
HETATM 8909 O  O     . HOH N 6 .   ? 128.407 -42.020 87.350  1.00 33.05 ? 1268 HOH B O     1 
HETATM 8910 O  O     . HOH N 6 .   ? 154.883 -8.829  111.307 1.00 29.98 ? 1269 HOH B O     1 
HETATM 8911 O  O     . HOH N 6 .   ? 180.663 -21.537 96.865  1.00 33.97 ? 1270 HOH B O     1 
HETATM 8912 O  O     . HOH N 6 .   ? 164.008 -6.900  82.345  1.00 39.88 ? 1271 HOH B O     1 
HETATM 8913 O  O     . HOH N 6 .   ? 155.204 -16.094 73.361  1.00 36.00 ? 1272 HOH B O     1 
HETATM 8914 O  O     . HOH N 6 .   ? 117.947 -16.005 82.507  1.00 48.61 ? 1273 HOH B O     1 
HETATM 8915 O  O     . HOH N 6 .   ? 136.529 -15.385 94.160  1.00 29.18 ? 1274 HOH B O     1 
HETATM 8916 O  O     . HOH N 6 .   ? 150.922 -20.861 70.312  1.00 31.94 ? 1275 HOH B O     1 
HETATM 8917 O  O     . HOH N 6 .   ? 165.387 -3.516  94.513  1.00 31.34 ? 1276 HOH B O     1 
HETATM 8918 O  O     . HOH N 6 .   ? 181.564 -18.879 103.913 1.00 33.02 ? 1277 HOH B O     1 
HETATM 8919 O  O     . HOH N 6 .   ? 129.907 -34.972 111.252 1.00 34.08 ? 1278 HOH B O     1 
HETATM 8920 O  O     . HOH N 6 .   ? 153.973 -27.154 95.321  1.00 31.99 ? 1279 HOH B O     1 
HETATM 8921 O  O     . HOH N 6 .   ? 120.442 -16.061 81.525  1.00 50.97 ? 1280 HOH B O     1 
HETATM 8922 O  O     . HOH N 6 .   ? 118.316 -12.114 91.113  1.00 32.58 ? 1281 HOH B O     1 
HETATM 8923 O  O     . HOH N 6 .   ? 172.341 -40.596 110.226 1.00 32.51 ? 1282 HOH B O     1 
HETATM 8924 O  O     . HOH N 6 .   ? 167.900 -12.970 105.302 1.00 32.84 ? 1283 HOH B O     1 
HETATM 8925 O  O     . HOH N 6 .   ? 121.867 -53.039 105.821 1.00 40.20 ? 1284 HOH B O     1 
HETATM 8926 O  O     . HOH N 6 .   ? 151.482 -12.035 111.479 1.00 32.69 ? 1285 HOH B O     1 
HETATM 8927 O  O     . HOH N 6 .   ? 135.560 -42.701 110.007 1.00 30.49 ? 1286 HOH B O     1 
HETATM 8928 O  O     . HOH N 6 .   ? 169.595 -4.228  88.075  1.00 38.23 ? 1287 HOH B O     1 
HETATM 8929 O  O     . HOH N 6 .   ? 161.059 -3.777  86.000  1.00 35.00 ? 1288 HOH B O     1 
HETATM 8930 O  O     . HOH N 6 .   ? 166.330 -33.002 98.905  1.00 31.42 ? 1289 HOH B O     1 
HETATM 8931 O  O     . HOH N 6 .   ? 142.005 -48.489 105.535 1.00 37.91 ? 1290 HOH B O     1 
HETATM 8932 O  O     . HOH N 6 .   ? 170.257 -4.137  85.525  1.00 37.31 ? 1291 HOH B O     1 
HETATM 8933 O  O     . HOH N 6 .   ? 160.694 -6.580  84.816  1.00 30.61 ? 1292 HOH B O     1 
HETATM 8934 O  O     . HOH N 6 .   ? 179.512 -39.128 118.263 1.00 44.58 ? 1293 HOH B O     1 
HETATM 8935 O  O     . HOH N 6 .   ? 164.176 -10.775 108.534 1.00 34.47 ? 1294 HOH B O     1 
HETATM 8936 O  O     . HOH N 6 .   ? 127.358 -51.522 97.634  1.00 37.64 ? 1295 HOH B O     1 
HETATM 8937 O  O     . HOH N 6 .   ? 153.316 -4.197  112.846 1.00 38.75 ? 1296 HOH B O     1 
HETATM 8938 O  O     . HOH N 6 .   ? 159.957 -46.981 103.958 1.00 40.47 ? 1297 HOH B O     1 
HETATM 8939 O  O     . HOH N 6 .   ? 136.149 -46.937 88.143  1.00 43.06 ? 1298 HOH B O     1 
HETATM 8940 O  O     . HOH N 6 .   ? 120.148 -25.547 78.631  1.00 41.52 ? 1299 HOH B O     1 
HETATM 8941 O  O     . HOH N 6 .   ? 179.754 -22.603 89.744  1.00 35.94 ? 1300 HOH B O     1 
HETATM 8942 O  O     . HOH N 6 .   ? 149.591 -13.720 111.332 1.00 28.96 ? 1301 HOH B O     1 
HETATM 8943 O  O     . HOH N 6 .   ? 122.854 -31.258 103.608 1.00 33.15 ? 1302 HOH B O     1 
HETATM 8944 O  O     . HOH N 6 .   ? 133.698 -33.373 94.986  1.00 30.98 ? 1303 HOH B O     1 
HETATM 8945 O  O     . HOH N 6 .   ? 114.299 -39.779 109.285 1.00 41.40 ? 1304 HOH B O     1 
HETATM 8946 O  O     . HOH N 6 .   ? 158.569 -14.644 74.591  1.00 42.35 ? 1305 HOH B O     1 
HETATM 8947 O  O     . HOH N 6 .   ? 137.134 -30.135 77.353  1.00 37.12 ? 1306 HOH B O     1 
HETATM 8948 O  O     . HOH N 6 .   ? 145.310 -38.005 73.968  1.00 36.47 ? 1307 HOH B O     1 
HETATM 8949 O  O     . HOH N 6 .   ? 147.966 -37.597 99.277  1.00 34.22 ? 1308 HOH B O     1 
HETATM 8950 O  O     . HOH N 6 .   ? 192.913 5.661   91.100  1.00 35.39 ? 1309 HOH B O     1 
HETATM 8951 O  O     . HOH N 6 .   ? 131.154 -19.459 71.515  1.00 41.89 ? 1310 HOH B O     1 
HETATM 8952 O  O     . HOH N 6 .   ? 123.678 -47.421 89.580  1.00 34.18 ? 1311 HOH B O     1 
HETATM 8953 O  O     . HOH N 6 .   ? 121.810 -17.887 76.418  1.00 33.62 ? 1312 HOH B O     1 
HETATM 8954 O  O     . HOH N 6 .   ? 116.086 -44.778 116.171 1.00 38.44 ? 1313 HOH B O     1 
HETATM 8955 O  O     . HOH N 6 .   ? 117.820 -32.285 106.337 1.00 39.17 ? 1314 HOH B O     1 
HETATM 8956 O  O     . HOH N 6 .   ? 140.848 -32.716 74.528  1.00 43.51 ? 1315 HOH B O     1 
HETATM 8957 O  O     . HOH N 6 .   ? 117.334 -18.267 84.086  1.00 44.00 ? 1316 HOH B O     1 
HETATM 8958 O  O     . HOH N 6 .   ? 162.947 -22.504 76.045  1.00 41.44 ? 1317 HOH B O     1 
HETATM 8959 O  O     . HOH N 6 .   ? 127.713 -18.563 69.994  1.00 37.05 ? 1318 HOH B O     1 
HETATM 8960 O  O     . HOH N 6 .   ? 175.856 -15.417 102.048 1.00 41.81 ? 1319 HOH B O     1 
HETATM 8961 O  O     . HOH N 6 .   ? 176.211 -39.523 111.740 1.00 29.58 ? 1320 HOH B O     1 
HETATM 8962 O  O     . HOH N 6 .   ? 155.722 -11.236 78.337  1.00 37.47 ? 1321 HOH B O     1 
HETATM 8963 O  O     . HOH N 6 .   ? 125.091 -21.918 69.470  1.00 39.88 ? 1322 HOH B O     1 
HETATM 8964 O  O     . HOH N 6 .   ? 141.859 -35.772 90.082  1.00 32.81 ? 1323 HOH B O     1 
HETATM 8965 O  O     . HOH N 6 .   ? 144.542 -33.766 102.170 1.00 34.73 ? 1324 HOH B O     1 
HETATM 8966 O  O     . HOH N 6 .   ? 163.745 -27.945 82.360  1.00 36.18 ? 1325 HOH B O     1 
HETATM 8967 O  O     . HOH N 6 .   ? 151.681 -35.445 79.294  1.00 40.95 ? 1326 HOH B O     1 
HETATM 8968 O  O     . HOH N 6 .   ? 134.174 -33.400 79.837  1.00 39.63 ? 1327 HOH B O     1 
HETATM 8969 O  O     . HOH N 6 .   ? 151.389 -28.572 78.889  1.00 33.74 ? 1328 HOH B O     1 
HETATM 8970 O  O     . HOH N 6 .   ? 149.580 -30.547 94.025  1.00 35.87 ? 1329 HOH B O     1 
HETATM 8971 O  O     . HOH N 6 .   ? 163.553 -42.737 112.436 1.00 30.03 ? 1330 HOH B O     1 
HETATM 8972 O  O     . HOH N 6 .   ? 175.595 -27.431 120.386 1.00 40.71 ? 1331 HOH B O     1 
HETATM 8973 O  O     . HOH N 6 .   ? 121.774 -14.334 88.184  1.00 29.70 ? 1332 HOH B O     1 
HETATM 8974 O  O     . HOH N 6 .   ? 139.957 -30.216 97.732  1.00 25.86 ? 1333 HOH B O     1 
HETATM 8975 O  O     . HOH N 6 .   ? 140.732 -23.657 70.586  1.00 39.97 ? 1334 HOH B O     1 
HETATM 8976 O  O     . HOH N 6 .   ? 123.528 -15.623 89.927  1.00 23.92 ? 1335 HOH B O     1 
HETATM 8977 O  O     . HOH N 6 .   ? 148.064 -17.112 113.262 1.00 22.72 ? 1336 HOH B O     1 
HETATM 8978 O  O     . HOH N 6 .   ? 119.916 -25.983 100.700 1.00 34.36 ? 1337 HOH B O     1 
HETATM 8979 O  O     . HOH N 6 .   ? 159.482 -30.458 124.191 1.00 29.57 ? 1338 HOH B O     1 
HETATM 8980 O  O     . HOH N 6 .   ? 155.702 -15.253 111.467 1.00 34.19 ? 1339 HOH B O     1 
HETATM 8981 O  O     . HOH N 6 .   ? 118.684 -54.266 103.769 1.00 42.17 ? 1340 HOH B O     1 
HETATM 8982 O  O     . HOH N 6 .   ? 162.912 -13.714 73.619  1.00 37.71 ? 1341 HOH B O     1 
HETATM 8983 O  O     . HOH N 6 .   ? 120.339 -27.342 91.187  1.00 40.24 ? 1342 HOH B O     1 
HETATM 8984 O  O     . HOH N 6 .   ? 135.922 -52.165 92.504  1.00 42.19 ? 1343 HOH B O     1 
HETATM 8985 O  O     . HOH N 6 .   ? 144.705 -34.568 99.626  1.00 37.62 ? 1344 HOH B O     1 
HETATM 8986 O  O     . HOH N 6 .   ? 138.392 -22.830 71.887  1.00 40.17 ? 1345 HOH B O     1 
HETATM 8987 O  O     . HOH N 6 .   ? 180.767 -37.009 117.919 1.00 41.61 ? 1346 HOH B O     1 
HETATM 8988 O  O     . HOH N 6 .   ? 155.534 -12.332 76.255  1.00 40.12 ? 1347 HOH B O     1 
HETATM 8989 O  O     . HOH N 6 .   ? 114.999 -38.269 91.102  1.00 38.20 ? 1348 HOH B O     1 
HETATM 8990 O  O     . HOH N 6 .   ? 141.762 -28.141 71.111  1.00 41.46 ? 1349 HOH B O     1 
HETATM 8991 O  O     . HOH N 6 .   ? 139.301 -51.213 97.100  1.00 43.59 ? 1350 HOH B O     1 
HETATM 8992 O  O     . HOH N 6 .   ? 171.919 -25.209 118.022 1.00 37.59 ? 1351 HOH B O     1 
HETATM 8993 O  O     . HOH N 6 .   ? 178.655 -15.335 85.361  1.00 39.11 ? 1352 HOH B O     1 
HETATM 8994 O  O     . HOH N 6 .   ? 174.847 -26.099 118.140 1.00 37.31 ? 1353 HOH B O     1 
HETATM 8995 O  O     . HOH N 6 .   ? 174.604 -38.572 97.567  1.00 37.81 ? 1354 HOH B O     1 
HETATM 8996 O  O     . HOH N 6 .   ? 133.756 -34.067 92.683  1.00 32.59 ? 1355 HOH B O     1 
HETATM 8997 O  O     . HOH N 6 .   ? 163.721 -1.886  85.202  1.00 44.34 ? 1356 HOH B O     1 
HETATM 8998 O  O     . HOH N 6 .   ? 167.716 -7.451  79.902  1.00 34.46 ? 1357 HOH B O     1 
HETATM 8999 O  O     . HOH N 6 .   ? 173.977 -6.952  78.810  1.00 41.70 ? 1358 HOH B O     1 
HETATM 9000 O  O     . HOH N 6 .   ? 129.182 -10.379 76.639  1.00 37.46 ? 1359 HOH B O     1 
HETATM 9001 O  O     . HOH N 6 .   ? 114.998 -46.872 114.621 1.00 40.04 ? 1360 HOH B O     1 
HETATM 9002 O  O     . HOH N 6 .   ? 172.098 -1.768  87.402  1.00 44.93 ? 1361 HOH B O     1 
HETATM 9003 O  O     . HOH N 6 .   ? 184.580 6.827   88.207  1.00 46.26 ? 1362 HOH B O     1 
HETATM 9004 O  O     . HOH N 6 .   ? 160.536 -13.108 115.951 1.00 36.89 ? 1363 HOH B O     1 
HETATM 9005 O  O     . HOH N 6 .   ? 157.087 -47.566 104.259 1.00 45.63 ? 1364 HOH B O     1 
HETATM 9006 O  O     . HOH N 6 .   ? 185.018 -4.543  99.569  1.00 46.83 ? 1365 HOH B O     1 
HETATM 9007 O  O     . HOH N 6 .   ? 115.649 -53.640 107.672 1.00 44.53 ? 1366 HOH B O     1 
HETATM 9008 O  O     . HOH N 6 .   ? 155.154 -47.377 102.178 1.00 40.67 ? 1367 HOH B O     1 
HETATM 9009 O  O     . HOH N 6 .   ? 148.518 -12.270 102.581 1.00 15.98 ? 1368 HOH B O     1 
HETATM 9010 O  O     . HOH N 6 .   ? 123.384 -36.157 106.494 1.00 30.89 ? 1369 HOH B O     1 
HETATM 9011 O  O     . HOH N 6 .   ? 153.333 -14.377 78.161  1.00 30.80 ? 1370 HOH B O     1 
HETATM 9012 O  O     . HOH N 6 .   ? 132.095 -32.133 108.776 1.00 33.41 ? 1371 HOH B O     1 
HETATM 9013 O  O     . HOH N 6 .   ? 121.416 -16.750 79.358  1.00 35.95 ? 1372 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   88  ?   ?   ?   A . n 
A 1 2   GLY 2   89  ?   ?   ?   A . n 
A 1 3   SER 3   90  ?   ?   ?   A . n 
A 1 4   SER 4   91  ?   ?   ?   A . n 
A 1 5   HIS 5   92  ?   ?   ?   A . n 
A 1 6   HIS 6   93  ?   ?   ?   A . n 
A 1 7   HIS 7   94  ?   ?   ?   A . n 
A 1 8   HIS 8   95  ?   ?   ?   A . n 
A 1 9   HIS 9   96  ?   ?   ?   A . n 
A 1 10  HIS 10  97  ?   ?   ?   A . n 
A 1 11  SER 11  98  ?   ?   ?   A . n 
A 1 12  SER 12  99  ?   ?   ?   A . n 
A 1 13  GLY 13  100 ?   ?   ?   A . n 
A 1 14  GLU 14  101 ?   ?   ?   A . n 
A 1 15  ASN 15  102 ?   ?   ?   A . n 
A 1 16  LEU 16  103 ?   ?   ?   A . n 
A 1 17  TYR 17  104 ?   ?   ?   A . n 
A 1 18  PHE 18  105 ?   ?   ?   A . n 
A 1 19  GLN 19  106 ?   ?   ?   A . n 
A 1 20  GLY 20  107 ?   ?   ?   A . n 
A 1 21  SER 21  108 ?   ?   ?   A . n 
A 1 22  GLN 22  109 ?   ?   ?   A . n 
A 1 23  ILE 23  110 ?   ?   ?   A . n 
A 1 24  HIS 24  111 ?   ?   ?   A . n 
A 1 25  VAL 25  112 ?   ?   ?   A . n 
A 1 26  ASP 26  113 113 ASP ASP A . n 
A 1 27  THR 27  114 114 THR THR A . n 
A 1 28  MET 28  115 115 MET MET A . n 
A 1 29  LYS 29  116 116 LYS LYS A . n 
A 1 30  VAL 30  117 117 VAL VAL A . n 
A 1 31  ILE 31  118 118 ILE ILE A . n 
A 1 32  ASN 32  119 119 ASN ASN A . n 
A 1 33  ASP 33  120 120 ASP ASP A . n 
A 1 34  PRO 34  121 121 PRO PRO A . n 
A 1 35  ILE 35  122 122 ILE ILE A . n 
A 1 36  HIS 36  123 123 HIS HIS A . n 
A 1 37  GLY 37  124 124 GLY GLY A . n 
A 1 38  HIS 38  125 125 HIS HIS A . n 
A 1 39  ILE 39  126 126 ILE ILE A . n 
A 1 40  GLU 40  127 127 GLU GLU A . n 
A 1 41  LEU 41  128 128 LEU LEU A . n 
A 1 42  HIS 42  129 129 HIS HIS A . n 
A 1 43  PRO 43  130 130 PRO PRO A . n 
A 1 44  LEU 44  131 131 LEU LEU A . n 
A 1 45  LEU 45  132 132 LEU LEU A . n 
A 1 46  VAL 46  133 133 VAL VAL A . n 
A 1 47  ARG 47  134 134 ARG ARG A . n 
A 1 48  ILE 48  135 135 ILE ILE A . n 
A 1 49  ILE 49  136 136 ILE ILE A . n 
A 1 50  ASP 50  137 137 ASP ASP A . n 
A 1 51  THR 51  138 138 THR THR A . n 
A 1 52  PRO 52  139 139 PRO PRO A . n 
A 1 53  GLN 53  140 140 GLN GLN A . n 
A 1 54  PHE 54  141 141 PHE PHE A . n 
A 1 55  GLN 55  142 142 GLN GLN A . n 
A 1 56  ARG 56  143 143 ARG ARG A . n 
A 1 57  LEU 57  144 144 LEU LEU A . n 
A 1 58  ARG 58  145 145 ARG ARG A . n 
A 1 59  TYR 59  146 146 TYR TYR A . n 
A 1 60  ILE 60  147 147 ILE ILE A . n 
A 1 61  LYS 61  148 148 LYS LYS A . n 
A 1 62  GLN 62  149 149 GLN GLN A . n 
A 1 63  LEU 63  150 150 LEU LEU A . n 
A 1 64  GLY 64  151 151 GLY GLY A . n 
A 1 65  GLY 65  152 152 GLY GLY A . n 
A 1 66  GLY 66  153 153 GLY GLY A . n 
A 1 67  TYR 67  154 154 TYR TYR A . n 
A 1 68  TYR 68  155 155 TYR TYR A . n 
A 1 69  VAL 69  156 156 VAL VAL A . n 
A 1 70  PHE 70  157 157 PHE PHE A . n 
A 1 71  PRO 71  158 158 PRO PRO A . n 
A 1 72  GLY 72  159 159 GLY GLY A . n 
A 1 73  ALA 73  160 160 ALA ALA A . n 
A 1 74  SER 74  161 161 SER SER A . n 
A 1 75  HIS 75  162 162 HIS HIS A . n 
A 1 76  ASN 76  163 163 ASN ASN A . n 
A 1 77  ARG 77  164 164 ARG ARG A . n 
A 1 78  PHE 78  165 165 PHE PHE A . n 
A 1 79  GLU 79  166 166 GLU GLU A . n 
A 1 80  HIS 80  167 167 HIS HIS A . n 
A 1 81  SER 81  168 168 SER SER A . n 
A 1 82  LEU 82  169 169 LEU LEU A . n 
A 1 83  GLY 83  170 170 GLY GLY A . n 
A 1 84  VAL 84  171 171 VAL VAL A . n 
A 1 85  GLY 85  172 172 GLY GLY A . n 
A 1 86  TYR 86  173 173 TYR TYR A . n 
A 1 87  LEU 87  174 174 LEU LEU A . n 
A 1 88  ALA 88  175 175 ALA ALA A . n 
A 1 89  GLY 89  176 176 GLY GLY A . n 
A 1 90  CYS 90  177 177 CYS CYS A . n 
A 1 91  LEU 91  178 178 LEU LEU A . n 
A 1 92  VAL 92  179 179 VAL VAL A . n 
A 1 93  HIS 93  180 180 HIS HIS A . n 
A 1 94  ALA 94  181 181 ALA ALA A . n 
A 1 95  LEU 95  182 182 LEU LEU A . n 
A 1 96  GLY 96  183 183 GLY GLY A . n 
A 1 97  GLU 97  184 184 GLU GLU A . n 
A 1 98  LYS 98  185 185 LYS LYS A . n 
A 1 99  GLN 99  186 186 GLN GLN A . n 
A 1 100 PRO 100 187 187 PRO PRO A . n 
A 1 101 GLU 101 188 188 GLU GLU A . n 
A 1 102 LEU 102 189 189 LEU LEU A . n 
A 1 103 GLN 103 190 190 GLN GLN A . n 
A 1 104 ILE 104 191 191 ILE ILE A . n 
A 1 105 SER 105 192 192 SER SER A . n 
A 1 106 GLU 106 193 193 GLU GLU A . n 
A 1 107 ARG 107 194 194 ARG ARG A . n 
A 1 108 ASP 108 195 195 ASP ASP A . n 
A 1 109 VAL 109 196 196 VAL VAL A . n 
A 1 110 LEU 110 197 197 LEU LEU A . n 
A 1 111 CYS 111 198 198 CYS CYS A . n 
A 1 112 VAL 112 199 199 VAL VAL A . n 
A 1 113 GLN 113 200 200 GLN GLN A . n 
A 1 114 ILE 114 201 201 ILE ILE A . n 
A 1 115 ALA 115 202 202 ALA ALA A . n 
A 1 116 GLY 116 203 203 GLY GLY A . n 
A 1 117 LEU 117 204 204 LEU LEU A . n 
A 1 118 CYS 118 205 205 CYS CYS A . n 
A 1 119 HIS 119 206 206 HIS HIS A . n 
A 1 120 ASP 120 207 207 ASP ASP A . n 
A 1 121 LEU 121 208 208 LEU LEU A . n 
A 1 122 GLY 122 209 209 GLY GLY A . n 
A 1 123 HIS 123 210 210 HIS HIS A . n 
A 1 124 GLY 124 211 211 GLY GLY A . n 
A 1 125 PRO 125 212 212 PRO PRO A . n 
A 1 126 PHE 126 213 213 PHE PHE A . n 
A 1 127 SER 127 214 214 SER SER A . n 
A 1 128 HIS 128 215 215 HIS HIS A . n 
A 1 129 MET 129 216 216 MET MET A . n 
A 1 130 PHE 130 217 217 PHE PHE A . n 
A 1 131 ASP 131 218 218 ASP ASP A . n 
A 1 132 GLY 132 219 219 GLY GLY A . n 
A 1 133 ARG 133 220 220 ARG ARG A . n 
A 1 134 PHE 134 221 221 PHE PHE A . n 
A 1 135 ILE 135 222 222 ILE ILE A . n 
A 1 136 PRO 136 223 223 PRO PRO A . n 
A 1 137 LEU 137 224 224 LEU LEU A . n 
A 1 138 ALA 138 225 225 ALA ALA A . n 
A 1 139 ARG 139 226 226 ARG ARG A . n 
A 1 140 PRO 140 227 227 PRO PRO A . n 
A 1 141 GLU 141 228 228 GLU GLU A . n 
A 1 142 VAL 142 229 229 VAL VAL A . n 
A 1 143 LYS 143 230 230 LYS LYS A . n 
A 1 144 TRP 144 231 231 TRP TRP A . n 
A 1 145 THR 145 232 232 THR THR A . n 
A 1 146 HIS 146 233 233 HIS HIS A . n 
A 1 147 GLU 147 234 234 GLU GLU A . n 
A 1 148 GLN 148 235 235 GLN GLN A . n 
A 1 149 GLY 149 236 236 GLY GLY A . n 
A 1 150 SER 150 237 237 SER SER A . n 
A 1 151 VAL 151 238 238 VAL VAL A . n 
A 1 152 MET 152 239 239 MET MET A . n 
A 1 153 MET 153 240 240 MET MET A . n 
A 1 154 PHE 154 241 241 PHE PHE A . n 
A 1 155 GLU 155 242 242 GLU GLU A . n 
A 1 156 HIS 156 243 243 HIS HIS A . n 
A 1 157 LEU 157 244 244 LEU LEU A . n 
A 1 158 ILE 158 245 245 ILE ILE A . n 
A 1 159 ASN 159 246 246 ASN ASN A . n 
A 1 160 SER 160 247 247 SER SER A . n 
A 1 161 ASN 161 248 248 ASN ASN A . n 
A 1 162 GLY 162 249 249 GLY GLY A . n 
A 1 163 ILE 163 250 250 ILE ILE A . n 
A 1 164 LYS 164 251 251 LYS LYS A . n 
A 1 165 PRO 165 252 252 PRO PRO A . n 
A 1 166 VAL 166 253 253 VAL VAL A . n 
A 1 167 MET 167 254 254 MET MET A . n 
A 1 168 GLU 168 255 255 GLU GLU A . n 
A 1 169 GLN 169 256 256 GLN GLN A . n 
A 1 170 TYR 170 257 257 TYR TYR A . n 
A 1 171 GLY 171 258 258 GLY GLY A . n 
A 1 172 LEU 172 259 259 LEU LEU A . n 
A 1 173 ILE 173 260 260 ILE ILE A . n 
A 1 174 PRO 174 261 261 PRO PRO A . n 
A 1 175 GLU 175 262 262 GLU GLU A . n 
A 1 176 GLU 176 263 263 GLU GLU A . n 
A 1 177 ASP 177 264 264 ASP ASP A . n 
A 1 178 ILE 178 265 265 ILE ILE A . n 
A 1 179 TYR 179 266 266 TYR TYR A . n 
A 1 180 PHE 180 267 267 PHE PHE A . n 
A 1 181 ILE 181 268 268 ILE ILE A . n 
A 1 182 LYS 182 269 269 LYS LYS A . n 
A 1 183 GLU 183 270 270 GLU GLU A . n 
A 1 184 GLN 184 271 271 GLN GLN A . n 
A 1 185 ILE 185 272 272 ILE ILE A . n 
A 1 186 VAL 186 273 273 VAL VAL A . n 
A 1 187 GLY 187 274 274 GLY GLY A . n 
A 1 188 PRO 188 275 275 PRO PRO A . n 
A 1 189 LEU 189 276 276 LEU LEU A . n 
A 1 190 GLU 190 277 277 GLU GLU A . n 
A 1 191 SER 191 278 ?   ?   ?   A . n 
A 1 192 PRO 192 279 ?   ?   ?   A . n 
A 1 193 VAL 193 280 ?   ?   ?   A . n 
A 1 194 GLU 194 281 ?   ?   ?   A . n 
A 1 195 ASP 195 282 ?   ?   ?   A . n 
A 1 196 SER 196 283 ?   ?   ?   A . n 
A 1 197 LEU 197 284 284 LEU LEU A . n 
A 1 198 TRP 198 285 285 TRP TRP A . n 
A 1 199 PRO 199 286 286 PRO PRO A . n 
A 1 200 TYR 200 287 287 TYR TYR A . n 
A 1 201 LYS 201 288 288 LYS LYS A . n 
A 1 202 GLY 202 289 289 GLY GLY A . n 
A 1 203 ARG 203 290 290 ARG ARG A . n 
A 1 204 PRO 204 291 291 PRO PRO A . n 
A 1 205 GLU 205 292 292 GLU GLU A . n 
A 1 206 ASN 206 293 293 ASN ASN A . n 
A 1 207 LYS 207 294 294 LYS LYS A . n 
A 1 208 SER 208 295 295 SER SER A . n 
A 1 209 PHE 209 296 296 PHE PHE A . n 
A 1 210 LEU 210 297 297 LEU LEU A . n 
A 1 211 TYR 211 298 298 TYR TYR A . n 
A 1 212 GLU 212 299 299 GLU GLU A . n 
A 1 213 ILE 213 300 300 ILE ILE A . n 
A 1 214 VAL 214 301 301 VAL VAL A . n 
A 1 215 SER 215 302 302 SER SER A . n 
A 1 216 ASN 216 303 303 ASN ASN A . n 
A 1 217 LYS 217 304 304 LYS LYS A . n 
A 1 218 ARG 218 305 305 ARG ARG A . n 
A 1 219 ASN 219 306 306 ASN ASN A . n 
A 1 220 GLY 220 307 307 GLY GLY A . n 
A 1 221 ILE 221 308 308 ILE ILE A . n 
A 1 222 ASP 222 309 309 ASP ASP A . n 
A 1 223 VAL 223 310 310 VAL VAL A . n 
A 1 224 ASP 224 311 311 ASP ASP A . n 
A 1 225 LYS 225 312 312 LYS LYS A . n 
A 1 226 TRP 226 313 313 TRP TRP A . n 
A 1 227 ASP 227 314 314 ASP ASP A . n 
A 1 228 TYR 228 315 315 TYR TYR A . n 
A 1 229 PHE 229 316 316 PHE PHE A . n 
A 1 230 ALA 230 317 317 ALA ALA A . n 
A 1 231 ARG 231 318 318 ARG ARG A . n 
A 1 232 ASP 232 319 319 ASP ASP A . n 
A 1 233 CYS 233 320 320 CYS CYS A . n 
A 1 234 HIS 234 321 321 HIS HIS A . n 
A 1 235 HIS 235 322 322 HIS HIS A . n 
A 1 236 LEU 236 323 323 LEU LEU A . n 
A 1 237 GLY 237 324 324 GLY GLY A . n 
A 1 238 ILE 238 325 325 ILE ILE A . n 
A 1 239 GLN 239 326 326 GLN GLN A . n 
A 1 240 ASN 240 327 327 ASN ASN A . n 
A 1 241 ASN 241 328 328 ASN ASN A . n 
A 1 242 PHE 242 329 329 PHE PHE A . n 
A 1 243 ASP 243 330 330 ASP ASP A . n 
A 1 244 TYR 244 331 331 TYR TYR A . n 
A 1 245 LYS 245 332 332 LYS LYS A . n 
A 1 246 ARG 246 333 333 ARG ARG A . n 
A 1 247 PHE 247 334 334 PHE PHE A . n 
A 1 248 ILE 248 335 335 ILE ILE A . n 
A 1 249 LYS 249 336 336 LYS LYS A . n 
A 1 250 PHE 250 337 337 PHE PHE A . n 
A 1 251 ALA 251 338 338 ALA ALA A . n 
A 1 252 ARG 252 339 339 ARG ARG A . n 
A 1 253 VAL 253 340 340 VAL VAL A . n 
A 1 254 CYS 254 341 341 CYS CYS A . n 
A 1 255 GLU 255 342 342 GLU GLU A . n 
A 1 256 VAL 256 343 343 VAL VAL A . n 
A 1 257 ASP 257 344 344 ASP ASP A . n 
A 1 258 ASN 258 345 345 ASN ASN A . n 
A 1 259 GLU 259 346 346 GLU GLU A . n 
A 1 260 LEU 260 347 347 LEU LEU A . n 
A 1 261 ARG 261 348 348 ARG ARG A . n 
A 1 262 ILE 262 349 349 ILE ILE A . n 
A 1 263 CYS 263 350 350 CYS CYS A . n 
A 1 264 ALA 264 351 351 ALA ALA A . n 
A 1 265 ARG 265 352 352 ARG ARG A . n 
A 1 266 ASP 266 353 353 ASP ASP A . n 
A 1 267 LYS 267 354 354 LYS LYS A . n 
A 1 268 GLU 268 355 355 GLU GLU A . n 
A 1 269 VAL 269 356 356 VAL VAL A . n 
A 1 270 GLY 270 357 357 GLY GLY A . n 
A 1 271 ASN 271 358 358 ASN ASN A . n 
A 1 272 LEU 272 359 359 LEU LEU A . n 
A 1 273 TYR 273 360 360 TYR TYR A . n 
A 1 274 ASP 274 361 361 ASP ASP A . n 
A 1 275 MET 275 362 362 MET MET A . n 
A 1 276 PHE 276 363 363 PHE PHE A . n 
A 1 277 HIS 277 364 364 HIS HIS A . n 
A 1 278 THR 278 365 365 THR THR A . n 
A 1 279 ARG 279 366 366 ARG ARG A . n 
A 1 280 ASN 280 367 367 ASN ASN A . n 
A 1 281 SER 281 368 368 SER SER A . n 
A 1 282 LEU 282 369 369 LEU LEU A . n 
A 1 283 HIS 283 370 370 HIS HIS A . n 
A 1 284 ARG 284 371 371 ARG ARG A . n 
A 1 285 ARG 285 372 372 ARG ARG A . n 
A 1 286 ALA 286 373 373 ALA ALA A . n 
A 1 287 TYR 287 374 374 TYR TYR A . n 
A 1 288 GLN 288 375 375 GLN GLN A . n 
A 1 289 HIS 289 376 376 HIS HIS A . n 
A 1 290 LYS 290 377 377 LYS LYS A . n 
A 1 291 VAL 291 378 378 VAL VAL A . n 
A 1 292 GLY 292 379 379 GLY GLY A . n 
A 1 293 ASN 293 380 380 ASN ASN A . n 
A 1 294 ILE 294 381 381 ILE ILE A . n 
A 1 295 ILE 295 382 382 ILE ILE A . n 
A 1 296 ASP 296 383 383 ASP ASP A . n 
A 1 297 THR 297 384 384 THR THR A . n 
A 1 298 MET 298 385 385 MET MET A . n 
A 1 299 ILE 299 386 386 ILE ILE A . n 
A 1 300 THR 300 387 387 THR THR A . n 
A 1 301 ASP 301 388 388 ASP ASP A . n 
A 1 302 ALA 302 389 389 ALA ALA A . n 
A 1 303 PHE 303 390 390 PHE PHE A . n 
A 1 304 LEU 304 391 391 LEU LEU A . n 
A 1 305 LYS 305 392 392 LYS LYS A . n 
A 1 306 ALA 306 393 393 ALA ALA A . n 
A 1 307 ASP 307 394 394 ASP ASP A . n 
A 1 308 ASP 308 395 395 ASP ASP A . n 
A 1 309 TYR 309 396 396 TYR TYR A . n 
A 1 310 ILE 310 397 397 ILE ILE A . n 
A 1 311 GLU 311 398 398 GLU GLU A . n 
A 1 312 ILE 312 399 399 ILE ILE A . n 
A 1 313 THR 313 400 400 THR THR A . n 
A 1 314 GLY 314 401 401 GLY GLY A . n 
A 1 315 ALA 315 402 402 ALA ALA A . n 
A 1 316 GLY 316 403 403 GLY GLY A . n 
A 1 317 GLY 317 404 404 GLY GLY A . n 
A 1 318 LYS 318 405 405 LYS LYS A . n 
A 1 319 LYS 319 406 406 LYS LYS A . n 
A 1 320 TYR 320 407 407 TYR TYR A . n 
A 1 321 ARG 321 408 408 ARG ARG A . n 
A 1 322 ILE 322 409 409 ILE ILE A . n 
A 1 323 SER 323 410 410 SER SER A . n 
A 1 324 THR 324 411 411 THR THR A . n 
A 1 325 ALA 325 412 412 ALA ALA A . n 
A 1 326 ILE 326 413 413 ILE ILE A . n 
A 1 327 ASP 327 414 414 ASP ASP A . n 
A 1 328 ASP 328 415 415 ASP ASP A . n 
A 1 329 MET 329 416 416 MET MET A . n 
A 1 330 GLU 330 417 417 GLU GLU A . n 
A 1 331 ALA 331 418 418 ALA ALA A . n 
A 1 332 TYR 332 419 419 TYR TYR A . n 
A 1 333 THR 333 420 420 THR THR A . n 
A 1 334 LYS 334 421 421 LYS LYS A . n 
A 1 335 LEU 335 422 422 LEU LEU A . n 
A 1 336 THR 336 423 423 THR THR A . n 
A 1 337 ASP 337 424 424 ASP ASP A . n 
A 1 338 ASN 338 425 425 ASN ASN A . n 
A 1 339 ILE 339 426 426 ILE ILE A . n 
A 1 340 PHE 340 427 427 PHE PHE A . n 
A 1 341 LEU 341 428 428 LEU LEU A . n 
A 1 342 GLU 342 429 429 GLU GLU A . n 
A 1 343 ILE 343 430 430 ILE ILE A . n 
A 1 344 LEU 344 431 431 LEU LEU A . n 
A 1 345 TYR 345 432 432 TYR TYR A . n 
A 1 346 SER 346 433 433 SER SER A . n 
A 1 347 THR 347 434 434 THR THR A . n 
A 1 348 ASP 348 435 435 ASP ASP A . n 
A 1 349 PRO 349 436 436 PRO PRO A . n 
A 1 350 LYS 350 437 437 LYS LYS A . n 
A 1 351 LEU 351 438 438 LEU LEU A . n 
A 1 352 LYS 352 439 439 LYS LYS A . n 
A 1 353 ASP 353 440 440 ASP ASP A . n 
A 1 354 ALA 354 441 441 ALA ALA A . n 
A 1 355 ARG 355 442 442 ARG ARG A . n 
A 1 356 GLU 356 443 443 GLU GLU A . n 
A 1 357 ILE 357 444 444 ILE ILE A . n 
A 1 358 LEU 358 445 445 LEU LEU A . n 
A 1 359 LYS 359 446 446 LYS LYS A . n 
A 1 360 GLN 360 447 447 GLN GLN A . n 
A 1 361 ILE 361 448 448 ILE ILE A . n 
A 1 362 GLU 362 449 449 GLU GLU A . n 
A 1 363 TYR 363 450 450 TYR TYR A . n 
A 1 364 ARG 364 451 451 ARG ARG A . n 
A 1 365 ASN 365 452 452 ASN ASN A . n 
A 1 366 LEU 366 453 453 LEU LEU A . n 
A 1 367 PHE 367 454 454 PHE PHE A . n 
A 1 368 LYS 368 455 455 LYS LYS A . n 
A 1 369 TYR 369 456 456 TYR TYR A . n 
A 1 370 VAL 370 457 457 VAL VAL A . n 
A 1 371 GLY 371 458 458 GLY GLY A . n 
A 1 372 GLU 372 459 459 GLU GLU A . n 
A 1 373 THR 373 460 460 THR THR A . n 
A 1 374 GLN 374 461 461 GLN GLN A . n 
A 1 375 PRO 375 462 462 PRO PRO A . n 
A 1 376 THR 376 463 463 THR THR A . n 
A 1 377 GLY 377 464 464 GLY GLY A . n 
A 1 378 GLN 378 465 465 GLN GLN A . n 
A 1 379 ILE 379 466 466 ILE ILE A . n 
A 1 380 LYS 380 467 467 LYS LYS A . n 
A 1 381 ILE 381 468 468 ILE ILE A . n 
A 1 382 LYS 382 469 469 LYS LYS A . n 
A 1 383 ARG 383 470 470 ARG ARG A . n 
A 1 384 GLU 384 471 471 GLU GLU A . n 
A 1 385 ASP 385 472 472 ASP ASP A . n 
A 1 386 TYR 386 473 473 TYR TYR A . n 
A 1 387 GLU 387 474 474 GLU GLU A . n 
A 1 388 SER 388 475 475 SER SER A . n 
A 1 389 LEU 389 476 476 LEU LEU A . n 
A 1 390 PRO 390 477 477 PRO PRO A . n 
A 1 391 LYS 391 478 478 LYS LYS A . n 
A 1 392 GLU 392 479 479 GLU GLU A . n 
A 1 393 VAL 393 480 480 VAL VAL A . n 
A 1 394 ALA 394 481 481 ALA ALA A . n 
A 1 395 SER 395 482 482 SER SER A . n 
A 1 396 ALA 396 483 483 ALA ALA A . n 
A 1 397 LYS 397 484 484 LYS LYS A . n 
A 1 398 PRO 398 485 485 PRO PRO A . n 
A 1 399 LYS 399 486 486 LYS LYS A . n 
A 1 400 VAL 400 487 487 VAL VAL A . n 
A 1 401 LEU 401 488 488 LEU LEU A . n 
A 1 402 LEU 402 489 489 LEU LEU A . n 
A 1 403 ASP 403 490 490 ASP ASP A . n 
A 1 404 VAL 404 491 491 VAL VAL A . n 
A 1 405 LYS 405 492 492 LYS LYS A . n 
A 1 406 LEU 406 493 493 LEU LEU A . n 
A 1 407 LYS 407 494 494 LYS LYS A . n 
A 1 408 ALA 408 495 495 ALA ALA A . n 
A 1 409 GLU 409 496 496 GLU GLU A . n 
A 1 410 ASP 410 497 497 ASP ASP A . n 
A 1 411 PHE 411 498 498 PHE PHE A . n 
A 1 412 ILE 412 499 499 ILE ILE A . n 
A 1 413 VAL 413 500 500 VAL VAL A . n 
A 1 414 ASP 414 501 501 ASP ASP A . n 
A 1 415 VAL 415 502 502 VAL VAL A . n 
A 1 416 ILE 416 503 503 ILE ILE A . n 
A 1 417 ASN 417 504 504 ASN ASN A . n 
A 1 418 MET 418 505 505 MET MET A . n 
A 1 419 ASP 419 506 506 ASP ASP A . n 
A 1 420 TYR 420 507 507 TYR TYR A . n 
A 1 421 GLY 421 508 508 GLY GLY A . n 
A 1 422 MET 422 509 509 MET MET A . n 
A 1 423 GLN 423 510 510 GLN GLN A . n 
A 1 424 GLU 424 511 511 GLU GLU A . n 
A 1 425 LYS 425 512 512 LYS LYS A . n 
A 1 426 ASN 426 513 513 ASN ASN A . n 
A 1 427 PRO 427 514 514 PRO PRO A . n 
A 1 428 ILE 428 515 515 ILE ILE A . n 
A 1 429 ASP 429 516 516 ASP ASP A . n 
A 1 430 HIS 430 517 517 HIS HIS A . n 
A 1 431 VAL 431 518 518 VAL VAL A . n 
A 1 432 SER 432 519 519 SER SER A . n 
A 1 433 PHE 433 520 520 PHE PHE A . n 
A 1 434 TYR 434 521 521 TYR TYR A . n 
A 1 435 CYS 435 522 522 CYS CYS A . n 
A 1 436 LYS 436 523 523 LYS LYS A . n 
A 1 437 THR 437 524 524 THR THR A . n 
A 1 438 ALA 438 525 525 ALA ALA A . n 
A 1 439 PRO 439 526 526 PRO PRO A . n 
A 1 440 ASN 440 527 527 ASN ASN A . n 
A 1 441 ARG 441 528 528 ARG ARG A . n 
A 1 442 ALA 442 529 529 ALA ALA A . n 
A 1 443 ILE 443 530 530 ILE ILE A . n 
A 1 444 ARG 444 531 531 ARG ARG A . n 
A 1 445 ILE 445 532 532 ILE ILE A . n 
A 1 446 THR 446 533 533 THR THR A . n 
A 1 447 LYS 447 534 534 LYS LYS A . n 
A 1 448 ASN 448 535 535 ASN ASN A . n 
A 1 449 GLN 449 536 536 GLN GLN A . n 
A 1 450 VAL 450 537 537 VAL VAL A . n 
A 1 451 SER 451 538 538 SER SER A . n 
A 1 452 GLN 452 539 539 GLN GLN A . n 
A 1 453 LEU 453 540 540 LEU LEU A . n 
A 1 454 LEU 454 541 541 LEU LEU A . n 
A 1 455 PRO 455 542 542 PRO PRO A . n 
A 1 456 GLU 456 543 543 GLU GLU A . n 
A 1 457 LYS 457 544 544 LYS LYS A . n 
A 1 458 PHE 458 545 545 PHE PHE A . n 
A 1 459 ALA 459 546 546 ALA ALA A . n 
A 1 460 GLU 460 547 547 GLU GLU A . n 
A 1 461 GLN 461 548 548 GLN GLN A . n 
A 1 462 LEU 462 549 549 LEU LEU A . n 
A 1 463 ILE 463 550 550 ILE ILE A . n 
A 1 464 ARG 464 551 551 ARG ARG A . n 
A 1 465 VAL 465 552 552 VAL VAL A . n 
A 1 466 TYR 466 553 553 TYR TYR A . n 
A 1 467 CYS 467 554 554 CYS CYS A . n 
A 1 468 LYS 468 555 555 LYS LYS A . n 
A 1 469 LYS 469 556 556 LYS LYS A . n 
A 1 470 VAL 470 557 557 VAL VAL A . n 
A 1 471 ASP 471 558 558 ASP ASP A . n 
A 1 472 ARG 472 559 559 ARG ARG A . n 
A 1 473 LYS 473 560 560 LYS LYS A . n 
A 1 474 SER 474 561 561 SER SER A . n 
A 1 475 LEU 475 562 562 LEU LEU A . n 
A 1 476 TYR 476 563 563 TYR TYR A . n 
A 1 477 ALA 477 564 564 ALA ALA A . n 
A 1 478 ALA 478 565 565 ALA ALA A . n 
A 1 479 ARG 479 566 566 ARG ARG A . n 
A 1 480 GLN 480 567 567 GLN GLN A . n 
A 1 481 TYR 481 568 568 TYR TYR A . n 
A 1 482 PHE 482 569 569 PHE PHE A . n 
A 1 483 VAL 483 570 570 VAL VAL A . n 
A 1 484 GLN 484 571 571 GLN GLN A . n 
A 1 485 TRP 485 572 572 TRP TRP A . n 
A 1 486 CYS 486 573 573 CYS CYS A . n 
A 1 487 ALA 487 574 574 ALA ALA A . n 
A 1 488 ASP 488 575 575 ASP ASP A . n 
A 1 489 ARG 489 576 576 ARG ARG A . n 
A 1 490 ASN 490 577 577 ASN ASN A . n 
A 1 491 PHE 491 578 578 PHE PHE A . n 
A 1 492 THR 492 579 579 THR THR A . n 
A 1 493 LYS 493 580 580 LYS LYS A . n 
A 1 494 PRO 494 581 581 PRO PRO A . n 
A 1 495 GLN 495 582 582 GLN GLN A . n 
A 1 496 ASP 496 583 583 ASP ASP A . n 
A 1 497 GLY 497 584 584 GLY GLY A . n 
A 1 498 ASP 498 585 585 ASP ASP A . n 
A 1 499 VAL 499 586 586 VAL VAL A . n 
A 1 500 ILE 500 587 587 ILE ILE A . n 
A 1 501 ALA 501 588 588 ALA ALA A . n 
A 1 502 PRO 502 589 589 PRO PRO A . n 
A 1 503 LEU 503 590 590 LEU LEU A . n 
A 1 504 ILE 504 591 591 ILE ILE A . n 
A 1 505 THR 505 592 592 THR THR A . n 
A 1 506 PRO 506 593 593 PRO PRO A . n 
A 1 507 GLN 507 594 594 GLN GLN A . n 
A 1 508 LYS 508 595 595 LYS LYS A . n 
A 1 509 LYS 509 596 596 LYS LYS A . n 
A 1 510 GLU 510 597 597 GLU GLU A . n 
A 1 511 TRP 511 598 598 TRP TRP A . n 
A 1 512 ASN 512 599 599 ASN ASN A . n 
A 1 513 ASP 513 600 ?   ?   ?   A . n 
A 1 514 SER 514 601 ?   ?   ?   A . n 
A 1 515 THR 515 602 ?   ?   ?   A . n 
A 1 516 SER 516 603 ?   ?   ?   A . n 
A 1 517 VAL 517 604 ?   ?   ?   A . n 
A 1 518 GLN 518 605 ?   ?   ?   A . n 
A 1 519 ASN 519 606 ?   ?   ?   A . n 
A 1 520 PRO 520 607 ?   ?   ?   A . n 
A 1 521 THR 521 608 ?   ?   ?   A . n 
A 1 522 ARG 522 609 ?   ?   ?   A . n 
A 1 523 LEU 523 610 ?   ?   ?   A . n 
A 1 524 ARG 524 611 ?   ?   ?   A . n 
A 1 525 GLU 525 612 ?   ?   ?   A . n 
A 1 526 ALA 526 613 ?   ?   ?   A . n 
A 1 527 SER 527 614 ?   ?   ?   A . n 
A 1 528 LYS 528 615 ?   ?   ?   A . n 
A 1 529 SER 529 616 ?   ?   ?   A . n 
A 1 530 ARG 530 617 ?   ?   ?   A . n 
A 1 531 VAL 531 618 ?   ?   ?   A . n 
A 1 532 GLN 532 619 ?   ?   ?   A . n 
A 1 533 LEU 533 620 ?   ?   ?   A . n 
A 1 534 PHE 534 621 ?   ?   ?   A . n 
A 1 535 LYS 535 622 ?   ?   ?   A . n 
A 1 536 ASP 536 623 ?   ?   ?   A . n 
A 1 537 ASP 537 624 ?   ?   ?   A . n 
A 1 538 PRO 538 625 ?   ?   ?   A . n 
A 1 539 MET 539 626 ?   ?   ?   A . n 
B 1 1   MET 1   88  ?   ?   ?   B . n 
B 1 2   GLY 2   89  ?   ?   ?   B . n 
B 1 3   SER 3   90  ?   ?   ?   B . n 
B 1 4   SER 4   91  ?   ?   ?   B . n 
B 1 5   HIS 5   92  ?   ?   ?   B . n 
B 1 6   HIS 6   93  ?   ?   ?   B . n 
B 1 7   HIS 7   94  ?   ?   ?   B . n 
B 1 8   HIS 8   95  ?   ?   ?   B . n 
B 1 9   HIS 9   96  ?   ?   ?   B . n 
B 1 10  HIS 10  97  ?   ?   ?   B . n 
B 1 11  SER 11  98  ?   ?   ?   B . n 
B 1 12  SER 12  99  ?   ?   ?   B . n 
B 1 13  GLY 13  100 ?   ?   ?   B . n 
B 1 14  GLU 14  101 ?   ?   ?   B . n 
B 1 15  ASN 15  102 102 ASN ASN B . n 
B 1 16  LEU 16  103 103 LEU LEU B . n 
B 1 17  TYR 17  104 104 TYR TYR B . n 
B 1 18  PHE 18  105 105 PHE PHE B . n 
B 1 19  GLN 19  106 106 GLN GLN B . n 
B 1 20  GLY 20  107 107 GLY GLY B . n 
B 1 21  SER 21  108 108 SER SER B . n 
B 1 22  GLN 22  109 109 GLN GLN B . n 
B 1 23  ILE 23  110 110 ILE ILE B . n 
B 1 24  HIS 24  111 111 HIS HIS B . n 
B 1 25  VAL 25  112 112 VAL VAL B . n 
B 1 26  ASP 26  113 113 ASP ASP B . n 
B 1 27  THR 27  114 114 THR THR B . n 
B 1 28  MET 28  115 115 MET MET B . n 
B 1 29  LYS 29  116 116 LYS LYS B . n 
B 1 30  VAL 30  117 117 VAL VAL B . n 
B 1 31  ILE 31  118 118 ILE ILE B . n 
B 1 32  ASN 32  119 119 ASN ASN B . n 
B 1 33  ASP 33  120 120 ASP ASP B . n 
B 1 34  PRO 34  121 121 PRO PRO B . n 
B 1 35  ILE 35  122 122 ILE ILE B . n 
B 1 36  HIS 36  123 123 HIS HIS B . n 
B 1 37  GLY 37  124 124 GLY GLY B . n 
B 1 38  HIS 38  125 125 HIS HIS B . n 
B 1 39  ILE 39  126 126 ILE ILE B . n 
B 1 40  GLU 40  127 127 GLU GLU B . n 
B 1 41  LEU 41  128 128 LEU LEU B . n 
B 1 42  HIS 42  129 129 HIS HIS B . n 
B 1 43  PRO 43  130 130 PRO PRO B . n 
B 1 44  LEU 44  131 131 LEU LEU B . n 
B 1 45  LEU 45  132 132 LEU LEU B . n 
B 1 46  VAL 46  133 133 VAL VAL B . n 
B 1 47  ARG 47  134 134 ARG ARG B . n 
B 1 48  ILE 48  135 135 ILE ILE B . n 
B 1 49  ILE 49  136 136 ILE ILE B . n 
B 1 50  ASP 50  137 137 ASP ASP B . n 
B 1 51  THR 51  138 138 THR THR B . n 
B 1 52  PRO 52  139 139 PRO PRO B . n 
B 1 53  GLN 53  140 140 GLN GLN B . n 
B 1 54  PHE 54  141 141 PHE PHE B . n 
B 1 55  GLN 55  142 142 GLN GLN B . n 
B 1 56  ARG 56  143 143 ARG ARG B . n 
B 1 57  LEU 57  144 144 LEU LEU B . n 
B 1 58  ARG 58  145 145 ARG ARG B . n 
B 1 59  TYR 59  146 146 TYR TYR B . n 
B 1 60  ILE 60  147 147 ILE ILE B . n 
B 1 61  LYS 61  148 148 LYS LYS B . n 
B 1 62  GLN 62  149 149 GLN GLN B . n 
B 1 63  LEU 63  150 150 LEU LEU B . n 
B 1 64  GLY 64  151 151 GLY GLY B . n 
B 1 65  GLY 65  152 152 GLY GLY B . n 
B 1 66  GLY 66  153 153 GLY GLY B . n 
B 1 67  TYR 67  154 154 TYR TYR B . n 
B 1 68  TYR 68  155 155 TYR TYR B . n 
B 1 69  VAL 69  156 156 VAL VAL B . n 
B 1 70  PHE 70  157 157 PHE PHE B . n 
B 1 71  PRO 71  158 158 PRO PRO B . n 
B 1 72  GLY 72  159 159 GLY GLY B . n 
B 1 73  ALA 73  160 160 ALA ALA B . n 
B 1 74  SER 74  161 161 SER SER B . n 
B 1 75  HIS 75  162 162 HIS HIS B . n 
B 1 76  ASN 76  163 163 ASN ASN B . n 
B 1 77  ARG 77  164 164 ARG ARG B . n 
B 1 78  PHE 78  165 165 PHE PHE B . n 
B 1 79  GLU 79  166 166 GLU GLU B . n 
B 1 80  HIS 80  167 167 HIS HIS B . n 
B 1 81  SER 81  168 168 SER SER B . n 
B 1 82  LEU 82  169 169 LEU LEU B . n 
B 1 83  GLY 83  170 170 GLY GLY B . n 
B 1 84  VAL 84  171 171 VAL VAL B . n 
B 1 85  GLY 85  172 172 GLY GLY B . n 
B 1 86  TYR 86  173 173 TYR TYR B . n 
B 1 87  LEU 87  174 174 LEU LEU B . n 
B 1 88  ALA 88  175 175 ALA ALA B . n 
B 1 89  GLY 89  176 176 GLY GLY B . n 
B 1 90  CYS 90  177 177 CYS CYS B . n 
B 1 91  LEU 91  178 178 LEU LEU B . n 
B 1 92  VAL 92  179 179 VAL VAL B . n 
B 1 93  HIS 93  180 180 HIS HIS B . n 
B 1 94  ALA 94  181 181 ALA ALA B . n 
B 1 95  LEU 95  182 182 LEU LEU B . n 
B 1 96  GLY 96  183 183 GLY GLY B . n 
B 1 97  GLU 97  184 184 GLU GLU B . n 
B 1 98  LYS 98  185 185 LYS LYS B . n 
B 1 99  GLN 99  186 186 GLN GLN B . n 
B 1 100 PRO 100 187 187 PRO PRO B . n 
B 1 101 GLU 101 188 188 GLU GLU B . n 
B 1 102 LEU 102 189 189 LEU LEU B . n 
B 1 103 GLN 103 190 190 GLN GLN B . n 
B 1 104 ILE 104 191 191 ILE ILE B . n 
B 1 105 SER 105 192 192 SER SER B . n 
B 1 106 GLU 106 193 193 GLU GLU B . n 
B 1 107 ARG 107 194 194 ARG ARG B . n 
B 1 108 ASP 108 195 195 ASP ASP B . n 
B 1 109 VAL 109 196 196 VAL VAL B . n 
B 1 110 LEU 110 197 197 LEU LEU B . n 
B 1 111 CYS 111 198 198 CYS CYS B . n 
B 1 112 VAL 112 199 199 VAL VAL B . n 
B 1 113 GLN 113 200 200 GLN GLN B . n 
B 1 114 ILE 114 201 201 ILE ILE B . n 
B 1 115 ALA 115 202 202 ALA ALA B . n 
B 1 116 GLY 116 203 203 GLY GLY B . n 
B 1 117 LEU 117 204 204 LEU LEU B . n 
B 1 118 CYS 118 205 205 CYS CYS B . n 
B 1 119 HIS 119 206 206 HIS HIS B . n 
B 1 120 ASP 120 207 207 ASP ASP B . n 
B 1 121 LEU 121 208 208 LEU LEU B . n 
B 1 122 GLY 122 209 209 GLY GLY B . n 
B 1 123 HIS 123 210 210 HIS HIS B . n 
B 1 124 GLY 124 211 211 GLY GLY B . n 
B 1 125 PRO 125 212 212 PRO PRO B . n 
B 1 126 PHE 126 213 213 PHE PHE B . n 
B 1 127 SER 127 214 214 SER SER B . n 
B 1 128 HIS 128 215 215 HIS HIS B . n 
B 1 129 MET 129 216 216 MET MET B . n 
B 1 130 PHE 130 217 217 PHE PHE B . n 
B 1 131 ASP 131 218 218 ASP ASP B . n 
B 1 132 GLY 132 219 219 GLY GLY B . n 
B 1 133 ARG 133 220 220 ARG ARG B . n 
B 1 134 PHE 134 221 221 PHE PHE B . n 
B 1 135 ILE 135 222 222 ILE ILE B . n 
B 1 136 PRO 136 223 223 PRO PRO B . n 
B 1 137 LEU 137 224 224 LEU LEU B . n 
B 1 138 ALA 138 225 225 ALA ALA B . n 
B 1 139 ARG 139 226 226 ARG ARG B . n 
B 1 140 PRO 140 227 227 PRO PRO B . n 
B 1 141 GLU 141 228 228 GLU GLU B . n 
B 1 142 VAL 142 229 229 VAL VAL B . n 
B 1 143 LYS 143 230 230 LYS LYS B . n 
B 1 144 TRP 144 231 231 TRP TRP B . n 
B 1 145 THR 145 232 232 THR THR B . n 
B 1 146 HIS 146 233 233 HIS HIS B . n 
B 1 147 GLU 147 234 234 GLU GLU B . n 
B 1 148 GLN 148 235 235 GLN GLN B . n 
B 1 149 GLY 149 236 236 GLY GLY B . n 
B 1 150 SER 150 237 237 SER SER B . n 
B 1 151 VAL 151 238 238 VAL VAL B . n 
B 1 152 MET 152 239 239 MET MET B . n 
B 1 153 MET 153 240 240 MET MET B . n 
B 1 154 PHE 154 241 241 PHE PHE B . n 
B 1 155 GLU 155 242 242 GLU GLU B . n 
B 1 156 HIS 156 243 243 HIS HIS B . n 
B 1 157 LEU 157 244 244 LEU LEU B . n 
B 1 158 ILE 158 245 245 ILE ILE B . n 
B 1 159 ASN 159 246 246 ASN ASN B . n 
B 1 160 SER 160 247 247 SER SER B . n 
B 1 161 ASN 161 248 248 ASN ASN B . n 
B 1 162 GLY 162 249 249 GLY GLY B . n 
B 1 163 ILE 163 250 250 ILE ILE B . n 
B 1 164 LYS 164 251 251 LYS LYS B . n 
B 1 165 PRO 165 252 252 PRO PRO B . n 
B 1 166 VAL 166 253 253 VAL VAL B . n 
B 1 167 MET 167 254 254 MET MET B . n 
B 1 168 GLU 168 255 255 GLU GLU B . n 
B 1 169 GLN 169 256 256 GLN GLN B . n 
B 1 170 TYR 170 257 257 TYR TYR B . n 
B 1 171 GLY 171 258 258 GLY GLY B . n 
B 1 172 LEU 172 259 259 LEU LEU B . n 
B 1 173 ILE 173 260 260 ILE ILE B . n 
B 1 174 PRO 174 261 261 PRO PRO B . n 
B 1 175 GLU 175 262 262 GLU GLU B . n 
B 1 176 GLU 176 263 263 GLU GLU B . n 
B 1 177 ASP 177 264 264 ASP ASP B . n 
B 1 178 ILE 178 265 265 ILE ILE B . n 
B 1 179 TYR 179 266 266 TYR TYR B . n 
B 1 180 PHE 180 267 267 PHE PHE B . n 
B 1 181 ILE 181 268 268 ILE ILE B . n 
B 1 182 LYS 182 269 269 LYS LYS B . n 
B 1 183 GLU 183 270 270 GLU GLU B . n 
B 1 184 GLN 184 271 271 GLN GLN B . n 
B 1 185 ILE 185 272 272 ILE ILE B . n 
B 1 186 VAL 186 273 273 VAL VAL B . n 
B 1 187 GLY 187 274 274 GLY GLY B . n 
B 1 188 PRO 188 275 275 PRO PRO B . n 
B 1 189 LEU 189 276 276 LEU LEU B . n 
B 1 190 GLU 190 277 277 GLU GLU B . n 
B 1 191 SER 191 278 278 SER SER B . n 
B 1 192 PRO 192 279 ?   ?   ?   B . n 
B 1 193 VAL 193 280 ?   ?   ?   B . n 
B 1 194 GLU 194 281 ?   ?   ?   B . n 
B 1 195 ASP 195 282 ?   ?   ?   B . n 
B 1 196 SER 196 283 ?   ?   ?   B . n 
B 1 197 LEU 197 284 284 LEU LEU B . n 
B 1 198 TRP 198 285 285 TRP TRP B . n 
B 1 199 PRO 199 286 286 PRO PRO B . n 
B 1 200 TYR 200 287 287 TYR TYR B . n 
B 1 201 LYS 201 288 288 LYS LYS B . n 
B 1 202 GLY 202 289 289 GLY GLY B . n 
B 1 203 ARG 203 290 290 ARG ARG B . n 
B 1 204 PRO 204 291 291 PRO PRO B . n 
B 1 205 GLU 205 292 292 GLU GLU B . n 
B 1 206 ASN 206 293 293 ASN ASN B . n 
B 1 207 LYS 207 294 294 LYS LYS B . n 
B 1 208 SER 208 295 295 SER SER B . n 
B 1 209 PHE 209 296 296 PHE PHE B . n 
B 1 210 LEU 210 297 297 LEU LEU B . n 
B 1 211 TYR 211 298 298 TYR TYR B . n 
B 1 212 GLU 212 299 299 GLU GLU B . n 
B 1 213 ILE 213 300 300 ILE ILE B . n 
B 1 214 VAL 214 301 301 VAL VAL B . n 
B 1 215 SER 215 302 302 SER SER B . n 
B 1 216 ASN 216 303 303 ASN ASN B . n 
B 1 217 LYS 217 304 304 LYS LYS B . n 
B 1 218 ARG 218 305 305 ARG ARG B . n 
B 1 219 ASN 219 306 306 ASN ASN B . n 
B 1 220 GLY 220 307 307 GLY GLY B . n 
B 1 221 ILE 221 308 308 ILE ILE B . n 
B 1 222 ASP 222 309 309 ASP ASP B . n 
B 1 223 VAL 223 310 310 VAL VAL B . n 
B 1 224 ASP 224 311 311 ASP ASP B . n 
B 1 225 LYS 225 312 312 LYS LYS B . n 
B 1 226 TRP 226 313 313 TRP TRP B . n 
B 1 227 ASP 227 314 314 ASP ASP B . n 
B 1 228 TYR 228 315 315 TYR TYR B . n 
B 1 229 PHE 229 316 316 PHE PHE B . n 
B 1 230 ALA 230 317 317 ALA ALA B . n 
B 1 231 ARG 231 318 318 ARG ARG B . n 
B 1 232 ASP 232 319 319 ASP ASP B . n 
B 1 233 CYS 233 320 320 CYS CYS B . n 
B 1 234 HIS 234 321 321 HIS HIS B . n 
B 1 235 HIS 235 322 322 HIS HIS B . n 
B 1 236 LEU 236 323 323 LEU LEU B . n 
B 1 237 GLY 237 324 324 GLY GLY B . n 
B 1 238 ILE 238 325 325 ILE ILE B . n 
B 1 239 GLN 239 326 326 GLN GLN B . n 
B 1 240 ASN 240 327 327 ASN ASN B . n 
B 1 241 ASN 241 328 328 ASN ASN B . n 
B 1 242 PHE 242 329 329 PHE PHE B . n 
B 1 243 ASP 243 330 330 ASP ASP B . n 
B 1 244 TYR 244 331 331 TYR TYR B . n 
B 1 245 LYS 245 332 332 LYS LYS B . n 
B 1 246 ARG 246 333 333 ARG ARG B . n 
B 1 247 PHE 247 334 334 PHE PHE B . n 
B 1 248 ILE 248 335 335 ILE ILE B . n 
B 1 249 LYS 249 336 336 LYS LYS B . n 
B 1 250 PHE 250 337 337 PHE PHE B . n 
B 1 251 ALA 251 338 338 ALA ALA B . n 
B 1 252 ARG 252 339 339 ARG ARG B . n 
B 1 253 VAL 253 340 340 VAL VAL B . n 
B 1 254 CYS 254 341 341 CYS CYS B . n 
B 1 255 GLU 255 342 342 GLU GLU B . n 
B 1 256 VAL 256 343 343 VAL VAL B . n 
B 1 257 ASP 257 344 344 ASP ASP B . n 
B 1 258 ASN 258 345 345 ASN ASN B . n 
B 1 259 GLU 259 346 346 GLU GLU B . n 
B 1 260 LEU 260 347 347 LEU LEU B . n 
B 1 261 ARG 261 348 348 ARG ARG B . n 
B 1 262 ILE 262 349 349 ILE ILE B . n 
B 1 263 CYS 263 350 350 CYS CYS B . n 
B 1 264 ALA 264 351 351 ALA ALA B . n 
B 1 265 ARG 265 352 352 ARG ARG B . n 
B 1 266 ASP 266 353 353 ASP ASP B . n 
B 1 267 LYS 267 354 354 LYS LYS B . n 
B 1 268 GLU 268 355 355 GLU GLU B . n 
B 1 269 VAL 269 356 356 VAL VAL B . n 
B 1 270 GLY 270 357 357 GLY GLY B . n 
B 1 271 ASN 271 358 358 ASN ASN B . n 
B 1 272 LEU 272 359 359 LEU LEU B . n 
B 1 273 TYR 273 360 360 TYR TYR B . n 
B 1 274 ASP 274 361 361 ASP ASP B . n 
B 1 275 MET 275 362 362 MET MET B . n 
B 1 276 PHE 276 363 363 PHE PHE B . n 
B 1 277 HIS 277 364 364 HIS HIS B . n 
B 1 278 THR 278 365 365 THR THR B . n 
B 1 279 ARG 279 366 366 ARG ARG B . n 
B 1 280 ASN 280 367 367 ASN ASN B . n 
B 1 281 SER 281 368 368 SER SER B . n 
B 1 282 LEU 282 369 369 LEU LEU B . n 
B 1 283 HIS 283 370 370 HIS HIS B . n 
B 1 284 ARG 284 371 371 ARG ARG B . n 
B 1 285 ARG 285 372 372 ARG ARG B . n 
B 1 286 ALA 286 373 373 ALA ALA B . n 
B 1 287 TYR 287 374 374 TYR TYR B . n 
B 1 288 GLN 288 375 375 GLN GLN B . n 
B 1 289 HIS 289 376 376 HIS HIS B . n 
B 1 290 LYS 290 377 377 LYS LYS B . n 
B 1 291 VAL 291 378 378 VAL VAL B . n 
B 1 292 GLY 292 379 379 GLY GLY B . n 
B 1 293 ASN 293 380 380 ASN ASN B . n 
B 1 294 ILE 294 381 381 ILE ILE B . n 
B 1 295 ILE 295 382 382 ILE ILE B . n 
B 1 296 ASP 296 383 383 ASP ASP B . n 
B 1 297 THR 297 384 384 THR THR B . n 
B 1 298 MET 298 385 385 MET MET B . n 
B 1 299 ILE 299 386 386 ILE ILE B . n 
B 1 300 THR 300 387 387 THR THR B . n 
B 1 301 ASP 301 388 388 ASP ASP B . n 
B 1 302 ALA 302 389 389 ALA ALA B . n 
B 1 303 PHE 303 390 390 PHE PHE B . n 
B 1 304 LEU 304 391 391 LEU LEU B . n 
B 1 305 LYS 305 392 392 LYS LYS B . n 
B 1 306 ALA 306 393 393 ALA ALA B . n 
B 1 307 ASP 307 394 394 ASP ASP B . n 
B 1 308 ASP 308 395 395 ASP ASP B . n 
B 1 309 TYR 309 396 396 TYR TYR B . n 
B 1 310 ILE 310 397 397 ILE ILE B . n 
B 1 311 GLU 311 398 398 GLU GLU B . n 
B 1 312 ILE 312 399 399 ILE ILE B . n 
B 1 313 THR 313 400 400 THR THR B . n 
B 1 314 GLY 314 401 401 GLY GLY B . n 
B 1 315 ALA 315 402 402 ALA ALA B . n 
B 1 316 GLY 316 403 403 GLY GLY B . n 
B 1 317 GLY 317 404 404 GLY GLY B . n 
B 1 318 LYS 318 405 405 LYS LYS B . n 
B 1 319 LYS 319 406 406 LYS LYS B . n 
B 1 320 TYR 320 407 407 TYR TYR B . n 
B 1 321 ARG 321 408 408 ARG ARG B . n 
B 1 322 ILE 322 409 409 ILE ILE B . n 
B 1 323 SER 323 410 410 SER SER B . n 
B 1 324 THR 324 411 411 THR THR B . n 
B 1 325 ALA 325 412 412 ALA ALA B . n 
B 1 326 ILE 326 413 413 ILE ILE B . n 
B 1 327 ASP 327 414 414 ASP ASP B . n 
B 1 328 ASP 328 415 415 ASP ASP B . n 
B 1 329 MET 329 416 416 MET MET B . n 
B 1 330 GLU 330 417 417 GLU GLU B . n 
B 1 331 ALA 331 418 418 ALA ALA B . n 
B 1 332 TYR 332 419 419 TYR TYR B . n 
B 1 333 THR 333 420 420 THR THR B . n 
B 1 334 LYS 334 421 421 LYS LYS B . n 
B 1 335 LEU 335 422 422 LEU LEU B . n 
B 1 336 THR 336 423 423 THR THR B . n 
B 1 337 ASP 337 424 424 ASP ASP B . n 
B 1 338 ASN 338 425 425 ASN ASN B . n 
B 1 339 ILE 339 426 426 ILE ILE B . n 
B 1 340 PHE 340 427 427 PHE PHE B . n 
B 1 341 LEU 341 428 428 LEU LEU B . n 
B 1 342 GLU 342 429 429 GLU GLU B . n 
B 1 343 ILE 343 430 430 ILE ILE B . n 
B 1 344 LEU 344 431 431 LEU LEU B . n 
B 1 345 TYR 345 432 432 TYR TYR B . n 
B 1 346 SER 346 433 433 SER SER B . n 
B 1 347 THR 347 434 434 THR THR B . n 
B 1 348 ASP 348 435 435 ASP ASP B . n 
B 1 349 PRO 349 436 436 PRO PRO B . n 
B 1 350 LYS 350 437 437 LYS LYS B . n 
B 1 351 LEU 351 438 438 LEU LEU B . n 
B 1 352 LYS 352 439 439 LYS LYS B . n 
B 1 353 ASP 353 440 440 ASP ASP B . n 
B 1 354 ALA 354 441 441 ALA ALA B . n 
B 1 355 ARG 355 442 442 ARG ARG B . n 
B 1 356 GLU 356 443 443 GLU GLU B . n 
B 1 357 ILE 357 444 444 ILE ILE B . n 
B 1 358 LEU 358 445 445 LEU LEU B . n 
B 1 359 LYS 359 446 446 LYS LYS B . n 
B 1 360 GLN 360 447 447 GLN GLN B . n 
B 1 361 ILE 361 448 448 ILE ILE B . n 
B 1 362 GLU 362 449 449 GLU GLU B . n 
B 1 363 TYR 363 450 450 TYR TYR B . n 
B 1 364 ARG 364 451 451 ARG ARG B . n 
B 1 365 ASN 365 452 452 ASN ASN B . n 
B 1 366 LEU 366 453 453 LEU LEU B . n 
B 1 367 PHE 367 454 454 PHE PHE B . n 
B 1 368 LYS 368 455 455 LYS LYS B . n 
B 1 369 TYR 369 456 456 TYR TYR B . n 
B 1 370 VAL 370 457 457 VAL VAL B . n 
B 1 371 GLY 371 458 458 GLY GLY B . n 
B 1 372 GLU 372 459 459 GLU GLU B . n 
B 1 373 THR 373 460 460 THR THR B . n 
B 1 374 GLN 374 461 461 GLN GLN B . n 
B 1 375 PRO 375 462 462 PRO PRO B . n 
B 1 376 THR 376 463 463 THR THR B . n 
B 1 377 GLY 377 464 464 GLY GLY B . n 
B 1 378 GLN 378 465 465 GLN GLN B . n 
B 1 379 ILE 379 466 466 ILE ILE B . n 
B 1 380 LYS 380 467 467 LYS LYS B . n 
B 1 381 ILE 381 468 468 ILE ILE B . n 
B 1 382 LYS 382 469 469 LYS LYS B . n 
B 1 383 ARG 383 470 470 ARG ARG B . n 
B 1 384 GLU 384 471 471 GLU GLU B . n 
B 1 385 ASP 385 472 472 ASP ASP B . n 
B 1 386 TYR 386 473 473 TYR TYR B . n 
B 1 387 GLU 387 474 474 GLU GLU B . n 
B 1 388 SER 388 475 475 SER SER B . n 
B 1 389 LEU 389 476 476 LEU LEU B . n 
B 1 390 PRO 390 477 477 PRO PRO B . n 
B 1 391 LYS 391 478 478 LYS LYS B . n 
B 1 392 GLU 392 479 479 GLU GLU B . n 
B 1 393 VAL 393 480 480 VAL VAL B . n 
B 1 394 ALA 394 481 481 ALA ALA B . n 
B 1 395 SER 395 482 482 SER SER B . n 
B 1 396 ALA 396 483 483 ALA ALA B . n 
B 1 397 LYS 397 484 484 LYS LYS B . n 
B 1 398 PRO 398 485 485 PRO PRO B . n 
B 1 399 LYS 399 486 486 LYS LYS B . n 
B 1 400 VAL 400 487 487 VAL VAL B . n 
B 1 401 LEU 401 488 488 LEU LEU B . n 
B 1 402 LEU 402 489 489 LEU LEU B . n 
B 1 403 ASP 403 490 490 ASP ASP B . n 
B 1 404 VAL 404 491 491 VAL VAL B . n 
B 1 405 LYS 405 492 492 LYS LYS B . n 
B 1 406 LEU 406 493 493 LEU LEU B . n 
B 1 407 LYS 407 494 494 LYS LYS B . n 
B 1 408 ALA 408 495 495 ALA ALA B . n 
B 1 409 GLU 409 496 496 GLU GLU B . n 
B 1 410 ASP 410 497 497 ASP ASP B . n 
B 1 411 PHE 411 498 498 PHE PHE B . n 
B 1 412 ILE 412 499 499 ILE ILE B . n 
B 1 413 VAL 413 500 500 VAL VAL B . n 
B 1 414 ASP 414 501 501 ASP ASP B . n 
B 1 415 VAL 415 502 502 VAL VAL B . n 
B 1 416 ILE 416 503 503 ILE ILE B . n 
B 1 417 ASN 417 504 504 ASN ASN B . n 
B 1 418 MET 418 505 505 MET MET B . n 
B 1 419 ASP 419 506 506 ASP ASP B . n 
B 1 420 TYR 420 507 507 TYR TYR B . n 
B 1 421 GLY 421 508 508 GLY GLY B . n 
B 1 422 MET 422 509 509 MET MET B . n 
B 1 423 GLN 423 510 510 GLN GLN B . n 
B 1 424 GLU 424 511 511 GLU GLU B . n 
B 1 425 LYS 425 512 512 LYS LYS B . n 
B 1 426 ASN 426 513 513 ASN ASN B . n 
B 1 427 PRO 427 514 514 PRO PRO B . n 
B 1 428 ILE 428 515 515 ILE ILE B . n 
B 1 429 ASP 429 516 516 ASP ASP B . n 
B 1 430 HIS 430 517 517 HIS HIS B . n 
B 1 431 VAL 431 518 518 VAL VAL B . n 
B 1 432 SER 432 519 519 SER SER B . n 
B 1 433 PHE 433 520 520 PHE PHE B . n 
B 1 434 TYR 434 521 521 TYR TYR B . n 
B 1 435 CYS 435 522 522 CYS CYS B . n 
B 1 436 LYS 436 523 523 LYS LYS B . n 
B 1 437 THR 437 524 524 THR THR B . n 
B 1 438 ALA 438 525 525 ALA ALA B . n 
B 1 439 PRO 439 526 526 PRO PRO B . n 
B 1 440 ASN 440 527 527 ASN ASN B . n 
B 1 441 ARG 441 528 528 ARG ARG B . n 
B 1 442 ALA 442 529 529 ALA ALA B . n 
B 1 443 ILE 443 530 530 ILE ILE B . n 
B 1 444 ARG 444 531 531 ARG ARG B . n 
B 1 445 ILE 445 532 532 ILE ILE B . n 
B 1 446 THR 446 533 533 THR THR B . n 
B 1 447 LYS 447 534 534 LYS LYS B . n 
B 1 448 ASN 448 535 535 ASN ASN B . n 
B 1 449 GLN 449 536 536 GLN GLN B . n 
B 1 450 VAL 450 537 537 VAL VAL B . n 
B 1 451 SER 451 538 538 SER SER B . n 
B 1 452 GLN 452 539 539 GLN GLN B . n 
B 1 453 LEU 453 540 540 LEU LEU B . n 
B 1 454 LEU 454 541 541 LEU LEU B . n 
B 1 455 PRO 455 542 542 PRO PRO B . n 
B 1 456 GLU 456 543 543 GLU GLU B . n 
B 1 457 LYS 457 544 544 LYS LYS B . n 
B 1 458 PHE 458 545 545 PHE PHE B . n 
B 1 459 ALA 459 546 546 ALA ALA B . n 
B 1 460 GLU 460 547 547 GLU GLU B . n 
B 1 461 GLN 461 548 548 GLN GLN B . n 
B 1 462 LEU 462 549 549 LEU LEU B . n 
B 1 463 ILE 463 550 550 ILE ILE B . n 
B 1 464 ARG 464 551 551 ARG ARG B . n 
B 1 465 VAL 465 552 552 VAL VAL B . n 
B 1 466 TYR 466 553 553 TYR TYR B . n 
B 1 467 CYS 467 554 554 CYS CYS B . n 
B 1 468 LYS 468 555 555 LYS LYS B . n 
B 1 469 LYS 469 556 556 LYS LYS B . n 
B 1 470 VAL 470 557 557 VAL VAL B . n 
B 1 471 ASP 471 558 558 ASP ASP B . n 
B 1 472 ARG 472 559 559 ARG ARG B . n 
B 1 473 LYS 473 560 560 LYS LYS B . n 
B 1 474 SER 474 561 561 SER SER B . n 
B 1 475 LEU 475 562 562 LEU LEU B . n 
B 1 476 TYR 476 563 563 TYR TYR B . n 
B 1 477 ALA 477 564 564 ALA ALA B . n 
B 1 478 ALA 478 565 565 ALA ALA B . n 
B 1 479 ARG 479 566 566 ARG ARG B . n 
B 1 480 GLN 480 567 567 GLN GLN B . n 
B 1 481 TYR 481 568 568 TYR TYR B . n 
B 1 482 PHE 482 569 569 PHE PHE B . n 
B 1 483 VAL 483 570 570 VAL VAL B . n 
B 1 484 GLN 484 571 571 GLN GLN B . n 
B 1 485 TRP 485 572 572 TRP TRP B . n 
B 1 486 CYS 486 573 573 CYS CYS B . n 
B 1 487 ALA 487 574 574 ALA ALA B . n 
B 1 488 ASP 488 575 575 ASP ASP B . n 
B 1 489 ARG 489 576 576 ARG ARG B . n 
B 1 490 ASN 490 577 577 ASN ASN B . n 
B 1 491 PHE 491 578 578 PHE PHE B . n 
B 1 492 THR 492 579 579 THR THR B . n 
B 1 493 LYS 493 580 580 LYS LYS B . n 
B 1 494 PRO 494 581 581 PRO PRO B . n 
B 1 495 GLN 495 582 582 GLN GLN B . n 
B 1 496 ASP 496 583 583 ASP ASP B . n 
B 1 497 GLY 497 584 584 GLY GLY B . n 
B 1 498 ASP 498 585 585 ASP ASP B . n 
B 1 499 VAL 499 586 586 VAL VAL B . n 
B 1 500 ILE 500 587 587 ILE ILE B . n 
B 1 501 ALA 501 588 588 ALA ALA B . n 
B 1 502 PRO 502 589 589 PRO PRO B . n 
B 1 503 LEU 503 590 590 LEU LEU B . n 
B 1 504 ILE 504 591 591 ILE ILE B . n 
B 1 505 THR 505 592 592 THR THR B . n 
B 1 506 PRO 506 593 593 PRO PRO B . n 
B 1 507 GLN 507 594 594 GLN GLN B . n 
B 1 508 LYS 508 595 595 LYS LYS B . n 
B 1 509 LYS 509 596 596 LYS LYS B . n 
B 1 510 GLU 510 597 597 GLU GLU B . n 
B 1 511 TRP 511 598 598 TRP TRP B . n 
B 1 512 ASN 512 599 599 ASN ASN B . n 
B 1 513 ASP 513 600 ?   ?   ?   B . n 
B 1 514 SER 514 601 ?   ?   ?   B . n 
B 1 515 THR 515 602 ?   ?   ?   B . n 
B 1 516 SER 516 603 ?   ?   ?   B . n 
B 1 517 VAL 517 604 ?   ?   ?   B . n 
B 1 518 GLN 518 605 ?   ?   ?   B . n 
B 1 519 ASN 519 606 ?   ?   ?   B . n 
B 1 520 PRO 520 607 ?   ?   ?   B . n 
B 1 521 THR 521 608 ?   ?   ?   B . n 
B 1 522 ARG 522 609 ?   ?   ?   B . n 
B 1 523 LEU 523 610 ?   ?   ?   B . n 
B 1 524 ARG 524 611 ?   ?   ?   B . n 
B 1 525 GLU 525 612 ?   ?   ?   B . n 
B 1 526 ALA 526 613 ?   ?   ?   B . n 
B 1 527 SER 527 614 ?   ?   ?   B . n 
B 1 528 LYS 528 615 ?   ?   ?   B . n 
B 1 529 SER 529 616 ?   ?   ?   B . n 
B 1 530 ARG 530 617 ?   ?   ?   B . n 
B 1 531 VAL 531 618 ?   ?   ?   B . n 
B 1 532 GLN 532 619 ?   ?   ?   B . n 
B 1 533 LEU 533 620 ?   ?   ?   B . n 
B 1 534 PHE 534 621 ?   ?   ?   B . n 
B 1 535 LYS 535 622 ?   ?   ?   B . n 
B 1 536 ASP 536 623 ?   ?   ?   B . n 
B 1 537 ASP 537 624 ?   ?   ?   B . n 
B 1 538 PRO 538 625 ?   ?   ?   B . n 
B 1 539 MET 539 626 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 30150 ? 
1 MORE         -202  ? 
1 'SSA (A^2)'  70970 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 2_858 -x+3,y,-z+3 -1.0000000000 0.0000000000 0.0000000000 295.8230862490 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 234.4533035272 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O2G ? H DGT .   ? B DGT 801 ? 1_555 MG ? I MG . ? B MG 802 ? 1_555 O2B ? E DGT .   ? A DGT 703  ? 1_555 174.7 ? 
2  O2G ? H DGT .   ? B DGT 801 ? 1_555 MG ? I MG . ? B MG 802 ? 1_555 O3G ? E DGT .   ? A DGT 703  ? 1_555 93.5  ? 
3  O2B ? E DGT .   ? A DGT 703 ? 1_555 MG ? I MG . ? B MG 802 ? 1_555 O3G ? E DGT .   ? A DGT 703  ? 1_555 87.7  ? 
4  O2G ? H DGT .   ? B DGT 801 ? 1_555 MG ? I MG . ? B MG 802 ? 1_555 O1B ? H DGT .   ? B DGT 801  ? 1_555 86.8  ? 
5  O2B ? E DGT .   ? A DGT 703 ? 1_555 MG ? I MG . ? B MG 802 ? 1_555 O1B ? H DGT .   ? B DGT 801  ? 1_555 98.4  ? 
6  O3G ? E DGT .   ? A DGT 703 ? 1_555 MG ? I MG . ? B MG 802 ? 1_555 O1B ? H DGT .   ? B DGT 801  ? 1_555 92.2  ? 
7  O2G ? H DGT .   ? B DGT 801 ? 1_555 MG ? I MG . ? B MG 802 ? 1_555 O1A ? H DGT .   ? B DGT 801  ? 1_555 89.4  ? 
8  O2B ? E DGT .   ? A DGT 703 ? 1_555 MG ? I MG . ? B MG 802 ? 1_555 O1A ? H DGT .   ? B DGT 801  ? 1_555 89.5  ? 
9  O3G ? E DGT .   ? A DGT 703 ? 1_555 MG ? I MG . ? B MG 802 ? 1_555 O1A ? H DGT .   ? B DGT 801  ? 1_555 177.1 ? 
10 O1B ? H DGT .   ? B DGT 801 ? 1_555 MG ? I MG . ? B MG 802 ? 1_555 O1A ? H DGT .   ? B DGT 801  ? 1_555 88.1  ? 
11 O2G ? H DGT .   ? B DGT 801 ? 1_555 MG ? I MG . ? B MG 802 ? 1_555 O   ? N HOH .   ? B HOH 1241 ? 1_555 85.3  ? 
12 O2B ? E DGT .   ? A DGT 703 ? 1_555 MG ? I MG . ? B MG 802 ? 1_555 O   ? N HOH .   ? B HOH 1241 ? 1_555 89.4  ? 
13 O3G ? E DGT .   ? A DGT 703 ? 1_555 MG ? I MG . ? B MG 802 ? 1_555 O   ? N HOH .   ? B HOH 1241 ? 1_555 94.4  ? 
14 O1B ? H DGT .   ? B DGT 801 ? 1_555 MG ? I MG . ? B MG 802 ? 1_555 O   ? N HOH .   ? B HOH 1241 ? 1_555 170.0 ? 
15 O1A ? H DGT .   ? B DGT 801 ? 1_555 MG ? I MG . ? B MG 802 ? 1_555 O   ? N HOH .   ? B HOH 1241 ? 1_555 85.7  ? 
16 O1G ? L DTP .   ? B DTP 805 ? 1_555 MG ? G MG . ? A MG 705 ? 1_555 O2G ? F DGT .   ? A DGT 704  ? 1_555 96.1  ? 
17 O1G ? L DTP .   ? B DTP 805 ? 1_555 MG ? G MG . ? A MG 705 ? 1_555 O2B ? L DTP .   ? B DTP 805  ? 1_555 84.9  ? 
18 O2G ? F DGT .   ? A DGT 704 ? 1_555 MG ? G MG . ? A MG 705 ? 1_555 O2B ? L DTP .   ? B DTP 805  ? 1_555 176.6 ? 
19 O1G ? L DTP .   ? B DTP 805 ? 1_555 MG ? G MG . ? A MG 705 ? 1_555 O1B ? F DGT .   ? A DGT 704  ? 1_555 93.1  ? 
20 O2G ? F DGT .   ? A DGT 704 ? 1_555 MG ? G MG . ? A MG 705 ? 1_555 O1B ? F DGT .   ? A DGT 704  ? 1_555 86.0  ? 
21 O2B ? L DTP .   ? B DTP 805 ? 1_555 MG ? G MG . ? A MG 705 ? 1_555 O1B ? F DGT .   ? A DGT 704  ? 1_555 97.2  ? 
22 O1G ? L DTP .   ? B DTP 805 ? 1_555 MG ? G MG . ? A MG 705 ? 1_555 O1A ? F DGT .   ? A DGT 704  ? 1_555 173.3 ? 
23 O2G ? F DGT .   ? A DGT 704 ? 1_555 MG ? G MG . ? A MG 705 ? 1_555 O1A ? F DGT .   ? A DGT 704  ? 1_555 90.4  ? 
24 O2B ? L DTP .   ? B DTP 805 ? 1_555 MG ? G MG . ? A MG 705 ? 1_555 O1A ? F DGT .   ? A DGT 704  ? 1_555 88.7  ? 
25 O1B ? F DGT .   ? A DGT 704 ? 1_555 MG ? G MG . ? A MG 705 ? 1_555 O1A ? F DGT .   ? A DGT 704  ? 1_555 86.1  ? 
26 O1G ? L DTP .   ? B DTP 805 ? 1_555 MG ? G MG . ? A MG 705 ? 1_555 O   ? M HOH .   ? A HOH 1038 ? 1_555 97.8  ? 
27 O2G ? F DGT .   ? A DGT 704 ? 1_555 MG ? G MG . ? A MG 705 ? 1_555 O   ? M HOH .   ? A HOH 1038 ? 1_555 86.8  ? 
28 O2B ? L DTP .   ? B DTP 805 ? 1_555 MG ? G MG . ? A MG 705 ? 1_555 O   ? M HOH .   ? A HOH 1038 ? 1_555 89.9  ? 
29 O1B ? F DGT .   ? A DGT 704 ? 1_555 MG ? G MG . ? A MG 705 ? 1_555 O   ? M HOH .   ? A HOH 1038 ? 1_555 167.5 ? 
30 O1A ? F DGT .   ? A DGT 704 ? 1_555 MG ? G MG . ? A MG 705 ? 1_555 O   ? M HOH .   ? A HOH 1038 ? 1_555 83.8  ? 
31 NE2 ? B HIS 80  ? B HIS 167 ? 1_555 ZN ? J ZN . ? B ZN 803 ? 1_555 NE2 ? B HIS 119 ? B HIS 206  ? 1_555 107.5 ? 
32 NE2 ? B HIS 80  ? B HIS 167 ? 1_555 ZN ? J ZN . ? B ZN 803 ? 1_555 OD1 ? B ASP 224 ? B ASP 311  ? 1_555 92.3  ? 
33 NE2 ? B HIS 119 ? B HIS 206 ? 1_555 ZN ? J ZN . ? B ZN 803 ? 1_555 OD1 ? B ASP 224 ? B ASP 311  ? 1_555 94.5  ? 
34 NE2 ? B HIS 80  ? B HIS 167 ? 1_555 ZN ? J ZN . ? B ZN 803 ? 1_555 OD2 ? B ASP 120 ? B ASP 207  ? 1_555 87.7  ? 
35 NE2 ? B HIS 119 ? B HIS 206 ? 1_555 ZN ? J ZN . ? B ZN 803 ? 1_555 OD2 ? B ASP 120 ? B ASP 207  ? 1_555 84.4  ? 
36 OD1 ? B ASP 224 ? B ASP 311 ? 1_555 ZN ? J ZN . ? B ZN 803 ? 1_555 OD2 ? B ASP 120 ? B ASP 207  ? 1_555 178.8 ? 
37 NE2 ? A HIS 80  ? A HIS 167 ? 1_555 ZN ? C ZN . ? A ZN 701 ? 1_555 NE2 ? A HIS 119 ? A HIS 206  ? 1_555 106.1 ? 
38 NE2 ? A HIS 80  ? A HIS 167 ? 1_555 ZN ? C ZN . ? A ZN 701 ? 1_555 OD1 ? A ASP 224 ? A ASP 311  ? 1_555 89.0  ? 
39 NE2 ? A HIS 119 ? A HIS 206 ? 1_555 ZN ? C ZN . ? A ZN 701 ? 1_555 OD1 ? A ASP 224 ? A ASP 311  ? 1_555 88.7  ? 
40 NE2 ? A HIS 80  ? A HIS 167 ? 1_555 ZN ? C ZN . ? A ZN 701 ? 1_555 OD2 ? A ASP 120 ? A ASP 207  ? 1_555 90.5  ? 
41 NE2 ? A HIS 119 ? A HIS 206 ? 1_555 ZN ? C ZN . ? A ZN 701 ? 1_555 OD2 ? A ASP 120 ? A ASP 207  ? 1_555 82.4  ? 
42 OD1 ? A ASP 224 ? A ASP 311 ? 1_555 ZN ? C ZN . ? A ZN 701 ? 1_555 OD2 ? A ASP 120 ? A ASP 207  ? 1_555 170.6 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-11-20 
2 'Structure model' 1 1 2013-12-18 
3 'Structure model' 1 2 2017-03-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Refinement description' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
PHASES   phasing           .        ? 2 
REFMAC   refinement        5.6.0117 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 214 ? ? 54.50   -113.42 
2  1 SER A 214 ? ? 54.50   -112.79 
3  1 ARG A 220 ? ? -124.24 -54.15  
4  1 ASN A 306 ? ? -145.53 -1.68   
5  1 ASP A 344 ? ? 53.65   -122.42 
6  1 ALA A 373 ? ? -123.86 -59.80  
7  1 LEU A 488 ? ? -62.85  97.13   
8  1 MET A 509 ? ? -143.12 47.33   
9  1 GLN A 510 ? ? 49.42   -123.75 
10 1 ALA A 525 ? ? -150.53 69.39   
11 1 SER B 214 ? ? 54.40   -114.73 
12 1 ARG B 220 ? ? -124.73 -53.61  
13 1 ASN B 306 ? ? -148.66 -2.39   
14 1 ALA B 373 ? ? -123.36 -59.95  
15 1 MET B 509 ? ? -140.62 46.65   
16 1 GLN B 510 ? ? 54.81   -124.76 
17 1 ALA B 525 ? ? -152.37 73.84   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 88  ? A MET 1   
2   1 Y 1 A GLY 89  ? A GLY 2   
3   1 Y 1 A SER 90  ? A SER 3   
4   1 Y 1 A SER 91  ? A SER 4   
5   1 Y 1 A HIS 92  ? A HIS 5   
6   1 Y 1 A HIS 93  ? A HIS 6   
7   1 Y 1 A HIS 94  ? A HIS 7   
8   1 Y 1 A HIS 95  ? A HIS 8   
9   1 Y 1 A HIS 96  ? A HIS 9   
10  1 Y 1 A HIS 97  ? A HIS 10  
11  1 Y 1 A SER 98  ? A SER 11  
12  1 Y 1 A SER 99  ? A SER 12  
13  1 Y 1 A GLY 100 ? A GLY 13  
14  1 Y 1 A GLU 101 ? A GLU 14  
15  1 Y 1 A ASN 102 ? A ASN 15  
16  1 Y 1 A LEU 103 ? A LEU 16  
17  1 Y 1 A TYR 104 ? A TYR 17  
18  1 Y 1 A PHE 105 ? A PHE 18  
19  1 Y 1 A GLN 106 ? A GLN 19  
20  1 Y 1 A GLY 107 ? A GLY 20  
21  1 Y 1 A SER 108 ? A SER 21  
22  1 Y 1 A GLN 109 ? A GLN 22  
23  1 Y 1 A ILE 110 ? A ILE 23  
24  1 Y 1 A HIS 111 ? A HIS 24  
25  1 Y 1 A VAL 112 ? A VAL 25  
26  1 Y 1 A SER 278 ? A SER 191 
27  1 Y 1 A PRO 279 ? A PRO 192 
28  1 Y 1 A VAL 280 ? A VAL 193 
29  1 Y 1 A GLU 281 ? A GLU 194 
30  1 Y 1 A ASP 282 ? A ASP 195 
31  1 Y 1 A SER 283 ? A SER 196 
32  1 Y 1 A ASP 600 ? A ASP 513 
33  1 Y 1 A SER 601 ? A SER 514 
34  1 Y 1 A THR 602 ? A THR 515 
35  1 Y 1 A SER 603 ? A SER 516 
36  1 Y 1 A VAL 604 ? A VAL 517 
37  1 Y 1 A GLN 605 ? A GLN 518 
38  1 Y 1 A ASN 606 ? A ASN 519 
39  1 Y 1 A PRO 607 ? A PRO 520 
40  1 Y 1 A THR 608 ? A THR 521 
41  1 Y 1 A ARG 609 ? A ARG 522 
42  1 Y 1 A LEU 610 ? A LEU 523 
43  1 Y 1 A ARG 611 ? A ARG 524 
44  1 Y 1 A GLU 612 ? A GLU 525 
45  1 Y 1 A ALA 613 ? A ALA 526 
46  1 Y 1 A SER 614 ? A SER 527 
47  1 Y 1 A LYS 615 ? A LYS 528 
48  1 Y 1 A SER 616 ? A SER 529 
49  1 Y 1 A ARG 617 ? A ARG 530 
50  1 Y 1 A VAL 618 ? A VAL 531 
51  1 Y 1 A GLN 619 ? A GLN 532 
52  1 Y 1 A LEU 620 ? A LEU 533 
53  1 Y 1 A PHE 621 ? A PHE 534 
54  1 Y 1 A LYS 622 ? A LYS 535 
55  1 Y 1 A ASP 623 ? A ASP 536 
56  1 Y 1 A ASP 624 ? A ASP 537 
57  1 Y 1 A PRO 625 ? A PRO 538 
58  1 Y 1 A MET 626 ? A MET 539 
59  1 Y 1 B MET 88  ? B MET 1   
60  1 Y 1 B GLY 89  ? B GLY 2   
61  1 Y 1 B SER 90  ? B SER 3   
62  1 Y 1 B SER 91  ? B SER 4   
63  1 Y 1 B HIS 92  ? B HIS 5   
64  1 Y 1 B HIS 93  ? B HIS 6   
65  1 Y 1 B HIS 94  ? B HIS 7   
66  1 Y 1 B HIS 95  ? B HIS 8   
67  1 Y 1 B HIS 96  ? B HIS 9   
68  1 Y 1 B HIS 97  ? B HIS 10  
69  1 Y 1 B SER 98  ? B SER 11  
70  1 Y 1 B SER 99  ? B SER 12  
71  1 Y 1 B GLY 100 ? B GLY 13  
72  1 Y 1 B GLU 101 ? B GLU 14  
73  1 Y 1 B PRO 279 ? B PRO 192 
74  1 Y 1 B VAL 280 ? B VAL 193 
75  1 Y 1 B GLU 281 ? B GLU 194 
76  1 Y 1 B ASP 282 ? B ASP 195 
77  1 Y 1 B SER 283 ? B SER 196 
78  1 Y 1 B ASP 600 ? B ASP 513 
79  1 Y 1 B SER 601 ? B SER 514 
80  1 Y 1 B THR 602 ? B THR 515 
81  1 Y 1 B SER 603 ? B SER 516 
82  1 Y 1 B VAL 604 ? B VAL 517 
83  1 Y 1 B GLN 605 ? B GLN 518 
84  1 Y 1 B ASN 606 ? B ASN 519 
85  1 Y 1 B PRO 607 ? B PRO 520 
86  1 Y 1 B THR 608 ? B THR 521 
87  1 Y 1 B ARG 609 ? B ARG 522 
88  1 Y 1 B LEU 610 ? B LEU 523 
89  1 Y 1 B ARG 611 ? B ARG 524 
90  1 Y 1 B GLU 612 ? B GLU 525 
91  1 Y 1 B ALA 613 ? B ALA 526 
92  1 Y 1 B SER 614 ? B SER 527 
93  1 Y 1 B LYS 615 ? B LYS 528 
94  1 Y 1 B SER 616 ? B SER 529 
95  1 Y 1 B ARG 617 ? B ARG 530 
96  1 Y 1 B VAL 618 ? B VAL 531 
97  1 Y 1 B GLN 619 ? B GLN 532 
98  1 Y 1 B LEU 620 ? B LEU 533 
99  1 Y 1 B PHE 621 ? B PHE 534 
100 1 Y 1 B LYS 622 ? B LYS 535 
101 1 Y 1 B ASP 623 ? B ASP 536 
102 1 Y 1 B ASP 624 ? B ASP 537 
103 1 Y 1 B PRO 625 ? B PRO 538 
104 1 Y 1 B MET 626 ? B MET 539 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'                          ZN  
3 "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE" DGT 
4 'MAGNESIUM ION'                     MG  
5 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
6 water                               HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ZN  1   701  799 ZN  ZN  A . 
D 3 DGT 1   702  802 DGT DGT A . 
E 3 DGT 1   703  803 DGT DGT A . 
F 3 DGT 1   704  801 DGT DGT A . 
G 4 MG  1   705  806 MG  MG  A . 
H 3 DGT 1   801  801 DGT DGT B . 
I 4 MG  1   802  806 MG  MG  B . 
J 2 ZN  1   803  799 ZN  ZN  B . 
K 3 DGT 1   804  802 DGT DGT B . 
L 5 DTP 1   805  803 DTP DTP B . 
M 6 HOH 1   801  2   HOH HOH A . 
M 6 HOH 2   802  3   HOH HOH A . 
M 6 HOH 3   803  4   HOH HOH A . 
M 6 HOH 4   804  6   HOH HOH A . 
M 6 HOH 5   805  10  HOH HOH A . 
M 6 HOH 6   806  12  HOH HOH A . 
M 6 HOH 7   807  13  HOH HOH A . 
M 6 HOH 8   808  17  HOH HOH A . 
M 6 HOH 9   809  21  HOH HOH A . 
M 6 HOH 10  810  24  HOH HOH A . 
M 6 HOH 11  811  26  HOH HOH A . 
M 6 HOH 12  812  29  HOH HOH A . 
M 6 HOH 13  813  37  HOH HOH A . 
M 6 HOH 14  814  39  HOH HOH A . 
M 6 HOH 15  815  43  HOH HOH A . 
M 6 HOH 16  816  44  HOH HOH A . 
M 6 HOH 17  817  45  HOH HOH A . 
M 6 HOH 18  818  47  HOH HOH A . 
M 6 HOH 19  819  48  HOH HOH A . 
M 6 HOH 20  820  51  HOH HOH A . 
M 6 HOH 21  821  52  HOH HOH A . 
M 6 HOH 22  822  56  HOH HOH A . 
M 6 HOH 23  823  58  HOH HOH A . 
M 6 HOH 24  824  59  HOH HOH A . 
M 6 HOH 25  825  61  HOH HOH A . 
M 6 HOH 26  826  63  HOH HOH A . 
M 6 HOH 27  827  64  HOH HOH A . 
M 6 HOH 28  828  68  HOH HOH A . 
M 6 HOH 29  829  70  HOH HOH A . 
M 6 HOH 30  830  71  HOH HOH A . 
M 6 HOH 31  831  73  HOH HOH A . 
M 6 HOH 32  832  80  HOH HOH A . 
M 6 HOH 33  833  84  HOH HOH A . 
M 6 HOH 34  834  86  HOH HOH A . 
M 6 HOH 35  835  90  HOH HOH A . 
M 6 HOH 36  836  92  HOH HOH A . 
M 6 HOH 37  837  94  HOH HOH A . 
M 6 HOH 38  838  96  HOH HOH A . 
M 6 HOH 39  839  97  HOH HOH A . 
M 6 HOH 40  840  102 HOH HOH A . 
M 6 HOH 41  841  104 HOH HOH A . 
M 6 HOH 42  842  105 HOH HOH A . 
M 6 HOH 43  843  106 HOH HOH A . 
M 6 HOH 44  844  108 HOH HOH A . 
M 6 HOH 45  845  109 HOH HOH A . 
M 6 HOH 46  846  110 HOH HOH A . 
M 6 HOH 47  847  113 HOH HOH A . 
M 6 HOH 48  848  115 HOH HOH A . 
M 6 HOH 49  849  116 HOH HOH A . 
M 6 HOH 50  850  117 HOH HOH A . 
M 6 HOH 51  851  121 HOH HOH A . 
M 6 HOH 52  852  122 HOH HOH A . 
M 6 HOH 53  853  127 HOH HOH A . 
M 6 HOH 54  854  130 HOH HOH A . 
M 6 HOH 55  855  132 HOH HOH A . 
M 6 HOH 56  856  136 HOH HOH A . 
M 6 HOH 57  857  138 HOH HOH A . 
M 6 HOH 58  858  143 HOH HOH A . 
M 6 HOH 59  859  146 HOH HOH A . 
M 6 HOH 60  860  154 HOH HOH A . 
M 6 HOH 61  861  155 HOH HOH A . 
M 6 HOH 62  862  158 HOH HOH A . 
M 6 HOH 63  863  159 HOH HOH A . 
M 6 HOH 64  864  160 HOH HOH A . 
M 6 HOH 65  865  161 HOH HOH A . 
M 6 HOH 66  866  165 HOH HOH A . 
M 6 HOH 67  867  167 HOH HOH A . 
M 6 HOH 68  868  168 HOH HOH A . 
M 6 HOH 69  869  170 HOH HOH A . 
M 6 HOH 70  870  173 HOH HOH A . 
M 6 HOH 71  871  174 HOH HOH A . 
M 6 HOH 72  872  176 HOH HOH A . 
M 6 HOH 73  873  178 HOH HOH A . 
M 6 HOH 74  874  179 HOH HOH A . 
M 6 HOH 75  875  181 HOH HOH A . 
M 6 HOH 76  876  182 HOH HOH A . 
M 6 HOH 77  877  183 HOH HOH A . 
M 6 HOH 78  878  186 HOH HOH A . 
M 6 HOH 79  879  187 HOH HOH A . 
M 6 HOH 80  880  189 HOH HOH A . 
M 6 HOH 81  881  191 HOH HOH A . 
M 6 HOH 82  882  196 HOH HOH A . 
M 6 HOH 83  883  201 HOH HOH A . 
M 6 HOH 84  884  202 HOH HOH A . 
M 6 HOH 85  885  203 HOH HOH A . 
M 6 HOH 86  886  207 HOH HOH A . 
M 6 HOH 87  887  209 HOH HOH A . 
M 6 HOH 88  888  210 HOH HOH A . 
M 6 HOH 89  889  211 HOH HOH A . 
M 6 HOH 90  890  213 HOH HOH A . 
M 6 HOH 91  891  217 HOH HOH A . 
M 6 HOH 92  892  218 HOH HOH A . 
M 6 HOH 93  893  222 HOH HOH A . 
M 6 HOH 94  894  223 HOH HOH A . 
M 6 HOH 95  895  225 HOH HOH A . 
M 6 HOH 96  896  230 HOH HOH A . 
M 6 HOH 97  897  231 HOH HOH A . 
M 6 HOH 98  898  235 HOH HOH A . 
M 6 HOH 99  899  239 HOH HOH A . 
M 6 HOH 100 900  240 HOH HOH A . 
M 6 HOH 101 901  242 HOH HOH A . 
M 6 HOH 102 902  243 HOH HOH A . 
M 6 HOH 103 903  244 HOH HOH A . 
M 6 HOH 104 904  249 HOH HOH A . 
M 6 HOH 105 905  251 HOH HOH A . 
M 6 HOH 106 906  253 HOH HOH A . 
M 6 HOH 107 907  255 HOH HOH A . 
M 6 HOH 108 908  257 HOH HOH A . 
M 6 HOH 109 909  259 HOH HOH A . 
M 6 HOH 110 910  260 HOH HOH A . 
M 6 HOH 111 911  263 HOH HOH A . 
M 6 HOH 112 912  264 HOH HOH A . 
M 6 HOH 113 913  265 HOH HOH A . 
M 6 HOH 114 914  266 HOH HOH A . 
M 6 HOH 115 915  268 HOH HOH A . 
M 6 HOH 116 916  269 HOH HOH A . 
M 6 HOH 117 917  270 HOH HOH A . 
M 6 HOH 118 918  274 HOH HOH A . 
M 6 HOH 119 919  275 HOH HOH A . 
M 6 HOH 120 920  276 HOH HOH A . 
M 6 HOH 121 921  277 HOH HOH A . 
M 6 HOH 122 922  279 HOH HOH A . 
M 6 HOH 123 923  280 HOH HOH A . 
M 6 HOH 124 924  281 HOH HOH A . 
M 6 HOH 125 925  282 HOH HOH A . 
M 6 HOH 126 926  285 HOH HOH A . 
M 6 HOH 127 927  287 HOH HOH A . 
M 6 HOH 128 928  290 HOH HOH A . 
M 6 HOH 129 929  293 HOH HOH A . 
M 6 HOH 130 930  296 HOH HOH A . 
M 6 HOH 131 931  297 HOH HOH A . 
M 6 HOH 132 932  298 HOH HOH A . 
M 6 HOH 133 933  300 HOH HOH A . 
M 6 HOH 134 934  301 HOH HOH A . 
M 6 HOH 135 935  302 HOH HOH A . 
M 6 HOH 136 936  303 HOH HOH A . 
M 6 HOH 137 937  305 HOH HOH A . 
M 6 HOH 138 938  310 HOH HOH A . 
M 6 HOH 139 939  311 HOH HOH A . 
M 6 HOH 140 940  322 HOH HOH A . 
M 6 HOH 141 941  323 HOH HOH A . 
M 6 HOH 142 942  324 HOH HOH A . 
M 6 HOH 143 943  325 HOH HOH A . 
M 6 HOH 144 944  328 HOH HOH A . 
M 6 HOH 145 945  331 HOH HOH A . 
M 6 HOH 146 946  332 HOH HOH A . 
M 6 HOH 147 947  335 HOH HOH A . 
M 6 HOH 148 948  336 HOH HOH A . 
M 6 HOH 149 949  337 HOH HOH A . 
M 6 HOH 150 950  338 HOH HOH A . 
M 6 HOH 151 951  340 HOH HOH A . 
M 6 HOH 152 952  342 HOH HOH A . 
M 6 HOH 153 953  344 HOH HOH A . 
M 6 HOH 154 954  351 HOH HOH A . 
M 6 HOH 155 955  352 HOH HOH A . 
M 6 HOH 156 956  353 HOH HOH A . 
M 6 HOH 157 957  355 HOH HOH A . 
M 6 HOH 158 958  357 HOH HOH A . 
M 6 HOH 159 959  358 HOH HOH A . 
M 6 HOH 160 960  360 HOH HOH A . 
M 6 HOH 161 961  363 HOH HOH A . 
M 6 HOH 162 962  367 HOH HOH A . 
M 6 HOH 163 963  370 HOH HOH A . 
M 6 HOH 164 964  376 HOH HOH A . 
M 6 HOH 165 965  378 HOH HOH A . 
M 6 HOH 166 966  379 HOH HOH A . 
M 6 HOH 167 967  386 HOH HOH A . 
M 6 HOH 168 968  388 HOH HOH A . 
M 6 HOH 169 969  389 HOH HOH A . 
M 6 HOH 170 970  395 HOH HOH A . 
M 6 HOH 171 971  396 HOH HOH A . 
M 6 HOH 172 972  399 HOH HOH A . 
M 6 HOH 173 973  402 HOH HOH A . 
M 6 HOH 174 974  403 HOH HOH A . 
M 6 HOH 175 975  405 HOH HOH A . 
M 6 HOH 176 976  406 HOH HOH A . 
M 6 HOH 177 977  407 HOH HOH A . 
M 6 HOH 178 978  410 HOH HOH A . 
M 6 HOH 179 979  415 HOH HOH A . 
M 6 HOH 180 980  420 HOH HOH A . 
M 6 HOH 181 981  422 HOH HOH A . 
M 6 HOH 182 982  423 HOH HOH A . 
M 6 HOH 183 983  432 HOH HOH A . 
M 6 HOH 184 984  436 HOH HOH A . 
M 6 HOH 185 985  437 HOH HOH A . 
M 6 HOH 186 986  438 HOH HOH A . 
M 6 HOH 187 987  444 HOH HOH A . 
M 6 HOH 188 988  445 HOH HOH A . 
M 6 HOH 189 989  447 HOH HOH A . 
M 6 HOH 190 990  449 HOH HOH A . 
M 6 HOH 191 991  451 HOH HOH A . 
M 6 HOH 192 992  457 HOH HOH A . 
M 6 HOH 193 993  458 HOH HOH A . 
M 6 HOH 194 994  461 HOH HOH A . 
M 6 HOH 195 995  465 HOH HOH A . 
M 6 HOH 196 996  467 HOH HOH A . 
M 6 HOH 197 997  476 HOH HOH A . 
M 6 HOH 198 998  479 HOH HOH A . 
M 6 HOH 199 999  483 HOH HOH A . 
M 6 HOH 200 1000 484 HOH HOH A . 
M 6 HOH 201 1001 485 HOH HOH A . 
M 6 HOH 202 1002 490 HOH HOH A . 
M 6 HOH 203 1003 491 HOH HOH A . 
M 6 HOH 204 1004 492 HOH HOH A . 
M 6 HOH 205 1005 495 HOH HOH A . 
M 6 HOH 206 1006 497 HOH HOH A . 
M 6 HOH 207 1007 499 HOH HOH A . 
M 6 HOH 208 1008 501 HOH HOH A . 
M 6 HOH 209 1009 503 HOH HOH A . 
M 6 HOH 210 1010 506 HOH HOH A . 
M 6 HOH 211 1011 507 HOH HOH A . 
M 6 HOH 212 1012 510 HOH HOH A . 
M 6 HOH 213 1013 515 HOH HOH A . 
M 6 HOH 214 1014 516 HOH HOH A . 
M 6 HOH 215 1015 518 HOH HOH A . 
M 6 HOH 216 1016 523 HOH HOH A . 
M 6 HOH 217 1017 524 HOH HOH A . 
M 6 HOH 218 1018 525 HOH HOH A . 
M 6 HOH 219 1019 532 HOH HOH A . 
M 6 HOH 220 1020 533 HOH HOH A . 
M 6 HOH 221 1021 534 HOH HOH A . 
M 6 HOH 222 1022 538 HOH HOH A . 
M 6 HOH 223 1023 539 HOH HOH A . 
M 6 HOH 224 1024 542 HOH HOH A . 
M 6 HOH 225 1025 543 HOH HOH A . 
M 6 HOH 226 1026 544 HOH HOH A . 
M 6 HOH 227 1027 548 HOH HOH A . 
M 6 HOH 228 1028 549 HOH HOH A . 
M 6 HOH 229 1029 553 HOH HOH A . 
M 6 HOH 230 1030 558 HOH HOH A . 
M 6 HOH 231 1031 559 HOH HOH A . 
M 6 HOH 232 1032 561 HOH HOH A . 
M 6 HOH 233 1033 562 HOH HOH A . 
M 6 HOH 234 1034 566 HOH HOH A . 
M 6 HOH 235 1035 569 HOH HOH A . 
M 6 HOH 236 1036 571 HOH HOH A . 
M 6 HOH 237 1037 575 HOH HOH A . 
M 6 HOH 238 1038 578 HOH HOH A . 
M 6 HOH 239 1039 580 HOH HOH A . 
M 6 HOH 240 1040 582 HOH HOH A . 
M 6 HOH 241 1041 584 HOH HOH A . 
M 6 HOH 242 1042 587 HOH HOH A . 
M 6 HOH 243 1043 590 HOH HOH A . 
M 6 HOH 244 1044 592 HOH HOH A . 
M 6 HOH 245 1045 595 HOH HOH A . 
M 6 HOH 246 1046 596 HOH HOH A . 
M 6 HOH 247 1047 598 HOH HOH A . 
M 6 HOH 248 1048 599 HOH HOH A . 
M 6 HOH 249 1049 601 HOH HOH A . 
M 6 HOH 250 1050 603 HOH HOH A . 
M 6 HOH 251 1051 604 HOH HOH A . 
M 6 HOH 252 1052 605 HOH HOH A . 
M 6 HOH 253 1053 615 HOH HOH A . 
M 6 HOH 254 1054 619 HOH HOH A . 
M 6 HOH 255 1055 622 HOH HOH A . 
M 6 HOH 256 1056 624 HOH HOH A . 
M 6 HOH 257 1057 625 HOH HOH A . 
M 6 HOH 258 1058 627 HOH HOH A . 
M 6 HOH 259 1059 628 HOH HOH A . 
M 6 HOH 260 1060 629 HOH HOH A . 
M 6 HOH 261 1061 630 HOH HOH A . 
M 6 HOH 262 1062 631 HOH HOH A . 
M 6 HOH 263 1063 632 HOH HOH A . 
M 6 HOH 264 1064 634 HOH HOH A . 
M 6 HOH 265 1065 635 HOH HOH A . 
M 6 HOH 266 1066 636 HOH HOH A . 
M 6 HOH 267 1067 642 HOH HOH A . 
M 6 HOH 268 1068 643 HOH HOH A . 
M 6 HOH 269 1069 644 HOH HOH A . 
M 6 HOH 270 1070 650 HOH HOH A . 
M 6 HOH 271 1071 653 HOH HOH A . 
M 6 HOH 272 1072 654 HOH HOH A . 
M 6 HOH 273 1073 657 HOH HOH A . 
M 6 HOH 274 1074 658 HOH HOH A . 
M 6 HOH 275 1075 661 HOH HOH A . 
M 6 HOH 276 1076 662 HOH HOH A . 
M 6 HOH 277 1077 666 HOH HOH A . 
M 6 HOH 278 1078 670 HOH HOH A . 
M 6 HOH 279 1079 673 HOH HOH A . 
M 6 HOH 280 1080 674 HOH HOH A . 
M 6 HOH 281 1081 676 HOH HOH A . 
M 6 HOH 282 1082 677 HOH HOH A . 
M 6 HOH 283 1083 679 HOH HOH A . 
M 6 HOH 284 1084 681 HOH HOH A . 
M 6 HOH 285 1085 683 HOH HOH A . 
M 6 HOH 286 1086 686 HOH HOH A . 
M 6 HOH 287 1087 690 HOH HOH A . 
M 6 HOH 288 1088 691 HOH HOH A . 
M 6 HOH 289 1089 692 HOH HOH A . 
M 6 HOH 290 1090 694 HOH HOH A . 
M 6 HOH 291 1091 695 HOH HOH A . 
M 6 HOH 292 1092 696 HOH HOH A . 
M 6 HOH 293 1093 697 HOH HOH A . 
M 6 HOH 294 1094 698 HOH HOH A . 
M 6 HOH 295 1095 699 HOH HOH A . 
M 6 HOH 296 1096 701 HOH HOH A . 
M 6 HOH 297 1097 702 HOH HOH A . 
M 6 HOH 298 1098 705 HOH HOH A . 
M 6 HOH 299 1099 710 HOH HOH A . 
M 6 HOH 300 1100 712 HOH HOH A . 
M 6 HOH 301 1101 713 HOH HOH A . 
M 6 HOH 302 1102 715 HOH HOH A . 
M 6 HOH 303 1103 716 HOH HOH A . 
M 6 HOH 304 1104 717 HOH HOH A . 
M 6 HOH 305 1105 718 HOH HOH A . 
M 6 HOH 306 1106 722 HOH HOH A . 
M 6 HOH 307 1107 723 HOH HOH A . 
M 6 HOH 308 1108 724 HOH HOH A . 
M 6 HOH 309 1109 728 HOH HOH A . 
M 6 HOH 310 1110 729 HOH HOH A . 
M 6 HOH 311 1111 732 HOH HOH A . 
M 6 HOH 312 1112 733 HOH HOH A . 
M 6 HOH 313 1113 735 HOH HOH A . 
M 6 HOH 314 1114 736 HOH HOH A . 
M 6 HOH 315 1115 737 HOH HOH A . 
M 6 HOH 316 1116 738 HOH HOH A . 
M 6 HOH 317 1117 740 HOH HOH A . 
M 6 HOH 318 1118 742 HOH HOH A . 
M 6 HOH 319 1119 746 HOH HOH A . 
M 6 HOH 320 1120 749 HOH HOH A . 
M 6 HOH 321 1121 753 HOH HOH A . 
M 6 HOH 322 1122 754 HOH HOH A . 
M 6 HOH 323 1123 757 HOH HOH A . 
M 6 HOH 324 1124 760 HOH HOH A . 
M 6 HOH 325 1125 761 HOH HOH A . 
M 6 HOH 326 1126 763 HOH HOH A . 
M 6 HOH 327 1127 764 HOH HOH A . 
M 6 HOH 328 1128 765 HOH HOH A . 
M 6 HOH 329 1129 766 HOH HOH A . 
M 6 HOH 330 1130 767 HOH HOH A . 
M 6 HOH 331 1131 774 HOH HOH A . 
M 6 HOH 332 1132 776 HOH HOH A . 
M 6 HOH 333 1133 778 HOH HOH A . 
M 6 HOH 334 1134 783 HOH HOH A . 
M 6 HOH 335 1135 785 HOH HOH A . 
M 6 HOH 336 1136 788 HOH HOH A . 
M 6 HOH 337 1137 790 HOH HOH A . 
M 6 HOH 338 1138 791 HOH HOH A . 
M 6 HOH 339 1139 792 HOH HOH A . 
M 6 HOH 340 1140 794 HOH HOH A . 
M 6 HOH 341 1141 799 HOH HOH A . 
M 6 HOH 342 1142 802 HOH HOH A . 
M 6 HOH 343 1143 810 HOH HOH A . 
M 6 HOH 344 1144 811 HOH HOH A . 
M 6 HOH 345 1145 812 HOH HOH A . 
M 6 HOH 346 1146 816 HOH HOH A . 
M 6 HOH 347 1147 818 HOH HOH A . 
N 6 HOH 1   901  1   HOH HOH B . 
N 6 HOH 2   902  5   HOH HOH B . 
N 6 HOH 3   903  7   HOH HOH B . 
N 6 HOH 4   904  8   HOH HOH B . 
N 6 HOH 5   905  9   HOH HOH B . 
N 6 HOH 6   906  11  HOH HOH B . 
N 6 HOH 7   907  14  HOH HOH B . 
N 6 HOH 8   908  15  HOH HOH B . 
N 6 HOH 9   909  16  HOH HOH B . 
N 6 HOH 10  910  18  HOH HOH B . 
N 6 HOH 11  911  19  HOH HOH B . 
N 6 HOH 12  912  20  HOH HOH B . 
N 6 HOH 13  913  22  HOH HOH B . 
N 6 HOH 14  914  23  HOH HOH B . 
N 6 HOH 15  915  25  HOH HOH B . 
N 6 HOH 16  916  27  HOH HOH B . 
N 6 HOH 17  917  28  HOH HOH B . 
N 6 HOH 18  918  30  HOH HOH B . 
N 6 HOH 19  919  31  HOH HOH B . 
N 6 HOH 20  920  32  HOH HOH B . 
N 6 HOH 21  921  33  HOH HOH B . 
N 6 HOH 22  922  34  HOH HOH B . 
N 6 HOH 23  923  35  HOH HOH B . 
N 6 HOH 24  924  36  HOH HOH B . 
N 6 HOH 25  925  38  HOH HOH B . 
N 6 HOH 26  926  40  HOH HOH B . 
N 6 HOH 27  927  41  HOH HOH B . 
N 6 HOH 28  928  42  HOH HOH B . 
N 6 HOH 29  929  46  HOH HOH B . 
N 6 HOH 30  930  49  HOH HOH B . 
N 6 HOH 31  931  50  HOH HOH B . 
N 6 HOH 32  932  53  HOH HOH B . 
N 6 HOH 33  933  54  HOH HOH B . 
N 6 HOH 34  934  55  HOH HOH B . 
N 6 HOH 35  935  57  HOH HOH B . 
N 6 HOH 36  936  60  HOH HOH B . 
N 6 HOH 37  937  62  HOH HOH B . 
N 6 HOH 38  938  65  HOH HOH B . 
N 6 HOH 39  939  66  HOH HOH B . 
N 6 HOH 40  940  67  HOH HOH B . 
N 6 HOH 41  941  69  HOH HOH B . 
N 6 HOH 42  942  72  HOH HOH B . 
N 6 HOH 43  943  74  HOH HOH B . 
N 6 HOH 44  944  75  HOH HOH B . 
N 6 HOH 45  945  76  HOH HOH B . 
N 6 HOH 46  946  77  HOH HOH B . 
N 6 HOH 47  947  78  HOH HOH B . 
N 6 HOH 48  948  79  HOH HOH B . 
N 6 HOH 49  949  81  HOH HOH B . 
N 6 HOH 50  950  82  HOH HOH B . 
N 6 HOH 51  951  83  HOH HOH B . 
N 6 HOH 52  952  85  HOH HOH B . 
N 6 HOH 53  953  87  HOH HOH B . 
N 6 HOH 54  954  88  HOH HOH B . 
N 6 HOH 55  955  89  HOH HOH B . 
N 6 HOH 56  956  91  HOH HOH B . 
N 6 HOH 57  957  93  HOH HOH B . 
N 6 HOH 58  958  95  HOH HOH B . 
N 6 HOH 59  959  98  HOH HOH B . 
N 6 HOH 60  960  99  HOH HOH B . 
N 6 HOH 61  961  100 HOH HOH B . 
N 6 HOH 62  962  101 HOH HOH B . 
N 6 HOH 63  963  103 HOH HOH B . 
N 6 HOH 64  964  107 HOH HOH B . 
N 6 HOH 65  965  111 HOH HOH B . 
N 6 HOH 66  966  112 HOH HOH B . 
N 6 HOH 67  967  114 HOH HOH B . 
N 6 HOH 68  968  118 HOH HOH B . 
N 6 HOH 69  969  119 HOH HOH B . 
N 6 HOH 70  970  120 HOH HOH B . 
N 6 HOH 71  971  123 HOH HOH B . 
N 6 HOH 72  972  124 HOH HOH B . 
N 6 HOH 73  973  125 HOH HOH B . 
N 6 HOH 74  974  126 HOH HOH B . 
N 6 HOH 75  975  128 HOH HOH B . 
N 6 HOH 76  976  129 HOH HOH B . 
N 6 HOH 77  977  131 HOH HOH B . 
N 6 HOH 78  978  133 HOH HOH B . 
N 6 HOH 79  979  134 HOH HOH B . 
N 6 HOH 80  980  135 HOH HOH B . 
N 6 HOH 81  981  137 HOH HOH B . 
N 6 HOH 82  982  139 HOH HOH B . 
N 6 HOH 83  983  140 HOH HOH B . 
N 6 HOH 84  984  141 HOH HOH B . 
N 6 HOH 85  985  142 HOH HOH B . 
N 6 HOH 86  986  144 HOH HOH B . 
N 6 HOH 87  987  145 HOH HOH B . 
N 6 HOH 88  988  147 HOH HOH B . 
N 6 HOH 89  989  148 HOH HOH B . 
N 6 HOH 90  990  149 HOH HOH B . 
N 6 HOH 91  991  150 HOH HOH B . 
N 6 HOH 92  992  151 HOH HOH B . 
N 6 HOH 93  993  152 HOH HOH B . 
N 6 HOH 94  994  153 HOH HOH B . 
N 6 HOH 95  995  156 HOH HOH B . 
N 6 HOH 96  996  157 HOH HOH B . 
N 6 HOH 97  997  162 HOH HOH B . 
N 6 HOH 98  998  163 HOH HOH B . 
N 6 HOH 99  999  164 HOH HOH B . 
N 6 HOH 100 1000 166 HOH HOH B . 
N 6 HOH 101 1001 169 HOH HOH B . 
N 6 HOH 102 1002 171 HOH HOH B . 
N 6 HOH 103 1003 172 HOH HOH B . 
N 6 HOH 104 1004 175 HOH HOH B . 
N 6 HOH 105 1005 177 HOH HOH B . 
N 6 HOH 106 1006 180 HOH HOH B . 
N 6 HOH 107 1007 184 HOH HOH B . 
N 6 HOH 108 1008 185 HOH HOH B . 
N 6 HOH 109 1009 188 HOH HOH B . 
N 6 HOH 110 1010 190 HOH HOH B . 
N 6 HOH 111 1011 192 HOH HOH B . 
N 6 HOH 112 1012 193 HOH HOH B . 
N 6 HOH 113 1013 194 HOH HOH B . 
N 6 HOH 114 1014 195 HOH HOH B . 
N 6 HOH 115 1015 197 HOH HOH B . 
N 6 HOH 116 1016 198 HOH HOH B . 
N 6 HOH 117 1017 199 HOH HOH B . 
N 6 HOH 118 1018 200 HOH HOH B . 
N 6 HOH 119 1019 204 HOH HOH B . 
N 6 HOH 120 1020 205 HOH HOH B . 
N 6 HOH 121 1021 206 HOH HOH B . 
N 6 HOH 122 1022 208 HOH HOH B . 
N 6 HOH 123 1023 212 HOH HOH B . 
N 6 HOH 124 1024 214 HOH HOH B . 
N 6 HOH 125 1025 215 HOH HOH B . 
N 6 HOH 126 1026 216 HOH HOH B . 
N 6 HOH 127 1027 219 HOH HOH B . 
N 6 HOH 128 1028 220 HOH HOH B . 
N 6 HOH 129 1029 221 HOH HOH B . 
N 6 HOH 130 1030 224 HOH HOH B . 
N 6 HOH 131 1031 226 HOH HOH B . 
N 6 HOH 132 1032 227 HOH HOH B . 
N 6 HOH 133 1033 228 HOH HOH B . 
N 6 HOH 134 1034 229 HOH HOH B . 
N 6 HOH 135 1035 232 HOH HOH B . 
N 6 HOH 136 1036 233 HOH HOH B . 
N 6 HOH 137 1037 234 HOH HOH B . 
N 6 HOH 138 1038 236 HOH HOH B . 
N 6 HOH 139 1039 237 HOH HOH B . 
N 6 HOH 140 1040 238 HOH HOH B . 
N 6 HOH 141 1041 241 HOH HOH B . 
N 6 HOH 142 1042 245 HOH HOH B . 
N 6 HOH 143 1043 246 HOH HOH B . 
N 6 HOH 144 1044 247 HOH HOH B . 
N 6 HOH 145 1045 248 HOH HOH B . 
N 6 HOH 146 1046 250 HOH HOH B . 
N 6 HOH 147 1047 252 HOH HOH B . 
N 6 HOH 148 1048 254 HOH HOH B . 
N 6 HOH 149 1049 256 HOH HOH B . 
N 6 HOH 150 1050 258 HOH HOH B . 
N 6 HOH 151 1051 261 HOH HOH B . 
N 6 HOH 152 1052 262 HOH HOH B . 
N 6 HOH 153 1053 267 HOH HOH B . 
N 6 HOH 154 1054 271 HOH HOH B . 
N 6 HOH 155 1055 272 HOH HOH B . 
N 6 HOH 156 1056 273 HOH HOH B . 
N 6 HOH 157 1057 278 HOH HOH B . 
N 6 HOH 158 1058 283 HOH HOH B . 
N 6 HOH 159 1059 284 HOH HOH B . 
N 6 HOH 160 1060 286 HOH HOH B . 
N 6 HOH 161 1061 288 HOH HOH B . 
N 6 HOH 162 1062 289 HOH HOH B . 
N 6 HOH 163 1063 291 HOH HOH B . 
N 6 HOH 164 1064 292 HOH HOH B . 
N 6 HOH 165 1065 294 HOH HOH B . 
N 6 HOH 166 1066 295 HOH HOH B . 
N 6 HOH 167 1067 299 HOH HOH B . 
N 6 HOH 168 1068 304 HOH HOH B . 
N 6 HOH 169 1069 306 HOH HOH B . 
N 6 HOH 170 1070 307 HOH HOH B . 
N 6 HOH 171 1071 308 HOH HOH B . 
N 6 HOH 172 1072 309 HOH HOH B . 
N 6 HOH 173 1073 312 HOH HOH B . 
N 6 HOH 174 1074 313 HOH HOH B . 
N 6 HOH 175 1075 314 HOH HOH B . 
N 6 HOH 176 1076 315 HOH HOH B . 
N 6 HOH 177 1077 316 HOH HOH B . 
N 6 HOH 178 1078 317 HOH HOH B . 
N 6 HOH 179 1079 318 HOH HOH B . 
N 6 HOH 180 1080 319 HOH HOH B . 
N 6 HOH 181 1081 320 HOH HOH B . 
N 6 HOH 182 1082 321 HOH HOH B . 
N 6 HOH 183 1083 326 HOH HOH B . 
N 6 HOH 184 1084 327 HOH HOH B . 
N 6 HOH 185 1085 329 HOH HOH B . 
N 6 HOH 186 1086 330 HOH HOH B . 
N 6 HOH 187 1087 333 HOH HOH B . 
N 6 HOH 188 1088 334 HOH HOH B . 
N 6 HOH 189 1089 339 HOH HOH B . 
N 6 HOH 190 1090 341 HOH HOH B . 
N 6 HOH 191 1091 343 HOH HOH B . 
N 6 HOH 192 1092 345 HOH HOH B . 
N 6 HOH 193 1093 346 HOH HOH B . 
N 6 HOH 194 1094 347 HOH HOH B . 
N 6 HOH 195 1095 348 HOH HOH B . 
N 6 HOH 196 1096 349 HOH HOH B . 
N 6 HOH 197 1097 350 HOH HOH B . 
N 6 HOH 198 1098 354 HOH HOH B . 
N 6 HOH 199 1099 356 HOH HOH B . 
N 6 HOH 200 1100 359 HOH HOH B . 
N 6 HOH 201 1101 361 HOH HOH B . 
N 6 HOH 202 1102 362 HOH HOH B . 
N 6 HOH 203 1103 364 HOH HOH B . 
N 6 HOH 204 1104 365 HOH HOH B . 
N 6 HOH 205 1105 366 HOH HOH B . 
N 6 HOH 206 1106 368 HOH HOH B . 
N 6 HOH 207 1107 369 HOH HOH B . 
N 6 HOH 208 1108 371 HOH HOH B . 
N 6 HOH 209 1109 372 HOH HOH B . 
N 6 HOH 210 1110 373 HOH HOH B . 
N 6 HOH 211 1111 374 HOH HOH B . 
N 6 HOH 212 1112 375 HOH HOH B . 
N 6 HOH 213 1113 377 HOH HOH B . 
N 6 HOH 214 1114 380 HOH HOH B . 
N 6 HOH 215 1115 381 HOH HOH B . 
N 6 HOH 216 1116 382 HOH HOH B . 
N 6 HOH 217 1117 383 HOH HOH B . 
N 6 HOH 218 1118 384 HOH HOH B . 
N 6 HOH 219 1119 385 HOH HOH B . 
N 6 HOH 220 1120 387 HOH HOH B . 
N 6 HOH 221 1121 390 HOH HOH B . 
N 6 HOH 222 1122 391 HOH HOH B . 
N 6 HOH 223 1123 392 HOH HOH B . 
N 6 HOH 224 1124 393 HOH HOH B . 
N 6 HOH 225 1125 394 HOH HOH B . 
N 6 HOH 226 1126 397 HOH HOH B . 
N 6 HOH 227 1127 398 HOH HOH B . 
N 6 HOH 228 1128 400 HOH HOH B . 
N 6 HOH 229 1129 401 HOH HOH B . 
N 6 HOH 230 1130 404 HOH HOH B . 
N 6 HOH 231 1131 408 HOH HOH B . 
N 6 HOH 232 1132 409 HOH HOH B . 
N 6 HOH 233 1133 411 HOH HOH B . 
N 6 HOH 234 1134 412 HOH HOH B . 
N 6 HOH 235 1135 413 HOH HOH B . 
N 6 HOH 236 1136 414 HOH HOH B . 
N 6 HOH 237 1137 416 HOH HOH B . 
N 6 HOH 238 1138 417 HOH HOH B . 
N 6 HOH 239 1139 418 HOH HOH B . 
N 6 HOH 240 1140 419 HOH HOH B . 
N 6 HOH 241 1141 421 HOH HOH B . 
N 6 HOH 242 1142 424 HOH HOH B . 
N 6 HOH 243 1143 425 HOH HOH B . 
N 6 HOH 244 1144 426 HOH HOH B . 
N 6 HOH 245 1145 427 HOH HOH B . 
N 6 HOH 246 1146 428 HOH HOH B . 
N 6 HOH 247 1147 429 HOH HOH B . 
N 6 HOH 248 1148 430 HOH HOH B . 
N 6 HOH 249 1149 431 HOH HOH B . 
N 6 HOH 250 1150 433 HOH HOH B . 
N 6 HOH 251 1151 434 HOH HOH B . 
N 6 HOH 252 1152 435 HOH HOH B . 
N 6 HOH 253 1153 439 HOH HOH B . 
N 6 HOH 254 1154 440 HOH HOH B . 
N 6 HOH 255 1155 441 HOH HOH B . 
N 6 HOH 256 1156 442 HOH HOH B . 
N 6 HOH 257 1157 443 HOH HOH B . 
N 6 HOH 258 1158 446 HOH HOH B . 
N 6 HOH 259 1159 448 HOH HOH B . 
N 6 HOH 260 1160 450 HOH HOH B . 
N 6 HOH 261 1161 452 HOH HOH B . 
N 6 HOH 262 1162 453 HOH HOH B . 
N 6 HOH 263 1163 454 HOH HOH B . 
N 6 HOH 264 1164 455 HOH HOH B . 
N 6 HOH 265 1165 456 HOH HOH B . 
N 6 HOH 266 1166 459 HOH HOH B . 
N 6 HOH 267 1167 460 HOH HOH B . 
N 6 HOH 268 1168 462 HOH HOH B . 
N 6 HOH 269 1169 463 HOH HOH B . 
N 6 HOH 270 1170 464 HOH HOH B . 
N 6 HOH 271 1171 466 HOH HOH B . 
N 6 HOH 272 1172 468 HOH HOH B . 
N 6 HOH 273 1173 469 HOH HOH B . 
N 6 HOH 274 1174 470 HOH HOH B . 
N 6 HOH 275 1175 471 HOH HOH B . 
N 6 HOH 276 1176 472 HOH HOH B . 
N 6 HOH 277 1177 473 HOH HOH B . 
N 6 HOH 278 1178 474 HOH HOH B . 
N 6 HOH 279 1179 475 HOH HOH B . 
N 6 HOH 280 1180 477 HOH HOH B . 
N 6 HOH 281 1181 478 HOH HOH B . 
N 6 HOH 282 1182 480 HOH HOH B . 
N 6 HOH 283 1183 481 HOH HOH B . 
N 6 HOH 284 1184 482 HOH HOH B . 
N 6 HOH 285 1185 486 HOH HOH B . 
N 6 HOH 286 1186 487 HOH HOH B . 
N 6 HOH 287 1187 488 HOH HOH B . 
N 6 HOH 288 1188 489 HOH HOH B . 
N 6 HOH 289 1189 493 HOH HOH B . 
N 6 HOH 290 1190 494 HOH HOH B . 
N 6 HOH 291 1191 496 HOH HOH B . 
N 6 HOH 292 1192 498 HOH HOH B . 
N 6 HOH 293 1193 500 HOH HOH B . 
N 6 HOH 294 1194 502 HOH HOH B . 
N 6 HOH 295 1195 504 HOH HOH B . 
N 6 HOH 296 1196 505 HOH HOH B . 
N 6 HOH 297 1197 508 HOH HOH B . 
N 6 HOH 298 1198 509 HOH HOH B . 
N 6 HOH 299 1199 511 HOH HOH B . 
N 6 HOH 300 1200 512 HOH HOH B . 
N 6 HOH 301 1201 513 HOH HOH B . 
N 6 HOH 302 1202 514 HOH HOH B . 
N 6 HOH 303 1203 517 HOH HOH B . 
N 6 HOH 304 1204 519 HOH HOH B . 
N 6 HOH 305 1205 520 HOH HOH B . 
N 6 HOH 306 1206 521 HOH HOH B . 
N 6 HOH 307 1207 522 HOH HOH B . 
N 6 HOH 308 1208 526 HOH HOH B . 
N 6 HOH 309 1209 527 HOH HOH B . 
N 6 HOH 310 1210 528 HOH HOH B . 
N 6 HOH 311 1211 529 HOH HOH B . 
N 6 HOH 312 1212 530 HOH HOH B . 
N 6 HOH 313 1213 531 HOH HOH B . 
N 6 HOH 314 1214 535 HOH HOH B . 
N 6 HOH 315 1215 536 HOH HOH B . 
N 6 HOH 316 1216 537 HOH HOH B . 
N 6 HOH 317 1217 540 HOH HOH B . 
N 6 HOH 318 1218 541 HOH HOH B . 
N 6 HOH 319 1219 545 HOH HOH B . 
N 6 HOH 320 1220 546 HOH HOH B . 
N 6 HOH 321 1221 547 HOH HOH B . 
N 6 HOH 322 1222 550 HOH HOH B . 
N 6 HOH 323 1223 551 HOH HOH B . 
N 6 HOH 324 1224 552 HOH HOH B . 
N 6 HOH 325 1225 554 HOH HOH B . 
N 6 HOH 326 1226 555 HOH HOH B . 
N 6 HOH 327 1227 556 HOH HOH B . 
N 6 HOH 328 1228 557 HOH HOH B . 
N 6 HOH 329 1229 560 HOH HOH B . 
N 6 HOH 330 1230 563 HOH HOH B . 
N 6 HOH 331 1231 564 HOH HOH B . 
N 6 HOH 332 1232 565 HOH HOH B . 
N 6 HOH 333 1233 567 HOH HOH B . 
N 6 HOH 334 1234 568 HOH HOH B . 
N 6 HOH 335 1235 570 HOH HOH B . 
N 6 HOH 336 1236 572 HOH HOH B . 
N 6 HOH 337 1237 573 HOH HOH B . 
N 6 HOH 338 1238 574 HOH HOH B . 
N 6 HOH 339 1239 576 HOH HOH B . 
N 6 HOH 340 1240 577 HOH HOH B . 
N 6 HOH 341 1241 579 HOH HOH B . 
N 6 HOH 342 1242 581 HOH HOH B . 
N 6 HOH 343 1243 583 HOH HOH B . 
N 6 HOH 344 1244 585 HOH HOH B . 
N 6 HOH 345 1245 586 HOH HOH B . 
N 6 HOH 346 1246 588 HOH HOH B . 
N 6 HOH 347 1247 589 HOH HOH B . 
N 6 HOH 348 1248 591 HOH HOH B . 
N 6 HOH 349 1249 593 HOH HOH B . 
N 6 HOH 350 1250 594 HOH HOH B . 
N 6 HOH 351 1251 597 HOH HOH B . 
N 6 HOH 352 1252 600 HOH HOH B . 
N 6 HOH 353 1253 602 HOH HOH B . 
N 6 HOH 354 1254 606 HOH HOH B . 
N 6 HOH 355 1255 607 HOH HOH B . 
N 6 HOH 356 1256 608 HOH HOH B . 
N 6 HOH 357 1257 609 HOH HOH B . 
N 6 HOH 358 1258 610 HOH HOH B . 
N 6 HOH 359 1259 611 HOH HOH B . 
N 6 HOH 360 1260 612 HOH HOH B . 
N 6 HOH 361 1261 613 HOH HOH B . 
N 6 HOH 362 1262 614 HOH HOH B . 
N 6 HOH 363 1263 616 HOH HOH B . 
N 6 HOH 364 1264 617 HOH HOH B . 
N 6 HOH 365 1265 618 HOH HOH B . 
N 6 HOH 366 1266 620 HOH HOH B . 
N 6 HOH 367 1267 621 HOH HOH B . 
N 6 HOH 368 1268 623 HOH HOH B . 
N 6 HOH 369 1269 626 HOH HOH B . 
N 6 HOH 370 1270 633 HOH HOH B . 
N 6 HOH 371 1271 637 HOH HOH B . 
N 6 HOH 372 1272 638 HOH HOH B . 
N 6 HOH 373 1273 639 HOH HOH B . 
N 6 HOH 374 1274 640 HOH HOH B . 
N 6 HOH 375 1275 641 HOH HOH B . 
N 6 HOH 376 1276 645 HOH HOH B . 
N 6 HOH 377 1277 646 HOH HOH B . 
N 6 HOH 378 1278 647 HOH HOH B . 
N 6 HOH 379 1279 648 HOH HOH B . 
N 6 HOH 380 1280 649 HOH HOH B . 
N 6 HOH 381 1281 651 HOH HOH B . 
N 6 HOH 382 1282 652 HOH HOH B . 
N 6 HOH 383 1283 655 HOH HOH B . 
N 6 HOH 384 1284 656 HOH HOH B . 
N 6 HOH 385 1285 659 HOH HOH B . 
N 6 HOH 386 1286 660 HOH HOH B . 
N 6 HOH 387 1287 663 HOH HOH B . 
N 6 HOH 388 1288 664 HOH HOH B . 
N 6 HOH 389 1289 665 HOH HOH B . 
N 6 HOH 390 1290 667 HOH HOH B . 
N 6 HOH 391 1291 668 HOH HOH B . 
N 6 HOH 392 1292 669 HOH HOH B . 
N 6 HOH 393 1293 671 HOH HOH B . 
N 6 HOH 394 1294 672 HOH HOH B . 
N 6 HOH 395 1295 675 HOH HOH B . 
N 6 HOH 396 1296 678 HOH HOH B . 
N 6 HOH 397 1297 680 HOH HOH B . 
N 6 HOH 398 1298 682 HOH HOH B . 
N 6 HOH 399 1299 684 HOH HOH B . 
N 6 HOH 400 1300 685 HOH HOH B . 
N 6 HOH 401 1301 687 HOH HOH B . 
N 6 HOH 402 1302 688 HOH HOH B . 
N 6 HOH 403 1303 689 HOH HOH B . 
N 6 HOH 404 1304 693 HOH HOH B . 
N 6 HOH 405 1305 700 HOH HOH B . 
N 6 HOH 406 1306 703 HOH HOH B . 
N 6 HOH 407 1307 704 HOH HOH B . 
N 6 HOH 408 1308 706 HOH HOH B . 
N 6 HOH 409 1309 707 HOH HOH B . 
N 6 HOH 410 1310 708 HOH HOH B . 
N 6 HOH 411 1311 709 HOH HOH B . 
N 6 HOH 412 1312 711 HOH HOH B . 
N 6 HOH 413 1313 714 HOH HOH B . 
N 6 HOH 414 1314 719 HOH HOH B . 
N 6 HOH 415 1315 720 HOH HOH B . 
N 6 HOH 416 1316 721 HOH HOH B . 
N 6 HOH 417 1317 725 HOH HOH B . 
N 6 HOH 418 1318 726 HOH HOH B . 
N 6 HOH 419 1319 727 HOH HOH B . 
N 6 HOH 420 1320 730 HOH HOH B . 
N 6 HOH 421 1321 731 HOH HOH B . 
N 6 HOH 422 1322 734 HOH HOH B . 
N 6 HOH 423 1323 739 HOH HOH B . 
N 6 HOH 424 1324 741 HOH HOH B . 
N 6 HOH 425 1325 743 HOH HOH B . 
N 6 HOH 426 1326 744 HOH HOH B . 
N 6 HOH 427 1327 745 HOH HOH B . 
N 6 HOH 428 1328 747 HOH HOH B . 
N 6 HOH 429 1329 748 HOH HOH B . 
N 6 HOH 430 1330 750 HOH HOH B . 
N 6 HOH 431 1331 751 HOH HOH B . 
N 6 HOH 432 1332 752 HOH HOH B . 
N 6 HOH 433 1333 755 HOH HOH B . 
N 6 HOH 434 1334 756 HOH HOH B . 
N 6 HOH 435 1335 758 HOH HOH B . 
N 6 HOH 436 1336 759 HOH HOH B . 
N 6 HOH 437 1337 762 HOH HOH B . 
N 6 HOH 438 1338 768 HOH HOH B . 
N 6 HOH 439 1339 769 HOH HOH B . 
N 6 HOH 440 1340 770 HOH HOH B . 
N 6 HOH 441 1341 771 HOH HOH B . 
N 6 HOH 442 1342 772 HOH HOH B . 
N 6 HOH 443 1343 773 HOH HOH B . 
N 6 HOH 444 1344 775 HOH HOH B . 
N 6 HOH 445 1345 777 HOH HOH B . 
N 6 HOH 446 1346 779 HOH HOH B . 
N 6 HOH 447 1347 780 HOH HOH B . 
N 6 HOH 448 1348 781 HOH HOH B . 
N 6 HOH 449 1349 782 HOH HOH B . 
N 6 HOH 450 1350 784 HOH HOH B . 
N 6 HOH 451 1351 786 HOH HOH B . 
N 6 HOH 452 1352 787 HOH HOH B . 
N 6 HOH 453 1353 789 HOH HOH B . 
N 6 HOH 454 1354 793 HOH HOH B . 
N 6 HOH 455 1355 795 HOH HOH B . 
N 6 HOH 456 1356 796 HOH HOH B . 
N 6 HOH 457 1357 797 HOH HOH B . 
N 6 HOH 458 1358 798 HOH HOH B . 
N 6 HOH 459 1359 800 HOH HOH B . 
N 6 HOH 460 1360 801 HOH HOH B . 
N 6 HOH 461 1361 803 HOH HOH B . 
N 6 HOH 462 1362 804 HOH HOH B . 
N 6 HOH 463 1363 805 HOH HOH B . 
N 6 HOH 464 1364 806 HOH HOH B . 
N 6 HOH 465 1365 807 HOH HOH B . 
N 6 HOH 466 1366 808 HOH HOH B . 
N 6 HOH 467 1367 809 HOH HOH B . 
N 6 HOH 468 1368 813 HOH HOH B . 
N 6 HOH 469 1369 814 HOH HOH B . 
N 6 HOH 470 1370 815 HOH HOH B . 
N 6 HOH 471 1371 817 HOH HOH B . 
N 6 HOH 472 1372 819 HOH HOH B . 
#