data_4N7E
# 
_entry.id   4N7E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4N7E         
RCSB  RCSB082845   
WWPDB D_1000082845 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3F6K 'Crystal structure of the Vps10p domain of human sortilin/NTS3 in complex with neurotensin' unspecified 
PDB 4MSL 'Crystal structure of the Vps10p domain of human sortilin/NTS3 in complex with AF40431'     unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4N7E 
_pdbx_database_status.recvd_initial_deposition_date   2013-10-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Andersen, J.L.'    1 
'Strandbygaard, D.' 2 
'Thirup, S.'        3 
# 
_citation.id                        primary 
_citation.title                     
'The identification of AF38469: An orally bioavailable inhibitor of the VPS10P family sorting receptor Sortilin.' 
_citation.journal_abbrev            Bioorg.Med.Chem.Lett. 
_citation.journal_volume            24 
_citation.page_first                177 
_citation.page_last                 180 
_citation.year                      2014 
_citation.journal_id_ASTM           BMCLE8 
_citation.country                   UK 
_citation.journal_id_ISSN           0960-894X 
_citation.journal_id_CSD            1127 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24355129 
_citation.pdbx_database_id_DOI      10.1016/j.bmcl.2013.11.046 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Schrder, T.J.'      1  
primary 'Christensen, S.'    2  
primary 'Lindberg, S.'       3  
primary 'Langgard, M.'       4  
primary 'David, L.'          5  
primary 'Maltas, P.J.'       6  
primary 'Eskildsen, J.'      7  
primary 'Jacobsen, J.'       8  
primary 'Tagmose, L.'        9  
primary 'Simonsen, K.B.'     10 
primary 'Biilmann Rnn, L.C.' 11 
primary 'de Jong, I.E.'      12 
primary 'Malik, I.J.'        13 
primary 'Karlsson, J.J.'     14 
primary 'Bundgaard, C.'      15 
primary 'Egebjerg, J.'       16 
primary 'Stavenhagen, J.B.'  17 
primary 'Strandbygard, D.'   18 
primary 'Thirup, S.'         19 
primary 'Andersen, J.L.'     20 
primary 'Uppalanchi, S.'     21 
primary 'Pervaram, S.'       22 
primary 'Kasturi, S.P.'      23 
primary 'Eradi, P.'          24 
primary 'Sakumudi, D.R.'     25 
primary 'Watson, S.P.'       26 
# 
_cell.entry_id           4N7E 
_cell.length_a           161.948 
_cell.length_b           77.402 
_cell.length_c           111.176 
_cell.angle_alpha        90.00 
_cell.angle_beta         127.06 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4N7E 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Sortilin                                                              77790.883 1  ? V617M 'UNP residues 78-756' 
? 
2 non-polymer man N-ACETYL-D-GLUCOSAMINE                                                221.208   4  ? ?     ?                     
? 
3 non-polymer man BETA-D-MANNOSE                                                        180.156   1  ? ?     ?                     
? 
4 non-polymer syn 'TRIETHYLENE GLYCOL'                                                  150.173   1  ? ?     ?                     
? 
5 non-polymer syn '2-[(6-methylpyridin-2-yl)carbamoyl]-5-(trifluoromethyl)benzoic acid' 324.255   1  ? ?     ?                     
? 
6 water       nat water                                                                 18.015    51 ? ?     ?                     
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        '100 kDa NT receptor, Glycoprotein 95, Gp95, Neurotensin receptor 3, NT3, NTR3' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDI
TDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTEN
GLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASV
MADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTT
TGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMA
PLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCW
QTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILG
YKEQFLRLRKSSMCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRK
IPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSGSAMIEGRGVGHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDI
TDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTEN
GLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASV
MADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTT
TGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMA
PLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCW
QTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILG
YKEQFLRLRKSSMCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRK
IPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSGSAMIEGRGVGHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ALA n 
1 3   PRO n 
1 4   GLY n 
1 5   GLU n 
1 6   ASP n 
1 7   GLU n 
1 8   GLU n 
1 9   CYS n 
1 10  GLY n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  ASP n 
1 15  PHE n 
1 16  VAL n 
1 17  ALA n 
1 18  LYS n 
1 19  LEU n 
1 20  ALA n 
1 21  ASN n 
1 22  ASN n 
1 23  THR n 
1 24  HIS n 
1 25  GLN n 
1 26  HIS n 
1 27  VAL n 
1 28  PHE n 
1 29  ASP n 
1 30  ASP n 
1 31  LEU n 
1 32  ARG n 
1 33  GLY n 
1 34  SER n 
1 35  VAL n 
1 36  SER n 
1 37  LEU n 
1 38  SER n 
1 39  TRP n 
1 40  VAL n 
1 41  GLY n 
1 42  ASP n 
1 43  SER n 
1 44  THR n 
1 45  GLY n 
1 46  VAL n 
1 47  ILE n 
1 48  LEU n 
1 49  VAL n 
1 50  LEU n 
1 51  THR n 
1 52  THR n 
1 53  PHE n 
1 54  HIS n 
1 55  VAL n 
1 56  PRO n 
1 57  LEU n 
1 58  VAL n 
1 59  ILE n 
1 60  MET n 
1 61  THR n 
1 62  PHE n 
1 63  GLY n 
1 64  GLN n 
1 65  SER n 
1 66  LYS n 
1 67  LEU n 
1 68  TYR n 
1 69  ARG n 
1 70  SER n 
1 71  GLU n 
1 72  ASP n 
1 73  TYR n 
1 74  GLY n 
1 75  LYS n 
1 76  ASN n 
1 77  PHE n 
1 78  LYS n 
1 79  ASP n 
1 80  ILE n 
1 81  THR n 
1 82  ASP n 
1 83  LEU n 
1 84  ILE n 
1 85  ASN n 
1 86  ASN n 
1 87  THR n 
1 88  PHE n 
1 89  ILE n 
1 90  ARG n 
1 91  THR n 
1 92  GLU n 
1 93  PHE n 
1 94  GLY n 
1 95  MET n 
1 96  ALA n 
1 97  ILE n 
1 98  GLY n 
1 99  PRO n 
1 100 GLU n 
1 101 ASN n 
1 102 SER n 
1 103 GLY n 
1 104 LYS n 
1 105 VAL n 
1 106 VAL n 
1 107 LEU n 
1 108 THR n 
1 109 ALA n 
1 110 GLU n 
1 111 VAL n 
1 112 SER n 
1 113 GLY n 
1 114 GLY n 
1 115 SER n 
1 116 ARG n 
1 117 GLY n 
1 118 GLY n 
1 119 ARG n 
1 120 ILE n 
1 121 PHE n 
1 122 ARG n 
1 123 SER n 
1 124 SER n 
1 125 ASP n 
1 126 PHE n 
1 127 ALA n 
1 128 LYS n 
1 129 ASN n 
1 130 PHE n 
1 131 VAL n 
1 132 GLN n 
1 133 THR n 
1 134 ASP n 
1 135 LEU n 
1 136 PRO n 
1 137 PHE n 
1 138 HIS n 
1 139 PRO n 
1 140 LEU n 
1 141 THR n 
1 142 GLN n 
1 143 MET n 
1 144 MET n 
1 145 TYR n 
1 146 SER n 
1 147 PRO n 
1 148 GLN n 
1 149 ASN n 
1 150 SER n 
1 151 ASP n 
1 152 TYR n 
1 153 LEU n 
1 154 LEU n 
1 155 ALA n 
1 156 LEU n 
1 157 SER n 
1 158 THR n 
1 159 GLU n 
1 160 ASN n 
1 161 GLY n 
1 162 LEU n 
1 163 TRP n 
1 164 VAL n 
1 165 SER n 
1 166 LYS n 
1 167 ASN n 
1 168 PHE n 
1 169 GLY n 
1 170 GLY n 
1 171 LYS n 
1 172 TRP n 
1 173 GLU n 
1 174 GLU n 
1 175 ILE n 
1 176 HIS n 
1 177 LYS n 
1 178 ALA n 
1 179 VAL n 
1 180 CYS n 
1 181 LEU n 
1 182 ALA n 
1 183 LYS n 
1 184 TRP n 
1 185 GLY n 
1 186 SER n 
1 187 ASP n 
1 188 ASN n 
1 189 THR n 
1 190 ILE n 
1 191 PHE n 
1 192 PHE n 
1 193 THR n 
1 194 THR n 
1 195 TYR n 
1 196 ALA n 
1 197 ASN n 
1 198 GLY n 
1 199 SER n 
1 200 CYS n 
1 201 LYS n 
1 202 ALA n 
1 203 ASP n 
1 204 LEU n 
1 205 GLY n 
1 206 ALA n 
1 207 LEU n 
1 208 GLU n 
1 209 LEU n 
1 210 TRP n 
1 211 ARG n 
1 212 THR n 
1 213 SER n 
1 214 ASP n 
1 215 LEU n 
1 216 GLY n 
1 217 LYS n 
1 218 SER n 
1 219 PHE n 
1 220 LYS n 
1 221 THR n 
1 222 ILE n 
1 223 GLY n 
1 224 VAL n 
1 225 LYS n 
1 226 ILE n 
1 227 TYR n 
1 228 SER n 
1 229 PHE n 
1 230 GLY n 
1 231 LEU n 
1 232 GLY n 
1 233 GLY n 
1 234 ARG n 
1 235 PHE n 
1 236 LEU n 
1 237 PHE n 
1 238 ALA n 
1 239 SER n 
1 240 VAL n 
1 241 MET n 
1 242 ALA n 
1 243 ASP n 
1 244 LYS n 
1 245 ASP n 
1 246 THR n 
1 247 THR n 
1 248 ARG n 
1 249 ARG n 
1 250 ILE n 
1 251 HIS n 
1 252 VAL n 
1 253 SER n 
1 254 THR n 
1 255 ASP n 
1 256 GLN n 
1 257 GLY n 
1 258 ASP n 
1 259 THR n 
1 260 TRP n 
1 261 SER n 
1 262 MET n 
1 263 ALA n 
1 264 GLN n 
1 265 LEU n 
1 266 PRO n 
1 267 SER n 
1 268 VAL n 
1 269 GLY n 
1 270 GLN n 
1 271 GLU n 
1 272 GLN n 
1 273 PHE n 
1 274 TYR n 
1 275 SER n 
1 276 ILE n 
1 277 LEU n 
1 278 ALA n 
1 279 ALA n 
1 280 ASN n 
1 281 ASP n 
1 282 ASP n 
1 283 MET n 
1 284 VAL n 
1 285 PHE n 
1 286 MET n 
1 287 HIS n 
1 288 VAL n 
1 289 ASP n 
1 290 GLU n 
1 291 PRO n 
1 292 GLY n 
1 293 ASP n 
1 294 THR n 
1 295 GLY n 
1 296 PHE n 
1 297 GLY n 
1 298 THR n 
1 299 ILE n 
1 300 PHE n 
1 301 THR n 
1 302 SER n 
1 303 ASP n 
1 304 ASP n 
1 305 ARG n 
1 306 GLY n 
1 307 ILE n 
1 308 VAL n 
1 309 TYR n 
1 310 SER n 
1 311 LYS n 
1 312 SER n 
1 313 LEU n 
1 314 ASP n 
1 315 ARG n 
1 316 HIS n 
1 317 LEU n 
1 318 TYR n 
1 319 THR n 
1 320 THR n 
1 321 THR n 
1 322 GLY n 
1 323 GLY n 
1 324 GLU n 
1 325 THR n 
1 326 ASP n 
1 327 PHE n 
1 328 THR n 
1 329 ASN n 
1 330 VAL n 
1 331 THR n 
1 332 SER n 
1 333 LEU n 
1 334 ARG n 
1 335 GLY n 
1 336 VAL n 
1 337 TYR n 
1 338 ILE n 
1 339 THR n 
1 340 SER n 
1 341 VAL n 
1 342 LEU n 
1 343 SER n 
1 344 GLU n 
1 345 ASP n 
1 346 ASN n 
1 347 SER n 
1 348 ILE n 
1 349 GLN n 
1 350 THR n 
1 351 MET n 
1 352 ILE n 
1 353 THR n 
1 354 PHE n 
1 355 ASP n 
1 356 GLN n 
1 357 GLY n 
1 358 GLY n 
1 359 ARG n 
1 360 TRP n 
1 361 THR n 
1 362 HIS n 
1 363 LEU n 
1 364 ARG n 
1 365 LYS n 
1 366 PRO n 
1 367 GLU n 
1 368 ASN n 
1 369 SER n 
1 370 GLU n 
1 371 CYS n 
1 372 ASP n 
1 373 ALA n 
1 374 THR n 
1 375 ALA n 
1 376 LYS n 
1 377 ASN n 
1 378 LYS n 
1 379 ASN n 
1 380 GLU n 
1 381 CYS n 
1 382 SER n 
1 383 LEU n 
1 384 HIS n 
1 385 ILE n 
1 386 HIS n 
1 387 ALA n 
1 388 SER n 
1 389 TYR n 
1 390 SER n 
1 391 ILE n 
1 392 SER n 
1 393 GLN n 
1 394 LYS n 
1 395 LEU n 
1 396 ASN n 
1 397 VAL n 
1 398 PRO n 
1 399 MET n 
1 400 ALA n 
1 401 PRO n 
1 402 LEU n 
1 403 SER n 
1 404 GLU n 
1 405 PRO n 
1 406 ASN n 
1 407 ALA n 
1 408 VAL n 
1 409 GLY n 
1 410 ILE n 
1 411 VAL n 
1 412 ILE n 
1 413 ALA n 
1 414 HIS n 
1 415 GLY n 
1 416 SER n 
1 417 VAL n 
1 418 GLY n 
1 419 ASP n 
1 420 ALA n 
1 421 ILE n 
1 422 SER n 
1 423 VAL n 
1 424 MET n 
1 425 VAL n 
1 426 PRO n 
1 427 ASP n 
1 428 VAL n 
1 429 TYR n 
1 430 ILE n 
1 431 SER n 
1 432 ASP n 
1 433 ASP n 
1 434 GLY n 
1 435 GLY n 
1 436 TYR n 
1 437 SER n 
1 438 TRP n 
1 439 THR n 
1 440 LYS n 
1 441 MET n 
1 442 LEU n 
1 443 GLU n 
1 444 GLY n 
1 445 PRO n 
1 446 HIS n 
1 447 TYR n 
1 448 TYR n 
1 449 THR n 
1 450 ILE n 
1 451 LEU n 
1 452 ASP n 
1 453 SER n 
1 454 GLY n 
1 455 GLY n 
1 456 ILE n 
1 457 ILE n 
1 458 VAL n 
1 459 ALA n 
1 460 ILE n 
1 461 GLU n 
1 462 HIS n 
1 463 SER n 
1 464 SER n 
1 465 ARG n 
1 466 PRO n 
1 467 ILE n 
1 468 ASN n 
1 469 VAL n 
1 470 ILE n 
1 471 LYS n 
1 472 PHE n 
1 473 SER n 
1 474 THR n 
1 475 ASP n 
1 476 GLU n 
1 477 GLY n 
1 478 GLN n 
1 479 CYS n 
1 480 TRP n 
1 481 GLN n 
1 482 THR n 
1 483 TYR n 
1 484 THR n 
1 485 PHE n 
1 486 THR n 
1 487 ARG n 
1 488 ASP n 
1 489 PRO n 
1 490 ILE n 
1 491 TYR n 
1 492 PHE n 
1 493 THR n 
1 494 GLY n 
1 495 LEU n 
1 496 ALA n 
1 497 SER n 
1 498 GLU n 
1 499 PRO n 
1 500 GLY n 
1 501 ALA n 
1 502 ARG n 
1 503 SER n 
1 504 MET n 
1 505 ASN n 
1 506 ILE n 
1 507 SER n 
1 508 ILE n 
1 509 TRP n 
1 510 GLY n 
1 511 PHE n 
1 512 THR n 
1 513 GLU n 
1 514 SER n 
1 515 PHE n 
1 516 LEU n 
1 517 THR n 
1 518 SER n 
1 519 GLN n 
1 520 TRP n 
1 521 VAL n 
1 522 SER n 
1 523 TYR n 
1 524 THR n 
1 525 ILE n 
1 526 ASP n 
1 527 PHE n 
1 528 LYS n 
1 529 ASP n 
1 530 ILE n 
1 531 LEU n 
1 532 GLU n 
1 533 ARG n 
1 534 ASN n 
1 535 CYS n 
1 536 GLU n 
1 537 GLU n 
1 538 LYS n 
1 539 ASP n 
1 540 TYR n 
1 541 THR n 
1 542 ILE n 
1 543 TRP n 
1 544 LEU n 
1 545 ALA n 
1 546 HIS n 
1 547 SER n 
1 548 THR n 
1 549 ASP n 
1 550 PRO n 
1 551 GLU n 
1 552 ASP n 
1 553 TYR n 
1 554 GLU n 
1 555 ASP n 
1 556 GLY n 
1 557 CYS n 
1 558 ILE n 
1 559 LEU n 
1 560 GLY n 
1 561 TYR n 
1 562 LYS n 
1 563 GLU n 
1 564 GLN n 
1 565 PHE n 
1 566 LEU n 
1 567 ARG n 
1 568 LEU n 
1 569 ARG n 
1 570 LYS n 
1 571 SER n 
1 572 SER n 
1 573 MET n 
1 574 CYS n 
1 575 GLN n 
1 576 ASN n 
1 577 GLY n 
1 578 ARG n 
1 579 ASP n 
1 580 TYR n 
1 581 VAL n 
1 582 VAL n 
1 583 THR n 
1 584 LYS n 
1 585 GLN n 
1 586 PRO n 
1 587 SER n 
1 588 ILE n 
1 589 CYS n 
1 590 LEU n 
1 591 CYS n 
1 592 SER n 
1 593 LEU n 
1 594 GLU n 
1 595 ASP n 
1 596 PHE n 
1 597 LEU n 
1 598 CYS n 
1 599 ASP n 
1 600 PHE n 
1 601 GLY n 
1 602 TYR n 
1 603 TYR n 
1 604 ARG n 
1 605 PRO n 
1 606 GLU n 
1 607 ASN n 
1 608 ASP n 
1 609 SER n 
1 610 LYS n 
1 611 CYS n 
1 612 VAL n 
1 613 GLU n 
1 614 GLN n 
1 615 PRO n 
1 616 GLU n 
1 617 LEU n 
1 618 LYS n 
1 619 GLY n 
1 620 HIS n 
1 621 ASP n 
1 622 LEU n 
1 623 GLU n 
1 624 PHE n 
1 625 CYS n 
1 626 LEU n 
1 627 TYR n 
1 628 GLY n 
1 629 ARG n 
1 630 GLU n 
1 631 GLU n 
1 632 HIS n 
1 633 LEU n 
1 634 THR n 
1 635 THR n 
1 636 ASN n 
1 637 GLY n 
1 638 TYR n 
1 639 ARG n 
1 640 LYS n 
1 641 ILE n 
1 642 PRO n 
1 643 GLY n 
1 644 ASP n 
1 645 LYS n 
1 646 CYS n 
1 647 GLN n 
1 648 GLY n 
1 649 GLY n 
1 650 VAL n 
1 651 ASN n 
1 652 PRO n 
1 653 VAL n 
1 654 ARG n 
1 655 GLU n 
1 656 VAL n 
1 657 LYS n 
1 658 ASP n 
1 659 LEU n 
1 660 LYS n 
1 661 LYS n 
1 662 LYS n 
1 663 CYS n 
1 664 THR n 
1 665 SER n 
1 666 ASN n 
1 667 PHE n 
1 668 LEU n 
1 669 SER n 
1 670 PRO n 
1 671 GLU n 
1 672 LYS n 
1 673 GLN n 
1 674 ASN n 
1 675 SER n 
1 676 LYS n 
1 677 SER n 
1 678 ASN n 
1 679 SER n 
1 680 GLY n 
1 681 SER n 
1 682 ALA n 
1 683 MET n 
1 684 ILE n 
1 685 GLU n 
1 686 GLY n 
1 687 ARG n 
1 688 GLY n 
1 689 VAL n 
1 690 GLY n 
1 691 HIS n 
1 692 HIS n 
1 693 HIS n 
1 694 HIS n 
1 695 HIS n 
1 696 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 SORT1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo Sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 'HEK 293F cell' 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pCEP-pu 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SORT_HUMAN 
_struct_ref.pdbx_db_accession          Q99523 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDI
TDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTEN
GLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASV
MADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTT
TGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMA
PLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCW
QTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILG
YKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRK
IPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNS
;
_struct_ref.pdbx_align_begin           78 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4N7E 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 679 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q99523 
_struct_ref_seq.db_align_beg                  78 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  756 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       45 
_struct_ref_seq.pdbx_auth_seq_align_end       723 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4N7E MET A 573 ? UNP Q99523 VAL 650 VARIANT          617 1  
1 4N7E GLY A 680 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 724 2  
1 4N7E SER A 681 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 725 3  
1 4N7E ALA A 682 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 726 4  
1 4N7E MET A 683 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 727 5  
1 4N7E ILE A 684 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 728 6  
1 4N7E GLU A 685 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 729 7  
1 4N7E GLY A 686 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 730 8  
1 4N7E ARG A 687 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 731 9  
1 4N7E GLY A 688 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 732 10 
1 4N7E VAL A 689 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 733 11 
1 4N7E GLY A 690 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 734 12 
1 4N7E HIS A 691 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 735 13 
1 4N7E HIS A 692 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 736 14 
1 4N7E HIS A 693 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 737 15 
1 4N7E HIS A 694 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 738 16 
1 4N7E HIS A 695 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 739 17 
1 4N7E HIS A 696 ? UNP Q99523 ?   ?   'EXPRESSION TAG' 740 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2JQ non-polymer         . '2-[(6-methylpyridin-2-yl)carbamoyl]-5-(trifluoromethyl)benzoic acid' ? 'C15 H11 F3 N2 O3' 324.255 
ALA 'L-peptide linking' y ALANINE                                                               ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                                              ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                            ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                       ? 'C4 H7 N O4'       133.103 
BMA D-saccharide        . BETA-D-MANNOSE                                                        ? 'C6 H12 O6'        180.156 
CYS 'L-peptide linking' y CYSTEINE                                                              ? 'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                             ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                       ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                                               ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                                             ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                                                 ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                            ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                                               ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                                                ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                                            ? 'C5 H11 N O2 S'    149.211 
NAG D-saccharide        . N-ACETYL-D-GLUCOSAMINE                                                ? 'C8 H15 N O6'      221.208 
PGE non-polymer         . 'TRIETHYLENE GLYCOL'                                                  ? 'C6 H14 O4'        150.173 
PHE 'L-peptide linking' y PHENYLALANINE                                                         ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                                               ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                                                ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                                             ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                            ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                                              ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                                                ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          4N7E 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.57 
_exptl_crystal.density_percent_sol   65.58 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.3 
_exptl_crystal_grow.pdbx_details    
;0.1 M HEPES-Tris, 0.4 M sodium malonate, 27 % (w/v) PEG 3350, 4.5 % (v/v) glycerol, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 292K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 2M-F' 
_diffrn_detector.pdbx_collection_date   2012-05-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Bartels Monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06DA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06DA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9000 
# 
_reflns.entry_id                     4N7E 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   1.34 
_reflns.d_resolution_low             46.7 
_reflns.d_resolution_high            2.7 
_reflns.number_obs                   30397 
_reflns.number_all                   30397 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.071 
_reflns.pdbx_Rsym_value              0.071 
_reflns.pdbx_netI_over_sigmaI        15.2 
_reflns.B_iso_Wilson_estimate        84.3 
_reflns.pdbx_redundancy              6.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.7 2.8  97.9  0.845 ? 2.2  ? ? ? ? ? ? ? 1  1 
2.8 3.0  100.0 0.522 ? 3.7  ? ? ? ? ? ? ? 2  1 
3.0 3.2  100.0 0.277 ? 6.2  ? ? ? ? ? ? ? 3  1 
3.2 3.5  100.0 0.158 ? 10.5 ? ? ? ? ? ? ? 4  1 
3.5 3.8  100.0 0.092 ? 15.5 ? ? ? ? ? ? ? 5  1 
3.8 4.3  100.0 0.062 ? 21.5 ? ? ? ? ? ? ? 6  1 
4.3 4.9  100.0 0.045 ? 30.9 ? ? ? ? ? ? ? 7  1 
4.9 6.0  100.0 0.046 ? 30.6 ? ? ? ? ? ? ? 8  1 
6.0 8.5  100.0 0.044 ? 31.1 ? ? ? ? ? ? ? 9  1 
8.5 46.7 99.4  0.033 ? 46.0 ? ? ? ? ? ? ? 10 1 
# 
_refine.entry_id                                 4N7E 
_refine.ls_number_reflns_obs                     30366 
_refine.ls_number_reflns_all                     30397 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             44.4 
_refine.ls_d_res_high                            2.7 
_refine.ls_percent_reflns_obs                    99.60 
_refine.ls_R_factor_obs                          0.2038 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2008 
_refine.ls_R_factor_R_free                       0.2416 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 7.32 
_refine.ls_number_reflns_R_free                  2223 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3F6K with ligand, glycosylations and waters removed' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.38 
_refine.pdbx_overall_phase_error                 28.65 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5140 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         100 
_refine_hist.number_atoms_solvent             51 
_refine_hist.number_atoms_total               5291 
_refine_hist.d_res_high                       2.7 
_refine_hist.d_res_low                        44.4 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.011  ? ? 5367 ? 'X-RAY DIFFRACTION' 
f_angle_d          1.354  ? ? 7258 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 15.237 ? ? 1942 ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.061  ? ? 793  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.007  ? ? 929  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 2.7    2.7549  1640 0.3369 95.00  0.3406 . . 130 . . . . 'X-RAY DIFFRACTION' 
. 2.7549 2.8190  1763 0.3093 100.00 0.3200 . . 139 . . . . 'X-RAY DIFFRACTION' 
. 2.8190 2.8895  1783 0.2832 100.00 0.3484 . . 134 . . . . 'X-RAY DIFFRACTION' 
. 2.8895 2.9676  1732 0.2763 100.00 0.3326 . . 141 . . . . 'X-RAY DIFFRACTION' 
. 2.9676 3.0549  1752 0.2811 100.00 0.3553 . . 140 . . . . 'X-RAY DIFFRACTION' 
. 3.0549 3.1535  1754 0.2709 100.00 0.3207 . . 139 . . . . 'X-RAY DIFFRACTION' 
. 3.1535 3.2662  1752 0.2503 100.00 0.3170 . . 138 . . . . 'X-RAY DIFFRACTION' 
. 3.2662 3.3969  1743 0.2352 100.00 0.2418 . . 140 . . . . 'X-RAY DIFFRACTION' 
. 3.3969 3.5514  1759 0.2142 100.00 0.2389 . . 137 . . . . 'X-RAY DIFFRACTION' 
. 3.5514 3.7386  1787 0.2155 100.00 0.2491 . . 137 . . . . 'X-RAY DIFFRACTION' 
. 3.7386 3.9727  1745 0.2037 100.00 0.2604 . . 135 . . . . 'X-RAY DIFFRACTION' 
. 3.9727 4.2792  1778 0.1657 100.00 0.2195 . . 148 . . . . 'X-RAY DIFFRACTION' 
. 4.2792 4.7094  1761 0.1534 100.00 0.1851 . . 137 . . . . 'X-RAY DIFFRACTION' 
. 4.7094 5.3898  1769 0.1610 100.00 0.2130 . . 142 . . . . 'X-RAY DIFFRACTION' 
. 5.3898 6.7867  1790 0.1838 100.00 0.2391 . . 138 . . . . 'X-RAY DIFFRACTION' 
. 6.7867 44.3643 1835 0.1892 100.00 0.2147 . . 148 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4N7E 
_struct.title                     'Crystal structure of the Vps10p domain of human sortilin/NTS3 in complex with AF38469' 
_struct.pdbx_descriptor           Sortilin 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4N7E 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
;Sortilin, Small molecule ligand, AF38469, AF40431, proNGF, Alzheimer's disease, Beta-propeller Asp-box repeat, Vps10p domain, 10CC domain, Receptor Sorting, Membrane, SIGNALING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 2 ? 
G N N 4 ? 
H N N 5 ? 
I N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 14  ? ASN A 22  ? ASP A 58  ASN A 66  1 ? 9  
HELX_P HELX_P2 2 THR A 81  ? ASN A 85  ? THR A 125 ASN A 129 5 ? 5  
HELX_P HELX_P3 3 ALA A 387 ? GLN A 393 ? ALA A 431 GLN A 437 1 ? 7  
HELX_P HELX_P4 4 ASP A 452 ? GLY A 455 ? ASP A 496 GLY A 499 5 ? 4  
HELX_P HELX_P5 5 GLU A 536 ? LYS A 538 ? GLU A 580 LYS A 582 5 ? 3  
HELX_P HELX_P6 6 SER A 592 ? GLU A 594 ? SER A 636 GLU A 638 5 ? 3  
HELX_P HELX_P7 7 LYS A 618 ? GLY A 628 ? LYS A 662 GLY A 672 1 ? 11 
HELX_P HELX_P8 8 ARG A 629 ? HIS A 632 ? ARG A 673 HIS A 676 5 ? 4  
HELX_P HELX_P9 9 LEU A 659 ? SER A 665 ? LEU A 703 SER A 709 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 180 SG  ? ? ? 1_555 A CYS 200 SG ? ? A CYS 224 A CYS 244 1_555 ? ? ? ? ? ? ? 2.048 ? 
disulf2 disulf ? ? A CYS 371 SG  ? ? ? 1_555 A CYS 381 SG ? ? A CYS 415 A CYS 425 1_555 ? ? ? ? ? ? ? 2.062 ? 
disulf3 disulf ? ? A CYS 535 SG  ? ? ? 1_555 A CYS 574 SG ? ? A CYS 579 A CYS 618 1_555 ? ? ? ? ? ? ? 2.050 ? 
disulf4 disulf ? ? A CYS 557 SG  ? ? ? 1_555 A CYS 589 SG ? ? A CYS 601 A CYS 633 1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf5 disulf ? ? A CYS 591 SG  ? ? ? 1_555 A CYS 646 SG ? ? A CYS 635 A CYS 690 1_555 ? ? ? ? ? ? ? 2.066 ? 
disulf6 disulf ? ? A CYS 598 SG  ? ? ? 1_555 A CYS 611 SG ? ? A CYS 642 A CYS 655 1_555 ? ? ? ? ? ? ? 2.093 ? 
disulf7 disulf ? ? A CYS 625 SG  ? ? ? 1_555 A CYS 663 SG ? ? A CYS 669 A CYS 707 1_555 ? ? ? ? ? ? ? 2.020 ? 
covale1 covale ? ? A ASN 329 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 373 A NAG 801 1_555 ? ? ? ? ? ? ? 1.434 ? 
covale2 covale ? ? B NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? A NAG 801 A NAG 802 1_555 ? ? ? ? ? ? ? 1.439 ? 
covale3 covale ? ? A ASN 505 ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 549 A NAG 804 1_555 ? ? ? ? ? ? ? 1.447 ? 
covale4 covale ? ? E NAG .   O4  ? ? ? 1_555 F NAG .   C1 ? ? A NAG 804 A NAG 805 1_555 ? ? ? ? ? ? ? 1.448 ? 
covale5 covale ? ? C NAG .   O4  ? ? ? 1_555 D BMA .   C1 ? ? A NAG 802 A BMA 803 1_555 ? ? ? ? ? ? ? 1.450 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LEU 
_struct_mon_prot_cis.label_seq_id           31 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LEU 
_struct_mon_prot_cis.auth_seq_id            75 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   ARG 
_struct_mon_prot_cis.pdbx_label_seq_id_2    32 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    ARG 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     76 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.88 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 7 ? 
F ? 4 ? 
G ? 4 ? 
H ? 5 ? 
I ? 4 ? 
J ? 3 ? 
K ? 2 ? 
L ? 2 ? 
M ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? anti-parallel 
E 6 7 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
M 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 23  ? VAL A 27  ? THR A 67  VAL A 71  
A 2 TRP A 520 ? ASP A 526 ? TRP A 564 ASP A 570 
A 3 ASN A 505 ? PHE A 511 ? ASN A 549 PHE A 555 
A 4 TYR A 491 ? ALA A 496 ? TYR A 535 ALA A 540 
B 1 SER A 34  ? VAL A 40  ? SER A 78  VAL A 84  
B 2 VAL A 46  ? THR A 52  ? VAL A 90  THR A 96  
B 3 SER A 65  ? SER A 70  ? SER A 109 SER A 114 
B 4 LYS A 78  ? ASP A 79  ? LYS A 122 ASP A 123 
C 1 MET A 95  ? ILE A 97  ? MET A 139 ILE A 141 
C 2 VAL A 105 ? ALA A 109 ? VAL A 149 ALA A 153 
C 3 ARG A 119 ? SER A 123 ? ARG A 163 SER A 167 
C 4 VAL A 131 ? ASP A 134 ? VAL A 175 ASP A 178 
D 1 MET A 144 ? TYR A 145 ? MET A 188 TYR A 189 
D 2 LEU A 153 ? LEU A 156 ? LEU A 197 LEU A 200 
D 3 LEU A 162 ? SER A 165 ? LEU A 206 SER A 209 
D 4 GLU A 173 ? HIS A 176 ? GLU A 217 HIS A 220 
E 1 VAL A 179 ? TRP A 184 ? VAL A 223 TRP A 228 
E 2 ILE A 190 ? THR A 194 ? ILE A 234 THR A 238 
E 3 LEU A 207 ? THR A 212 ? LEU A 251 THR A 256 
E 4 LYS A 220 ? GLY A 232 ? LYS A 264 GLY A 276 
E 5 PHE A 235 ? MET A 241 ? PHE A 279 MET A 285 
E 6 ARG A 248 ? SER A 253 ? ARG A 292 SER A 297 
E 7 SER A 261 ? MET A 262 ? SER A 305 MET A 306 
F 1 TYR A 274 ? ASN A 280 ? TYR A 318 ASN A 324 
F 2 MET A 283 ? ASP A 289 ? MET A 327 ASP A 333 
F 3 PHE A 296 ? SER A 302 ? PHE A 340 SER A 346 
F 4 TYR A 309 ? LEU A 317 ? TYR A 353 LEU A 361 
G 1 THR A 328 ? ASN A 329 ? THR A 372 ASN A 373 
G 2 TYR A 337 ? LEU A 342 ? TYR A 381 LEU A 386 
G 3 ILE A 348 ? THR A 353 ? ILE A 392 THR A 397 
G 4 TRP A 360 ? THR A 361 ? TRP A 404 THR A 405 
H 1 LEU A 363 ? ARG A 364 ? LEU A 407 ARG A 408 
H 2 SER A 382 ? ILE A 385 ? SER A 426 ILE A 429 
H 3 VAL A 411 ? GLY A 418 ? VAL A 455 GLY A 462 
H 4 ASP A 427 ? SER A 431 ? ASP A 471 SER A 475 
H 5 THR A 439 ? LEU A 442 ? THR A 483 LEU A 486 
I 1 HIS A 446 ? LEU A 451 ? HIS A 490 LEU A 495 
I 2 ILE A 456 ? GLU A 461 ? ILE A 500 GLU A 505 
I 3 VAL A 469 ? SER A 473 ? VAL A 513 SER A 517 
I 4 GLN A 481 ? THR A 484 ? GLN A 525 THR A 528 
J 1 TYR A 540 ? LEU A 544 ? TYR A 584 LEU A 588 
J 2 TYR A 561 ? LEU A 568 ? TYR A 605 LEU A 612 
J 3 THR A 583 ? ILE A 588 ? THR A 627 ILE A 632 
K 1 PHE A 596 ? CYS A 598 ? PHE A 640 CYS A 642 
K 2 TYR A 638 ? LYS A 640 ? TYR A 682 LYS A 684 
L 1 TYR A 602 ? TYR A 603 ? TYR A 646 TYR A 647 
L 2 VAL A 612 ? GLU A 613 ? VAL A 656 GLU A 657 
M 1 THR A 634 ? THR A 635 ? THR A 678 THR A 679 
M 2 LYS A 657 ? ASP A 658 ? LYS A 701 ASP A 702 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N HIS A 24  ? N HIS A 68  O THR A 524 ? O THR A 568 
A 2 3 O VAL A 521 ? O VAL A 565 N GLY A 510 ? N GLY A 554 
A 3 4 O PHE A 511 ? O PHE A 555 N TYR A 491 ? N TYR A 535 
B 1 2 N SER A 36  ? N SER A 80  O LEU A 50  ? O LEU A 94  
B 2 3 N THR A 51  ? N THR A 95  O LYS A 66  ? O LYS A 110 
B 3 4 N ARG A 69  ? N ARG A 113 O LYS A 78  ? O LYS A 122 
C 1 2 N ALA A 96  ? N ALA A 140 O VAL A 106 ? O VAL A 150 
C 2 3 N VAL A 105 ? N VAL A 149 O SER A 123 ? O SER A 167 
C 3 4 N ARG A 122 ? N ARG A 166 O VAL A 131 ? O VAL A 175 
D 1 2 N MET A 144 ? N MET A 188 O LEU A 154 ? O LEU A 198 
D 2 3 N ALA A 155 ? N ALA A 199 O TRP A 163 ? O TRP A 207 
D 3 4 N LEU A 162 ? N LEU A 206 O HIS A 176 ? O HIS A 220 
E 1 2 N LYS A 183 ? N LYS A 227 O PHE A 191 ? O PHE A 235 
E 2 3 N PHE A 192 ? N PHE A 236 O TRP A 210 ? O TRP A 254 
E 3 4 N LEU A 207 ? N LEU A 251 O ILE A 226 ? O ILE A 270 
E 4 5 N TYR A 227 ? N TYR A 271 O SER A 239 ? O SER A 283 
E 5 6 N ALA A 238 ? N ALA A 282 O HIS A 251 ? O HIS A 295 
E 6 7 N VAL A 252 ? N VAL A 296 O SER A 261 ? O SER A 305 
F 1 2 N SER A 275 ? N SER A 319 O HIS A 287 ? O HIS A 331 
F 2 3 N MET A 286 ? N MET A 330 O PHE A 300 ? O PHE A 344 
F 3 4 N GLY A 297 ? N GLY A 341 O HIS A 316 ? O HIS A 360 
G 1 2 N THR A 328 ? N THR A 372 O ILE A 338 ? O ILE A 382 
G 2 3 N THR A 339 ? N THR A 383 O MET A 351 ? O MET A 395 
G 3 4 N ILE A 352 ? N ILE A 396 O THR A 361 ? O THR A 405 
H 1 2 N LEU A 363 ? N LEU A 407 O LEU A 383 ? O LEU A 427 
H 2 3 N HIS A 384 ? N HIS A 428 O SER A 416 ? O SER A 460 
H 3 4 N ALA A 413 ? N ALA A 457 O TYR A 429 ? O TYR A 473 
H 4 5 N VAL A 428 ? N VAL A 472 O LEU A 442 ? O LEU A 486 
I 1 2 N TYR A 447 ? N TYR A 491 O ILE A 460 ? O ILE A 504 
I 2 3 N ALA A 459 ? N ALA A 503 O LYS A 471 ? O LYS A 515 
I 3 4 N ILE A 470 ? N ILE A 514 O TYR A 483 ? O TYR A 527 
J 1 2 N TRP A 543 ? N TRP A 587 O PHE A 565 ? O PHE A 609 
J 2 3 N GLN A 564 ? N GLN A 608 O GLN A 585 ? O GLN A 629 
K 1 2 N LEU A 597 ? N LEU A 641 O ARG A 639 ? O ARG A 683 
L 1 2 N TYR A 603 ? N TYR A 647 O VAL A 612 ? O VAL A 656 
M 1 2 N THR A 635 ? N THR A 679 O LYS A 657 ? O LYS A 701 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE PGE A 806'                                       
AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE 2JQ A 807'                                       
AC3 Software ? ? ? ? 10 'BINDING SITE FOR CHAIN A OF SUGAR BOUND TO ASN A 373 RESIDUES 801 TO 803' 
AC4 Software ? ? ? ? 9  'BINDING SITE FOR CHAIN A OF SUGAR BOUND TO ASN A 549 RESIDUES 804 TO 805' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3  VAL A 35  ? VAL A 79   . ? 1_555 ? 
2  AC1 3  TRP A 509 ? TRP A 553  . ? 1_555 ? 
3  AC1 3  TRP A 520 ? TRP A 564  . ? 1_555 ? 
4  AC2 11 TYR A 227 ? TYR A 271  . ? 1_555 ? 
5  AC2 11 PHE A 229 ? PHE A 273  . ? 1_555 ? 
6  AC2 11 GLY A 230 ? GLY A 274  . ? 1_555 ? 
7  AC2 11 PHE A 237 ? PHE A 281  . ? 1_555 ? 
8  AC2 11 ALA A 238 ? ALA A 282  . ? 1_555 ? 
9  AC2 11 SER A 239 ? SER A 283  . ? 1_555 ? 
10 AC2 11 ARG A 248 ? ARG A 292  . ? 1_555 ? 
11 AC2 11 ILE A 250 ? ILE A 294  . ? 1_555 ? 
12 AC2 11 PHE A 273 ? PHE A 317  . ? 1_555 ? 
13 AC2 11 TYR A 274 ? TYR A 318  . ? 1_555 ? 
14 AC2 11 TYR A 318 ? TYR A 362  . ? 1_555 ? 
15 AC3 10 ALA A 278 ? ALA A 322  . ? 1_555 ? 
16 AC3 10 ALA A 279 ? ALA A 323  . ? 1_555 ? 
17 AC3 10 ASN A 280 ? ASN A 324  . ? 1_555 ? 
18 AC3 10 ASN A 329 ? ASN A 373  . ? 1_555 ? 
19 AC3 10 THR A 331 ? THR A 375  . ? 1_555 ? 
20 AC3 10 TYR A 337 ? TYR A 381  . ? 1_555 ? 
21 AC3 10 HOH I .   ? HOH A 1003 . ? 1_555 ? 
22 AC3 10 HOH I .   ? HOH A 1005 . ? 1_555 ? 
23 AC3 10 HOH I .   ? HOH A 1006 . ? 1_555 ? 
24 AC3 10 HOH I .   ? HOH A 1033 . ? 1_555 ? 
25 AC4 9  ASP A 72  ? ASP A 116  . ? 1_555 ? 
26 AC4 9  TYR A 73  ? TYR A 117  . ? 1_555 ? 
27 AC4 9  LYS A 75  ? LYS A 119  . ? 1_555 ? 
28 AC4 9  SER A 503 ? SER A 547  . ? 1_555 ? 
29 AC4 9  MET A 504 ? MET A 548  . ? 1_555 ? 
30 AC4 9  ASN A 505 ? ASN A 549  . ? 1_555 ? 
31 AC4 9  ASP A 526 ? ASP A 570  . ? 1_555 ? 
32 AC4 9  ARG A 578 ? ARG A 622  . ? 1_555 ? 
33 AC4 9  HOH I .   ? HOH A 1026 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4N7E 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4N7E 
_atom_sites.fract_transf_matrix[1][1]   0.006175 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004664 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012920 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011272 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
F 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 10  ? -10.899 -3.644 27.545  1.00 140.81 ? 54   GLY A N   1 
ATOM   2    C CA  . GLY A 1 10  ? -10.336 -2.633 28.420  1.00 140.23 ? 54   GLY A CA  1 
ATOM   3    C C   . GLY A 1 10  ? -8.893  -2.349 28.070  1.00 141.23 ? 54   GLY A C   1 
ATOM   4    O O   . GLY A 1 10  ? -8.586  -1.330 27.473  1.00 140.76 ? 54   GLY A O   1 
ATOM   5    N N   . ARG A 1 11  ? -8.010  -3.273 28.432  1.00 171.77 ? 55   ARG A N   1 
ATOM   6    C CA  . ARG A 1 11  ? -6.613  -3.223 28.005  1.00 173.04 ? 55   ARG A CA  1 
ATOM   7    C C   . ARG A 1 11  ? -5.672  -2.343 28.834  1.00 171.68 ? 55   ARG A C   1 
ATOM   8    O O   . ARG A 1 11  ? -4.504  -2.193 28.475  1.00 171.54 ? 55   ARG A O   1 
ATOM   9    C CB  . ARG A 1 11  ? -6.530  -2.815 26.530  1.00 173.52 ? 55   ARG A CB  1 
ATOM   10   C CG  . ARG A 1 11  ? -6.871  -3.932 25.557  1.00 175.69 ? 55   ARG A CG  1 
ATOM   11   C CD  . ARG A 1 11  ? -8.267  -3.756 24.983  1.00 178.14 ? 55   ARG A CD  1 
ATOM   12   N NE  . ARG A 1 11  ? -8.657  -4.882 24.138  1.00 174.19 ? 55   ARG A NE  1 
ATOM   13   C CZ  . ARG A 1 11  ? -8.690  -4.843 22.810  1.00 174.58 ? 55   ARG A CZ  1 
ATOM   14   N NH1 . ARG A 1 11  ? -8.356  -3.732 22.169  1.00 178.79 ? 55   ARG A NH1 1 
ATOM   15   N NH2 . ARG A 1 11  ? -9.057  -5.916 22.123  1.00 170.64 ? 55   ARG A NH2 1 
ATOM   16   N N   . VAL A 1 12  ? -6.151  -1.769 29.934  1.00 146.03 ? 56   VAL A N   1 
ATOM   17   C CA  . VAL A 1 12  ? -5.253  -1.006 30.792  1.00 144.45 ? 56   VAL A CA  1 
ATOM   18   C C   . VAL A 1 12  ? -4.905  -1.797 32.040  1.00 143.71 ? 56   VAL A C   1 
ATOM   19   O O   . VAL A 1 12  ? -5.777  -2.342 32.709  1.00 143.74 ? 56   VAL A O   1 
ATOM   20   C CB  . VAL A 1 12  ? -5.836  0.344  31.218  1.00 141.89 ? 56   VAL A CB  1 
ATOM   21   C CG1 . VAL A 1 12  ? -4.898  1.016  32.203  1.00 140.96 ? 56   VAL A CG1 1 
ATOM   22   C CG2 . VAL A 1 12  ? -6.040  1.229  30.010  1.00 142.31 ? 56   VAL A CG2 1 
ATOM   23   N N   . ARG A 1 13  ? -3.616  -1.868 32.340  1.00 161.95 ? 57   ARG A N   1 
ATOM   24   C CA  . ARG A 1 13  ? -3.157  -2.646 33.471  1.00 160.92 ? 57   ARG A CA  1 
ATOM   25   C C   . ARG A 1 13  ? -2.978  -1.769 34.687  1.00 157.86 ? 57   ARG A C   1 
ATOM   26   O O   . ARG A 1 13  ? -2.402  -0.695 34.616  1.00 156.44 ? 57   ARG A O   1 
ATOM   27   C CB  . ARG A 1 13  ? -1.840  -3.342 33.134  1.00 162.68 ? 57   ARG A CB  1 
ATOM   28   C CG  . ARG A 1 13  ? -1.958  -4.420 32.067  1.00 163.19 ? 57   ARG A CG  1 
ATOM   29   C CD  . ARG A 1 13  ? -0.620  -5.104 31.817  1.00 165.36 ? 57   ARG A CD  1 
ATOM   30   N NE  . ARG A 1 13  ? -0.692  -6.096 30.744  1.00 164.34 ? 57   ARG A NE  1 
ATOM   31   C CZ  . ARG A 1 13  ? 0.355   -6.750 30.252  1.00 165.40 ? 57   ARG A CZ  1 
ATOM   32   N NH1 . ARG A 1 13  ? 1.571   -6.529 30.730  1.00 167.70 ? 57   ARG A NH1 1 
ATOM   33   N NH2 . ARG A 1 13  ? 0.187   -7.631 29.277  1.00 164.18 ? 57   ARG A NH2 1 
ATOM   34   N N   . ASP A 1 14  ? -3.468  -2.228 35.821  1.00 160.96 ? 58   ASP A N   1 
ATOM   35   C CA  . ASP A 1 14  ? -3.158  -1.504 37.059  1.00 158.81 ? 58   ASP A CA  1 
ATOM   36   C C   . ASP A 1 14  ? -3.701  -0.075 37.215  1.00 156.35 ? 58   ASP A C   1 
ATOM   37   O O   . ASP A 1 14  ? -2.997  0.802  37.714  1.00 154.91 ? 58   ASP A O   1 
ATOM   38   C CB  . ASP A 1 14  ? -1.644  -1.503 37.297  1.00 158.94 ? 58   ASP A CB  1 
ATOM   39   C CG  . ASP A 1 14  ? -1.114  -2.868 37.691  1.00 160.65 ? 58   ASP A CG  1 
ATOM   40   O OD1 . ASP A 1 14  ? -1.930  -3.741 38.055  1.00 162.03 ? 58   ASP A OD1 1 
ATOM   41   O OD2 . ASP A 1 14  ? 0.117   -3.068 37.636  1.00 160.97 ? 58   ASP A OD2 1 
ATOM   42   N N   . PHE A 1 15  ? -4.944  0.160  36.802  1.00 131.22 ? 59   PHE A N   1 
ATOM   43   C CA  . PHE A 1 15  ? -5.586  1.494  37.010  1.00 128.74 ? 59   PHE A CA  1 
ATOM   44   C C   . PHE A 1 15  ? -6.069  1.915  38.413  1.00 126.41 ? 59   PHE A C   1 
ATOM   45   O O   . PHE A 1 15  ? -5.867  3.072  38.779  1.00 124.51 ? 59   PHE A O   1 
ATOM   46   C CB  . PHE A 1 15  ? -6.771  1.669  36.016  1.00 128.70 ? 59   PHE A CB  1 
ATOM   47   C CG  . PHE A 1 15  ? -7.994  0.855  36.336  1.00 128.76 ? 59   PHE A CG  1 
ATOM   48   C CD1 . PHE A 1 15  ? -8.123  -0.425 35.836  1.00 130.47 ? 59   PHE A CD1 1 
ATOM   49   C CD2 . PHE A 1 15  ? -9.035  1.391  37.083  1.00 127.46 ? 59   PHE A CD2 1 
ATOM   50   C CE1 . PHE A 1 15  ? -9.250  -1.176 36.095  1.00 131.05 ? 59   PHE A CE1 1 
ATOM   51   C CE2 . PHE A 1 15  ? -10.170 0.639  37.341  1.00 128.32 ? 59   PHE A CE2 1 
ATOM   52   C CZ  . PHE A 1 15  ? -10.272 -0.647 36.848  1.00 130.16 ? 59   PHE A CZ  1 
ATOM   53   N N   . VAL A 1 16  ? -6.699  1.037  39.193  1.00 118.52 ? 60   VAL A N   1 
ATOM   54   C CA  . VAL A 1 16  ? -7.225  1.459  40.507  1.00 116.85 ? 60   VAL A CA  1 
ATOM   55   C C   . VAL A 1 16  ? -6.127  2.027  41.402  1.00 115.60 ? 60   VAL A C   1 
ATOM   56   O O   . VAL A 1 16  ? -6.348  2.972  42.163  1.00 113.57 ? 60   VAL A O   1 
ATOM   57   C CB  . VAL A 1 16  ? -7.913  0.301  41.253  1.00 118.32 ? 60   VAL A CB  1 
ATOM   58   C CG1 . VAL A 1 16  ? -8.572  0.811  42.527  1.00 116.82 ? 60   VAL A CG1 1 
ATOM   59   C CG2 . VAL A 1 16  ? -8.941  -0.359 40.363  1.00 120.04 ? 60   VAL A CG2 1 
ATOM   60   N N   . ALA A 1 17  ? -4.940  1.441  41.286  1.00 134.82 ? 61   ALA A N   1 
ATOM   61   C CA  . ALA A 1 17  ? -3.761  1.923  41.991  1.00 133.98 ? 61   ALA A CA  1 
ATOM   62   C C   . ALA A 1 17  ? -3.478  3.400  41.690  1.00 132.21 ? 61   ALA A C   1 
ATOM   63   O O   . ALA A 1 17  ? -3.214  4.182  42.601  1.00 130.63 ? 61   ALA A O   1 
ATOM   64   C CB  . ALA A 1 17  ? -2.555  1.071  41.629  1.00 135.85 ? 61   ALA A CB  1 
ATOM   65   N N   . LYS A 1 18  ? -3.464  3.747  40.407  1.00 122.23 ? 62   LYS A N   1 
ATOM   66   C CA  . LYS A 1 18  ? -3.156  5.107  39.968  1.00 120.93 ? 62   LYS A CA  1 
ATOM   67   C C   . LYS A 1 18  ? -4.171  6.157  40.418  1.00 118.23 ? 62   LYS A C   1 
ATOM   68   O O   . LYS A 1 18  ? -3.803  7.269  40.797  1.00 116.27 ? 62   LYS A O   1 
ATOM   69   C CB  . LYS A 1 18  ? -3.004  5.151  38.445  1.00 122.45 ? 62   LYS A CB  1 
ATOM   70   C CG  . LYS A 1 18  ? -1.823  4.354  37.916  1.00 124.65 ? 62   LYS A CG  1 
ATOM   71   C CD  . LYS A 1 18  ? -2.011  3.995  36.451  1.00 131.94 ? 62   LYS A CD  1 
ATOM   72   C CE  . LYS A 1 18  ? -1.306  2.694  36.106  1.00 133.48 ? 62   LYS A CE  1 
ATOM   73   N NZ  . LYS A 1 18  ? -0.875  2.657  34.681  1.00 140.47 ? 62   LYS A NZ  1 
ATOM   74   N N   . LEU A 1 19  ? -5.449  5.798  40.360  1.00 90.33  ? 63   LEU A N   1 
ATOM   75   C CA  . LEU A 1 19  ? -6.523  6.735  40.572  1.00 87.66  ? 63   LEU A CA  1 
ATOM   76   C C   . LEU A 1 19  ? -6.846  6.901  42.048  1.00 87.25  ? 63   LEU A C   1 
ATOM   77   O O   . LEU A 1 19  ? -7.441  7.900  42.434  1.00 85.59  ? 63   LEU A O   1 
ATOM   78   C CB  . LEU A 1 19  ? -7.757  6.288  39.788  1.00 88.41  ? 63   LEU A CB  1 
ATOM   79   C CG  . LEU A 1 19  ? -7.579  6.346  38.268  1.00 89.66  ? 63   LEU A CG  1 
ATOM   80   C CD1 . LEU A 1 19  ? -8.728  5.653  37.571  1.00 91.01  ? 63   LEU A CD1 1 
ATOM   81   C CD2 . LEU A 1 19  ? -7.460  7.787  37.816  1.00 87.62  ? 63   LEU A CD2 1 
ATOM   82   N N   . ALA A 1 20  ? -6.440  5.934  42.872  1.00 110.22 ? 64   ALA A N   1 
ATOM   83   C CA  . ALA A 1 20  ? -6.746  5.955  44.306  1.00 109.75 ? 64   ALA A CA  1 
ATOM   84   C C   . ALA A 1 20  ? -6.195  7.200  44.994  1.00 107.66 ? 64   ALA A C   1 
ATOM   85   O O   . ALA A 1 20  ? -6.938  7.946  45.634  1.00 106.32 ? 64   ALA A O   1 
ATOM   86   C CB  . ALA A 1 20  ? -6.207  4.715  44.973  1.00 111.70 ? 64   ALA A CB  1 
ATOM   87   N N   . ASN A 1 21  ? -4.888  7.400  44.861  1.00 208.34 ? 65   ASN A N   1 
ATOM   88   C CA  . ASN A 1 21  ? -4.209  8.606  45.321  1.00 206.34 ? 65   ASN A CA  1 
ATOM   89   C C   . ASN A 1 21  ? -4.900  9.840  44.761  1.00 204.05 ? 65   ASN A C   1 
ATOM   90   O O   . ASN A 1 21  ? -5.212  10.780 45.490  1.00 202.12 ? 65   ASN A O   1 
ATOM   91   C CB  . ASN A 1 21  ? -2.718  8.529  44.909  1.00 206.60 ? 65   ASN A CB  1 
ATOM   92   C CG  . ASN A 1 21  ? -2.024  9.901  44.734  1.00 205.53 ? 65   ASN A CG  1 
ATOM   93   O OD1 . ASN A 1 21  ? -2.518  10.954 45.140  1.00 204.74 ? 65   ASN A OD1 1 
ATOM   94   N ND2 . ASN A 1 21  ? -0.840  9.865  44.125  1.00 206.19 ? 65   ASN A ND2 1 
ATOM   95   N N   . ASN A 1 22  ? -5.168  9.810  43.466  1.00 106.30 ? 66   ASN A N   1 
ATOM   96   C CA  . ASN A 1 22  ? -5.476  11.019 42.722  1.00 104.45 ? 66   ASN A CA  1 
ATOM   97   C C   . ASN A 1 22  ? -6.932  11.493 42.794  1.00 102.69 ? 66   ASN A C   1 
ATOM   98   O O   . ASN A 1 22  ? -7.267  12.549 42.265  1.00 100.64 ? 66   ASN A O   1 
ATOM   99   C CB  . ASN A 1 22  ? -5.064  10.795 41.272  1.00 106.07 ? 66   ASN A CB  1 
ATOM   100  C CG  . ASN A 1 22  ? -3.549  10.675 41.112  1.00 108.14 ? 66   ASN A CG  1 
ATOM   101  O OD1 . ASN A 1 22  ? -2.788  11.477 41.660  1.00 107.48 ? 66   ASN A OD1 1 
ATOM   102  N ND2 . ASN A 1 22  ? -3.109  9.659  40.378  1.00 110.99 ? 66   ASN A ND2 1 
ATOM   103  N N   . THR A 1 23  ? -7.788  10.722 43.458  1.00 91.16  ? 67   THR A N   1 
ATOM   104  C CA  . THR A 1 23  ? -9.171  11.125 43.684  1.00 90.46  ? 67   THR A CA  1 
ATOM   105  C C   . THR A 1 23  ? -9.250  12.114 44.838  1.00 88.86  ? 67   THR A C   1 
ATOM   106  O O   . THR A 1 23  ? -8.859  11.795 45.950  1.00 90.25  ? 67   THR A O   1 
ATOM   107  C CB  . THR A 1 23  ? -10.050 9.923  44.014  1.00 92.98  ? 67   THR A CB  1 
ATOM   108  O OG1 . THR A 1 23  ? -9.812  8.883  43.061  1.00 94.86  ? 67   THR A OG1 1 
ATOM   109  C CG2 . THR A 1 23  ? -11.524 10.315 44.015  1.00 93.05  ? 67   THR A CG2 1 
ATOM   110  N N   . HIS A 1 24  ? -9.760  13.310 44.592  1.00 93.56  ? 68   HIS A N   1 
ATOM   111  C CA  . HIS A 1 24  ? -9.817  14.308 45.648  1.00 92.18  ? 68   HIS A CA  1 
ATOM   112  C C   . HIS A 1 24  ? -11.236 14.769 45.903  1.00 92.40  ? 68   HIS A C   1 
ATOM   113  O O   . HIS A 1 24  ? -11.880 15.341 45.021  1.00 91.40  ? 68   HIS A O   1 
ATOM   114  C CB  . HIS A 1 24  ? -8.950  15.515 45.301  1.00 89.39  ? 68   HIS A CB  1 
ATOM   115  C CG  . HIS A 1 24  ? -7.495  15.200 45.149  1.00 90.46  ? 68   HIS A CG  1 
ATOM   116  N ND1 . HIS A 1 24  ? -6.927  14.855 43.941  1.00 89.14  ? 68   HIS A ND1 1 
ATOM   117  C CD2 . HIS A 1 24  ? -6.486  15.195 46.052  1.00 93.18  ? 68   HIS A CD2 1 
ATOM   118  C CE1 . HIS A 1 24  ? -5.633  14.644 44.106  1.00 91.31  ? 68   HIS A CE1 1 
ATOM   119  N NE2 . HIS A 1 24  ? -5.342  14.842 45.378  1.00 93.68  ? 68   HIS A NE2 1 
ATOM   120  N N   . GLN A 1 25  ? -11.708 14.534 47.122  1.00 108.01 ? 69   GLN A N   1 
ATOM   121  C CA  . GLN A 1 25  ? -13.045 14.945 47.521  1.00 109.10 ? 69   GLN A CA  1 
ATOM   122  C C   . GLN A 1 25  ? -13.027 16.278 48.255  1.00 107.47 ? 69   GLN A C   1 
ATOM   123  O O   . GLN A 1 25  ? -12.119 16.558 49.046  1.00 106.57 ? 69   GLN A O   1 
ATOM   124  C CB  . GLN A 1 25  ? -13.686 13.876 48.400  1.00 112.19 ? 69   GLN A CB  1 
ATOM   125  C CG  . GLN A 1 25  ? -14.897 14.351 49.172  1.00 112.17 ? 69   GLN A CG  1 
ATOM   126  C CD  . GLN A 1 25  ? -14.951 13.735 50.543  1.00 114.55 ? 69   GLN A CD  1 
ATOM   127  O OE1 . GLN A 1 25  ? -15.478 12.637 50.718  1.00 117.30 ? 69   GLN A OE1 1 
ATOM   128  N NE2 . GLN A 1 25  ? -14.368 14.421 51.528  1.00 113.58 ? 69   GLN A NE2 1 
ATOM   129  N N   . HIS A 1 26  ? -14.023 17.108 47.962  1.00 96.31  ? 70   HIS A N   1 
ATOM   130  C CA  . HIS A 1 26  ? -14.277 18.308 48.743  1.00 95.59  ? 70   HIS A CA  1 
ATOM   131  C C   . HIS A 1 26  ? -15.778 18.425 48.999  1.00 98.33  ? 70   HIS A C   1 
ATOM   132  O O   . HIS A 1 26  ? -16.586 18.133 48.115  1.00 99.79  ? 70   HIS A O   1 
ATOM   133  C CB  . HIS A 1 26  ? -13.747 19.560 48.039  1.00 92.39  ? 70   HIS A CB  1 
ATOM   134  C CG  . HIS A 1 26  ? -13.746 20.780 48.910  1.00 91.54  ? 70   HIS A CG  1 
ATOM   135  N ND1 . HIS A 1 26  ? -14.818 21.642 48.988  1.00 89.46  ? 70   HIS A ND1 1 
ATOM   136  C CD2 . HIS A 1 26  ? -12.807 21.269 49.756  1.00 93.01  ? 70   HIS A CD2 1 
ATOM   137  C CE1 . HIS A 1 26  ? -14.541 22.612 49.844  1.00 89.41  ? 70   HIS A CE1 1 
ATOM   138  N NE2 . HIS A 1 26  ? -13.328 22.409 50.323  1.00 91.56  ? 70   HIS A NE2 1 
ATOM   139  N N   . VAL A 1 27  ? -16.152 18.950 50.154  1.00 124.85 ? 71   VAL A N   1 
ATOM   140  C CA  . VAL A 1 27  ? -17.562 19.104 50.464  1.00 127.73 ? 71   VAL A CA  1 
ATOM   141  C C   . VAL A 1 27  ? -18.014 20.532 50.667  1.00 127.12 ? 71   VAL A C   1 
ATOM   142  O O   . VAL A 1 27  ? -17.240 21.404 51.000  1.00 124.54 ? 71   VAL A O   1 
ATOM   143  C CB  . VAL A 1 27  ? -17.974 18.298 51.680  1.00 129.89 ? 71   VAL A CB  1 
ATOM   144  C CG1 . VAL A 1 27  ? -19.418 18.606 52.011  1.00 132.78 ? 71   VAL A CG1 1 
ATOM   145  C CG2 . VAL A 1 27  ? -17.797 16.825 51.393  1.00 132.39 ? 71   VAL A CG2 1 
ATOM   146  N N   . PHE A 1 28  ? -19.294 20.745 50.446  1.00 105.77 ? 72   PHE A N   1 
ATOM   147  C CA  . PHE A 1 28  ? -19.869 22.060 50.348  1.00 105.97 ? 72   PHE A CA  1 
ATOM   148  C C   . PHE A 1 28  ? -21.164 22.073 51.121  1.00 109.21 ? 72   PHE A C   1 
ATOM   149  O O   . PHE A 1 28  ? -21.592 21.057 51.636  1.00 110.47 ? 72   PHE A O   1 
ATOM   150  C CB  . PHE A 1 28  ? -20.158 22.416 48.899  1.00 106.10 ? 72   PHE A CB  1 
ATOM   151  C CG  . PHE A 1 28  ? -18.944 22.512 48.035  1.00 102.16 ? 72   PHE A CG  1 
ATOM   152  C CD1 . PHE A 1 28  ? -18.195 23.659 48.001  1.00 101.19 ? 72   PHE A CD1 1 
ATOM   153  C CD2 . PHE A 1 28  ? -18.535 21.441 47.290  1.00 99.09  ? 72   PHE A CD2 1 
ATOM   154  C CE1 . PHE A 1 28  ? -17.072 23.746 47.220  1.00 97.40  ? 72   PHE A CE1 1 
ATOM   155  C CE2 . PHE A 1 28  ? -17.413 21.520 46.509  1.00 94.81  ? 72   PHE A CE2 1 
ATOM   156  C CZ  . PHE A 1 28  ? -16.682 22.673 46.473  1.00 94.08  ? 72   PHE A CZ  1 
ATOM   157  N N   . ASP A 1 29  ? -21.768 23.244 51.215  1.00 136.39 ? 73   ASP A N   1 
ATOM   158  C CA  . ASP A 1 29  ? -22.997 23.453 51.966  1.00 139.22 ? 73   ASP A CA  1 
ATOM   159  C C   . ASP A 1 29  ? -24.307 23.021 51.284  1.00 142.12 ? 73   ASP A C   1 
ATOM   160  O O   . ASP A 1 29  ? -24.331 22.524 50.179  1.00 142.51 ? 73   ASP A O   1 
ATOM   161  C CB  . ASP A 1 29  ? -23.090 24.903 52.407  1.00 139.63 ? 73   ASP A CB  1 
ATOM   162  C CG  . ASP A 1 29  ? -23.190 25.830 51.256  1.00 140.02 ? 73   ASP A CG  1 
ATOM   163  O OD1 . ASP A 1 29  ? -24.191 25.745 50.531  1.00 142.78 ? 73   ASP A OD1 1 
ATOM   164  O OD2 . ASP A 1 29  ? -22.265 26.626 51.057  1.00 137.42 ? 73   ASP A OD2 1 
ATOM   165  N N   . ASP A 1 30  ? -25.375 23.143 52.068  1.00 213.77 ? 74   ASP A N   1 
ATOM   166  C CA  . ASP A 1 30  ? -26.645 22.458 51.851  1.00 215.87 ? 74   ASP A CA  1 
ATOM   167  C C   . ASP A 1 30  ? -27.499 22.914 50.676  1.00 216.74 ? 74   ASP A C   1 
ATOM   168  O O   . ASP A 1 30  ? -27.540 24.095 50.330  1.00 216.37 ? 74   ASP A O   1 
ATOM   169  C CB  . ASP A 1 30  ? -27.484 22.497 53.134  1.00 215.83 ? 74   ASP A CB  1 
ATOM   170  C CG  . ASP A 1 30  ? -28.524 21.395 53.183  1.00 218.03 ? 74   ASP A CG  1 
ATOM   171  O OD1 . ASP A 1 30  ? -28.264 20.305 52.632  1.00 220.37 ? 74   ASP A OD1 1 
ATOM   172  O OD2 . ASP A 1 30  ? -29.602 21.619 53.772  1.00 217.09 ? 74   ASP A OD2 1 
ATOM   173  N N   . LEU A 1 31  ? -28.191 21.949 50.080  1.00 166.53 ? 75   LEU A N   1 
ATOM   174  C CA  . LEU A 1 31  ? -29.218 22.216 49.087  1.00 166.90 ? 75   LEU A CA  1 
ATOM   175  C C   . LEU A 1 31  ? -30.442 22.846 49.763  1.00 167.38 ? 75   LEU A C   1 
ATOM   176  O O   . LEU A 1 31  ? -30.726 22.545 50.923  1.00 167.07 ? 75   LEU A O   1 
ATOM   177  C CB  . LEU A 1 31  ? -29.617 20.929 48.365  1.00 165.96 ? 75   LEU A CB  1 
ATOM   178  C CG  . LEU A 1 31  ? -30.228 19.826 49.232  1.00 165.30 ? 75   LEU A CG  1 
ATOM   179  C CD1 . LEU A 1 31  ? -31.698 20.109 49.504  1.00 166.38 ? 75   LEU A CD1 1 
ATOM   180  C CD2 . LEU A 1 31  ? -30.053 18.466 48.574  1.00 166.32 ? 75   LEU A CD2 1 
ATOM   181  N N   . ARG A 1 32  ? -31.163 23.718 49.057  1.00 167.40 ? 76   ARG A N   1 
ATOM   182  C CA  . ARG A 1 32  ? -30.850 24.079 47.678  1.00 167.58 ? 76   ARG A CA  1 
ATOM   183  C C   . ARG A 1 32  ? -30.493 25.552 47.545  1.00 169.11 ? 76   ARG A C   1 
ATOM   184  O O   . ARG A 1 32  ? -31.246 26.429 47.970  1.00 169.84 ? 76   ARG A O   1 
ATOM   185  C CB  . ARG A 1 32  ? -32.024 23.739 46.758  1.00 167.15 ? 76   ARG A CB  1 
ATOM   186  C CG  . ARG A 1 32  ? -32.260 22.248 46.578  1.00 173.09 ? 76   ARG A CG  1 
ATOM   187  C CD  . ARG A 1 32  ? -33.213 21.975 45.426  1.00 172.49 ? 76   ARG A CD  1 
ATOM   188  N NE  . ARG A 1 32  ? -34.538 22.537 45.667  1.00 178.42 ? 76   ARG A NE  1 
ATOM   189  C CZ  . ARG A 1 32  ? -35.503 21.915 46.337  1.00 177.05 ? 76   ARG A CZ  1 
ATOM   190  N NH1 . ARG A 1 32  ? -35.292 20.704 46.835  1.00 169.53 ? 76   ARG A NH1 1 
ATOM   191  N NH2 . ARG A 1 32  ? -36.679 22.502 46.509  1.00 182.40 ? 76   ARG A NH2 1 
ATOM   192  N N   . GLY A 1 33  ? -29.341 25.811 46.940  1.00 132.46 ? 77   GLY A N   1 
ATOM   193  C CA  . GLY A 1 33  ? -28.937 27.160 46.598  1.00 133.32 ? 77   GLY A CA  1 
ATOM   194  C C   . GLY A 1 33  ? -28.546 27.222 45.149  1.00 131.92 ? 77   GLY A C   1 
ATOM   195  O O   . GLY A 1 33  ? -28.203 26.210 44.552  1.00 129.48 ? 77   GLY A O   1 
ATOM   196  N N   . SER A 1 34  ? -28.616 28.411 44.570  1.00 125.40 ? 78   SER A N   1 
ATOM   197  C CA  . SER A 1 34  ? -28.221 28.570 43.188  1.00 119.53 ? 78   SER A CA  1 
ATOM   198  C C   . SER A 1 34  ? -26.712 28.453 43.137  1.00 116.37 ? 78   SER A C   1 
ATOM   199  O O   . SER A 1 34  ? -26.007 29.038 43.953  1.00 117.30 ? 78   SER A O   1 
ATOM   200  C CB  . SER A 1 34  ? -28.706 29.901 42.618  1.00 117.81 ? 78   SER A CB  1 
ATOM   201  O OG  . SER A 1 34  ? -30.102 29.858 42.381  1.00 121.27 ? 78   SER A OG  1 
ATOM   202  N N   . VAL A 1 35  ? -26.221 27.670 42.190  1.00 118.13 ? 79   VAL A N   1 
ATOM   203  C CA  . VAL A 1 35  ? -24.806 27.351 42.131  1.00 114.76 ? 79   VAL A CA  1 
ATOM   204  C C   . VAL A 1 35  ? -24.182 27.893 40.856  1.00 106.12 ? 79   VAL A C   1 
ATOM   205  O O   . VAL A 1 35  ? -24.646 27.590 39.763  1.00 103.39 ? 79   VAL A O   1 
ATOM   206  C CB  . VAL A 1 35  ? -24.589 25.832 42.201  1.00 117.12 ? 79   VAL A CB  1 
ATOM   207  C CG1 . VAL A 1 35  ? -23.119 25.505 42.189  1.00 113.93 ? 79   VAL A CG1 1 
ATOM   208  C CG2 . VAL A 1 35  ? -25.263 25.262 43.438  1.00 124.06 ? 79   VAL A CG2 1 
ATOM   209  N N   . SER A 1 36  ? -23.146 28.714 40.999  1.00 94.33  ? 80   SER A N   1 
ATOM   210  C CA  . SER A 1 36  ? -22.341 29.130 39.851  1.00 86.62  ? 80   SER A CA  1 
ATOM   211  C C   . SER A 1 36  ? -20.914 28.613 39.990  1.00 83.76  ? 80   SER A C   1 
ATOM   212  O O   . SER A 1 36  ? -20.320 28.705 41.059  1.00 85.23  ? 80   SER A O   1 
ATOM   213  C CB  . SER A 1 36  ? -22.317 30.652 39.703  1.00 83.56  ? 80   SER A CB  1 
ATOM   214  O OG  . SER A 1 36  ? -23.570 31.166 39.298  1.00 85.39  ? 80   SER A OG  1 
ATOM   215  N N   . LEU A 1 37  ? -20.380 28.063 38.903  1.00 69.85  ? 81   LEU A N   1 
ATOM   216  C CA  . LEU A 1 37  ? -18.984 27.636 38.823  1.00 66.82  ? 81   LEU A CA  1 
ATOM   217  C C   . LEU A 1 37  ? -18.323 28.374 37.668  1.00 61.25  ? 81   LEU A C   1 
ATOM   218  O O   . LEU A 1 37  ? -18.836 28.330 36.551  1.00 59.91  ? 81   LEU A O   1 
ATOM   219  C CB  . LEU A 1 37  ? -18.888 26.121 38.625  1.00 69.29  ? 81   LEU A CB  1 
ATOM   220  C CG  . LEU A 1 37  ? -17.529 25.425 38.617  1.00 67.75  ? 81   LEU A CG  1 
ATOM   221  C CD1 . LEU A 1 37  ? -17.709 23.972 38.956  1.00 72.49  ? 81   LEU A CD1 1 
ATOM   222  C CD2 . LEU A 1 37  ? -16.822 25.550 37.257  1.00 63.57  ? 81   LEU A CD2 1 
ATOM   223  N N   . SER A 1 38  ? -17.201 29.042 37.928  1.00 79.09  ? 82   SER A N   1 
ATOM   224  C CA  . SER A 1 38  ? -16.462 29.765 36.888  1.00 75.32  ? 82   SER A CA  1 
ATOM   225  C C   . SER A 1 38  ? -14.982 29.457 36.860  1.00 74.70  ? 82   SER A C   1 
ATOM   226  O O   . SER A 1 38  ? -14.289 29.552 37.868  1.00 75.42  ? 82   SER A O   1 
ATOM   227  C CB  . SER A 1 38  ? -16.606 31.270 37.054  1.00 73.77  ? 82   SER A CB  1 
ATOM   228  O OG  . SER A 1 38  ? -17.923 31.670 36.792  1.00 74.57  ? 82   SER A OG  1 
ATOM   229  N N   . TRP A 1 39  ? -14.478 29.111 35.691  1.00 62.37  ? 83   TRP A N   1 
ATOM   230  C CA  . TRP A 1 39  ? -13.055 28.937 35.560  1.00 63.15  ? 83   TRP A CA  1 
ATOM   231  C C   . TRP A 1 39  ? -12.438 30.316 35.422  1.00 62.26  ? 83   TRP A C   1 
ATOM   232  O O   . TRP A 1 39  ? -12.986 31.172 34.721  1.00 61.23  ? 83   TRP A O   1 
ATOM   233  C CB  . TRP A 1 39  ? -12.723 28.046 34.377  1.00 64.51  ? 83   TRP A CB  1 
ATOM   234  C CG  . TRP A 1 39  ? -12.958 26.630 34.674  1.00 66.54  ? 83   TRP A CG  1 
ATOM   235  C CD1 . TRP A 1 39  ? -14.124 25.965 34.553  1.00 66.92  ? 83   TRP A CD1 1 
ATOM   236  C CD2 . TRP A 1 39  ? -12.001 25.686 35.161  1.00 69.20  ? 83   TRP A CD2 1 
ATOM   237  N NE1 . TRP A 1 39  ? -13.964 24.652 34.929  1.00 69.75  ? 83   TRP A NE1 1 
ATOM   238  C CE2 . TRP A 1 39  ? -12.665 24.455 35.302  1.00 70.89  ? 83   TRP A CE2 1 
ATOM   239  C CE3 . TRP A 1 39  ? -10.644 25.760 35.478  1.00 70.99  ? 83   TRP A CE3 1 
ATOM   240  C CZ2 . TRP A 1 39  ? -12.029 23.311 35.748  1.00 73.75  ? 83   TRP A CZ2 1 
ATOM   241  C CZ3 . TRP A 1 39  ? -10.008 24.624 35.929  1.00 73.81  ? 83   TRP A CZ3 1 
ATOM   242  C CH2 . TRP A 1 39  ? -10.699 23.412 36.059  1.00 74.89  ? 83   TRP A CH2 1 
ATOM   243  N N   . VAL A 1 40  ? -11.343 30.571 36.135  1.00 66.83  ? 84   VAL A N   1 
ATOM   244  C CA  . VAL A 1 40  ? -10.683 31.851 35.957  1.00 67.76  ? 84   VAL A CA  1 
ATOM   245  C C   . VAL A 1 40  ? -9.267  31.642 35.428  1.00 70.94  ? 84   VAL A C   1 
ATOM   246  O O   . VAL A 1 40  ? -8.373  31.221 36.156  1.00 72.73  ? 84   VAL A O   1 
ATOM   247  C CB  . VAL A 1 40  ? -10.681 32.666 37.261  1.00 67.78  ? 84   VAL A CB  1 
ATOM   248  C CG1 . VAL A 1 40  ? -10.046 34.008 37.025  1.00 69.02  ? 84   VAL A CG1 1 
ATOM   249  C CG2 . VAL A 1 40  ? -12.114 32.862 37.754  1.00 66.00  ? 84   VAL A CG2 1 
ATOM   250  N N   . GLY A 1 41  ? -9.083  32.007 34.162  1.00 70.46  ? 85   GLY A N   1 
ATOM   251  C CA  . GLY A 1 41  ? -7.790  31.984 33.506  1.00 74.94  ? 85   GLY A CA  1 
ATOM   252  C C   . GLY A 1 41  ? -7.440  30.664 32.854  1.00 78.25  ? 85   GLY A C   1 
ATOM   253  O O   . GLY A 1 41  ? -8.166  29.678 32.981  1.00 76.57  ? 85   GLY A O   1 
ATOM   254  N N   . ASP A 1 42  ? -6.313  30.651 32.151  1.00 66.06  ? 86   ASP A N   1 
ATOM   255  C CA  . ASP A 1 42  ? -5.831  29.449 31.487  1.00 69.54  ? 86   ASP A CA  1 
ATOM   256  C C   . ASP A 1 42  ? -4.472  29.063 32.051  1.00 73.70  ? 86   ASP A C   1 
ATOM   257  O O   . ASP A 1 42  ? -3.569  29.894 32.140  1.00 74.51  ? 86   ASP A O   1 
ATOM   258  C CB  . ASP A 1 42  ? -5.733  29.671 29.977  1.00 72.16  ? 86   ASP A CB  1 
ATOM   259  C CG  . ASP A 1 42  ? -5.257  28.437 29.237  1.00 76.45  ? 86   ASP A CG  1 
ATOM   260  O OD1 . ASP A 1 42  ? -5.985  27.422 29.242  1.00 74.46  ? 86   ASP A OD1 1 
ATOM   261  O OD2 . ASP A 1 42  ? -4.156  28.481 28.649  1.00 80.34  ? 86   ASP A OD2 1 
ATOM   262  N N   . SER A 1 43  ? -4.340  27.796 32.433  1.00 86.55  ? 87   SER A N   1 
ATOM   263  C CA  . SER A 1 43  ? -3.104  27.293 33.016  1.00 89.04  ? 87   SER A CA  1 
ATOM   264  C C   . SER A 1 43  ? -2.979  27.757 34.463  1.00 85.33  ? 87   SER A C   1 
ATOM   265  O O   . SER A 1 43  ? -1.882  27.786 35.021  1.00 86.90  ? 87   SER A O   1 
ATOM   266  C CB  . SER A 1 43  ? -1.893  27.832 32.252  1.00 93.10  ? 87   SER A CB  1 
ATOM   267  O OG  . SER A 1 43  ? -1.841  27.301 30.940  1.00 96.10  ? 87   SER A OG  1 
ATOM   268  N N   . THR A 1 44  ? -4.106  28.125 35.067  1.00 83.67  ? 88   THR A N   1 
ATOM   269  C CA  . THR A 1 44  ? -4.097  28.637 36.441  1.00 80.34  ? 88   THR A CA  1 
ATOM   270  C C   . THR A 1 44  ? -4.636  27.538 37.383  1.00 78.28  ? 88   THR A C   1 
ATOM   271  O O   . THR A 1 44  ? -4.075  27.305 38.441  1.00 78.51  ? 88   THR A O   1 
ATOM   272  C CB  . THR A 1 44  ? -4.949  29.898 36.666  1.00 76.25  ? 88   THR A CB  1 
ATOM   273  O OG1 . THR A 1 44  ? -6.339  29.548 36.694  1.00 72.36  ? 88   THR A OG1 1 
ATOM   274  C CG2 . THR A 1 44  ? -4.719  30.912 35.567  1.00 77.97  ? 88   THR A CG2 1 
ATOM   275  N N   . GLY A 1 45  ? -5.719  26.864 37.014  1.00 76.07  ? 89   GLY A N   1 
ATOM   276  C CA  . GLY A 1 45  ? -6.341  25.899 37.908  1.00 74.45  ? 89   GLY A CA  1 
ATOM   277  C C   . GLY A 1 45  ? -7.366  26.520 38.843  1.00 70.66  ? 89   GLY A C   1 
ATOM   278  O O   . GLY A 1 45  ? -7.961  25.828 39.677  1.00 70.19  ? 89   GLY A O   1 
ATOM   279  N N   . VAL A 1 46  ? -7.573  27.827 38.685  1.00 81.84  ? 90   VAL A N   1 
ATOM   280  C CA  . VAL A 1 46  ? -8.503  28.594 39.508  1.00 79.33  ? 90   VAL A CA  1 
ATOM   281  C C   . VAL A 1 46  ? -9.973  28.426 39.138  1.00 77.54  ? 90   VAL A C   1 
ATOM   282  O O   . VAL A 1 46  ? -10.377 28.662 37.996  1.00 76.32  ? 90   VAL A O   1 
ATOM   283  C CB  . VAL A 1 46  ? -8.194  30.080 39.439  1.00 78.76  ? 90   VAL A CB  1 
ATOM   284  C CG1 . VAL A 1 46  ? -9.254  30.852 40.189  1.00 77.49  ? 90   VAL A CG1 1 
ATOM   285  C CG2 . VAL A 1 46  ? -6.822  30.359 40.007  1.00 81.32  ? 90   VAL A CG2 1 
ATOM   286  N N   . ILE A 1 47  ? -10.773 28.033 40.124  1.00 66.32  ? 91   ILE A N   1 
ATOM   287  C CA  . ILE A 1 47  ? -12.214 27.880 39.947  1.00 64.58  ? 91   ILE A CA  1 
ATOM   288  C C   . ILE A 1 47  ? -12.973 28.695 41.000  1.00 65.74  ? 91   ILE A C   1 
ATOM   289  O O   . ILE A 1 47  ? -12.587 28.711 42.172  1.00 68.16  ? 91   ILE A O   1 
ATOM   290  C CB  . ILE A 1 47  ? -12.634 26.418 40.058  1.00 64.34  ? 91   ILE A CB  1 
ATOM   291  C CG1 . ILE A 1 47  ? -11.696 25.522 39.250  1.00 63.98  ? 91   ILE A CG1 1 
ATOM   292  C CG2 . ILE A 1 47  ? -14.081 26.252 39.614  1.00 63.96  ? 91   ILE A CG2 1 
ATOM   293  C CD1 . ILE A 1 47  ? -12.171 24.082 39.174  1.00 66.16  ? 91   ILE A CD1 1 
ATOM   294  N N   . LEU A 1 48  ? -14.033 29.386 40.586  1.00 68.53  ? 92   LEU A N   1 
ATOM   295  C CA  . LEU A 1 48  ? -14.903 30.079 41.541  1.00 70.31  ? 92   LEU A CA  1 
ATOM   296  C C   . LEU A 1 48  ? -16.255 29.408 41.604  1.00 73.93  ? 92   LEU A C   1 
ATOM   297  O O   . LEU A 1 48  ? -16.910 29.282 40.587  1.00 73.38  ? 92   LEU A O   1 
ATOM   298  C CB  . LEU A 1 48  ? -15.079 31.558 41.180  1.00 68.06  ? 92   LEU A CB  1 
ATOM   299  C CG  . LEU A 1 48  ? -13.928 32.480 41.637  1.00 69.30  ? 92   LEU A CG  1 
ATOM   300  C CD1 . LEU A 1 48  ? -14.299 33.958 41.499  1.00 69.59  ? 92   LEU A CD1 1 
ATOM   301  C CD2 . LEU A 1 48  ? -13.481 32.185 43.063  1.00 72.26  ? 92   LEU A CD2 1 
ATOM   302  N N   . VAL A 1 49  ? -16.658 28.957 42.793  1.00 69.11  ? 93   VAL A N   1 
ATOM   303  C CA  . VAL A 1 49  ? -18.019 28.442 43.021  1.00 74.56  ? 93   VAL A CA  1 
ATOM   304  C C   . VAL A 1 49  ? -18.807 29.473 43.835  1.00 77.38  ? 93   VAL A C   1 
ATOM   305  O O   . VAL A 1 49  ? -18.354 29.907 44.886  1.00 77.76  ? 93   VAL A O   1 
ATOM   306  C CB  . VAL A 1 49  ? -18.027 27.064 43.765  1.00 78.81  ? 93   VAL A CB  1 
ATOM   307  C CG1 . VAL A 1 49  ? -19.421 26.720 44.246  1.00 85.90  ? 93   VAL A CG1 1 
ATOM   308  C CG2 . VAL A 1 49  ? -17.472 25.944 42.880  1.00 77.18  ? 93   VAL A CG2 1 
ATOM   309  N N   . LEU A 1 50  ? -19.970 29.880 43.343  1.00 78.53  ? 94   LEU A N   1 
ATOM   310  C CA  . LEU A 1 50  ? -20.801 30.871 44.033  1.00 81.90  ? 94   LEU A CA  1 
ATOM   311  C C   . LEU A 1 50  ? -22.205 30.345 44.362  1.00 89.75  ? 94   LEU A C   1 
ATOM   312  O O   . LEU A 1 50  ? -22.909 29.875 43.470  1.00 90.77  ? 94   LEU A O   1 
ATOM   313  C CB  . LEU A 1 50  ? -20.909 32.133 43.182  1.00 77.59  ? 94   LEU A CB  1 
ATOM   314  C CG  . LEU A 1 50  ? -21.855 33.233 43.659  1.00 81.48  ? 94   LEU A CG  1 
ATOM   315  C CD1 . LEU A 1 50  ? -21.229 33.987 44.832  1.00 81.74  ? 94   LEU A CD1 1 
ATOM   316  C CD2 . LEU A 1 50  ? -22.192 34.192 42.522  1.00 78.08  ? 94   LEU A CD2 1 
ATOM   317  N N   . THR A 1 51  ? -22.600 30.449 45.636  1.00 78.75  ? 95   THR A N   1 
ATOM   318  C CA  . THR A 1 51  ? -23.871 29.906 46.154  1.00 86.68  ? 95   THR A CA  1 
ATOM   319  C C   . THR A 1 51  ? -24.746 30.973 46.806  1.00 89.71  ? 95   THR A C   1 
ATOM   320  O O   . THR A 1 51  ? -24.300 31.626 47.743  1.00 87.86  ? 95   THR A O   1 
ATOM   321  C CB  . THR A 1 51  ? -23.629 28.811 47.218  1.00 88.61  ? 95   THR A CB  1 
ATOM   322  O OG1 . THR A 1 51  ? -23.047 27.661 46.612  1.00 89.51  ? 95   THR A OG1 1 
ATOM   323  C CG2 . THR A 1 51  ? -24.925 28.393 47.879  1.00 88.30  ? 95   THR A CG2 1 
ATOM   324  N N   . THR A 1 52  ? -25.994 31.132 46.358  1.00 126.46 ? 96   THR A N   1 
ATOM   325  C CA  . THR A 1 52  ? -26.891 32.145 46.944  1.00 128.75 ? 96   THR A CA  1 
ATOM   326  C C   . THR A 1 52  ? -28.222 31.580 47.484  1.00 133.24 ? 96   THR A C   1 
ATOM   327  O O   . THR A 1 52  ? -28.860 30.766 46.826  1.00 135.10 ? 96   THR A O   1 
ATOM   328  C CB  . THR A 1 52  ? -27.208 33.263 45.916  1.00 126.67 ? 96   THR A CB  1 
ATOM   329  O OG1 . THR A 1 52  ? -28.045 32.745 44.874  1.00 128.41 ? 96   THR A OG1 1 
ATOM   330  C CG2 . THR A 1 52  ? -25.923 33.826 45.315  1.00 118.63 ? 96   THR A CG2 1 
ATOM   331  N N   . PHE A 1 53  ? -28.639 32.027 48.673  1.00 150.86 ? 97   PHE A N   1 
ATOM   332  C CA  . PHE A 1 53  ? -29.877 31.549 49.307  1.00 151.71 ? 97   PHE A CA  1 
ATOM   333  C C   . PHE A 1 53  ? -30.963 32.620 49.520  1.00 153.34 ? 97   PHE A C   1 
ATOM   334  O O   . PHE A 1 53  ? -30.705 33.684 50.079  1.00 155.15 ? 97   PHE A O   1 
ATOM   335  C CB  . PHE A 1 53  ? -29.582 30.919 50.674  1.00 153.28 ? 97   PHE A CB  1 
ATOM   336  C CG  . PHE A 1 53  ? -28.762 29.657 50.619  1.00 152.08 ? 97   PHE A CG  1 
ATOM   337  C CD1 . PHE A 1 53  ? -29.174 28.574 49.866  1.00 149.67 ? 97   PHE A CD1 1 
ATOM   338  C CD2 . PHE A 1 53  ? -27.604 29.534 51.369  1.00 153.30 ? 97   PHE A CD2 1 
ATOM   339  C CE1 . PHE A 1 53  ? -28.421 27.405 49.836  1.00 148.71 ? 97   PHE A CE1 1 
ATOM   340  C CE2 . PHE A 1 53  ? -26.854 28.368 51.339  1.00 152.31 ? 97   PHE A CE2 1 
ATOM   341  C CZ  . PHE A 1 53  ? -27.263 27.305 50.570  1.00 150.16 ? 97   PHE A CZ  1 
ATOM   342  N N   . HIS A 1 54  ? -32.186 32.292 49.104  1.00 158.29 ? 98   HIS A N   1 
ATOM   343  C CA  . HIS A 1 54  ? -33.370 33.123 49.363  1.00 159.45 ? 98   HIS A CA  1 
ATOM   344  C C   . HIS A 1 54  ? -34.321 32.499 50.388  1.00 159.98 ? 98   HIS A C   1 
ATOM   345  O O   . HIS A 1 54  ? -35.077 31.608 50.012  1.00 159.06 ? 98   HIS A O   1 
ATOM   346  C CB  . HIS A 1 54  ? -34.192 33.271 48.079  1.00 158.50 ? 98   HIS A CB  1 
ATOM   347  C CG  . HIS A 1 54  ? -33.393 33.637 46.870  1.00 157.16 ? 98   HIS A CG  1 
ATOM   348  N ND1 . HIS A 1 54  ? -33.023 34.932 46.579  1.00 156.16 ? 98   HIS A ND1 1 
ATOM   349  C CD2 . HIS A 1 54  ? -32.847 32.862 45.904  1.00 156.09 ? 98   HIS A CD2 1 
ATOM   350  C CE1 . HIS A 1 54  ? -32.320 34.943 45.460  1.00 154.70 ? 98   HIS A CE1 1 
ATOM   351  N NE2 . HIS A 1 54  ? -32.188 33.700 45.036  1.00 154.72 ? 98   HIS A NE2 1 
ATOM   352  N N   . VAL A 1 55  ? -34.347 32.980 51.632  1.00 149.77 ? 99   VAL A N   1 
ATOM   353  C CA  . VAL A 1 55  ? -35.468 32.690 52.546  1.00 150.61 ? 99   VAL A CA  1 
ATOM   354  C C   . VAL A 1 55  ? -35.708 33.875 53.500  1.00 152.35 ? 99   VAL A C   1 
ATOM   355  O O   . VAL A 1 55  ? -34.772 34.622 53.791  1.00 152.70 ? 99   VAL A O   1 
ATOM   356  C CB  . VAL A 1 55  ? -35.265 31.374 53.391  1.00 149.98 ? 99   VAL A CB  1 
ATOM   357  C CG1 . VAL A 1 55  ? -35.181 30.117 52.506  1.00 147.31 ? 99   VAL A CG1 1 
ATOM   358  C CG2 . VAL A 1 55  ? -34.091 31.482 54.351  1.00 149.80 ? 99   VAL A CG2 1 
ATOM   359  N N   . PRO A 1 56  ? -36.942 34.030 53.968  1.00 162.32 ? 100  PRO A N   1 
ATOM   360  C CA  . PRO A 1 56  ? -37.287 35.123 54.883  1.00 163.83 ? 100  PRO A CA  1 
ATOM   361  C C   . PRO A 1 56  ? -36.150 35.433 55.850  1.00 164.66 ? 100  PRO A C   1 
ATOM   362  O O   . PRO A 1 56  ? -36.121 36.530 56.406  1.00 165.69 ? 100  PRO A O   1 
ATOM   363  C CB  . PRO A 1 56  ? -38.490 34.566 55.647  1.00 163.70 ? 100  PRO A CB  1 
ATOM   364  C CG  . PRO A 1 56  ? -39.117 33.603 54.699  1.00 162.60 ? 100  PRO A CG  1 
ATOM   365  C CD  . PRO A 1 56  ? -37.982 32.987 53.931  1.00 161.32 ? 100  PRO A CD  1 
ATOM   366  N N   . GLN A 1 64  ? -28.386 34.371 52.084  1.00 131.43 ? 108  GLN A N   1 
ATOM   367  C CA  . GLN A 1 64  ? -27.172 35.086 51.722  1.00 130.32 ? 108  GLN A CA  1 
ATOM   368  C C   . GLN A 1 64  ? -26.277 34.268 50.806  1.00 128.23 ? 108  GLN A C   1 
ATOM   369  O O   . GLN A 1 64  ? -26.698 33.255 50.248  1.00 127.71 ? 108  GLN A O   1 
ATOM   370  C CB  . GLN A 1 64  ? -26.402 35.494 52.966  1.00 131.90 ? 108  GLN A CB  1 
ATOM   371  C CG  . GLN A 1 64  ? -27.173 36.453 53.838  1.00 134.77 ? 108  GLN A CG  1 
ATOM   372  C CD  . GLN A 1 64  ? -26.487 36.706 55.161  1.00 138.50 ? 108  GLN A CD  1 
ATOM   373  O OE1 . GLN A 1 64  ? -25.367 36.247 55.387  1.00 138.54 ? 108  GLN A OE1 1 
ATOM   374  N NE2 . GLN A 1 64  ? -27.162 37.431 56.051  1.00 141.42 ? 108  GLN A NE2 1 
ATOM   375  N N   . SER A 1 65  ? -25.032 34.705 50.662  1.00 113.95 ? 109  SER A N   1 
ATOM   376  C CA  . SER A 1 65  ? -24.196 34.197 49.589  1.00 111.28 ? 109  SER A CA  1 
ATOM   377  C C   . SER A 1 65  ? -22.839 33.669 50.072  1.00 110.73 ? 109  SER A C   1 
ATOM   378  O O   . SER A 1 65  ? -22.174 34.300 50.888  1.00 111.13 ? 109  SER A O   1 
ATOM   379  C CB  . SER A 1 65  ? -24.008 35.298 48.546  1.00 108.89 ? 109  SER A CB  1 
ATOM   380  O OG  . SER A 1 65  ? -23.103 34.895 47.541  1.00 107.37 ? 109  SER A OG  1 
ATOM   381  N N   . LYS A 1 66  ? -22.448 32.508 49.552  1.00 105.36 ? 110  LYS A N   1 
ATOM   382  C CA  . LYS A 1 66  ? -21.189 31.860 49.901  1.00 104.53 ? 110  LYS A CA  1 
ATOM   383  C C   . LYS A 1 66  ? -20.273 31.761 48.682  1.00 101.28 ? 110  LYS A C   1 
ATOM   384  O O   . LYS A 1 66  ? -20.750 31.506 47.579  1.00 100.36 ? 110  LYS A O   1 
ATOM   385  C CB  . LYS A 1 66  ? -21.458 30.470 50.464  1.00 105.91 ? 110  LYS A CB  1 
ATOM   386  C CG  . LYS A 1 66  ? -22.305 30.479 51.715  1.00 109.51 ? 110  LYS A CG  1 
ATOM   387  C CD  . LYS A 1 66  ? -21.554 29.862 52.877  1.00 111.35 ? 110  LYS A CD  1 
ATOM   388  C CE  . LYS A 1 66  ? -21.808 30.619 54.169  1.00 114.82 ? 110  LYS A CE  1 
ATOM   389  N NZ  . LYS A 1 66  ? -23.240 31.004 54.341  1.00 115.91 ? 110  LYS A NZ  1 
ATOM   390  N N   . LEU A 1 67  ? -18.969 31.961 48.869  1.00 91.02  ? 111  LEU A N   1 
ATOM   391  C CA  . LEU A 1 67  ? -18.037 31.967 47.735  1.00 86.90  ? 111  LEU A CA  1 
ATOM   392  C C   . LEU A 1 67  ? -16.751 31.161 47.948  1.00 85.16  ? 111  LEU A C   1 
ATOM   393  O O   . LEU A 1 67  ? -15.928 31.525 48.781  1.00 85.14  ? 111  LEU A O   1 
ATOM   394  C CB  . LEU A 1 67  ? -17.653 33.408 47.400  1.00 84.22  ? 111  LEU A CB  1 
ATOM   395  C CG  . LEU A 1 67  ? -16.744 33.577 46.180  1.00 78.98  ? 111  LEU A CG  1 
ATOM   396  C CD1 . LEU A 1 67  ? -17.496 33.229 44.898  1.00 77.69  ? 111  LEU A CD1 1 
ATOM   397  C CD2 . LEU A 1 67  ? -16.127 34.989 46.113  1.00 77.76  ? 111  LEU A CD2 1 
ATOM   398  N N   . TYR A 1 68  ? -16.548 30.089 47.188  1.00 95.11  ? 112  TYR A N   1 
ATOM   399  C CA  . TYR A 1 68  ? -15.329 29.310 47.376  1.00 93.53  ? 112  TYR A CA  1 
ATOM   400  C C   . TYR A 1 68  ? -14.318 29.509 46.261  1.00 88.48  ? 112  TYR A C   1 
ATOM   401  O O   . TYR A 1 68  ? -14.641 30.044 45.211  1.00 85.93  ? 112  TYR A O   1 
ATOM   402  C CB  . TYR A 1 68  ? -15.664 27.829 47.481  1.00 95.54  ? 112  TYR A CB  1 
ATOM   403  C CG  . TYR A 1 68  ? -16.732 27.515 48.489  1.00 99.97  ? 112  TYR A CG  1 
ATOM   404  C CD1 . TYR A 1 68  ? -18.081 27.631 48.169  1.00 101.57 ? 112  TYR A CD1 1 
ATOM   405  C CD2 . TYR A 1 68  ? -16.397 27.089 49.759  1.00 102.28 ? 112  TYR A CD2 1 
ATOM   406  C CE1 . TYR A 1 68  ? -19.063 27.339 49.097  1.00 104.67 ? 112  TYR A CE1 1 
ATOM   407  C CE2 . TYR A 1 68  ? -17.368 26.789 50.687  1.00 105.68 ? 112  TYR A CE2 1 
ATOM   408  C CZ  . TYR A 1 68  ? -18.698 26.916 50.355  1.00 106.60 ? 112  TYR A CZ  1 
ATOM   409  O OH  . TYR A 1 68  ? -19.661 26.620 51.291  1.00 109.31 ? 112  TYR A OH  1 
ATOM   410  N N   . ARG A 1 69  ? -13.119 28.973 46.459  1.00 99.16  ? 113  ARG A N   1 
ATOM   411  C CA  . ARG A 1 69  ? -12.053 29.140 45.493  1.00 94.72  ? 113  ARG A CA  1 
ATOM   412  C C   . ARG A 1 69  ? -11.087 27.973 45.539  1.00 94.34  ? 113  ARG A C   1 
ATOM   413  O O   . ARG A 1 69  ? -10.782 27.472 46.611  1.00 97.17  ? 113  ARG A O   1 
ATOM   414  C CB  . ARG A 1 69  ? -11.323 30.446 45.757  1.00 93.54  ? 113  ARG A CB  1 
ATOM   415  C CG  . ARG A 1 69  ? -10.240 30.751 44.767  1.00 89.64  ? 113  ARG A CG  1 
ATOM   416  C CD  . ARG A 1 69  ? -9.733  32.156 44.965  1.00 88.84  ? 113  ARG A CD  1 
ATOM   417  N NE  . ARG A 1 69  ? -8.630  32.490 44.063  1.00 86.15  ? 113  ARG A NE  1 
ATOM   418  C CZ  . ARG A 1 69  ? -7.385  32.055 44.231  1.00 86.44  ? 113  ARG A CZ  1 
ATOM   419  N NH1 . ARG A 1 69  ? -7.114  31.248 45.245  1.00 88.81  ? 113  ARG A NH1 1 
ATOM   420  N NH2 . ARG A 1 69  ? -6.421  32.405 43.389  1.00 84.88  ? 113  ARG A NH2 1 
ATOM   421  N N   . SER A 1 70  ? -10.602 27.551 44.374  1.00 92.05  ? 114  SER A N   1 
ATOM   422  C CA  . SER A 1 70  ? -9.607  26.485 44.275  1.00 91.71  ? 114  SER A CA  1 
ATOM   423  C C   . SER A 1 70  ? -8.501  26.862 43.295  1.00 88.35  ? 114  SER A C   1 
ATOM   424  O O   . SER A 1 70  ? -8.792  27.381 42.230  1.00 85.72  ? 114  SER A O   1 
ATOM   425  C CB  . SER A 1 70  ? -10.261 25.179 43.838  1.00 92.26  ? 114  SER A CB  1 
ATOM   426  O OG  . SER A 1 70  ? -9.282  24.243 43.434  1.00 91.30  ? 114  SER A OG  1 
ATOM   427  N N   . GLU A 1 71  ? -7.242  26.655 43.669  1.00 100.78 ? 115  GLU A N   1 
ATOM   428  C CA  . GLU A 1 71  ? -6.123  26.834 42.747  1.00 98.75  ? 115  GLU A CA  1 
ATOM   429  C C   . GLU A 1 71  ? -5.608  25.525 42.170  1.00 98.62  ? 115  GLU A C   1 
ATOM   430  O O   . GLU A 1 71  ? -4.659  25.514 41.398  1.00 97.81  ? 115  GLU A O   1 
ATOM   431  C CB  . GLU A 1 71  ? -4.974  27.547 43.445  1.00 99.98  ? 115  GLU A CB  1 
ATOM   432  C CG  . GLU A 1 71  ? -5.259  28.978 43.797  1.00 99.91  ? 115  GLU A CG  1 
ATOM   433  C CD  . GLU A 1 71  ? -4.124  29.632 44.587  1.00 101.63 ? 115  GLU A CD  1 
ATOM   434  O OE1 . GLU A 1 71  ? -3.197  28.923 45.063  1.00 103.59 ? 115  GLU A OE1 1 
ATOM   435  O OE2 . GLU A 1 71  ? -4.162  30.876 44.731  1.00 101.28 ? 115  GLU A OE2 1 
ATOM   436  N N   . ASP A 1 72  ? -6.180  24.419 42.616  1.00 88.33  ? 116  ASP A N   1 
ATOM   437  C CA  . ASP A 1 72  ? -5.706  23.092 42.234  1.00 88.60  ? 116  ASP A CA  1 
ATOM   438  C C   . ASP A 1 72  ? -6.507  22.362 41.146  1.00 87.21  ? 116  ASP A C   1 
ATOM   439  O O   . ASP A 1 72  ? -6.362  21.147 41.029  1.00 87.90  ? 116  ASP A O   1 
ATOM   440  C CB  . ASP A 1 72  ? -5.586  22.195 43.470  1.00 91.40  ? 116  ASP A CB  1 
ATOM   441  C CG  . ASP A 1 72  ? -6.752  22.342 44.417  1.00 93.65  ? 116  ASP A CG  1 
ATOM   442  O OD1 . ASP A 1 72  ? -7.911  22.432 43.935  1.00 93.08  ? 116  ASP A OD1 1 
ATOM   443  O OD2 . ASP A 1 72  ? -6.494  22.369 45.645  1.00 96.35  ? 116  ASP A OD2 1 
ATOM   444  N N   . TYR A 1 73  ? -7.406  23.064 40.448  1.00 83.87  ? 117  TYR A N   1 
ATOM   445  C CA  . TYR A 1 73  ? -8.283  22.453 39.420  1.00 82.61  ? 117  TYR A CA  1 
ATOM   446  C C   . TYR A 1 73  ? -9.559  21.834 40.011  1.00 84.59  ? 117  TYR A C   1 
ATOM   447  O O   . TYR A 1 73  ? -10.229 21.060 39.348  1.00 84.35  ? 117  TYR A O   1 
ATOM   448  C CB  . TYR A 1 73  ? -7.536  21.427 38.546  1.00 81.94  ? 117  TYR A CB  1 
ATOM   449  C CG  . TYR A 1 73  ? -6.752  22.090 37.434  1.00 80.25  ? 117  TYR A CG  1 
ATOM   450  C CD1 . TYR A 1 73  ? -5.498  22.642 37.676  1.00 81.05  ? 117  TYR A CD1 1 
ATOM   451  C CD2 . TYR A 1 73  ? -7.284  22.196 36.144  1.00 78.40  ? 117  TYR A CD2 1 
ATOM   452  C CE1 . TYR A 1 73  ? -4.787  23.265 36.669  1.00 80.65  ? 117  TYR A CE1 1 
ATOM   453  C CE2 . TYR A 1 73  ? -6.581  22.826 35.129  1.00 77.85  ? 117  TYR A CE2 1 
ATOM   454  C CZ  . TYR A 1 73  ? -5.333  23.359 35.402  1.00 79.29  ? 117  TYR A CZ  1 
ATOM   455  O OH  . TYR A 1 73  ? -4.623  23.979 34.403  1.00 79.95  ? 117  TYR A OH  1 
ATOM   456  N N   . GLY A 1 74  ? -9.823  22.096 41.289  1.00 68.95  ? 118  GLY A N   1 
ATOM   457  C CA  . GLY A 1 74  ? -11.033 21.642 41.949  1.00 71.92  ? 118  GLY A CA  1 
ATOM   458  C C   . GLY A 1 74  ? -10.817 20.528 42.953  1.00 75.02  ? 118  GLY A C   1 
ATOM   459  O O   . GLY A 1 74  ? -11.772 19.939 43.464  1.00 77.83  ? 118  GLY A O   1 
ATOM   460  N N   . LYS A 1 75  ? -9.559  20.232 43.243  1.00 93.14  ? 119  LYS A N   1 
ATOM   461  C CA  . LYS A 1 75  ? -9.252  19.207 44.219  1.00 95.91  ? 119  LYS A CA  1 
ATOM   462  C C   . LYS A 1 75  ? -9.547  19.716 45.629  1.00 98.95  ? 119  LYS A C   1 
ATOM   463  O O   . LYS A 1 75  ? -10.183 19.032 46.428  1.00 101.84 ? 119  LYS A O   1 
ATOM   464  C CB  . LYS A 1 75  ? -7.794  18.765 44.086  1.00 94.94  ? 119  LYS A CB  1 
ATOM   465  C CG  . LYS A 1 75  ? -7.463  18.169 42.726  1.00 92.34  ? 119  LYS A CG  1 
ATOM   466  C CD  . LYS A 1 75  ? -5.977  17.911 42.574  1.00 91.80  ? 119  LYS A CD  1 
ATOM   467  C CE  . LYS A 1 75  ? -5.680  17.228 41.257  1.00 89.95  ? 119  LYS A CE  1 
ATOM   468  N NZ  . LYS A 1 75  ? -4.233  17.284 40.907  1.00 89.64  ? 119  LYS A NZ  1 
ATOM   469  N N   . ASN A 1 76  ? -9.090  20.920 45.939  1.00 107.47 ? 120  ASN A N   1 
ATOM   470  C CA  . ASN A 1 76  ? -9.422  21.526 47.216  1.00 110.45 ? 120  ASN A CA  1 
ATOM   471  C C   . ASN A 1 76  ? -9.862  22.967 47.039  1.00 109.60 ? 120  ASN A C   1 
ATOM   472  O O   . ASN A 1 76  ? -9.128  23.801 46.520  1.00 107.20 ? 120  ASN A O   1 
ATOM   473  C CB  . ASN A 1 76  ? -8.239  21.443 48.180  1.00 111.68 ? 120  ASN A CB  1 
ATOM   474  C CG  . ASN A 1 76  ? -7.983  20.028 48.660  1.00 113.44 ? 120  ASN A CG  1 
ATOM   475  O OD1 . ASN A 1 76  ? -8.622  19.544 49.603  1.00 114.76 ? 120  ASN A OD1 1 
ATOM   476  N ND2 . ASN A 1 76  ? -7.058  19.346 47.998  1.00 113.47 ? 120  ASN A ND2 1 
ATOM   477  N N   . PHE A 1 77  ? -11.094 23.234 47.444  1.00 85.30  ? 121  PHE A N   1 
ATOM   478  C CA  . PHE A 1 77  ? -11.612 24.590 47.552  1.00 85.28  ? 121  PHE A CA  1 
ATOM   479  C C   . PHE A 1 77  ? -11.408 25.070 48.979  1.00 88.15  ? 121  PHE A C   1 
ATOM   480  O O   . PHE A 1 77  ? -11.448 24.276 49.915  1.00 90.87  ? 121  PHE A O   1 
ATOM   481  C CB  . PHE A 1 77  ? -13.103 24.665 47.202  1.00 86.68  ? 121  PHE A CB  1 
ATOM   482  C CG  . PHE A 1 77  ? -13.400 24.440 45.757  1.00 83.83  ? 121  PHE A CG  1 
ATOM   483  C CD1 . PHE A 1 77  ? -13.439 23.161 45.239  1.00 83.53  ? 121  PHE A CD1 1 
ATOM   484  C CD2 . PHE A 1 77  ? -13.664 25.505 44.926  1.00 81.40  ? 121  PHE A CD2 1 
ATOM   485  C CE1 . PHE A 1 77  ? -13.713 22.946 43.916  1.00 80.90  ? 121  PHE A CE1 1 
ATOM   486  C CE2 . PHE A 1 77  ? -13.947 25.298 43.595  1.00 78.59  ? 121  PHE A CE2 1 
ATOM   487  C CZ  . PHE A 1 77  ? -13.966 24.016 43.088  1.00 78.39  ? 121  PHE A CZ  1 
ATOM   488  N N   . LYS A 1 78  ? -11.155 26.355 49.159  1.00 114.08 ? 122  LYS A N   1 
ATOM   489  C CA  . LYS A 1 78  ? -11.261 26.907 50.491  1.00 117.11 ? 122  LYS A CA  1 
ATOM   490  C C   . LYS A 1 78  ? -12.043 28.227 50.407  1.00 117.36 ? 122  LYS A C   1 
ATOM   491  O O   . LYS A 1 78  ? -12.038 28.893 49.380  1.00 114.50 ? 122  LYS A O   1 
ATOM   492  C CB  . LYS A 1 78  ? -9.868  27.036 51.136  1.00 116.90 ? 122  LYS A CB  1 
ATOM   493  C CG  . LYS A 1 78  ? -9.188  25.662 51.429  1.00 115.28 ? 122  LYS A CG  1 
ATOM   494  C CD  . LYS A 1 78  ? -7.780  25.748 52.053  1.00 118.14 ? 122  LYS A CD  1 
ATOM   495  C CE  . LYS A 1 78  ? -7.159  24.380 52.346  1.00 121.54 ? 122  LYS A CE  1 
ATOM   496  N NZ  . LYS A 1 78  ? -5.771  24.487 52.935  1.00 124.50 ? 122  LYS A NZ  1 
ATOM   497  N N   . ASP A 1 79  ? -12.724 28.581 51.494  1.00 100.15 ? 123  ASP A N   1 
ATOM   498  C CA  . ASP A 1 79  ? -13.858 29.509 51.469  1.00 101.27 ? 123  ASP A CA  1 
ATOM   499  C C   . ASP A 1 79  ? -13.449 30.972 51.692  1.00 100.34 ? 123  ASP A C   1 
ATOM   500  O O   . ASP A 1 79  ? -13.136 31.393 52.813  1.00 102.56 ? 123  ASP A O   1 
ATOM   501  C CB  . ASP A 1 79  ? -14.880 29.027 52.528  1.00 105.61 ? 123  ASP A CB  1 
ATOM   502  C CG  . ASP A 1 79  ? -15.910 30.081 52.938  1.00 107.50 ? 123  ASP A CG  1 
ATOM   503  O OD1 . ASP A 1 79  ? -16.040 31.143 52.307  1.00 105.70 ? 123  ASP A OD1 1 
ATOM   504  O OD2 . ASP A 1 79  ? -16.632 29.813 53.921  1.00 110.84 ? 123  ASP A OD2 1 
ATOM   505  N N   . ILE A 1 80  ? -13.530 31.741 50.605  1.00 94.41  ? 124  ILE A N   1 
ATOM   506  C CA  . ILE A 1 80  ? -13.193 33.166 50.564  1.00 92.91  ? 124  ILE A CA  1 
ATOM   507  C C   . ILE A 1 80  ? -14.399 34.114 50.722  1.00 94.59  ? 124  ILE A C   1 
ATOM   508  O O   . ILE A 1 80  ? -14.296 35.302 50.401  1.00 92.87  ? 124  ILE A O   1 
ATOM   509  C CB  . ILE A 1 80  ? -12.418 33.539 49.269  1.00 88.14  ? 124  ILE A CB  1 
ATOM   510  C CG1 . ILE A 1 80  ? -13.227 33.236 48.008  1.00 86.16  ? 124  ILE A CG1 1 
ATOM   511  C CG2 . ILE A 1 80  ? -11.073 32.833 49.246  1.00 86.74  ? 124  ILE A CG2 1 
ATOM   512  C CD1 . ILE A 1 80  ? -12.554 33.736 46.755  1.00 81.54  ? 124  ILE A CD1 1 
ATOM   513  N N   . THR A 1 81  ? -15.546 33.584 51.152  1.00 93.78  ? 125  THR A N   1 
ATOM   514  C CA  . THR A 1 81  ? -16.729 34.408 51.441  1.00 96.00  ? 125  THR A CA  1 
ATOM   515  C C   . THR A 1 81  ? -16.367 35.608 52.313  1.00 96.87  ? 125  THR A C   1 
ATOM   516  O O   . THR A 1 81  ? -17.050 36.608 52.287  1.00 97.33  ? 125  THR A O   1 
ATOM   517  C CB  . THR A 1 81  ? -17.836 33.587 52.146  1.00 99.92  ? 125  THR A CB  1 
ATOM   518  O OG1 . THR A 1 81  ? -18.212 32.491 51.308  1.00 99.12  ? 125  THR A OG1 1 
ATOM   519  C CG2 . THR A 1 81  ? -19.073 34.436 52.450  1.00 102.17 ? 125  THR A CG2 1 
ATOM   520  N N   . ASP A 1 82  ? -15.288 35.500 53.078  1.00 138.18 ? 126  ASP A N   1 
ATOM   521  C CA  . ASP A 1 82  ? -14.712 36.625 53.816  1.00 138.91 ? 126  ASP A CA  1 
ATOM   522  C C   . ASP A 1 82  ? -14.439 37.882 52.993  1.00 135.65 ? 126  ASP A C   1 
ATOM   523  O O   . ASP A 1 82  ? -14.553 39.000 53.491  1.00 136.70 ? 126  ASP A O   1 
ATOM   524  C CB  . ASP A 1 82  ? -13.401 36.180 54.440  1.00 139.31 ? 126  ASP A CB  1 
ATOM   525  C CG  . ASP A 1 82  ? -13.588 35.051 55.408  1.00 143.25 ? 126  ASP A CG  1 
ATOM   526  O OD1 . ASP A 1 82  ? -14.228 35.278 56.462  1.00 149.41 ? 126  ASP A OD1 1 
ATOM   527  O OD2 . ASP A 1 82  ? -13.124 33.930 55.092  1.00 140.23 ? 126  ASP A OD2 1 
ATOM   528  N N   . LEU A 1 83  ? -14.064 37.682 51.736  1.00 111.42 ? 127  LEU A N   1 
ATOM   529  C CA  . LEU A 1 83  ? -13.481 38.729 50.908  1.00 108.05 ? 127  LEU A CA  1 
ATOM   530  C C   . LEU A 1 83  ? -14.509 39.662 50.247  1.00 107.23 ? 127  LEU A C   1 
ATOM   531  O O   . LEU A 1 83  ? -14.149 40.718 49.731  1.00 105.13 ? 127  LEU A O   1 
ATOM   532  C CB  . LEU A 1 83  ? -12.597 38.085 49.830  1.00 104.34 ? 127  LEU A CB  1 
ATOM   533  C CG  . LEU A 1 83  ? -11.152 37.631 50.112  1.00 103.69 ? 127  LEU A CG  1 
ATOM   534  C CD1 . LEU A 1 83  ? -10.984 36.838 51.409  1.00 107.52 ? 127  LEU A CD1 1 
ATOM   535  C CD2 . LEU A 1 83  ? -10.666 36.803 48.914  1.00 99.97  ? 127  LEU A CD2 1 
ATOM   536  N N   . ILE A 1 84  ? -15.765 39.226 50.234  1.00 120.30 ? 128  ILE A N   1 
ATOM   537  C CA  . ILE A 1 84  ? -16.864 40.014 49.687  1.00 120.29 ? 128  ILE A CA  1 
ATOM   538  C C   . ILE A 1 84  ? -17.557 40.824 50.778  1.00 123.49 ? 128  ILE A C   1 
ATOM   539  O O   . ILE A 1 84  ? -18.509 41.556 50.508  1.00 124.47 ? 128  ILE A O   1 
ATOM   540  C CB  . ILE A 1 84  ? -17.904 39.122 48.984  1.00 120.82 ? 128  ILE A CB  1 
ATOM   541  C CG1 . ILE A 1 84  ? -18.511 38.129 49.976  1.00 121.89 ? 128  ILE A CG1 1 
ATOM   542  C CG2 . ILE A 1 84  ? -17.272 38.391 47.810  1.00 117.77 ? 128  ILE A CG2 1 
ATOM   543  C CD1 . ILE A 1 84  ? -19.692 37.360 49.426  1.00 121.96 ? 128  ILE A CD1 1 
ATOM   544  N N   . ASN A 1 85  ? -17.078 40.673 52.010  1.00 140.86 ? 129  ASN A N   1 
ATOM   545  C CA  . ASN A 1 85  ? -17.660 41.345 53.169  1.00 144.87 ? 129  ASN A CA  1 
ATOM   546  C C   . ASN A 1 85  ? -18.892 40.624 53.715  1.00 146.68 ? 129  ASN A C   1 
ATOM   547  O O   . ASN A 1 85  ? -19.572 41.130 54.607  1.00 145.36 ? 129  ASN A O   1 
ATOM   548  C CB  . ASN A 1 85  ? -17.993 42.805 52.850  1.00 145.32 ? 129  ASN A CB  1 
ATOM   549  C CG  . ASN A 1 85  ? -17.139 43.782 53.634  1.00 144.54 ? 129  ASN A CG  1 
ATOM   550  O OD1 . ASN A 1 85  ? -16.242 43.383 54.377  1.00 145.30 ? 129  ASN A OD1 1 
ATOM   551  N ND2 . ASN A 1 85  ? -17.413 45.071 53.471  1.00 143.17 ? 129  ASN A ND2 1 
ATOM   552  N N   . ASN A 1 86  ? -19.170 39.440 53.176  1.00 139.08 ? 130  ASN A N   1 
ATOM   553  C CA  . ASN A 1 86  ? -20.288 38.623 53.641  1.00 140.45 ? 130  ASN A CA  1 
ATOM   554  C C   . ASN A 1 86  ? -21.635 39.073 53.083  1.00 140.35 ? 130  ASN A C   1 
ATOM   555  O O   . ASN A 1 86  ? -22.686 38.592 53.508  1.00 142.14 ? 130  ASN A O   1 
ATOM   556  C CB  . ASN A 1 86  ? -20.335 38.598 55.171  1.00 143.86 ? 130  ASN A CB  1 
ATOM   557  C CG  . ASN A 1 86  ? -19.220 37.765 55.774  1.00 145.03 ? 130  ASN A CG  1 
ATOM   558  O OD1 . ASN A 1 86  ? -18.076 37.820 55.325  1.00 141.97 ? 130  ASN A OD1 1 
ATOM   559  N ND2 . ASN A 1 86  ? -19.551 36.987 56.799  1.00 149.27 ? 130  ASN A ND2 1 
ATOM   560  N N   . THR A 1 87  ? -21.597 39.999 52.131  1.00 138.53 ? 131  THR A N   1 
ATOM   561  C CA  . THR A 1 87  ? -22.812 40.527 51.520  1.00 138.77 ? 131  THR A CA  1 
ATOM   562  C C   . THR A 1 87  ? -23.433 39.596 50.487  1.00 138.52 ? 131  THR A C   1 
ATOM   563  O O   . THR A 1 87  ? -22.901 38.530 50.183  1.00 137.97 ? 131  THR A O   1 
ATOM   564  C CB  . THR A 1 87  ? -22.528 41.844 50.785  1.00 135.98 ? 131  THR A CB  1 
ATOM   565  O OG1 . THR A 1 87  ? -23.743 42.363 50.232  1.00 136.34 ? 131  THR A OG1 1 
ATOM   566  C CG2 . THR A 1 87  ? -21.589 41.570 49.638  1.00 132.53 ? 131  THR A CG2 1 
ATOM   567  N N   . PHE A 1 88  ? -24.560 40.026 49.935  1.00 112.33 ? 132  PHE A N   1 
ATOM   568  C CA  . PHE A 1 88  ? -25.392 39.143 49.145  1.00 112.92 ? 132  PHE A CA  1 
ATOM   569  C C   . PHE A 1 88  ? -25.175 39.364 47.661  1.00 110.40 ? 132  PHE A C   1 
ATOM   570  O O   . PHE A 1 88  ? -25.521 40.416 47.127  1.00 109.36 ? 132  PHE A O   1 
ATOM   571  C CB  . PHE A 1 88  ? -26.862 39.350 49.505  1.00 115.13 ? 132  PHE A CB  1 
ATOM   572  C CG  . PHE A 1 88  ? -27.799 38.437 48.769  1.00 115.57 ? 132  PHE A CG  1 
ATOM   573  C CD1 . PHE A 1 88  ? -27.832 37.086 49.052  1.00 116.31 ? 132  PHE A CD1 1 
ATOM   574  C CD2 . PHE A 1 88  ? -28.656 38.930 47.801  1.00 115.09 ? 132  PHE A CD2 1 
ATOM   575  C CE1 . PHE A 1 88  ? -28.696 36.238 48.381  1.00 116.18 ? 132  PHE A CE1 1 
ATOM   576  C CE2 . PHE A 1 88  ? -29.521 38.088 47.129  1.00 115.20 ? 132  PHE A CE2 1 
ATOM   577  C CZ  . PHE A 1 88  ? -29.542 36.741 47.421  1.00 115.54 ? 132  PHE A CZ  1 
ATOM   578  N N   . ILE A 1 89  ? -24.598 38.362 47.004  1.00 111.35 ? 133  ILE A N   1 
ATOM   579  C CA  . ILE A 1 89  ? -24.293 38.442 45.575  1.00 108.94 ? 133  ILE A CA  1 
ATOM   580  C C   . ILE A 1 89  ? -25.481 37.947 44.749  1.00 110.27 ? 133  ILE A C   1 
ATOM   581  O O   . ILE A 1 89  ? -26.184 37.007 45.136  1.00 111.60 ? 133  ILE A O   1 
ATOM   582  C CB  . ILE A 1 89  ? -23.010 37.641 45.222  1.00 106.43 ? 133  ILE A CB  1 
ATOM   583  C CG1 . ILE A 1 89  ? -21.815 38.212 45.981  1.00 104.14 ? 133  ILE A CG1 1 
ATOM   584  C CG2 . ILE A 1 89  ? -22.724 37.679 43.737  1.00 103.04 ? 133  ILE A CG2 1 
ATOM   585  C CD1 . ILE A 1 89  ? -21.583 39.684 45.721  1.00 101.68 ? 133  ILE A CD1 1 
ATOM   586  N N   . ARG A 1 90  ? -25.700 38.603 43.616  1.00 120.32 ? 134  ARG A N   1 
ATOM   587  C CA  . ARG A 1 90  ? -26.870 38.349 42.804  1.00 120.54 ? 134  ARG A CA  1 
ATOM   588  C C   . ARG A 1 90  ? -26.563 37.542 41.564  1.00 117.30 ? 134  ARG A C   1 
ATOM   589  O O   . ARG A 1 90  ? -25.804 37.976 40.705  1.00 113.57 ? 134  ARG A O   1 
ATOM   590  C CB  . ARG A 1 90  ? -27.510 39.660 42.410  1.00 120.82 ? 134  ARG A CB  1 
ATOM   591  C CG  . ARG A 1 90  ? -28.965 39.670 42.752  1.00 123.02 ? 134  ARG A CG  1 
ATOM   592  C CD  . ARG A 1 90  ? -29.537 41.038 42.588  1.00 124.06 ? 134  ARG A CD  1 
ATOM   593  N NE  . ARG A 1 90  ? -29.656 41.407 41.186  1.00 121.49 ? 134  ARG A NE  1 
ATOM   594  C CZ  . ARG A 1 90  ? -30.068 42.600 40.779  1.00 121.00 ? 134  ARG A CZ  1 
ATOM   595  N NH1 . ARG A 1 90  ? -30.398 43.514 41.675  1.00 123.34 ? 134  ARG A NH1 1 
ATOM   596  N NH2 . ARG A 1 90  ? -30.182 42.874 39.488  1.00 118.06 ? 134  ARG A NH2 1 
ATOM   597  N N   . THR A 1 91  ? -27.198 36.382 41.465  1.00 118.05 ? 135  THR A N   1 
ATOM   598  C CA  . THR A 1 91  ? -26.849 35.397 40.461  1.00 113.51 ? 135  THR A CA  1 
ATOM   599  C C   . THR A 1 91  ? -27.325 35.791 39.061  1.00 110.11 ? 135  THR A C   1 
ATOM   600  O O   . THR A 1 91  ? -26.897 35.199 38.072  1.00 105.32 ? 135  THR A O   1 
ATOM   601  C CB  . THR A 1 91  ? -27.417 34.018 40.845  1.00 113.64 ? 135  THR A CB  1 
ATOM   602  O OG1 . THR A 1 91  ? -26.825 33.007 40.019  1.00 110.69 ? 135  THR A OG1 1 
ATOM   603  C CG2 . THR A 1 91  ? -28.942 33.993 40.718  1.00 114.72 ? 135  THR A CG2 1 
ATOM   604  N N   . GLU A 1 92  ? -28.199 36.793 38.983  1.00 109.95 ? 136  GLU A N   1 
ATOM   605  C CA  . GLU A 1 92  ? -28.638 37.331 37.697  1.00 107.65 ? 136  GLU A CA  1 
ATOM   606  C C   . GLU A 1 92  ? -27.447 37.711 36.835  1.00 102.51 ? 136  GLU A C   1 
ATOM   607  O O   . GLU A 1 92  ? -27.341 37.289 35.694  1.00 98.66  ? 136  GLU A O   1 
ATOM   608  C CB  . GLU A 1 92  ? -29.529 38.555 37.896  1.00 111.54 ? 136  GLU A CB  1 
ATOM   609  C CG  . GLU A 1 92  ? -30.381 38.501 39.144  1.00 116.54 ? 136  GLU A CG  1 
ATOM   610  C CD  . GLU A 1 92  ? -31.273 39.719 39.281  1.00 119.97 ? 136  GLU A CD  1 
ATOM   611  O OE1 . GLU A 1 92  ? -31.706 40.256 38.238  1.00 120.05 ? 136  GLU A OE1 1 
ATOM   612  O OE2 . GLU A 1 92  ? -31.586 40.109 40.428  1.00 122.60 ? 136  GLU A OE2 1 
ATOM   613  N N   . PHE A 1 93  ? -26.552 38.514 37.399  1.00 90.23  ? 137  PHE A N   1 
ATOM   614  C CA  . PHE A 1 93  ? -25.379 38.983 36.684  1.00 84.94  ? 137  PHE A CA  1 
ATOM   615  C C   . PHE A 1 93  ? -24.237 37.998 36.798  1.00 81.75  ? 137  PHE A C   1 
ATOM   616  O O   . PHE A 1 93  ? -23.225 38.134 36.111  1.00 77.42  ? 137  PHE A O   1 
ATOM   617  C CB  . PHE A 1 93  ? -24.921 40.338 37.208  1.00 85.67  ? 137  PHE A CB  1 
ATOM   618  C CG  . PHE A 1 93  ? -26.002 41.363 37.260  1.00 89.24  ? 137  PHE A CG  1 
ATOM   619  C CD1 . PHE A 1 93  ? -26.508 41.917 36.096  1.00 87.24  ? 137  PHE A CD1 1 
ATOM   620  C CD2 . PHE A 1 93  ? -26.499 41.789 38.470  1.00 95.19  ? 137  PHE A CD2 1 
ATOM   621  C CE1 . PHE A 1 93  ? -27.494 42.865 36.141  1.00 90.55  ? 137  PHE A CE1 1 
ATOM   622  C CE2 . PHE A 1 93  ? -27.474 42.744 38.523  1.00 98.44  ? 137  PHE A CE2 1 
ATOM   623  C CZ  . PHE A 1 93  ? -27.984 43.281 37.357  1.00 95.89  ? 137  PHE A CZ  1 
ATOM   624  N N   . GLY A 1 94  ? -24.386 37.022 37.684  1.00 95.17  ? 138  GLY A N   1 
ATOM   625  C CA  . GLY A 1 94  ? -23.355 36.024 37.883  1.00 92.90  ? 138  GLY A CA  1 
ATOM   626  C C   . GLY A 1 94  ? -21.966 36.600 38.106  1.00 90.53  ? 138  GLY A C   1 
ATOM   627  O O   . GLY A 1 94  ? -21.782 37.634 38.761  1.00 92.10  ? 138  GLY A O   1 
ATOM   628  N N   . MET A 1 95  ? -20.980 35.916 37.542  1.00 88.48  ? 139  MET A N   1 
ATOM   629  C CA  . MET A 1 95  ? -19.585 36.278 37.718  1.00 86.49  ? 139  MET A CA  1 
ATOM   630  C C   . MET A 1 95  ? -19.012 36.704 36.390  1.00 82.75  ? 139  MET A C   1 
ATOM   631  O O   . MET A 1 95  ? -18.795 35.879 35.514  1.00 80.96  ? 139  MET A O   1 
ATOM   632  C CB  . MET A 1 95  ? -18.783 35.106 38.291  1.00 86.82  ? 139  MET A CB  1 
ATOM   633  C CG  . MET A 1 95  ? -19.396 34.511 39.539  1.00 91.69  ? 139  MET A CG  1 
ATOM   634  S SD  . MET A 1 95  ? -18.345 33.327 40.397  1.00 92.82  ? 139  MET A SD  1 
ATOM   635  C CE  . MET A 1 95  ? -18.935 31.794 39.674  1.00 92.57  ? 139  MET A CE  1 
ATOM   636  N N   . ALA A 1 96  ? -18.712 37.985 36.248  1.00 77.41  ? 140  ALA A N   1 
ATOM   637  C CA  . ALA A 1 96  ? -18.226 38.444 34.971  1.00 75.24  ? 140  ALA A CA  1 
ATOM   638  C C   . ALA A 1 96  ? -16.715 38.268 34.973  1.00 74.35  ? 140  ALA A C   1 
ATOM   639  O O   . ALA A 1 96  ? -15.988 39.014 35.628  1.00 74.87  ? 140  ALA A O   1 
ATOM   640  C CB  . ALA A 1 96  ? -18.613 39.893 34.739  1.00 75.65  ? 140  ALA A CB  1 
ATOM   641  N N   . ILE A 1 97  ? -16.258 37.283 34.204  1.00 68.16  ? 141  ILE A N   1 
ATOM   642  C CA  . ILE A 1 97  ? -14.856 36.892 34.182  1.00 68.11  ? 141  ILE A CA  1 
ATOM   643  C C   . ILE A 1 97  ? -14.122 37.517 33.002  1.00 68.56  ? 141  ILE A C   1 
ATOM   644  O O   . ILE A 1 97  ? -14.538 37.368 31.842  1.00 68.72  ? 141  ILE A O   1 
ATOM   645  C CB  . ILE A 1 97  ? -14.690 35.363 34.112  1.00 67.79  ? 141  ILE A CB  1 
ATOM   646  C CG1 . ILE A 1 97  ? -15.605 34.679 35.123  1.00 68.31  ? 141  ILE A CG1 1 
ATOM   647  C CG2 . ILE A 1 97  ? -13.226 34.980 34.340  1.00 68.37  ? 141  ILE A CG2 1 
ATOM   648  C CD1 . ILE A 1 97  ? -15.386 35.133 36.547  1.00 69.98  ? 141  ILE A CD1 1 
ATOM   649  N N   . GLY A 1 98  ? -13.026 38.209 33.303  1.00 65.79  ? 142  GLY A N   1 
ATOM   650  C CA  . GLY A 1 98  ? -12.243 38.882 32.277  1.00 67.48  ? 142  GLY A CA  1 
ATOM   651  C C   . GLY A 1 98  ? -11.692 37.939 31.224  1.00 69.01  ? 142  GLY A C   1 
ATOM   652  O O   . GLY A 1 98  ? -11.537 36.742 31.466  1.00 68.43  ? 142  GLY A O   1 
ATOM   653  N N   . PRO A 1 99  ? -11.382 38.482 30.043  1.00 76.46  ? 143  PRO A N   1 
ATOM   654  C CA  . PRO A 1 99  ? -10.858 37.710 28.905  1.00 79.55  ? 143  PRO A CA  1 
ATOM   655  C C   . PRO A 1 99  ? -9.480  37.097 29.169  1.00 81.44  ? 143  PRO A C   1 
ATOM   656  O O   . PRO A 1 99  ? -8.677  37.689 29.888  1.00 81.60  ? 143  PRO A O   1 
ATOM   657  C CB  . PRO A 1 99  ? -10.770 38.755 27.784  1.00 83.19  ? 143  PRO A CB  1 
ATOM   658  C CG  . PRO A 1 99  ? -10.584 40.063 28.503  1.00 82.06  ? 143  PRO A CG  1 
ATOM   659  C CD  . PRO A 1 99  ? -11.388 39.934 29.785  1.00 77.60  ? 143  PRO A CD  1 
ATOM   660  N N   . GLU A 1 100 ? -9.223  35.931 28.590  1.00 104.61 ? 144  GLU A N   1 
ATOM   661  C CA  . GLU A 1 100 ? -7.914  35.290 28.661  1.00 107.25 ? 144  GLU A CA  1 
ATOM   662  C C   . GLU A 1 100 ? -7.369  35.211 30.085  1.00 104.65 ? 144  GLU A C   1 
ATOM   663  O O   . GLU A 1 100 ? -8.086  34.842 31.012  1.00 100.86 ? 144  GLU A O   1 
ATOM   664  C CB  . GLU A 1 100 ? -6.923  36.026 27.761  1.00 112.98 ? 144  GLU A CB  1 
ATOM   665  C CG  . GLU A 1 100 ? -7.305  36.024 26.294  1.00 117.72 ? 144  GLU A CG  1 
ATOM   666  C CD  . GLU A 1 100 ? -6.248  36.655 25.404  1.00 124.58 ? 144  GLU A CD  1 
ATOM   667  O OE1 . GLU A 1 100 ? -5.671  37.696 25.798  1.00 124.03 ? 144  GLU A OE1 1 
ATOM   668  O OE2 . GLU A 1 100 ? -5.988  36.103 24.310  1.00 130.56 ? 144  GLU A OE2 1 
ATOM   669  N N   . ASN A 1 101 ? -6.099  35.566 30.248  1.00 91.85  ? 145  ASN A N   1 
ATOM   670  C CA  . ASN A 1 101 ? -5.421  35.461 31.534  1.00 90.34  ? 145  ASN A CA  1 
ATOM   671  C C   . ASN A 1 101 ? -5.401  36.732 32.377  1.00 89.23  ? 145  ASN A C   1 
ATOM   672  O O   . ASN A 1 101 ? -4.700  36.783 33.379  1.00 89.09  ? 145  ASN A O   1 
ATOM   673  C CB  . ASN A 1 101 ? -3.995  34.964 31.329  1.00 93.90  ? 145  ASN A CB  1 
ATOM   674  C CG  . ASN A 1 101 ? -3.890  33.449 31.423  1.00 93.47  ? 145  ASN A CG  1 
ATOM   675  O OD1 . ASN A 1 101 ? -4.895  32.743 31.376  1.00 90.99  ? 145  ASN A OD1 1 
ATOM   676  N ND2 . ASN A 1 101 ? -2.669  32.946 31.562  1.00 95.88  ? 145  ASN A ND2 1 
ATOM   677  N N   . SER A 1 102 ? -6.139  37.758 31.964  1.00 91.06  ? 146  SER A N   1 
ATOM   678  C CA  . SER A 1 102 ? -6.235  39.016 32.718  1.00 90.00  ? 146  SER A CA  1 
ATOM   679  C C   . SER A 1 102 ? -6.625  38.834 34.185  1.00 87.31  ? 146  SER A C   1 
ATOM   680  O O   . SER A 1 102 ? -6.360  39.699 35.012  1.00 87.42  ? 146  SER A O   1 
ATOM   681  C CB  . SER A 1 102 ? -7.250  39.953 32.055  1.00 89.46  ? 146  SER A CB  1 
ATOM   682  O OG  . SER A 1 102 ? -8.558  39.401 32.091  1.00 86.70  ? 146  SER A OG  1 
ATOM   683  N N   . GLY A 1 103 ? -7.275  37.717 34.491  1.00 81.82  ? 147  GLY A N   1 
ATOM   684  C CA  . GLY A 1 103 ? -7.678  37.387 35.847  1.00 80.33  ? 147  GLY A CA  1 
ATOM   685  C C   . GLY A 1 103 ? -8.734  38.289 36.461  1.00 79.19  ? 147  GLY A C   1 
ATOM   686  O O   . GLY A 1 103 ? -8.852  38.360 37.679  1.00 79.42  ? 147  GLY A O   1 
ATOM   687  N N   . LYS A 1 104 ? -9.506  38.988 35.641  1.00 83.24  ? 148  LYS A N   1 
ATOM   688  C CA  . LYS A 1 104 ? -10.493 39.901 36.196  1.00 82.61  ? 148  LYS A CA  1 
ATOM   689  C C   . LYS A 1 104 ? -11.764 39.142 36.608  1.00 81.55  ? 148  LYS A C   1 
ATOM   690  O O   . LYS A 1 104 ? -12.275 38.286 35.881  1.00 80.65  ? 148  LYS A O   1 
ATOM   691  C CB  . LYS A 1 104 ? -10.829 41.010 35.201  1.00 82.76  ? 148  LYS A CB  1 
ATOM   692  C CG  . LYS A 1 104 ? -9.629  41.715 34.595  1.00 84.63  ? 148  LYS A CG  1 
ATOM   693  C CD  . LYS A 1 104 ? -9.250  42.961 35.365  1.00 85.47  ? 148  LYS A CD  1 
ATOM   694  C CE  . LYS A 1 104 ? -8.307  43.869 34.561  1.00 87.58  ? 148  LYS A CE  1 
ATOM   695  N NZ  . LYS A 1 104 ? -6.936  43.296 34.392  1.00 89.97  ? 148  LYS A NZ  1 
ATOM   696  N N   . VAL A 1 105 ? -12.259 39.449 37.798  1.00 79.76  ? 149  VAL A N   1 
ATOM   697  C CA  . VAL A 1 105 ? -13.504 38.880 38.273  1.00 80.05  ? 149  VAL A CA  1 
ATOM   698  C C   . VAL A 1 105 ? -14.374 40.003 38.814  1.00 81.22  ? 149  VAL A C   1 
ATOM   699  O O   . VAL A 1 105 ? -13.900 40.839 39.587  1.00 82.41  ? 149  VAL A O   1 
ATOM   700  C CB  . VAL A 1 105 ? -13.270 37.824 39.361  1.00 81.44  ? 149  VAL A CB  1 
ATOM   701  C CG1 . VAL A 1 105 ? -14.600 37.268 39.843  1.00 82.93  ? 149  VAL A CG1 1 
ATOM   702  C CG2 . VAL A 1 105 ? -12.373 36.709 38.839  1.00 80.54  ? 149  VAL A CG2 1 
ATOM   703  N N   . VAL A 1 106 ? -15.633 40.046 38.385  1.00 71.92  ? 150  VAL A N   1 
ATOM   704  C CA  . VAL A 1 106 ? -16.571 41.040 38.911  1.00 73.61  ? 150  VAL A CA  1 
ATOM   705  C C   . VAL A 1 106 ? -17.894 40.410 39.335  1.00 75.89  ? 150  VAL A C   1 
ATOM   706  O O   . VAL A 1 106 ? -18.517 39.671 38.570  1.00 75.20  ? 150  VAL A O   1 
ATOM   707  C CB  . VAL A 1 106 ? -16.864 42.161 37.881  1.00 72.35  ? 150  VAL A CB  1 
ATOM   708  C CG1 . VAL A 1 106 ? -18.000 43.066 38.383  1.00 74.28  ? 150  VAL A CG1 1 
ATOM   709  C CG2 . VAL A 1 106 ? -15.601 42.973 37.583  1.00 71.54  ? 150  VAL A CG2 1 
ATOM   710  N N   . LEU A 1 107 ? -18.310 40.709 40.565  1.00 78.28  ? 151  LEU A N   1 
ATOM   711  C CA  . LEU A 1 107 ? -19.583 40.218 41.111  1.00 82.09  ? 151  LEU A CA  1 
ATOM   712  C C   . LEU A 1 107 ? -20.492 41.387 41.446  1.00 84.32  ? 151  LEU A C   1 
ATOM   713  O O   . LEU A 1 107 ? -20.061 42.323 42.122  1.00 84.55  ? 151  LEU A O   1 
ATOM   714  C CB  . LEU A 1 107 ? -19.361 39.376 42.373  1.00 85.31  ? 151  LEU A CB  1 
ATOM   715  C CG  . LEU A 1 107 ? -18.257 38.322 42.363  1.00 83.72  ? 151  LEU A CG  1 
ATOM   716  C CD1 . LEU A 1 107 ? -18.311 37.518 43.626  1.00 88.02  ? 151  LEU A CD1 1 
ATOM   717  C CD2 . LEU A 1 107 ? -18.388 37.416 41.173  1.00 81.09  ? 151  LEU A CD2 1 
ATOM   718  N N   . THR A 1 108 ? -21.740 41.354 40.992  1.00 89.94  ? 152  THR A N   1 
ATOM   719  C CA  . THR A 1 108 ? -22.645 42.430 41.370  1.00 92.57  ? 152  THR A CA  1 
ATOM   720  C C   . THR A 1 108 ? -23.453 42.033 42.606  1.00 97.90  ? 152  THR A C   1 
ATOM   721  O O   . THR A 1 108 ? -23.981 40.926 42.700  1.00 100.81 ? 152  THR A O   1 
ATOM   722  C CB  . THR A 1 108 ? -23.598 42.828 40.229  1.00 92.35  ? 152  THR A CB  1 
ATOM   723  O OG1 . THR A 1 108 ? -22.929 42.693 38.971  1.00 87.61  ? 152  THR A OG1 1 
ATOM   724  C CG2 . THR A 1 108 ? -24.033 44.276 40.404  1.00 92.98  ? 152  THR A CG2 1 
ATOM   725  N N   . ALA A 1 109 ? -23.558 42.952 43.553  1.00 99.05  ? 153  ALA A N   1 
ATOM   726  C CA  . ALA A 1 109 ? -24.194 42.654 44.821  1.00 103.15 ? 153  ALA A CA  1 
ATOM   727  C C   . ALA A 1 109 ? -25.485 43.430 44.948  1.00 105.34 ? 153  ALA A C   1 
ATOM   728  O O   . ALA A 1 109 ? -25.661 44.464 44.303  1.00 103.55 ? 153  ALA A O   1 
ATOM   729  C CB  . ALA A 1 109 ? -23.264 42.984 45.974  1.00 102.81 ? 153  ALA A CB  1 
ATOM   730  N N   . GLU A 1 110 ? -26.391 42.914 45.770  1.00 115.52 ? 154  GLU A N   1 
ATOM   731  C CA  . GLU A 1 110 ? -27.670 43.559 46.000  1.00 117.34 ? 154  GLU A CA  1 
ATOM   732  C C   . GLU A 1 110 ? -27.553 44.685 47.013  1.00 117.37 ? 154  GLU A C   1 
ATOM   733  O O   . GLU A 1 110 ? -26.861 44.558 48.021  1.00 117.98 ? 154  GLU A O   1 
ATOM   734  C CB  . GLU A 1 110 ? -28.697 42.539 46.471  1.00 120.27 ? 154  GLU A CB  1 
ATOM   735  C CG  . GLU A 1 110 ? -30.089 43.109 46.643  1.00 122.08 ? 154  GLU A CG  1 
ATOM   736  C CD  . GLU A 1 110 ? -31.144 42.024 46.724  1.00 123.72 ? 154  GLU A CD  1 
ATOM   737  O OE1 . GLU A 1 110 ? -30.868 40.906 46.237  1.00 123.18 ? 154  GLU A OE1 1 
ATOM   738  O OE2 . GLU A 1 110 ? -32.242 42.287 47.270  1.00 125.27 ? 154  GLU A OE2 1 
ATOM   739  N N   . VAL A 1 111 ? -28.246 45.783 46.737  1.00 100.74 ? 155  VAL A N   1 
ATOM   740  C CA  . VAL A 1 111 ? -28.199 46.965 47.584  1.00 100.76 ? 155  VAL A CA  1 
ATOM   741  C C   . VAL A 1 111 ? -29.577 47.262 48.155  1.00 103.26 ? 155  VAL A C   1 
ATOM   742  O O   . VAL A 1 111 ? -30.589 46.813 47.611  1.00 104.23 ? 155  VAL A O   1 
ATOM   743  C CB  . VAL A 1 111 ? -27.707 48.195 46.808  1.00 97.74  ? 155  VAL A CB  1 
ATOM   744  C CG1 . VAL A 1 111 ? -26.306 47.959 46.266  1.00 95.02  ? 155  VAL A CG1 1 
ATOM   745  C CG2 . VAL A 1 111 ? -28.664 48.514 45.676  1.00 97.10  ? 155  VAL A CG2 1 
ATOM   746  N N   . SER A 1 112 ? -29.607 48.023 49.247  1.00 113.31 ? 156  SER A N   1 
ATOM   747  C CA  . SER A 1 112 ? -30.858 48.391 49.901  1.00 115.51 ? 156  SER A CA  1 
ATOM   748  C C   . SER A 1 112 ? -31.766 49.043 48.874  1.00 114.45 ? 156  SER A C   1 
ATOM   749  O O   . SER A 1 112 ? -31.284 49.667 47.938  1.00 111.89 ? 156  SER A O   1 
ATOM   750  C CB  . SER A 1 112 ? -30.604 49.342 51.073  1.00 116.33 ? 156  SER A CB  1 
ATOM   751  O OG  . SER A 1 112 ? -29.379 49.034 51.711  1.00 115.40 ? 156  SER A OG  1 
ATOM   752  N N   . GLY A 1 113 ? -33.073 48.877 49.043  1.00 146.68 ? 157  GLY A N   1 
ATOM   753  C CA  . GLY A 1 113 ? -34.046 49.321 48.061  1.00 146.43 ? 157  GLY A CA  1 
ATOM   754  C C   . GLY A 1 113 ? -33.880 50.731 47.520  1.00 144.40 ? 157  GLY A C   1 
ATOM   755  O O   . GLY A 1 113 ? -34.089 50.964 46.328  1.00 143.17 ? 157  GLY A O   1 
ATOM   756  N N   . GLY A 1 114 ? -33.486 51.669 48.376  1.00 117.73 ? 158  GLY A N   1 
ATOM   757  C CA  . GLY A 1 114 ? -33.409 53.066 47.977  1.00 116.01 ? 158  GLY A CA  1 
ATOM   758  C C   . GLY A 1 114 ? -32.048 53.659 47.633  1.00 113.43 ? 158  GLY A C   1 
ATOM   759  O O   . GLY A 1 114 ? -31.884 54.874 47.700  1.00 112.51 ? 158  GLY A O   1 
ATOM   760  N N   . SER A 1 115 ? -31.082 52.826 47.249  1.00 113.27 ? 159  SER A N   1 
ATOM   761  C CA  . SER A 1 115 ? -29.676 53.248 47.120  1.00 111.01 ? 159  SER A CA  1 
ATOM   762  C C   . SER A 1 115 ? -29.354 54.259 46.016  1.00 108.44 ? 159  SER A C   1 
ATOM   763  O O   . SER A 1 115 ? -30.109 54.429 45.060  1.00 107.98 ? 159  SER A O   1 
ATOM   764  C CB  . SER A 1 115 ? -28.782 52.023 46.908  1.00 110.27 ? 159  SER A CB  1 
ATOM   765  O OG  . SER A 1 115 ? -28.527 51.358 48.129  1.00 112.58 ? 159  SER A OG  1 
ATOM   766  N N   . ARG A 1 116 ? -28.210 54.921 46.189  1.00 160.02 ? 160  ARG A N   1 
ATOM   767  C CA  . ARG A 1 116 ? -27.579 55.774 45.180  1.00 157.47 ? 160  ARG A CA  1 
ATOM   768  C C   . ARG A 1 116 ? -27.468 55.093 43.825  1.00 155.29 ? 160  ARG A C   1 
ATOM   769  O O   . ARG A 1 116 ? -27.752 55.676 42.778  1.00 153.84 ? 160  ARG A O   1 
ATOM   770  C CB  . ARG A 1 116 ? -26.170 56.154 45.638  1.00 156.30 ? 160  ARG A CB  1 
ATOM   771  C CG  . ARG A 1 116 ? -25.941 57.610 45.967  1.00 158.66 ? 160  ARG A CG  1 
ATOM   772  C CD  . ARG A 1 116 ? -24.442 57.900 45.995  1.00 157.82 ? 160  ARG A CD  1 
ATOM   773  N NE  . ARG A 1 116 ? -23.820 57.689 44.686  1.00 152.78 ? 160  ARG A NE  1 
ATOM   774  C CZ  . ARG A 1 116 ? -22.516 57.506 44.497  1.00 150.99 ? 160  ARG A CZ  1 
ATOM   775  N NH1 . ARG A 1 116 ? -21.689 57.494 45.533  1.00 153.99 ? 160  ARG A NH1 1 
ATOM   776  N NH2 . ARG A 1 116 ? -22.039 57.324 43.274  1.00 148.06 ? 160  ARG A NH2 1 
ATOM   777  N N   . GLY A 1 117 ? -27.027 53.844 43.885  1.00 90.71  ? 161  GLY A N   1 
ATOM   778  C CA  . GLY A 1 117 ? -26.645 53.057 42.738  1.00 86.67  ? 161  GLY A CA  1 
ATOM   779  C C   . GLY A 1 117 ? -26.192 51.703 43.251  1.00 84.93  ? 161  GLY A C   1 
ATOM   780  O O   . GLY A 1 117 ? -26.214 51.451 44.457  1.00 86.99  ? 161  GLY A O   1 
ATOM   781  N N   . GLY A 1 118 ? -25.779 50.827 42.342  1.00 85.76  ? 162  GLY A N   1 
ATOM   782  C CA  . GLY A 1 118 ? -25.444 49.461 42.703  1.00 85.42  ? 162  GLY A CA  1 
ATOM   783  C C   . GLY A 1 118 ? -24.079 49.325 43.338  1.00 85.35  ? 162  GLY A C   1 
ATOM   784  O O   . GLY A 1 118 ? -23.412 50.315 43.624  1.00 86.10  ? 162  GLY A O   1 
ATOM   785  N N   . ARG A 1 119 ? -23.664 48.092 43.576  1.00 104.34 ? 163  ARG A N   1 
ATOM   786  C CA  . ARG A 1 119 ? -22.334 47.853 44.094  1.00 103.38 ? 163  ARG A CA  1 
ATOM   787  C C   . ARG A 1 119 ? -21.757 46.600 43.458  1.00 101.60 ? 163  ARG A C   1 
ATOM   788  O O   . ARG A 1 119 ? -22.482 45.635 43.215  1.00 102.96 ? 163  ARG A O   1 
ATOM   789  C CB  . ARG A 1 119 ? -22.363 47.739 45.619  1.00 106.71 ? 163  ARG A CB  1 
ATOM   790  C CG  . ARG A 1 119 ? -21.125 47.115 46.200  1.00 104.43 ? 163  ARG A CG  1 
ATOM   791  C CD  . ARG A 1 119 ? -20.904 47.517 47.629  1.00 108.92 ? 163  ARG A CD  1 
ATOM   792  N NE  . ARG A 1 119 ? -22.116 47.847 48.371  1.00 110.64 ? 163  ARG A NE  1 
ATOM   793  C CZ  . ARG A 1 119 ? -22.133 48.553 49.500  1.00 114.92 ? 163  ARG A CZ  1 
ATOM   794  N NH1 . ARG A 1 119 ? -21.004 49.012 50.030  1.00 117.89 ? 163  ARG A NH1 1 
ATOM   795  N NH2 . ARG A 1 119 ? -23.284 48.799 50.104  1.00 116.34 ? 163  ARG A NH2 1 
ATOM   796  N N   . ILE A 1 120 ? -20.460 46.634 43.158  1.00 98.36  ? 164  ILE A N   1 
ATOM   797  C CA  . ILE A 1 120 ? -19.758 45.475 42.616  1.00 96.39  ? 164  ILE A CA  1 
ATOM   798  C C   . ILE A 1 120 ? -18.499 45.128 43.412  1.00 96.40  ? 164  ILE A C   1 
ATOM   799  O O   . ILE A 1 120 ? -17.915 45.982 44.080  1.00 96.95  ? 164  ILE A O   1 
ATOM   800  C CB  . ILE A 1 120 ? -19.361 45.699 41.155  1.00 92.70  ? 164  ILE A CB  1 
ATOM   801  C CG1 . ILE A 1 120 ? -18.470 46.939 41.034  1.00 91.51  ? 164  ILE A CG1 1 
ATOM   802  C CG2 . ILE A 1 120 ? -20.600 45.820 40.272  1.00 92.90  ? 164  ILE A CG2 1 
ATOM   803  C CD1 . ILE A 1 120 ? -17.914 47.172 39.625  1.00 88.55  ? 164  ILE A CD1 1 
ATOM   804  N N   . PHE A 1 121 ? -18.082 43.871 43.344  1.00 94.16  ? 165  PHE A N   1 
ATOM   805  C CA  . PHE A 1 121 ? -16.847 43.452 43.995  1.00 94.11  ? 165  PHE A CA  1 
ATOM   806  C C   . PHE A 1 121 ? -15.839 43.059 42.945  1.00 90.77  ? 165  PHE A C   1 
ATOM   807  O O   . PHE A 1 121 ? -16.093 42.171 42.136  1.00 89.36  ? 165  PHE A O   1 
ATOM   808  C CB  . PHE A 1 121 ? -17.103 42.299 44.954  1.00 96.92  ? 165  PHE A CB  1 
ATOM   809  C CG  . PHE A 1 121 ? -17.801 42.717 46.204  1.00 100.67 ? 165  PHE A CG  1 
ATOM   810  C CD1 . PHE A 1 121 ? -19.164 42.951 46.204  1.00 102.58 ? 165  PHE A CD1 1 
ATOM   811  C CD2 . PHE A 1 121 ? -17.090 42.903 47.375  1.00 102.46 ? 165  PHE A CD2 1 
ATOM   812  C CE1 . PHE A 1 121 ? -19.803 43.356 47.354  1.00 105.93 ? 165  PHE A CE1 1 
ATOM   813  C CE2 . PHE A 1 121 ? -17.725 43.306 48.525  1.00 105.82 ? 165  PHE A CE2 1 
ATOM   814  C CZ  . PHE A 1 121 ? -19.079 43.532 48.520  1.00 107.44 ? 165  PHE A CZ  1 
ATOM   815  N N   . ARG A 1 122 ? -14.695 43.727 42.946  1.00 98.82  ? 166  ARG A N   1 
ATOM   816  C CA  . ARG A 1 122 ? -13.749 43.567 41.854  1.00 96.35  ? 166  ARG A CA  1 
ATOM   817  C C   . ARG A 1 122 ? -12.475 42.898 42.274  1.00 96.40  ? 166  ARG A C   1 
ATOM   818  O O   . ARG A 1 122 ? -11.811 43.341 43.190  1.00 97.97  ? 166  ARG A O   1 
ATOM   819  C CB  . ARG A 1 122 ? -13.411 44.921 41.244  1.00 95.91  ? 166  ARG A CB  1 
ATOM   820  C CG  . ARG A 1 122 ? -14.617 45.661 40.730  1.00 94.80  ? 166  ARG A CG  1 
ATOM   821  C CD  . ARG A 1 122 ? -14.224 47.054 40.333  1.00 95.10  ? 166  ARG A CD  1 
ATOM   822  N NE  . ARG A 1 122 ? -13.415 47.675 41.365  1.00 96.89  ? 166  ARG A NE  1 
ATOM   823  C CZ  . ARG A 1 122 ? -12.420 48.517 41.116  1.00 97.24  ? 166  ARG A CZ  1 
ATOM   824  N NH1 . ARG A 1 122 ? -12.117 48.826 39.865  1.00 96.09  ? 166  ARG A NH1 1 
ATOM   825  N NH2 . ARG A 1 122 ? -11.724 49.049 42.116  1.00 99.22  ? 166  ARG A NH2 1 
ATOM   826  N N   . SER A 1 123 ? -12.125 41.832 41.584  1.00 91.35  ? 167  SER A N   1 
ATOM   827  C CA  . SER A 1 123 ? -10.798 41.282 41.724  1.00 91.42  ? 167  SER A CA  1 
ATOM   828  C C   . SER A 1 123 ? -10.049 41.457 40.406  1.00 89.84  ? 167  SER A C   1 
ATOM   829  O O   . SER A 1 123 ? -10.547 41.090 39.334  1.00 88.20  ? 167  SER A O   1 
ATOM   830  C CB  . SER A 1 123 ? -10.856 39.818 42.130  1.00 91.67  ? 167  SER A CB  1 
ATOM   831  O OG  . SER A 1 123 ? -9.553  39.322 42.337  1.00 92.17  ? 167  SER A OG  1 
ATOM   832  N N   . SER A 1 124 ? -8.879  42.078 40.480  1.00 96.51  ? 168  SER A N   1 
ATOM   833  C CA  . SER A 1 124 ? -8.032  42.196 39.310  1.00 96.32  ? 168  SER A CA  1 
ATOM   834  C C   . SER A 1 124 ? -6.999  41.078 39.283  1.00 96.80  ? 168  SER A C   1 
ATOM   835  O O   . SER A 1 124 ? -6.297  40.919 38.290  1.00 97.11  ? 168  SER A O   1 
ATOM   836  C CB  . SER A 1 124 ? -7.350  43.561 39.259  1.00 97.92  ? 168  SER A CB  1 
ATOM   837  O OG  . SER A 1 124 ? -6.387  43.702 40.291  1.00 99.80  ? 168  SER A OG  1 
ATOM   838  N N   . ASP A 1 125 ? -6.882  40.314 40.367  1.00 97.80  ? 169  ASP A N   1 
ATOM   839  C CA  . ASP A 1 125 ? -6.026  39.134 40.318  1.00 98.23  ? 169  ASP A CA  1 
ATOM   840  C C   . ASP A 1 125 ? -6.668  37.864 40.846  1.00 97.65  ? 169  ASP A C   1 
ATOM   841  O O   . ASP A 1 125 ? -6.576  37.565 42.032  1.00 99.09  ? 169  ASP A O   1 
ATOM   842  C CB  . ASP A 1 125 ? -4.782  39.417 41.146  1.00 100.58 ? 169  ASP A CB  1 
ATOM   843  C CG  . ASP A 1 125 ? -5.129  39.957 42.531  1.00 101.93 ? 169  ASP A CG  1 
ATOM   844  O OD1 . ASP A 1 125 ? -6.342  40.153 42.797  1.00 101.18 ? 169  ASP A OD1 1 
ATOM   845  O OD2 . ASP A 1 125 ? -4.197  40.195 43.345  1.00 104.15 ? 169  ASP A OD2 1 
ATOM   846  N N   . PHE A 1 126 ? -7.212  37.070 39.937  1.00 80.77  ? 170  PHE A N   1 
ATOM   847  C CA  . PHE A 1 126 ? -7.703  35.707 40.195  1.00 80.37  ? 170  PHE A CA  1 
ATOM   848  C C   . PHE A 1 126 ? -8.434  35.491 41.529  1.00 81.59  ? 170  PHE A C   1 
ATOM   849  O O   . PHE A 1 126 ? -8.283  34.445 42.163  1.00 82.67  ? 170  PHE A O   1 
ATOM   850  C CB  . PHE A 1 126 ? -6.531  34.743 40.035  1.00 81.16  ? 170  PHE A CB  1 
ATOM   851  C CG  . PHE A 1 126 ? -5.874  34.863 38.693  1.00 81.01  ? 170  PHE A CG  1 
ATOM   852  C CD1 . PHE A 1 126 ? -6.448  34.270 37.575  1.00 79.83  ? 170  PHE A CD1 1 
ATOM   853  C CD2 . PHE A 1 126 ? -4.740  35.637 38.531  1.00 82.68  ? 170  PHE A CD2 1 
ATOM   854  C CE1 . PHE A 1 126 ? -5.872  34.406 36.331  1.00 80.76  ? 170  PHE A CE1 1 
ATOM   855  C CE2 . PHE A 1 126 ? -4.163  35.779 37.296  1.00 83.64  ? 170  PHE A CE2 1 
ATOM   856  C CZ  . PHE A 1 126 ? -4.725  35.163 36.193  1.00 82.90  ? 170  PHE A CZ  1 
ATOM   857  N N   . ALA A 1 127 ? -9.232  36.478 41.928  1.00 92.05  ? 171  ALA A N   1 
ATOM   858  C CA  . ALA A 1 127 ? -10.035 36.400 43.145  1.00 94.19  ? 171  ALA A CA  1 
ATOM   859  C C   . ALA A 1 127 ? -9.240  36.196 44.445  1.00 96.80  ? 171  ALA A C   1 
ATOM   860  O O   . ALA A 1 127 ? -9.749  35.572 45.377  1.00 99.00  ? 171  ALA A O   1 
ATOM   861  C CB  . ALA A 1 127 ? -11.070 35.294 43.004  1.00 94.28  ? 171  ALA A CB  1 
ATOM   862  N N   . LYS A 1 128 ? -8.005  36.685 44.517  1.00 106.04 ? 172  LYS A N   1 
ATOM   863  C CA  . LYS A 1 128 ? -7.264  36.667 45.788  1.00 108.77 ? 172  LYS A CA  1 
ATOM   864  C C   . LYS A 1 128 ? -7.568  37.852 46.709  1.00 110.77 ? 172  LYS A C   1 
ATOM   865  O O   . LYS A 1 128 ? -7.632  37.693 47.924  1.00 113.40 ? 172  LYS A O   1 
ATOM   866  C CB  . LYS A 1 128 ? -5.768  36.567 45.520  1.00 108.81 ? 172  LYS A CB  1 
ATOM   867  C CG  . LYS A 1 128 ? -5.414  35.174 45.037  1.00 107.89 ? 172  LYS A CG  1 
ATOM   868  C CD  . LYS A 1 128 ? -3.962  34.849 45.183  1.00 109.12 ? 172  LYS A CD  1 
ATOM   869  C CE  . LYS A 1 128 ? -3.203  35.157 43.918  1.00 107.84 ? 172  LYS A CE  1 
ATOM   870  N NZ  . LYS A 1 128 ? -1.767  34.831 44.148  1.00 109.89 ? 172  LYS A NZ  1 
ATOM   871  N N   . ASN A 1 129 ? -7.735  39.037 46.129  1.00 106.04 ? 173  ASN A N   1 
ATOM   872  C CA  . ASN A 1 129 ? -8.234  40.197 46.864  1.00 107.73 ? 173  ASN A CA  1 
ATOM   873  C C   . ASN A 1 129 ? -9.350  40.876 46.093  1.00 106.02 ? 173  ASN A C   1 
ATOM   874  O O   . ASN A 1 129 ? -9.213  41.128 44.899  1.00 103.64 ? 173  ASN A O   1 
ATOM   875  C CB  . ASN A 1 129 ? -7.128  41.214 47.131  1.00 108.94 ? 173  ASN A CB  1 
ATOM   876  C CG  . ASN A 1 129 ? -5.890  40.588 47.710  1.00 110.62 ? 173  ASN A CG  1 
ATOM   877  O OD1 . ASN A 1 129 ? -5.635  40.666 48.920  1.00 113.70 ? 173  ASN A OD1 1 
ATOM   878  N ND2 . ASN A 1 129 ? -5.096  39.968 46.849  1.00 108.93 ? 173  ASN A ND2 1 
ATOM   879  N N   . PHE A 1 130 ? -10.449 41.169 46.782  1.00 89.22  ? 174  PHE A N   1 
ATOM   880  C CA  . PHE A 1 130 ? -11.584 41.879 46.192  1.00 86.99  ? 174  PHE A CA  1 
ATOM   881  C C   . PHE A 1 130 ? -11.684 43.286 46.758  1.00 90.53  ? 174  PHE A C   1 
ATOM   882  O O   . PHE A 1 130 ? -11.386 43.521 47.933  1.00 94.54  ? 174  PHE A O   1 
ATOM   883  C CB  . PHE A 1 130 ? -12.890 41.132 46.446  1.00 87.23  ? 174  PHE A CB  1 
ATOM   884  C CG  . PHE A 1 130 ? -13.107 39.970 45.539  1.00 85.31  ? 174  PHE A CG  1 
ATOM   885  C CD1 . PHE A 1 130 ? -12.580 38.731 45.847  1.00 85.87  ? 174  PHE A CD1 1 
ATOM   886  C CD2 . PHE A 1 130 ? -13.863 40.107 44.371  1.00 83.09  ? 174  PHE A CD2 1 
ATOM   887  C CE1 . PHE A 1 130 ? -12.796 37.639 45.005  1.00 84.23  ? 174  PHE A CE1 1 
ATOM   888  C CE2 . PHE A 1 130 ? -14.091 39.016 43.523  1.00 81.47  ? 174  PHE A CE2 1 
ATOM   889  C CZ  . PHE A 1 130 ? -13.555 37.785 43.839  1.00 82.03  ? 174  PHE A CZ  1 
ATOM   890  N N   . VAL A 1 131 ? -12.093 44.218 45.911  1.00 121.26 ? 175  VAL A N   1 
ATOM   891  C CA  . VAL A 1 131 ? -12.376 45.574 46.344  1.00 122.70 ? 175  VAL A CA  1 
ATOM   892  C C   . VAL A 1 131 ? -13.812 45.894 45.950  1.00 122.36 ? 175  VAL A C   1 
ATOM   893  O O   . VAL A 1 131 ? -14.301 45.462 44.898  1.00 119.89 ? 175  VAL A O   1 
ATOM   894  C CB  . VAL A 1 131 ? -11.385 46.595 45.741  1.00 121.74 ? 175  VAL A CB  1 
ATOM   895  C CG1 . VAL A 1 131 ? -11.129 46.285 44.300  1.00 118.73 ? 175  VAL A CG1 1 
ATOM   896  C CG2 . VAL A 1 131 ? -11.905 48.008 45.879  1.00 122.74 ? 175  VAL A CG2 1 
ATOM   897  N N   . GLN A 1 132 ? -14.519 46.595 46.827  1.00 109.94 ? 176  GLN A N   1 
ATOM   898  C CA  . GLN A 1 132 ? -15.941 46.826 46.622  1.00 110.14 ? 176  GLN A CA  1 
ATOM   899  C C   . GLN A 1 132 ? -16.161 48.255 46.175  1.00 108.94 ? 176  GLN A C   1 
ATOM   900  O O   . GLN A 1 132 ? -15.699 49.195 46.822  1.00 109.82 ? 176  GLN A O   1 
ATOM   901  C CB  . GLN A 1 132 ? -16.720 46.549 47.909  1.00 113.96 ? 176  GLN A CB  1 
ATOM   902  C CG  . GLN A 1 132 ? -18.122 47.136 47.924  1.00 115.04 ? 176  GLN A CG  1 
ATOM   903  C CD  . GLN A 1 132 ? -18.613 47.438 49.326  1.00 118.38 ? 176  GLN A CD  1 
ATOM   904  O OE1 . GLN A 1 132 ? -19.500 46.761 49.845  1.00 124.56 ? 176  GLN A OE1 1 
ATOM   905  N NE2 . GLN A 1 132 ? -18.038 48.462 49.947  1.00 114.31 ? 176  GLN A NE2 1 
ATOM   906  N N   . THR A 1 133 ? -16.860 48.421 45.059  1.00 109.99 ? 177  THR A N   1 
ATOM   907  C CA  . THR A 1 133 ? -17.028 49.766 44.499  1.00 109.29 ? 177  THR A CA  1 
ATOM   908  C C   . THR A 1 133 ? -18.507 50.126 44.345  1.00 110.09 ? 177  THR A C   1 
ATOM   909  O O   . THR A 1 133 ? -19.291 49.326 43.839  1.00 109.76 ? 177  THR A O   1 
ATOM   910  C CB  . THR A 1 133 ? -16.307 49.908 43.120  1.00 106.47 ? 177  THR A CB  1 
ATOM   911  O OG1 . THR A 1 133 ? -14.887 49.841 43.309  1.00 106.32 ? 177  THR A OG1 1 
ATOM   912  C CG2 . THR A 1 133 ? -16.663 51.235 42.420  1.00 106.01 ? 177  THR A CG2 1 
ATOM   913  N N   . ASP A 1 134 ? -18.895 51.323 44.777  1.00 120.32 ? 178  ASP A N   1 
ATOM   914  C CA  . ASP A 1 134 ? -20.277 51.770 44.605  1.00 121.04 ? 178  ASP A CA  1 
ATOM   915  C C   . ASP A 1 134 ? -20.470 52.481 43.269  1.00 118.83 ? 178  ASP A C   1 
ATOM   916  O O   . ASP A 1 134 ? -19.812 53.478 42.986  1.00 118.12 ? 178  ASP A O   1 
ATOM   917  C CB  . ASP A 1 134 ? -20.702 52.697 45.747  1.00 123.55 ? 178  ASP A CB  1 
ATOM   918  C CG  . ASP A 1 134 ? -21.060 51.940 47.018  1.00 126.40 ? 178  ASP A CG  1 
ATOM   919  O OD1 . ASP A 1 134 ? -22.174 51.367 47.064  1.00 126.95 ? 178  ASP A OD1 1 
ATOM   920  O OD2 . ASP A 1 134 ? -20.243 51.939 47.972  1.00 128.39 ? 178  ASP A OD2 1 
ATOM   921  N N   . LEU A 1 135 ? -21.384 51.962 42.456  1.00 93.96  ? 179  LEU A N   1 
ATOM   922  C CA  . LEU A 1 135 ? -21.668 52.520 41.137  1.00 92.07  ? 179  LEU A CA  1 
ATOM   923  C C   . LEU A 1 135 ? -22.591 53.738 41.215  1.00 93.25  ? 179  LEU A C   1 
ATOM   924  O O   . LEU A 1 135 ? -23.457 53.812 42.084  1.00 95.59  ? 179  LEU A O   1 
ATOM   925  C CB  . LEU A 1 135 ? -22.291 51.447 40.255  1.00 91.23  ? 179  LEU A CB  1 
ATOM   926  C CG  . LEU A 1 135 ? -21.567 50.102 40.298  1.00 90.33  ? 179  LEU A CG  1 
ATOM   927  C CD1 . LEU A 1 135 ? -22.450 49.015 39.722  1.00 90.59  ? 179  LEU A CD1 1 
ATOM   928  C CD2 . LEU A 1 135 ? -20.265 50.167 39.537  1.00 87.60  ? 179  LEU A CD2 1 
ATOM   929  N N   . PRO A 1 136 ? -22.389 54.714 40.318  1.00 99.34  ? 180  PRO A N   1 
ATOM   930  C CA  . PRO A 1 136 ? -23.254 55.893 40.139  1.00 100.08 ? 180  PRO A CA  1 
ATOM   931  C C   . PRO A 1 136 ? -24.626 55.538 39.552  1.00 100.42 ? 180  PRO A C   1 
ATOM   932  O O   . PRO A 1 136 ? -25.498 56.396 39.481  1.00 101.24 ? 180  PRO A O   1 
ATOM   933  C CB  . PRO A 1 136 ? -22.456 56.773 39.179  1.00 98.52  ? 180  PRO A CB  1 
ATOM   934  C CG  . PRO A 1 136 ? -21.591 55.814 38.429  1.00 96.59  ? 180  PRO A CG  1 
ATOM   935  C CD  . PRO A 1 136 ? -21.241 54.725 39.395  1.00 97.11  ? 180  PRO A CD  1 
ATOM   936  N N   . PHE A 1 137 ? -24.778 54.303 39.078  1.00 91.26  ? 181  PHE A N   1 
ATOM   937  C CA  . PHE A 1 137 ? -26.021 53.832 38.459  1.00 92.03  ? 181  PHE A CA  1 
ATOM   938  C C   . PHE A 1 137 ? -26.468 52.467 38.984  1.00 93.77  ? 181  PHE A C   1 
ATOM   939  O O   . PHE A 1 137 ? -25.835 51.893 39.873  1.00 94.32  ? 181  PHE A O   1 
ATOM   940  C CB  . PHE A 1 137 ? -25.841 53.737 36.950  1.00 89.83  ? 181  PHE A CB  1 
ATOM   941  C CG  . PHE A 1 137 ? -24.733 52.818 36.547  1.00 87.87  ? 181  PHE A CG  1 
ATOM   942  C CD1 . PHE A 1 137 ? -23.414 53.254 36.564  1.00 86.43  ? 181  PHE A CD1 1 
ATOM   943  C CD2 . PHE A 1 137 ? -24.998 51.521 36.176  1.00 87.75  ? 181  PHE A CD2 1 
ATOM   944  C CE1 . PHE A 1 137 ? -22.386 52.419 36.208  1.00 84.80  ? 181  PHE A CE1 1 
ATOM   945  C CE2 . PHE A 1 137 ? -23.972 50.680 35.815  1.00 85.82  ? 181  PHE A CE2 1 
ATOM   946  C CZ  . PHE A 1 137 ? -22.662 51.132 35.834  1.00 84.30  ? 181  PHE A CZ  1 
ATOM   947  N N   . HIS A 1 138 ? -27.552 51.942 38.415  1.00 92.78  ? 182  HIS A N   1 
ATOM   948  C CA  . HIS A 1 138 ? -27.980 50.574 38.715  1.00 94.92  ? 182  HIS A CA  1 
ATOM   949  C C   . HIS A 1 138 ? -27.837 49.668 37.488  1.00 93.33  ? 182  HIS A C   1 
ATOM   950  O O   . HIS A 1 138 ? -28.439 49.931 36.450  1.00 92.87  ? 182  HIS A O   1 
ATOM   951  C CB  . HIS A 1 138 ? -29.418 50.562 39.225  1.00 98.84  ? 182  HIS A CB  1 
ATOM   952  C CG  . HIS A 1 138 ? -29.562 51.087 40.620  1.00 100.50 ? 182  HIS A CG  1 
ATOM   953  N ND1 . HIS A 1 138 ? -29.273 50.329 41.732  1.00 102.22 ? 182  HIS A ND1 1 
ATOM   954  C CD2 . HIS A 1 138 ? -29.950 52.299 41.081  1.00 100.70 ? 182  HIS A CD2 1 
ATOM   955  C CE1 . HIS A 1 138 ? -29.482 51.049 42.820  1.00 103.35 ? 182  HIS A CE1 1 
ATOM   956  N NE2 . HIS A 1 138 ? -29.890 52.249 42.452  1.00 102.47 ? 182  HIS A NE2 1 
ATOM   957  N N   . PRO A 1 139 ? -27.022 48.605 37.599  1.00 91.66  ? 183  PRO A N   1 
ATOM   958  C CA  . PRO A 1 139 ? -26.773 47.724 36.456  1.00 89.66  ? 183  PRO A CA  1 
ATOM   959  C C   . PRO A 1 139 ? -28.032 47.028 35.987  1.00 92.49  ? 183  PRO A C   1 
ATOM   960  O O   . PRO A 1 139 ? -28.753 46.429 36.797  1.00 96.58  ? 183  PRO A O   1 
ATOM   961  C CB  . PRO A 1 139 ? -25.771 46.702 37.001  1.00 88.75  ? 183  PRO A CB  1 
ATOM   962  C CG  . PRO A 1 139 ? -25.219 47.307 38.233  1.00 89.62  ? 183  PRO A CG  1 
ATOM   963  C CD  . PRO A 1 139 ? -26.312 48.150 38.803  1.00 92.60  ? 183  PRO A CD  1 
ATOM   964  N N   . LEU A 1 140 ? -28.306 47.142 34.691  1.00 77.58  ? 184  LEU A N   1 
ATOM   965  C CA  . LEU A 1 140 ? -29.342 46.341 34.049  1.00 79.87  ? 184  LEU A CA  1 
ATOM   966  C C   . LEU A 1 140 ? -28.776 45.093 33.375  1.00 77.80  ? 184  LEU A C   1 
ATOM   967  O O   . LEU A 1 140 ? -29.510 44.175 33.044  1.00 79.77  ? 184  LEU A O   1 
ATOM   968  C CB  . LEU A 1 140 ? -30.093 47.200 33.028  1.00 79.79  ? 184  LEU A CB  1 
ATOM   969  C CG  . LEU A 1 140 ? -31.227 46.587 32.218  1.00 82.35  ? 184  LEU A CG  1 
ATOM   970  C CD1 . LEU A 1 140 ? -32.245 45.985 33.158  1.00 87.49  ? 184  LEU A CD1 1 
ATOM   971  C CD2 . LEU A 1 140 ? -31.837 47.647 31.330  1.00 82.15  ? 184  LEU A CD2 1 
ATOM   972  N N   . THR A 1 141 ? -27.463 45.047 33.210  1.00 87.38  ? 185  THR A N   1 
ATOM   973  C CA  . THR A 1 141 ? -26.829 43.977 32.445  1.00 84.87  ? 185  THR A CA  1 
ATOM   974  C C   . THR A 1 141 ? -25.527 43.559 33.100  1.00 82.59  ? 185  THR A C   1 
ATOM   975  O O   . THR A 1 141 ? -24.939 44.312 33.874  1.00 82.32  ? 185  THR A O   1 
ATOM   976  C CB  . THR A 1 141 ? -26.516 44.395 30.974  1.00 82.72  ? 185  THR A CB  1 
ATOM   977  O OG1 . THR A 1 141 ? -25.504 45.415 30.958  1.00 80.70  ? 185  THR A OG1 1 
ATOM   978  C CG2 . THR A 1 141 ? -27.755 44.905 30.260  1.00 84.93  ? 185  THR A CG2 1 
ATOM   979  N N   . GLN A 1 142 ? -25.072 42.355 32.784  1.00 83.15  ? 186  GLN A N   1 
ATOM   980  C CA  . GLN A 1 142 ? -23.760 41.941 33.226  1.00 80.73  ? 186  GLN A CA  1 
ATOM   981  C C   . GLN A 1 142 ? -22.775 42.873 32.550  1.00 78.67  ? 186  GLN A C   1 
ATOM   982  O O   . GLN A 1 142 ? -22.984 43.280 31.411  1.00 78.49  ? 186  GLN A O   1 
ATOM   983  C CB  . GLN A 1 142 ? -23.489 40.478 32.882  1.00 79.55  ? 186  GLN A CB  1 
ATOM   984  C CG  . GLN A 1 142 ? -22.037 40.092 33.006  1.00 77.59  ? 186  GLN A CG  1 
ATOM   985  C CD  . GLN A 1 142 ? -21.821 38.603 32.929  1.00 76.22  ? 186  GLN A CD  1 
ATOM   986  O OE1 . GLN A 1 142 ? -21.575 38.052 31.845  1.00 74.33  ? 186  GLN A OE1 1 
ATOM   987  N NE2 . GLN A 1 142 ? -21.888 37.935 34.078  1.00 77.75  ? 186  GLN A NE2 1 
ATOM   988  N N   . MET A 1 143 ? -21.729 43.256 33.266  1.00 90.11  ? 187  MET A N   1 
ATOM   989  C CA  . MET A 1 143 ? -20.724 44.127 32.684  1.00 88.97  ? 187  MET A CA  1 
ATOM   990  C C   . MET A 1 143 ? -19.857 43.380 31.689  1.00 87.82  ? 187  MET A C   1 
ATOM   991  O O   . MET A 1 143 ? -19.558 42.195 31.862  1.00 87.14  ? 187  MET A O   1 
ATOM   992  C CB  . MET A 1 143 ? -19.880 44.738 33.776  1.00 89.09  ? 187  MET A CB  1 
ATOM   993  C CG  . MET A 1 143 ? -20.710 45.581 34.683  1.00 90.76  ? 187  MET A CG  1 
ATOM   994  S SD  . MET A 1 143 ? -19.732 46.064 36.076  1.00 91.59  ? 187  MET A SD  1 
ATOM   995  C CE  . MET A 1 143 ? -20.903 47.116 36.924  1.00 94.10  ? 187  MET A CE  1 
ATOM   996  N N   . MET A 1 144 ? -19.461 44.078 30.633  1.00 100.99 ? 188  MET A N   1 
ATOM   997  C CA  . MET A 1 144 ? -18.853 43.407 29.505  1.00 101.25 ? 188  MET A CA  1 
ATOM   998  C C   . MET A 1 144 ? -17.485 43.956 29.176  1.00 102.17 ? 188  MET A C   1 
ATOM   999  O O   . MET A 1 144 ? -17.329 45.134 28.871  1.00 103.14 ? 188  MET A O   1 
ATOM   1000 C CB  . MET A 1 144 ? -19.783 43.500 28.310  1.00 102.31 ? 188  MET A CB  1 
ATOM   1001 C CG  . MET A 1 144 ? -21.121 42.846 28.591  1.00 102.10 ? 188  MET A CG  1 
ATOM   1002 S SD  . MET A 1 144 ? -22.263 42.914 27.204  1.00 103.51 ? 188  MET A SD  1 
ATOM   1003 C CE  . MET A 1 144 ? -22.556 44.668 27.041  1.00 104.90 ? 188  MET A CE  1 
ATOM   1004 N N   . TYR A 1 145 ? -16.494 43.075 29.261  1.00 72.64  ? 189  TYR A N   1 
ATOM   1005 C CA  . TYR A 1 145 ? -15.099 43.429 29.042  1.00 74.35  ? 189  TYR A CA  1 
ATOM   1006 C C   . TYR A 1 145 ? -14.814 43.749 27.584  1.00 77.48  ? 189  TYR A C   1 
ATOM   1007 O O   . TYR A 1 145 ? -15.186 42.989 26.699  1.00 78.53  ? 189  TYR A O   1 
ATOM   1008 C CB  . TYR A 1 145 ? -14.189 42.280 29.483  1.00 74.09  ? 189  TYR A CB  1 
ATOM   1009 C CG  . TYR A 1 145 ? -14.223 41.974 30.954  1.00 71.91  ? 189  TYR A CG  1 
ATOM   1010 C CD1 . TYR A 1 145 ? -15.134 41.072 31.474  1.00 70.26  ? 189  TYR A CD1 1 
ATOM   1011 C CD2 . TYR A 1 145 ? -13.333 42.578 31.822  1.00 72.22  ? 189  TYR A CD2 1 
ATOM   1012 C CE1 . TYR A 1 145 ? -15.168 40.784 32.819  1.00 69.41  ? 189  TYR A CE1 1 
ATOM   1013 C CE2 . TYR A 1 145 ? -13.358 42.305 33.178  1.00 71.13  ? 189  TYR A CE2 1 
ATOM   1014 C CZ  . TYR A 1 145 ? -14.272 41.403 33.668  1.00 69.95  ? 189  TYR A CZ  1 
ATOM   1015 O OH  . TYR A 1 145 ? -14.294 41.128 35.013  1.00 69.96  ? 189  TYR A OH  1 
ATOM   1016 N N   . SER A 1 146 ? -14.139 44.855 27.318  1.00 78.70  ? 190  SER A N   1 
ATOM   1017 C CA  . SER A 1 146 ? -13.649 45.064 25.966  1.00 82.65  ? 190  SER A CA  1 
ATOM   1018 C C   . SER A 1 146 ? -12.640 43.965 25.619  1.00 85.25  ? 190  SER A C   1 
ATOM   1019 O O   . SER A 1 146 ? -11.785 43.628 26.435  1.00 84.60  ? 190  SER A O   1 
ATOM   1020 C CB  . SER A 1 146 ? -13.014 46.439 25.812  1.00 84.29  ? 190  SER A CB  1 
ATOM   1021 O OG  . SER A 1 146 ? -12.391 46.560 24.553  1.00 88.59  ? 190  SER A OG  1 
ATOM   1022 N N   . PRO A 1 147 ? -12.764 43.375 24.419  1.00 91.11  ? 191  PRO A N   1 
ATOM   1023 C CA  . PRO A 1 147 ? -11.867 42.326 23.919  1.00 94.84  ? 191  PRO A CA  1 
ATOM   1024 C C   . PRO A 1 147 ? -10.366 42.698 23.870  1.00 98.40  ? 191  PRO A C   1 
ATOM   1025 O O   . PRO A 1 147 ? -9.523  41.863 24.207  1.00 99.45  ? 191  PRO A O   1 
ATOM   1026 C CB  . PRO A 1 147 ? -12.405 42.074 22.509  1.00 98.33  ? 191  PRO A CB  1 
ATOM   1027 C CG  . PRO A 1 147 ? -13.840 42.395 22.608  1.00 94.13  ? 191  PRO A CG  1 
ATOM   1028 C CD  . PRO A 1 147 ? -13.931 43.557 23.541  1.00 91.30  ? 191  PRO A CD  1 
ATOM   1029 N N   . GLN A 1 148 ? -10.019 43.905 23.446  1.00 122.83 ? 192  GLN A N   1 
ATOM   1030 C CA  . GLN A 1 148 ? -8.603  44.232 23.385  1.00 125.59 ? 192  GLN A CA  1 
ATOM   1031 C C   . GLN A 1 148 ? -8.020  44.633 24.741  1.00 122.25 ? 192  GLN A C   1 
ATOM   1032 O O   . GLN A 1 148 ? -6.850  44.361 25.023  1.00 123.88 ? 192  GLN A O   1 
ATOM   1033 C CB  . GLN A 1 148 ? -8.342  45.337 22.372  1.00 128.28 ? 192  GLN A CB  1 
ATOM   1034 C CG  . GLN A 1 148 ? -6.862  45.656 22.239  1.00 131.39 ? 192  GLN A CG  1 
ATOM   1035 C CD  . GLN A 1 148 ? -6.483  46.052 20.840  1.00 134.68 ? 192  GLN A CD  1 
ATOM   1036 O OE1 . GLN A 1 148 ? -7.272  45.891 19.913  1.00 134.83 ? 192  GLN A OE1 1 
ATOM   1037 N NE2 . GLN A 1 148 ? -5.269  46.569 20.671  1.00 137.10 ? 192  GLN A NE2 1 
ATOM   1038 N N   . ASN A 1 149 ? -8.817  45.296 25.572  1.00 111.79 ? 193  ASN A N   1 
ATOM   1039 C CA  . ASN A 1 149 ? -8.327  45.731 26.875  1.00 109.13 ? 193  ASN A CA  1 
ATOM   1040 C C   . ASN A 1 149 ? -9.264  45.331 28.003  1.00 104.57 ? 193  ASN A C   1 
ATOM   1041 O O   . ASN A 1 149 ? -10.376 45.843 28.107  1.00 102.51 ? 193  ASN A O   1 
ATOM   1042 C CB  . ASN A 1 149 ? -8.112  47.248 26.885  1.00 109.51 ? 193  ASN A CB  1 
ATOM   1043 C CG  . ASN A 1 149 ? -7.349  47.720 28.108  1.00 108.32 ? 193  ASN A CG  1 
ATOM   1044 O OD1 . ASN A 1 149 ? -6.873  46.915 28.910  1.00 107.43 ? 193  ASN A OD1 1 
ATOM   1045 N ND2 . ASN A 1 149 ? -7.210  49.031 28.245  1.00 108.63 ? 193  ASN A ND2 1 
ATOM   1046 N N   . SER A 1 150 ? -8.797  44.442 28.872  1.00 92.55  ? 194  SER A N   1 
ATOM   1047 C CA  . SER A 1 150 ? -9.636  43.937 29.955  1.00 88.63  ? 194  SER A CA  1 
ATOM   1048 C C   . SER A 1 150 ? -9.911  44.994 31.028  1.00 86.80  ? 194  SER A C   1 
ATOM   1049 O O   . SER A 1 150 ? -10.702 44.761 31.940  1.00 84.33  ? 194  SER A O   1 
ATOM   1050 C CB  . SER A 1 150 ? -8.993  42.706 30.598  1.00 88.14  ? 194  SER A CB  1 
ATOM   1051 O OG  . SER A 1 150 ? -7.977  43.062 31.514  1.00 88.63  ? 194  SER A OG  1 
ATOM   1052 N N   . ASP A 1 151 ? -9.250  46.146 30.928  1.00 115.10 ? 195  ASP A N   1 
ATOM   1053 C CA  . ASP A 1 151 ? -9.495  47.245 31.856  1.00 114.16 ? 195  ASP A CA  1 
ATOM   1054 C C   . ASP A 1 151 ? -10.714 48.067 31.446  1.00 113.35 ? 195  ASP A C   1 
ATOM   1055 O O   . ASP A 1 151 ? -11.139 48.948 32.183  1.00 112.69 ? 195  ASP A O   1 
ATOM   1056 C CB  . ASP A 1 151 ? -8.271  48.164 31.958  1.00 116.43 ? 195  ASP A CB  1 
ATOM   1057 C CG  . ASP A 1 151 ? -7.063  47.475 32.573  1.00 117.69 ? 195  ASP A CG  1 
ATOM   1058 O OD1 . ASP A 1 151 ? -7.251  46.678 33.520  1.00 115.48 ? 195  ASP A OD1 1 
ATOM   1059 O OD2 . ASP A 1 151 ? -5.924  47.748 32.122  1.00 121.19 ? 195  ASP A OD2 1 
ATOM   1060 N N   . TYR A 1 152 ? -11.274 47.785 30.271  1.00 96.79  ? 196  TYR A N   1 
ATOM   1061 C CA  . TYR A 1 152 ? -12.416 48.552 29.770  1.00 96.39  ? 196  TYR A CA  1 
ATOM   1062 C C   . TYR A 1 152 ? -13.727 47.797 29.942  1.00 94.25  ? 196  TYR A C   1 
ATOM   1063 O O   . TYR A 1 152 ? -13.841 46.637 29.541  1.00 94.09  ? 196  TYR A O   1 
ATOM   1064 C CB  . TYR A 1 152 ? -12.233 48.911 28.297  1.00 99.02  ? 196  TYR A CB  1 
ATOM   1065 C CG  . TYR A 1 152 ? -11.058 49.811 28.015  1.00 101.59 ? 196  TYR A CG  1 
ATOM   1066 C CD1 . TYR A 1 152 ? -10.385 50.445 29.044  1.00 101.24 ? 196  TYR A CD1 1 
ATOM   1067 C CD2 . TYR A 1 152 ? -10.623 50.031 26.719  1.00 104.75 ? 196  TYR A CD2 1 
ATOM   1068 C CE1 . TYR A 1 152 ? -9.315  51.257 28.796  1.00 103.70 ? 196  TYR A CE1 1 
ATOM   1069 C CE2 . TYR A 1 152 ? -9.547  50.855 26.461  1.00 107.20 ? 196  TYR A CE2 1 
ATOM   1070 C CZ  . TYR A 1 152 ? -8.899  51.471 27.509  1.00 106.55 ? 196  TYR A CZ  1 
ATOM   1071 O OH  . TYR A 1 152 ? -7.823  52.297 27.284  1.00 109.12 ? 196  TYR A OH  1 
ATOM   1072 N N   . LEU A 1 153 ? -14.716 48.463 30.533  1.00 93.16  ? 197  LEU A N   1 
ATOM   1073 C CA  . LEU A 1 153 ? -16.028 47.868 30.765  1.00 91.66  ? 197  LEU A CA  1 
ATOM   1074 C C   . LEU A 1 153 ? -17.132 48.762 30.237  1.00 92.05  ? 197  LEU A C   1 
ATOM   1075 O O   . LEU A 1 153 ? -17.003 49.988 30.251  1.00 92.89  ? 197  LEU A O   1 
ATOM   1076 C CB  . LEU A 1 153 ? -16.259 47.627 32.254  1.00 90.58  ? 197  LEU A CB  1 
ATOM   1077 C CG  . LEU A 1 153 ? -15.172 46.910 33.042  1.00 90.26  ? 197  LEU A CG  1 
ATOM   1078 C CD1 . LEU A 1 153 ? -15.550 46.831 34.509  1.00 90.20  ? 197  LEU A CD1 1 
ATOM   1079 C CD2 . LEU A 1 153 ? -14.964 45.530 32.473  1.00 89.59  ? 197  LEU A CD2 1 
ATOM   1080 N N   . LEU A 1 154 ? -18.224 48.161 29.776  1.00 78.67  ? 198  LEU A N   1 
ATOM   1081 C CA  . LEU A 1 154 ? -19.434 48.947 29.564  1.00 79.05  ? 198  LEU A CA  1 
ATOM   1082 C C   . LEU A 1 154 ? -20.643 48.273 30.209  1.00 78.49  ? 198  LEU A C   1 
ATOM   1083 O O   . LEU A 1 154 ? -20.696 47.051 30.324  1.00 77.87  ? 198  LEU A O   1 
ATOM   1084 C CB  . LEU A 1 154 ? -19.665 49.204 28.074  1.00 80.39  ? 198  LEU A CB  1 
ATOM   1085 C CG  . LEU A 1 154 ? -19.974 48.109 27.068  1.00 80.83  ? 198  LEU A CG  1 
ATOM   1086 C CD1 . LEU A 1 154 ? -21.444 47.874 27.006  1.00 80.68  ? 198  LEU A CD1 1 
ATOM   1087 C CD2 . LEU A 1 154 ? -19.497 48.586 25.727  1.00 83.00  ? 198  LEU A CD2 1 
ATOM   1088 N N   . ALA A 1 155 ? -21.595 49.083 30.658  1.00 76.69  ? 199  ALA A N   1 
ATOM   1089 C CA  . ALA A 1 155 ? -22.808 48.561 31.269  1.00 77.38  ? 199  ALA A CA  1 
ATOM   1090 C C   . ALA A 1 155 ? -24.036 49.356 30.838  1.00 78.71  ? 199  ALA A C   1 
ATOM   1091 O O   . ALA A 1 155 ? -23.946 50.543 30.528  1.00 78.90  ? 199  ALA A O   1 
ATOM   1092 C CB  . ALA A 1 155 ? -22.678 48.571 32.782  1.00 77.88  ? 199  ALA A CB  1 
ATOM   1093 N N   . LEU A 1 156 ? -25.186 48.696 30.811  1.00 80.91  ? 200  LEU A N   1 
ATOM   1094 C CA  . LEU A 1 156 ? -26.444 49.405 30.640  1.00 82.69  ? 200  LEU A CA  1 
ATOM   1095 C C   . LEU A 1 156 ? -27.101 49.599 32.002  1.00 84.62  ? 200  LEU A C   1 
ATOM   1096 O O   . LEU A 1 156 ? -27.163 48.657 32.795  1.00 85.65  ? 200  LEU A O   1 
ATOM   1097 C CB  . LEU A 1 156 ? -27.369 48.637 29.701  1.00 83.84  ? 200  LEU A CB  1 
ATOM   1098 C CG  . LEU A 1 156 ? -27.904 49.458 28.532  1.00 84.26  ? 200  LEU A CG  1 
ATOM   1099 C CD1 . LEU A 1 156 ? -26.734 50.058 27.791  1.00 82.77  ? 200  LEU A CD1 1 
ATOM   1100 C CD2 . LEU A 1 156 ? -28.735 48.602 27.606  1.00 85.68  ? 200  LEU A CD2 1 
ATOM   1101 N N   . SER A 1 157 ? -27.584 50.806 32.291  1.00 78.03  ? 201  SER A N   1 
ATOM   1102 C CA  . SER A 1 157 ? -28.263 51.029 33.571  1.00 80.41  ? 201  SER A CA  1 
ATOM   1103 C C   . SER A 1 157 ? -29.766 50.769 33.476  1.00 83.54  ? 201  SER A C   1 
ATOM   1104 O O   . SER A 1 157 ? -30.297 50.525 32.401  1.00 83.66  ? 201  SER A O   1 
ATOM   1105 C CB  . SER A 1 157 ? -28.014 52.444 34.069  1.00 80.03  ? 201  SER A CB  1 
ATOM   1106 O OG  . SER A 1 157 ? -28.819 53.371 33.379  1.00 80.44  ? 201  SER A OG  1 
ATOM   1107 N N   . THR A 1 158 ? -30.461 50.845 34.601  1.00 91.72  ? 202  THR A N   1 
ATOM   1108 C CA  . THR A 1 158 ? -31.878 50.491 34.636  1.00 95.56  ? 202  THR A CA  1 
ATOM   1109 C C   . THR A 1 158 ? -32.706 51.641 34.096  1.00 95.66  ? 202  THR A C   1 
ATOM   1110 O O   . THR A 1 158 ? -33.916 51.524 33.871  1.00 98.49  ? 202  THR A O   1 
ATOM   1111 C CB  . THR A 1 158 ? -32.332 50.148 36.053  1.00 99.11  ? 202  THR A CB  1 
ATOM   1112 O OG1 . THR A 1 158 ? -32.084 51.268 36.911  1.00 98.24  ? 202  THR A OG1 1 
ATOM   1113 C CG2 . THR A 1 158 ? -31.561 48.950 36.561  1.00 99.51  ? 202  THR A CG2 1 
ATOM   1114 N N   . GLU A 1 159 ? -32.035 52.771 33.937  1.00 113.45 ? 203  GLU A N   1 
ATOM   1115 C CA  . GLU A 1 159 ? -32.598 53.922 33.267  1.00 112.98 ? 203  GLU A CA  1 
ATOM   1116 C C   . GLU A 1 159 ? -32.155 53.980 31.812  1.00 110.63 ? 203  GLU A C   1 
ATOM   1117 O O   . GLU A 1 159 ? -32.352 54.983 31.131  1.00 109.87 ? 203  GLU A O   1 
ATOM   1118 C CB  . GLU A 1 159 ? -32.234 55.185 34.019  1.00 112.18 ? 203  GLU A CB  1 
ATOM   1119 C CG  . GLU A 1 159 ? -33.036 55.311 35.297  1.00 114.92 ? 203  GLU A CG  1 
ATOM   1120 C CD  . GLU A 1 159 ? -32.795 56.624 35.992  1.00 114.40 ? 203  GLU A CD  1 
ATOM   1121 O OE1 . GLU A 1 159 ? -31.607 56.999 36.130  1.00 112.26 ? 203  GLU A OE1 1 
ATOM   1122 O OE2 . GLU A 1 159 ? -33.787 57.282 36.391  1.00 116.31 ? 203  GLU A OE2 1 
ATOM   1123 N N   . ASN A 1 160 ? -31.504 52.911 31.369  1.00 103.60 ? 204  ASN A N   1 
ATOM   1124 C CA  . ASN A 1 160 ? -31.047 52.775 29.993  1.00 101.81 ? 204  ASN A CA  1 
ATOM   1125 C C   . ASN A 1 160 ? -29.971 53.769 29.611  1.00 99.52  ? 204  ASN A C   1 
ATOM   1126 O O   . ASN A 1 160 ? -29.946 54.252 28.483  1.00 99.05  ? 204  ASN A O   1 
ATOM   1127 C CB  . ASN A 1 160 ? -32.214 52.907 29.014  1.00 103.31 ? 204  ASN A CB  1 
ATOM   1128 C CG  . ASN A 1 160 ? -33.125 51.716 29.044  1.00 105.98 ? 204  ASN A CG  1 
ATOM   1129 O OD1 . ASN A 1 160 ? -32.773 50.642 28.561  1.00 105.54 ? 204  ASN A OD1 1 
ATOM   1130 N ND2 . ASN A 1 160 ? -34.309 51.893 29.605  1.00 109.10 ? 204  ASN A ND2 1 
ATOM   1131 N N   . GLY A 1 161 ? -29.087 54.088 30.545  1.00 83.76  ? 205  GLY A N   1 
ATOM   1132 C CA  . GLY A 1 161 ? -27.887 54.823 30.194  1.00 82.13  ? 205  GLY A CA  1 
ATOM   1133 C C   . GLY A 1 161 ? -26.772 53.872 29.816  1.00 80.78  ? 205  GLY A C   1 
ATOM   1134 O O   . GLY A 1 161 ? -26.667 52.777 30.372  1.00 80.71  ? 205  GLY A O   1 
ATOM   1135 N N   . LEU A 1 162 ? -25.925 54.280 28.880  1.00 84.64  ? 206  LEU A N   1 
ATOM   1136 C CA  . LEU A 1 162 ? -24.710 53.520 28.592  1.00 83.68  ? 206  LEU A CA  1 
ATOM   1137 C C   . LEU A 1 162 ? -23.582 54.098 29.437  1.00 83.22  ? 206  LEU A C   1 
ATOM   1138 O O   . LEU A 1 162 ? -23.230 55.268 29.302  1.00 83.75  ? 206  LEU A O   1 
ATOM   1139 C CB  . LEU A 1 162 ? -24.358 53.567 27.101  1.00 84.13  ? 206  LEU A CB  1 
ATOM   1140 C CG  . LEU A 1 162 ? -23.152 52.757 26.626  1.00 83.73  ? 206  LEU A CG  1 
ATOM   1141 C CD1 . LEU A 1 162 ? -23.364 51.292 26.941  1.00 82.92  ? 206  LEU A CD1 1 
ATOM   1142 C CD2 . LEU A 1 162 ? -22.906 52.959 25.140  1.00 85.09  ? 206  LEU A CD2 1 
ATOM   1143 N N   . TRP A 1 163 ? -23.046 53.282 30.333  1.00 94.22  ? 207  TRP A N   1 
ATOM   1144 C CA  . TRP A 1 163 ? -21.943 53.699 31.184  1.00 93.98  ? 207  TRP A CA  1 
ATOM   1145 C C   . TRP A 1 163 ? -20.671 52.981 30.758  1.00 93.32  ? 207  TRP A C   1 
ATOM   1146 O O   . TRP A 1 163 ? -20.713 51.830 30.325  1.00 92.73  ? 207  TRP A O   1 
ATOM   1147 C CB  . TRP A 1 163 ? -22.256 53.411 32.654  1.00 94.21  ? 207  TRP A CB  1 
ATOM   1148 C CG  . TRP A 1 163 ? -23.362 54.253 33.216  1.00 95.43  ? 207  TRP A CG  1 
ATOM   1149 C CD1 . TRP A 1 163 ? -24.713 54.076 33.046  1.00 96.27  ? 207  TRP A CD1 1 
ATOM   1150 C CD2 . TRP A 1 163 ? -23.213 55.406 34.049  1.00 96.29  ? 207  TRP A CD2 1 
ATOM   1151 N NE1 . TRP A 1 163 ? -25.411 55.057 33.721  1.00 97.53  ? 207  TRP A NE1 1 
ATOM   1152 C CE2 . TRP A 1 163 ? -24.512 55.884 34.346  1.00 97.48  ? 207  TRP A CE2 1 
ATOM   1153 C CE3 . TRP A 1 163 ? -22.107 56.082 34.576  1.00 96.44  ? 207  TRP A CE3 1 
ATOM   1154 C CZ2 . TRP A 1 163 ? -24.730 57.000 35.141  1.00 98.61  ? 207  TRP A CZ2 1 
ATOM   1155 C CZ3 . TRP A 1 163 ? -22.327 57.192 35.363  1.00 97.65  ? 207  TRP A CZ3 1 
ATOM   1156 C CH2 . TRP A 1 163 ? -23.629 57.639 35.642  1.00 98.63  ? 207  TRP A CH2 1 
ATOM   1157 N N   . VAL A 1 164 ? -19.539 53.662 30.870  1.00 95.10  ? 208  VAL A N   1 
ATOM   1158 C CA  . VAL A 1 164 ? -18.268 53.091 30.442  1.00 95.16  ? 208  VAL A CA  1 
ATOM   1159 C C   . VAL A 1 164 ? -17.212 53.338 31.511  1.00 95.27  ? 208  VAL A C   1 
ATOM   1160 O O   . VAL A 1 164 ? -17.295 54.315 32.238  1.00 95.80  ? 208  VAL A O   1 
ATOM   1161 C CB  . VAL A 1 164 ? -17.816 53.687 29.078  1.00 96.68  ? 208  VAL A CB  1 
ATOM   1162 C CG1 . VAL A 1 164 ? -16.459 53.161 28.668  1.00 97.64  ? 208  VAL A CG1 1 
ATOM   1163 C CG2 . VAL A 1 164 ? -18.830 53.364 27.992  1.00 96.89  ? 208  VAL A CG2 1 
ATOM   1164 N N   . SER A 1 165 ? -16.241 52.438 31.625  1.00 89.87  ? 209  SER A N   1 
ATOM   1165 C CA  . SER A 1 165 ? -15.143 52.591 32.576  1.00 90.33  ? 209  SER A CA  1 
ATOM   1166 C C   . SER A 1 165 ? -13.795 52.205 31.965  1.00 91.26  ? 209  SER A C   1 
ATOM   1167 O O   . SER A 1 165 ? -13.659 51.104 31.421  1.00 90.87  ? 209  SER A O   1 
ATOM   1168 C CB  . SER A 1 165 ? -15.403 51.743 33.821  1.00 89.39  ? 209  SER A CB  1 
ATOM   1169 O OG  . SER A 1 165 ? -14.201 51.528 34.546  1.00 89.86  ? 209  SER A OG  1 
ATOM   1170 N N   . LYS A 1 166 ? -12.816 53.113 32.033  1.00 102.01 ? 210  LYS A N   1 
ATOM   1171 C CA  . LYS A 1 166 ? -11.451 52.834 31.576  1.00 103.53 ? 210  LYS A CA  1 
ATOM   1172 C C   . LYS A 1 166 ? -10.599 52.143 32.649  1.00 103.32 ? 210  LYS A C   1 
ATOM   1173 O O   . LYS A 1 166 ? -9.626  51.464 32.341  1.00 104.20 ? 210  LYS A O   1 
ATOM   1174 C CB  . LYS A 1 166 ? -10.768 54.131 31.125  1.00 105.75 ? 210  LYS A CB  1 
ATOM   1175 C CG  . LYS A 1 166 ? -9.351  53.929 30.583  1.00 108.16 ? 210  LYS A CG  1 
ATOM   1176 C CD  . LYS A 1 166 ? -8.479  55.200 30.527  1.00 110.62 ? 210  LYS A CD  1 
ATOM   1177 C CE  . LYS A 1 166 ? -6.983  54.842 30.487  1.00 113.04 ? 210  LYS A CE  1 
ATOM   1178 N NZ  . LYS A 1 166 ? -6.765  53.389 30.179  1.00 111.04 ? 210  LYS A NZ  1 
ATOM   1179 N N   . ASN A 1 167 ? -10.984 52.318 33.909  1.00 106.44 ? 211  ASN A N   1 
ATOM   1180 C CA  . ASN A 1 167 ? -10.188 51.870 35.056  1.00 106.78 ? 211  ASN A CA  1 
ATOM   1181 C C   . ASN A 1 167 ? -10.579 50.528 35.689  1.00 105.13 ? 211  ASN A C   1 
ATOM   1182 O O   . ASN A 1 167 ? -10.208 50.260 36.831  1.00 105.48 ? 211  ASN A O   1 
ATOM   1183 C CB  . ASN A 1 167 ? -10.158 52.955 36.128  1.00 107.92 ? 211  ASN A CB  1 
ATOM   1184 C CG  . ASN A 1 167 ? -11.493 53.183 36.765  1.00 106.87 ? 211  ASN A CG  1 
ATOM   1185 O OD1 . ASN A 1 167 ? -12.526 52.730 36.267  1.00 105.36 ? 211  ASN A OD1 1 
ATOM   1186 N ND2 . ASN A 1 167 ? -11.486 53.903 37.880  1.00 108.95 ? 211  ASN A ND2 1 
ATOM   1187 N N   . PHE A 1 168 ? -11.383 49.738 34.981  1.00 98.51  ? 212  PHE A N   1 
ATOM   1188 C CA  . PHE A 1 168 ? -11.880 48.435 35.453  1.00 97.00  ? 212  PHE A CA  1 
ATOM   1189 C C   . PHE A 1 168 ? -12.884 48.613 36.593  1.00 96.72  ? 212  PHE A C   1 
ATOM   1190 O O   . PHE A 1 168 ? -12.861 47.910 37.596  1.00 96.76  ? 212  PHE A O   1 
ATOM   1191 C CB  . PHE A 1 168 ? -10.703 47.517 35.864  1.00 97.42  ? 212  PHE A CB  1 
ATOM   1192 C CG  . PHE A 1 168 ? -11.119 46.180 36.431  1.00 96.15  ? 212  PHE A CG  1 
ATOM   1193 C CD1 . PHE A 1 168 ? -11.997 45.353 35.740  1.00 94.73  ? 212  PHE A CD1 1 
ATOM   1194 C CD2 . PHE A 1 168 ? -10.629 45.755 37.659  1.00 96.78  ? 212  PHE A CD2 1 
ATOM   1195 C CE1 . PHE A 1 168 ? -12.382 44.127 36.264  1.00 93.86  ? 212  PHE A CE1 1 
ATOM   1196 C CE2 . PHE A 1 168 ? -11.004 44.539 38.194  1.00 96.07  ? 212  PHE A CE2 1 
ATOM   1197 C CZ  . PHE A 1 168 ? -11.884 43.719 37.498  1.00 94.59  ? 212  PHE A CZ  1 
ATOM   1198 N N   . GLY A 1 169 ? -13.789 49.565 36.408  1.00 112.23 ? 213  GLY A N   1 
ATOM   1199 C CA  . GLY A 1 169 ? -14.978 49.650 37.232  1.00 112.41 ? 213  GLY A CA  1 
ATOM   1200 C C   . GLY A 1 169 ? -14.889 50.535 38.458  1.00 114.10 ? 213  GLY A C   1 
ATOM   1201 O O   . GLY A 1 169 ? -15.827 50.586 39.252  1.00 114.90 ? 213  GLY A O   1 
ATOM   1202 N N   . GLY A 1 170 ? -13.768 51.224 38.633  1.00 97.48  ? 214  GLY A N   1 
ATOM   1203 C CA  . GLY A 1 170 ? -13.638 52.137 39.746  1.00 99.38  ? 214  GLY A CA  1 
ATOM   1204 C C   . GLY A 1 170 ? -14.451 53.394 39.509  1.00 99.94  ? 214  GLY A C   1 
ATOM   1205 O O   . GLY A 1 170 ? -15.226 53.823 40.370  1.00 101.24 ? 214  GLY A O   1 
ATOM   1206 N N   . LYS A 1 171 ? -14.272 53.975 38.325  1.00 115.90 ? 215  LYS A N   1 
ATOM   1207 C CA  . LYS A 1 171 ? -14.955 55.199 37.928  1.00 116.57 ? 215  LYS A CA  1 
ATOM   1208 C C   . LYS A 1 171 ? -15.736 54.948 36.649  1.00 115.11 ? 215  LYS A C   1 
ATOM   1209 O O   . LYS A 1 171 ? -15.230 54.324 35.722  1.00 114.37 ? 215  LYS A O   1 
ATOM   1210 C CB  . LYS A 1 171 ? -13.958 56.342 37.718  1.00 120.09 ? 215  LYS A CB  1 
ATOM   1211 C CG  . LYS A 1 171 ? -14.614 57.707 37.531  1.00 122.75 ? 215  LYS A CG  1 
ATOM   1212 C CD  . LYS A 1 171 ? -13.768 58.657 36.679  1.00 125.79 ? 215  LYS A CD  1 
ATOM   1213 C CE  . LYS A 1 171 ? -14.312 58.766 35.249  1.00 123.97 ? 215  LYS A CE  1 
ATOM   1214 N NZ  . LYS A 1 171 ? -13.655 59.873 34.485  1.00 128.21 ? 215  LYS A NZ  1 
ATOM   1215 N N   . TRP A 1 172 ? -16.971 55.435 36.603  1.00 106.93 ? 216  TRP A N   1 
ATOM   1216 C CA  . TRP A 1 172 ? -17.833 55.236 35.447  1.00 105.99 ? 216  TRP A CA  1 
ATOM   1217 C C   . TRP A 1 172 ? -18.287 56.567 34.878  1.00 106.77 ? 216  TRP A C   1 
ATOM   1218 O O   . TRP A 1 172 ? -18.343 57.568 35.590  1.00 107.88 ? 216  TRP A O   1 
ATOM   1219 C CB  . TRP A 1 172 ? -19.048 54.391 35.827  1.00 105.56 ? 216  TRP A CB  1 
ATOM   1220 C CG  . TRP A 1 172 ? -18.705 52.995 36.222  1.00 104.86 ? 216  TRP A CG  1 
ATOM   1221 C CD1 . TRP A 1 172 ? -18.277 52.574 37.443  1.00 105.55 ? 216  TRP A CD1 1 
ATOM   1222 C CD2 . TRP A 1 172 ? -18.765 51.829 35.393  1.00 103.56 ? 216  TRP A CD2 1 
ATOM   1223 N NE1 . TRP A 1 172 ? -18.060 51.218 37.428  1.00 104.66 ? 216  TRP A NE1 1 
ATOM   1224 C CE2 . TRP A 1 172 ? -18.357 50.735 36.181  1.00 103.36 ? 216  TRP A CE2 1 
ATOM   1225 C CE3 . TRP A 1 172 ? -19.126 51.605 34.064  1.00 102.83 ? 216  TRP A CE3 1 
ATOM   1226 C CZ2 . TRP A 1 172 ? -18.296 49.437 35.686  1.00 102.22 ? 216  TRP A CZ2 1 
ATOM   1227 C CZ3 . TRP A 1 172 ? -19.066 50.313 33.571  1.00 101.87 ? 216  TRP A CZ3 1 
ATOM   1228 C CH2 . TRP A 1 172 ? -18.652 49.245 34.381  1.00 101.45 ? 216  TRP A CH2 1 
ATOM   1229 N N   . GLU A 1 173 ? -18.607 56.592 33.594  1.00 139.55 ? 217  GLU A N   1 
ATOM   1230 C CA  . GLU A 1 173 ? -19.201 57.787 33.033  1.00 140.27 ? 217  GLU A CA  1 
ATOM   1231 C C   . GLU A 1 173 ? -20.259 57.418 32.022  1.00 139.74 ? 217  GLU A C   1 
ATOM   1232 O O   . GLU A 1 173 ? -20.101 56.470 31.255  1.00 139.13 ? 217  GLU A O   1 
ATOM   1233 C CB  . GLU A 1 173 ? -18.138 58.691 32.403  1.00 141.55 ? 217  GLU A CB  1 
ATOM   1234 C CG  . GLU A 1 173 ? -18.693 60.027 31.898  1.00 143.11 ? 217  GLU A CG  1 
ATOM   1235 C CD  . GLU A 1 173 ? -19.306 60.892 33.011  1.00 145.76 ? 217  GLU A CD  1 
ATOM   1236 O OE1 . GLU A 1 173 ? -19.068 60.611 34.210  1.00 146.62 ? 217  GLU A OE1 1 
ATOM   1237 O OE2 . GLU A 1 173 ? -20.044 61.851 32.678  1.00 147.38 ? 217  GLU A OE2 1 
ATOM   1238 N N   . GLU A 1 174 ? -21.335 58.193 32.016  1.00 108.12 ? 218  GLU A N   1 
ATOM   1239 C CA  . GLU A 1 174 ? -22.473 57.893 31.173  1.00 107.99 ? 218  GLU A CA  1 
ATOM   1240 C C   . GLU A 1 174 ? -22.245 58.580 29.830  1.00 108.59 ? 218  GLU A C   1 
ATOM   1241 O O   . GLU A 1 174 ? -22.294 59.807 29.732  1.00 109.52 ? 218  GLU A O   1 
ATOM   1242 C CB  . GLU A 1 174 ? -23.772 58.370 31.840  1.00 108.66 ? 218  GLU A CB  1 
ATOM   1243 C CG  . GLU A 1 174 ? -25.046 57.864 31.185  1.00 108.68 ? 218  GLU A CG  1 
ATOM   1244 C CD  . GLU A 1 174 ? -26.315 58.461 31.786  1.00 109.75 ? 218  GLU A CD  1 
ATOM   1245 O OE1 . GLU A 1 174 ? -26.237 59.508 32.472  1.00 110.39 ? 218  GLU A OE1 1 
ATOM   1246 O OE2 . GLU A 1 174 ? -27.403 57.884 31.565  1.00 110.22 ? 218  GLU A OE2 1 
ATOM   1247 N N   . ILE A 1 175 ? -21.972 57.785 28.799  1.00 100.05 ? 219  ILE A N   1 
ATOM   1248 C CA  . ILE A 1 175 ? -21.593 58.355 27.520  1.00 101.11 ? 219  ILE A CA  1 
ATOM   1249 C C   . ILE A 1 175 ? -22.749 58.572 26.534  1.00 101.59 ? 219  ILE A C   1 
ATOM   1250 O O   . ILE A 1 175 ? -22.586 59.299 25.560  1.00 102.76 ? 219  ILE A O   1 
ATOM   1251 C CB  . ILE A 1 175 ? -20.515 57.490 26.842  1.00 101.39 ? 219  ILE A CB  1 
ATOM   1252 C CG1 . ILE A 1 175 ? -21.090 56.156 26.356  1.00 100.77 ? 219  ILE A CG1 1 
ATOM   1253 C CG2 . ILE A 1 175 ? -19.342 57.273 27.792  1.00 101.04 ? 219  ILE A CG2 1 
ATOM   1254 C CD1 . ILE A 1 175 ? -20.174 55.431 25.396  1.00 101.73 ? 219  ILE A CD1 1 
ATOM   1255 N N   . HIS A 1 176 ? -23.909 57.970 26.780  1.00 98.30  ? 220  HIS A N   1 
ATOM   1256 C CA  . HIS A 1 176 ? -25.101 58.237 25.969  1.00 98.88  ? 220  HIS A CA  1 
ATOM   1257 C C   . HIS A 1 176 ? -26.299 57.800 26.793  1.00 98.54  ? 220  HIS A C   1 
ATOM   1258 O O   . HIS A 1 176 ? -26.154 56.974 27.700  1.00 97.91  ? 220  HIS A O   1 
ATOM   1259 C CB  . HIS A 1 176 ? -25.052 57.491 24.623  1.00 99.38  ? 220  HIS A CB  1 
ATOM   1260 C CG  . HIS A 1 176 ? -25.717 58.213 23.483  1.00 100.51 ? 220  HIS A CG  1 
ATOM   1261 N ND1 . HIS A 1 176 ? -27.088 58.282 23.338  1.00 100.72 ? 220  HIS A ND1 1 
ATOM   1262 C CD2 . HIS A 1 176 ? -25.195 58.865 22.414  1.00 101.79 ? 220  HIS A CD2 1 
ATOM   1263 C CE1 . HIS A 1 176 ? -27.380 58.966 22.244  1.00 101.74 ? 220  HIS A CE1 1 
ATOM   1264 N NE2 . HIS A 1 176 ? -26.249 59.332 21.665  1.00 102.45 ? 220  HIS A NE2 1 
ATOM   1265 N N   . LYS A 1 177 ? -27.480 58.330 26.488  1.00 101.13 ? 221  LYS A N   1 
ATOM   1266 C CA  . LYS A 1 177 ? -28.687 57.860 27.159  1.00 101.58 ? 221  LYS A CA  1 
ATOM   1267 C C   . LYS A 1 177 ? -29.640 57.217 26.164  1.00 102.04 ? 221  LYS A C   1 
ATOM   1268 O O   . LYS A 1 177 ? -29.397 57.233 24.954  1.00 101.93 ? 221  LYS A O   1 
ATOM   1269 C CB  . LYS A 1 177 ? -29.380 59.006 27.892  1.00 102.45 ? 221  LYS A CB  1 
ATOM   1270 C CG  . LYS A 1 177 ? -28.416 60.003 28.501  1.00 101.88 ? 221  LYS A CG  1 
ATOM   1271 C CD  . LYS A 1 177 ? -29.136 61.135 29.214  1.00 102.98 ? 221  LYS A CD  1 
ATOM   1272 C CE  . LYS A 1 177 ? -29.205 60.886 30.711  1.00 102.20 ? 221  LYS A CE  1 
ATOM   1273 N NZ  . LYS A 1 177 ? -29.615 62.105 31.458  1.00 104.11 ? 221  LYS A NZ  1 
ATOM   1274 N N   . ALA A 1 178 ? -30.732 56.668 26.685  1.00 90.35  ? 222  ALA A N   1 
ATOM   1275 C CA  . ALA A 1 178 ? -31.695 55.912 25.887  1.00 91.31  ? 222  ALA A CA  1 
ATOM   1276 C C   . ALA A 1 178 ? -31.045 54.839 24.993  1.00 90.74  ? 222  ALA A C   1 
ATOM   1277 O O   . ALA A 1 178 ? -31.335 54.773 23.797  1.00 91.14  ? 222  ALA A O   1 
ATOM   1278 C CB  . ALA A 1 178 ? -32.530 56.866 25.038  1.00 91.97  ? 222  ALA A CB  1 
ATOM   1279 N N   . VAL A 1 179 ? -30.180 54.004 25.567  1.00 84.77  ? 223  VAL A N   1 
ATOM   1280 C CA  . VAL A 1 179 ? -29.514 52.948 24.809  1.00 84.22  ? 223  VAL A CA  1 
ATOM   1281 C C   . VAL A 1 179 ? -30.217 51.615 25.006  1.00 85.23  ? 223  VAL A C   1 
ATOM   1282 O O   . VAL A 1 179 ? -30.467 51.207 26.143  1.00 85.76  ? 223  VAL A O   1 
ATOM   1283 C CB  . VAL A 1 179 ? -28.040 52.806 25.216  1.00 82.71  ? 223  VAL A CB  1 
ATOM   1284 C CG1 . VAL A 1 179 ? -27.415 51.597 24.557  1.00 82.36  ? 223  VAL A CG1 1 
ATOM   1285 C CG2 . VAL A 1 179 ? -27.282 54.044 24.839  1.00 82.50  ? 223  VAL A CG2 1 
ATOM   1286 N N   . CYS A 1 180 ? -30.563 50.957 23.901  1.00 90.98  ? 224  CYS A N   1 
ATOM   1287 C CA  . CYS A 1 180 ? -31.200 49.640 23.939  1.00 92.37  ? 224  CYS A CA  1 
ATOM   1288 C C   . CYS A 1 180 ? -30.244 48.485 24.156  1.00 91.24  ? 224  CYS A C   1 
ATOM   1289 O O   . CYS A 1 180 ? -30.469 47.616 24.992  1.00 91.97  ? 224  CYS A O   1 
ATOM   1290 C CB  . CYS A 1 180 ? -31.953 49.386 22.636  1.00 93.65  ? 224  CYS A CB  1 
ATOM   1291 S SG  . CYS A 1 180 ? -33.582 50.122 22.574  1.00 96.11  ? 224  CYS A SG  1 
ATOM   1292 N N   . LEU A 1 181 ? -29.187 48.474 23.358  1.00 94.50  ? 225  LEU A N   1 
ATOM   1293 C CA  . LEU A 1 181 ? -28.270 47.352 23.283  1.00 93.53  ? 225  LEU A CA  1 
ATOM   1294 C C   . LEU A 1 181 ? -26.901 47.911 22.951  1.00 92.35  ? 225  LEU A C   1 
ATOM   1295 O O   . LEU A 1 181 ? -26.801 48.817 22.143  1.00 92.85  ? 225  LEU A O   1 
ATOM   1296 C CB  . LEU A 1 181 ? -28.744 46.359 22.224  1.00 94.50  ? 225  LEU A CB  1 
ATOM   1297 C CG  . LEU A 1 181 ? -27.871 45.141 21.948  1.00 93.61  ? 225  LEU A CG  1 
ATOM   1298 C CD1 . LEU A 1 181 ? -27.694 44.309 23.201  1.00 93.01  ? 225  LEU A CD1 1 
ATOM   1299 C CD2 . LEU A 1 181 ? -28.458 44.308 20.813  1.00 94.42  ? 225  LEU A CD2 1 
ATOM   1300 N N   . ALA A 1 182 ? -25.850 47.392 23.566  1.00 75.51  ? 226  ALA A N   1 
ATOM   1301 C CA  . ALA A 1 182 ? -24.513 47.920 23.317  1.00 74.98  ? 226  ALA A CA  1 
ATOM   1302 C C   . ALA A 1 182 ? -23.494 46.792 23.231  1.00 74.78  ? 226  ALA A C   1 
ATOM   1303 O O   . ALA A 1 182 ? -23.503 45.866 24.045  1.00 74.11  ? 226  ALA A O   1 
ATOM   1304 C CB  . ALA A 1 182 ? -24.121 48.900 24.399  1.00 74.67  ? 226  ALA A CB  1 
ATOM   1305 N N   . LYS A 1 183 ? -22.612 46.859 22.245  1.00 80.86  ? 227  LYS A N   1 
ATOM   1306 C CA  . LYS A 1 183 ? -21.646 45.785 22.063  1.00 81.75  ? 227  LYS A CA  1 
ATOM   1307 C C   . LYS A 1 183 ? -20.242 46.296 21.803  1.00 83.72  ? 227  LYS A C   1 
ATOM   1308 O O   . LYS A 1 183 ? -20.035 47.302 21.120  1.00 84.62  ? 227  LYS A O   1 
ATOM   1309 C CB  . LYS A 1 183 ? -22.079 44.872 20.918  1.00 82.63  ? 227  LYS A CB  1 
ATOM   1310 C CG  . LYS A 1 183 ? -23.206 43.955 21.278  1.00 81.33  ? 227  LYS A CG  1 
ATOM   1311 C CD  . LYS A 1 183 ? -23.825 43.307 20.063  1.00 82.76  ? 227  LYS A CD  1 
ATOM   1312 C CE  . LYS A 1 183 ? -25.070 42.538 20.489  1.00 82.12  ? 227  LYS A CE  1 
ATOM   1313 N NZ  . LYS A 1 183 ? -25.847 41.979 19.337  1.00 84.26  ? 227  LYS A NZ  1 
ATOM   1314 N N   . TRP A 1 184 ? -19.276 45.582 22.364  1.00 76.16  ? 228  TRP A N   1 
ATOM   1315 C CA  . TRP A 1 184 ? -17.875 45.841 22.082  1.00 78.94  ? 228  TRP A CA  1 
ATOM   1316 C C   . TRP A 1 184 ? -17.511 45.308 20.719  1.00 81.72  ? 228  TRP A C   1 
ATOM   1317 O O   . TRP A 1 184 ? -17.669 44.124 20.444  1.00 82.39  ? 228  TRP A O   1 
ATOM   1318 C CB  . TRP A 1 184 ? -16.974 45.187 23.120  1.00 79.51  ? 228  TRP A CB  1 
ATOM   1319 C CG  . TRP A 1 184 ? -16.834 45.926 24.382  1.00 78.25  ? 228  TRP A CG  1 
ATOM   1320 C CD1 . TRP A 1 184 ? -17.251 45.518 25.609  1.00 76.38  ? 228  TRP A CD1 1 
ATOM   1321 C CD2 . TRP A 1 184 ? -16.200 47.196 24.571  1.00 79.09  ? 228  TRP A CD2 1 
ATOM   1322 N NE1 . TRP A 1 184 ? -16.929 46.456 26.556  1.00 76.20  ? 228  TRP A NE1 1 
ATOM   1323 C CE2 . TRP A 1 184 ? -16.281 47.500 25.947  1.00 77.74  ? 228  TRP A CE2 1 
ATOM   1324 C CE3 . TRP A 1 184 ? -15.559 48.101 23.716  1.00 80.96  ? 228  TRP A CE3 1 
ATOM   1325 C CZ2 . TRP A 1 184 ? -15.757 48.684 26.489  1.00 78.19  ? 228  TRP A CZ2 1 
ATOM   1326 C CZ3 . TRP A 1 184 ? -15.040 49.275 24.252  1.00 81.17  ? 228  TRP A CZ3 1 
ATOM   1327 C CH2 . TRP A 1 184 ? -15.145 49.557 25.623  1.00 79.81  ? 228  TRP A CH2 1 
ATOM   1328 N N   . GLY A 1 185 ? -17.004 46.184 19.869  1.00 87.61  ? 229  GLY A N   1 
ATOM   1329 C CA  . GLY A 1 185 ? -16.426 45.749 18.618  1.00 88.93  ? 229  GLY A CA  1 
ATOM   1330 C C   . GLY A 1 185 ? -14.965 45.408 18.830  1.00 93.20  ? 229  GLY A C   1 
ATOM   1331 O O   . GLY A 1 185 ? -14.513 45.200 19.962  1.00 94.82  ? 229  GLY A O   1 
ATOM   1332 N N   . SER A 1 186 ? -14.224 45.326 17.733  1.00 94.62  ? 230  SER A N   1 
ATOM   1333 C CA  . SER A 1 186 ? -12.776 45.232 17.808  1.00 98.44  ? 230  SER A CA  1 
ATOM   1334 C C   . SER A 1 186 ? -12.198 46.629 18.037  1.00 99.41  ? 230  SER A C   1 
ATOM   1335 O O   . SER A 1 186 ? -12.832 47.630 17.698  1.00 97.31  ? 230  SER A O   1 
ATOM   1336 C CB  . SER A 1 186 ? -12.208 44.601 16.539  1.00 99.60  ? 230  SER A CB  1 
ATOM   1337 O OG  . SER A 1 186 ? -12.804 45.169 15.387  1.00 98.77  ? 230  SER A OG  1 
ATOM   1338 N N   . ASP A 1 187 ? -11.013 46.683 18.635  1.00 118.45 ? 231  ASP A N   1 
ATOM   1339 C CA  . ASP A 1 187 ? -10.323 47.943 18.908  1.00 119.86 ? 231  ASP A CA  1 
ATOM   1340 C C   . ASP A 1 187 ? -11.151 48.900 19.750  1.00 118.03 ? 231  ASP A C   1 
ATOM   1341 O O   . ASP A 1 187 ? -11.270 50.073 19.411  1.00 117.22 ? 231  ASP A O   1 
ATOM   1342 C CB  . ASP A 1 187 ? -9.929  48.640 17.601  1.00 119.89 ? 231  ASP A CB  1 
ATOM   1343 C CG  . ASP A 1 187 ? -9.061  47.771 16.702  1.00 121.06 ? 231  ASP A CG  1 
ATOM   1344 O OD1 . ASP A 1 187 ? -8.098  47.161 17.217  1.00 121.83 ? 231  ASP A OD1 1 
ATOM   1345 O OD2 . ASP A 1 187 ? -9.340  47.698 15.480  1.00 120.98 ? 231  ASP A OD2 1 
ATOM   1346 N N   . ASN A 1 188 ? -11.735 48.386 20.829  1.00 102.30 ? 232  ASN A N   1 
ATOM   1347 C CA  . ASN A 1 188 ? -12.468 49.194 21.811  1.00 100.76 ? 232  ASN A CA  1 
ATOM   1348 C C   . ASN A 1 188 ? -13.542 50.096 21.190  1.00 97.40  ? 232  ASN A C   1 
ATOM   1349 O O   . ASN A 1 188 ? -13.832 51.191 21.690  1.00 96.87  ? 232  ASN A O   1 
ATOM   1350 C CB  . ASN A 1 188 ? -11.489 50.037 22.632  1.00 103.74 ? 232  ASN A CB  1 
ATOM   1351 C CG  . ASN A 1 188 ? -10.402 49.198 23.292  1.00 107.18 ? 232  ASN A CG  1 
ATOM   1352 O OD1 . ASN A 1 188 ? -10.582 48.008 23.547  1.00 106.98 ? 232  ASN A OD1 1 
ATOM   1353 N ND2 . ASN A 1 188 ? -9.262  49.822 23.565  1.00 110.31 ? 232  ASN A ND2 1 
ATOM   1354 N N   . THR A 1 189 ? -14.119 49.621 20.092  1.00 95.66  ? 233  THR A N   1 
ATOM   1355 C CA  . THR A 1 189 ? -15.244 50.283 19.456  1.00 92.32  ? 233  THR A CA  1 
ATOM   1356 C C   . THR A 1 189 ? -16.523 49.821 20.128  1.00 89.56  ? 233  THR A C   1 
ATOM   1357 O O   . THR A 1 189 ? -16.673 48.645 20.439  1.00 89.40  ? 233  THR A O   1 
ATOM   1358 C CB  . THR A 1 189 ? -15.315 49.963 17.950  1.00 91.57  ? 233  THR A CB  1 
ATOM   1359 O OG1 . THR A 1 189 ? -14.105 50.376 17.313  1.00 94.06  ? 233  THR A OG1 1 
ATOM   1360 C CG2 . THR A 1 189 ? -16.482 50.679 17.298  1.00 88.49  ? 233  THR A CG2 1 
ATOM   1361 N N   . ILE A 1 190 ? -17.445 50.741 20.356  1.00 91.18  ? 234  ILE A N   1 
ATOM   1362 C CA  . ILE A 1 190 ? -18.735 50.368 20.909  1.00 88.87  ? 234  ILE A CA  1 
ATOM   1363 C C   . ILE A 1 190 ? -19.823 50.610 19.868  1.00 86.22  ? 234  ILE A C   1 
ATOM   1364 O O   . ILE A 1 190 ? -19.908 51.700 19.301  1.00 86.11  ? 234  ILE A O   1 
ATOM   1365 C CB  . ILE A 1 190 ? -19.040 51.165 22.199  1.00 89.63  ? 234  ILE A CB  1 
ATOM   1366 C CG1 . ILE A 1 190 ? -17.915 50.969 23.212  1.00 92.71  ? 234  ILE A CG1 1 
ATOM   1367 C CG2 . ILE A 1 190 ? -20.369 50.752 22.798  1.00 88.04  ? 234  ILE A CG2 1 
ATOM   1368 C CD1 . ILE A 1 190 ? -18.039 51.843 24.417  1.00 94.05  ? 234  ILE A CD1 1 
ATOM   1369 N N   . PHE A 1 191 ? -20.631 49.592 19.591  1.00 83.24  ? 235  PHE A N   1 
ATOM   1370 C CA  . PHE A 1 191 ? -21.841 49.785 18.786  1.00 81.24  ? 235  PHE A CA  1 
ATOM   1371 C C   . PHE A 1 191 ? -23.055 49.726 19.698  1.00 80.70  ? 235  PHE A C   1 
ATOM   1372 O O   . PHE A 1 191 ? -23.158 48.826 20.535  1.00 80.87  ? 235  PHE A O   1 
ATOM   1373 C CB  . PHE A 1 191 ? -21.966 48.729 17.679  1.00 80.31  ? 235  PHE A CB  1 
ATOM   1374 C CG  . PHE A 1 191 ? -20.813 48.714 16.721  1.00 81.72  ? 235  PHE A CG  1 
ATOM   1375 C CD1 . PHE A 1 191 ? -20.683 49.697 15.754  1.00 81.93  ? 235  PHE A CD1 1 
ATOM   1376 C CD2 . PHE A 1 191 ? -19.860 47.712 16.779  1.00 83.38  ? 235  PHE A CD2 1 
ATOM   1377 C CE1 . PHE A 1 191 ? -19.618 49.685 14.870  1.00 83.69  ? 235  PHE A CE1 1 
ATOM   1378 C CE2 . PHE A 1 191 ? -18.796 47.696 15.894  1.00 85.62  ? 235  PHE A CE2 1 
ATOM   1379 C CZ  . PHE A 1 191 ? -18.674 48.688 14.940  1.00 85.68  ? 235  PHE A CZ  1 
ATOM   1380 N N   . PHE A 1 192 ? -23.975 50.673 19.555  1.00 81.48  ? 236  PHE A N   1 
ATOM   1381 C CA  . PHE A 1 192 ? -25.190 50.592 20.360  1.00 82.13  ? 236  PHE A CA  1 
ATOM   1382 C C   . PHE A 1 192 ? -26.425 51.137 19.655  1.00 82.24  ? 236  PHE A C   1 
ATOM   1383 O O   . PHE A 1 192 ? -26.328 51.951 18.750  1.00 81.85  ? 236  PHE A O   1 
ATOM   1384 C CB  . PHE A 1 192 ? -24.998 51.313 21.704  1.00 83.98  ? 236  PHE A CB  1 
ATOM   1385 C CG  . PHE A 1 192 ? -24.756 52.778 21.576  1.00 84.59  ? 236  PHE A CG  1 
ATOM   1386 C CD1 . PHE A 1 192 ? -23.474 53.262 21.428  1.00 85.18  ? 236  PHE A CD1 1 
ATOM   1387 C CD2 . PHE A 1 192 ? -25.810 53.676 21.611  1.00 86.25  ? 236  PHE A CD2 1 
ATOM   1388 C CE1 . PHE A 1 192 ? -23.250 54.613 21.304  1.00 88.72  ? 236  PHE A CE1 1 
ATOM   1389 C CE2 . PHE A 1 192 ? -25.589 55.026 21.493  1.00 89.69  ? 236  PHE A CE2 1 
ATOM   1390 C CZ  . PHE A 1 192 ? -24.314 55.497 21.342  1.00 90.92  ? 236  PHE A CZ  1 
ATOM   1391 N N   . THR A 1 193 ? -27.590 50.673 20.086  1.00 81.67  ? 237  THR A N   1 
ATOM   1392 C CA  . THR A 1 193 ? -28.840 51.195 19.574  1.00 82.87  ? 237  THR A CA  1 
ATOM   1393 C C   . THR A 1 193 ? -29.466 52.175 20.559  1.00 85.68  ? 237  THR A C   1 
ATOM   1394 O O   . THR A 1 193 ? -29.375 51.995 21.775  1.00 86.62  ? 237  THR A O   1 
ATOM   1395 C CB  . THR A 1 193 ? -29.817 50.077 19.292  1.00 83.39  ? 237  THR A CB  1 
ATOM   1396 O OG1 . THR A 1 193 ? -29.631 49.051 20.267  1.00 83.83  ? 237  THR A OG1 1 
ATOM   1397 C CG2 . THR A 1 193 ? -29.544 49.498 17.929  1.00 81.82  ? 237  THR A CG2 1 
ATOM   1398 N N   . THR A 1 194 ? -30.096 53.218 20.029  1.00 93.47  ? 238  THR A N   1 
ATOM   1399 C CA  . THR A 1 194 ? -30.825 54.159 20.859  1.00 95.41  ? 238  THR A CA  1 
ATOM   1400 C C   . THR A 1 194 ? -32.262 54.227 20.405  1.00 96.46  ? 238  THR A C   1 
ATOM   1401 O O   . THR A 1 194 ? -32.613 53.701 19.351  1.00 95.65  ? 238  THR A O   1 
ATOM   1402 C CB  . THR A 1 194 ? -30.227 55.575 20.829  1.00 95.14  ? 238  THR A CB  1 
ATOM   1403 O OG1 . THR A 1 194 ? -30.128 56.041 19.477  1.00 94.01  ? 238  THR A OG1 1 
ATOM   1404 C CG2 . THR A 1 194 ? -28.867 55.581 21.466  1.00 94.62  ? 238  THR A CG2 1 
ATOM   1405 N N   . TYR A 1 195 ? -33.105 54.839 21.225  1.00 106.84 ? 239  TYR A N   1 
ATOM   1406 C CA  . TYR A 1 195 ? -34.491 55.035 20.840  1.00 107.88 ? 239  TYR A CA  1 
ATOM   1407 C C   . TYR A 1 195 ? -34.915 56.484 21.039  1.00 108.85 ? 239  TYR A C   1 
ATOM   1408 O O   . TYR A 1 195 ? -34.430 57.169 21.936  1.00 109.51 ? 239  TYR A O   1 
ATOM   1409 C CB  . TYR A 1 195 ? -35.391 54.077 21.616  1.00 109.37 ? 239  TYR A CB  1 
ATOM   1410 C CG  . TYR A 1 195 ? -35.377 54.268 23.118  1.00 111.15 ? 239  TYR A CG  1 
ATOM   1411 C CD1 . TYR A 1 195 ? -34.421 53.642 23.915  1.00 111.02 ? 239  TYR A CD1 1 
ATOM   1412 C CD2 . TYR A 1 195 ? -36.337 55.046 23.744  1.00 113.11 ? 239  TYR A CD2 1 
ATOM   1413 C CE1 . TYR A 1 195 ? -34.416 53.813 25.293  1.00 112.87 ? 239  TYR A CE1 1 
ATOM   1414 C CE2 . TYR A 1 195 ? -36.338 55.218 25.107  1.00 114.85 ? 239  TYR A CE2 1 
ATOM   1415 C CZ  . TYR A 1 195 ? -35.378 54.604 25.881  1.00 114.75 ? 239  TYR A CZ  1 
ATOM   1416 O OH  . TYR A 1 195 ? -35.394 54.777 27.251  1.00 116.69 ? 239  TYR A OH  1 
ATOM   1417 N N   . ALA A 1 196 ? -35.798 56.962 20.170  1.00 154.20 ? 240  ALA A N   1 
ATOM   1418 C CA  . ALA A 1 196 ? -36.204 58.360 20.208  1.00 157.47 ? 240  ALA A CA  1 
ATOM   1419 C C   . ALA A 1 196 ? -37.110 58.685 21.398  1.00 160.96 ? 240  ALA A C   1 
ATOM   1420 O O   . ALA A 1 196 ? -36.791 59.548 22.218  1.00 163.32 ? 240  ALA A O   1 
ATOM   1421 C CB  . ALA A 1 196 ? -36.896 58.723 18.910  1.00 159.13 ? 240  ALA A CB  1 
ATOM   1422 N N   . ASN A 1 197 ? -38.230 57.978 21.495  1.00 154.69 ? 241  ASN A N   1 
ATOM   1423 C CA  . ASN A 1 197 ? -39.185 58.176 22.583  1.00 158.52 ? 241  ASN A CA  1 
ATOM   1424 C C   . ASN A 1 197 ? -40.032 56.930 22.768  1.00 157.69 ? 241  ASN A C   1 
ATOM   1425 O O   . ASN A 1 197 ? -40.077 56.064 21.893  1.00 154.84 ? 241  ASN A O   1 
ATOM   1426 C CB  . ASN A 1 197 ? -40.071 59.399 22.329  1.00 163.76 ? 241  ASN A CB  1 
ATOM   1427 C CG  . ASN A 1 197 ? -40.654 59.420 20.929  1.00 164.29 ? 241  ASN A CG  1 
ATOM   1428 O OD1 . ASN A 1 197 ? -40.835 58.376 20.300  1.00 161.66 ? 241  ASN A OD1 1 
ATOM   1429 N ND2 . ASN A 1 197 ? -40.948 60.618 20.431  1.00 168.02 ? 241  ASN A ND2 1 
ATOM   1430 N N   . GLY A 1 198 ? -40.716 56.844 23.900  1.00 165.15 ? 242  GLY A N   1 
ATOM   1431 C CA  . GLY A 1 198 ? -41.354 55.601 24.277  1.00 165.06 ? 242  GLY A CA  1 
ATOM   1432 C C   . GLY A 1 198 ? -40.317 54.640 24.822  1.00 162.60 ? 242  GLY A C   1 
ATOM   1433 O O   . GLY A 1 198 ? -39.456 55.029 25.611  1.00 162.30 ? 242  GLY A O   1 
ATOM   1434 N N   . SER A 1 199 ? -40.403 53.379 24.418  1.00 132.96 ? 243  SER A N   1 
ATOM   1435 C CA  . SER A 1 199 ? -39.515 52.363 24.950  1.00 131.97 ? 243  SER A CA  1 
ATOM   1436 C C   . SER A 1 199 ? -38.945 51.505 23.837  1.00 129.66 ? 243  SER A C   1 
ATOM   1437 O O   . SER A 1 199 ? -39.506 51.445 22.743  1.00 129.13 ? 243  SER A O   1 
ATOM   1438 C CB  . SER A 1 199 ? -40.255 51.487 25.955  1.00 134.31 ? 243  SER A CB  1 
ATOM   1439 O OG  . SER A 1 199 ? -41.014 50.498 25.286  1.00 134.43 ? 243  SER A OG  1 
ATOM   1440 N N   . CYS A 1 200 ? -37.844 50.823 24.139  1.00 148.25 ? 244  CYS A N   1 
ATOM   1441 C CA  . CYS A 1 200 ? -37.155 49.983 23.172  1.00 146.16 ? 244  CYS A CA  1 
ATOM   1442 C C   . CYS A 1 200 ? -38.113 49.047 22.448  1.00 146.41 ? 244  CYS A C   1 
ATOM   1443 O O   . CYS A 1 200 ? -37.941 48.767 21.263  1.00 145.04 ? 244  CYS A O   1 
ATOM   1444 C CB  . CYS A 1 200 ? -36.058 49.171 23.863  1.00 145.54 ? 244  CYS A CB  1 
ATOM   1445 S SG  . CYS A 1 200 ? -34.595 50.119 24.354  1.00 144.73 ? 244  CYS A SG  1 
ATOM   1446 N N   . LYS A 1 201 ? -39.132 48.580 23.160  1.00 137.98 ? 245  LYS A N   1 
ATOM   1447 C CA  . LYS A 1 201 ? -40.162 47.752 22.553  1.00 138.96 ? 245  LYS A CA  1 
ATOM   1448 C C   . LYS A 1 201 ? -41.080 48.579 21.650  1.00 139.72 ? 245  LYS A C   1 
ATOM   1449 O O   . LYS A 1 201 ? -41.484 48.118 20.586  1.00 139.41 ? 245  LYS A O   1 
ATOM   1450 C CB  . LYS A 1 201 ? -40.977 47.036 23.632  1.00 141.54 ? 245  LYS A CB  1 
ATOM   1451 C CG  . LYS A 1 201 ? -40.187 45.994 24.416  1.00 140.29 ? 245  LYS A CG  1 
ATOM   1452 C CD  . LYS A 1 201 ? -41.036 45.327 25.494  1.00 141.63 ? 245  LYS A CD  1 
ATOM   1453 C CE  . LYS A 1 201 ? -40.244 44.270 26.256  1.00 141.33 ? 245  LYS A CE  1 
ATOM   1454 N NZ  . LYS A 1 201 ? -41.058 43.627 27.330  1.00 143.95 ? 245  LYS A NZ  1 
ATOM   1455 N N   . ALA A 1 202 ? -41.396 49.801 22.065  1.00 137.42 ? 246  ALA A N   1 
ATOM   1456 C CA  . ALA A 1 202 ? -42.320 50.652 21.313  1.00 138.44 ? 246  ALA A CA  1 
ATOM   1457 C C   . ALA A 1 202 ? -41.693 51.200 20.034  1.00 136.28 ? 246  ALA A C   1 
ATOM   1458 O O   . ALA A 1 202 ? -42.317 51.221 18.975  1.00 136.39 ? 246  ALA A O   1 
ATOM   1459 C CB  . ALA A 1 202 ? -42.806 51.803 22.187  1.00 140.27 ? 246  ALA A CB  1 
ATOM   1460 N N   . ASP A 1 203 ? -40.441 51.621 20.166  1.00 147.07 ? 247  ASP A N   1 
ATOM   1461 C CA  . ASP A 1 203 ? -39.703 52.289 19.106  1.00 145.12 ? 247  ASP A CA  1 
ATOM   1462 C C   . ASP A 1 203 ? -38.979 51.267 18.247  1.00 143.22 ? 247  ASP A C   1 
ATOM   1463 O O   . ASP A 1 203 ? -38.222 51.625 17.345  1.00 141.61 ? 247  ASP A O   1 
ATOM   1464 C CB  . ASP A 1 203 ? -38.703 53.286 19.695  1.00 144.57 ? 247  ASP A CB  1 
ATOM   1465 C CG  . ASP A 1 203 ? -39.063 54.725 19.384  1.00 144.95 ? 247  ASP A CG  1 
ATOM   1466 O OD1 . ASP A 1 203 ? -40.204 54.971 18.939  1.00 146.05 ? 247  ASP A OD1 1 
ATOM   1467 O OD2 . ASP A 1 203 ? -38.206 55.611 19.586  1.00 144.19 ? 247  ASP A OD2 1 
ATOM   1468 N N   . LEU A 1 204 ? -39.210 49.991 18.535  1.00 110.10 ? 248  LEU A N   1 
ATOM   1469 C CA  . LEU A 1 204 ? -38.518 48.934 17.819  1.00 108.49 ? 248  LEU A CA  1 
ATOM   1470 C C   . LEU A 1 204 ? -38.824 49.083 16.338  1.00 107.83 ? 248  LEU A C   1 
ATOM   1471 O O   . LEU A 1 204 ? -39.958 49.352 15.941  1.00 109.23 ? 248  LEU A O   1 
ATOM   1472 C CB  . LEU A 1 204 ? -38.967 47.561 18.318  1.00 109.33 ? 248  LEU A CB  1 
ATOM   1473 C CG  . LEU A 1 204 ? -38.590 46.364 17.442  1.00 107.48 ? 248  LEU A CG  1 
ATOM   1474 C CD1 . LEU A 1 204 ? -37.128 45.994 17.638  1.00 106.04 ? 248  LEU A CD1 1 
ATOM   1475 C CD2 . LEU A 1 204 ? -39.492 45.176 17.738  1.00 107.87 ? 248  LEU A CD2 1 
ATOM   1476 N N   . GLY A 1 205 ? -37.785 48.918 15.531  1.00 85.99  ? 249  GLY A N   1 
ATOM   1477 C CA  . GLY A 1 205 ? -37.815 49.251 14.117  1.00 85.58  ? 249  GLY A CA  1 
ATOM   1478 C C   . GLY A 1 205 ? -37.544 50.728 13.880  1.00 86.03  ? 249  GLY A C   1 
ATOM   1479 O O   . GLY A 1 205 ? -37.222 51.133 12.771  1.00 86.64  ? 249  GLY A O   1 
ATOM   1480 N N   . ALA A 1 206 ? -37.732 51.544 14.917  1.00 111.74 ? 250  ALA A N   1 
ATOM   1481 C CA  . ALA A 1 206 ? -37.423 52.978 14.865  1.00 111.50 ? 250  ALA A CA  1 
ATOM   1482 C C   . ALA A 1 206 ? -36.077 53.323 15.510  1.00 110.06 ? 250  ALA A C   1 
ATOM   1483 O O   . ALA A 1 206 ? -35.726 54.499 15.625  1.00 109.85 ? 250  ALA A O   1 
ATOM   1484 C CB  . ALA A 1 206 ? -38.530 53.779 15.517  1.00 113.48 ? 250  ALA A CB  1 
ATOM   1485 N N   . LEU A 1 207 ? -35.343 52.300 15.951  1.00 84.35  ? 251  LEU A N   1 
ATOM   1486 C CA  . LEU A 1 207 ? -34.051 52.490 16.615  1.00 83.13  ? 251  LEU A CA  1 
ATOM   1487 C C   . LEU A 1 207 ? -32.997 53.115 15.702  1.00 81.51  ? 251  LEU A C   1 
ATOM   1488 O O   . LEU A 1 207 ? -33.095 53.065 14.481  1.00 81.31  ? 251  LEU A O   1 
ATOM   1489 C CB  . LEU A 1 207 ? -33.521 51.162 17.149  1.00 82.60  ? 251  LEU A CB  1 
ATOM   1490 C CG  . LEU A 1 207 ? -34.437 50.403 18.089  1.00 84.31  ? 251  LEU A CG  1 
ATOM   1491 C CD1 . LEU A 1 207 ? -33.651 49.298 18.734  1.00 83.81  ? 251  LEU A CD1 1 
ATOM   1492 C CD2 . LEU A 1 207 ? -35.023 51.355 19.121  1.00 86.16  ? 251  LEU A CD2 1 
ATOM   1493 N N   . GLU A 1 208 ? -32.001 53.723 16.329  1.00 101.14 ? 252  GLU A N   1 
ATOM   1494 C CA  . GLU A 1 208 ? -30.916 54.376 15.633  1.00 99.74  ? 252  GLU A CA  1 
ATOM   1495 C C   . GLU A 1 208 ? -29.624 53.695 16.048  1.00 98.45  ? 252  GLU A C   1 
ATOM   1496 O O   . GLU A 1 208 ? -29.380 53.512 17.242  1.00 98.91  ? 252  GLU A O   1 
ATOM   1497 C CB  . GLU A 1 208 ? -30.892 55.853 15.978  1.00 100.28 ? 252  GLU A CB  1 
ATOM   1498 C CG  . GLU A 1 208 ? -30.207 56.739 14.985  1.00 99.61  ? 252  GLU A CG  1 
ATOM   1499 C CD  . GLU A 1 208 ? -30.510 58.198 15.253  1.00 102.66 ? 252  GLU A CD  1 
ATOM   1500 O OE1 . GLU A 1 208 ? -31.036 58.502 16.348  1.00 103.93 ? 252  GLU A OE1 1 
ATOM   1501 O OE2 . GLU A 1 208 ? -30.241 59.043 14.374  1.00 105.03 ? 252  GLU A OE2 1 
ATOM   1502 N N   . LEU A 1 209 ? -28.808 53.296 15.076  1.00 87.22  ? 253  LEU A N   1 
ATOM   1503 C CA  . LEU A 1 209 ? -27.576 52.585 15.392  1.00 86.17  ? 253  LEU A CA  1 
ATOM   1504 C C   . LEU A 1 209 ? -26.387 53.537 15.380  1.00 86.01  ? 253  LEU A C   1 
ATOM   1505 O O   . LEU A 1 209 ? -26.166 54.255 14.401  1.00 86.03  ? 253  LEU A O   1 
ATOM   1506 C CB  . LEU A 1 209 ? -27.344 51.432 14.420  1.00 85.31  ? 253  LEU A CB  1 
ATOM   1507 C CG  . LEU A 1 209 ? -26.126 50.589 14.792  1.00 84.52  ? 253  LEU A CG  1 
ATOM   1508 C CD1 . LEU A 1 209 ? -26.269 50.056 16.204  1.00 84.77  ? 253  LEU A CD1 1 
ATOM   1509 C CD2 . LEU A 1 209 ? -25.880 49.456 13.798  1.00 84.00  ? 253  LEU A CD2 1 
ATOM   1510 N N   . TRP A 1 210 ? -25.623 53.520 16.470  1.00 95.99  ? 254  TRP A N   1 
ATOM   1511 C CA  . TRP A 1 210 ? -24.500 54.430 16.665  1.00 96.48  ? 254  TRP A CA  1 
ATOM   1512 C C   . TRP A 1 210 ? -23.173 53.701 16.815  1.00 96.66  ? 254  TRP A C   1 
ATOM   1513 O O   . TRP A 1 210 ? -23.127 52.507 17.122  1.00 96.30  ? 254  TRP A O   1 
ATOM   1514 C CB  . TRP A 1 210 ? -24.696 55.282 17.908  1.00 97.61  ? 254  TRP A CB  1 
ATOM   1515 C CG  . TRP A 1 210 ? -25.889 56.127 17.915  1.00 98.11  ? 254  TRP A CG  1 
ATOM   1516 C CD1 . TRP A 1 210 ? -27.170 55.733 18.147  1.00 98.55  ? 254  TRP A CD1 1 
ATOM   1517 C CD2 . TRP A 1 210 ? -25.924 57.547 17.746  1.00 99.31  ? 254  TRP A CD2 1 
ATOM   1518 N NE1 . TRP A 1 210 ? -28.011 56.823 18.105  1.00 99.44  ? 254  TRP A NE1 1 
ATOM   1519 C CE2 . TRP A 1 210 ? -27.267 57.948 17.861  1.00 100.20 ? 254  TRP A CE2 1 
ATOM   1520 C CE3 . TRP A 1 210 ? -24.949 58.520 17.499  1.00 100.84 ? 254  TRP A CE3 1 
ATOM   1521 C CZ2 . TRP A 1 210 ? -27.659 59.274 17.735  1.00 103.65 ? 254  TRP A CZ2 1 
ATOM   1522 C CZ3 . TRP A 1 210 ? -25.341 59.832 17.374  1.00 104.68 ? 254  TRP A CZ3 1 
ATOM   1523 C CH2 . TRP A 1 210 ? -26.683 60.199 17.492  1.00 105.99 ? 254  TRP A CH2 1 
ATOM   1524 N N   . ARG A 1 211 ? -22.094 54.451 16.620  1.00 82.57  ? 255  ARG A N   1 
ATOM   1525 C CA  . ARG A 1 211 ? -20.757 53.943 16.855  1.00 83.82  ? 255  ARG A CA  1 
ATOM   1526 C C   . ARG A 1 211 ? -19.935 54.978 17.615  1.00 85.59  ? 255  ARG A C   1 
ATOM   1527 O O   . ARG A 1 211 ? -20.109 56.175 17.397  1.00 87.10  ? 255  ARG A O   1 
ATOM   1528 C CB  . ARG A 1 211 ? -20.092 53.597 15.530  1.00 84.09  ? 255  ARG A CB  1 
ATOM   1529 C CG  . ARG A 1 211 ? -18.747 52.926 15.673  1.00 86.15  ? 255  ARG A CG  1 
ATOM   1530 C CD  . ARG A 1 211 ? -18.042 52.880 14.341  1.00 87.29  ? 255  ARG A CD  1 
ATOM   1531 N NE  . ARG A 1 211 ? -17.604 54.207 13.932  1.00 88.11  ? 255  ARG A NE  1 
ATOM   1532 C CZ  . ARG A 1 211 ? -17.500 54.607 12.670  1.00 88.16  ? 255  ARG A CZ  1 
ATOM   1533 N NH1 . ARG A 1 211 ? -17.812 53.785 11.679  1.00 87.56  ? 255  ARG A NH1 1 
ATOM   1534 N NH2 . ARG A 1 211 ? -17.091 55.835 12.400  1.00 90.06  ? 255  ARG A NH2 1 
ATOM   1535 N N   . THR A 1 212 ? -19.078 54.527 18.533  1.00 96.60  ? 256  THR A N   1 
ATOM   1536 C CA  . THR A 1 212 ? -18.097 55.416 19.163  1.00 98.86  ? 256  THR A CA  1 
ATOM   1537 C C   . THR A 1 212 ? -16.743 54.707 19.295  1.00 101.36 ? 256  THR A C   1 
ATOM   1538 O O   . THR A 1 212 ? -16.647 53.606 19.850  1.00 101.71 ? 256  THR A O   1 
ATOM   1539 C CB  . THR A 1 212 ? -18.583 55.939 20.551  1.00 99.17  ? 256  THR A CB  1 
ATOM   1540 O OG1 . THR A 1 212 ? -17.586 56.792 21.124  1.00 101.60 ? 256  THR A OG1 1 
ATOM   1541 C CG2 . THR A 1 212 ? -18.885 54.804 21.518  1.00 99.11  ? 256  THR A CG2 1 
ATOM   1542 N N   . SER A 1 213 ? -15.719 55.325 18.705  1.00 104.99 ? 257  SER A N   1 
ATOM   1543 C CA  . SER A 1 213 ? -14.341 54.816 18.699  1.00 108.15 ? 257  SER A CA  1 
ATOM   1544 C C   . SER A 1 213 ? -13.528 55.199 19.936  1.00 110.13 ? 257  SER A C   1 
ATOM   1545 O O   . SER A 1 213 ? -12.649 54.462 20.380  1.00 111.73 ? 257  SER A O   1 
ATOM   1546 C CB  . SER A 1 213 ? -13.622 55.319 17.452  1.00 109.81 ? 257  SER A CB  1 
ATOM   1547 O OG  . SER A 1 213 ? -14.384 55.040 16.292  1.00 107.08 ? 257  SER A OG  1 
ATOM   1548 N N   . ASP A 1 214 ? -13.810 56.397 20.432  1.00 126.92 ? 258  ASP A N   1 
ATOM   1549 C CA  . ASP A 1 214 ? -13.080 57.050 21.520  1.00 128.84 ? 258  ASP A CA  1 
ATOM   1550 C C   . ASP A 1 214 ? -13.694 56.885 22.910  1.00 129.38 ? 258  ASP A C   1 
ATOM   1551 O O   . ASP A 1 214 ? -13.357 57.639 23.828  1.00 131.33 ? 258  ASP A O   1 
ATOM   1552 C CB  . ASP A 1 214 ? -12.925 58.530 21.211  1.00 129.88 ? 258  ASP A CB  1 
ATOM   1553 C CG  . ASP A 1 214 ? -14.144 59.104 20.544  1.00 127.83 ? 258  ASP A CG  1 
ATOM   1554 O OD1 . ASP A 1 214 ? -15.263 58.635 20.841  1.00 124.85 ? 258  ASP A OD1 1 
ATOM   1555 O OD2 . ASP A 1 214 ? -13.979 60.021 19.716  1.00 130.52 ? 258  ASP A OD2 1 
ATOM   1556 N N   . LEU A 1 215 ? -14.655 55.973 23.030  1.00 104.31 ? 259  LEU A N   1 
ATOM   1557 C CA  . LEU A 1 215 ? -15.369 55.737 24.281  1.00 104.28 ? 259  LEU A CA  1 
ATOM   1558 C C   . LEU A 1 215 ? -16.230 56.932 24.660  1.00 103.45 ? 259  LEU A C   1 
ATOM   1559 O O   . LEU A 1 215 ? -16.205 57.388 25.795  1.00 105.08 ? 259  LEU A O   1 
ATOM   1560 C CB  . LEU A 1 215 ? -14.394 55.406 25.417  1.00 107.21 ? 259  LEU A CB  1 
ATOM   1561 C CG  . LEU A 1 215 ? -13.489 54.209 25.136  1.00 108.80 ? 259  LEU A CG  1 
ATOM   1562 C CD1 . LEU A 1 215 ? -12.444 54.040 26.217  1.00 112.23 ? 259  LEU A CD1 1 
ATOM   1563 C CD2 . LEU A 1 215 ? -14.325 52.952 24.990  1.00 106.60 ? 259  LEU A CD2 1 
ATOM   1564 N N   . GLY A 1 216 ? -16.979 57.448 23.692  1.00 114.66 ? 260  GLY A N   1 
ATOM   1565 C CA  . GLY A 1 216 ? -18.004 58.428 23.982  1.00 114.42 ? 260  GLY A CA  1 
ATOM   1566 C C   . GLY A 1 216 ? -17.537 59.858 23.866  1.00 117.04 ? 260  GLY A C   1 
ATOM   1567 O O   . GLY A 1 216 ? -18.313 60.780 24.104  1.00 118.81 ? 260  GLY A O   1 
ATOM   1568 N N   . LYS A 1 217 ? -16.270 60.050 23.512  1.00 135.06 ? 261  LYS A N   1 
ATOM   1569 C CA  . LYS A 1 217 ? -15.774 61.394 23.250  1.00 139.79 ? 261  LYS A CA  1 
ATOM   1570 C C   . LYS A 1 217 ? -16.503 61.943 22.035  1.00 139.38 ? 261  LYS A C   1 
ATOM   1571 O O   . LYS A 1 217 ? -16.876 63.113 21.994  1.00 142.95 ? 261  LYS A O   1 
ATOM   1572 C CB  . LYS A 1 217 ? -14.262 61.400 23.020  1.00 142.52 ? 261  LYS A CB  1 
ATOM   1573 C CG  . LYS A 1 217 ? -13.433 60.927 24.207  1.00 144.15 ? 261  LYS A CG  1 
ATOM   1574 C CD  . LYS A 1 217 ? -11.940 61.055 23.919  1.00 147.61 ? 261  LYS A CD  1 
ATOM   1575 C CE  . LYS A 1 217 ? -11.094 60.676 25.127  1.00 149.85 ? 261  LYS A CE  1 
ATOM   1576 N NZ  . LYS A 1 217 ? -9.633  60.785 24.844  1.00 153.91 ? 261  LYS A NZ  1 
ATOM   1577 N N   . SER A 1 218 ? -16.717 61.072 21.054  1.00 136.09 ? 262  SER A N   1 
ATOM   1578 C CA  . SER A 1 218 ? -17.419 61.435 19.829  1.00 135.60 ? 262  SER A CA  1 
ATOM   1579 C C   . SER A 1 218 ? -18.235 60.266 19.283  1.00 130.17 ? 262  SER A C   1 
ATOM   1580 O O   . SER A 1 218 ? -17.854 59.104 19.429  1.00 127.39 ? 262  SER A O   1 
ATOM   1581 C CB  . SER A 1 218 ? -16.429 61.911 18.772  1.00 138.49 ? 262  SER A CB  1 
ATOM   1582 O OG  . SER A 1 218 ? -15.575 60.852 18.382  1.00 136.09 ? 262  SER A OG  1 
ATOM   1583 N N   . PHE A 1 219 ? -19.353 60.588 18.642  1.00 110.78 ? 263  PHE A N   1 
ATOM   1584 C CA  . PHE A 1 219 ? -20.272 59.579 18.124  1.00 106.49 ? 263  PHE A CA  1 
ATOM   1585 C C   . PHE A 1 219 ? -20.543 59.741 16.630  1.00 106.57 ? 263  PHE A C   1 
ATOM   1586 O O   . PHE A 1 219 ? -20.278 60.788 16.044  1.00 110.30 ? 263  PHE A O   1 
ATOM   1587 C CB  . PHE A 1 219 ? -21.604 59.627 18.875  1.00 105.89 ? 263  PHE A CB  1 
ATOM   1588 C CG  . PHE A 1 219 ? -21.500 59.256 20.316  1.00 105.71 ? 263  PHE A CG  1 
ATOM   1589 C CD1 . PHE A 1 219 ? -21.639 57.939 20.713  1.00 102.32 ? 263  PHE A CD1 1 
ATOM   1590 C CD2 . PHE A 1 219 ? -21.265 60.218 21.276  1.00 110.54 ? 263  PHE A CD2 1 
ATOM   1591 C CE1 . PHE A 1 219 ? -21.543 57.594 22.041  1.00 103.26 ? 263  PHE A CE1 1 
ATOM   1592 C CE2 . PHE A 1 219 ? -21.165 59.874 22.602  1.00 110.91 ? 263  PHE A CE2 1 
ATOM   1593 C CZ  . PHE A 1 219 ? -21.306 58.564 22.984  1.00 107.11 ? 263  PHE A CZ  1 
ATOM   1594 N N   . LYS A 1 220 ? -21.081 58.690 16.026  1.00 119.45 ? 264  LYS A N   1 
ATOM   1595 C CA  . LYS A 1 220 ? -21.465 58.706 14.625  1.00 119.41 ? 264  LYS A CA  1 
ATOM   1596 C C   . LYS A 1 220 ? -22.725 57.869 14.435  1.00 116.45 ? 264  LYS A C   1 
ATOM   1597 O O   . LYS A 1 220 ? -22.830 56.769 14.982  1.00 114.55 ? 264  LYS A O   1 
ATOM   1598 C CB  . LYS A 1 220 ? -20.316 58.181 13.769  1.00 119.03 ? 264  LYS A CB  1 
ATOM   1599 C CG  . LYS A 1 220 ? -20.733 57.479 12.496  1.00 117.31 ? 264  LYS A CG  1 
ATOM   1600 C CD  . LYS A 1 220 ? -21.158 58.459 11.424  1.00 120.42 ? 264  LYS A CD  1 
ATOM   1601 C CE  . LYS A 1 220 ? -21.012 57.830 10.042  1.00 119.74 ? 264  LYS A CE  1 
ATOM   1602 N NZ  . LYS A 1 220 ? -19.618 57.347 9.789   1.00 119.71 ? 264  LYS A NZ  1 
ATOM   1603 N N   . THR A 1 221 ? -23.683 58.378 13.668  1.00 115.94 ? 265  THR A N   1 
ATOM   1604 C CA  . THR A 1 221 ? -24.892 57.607 13.409  1.00 113.66 ? 265  THR A CA  1 
ATOM   1605 C C   . THR A 1 221 ? -24.667 56.801 12.157  1.00 112.15 ? 265  THR A C   1 
ATOM   1606 O O   . THR A 1 221 ? -24.530 57.344 11.061  1.00 114.29 ? 265  THR A O   1 
ATOM   1607 C CB  . THR A 1 221 ? -26.139 58.490 13.252  1.00 116.40 ? 265  THR A CB  1 
ATOM   1608 O OG1 . THR A 1 221 ? -26.654 58.806 14.550  1.00 117.18 ? 265  THR A OG1 1 
ATOM   1609 C CG2 . THR A 1 221 ? -27.222 57.759 12.474  1.00 114.35 ? 265  THR A CG2 1 
ATOM   1610 N N   . ILE A 1 222 ? -24.570 55.494 12.349  1.00 92.25  ? 266  ILE A N   1 
ATOM   1611 C CA  . ILE A 1 222 ? -24.346 54.575 11.254  1.00 92.04  ? 266  ILE A CA  1 
ATOM   1612 C C   . ILE A 1 222 ? -25.614 53.886 10.787  1.00 91.80  ? 266  ILE A C   1 
ATOM   1613 O O   . ILE A 1 222 ? -25.597 53.168 9.793   1.00 91.92  ? 266  ILE A O   1 
ATOM   1614 C CB  . ILE A 1 222 ? -23.336 53.508 11.656  1.00 92.08  ? 266  ILE A CB  1 
ATOM   1615 C CG1 . ILE A 1 222 ? -23.819 52.793 12.925  1.00 91.59  ? 266  ILE A CG1 1 
ATOM   1616 C CG2 . ILE A 1 222 ? -21.973 54.150 11.854  1.00 93.14  ? 266  ILE A CG2 1 
ATOM   1617 C CD1 . ILE A 1 222 ? -22.898 51.710 13.412  1.00 91.76  ? 266  ILE A CD1 1 
ATOM   1618 N N   . GLY A 1 223 ? -26.717 54.101 11.485  1.00 102.62 ? 267  GLY A N   1 
ATOM   1619 C CA  . GLY A 1 223 ? -27.933 53.409 11.120  1.00 102.98 ? 267  GLY A CA  1 
ATOM   1620 C C   . GLY A 1 223 ? -29.187 54.126 11.557  1.00 104.06 ? 267  GLY A C   1 
ATOM   1621 O O   . GLY A 1 223 ? -29.171 54.918 12.502  1.00 104.38 ? 267  GLY A O   1 
ATOM   1622 N N   . VAL A 1 224 ? -30.282 53.840 10.862  1.00 102.58 ? 268  VAL A N   1 
ATOM   1623 C CA  . VAL A 1 224 ? -31.583 54.391 11.212  1.00 103.88 ? 268  VAL A CA  1 
ATOM   1624 C C   . VAL A 1 224 ? -32.650 53.385 10.774  1.00 104.88 ? 268  VAL A C   1 
ATOM   1625 O O   . VAL A 1 224 ? -32.357 52.494 9.978   1.00 104.59 ? 268  VAL A O   1 
ATOM   1626 C CB  . VAL A 1 224 ? -31.806 55.769 10.560  1.00 104.49 ? 268  VAL A CB  1 
ATOM   1627 C CG1 . VAL A 1 224 ? -32.137 55.609 9.095   1.00 105.41 ? 268  VAL A CG1 1 
ATOM   1628 C CG2 . VAL A 1 224 ? -32.894 56.533 11.290  1.00 107.05 ? 268  VAL A CG2 1 
ATOM   1629 N N   . LYS A 1 225 ? -33.866 53.513 11.305  1.00 108.26 ? 269  LYS A N   1 
ATOM   1630 C CA  . LYS A 1 225 ? -34.928 52.542 11.055  1.00 109.47 ? 269  LYS A CA  1 
ATOM   1631 C C   . LYS A 1 225 ? -34.490 51.155 11.484  1.00 108.79 ? 269  LYS A C   1 
ATOM   1632 O O   . LYS A 1 225 ? -34.789 50.168 10.814  1.00 109.13 ? 269  LYS A O   1 
ATOM   1633 C CB  . LYS A 1 225 ? -35.317 52.513 9.575   1.00 110.09 ? 269  LYS A CB  1 
ATOM   1634 C CG  . LYS A 1 225 ? -36.281 53.585 9.123   1.00 111.37 ? 269  LYS A CG  1 
ATOM   1635 C CD  . LYS A 1 225 ? -37.718 53.207 9.426   1.00 112.94 ? 269  LYS A CD  1 
ATOM   1636 C CE  . LYS A 1 225 ? -38.661 54.109 8.637   1.00 115.86 ? 269  LYS A CE  1 
ATOM   1637 N NZ  . LYS A 1 225 ? -40.115 53.823 8.851   1.00 118.56 ? 269  LYS A NZ  1 
ATOM   1638 N N   . ILE A 1 226 ? -33.779 51.074 12.601  1.00 82.51  ? 270  ILE A N   1 
ATOM   1639 C CA  . ILE A 1 226 ? -33.155 49.809 12.971  1.00 81.65  ? 270  ILE A CA  1 
ATOM   1640 C C   . ILE A 1 226 ? -34.085 48.940 13.780  1.00 82.81  ? 270  ILE A C   1 
ATOM   1641 O O   . ILE A 1 226 ? -34.710 49.393 14.742  1.00 83.93  ? 270  ILE A O   1 
ATOM   1642 C CB  . ILE A 1 226 ? -31.864 50.016 13.762  1.00 80.25  ? 270  ILE A CB  1 
ATOM   1643 C CG1 . ILE A 1 226 ? -30.919 50.921 12.973  1.00 79.21  ? 270  ILE A CG1 1 
ATOM   1644 C CG2 . ILE A 1 226 ? -31.205 48.672 14.032  1.00 79.33  ? 270  ILE A CG2 1 
ATOM   1645 C CD1 . ILE A 1 226 ? -30.514 50.322 11.661  1.00 78.73  ? 270  ILE A CD1 1 
ATOM   1646 N N   . TYR A 1 227 ? -34.241 47.708 13.319  1.00 76.02  ? 271  TYR A N   1 
ATOM   1647 C CA  . TYR A 1 227 ? -34.874 46.679 14.112  1.00 76.76  ? 271  TYR A CA  1 
ATOM   1648 C C   . TYR A 1 227 ? -33.869 46.045 15.063  1.00 75.80  ? 271  TYR A C   1 
ATOM   1649 O O   . TYR A 1 227 ? -34.094 45.957 16.262  1.00 76.62  ? 271  TYR A O   1 
ATOM   1650 C CB  . TYR A 1 227 ? -35.496 45.636 13.198  1.00 77.12  ? 271  TYR A CB  1 
ATOM   1651 C CG  . TYR A 1 227 ? -36.329 44.588 13.885  1.00 78.03  ? 271  TYR A CG  1 
ATOM   1652 C CD1 . TYR A 1 227 ? -35.751 43.410 14.335  1.00 77.19  ? 271  TYR A CD1 1 
ATOM   1653 C CD2 . TYR A 1 227 ? -37.700 44.752 14.047  1.00 79.95  ? 271  TYR A CD2 1 
ATOM   1654 C CE1 . TYR A 1 227 ? -36.506 42.426 14.940  1.00 78.33  ? 271  TYR A CE1 1 
ATOM   1655 C CE2 . TYR A 1 227 ? -38.468 43.771 14.655  1.00 81.22  ? 271  TYR A CE2 1 
ATOM   1656 C CZ  . TYR A 1 227 ? -37.858 42.610 15.100  1.00 80.44  ? 271  TYR A CZ  1 
ATOM   1657 O OH  . TYR A 1 227 ? -38.581 41.613 15.706  1.00 82.10  ? 271  TYR A OH  1 
ATOM   1658 N N   . SER A 1 228 ? -32.725 45.642 14.540  1.00 84.30  ? 272  SER A N   1 
ATOM   1659 C CA  . SER A 1 228 ? -31.783 44.937 15.378  1.00 83.40  ? 272  SER A CA  1 
ATOM   1660 C C   . SER A 1 228 ? -30.402 44.923 14.738  1.00 81.36  ? 272  SER A C   1 
ATOM   1661 O O   . SER A 1 228 ? -30.245 45.342 13.589  1.00 81.00  ? 272  SER A O   1 
ATOM   1662 C CB  . SER A 1 228 ? -32.288 43.514 15.615  1.00 83.89  ? 272  SER A CB  1 
ATOM   1663 O OG  . SER A 1 228 ? -31.501 42.855 16.582  1.00 83.49  ? 272  SER A OG  1 
ATOM   1664 N N   . PHE A 1 229 ? -29.409 44.413 15.462  1.00 81.27  ? 273  PHE A N   1 
ATOM   1665 C CA  . PHE A 1 229 ? -28.071 44.303 14.897  1.00 79.48  ? 273  PHE A CA  1 
ATOM   1666 C C   . PHE A 1 229 ? -27.225 43.244 15.603  1.00 78.50  ? 273  PHE A C   1 
ATOM   1667 O O   . PHE A 1 229 ? -27.576 42.766 16.682  1.00 78.69  ? 273  PHE A O   1 
ATOM   1668 C CB  . PHE A 1 229 ? -27.362 45.665 14.919  1.00 79.12  ? 273  PHE A CB  1 
ATOM   1669 C CG  . PHE A 1 229 ? -26.719 46.007 16.227  1.00 78.91  ? 273  PHE A CG  1 
ATOM   1670 C CD1 . PHE A 1 229 ? -27.449 46.604 17.229  1.00 80.08  ? 273  PHE A CD1 1 
ATOM   1671 C CD2 . PHE A 1 229 ? -25.374 45.753 16.442  1.00 78.41  ? 273  PHE A CD2 1 
ATOM   1672 C CE1 . PHE A 1 229 ? -26.858 46.925 18.450  1.00 80.36  ? 273  PHE A CE1 1 
ATOM   1673 C CE2 . PHE A 1 229 ? -24.774 46.072 17.647  1.00 78.83  ? 273  PHE A CE2 1 
ATOM   1674 C CZ  . PHE A 1 229 ? -25.517 46.658 18.657  1.00 79.58  ? 273  PHE A CZ  1 
ATOM   1675 N N   . GLY A 1 230 ? -26.122 42.861 14.966  1.00 73.61  ? 274  GLY A N   1 
ATOM   1676 C CA  . GLY A 1 230 ? -25.244 41.848 15.514  1.00 73.45  ? 274  GLY A CA  1 
ATOM   1677 C C   . GLY A 1 230 ? -23.924 41.781 14.776  1.00 74.73  ? 274  GLY A C   1 
ATOM   1678 O O   . GLY A 1 230 ? -23.814 42.270 13.646  1.00 75.52  ? 274  GLY A O   1 
ATOM   1679 N N   . LEU A 1 231 ? -22.921 41.183 15.425  1.00 64.01  ? 275  LEU A N   1 
ATOM   1680 C CA  . LEU A 1 231 ? -21.584 40.995 14.840  1.00 66.92  ? 275  LEU A CA  1 
ATOM   1681 C C   . LEU A 1 231 ? -21.274 39.532 14.646  1.00 68.10  ? 275  LEU A C   1 
ATOM   1682 O O   . LEU A 1 231 ? -21.561 38.712 15.504  1.00 66.53  ? 275  LEU A O   1 
ATOM   1683 C CB  . LEU A 1 231 ? -20.501 41.610 15.726  1.00 68.62  ? 275  LEU A CB  1 
ATOM   1684 C CG  . LEU A 1 231 ? -20.802 43.023 16.219  1.00 67.41  ? 275  LEU A CG  1 
ATOM   1685 C CD1 . LEU A 1 231 ? -19.659 43.573 17.050  1.00 70.35  ? 275  LEU A CD1 1 
ATOM   1686 C CD2 . LEU A 1 231 ? -21.070 43.910 15.025  1.00 66.72  ? 275  LEU A CD2 1 
ATOM   1687 N N   . GLY A 1 232 ? -20.695 39.199 13.506  1.00 72.16  ? 276  GLY A N   1 
ATOM   1688 C CA  . GLY A 1 232 ? -20.003 37.931 13.391  1.00 73.57  ? 276  GLY A CA  1 
ATOM   1689 C C   . GLY A 1 232 ? -18.935 38.060 12.334  1.00 77.10  ? 276  GLY A C   1 
ATOM   1690 O O   . GLY A 1 232 ? -19.123 38.758 11.329  1.00 77.09  ? 276  GLY A O   1 
ATOM   1691 N N   . GLY A 1 233 ? -17.843 37.329 12.536  1.00 67.16  ? 277  GLY A N   1 
ATOM   1692 C CA  . GLY A 1 233 ? -16.662 37.466 11.710  1.00 69.66  ? 277  GLY A CA  1 
ATOM   1693 C C   . GLY A 1 233 ? -16.337 38.933 11.573  1.00 71.77  ? 277  GLY A C   1 
ATOM   1694 O O   . GLY A 1 233 ? -16.409 39.679 12.546  1.00 71.93  ? 277  GLY A O   1 
ATOM   1695 N N   . ARG A 1 234 ? -16.035 39.342 10.341  1.00 89.14  ? 278  ARG A N   1 
ATOM   1696 C CA  . ARG A 1 234 ? -15.734 40.725 10.005  1.00 89.18  ? 278  ARG A CA  1 
ATOM   1697 C C   . ARG A 1 234 ? -16.972 41.571 9.749   1.00 86.22  ? 278  ARG A C   1 
ATOM   1698 O O   . ARG A 1 234 ? -16.851 42.744 9.397   1.00 85.60  ? 278  ARG A O   1 
ATOM   1699 C CB  . ARG A 1 234 ? -14.859 40.778 8.760   1.00 89.19  ? 278  ARG A CB  1 
ATOM   1700 C CG  . ARG A 1 234 ? -13.510 40.130 8.920   1.00 91.28  ? 278  ARG A CG  1 
ATOM   1701 C CD  . ARG A 1 234 ? -12.732 40.144 7.613   1.00 90.54  ? 278  ARG A CD  1 
ATOM   1702 N NE  . ARG A 1 234 ? -13.451 39.414 6.578   1.00 87.53  ? 278  ARG A NE  1 
ATOM   1703 C CZ  . ARG A 1 234 ? -13.900 39.960 5.454   1.00 86.60  ? 278  ARG A CZ  1 
ATOM   1704 N NH1 . ARG A 1 234 ? -13.683 41.247 5.206   1.00 87.98  ? 278  ARG A NH1 1 
ATOM   1705 N NH2 . ARG A 1 234 ? -14.545 39.207 4.569   1.00 84.27  ? 278  ARG A NH2 1 
ATOM   1706 N N   . PHE A 1 235 ? -18.156 40.980 9.894   1.00 72.22  ? 279  PHE A N   1 
ATOM   1707 C CA  . PHE A 1 235 ? -19.388 41.642 9.458   1.00 69.14  ? 279  PHE A CA  1 
ATOM   1708 C C   . PHE A 1 235 ? -20.161 42.358 10.561  1.00 67.28  ? 279  PHE A C   1 
ATOM   1709 O O   . PHE A 1 235 ? -20.280 41.859 11.678  1.00 67.27  ? 279  PHE A O   1 
ATOM   1710 C CB  . PHE A 1 235 ? -20.321 40.632 8.796   1.00 67.65  ? 279  PHE A CB  1 
ATOM   1711 C CG  . PHE A 1 235 ? -19.665 39.786 7.765   1.00 68.44  ? 279  PHE A CG  1 
ATOM   1712 C CD1 . PHE A 1 235 ? -19.042 40.360 6.669   1.00 68.91  ? 279  PHE A CD1 1 
ATOM   1713 C CD2 . PHE A 1 235 ? -19.684 38.408 7.875   1.00 68.14  ? 279  PHE A CD2 1 
ATOM   1714 C CE1 . PHE A 1 235 ? -18.437 39.581 5.705   1.00 69.20  ? 279  PHE A CE1 1 
ATOM   1715 C CE2 . PHE A 1 235 ? -19.073 37.612 6.909   1.00 67.86  ? 279  PHE A CE2 1 
ATOM   1716 C CZ  . PHE A 1 235 ? -18.451 38.204 5.826   1.00 68.53  ? 279  PHE A CZ  1 
ATOM   1717 N N   . LEU A 1 236 ? -20.690 43.532 10.236  1.00 79.72  ? 280  LEU A N   1 
ATOM   1718 C CA  . LEU A 1 236 ? -21.708 44.165 11.066  1.00 77.31  ? 280  LEU A CA  1 
ATOM   1719 C C   . LEU A 1 236 ? -23.042 44.008 10.357  1.00 75.91  ? 280  LEU A C   1 
ATOM   1720 O O   . LEU A 1 236 ? -23.207 44.462 9.224   1.00 76.24  ? 280  LEU A O   1 
ATOM   1721 C CB  . LEU A 1 236 ? -21.395 45.642 11.316  1.00 77.07  ? 280  LEU A CB  1 
ATOM   1722 C CG  . LEU A 1 236 ? -22.523 46.557 11.820  1.00 75.06  ? 280  LEU A CG  1 
ATOM   1723 C CD1 . LEU A 1 236 ? -22.983 46.164 13.198  1.00 74.03  ? 280  LEU A CD1 1 
ATOM   1724 C CD2 . LEU A 1 236 ? -22.094 48.019 11.810  1.00 75.34  ? 280  LEU A CD2 1 
ATOM   1725 N N   . PHE A 1 237 ? -23.979 43.333 11.009  1.00 73.33  ? 281  PHE A N   1 
ATOM   1726 C CA  . PHE A 1 237 ? -25.295 43.098 10.431  1.00 72.89  ? 281  PHE A CA  1 
ATOM   1727 C C   . PHE A 1 237 ? -26.335 44.004 11.091  1.00 72.10  ? 281  PHE A C   1 
ATOM   1728 O O   . PHE A 1 237 ? -26.306 44.193 12.307  1.00 71.32  ? 281  PHE A O   1 
ATOM   1729 C CB  . PHE A 1 237 ? -25.707 41.628 10.595  1.00 73.07  ? 281  PHE A CB  1 
ATOM   1730 C CG  . PHE A 1 237 ? -24.884 40.666 9.799   1.00 74.26  ? 281  PHE A CG  1 
ATOM   1731 C CD1 . PHE A 1 237 ? -24.996 40.615 8.416   1.00 74.99  ? 281  PHE A CD1 1 
ATOM   1732 C CD2 . PHE A 1 237 ? -24.010 39.790 10.430  1.00 74.97  ? 281  PHE A CD2 1 
ATOM   1733 C CE1 . PHE A 1 237 ? -24.233 39.722 7.663   1.00 75.88  ? 281  PHE A CE1 1 
ATOM   1734 C CE2 . PHE A 1 237 ? -23.246 38.885 9.683   1.00 76.30  ? 281  PHE A CE2 1 
ATOM   1735 C CZ  . PHE A 1 237 ? -23.360 38.854 8.299   1.00 76.37  ? 281  PHE A CZ  1 
ATOM   1736 N N   . ALA A 1 238 ? -27.252 44.561 10.300  1.00 73.71  ? 282  ALA A N   1 
ATOM   1737 C CA  . ALA A 1 238 ? -28.367 45.335 10.851  1.00 74.03  ? 282  ALA A CA  1 
ATOM   1738 C C   . ALA A 1 238 ? -29.638 45.052 10.066  1.00 75.56  ? 282  ALA A C   1 
ATOM   1739 O O   . ALA A 1 238 ? -29.614 45.099 8.834   1.00 76.32  ? 282  ALA A O   1 
ATOM   1740 C CB  . ALA A 1 238 ? -28.048 46.831 10.832  1.00 73.84  ? 282  ALA A CB  1 
ATOM   1741 N N   . SER A 1 239 ? -30.743 44.755 10.754  1.00 73.12  ? 283  SER A N   1 
ATOM   1742 C CA  . SER A 1 239 ? -32.021 44.592 10.057  1.00 74.78  ? 283  SER A CA  1 
ATOM   1743 C C   . SER A 1 239 ? -32.755 45.921 10.067  1.00 75.54  ? 283  SER A C   1 
ATOM   1744 O O   . SER A 1 239 ? -32.879 46.564 11.112  1.00 75.37  ? 283  SER A O   1 
ATOM   1745 C CB  . SER A 1 239 ? -32.892 43.480 10.672  1.00 75.22  ? 283  SER A CB  1 
ATOM   1746 O OG  . SER A 1 239 ? -33.075 43.616 12.071  1.00 74.97  ? 283  SER A OG  1 
ATOM   1747 N N   . VAL A 1 240 ? -33.227 46.336 8.894   1.00 81.87  ? 284  VAL A N   1 
ATOM   1748 C CA  . VAL A 1 240 ? -33.796 47.670 8.703   1.00 82.53  ? 284  VAL A CA  1 
ATOM   1749 C C   . VAL A 1 240 ? -35.261 47.626 8.256   1.00 84.43  ? 284  VAL A C   1 
ATOM   1750 O O   . VAL A 1 240 ? -35.625 46.861 7.367   1.00 85.39  ? 284  VAL A O   1 
ATOM   1751 C CB  . VAL A 1 240 ? -32.980 48.465 7.663   1.00 82.14  ? 284  VAL A CB  1 
ATOM   1752 C CG1 . VAL A 1 240 ? -33.377 49.917 7.688   1.00 82.44  ? 284  VAL A CG1 1 
ATOM   1753 C CG2 . VAL A 1 240 ? -31.490 48.318 7.934   1.00 80.37  ? 284  VAL A CG2 1 
ATOM   1754 N N   . MET A 1 241 ? -36.091 48.460 8.873   1.00 106.35 ? 285  MET A N   1 
ATOM   1755 C CA  . MET A 1 241 ? -37.514 48.506 8.560   1.00 108.18 ? 285  MET A CA  1 
ATOM   1756 C C   . MET A 1 241 ? -37.792 49.155 7.216   1.00 109.18 ? 285  MET A C   1 
ATOM   1757 O O   . MET A 1 241 ? -37.210 50.189 6.883   1.00 108.64 ? 285  MET A O   1 
ATOM   1758 C CB  . MET A 1 241 ? -38.273 49.272 9.644   1.00 108.79 ? 285  MET A CB  1 
ATOM   1759 C CG  . MET A 1 241 ? -38.654 48.452 10.849  1.00 108.97 ? 285  MET A CG  1 
ATOM   1760 S SD  . MET A 1 241 ? -40.080 47.401 10.548  1.00 110.94 ? 285  MET A SD  1 
ATOM   1761 C CE  . MET A 1 241 ? -39.428 45.807 11.063  1.00 109.62 ? 285  MET A CE  1 
ATOM   1762 N N   . ALA A 1 242 ? -38.691 48.548 6.449   1.00 106.57 ? 286  ALA A N   1 
ATOM   1763 C CA  . ALA A 1 242 ? -39.195 49.180 5.236   1.00 107.93 ? 286  ALA A CA  1 
ATOM   1764 C C   . ALA A 1 242 ? -39.801 50.518 5.608   1.00 108.37 ? 286  ALA A C   1 
ATOM   1765 O O   . ALA A 1 242 ? -40.453 50.642 6.645   1.00 108.66 ? 286  ALA A O   1 
ATOM   1766 C CB  . ALA A 1 242 ? -40.231 48.300 4.541   1.00 109.81 ? 286  ALA A CB  1 
ATOM   1767 N N   . ASP A 1 243 ? -39.567 51.527 4.779   1.00 148.95 ? 287  ASP A N   1 
ATOM   1768 C CA  . ASP A 1 243 ? -40.183 52.829 4.996   1.00 152.80 ? 287  ASP A CA  1 
ATOM   1769 C C   . ASP A 1 243 ? -41.693 52.695 4.839   1.00 156.97 ? 287  ASP A C   1 
ATOM   1770 O O   . ASP A 1 243 ? -42.470 53.335 5.542   1.00 159.85 ? 287  ASP A O   1 
ATOM   1771 C CB  . ASP A 1 243 ? -39.632 53.861 4.010   1.00 155.54 ? 287  ASP A CB  1 
ATOM   1772 C CG  . ASP A 1 243 ? -38.136 54.068 4.154   1.00 152.04 ? 287  ASP A CG  1 
ATOM   1773 O OD1 . ASP A 1 243 ? -37.691 54.456 5.256   1.00 150.22 ? 287  ASP A OD1 1 
ATOM   1774 O OD2 . ASP A 1 243 ? -37.407 53.835 3.166   1.00 151.56 ? 287  ASP A OD2 1 
ATOM   1775 N N   . LYS A 1 244 ? -42.079 51.822 3.917   1.00 145.21 ? 288  LYS A N   1 
ATOM   1776 C CA  . LYS A 1 244 ? -43.463 51.637 3.503   1.00 150.06 ? 288  LYS A CA  1 
ATOM   1777 C C   . LYS A 1 244 ? -44.233 50.614 4.332   1.00 148.99 ? 288  LYS A C   1 
ATOM   1778 O O   . LYS A 1 244 ? -45.456 50.539 4.246   1.00 153.85 ? 288  LYS A O   1 
ATOM   1779 C CB  . LYS A 1 244 ? -43.489 51.198 2.033   1.00 151.98 ? 288  LYS A CB  1 
ATOM   1780 C CG  . LYS A 1 244 ? -42.759 49.868 1.789   1.00 146.91 ? 288  LYS A CG  1 
ATOM   1781 C CD  . LYS A 1 244 ? -42.760 49.455 0.322   1.00 149.17 ? 288  LYS A CD  1 
ATOM   1782 C CE  . LYS A 1 244 ? -44.151 49.099 -0.164  1.00 154.33 ? 288  LYS A CE  1 
ATOM   1783 N NZ  . LYS A 1 244 ? -44.134 48.665 -1.586  1.00 156.88 ? 288  LYS A NZ  1 
ATOM   1784 N N   . ASP A 1 245 ? -43.522 49.835 5.142   1.00 147.60 ? 289  ASP A N   1 
ATOM   1785 C CA  . ASP A 1 245 ? -44.061 48.557 5.602   1.00 147.21 ? 289  ASP A CA  1 
ATOM   1786 C C   . ASP A 1 245 ? -43.586 48.147 6.999   1.00 145.37 ? 289  ASP A C   1 
ATOM   1787 O O   . ASP A 1 245 ? -42.888 48.895 7.680   1.00 144.06 ? 289  ASP A O   1 
ATOM   1788 C CB  . ASP A 1 245 ? -43.682 47.471 4.582   1.00 146.65 ? 289  ASP A CB  1 
ATOM   1789 C CG  . ASP A 1 245 ? -44.649 46.301 4.568   1.00 148.53 ? 289  ASP A CG  1 
ATOM   1790 O OD1 . ASP A 1 245 ? -45.206 45.969 5.636   1.00 148.90 ? 289  ASP A OD1 1 
ATOM   1791 O OD2 . ASP A 1 245 ? -44.842 45.710 3.483   1.00 149.82 ? 289  ASP A OD2 1 
ATOM   1792 N N   . THR A 1 246 ? -44.014 46.961 7.423   1.00 150.52 ? 290  THR A N   1 
ATOM   1793 C CA  . THR A 1 246 ? -43.497 46.318 8.621   1.00 149.35 ? 290  THR A CA  1 
ATOM   1794 C C   . THR A 1 246 ? -42.362 45.351 8.300   1.00 147.58 ? 290  THR A C   1 
ATOM   1795 O O   . THR A 1 246 ? -41.719 44.821 9.207   1.00 146.18 ? 290  THR A O   1 
ATOM   1796 C CB  . THR A 1 246 ? -44.590 45.538 9.362   1.00 151.29 ? 290  THR A CB  1 
ATOM   1797 O OG1 . THR A 1 246 ? -44.994 44.417 8.567   1.00 152.91 ? 290  THR A OG1 1 
ATOM   1798 C CG2 . THR A 1 246 ? -45.781 46.420 9.626   1.00 153.44 ? 290  THR A CG2 1 
ATOM   1799 N N   . THR A 1 247 ? -42.124 45.096 7.017   1.00 89.79  ? 291  THR A N   1 
ATOM   1800 C CA  . THR A 1 247 ? -41.043 44.171 6.654   1.00 88.40  ? 291  THR A CA  1 
ATOM   1801 C C   . THR A 1 247 ? -39.679 44.780 6.919   1.00 86.41  ? 291  THR A C   1 
ATOM   1802 O O   . THR A 1 247 ? -39.497 45.995 6.895   1.00 86.27  ? 291  THR A O   1 
ATOM   1803 C CB  . THR A 1 247 ? -41.096 43.735 5.179   1.00 89.49  ? 291  THR A CB  1 
ATOM   1804 O OG1 . THR A 1 247 ? -40.956 44.882 4.331   1.00 90.21  ? 291  THR A OG1 1 
ATOM   1805 C CG2 . THR A 1 247 ? -42.410 43.026 4.880   1.00 91.25  ? 291  THR A CG2 1 
ATOM   1806 N N   . ARG A 1 248 ? -38.715 43.919 7.179   1.00 76.55  ? 292  ARG A N   1 
ATOM   1807 C CA  . ARG A 1 248 ? -37.347 44.374 7.338   1.00 74.81  ? 292  ARG A CA  1 
ATOM   1808 C C   . ARG A 1 248 ? -36.392 43.491 6.543   1.00 74.40  ? 292  ARG A C   1 
ATOM   1809 O O   . ARG A 1 248 ? -36.741 42.384 6.125   1.00 75.11  ? 292  ARG A O   1 
ATOM   1810 C CB  . ARG A 1 248 ? -36.962 44.391 8.825   1.00 73.38  ? 292  ARG A CB  1 
ATOM   1811 C CG  . ARG A 1 248 ? -37.005 43.026 9.498   1.00 72.82  ? 292  ARG A CG  1 
ATOM   1812 C CD  . ARG A 1 248 ? -37.008 43.155 11.007  1.00 72.29  ? 292  ARG A CD  1 
ATOM   1813 N NE  . ARG A 1 248 ? -36.773 41.870 11.660  1.00 71.64  ? 292  ARG A NE  1 
ATOM   1814 C CZ  . ARG A 1 248 ? -37.725 41.003 11.993  1.00 73.00  ? 292  ARG A CZ  1 
ATOM   1815 N NH1 . ARG A 1 248 ? -39.003 41.269 11.763  1.00 75.08  ? 292  ARG A NH1 1 
ATOM   1816 N NH2 . ARG A 1 248 ? -37.394 39.863 12.570  1.00 72.61  ? 292  ARG A NH2 1 
ATOM   1817 N N   . ARG A 1 249 ? -35.177 43.975 6.343   1.00 85.23  ? 293  ARG A N   1 
ATOM   1818 C CA  . ARG A 1 249 ? -34.195 43.174 5.641   1.00 85.12  ? 293  ARG A CA  1 
ATOM   1819 C C   . ARG A 1 249 ? -32.762 43.472 6.107   1.00 83.26  ? 293  ARG A C   1 
ATOM   1820 O O   . ARG A 1 249 ? -32.458 44.571 6.574   1.00 82.22  ? 293  ARG A O   1 
ATOM   1821 C CB  . ARG A 1 249 ? -34.340 43.392 4.141   1.00 86.84  ? 293  ARG A CB  1 
ATOM   1822 C CG  . ARG A 1 249 ? -34.018 44.775 3.691   1.00 86.53  ? 293  ARG A CG  1 
ATOM   1823 C CD  . ARG A 1 249 ? -34.344 44.889 2.229   1.00 88.38  ? 293  ARG A CD  1 
ATOM   1824 N NE  . ARG A 1 249 ? -34.175 43.589 1.589   1.00 89.28  ? 293  ARG A NE  1 
ATOM   1825 C CZ  . ARG A 1 249 ? -35.008 43.068 0.693   1.00 91.55  ? 293  ARG A CZ  1 
ATOM   1826 N NH1 . ARG A 1 249 ? -36.089 43.746 0.302   1.00 93.17  ? 293  ARG A NH1 1 
ATOM   1827 N NH2 . ARG A 1 249 ? -34.750 41.869 0.180   1.00 92.23  ? 293  ARG A NH2 1 
ATOM   1828 N N   . ILE A 1 250 ? -31.892 42.474 5.983   1.00 76.06  ? 294  ILE A N   1 
ATOM   1829 C CA  . ILE A 1 250 ? -30.492 42.607 6.374   1.00 74.25  ? 294  ILE A CA  1 
ATOM   1830 C C   . ILE A 1 250 ? -29.640 43.531 5.482   1.00 73.86  ? 294  ILE A C   1 
ATOM   1831 O O   . ILE A 1 250 ? -29.644 43.423 4.253   1.00 75.02  ? 294  ILE A O   1 
ATOM   1832 C CB  . ILE A 1 250 ? -29.809 41.228 6.409   1.00 73.89  ? 294  ILE A CB  1 
ATOM   1833 C CG1 . ILE A 1 250 ? -30.515 40.307 7.410   1.00 73.89  ? 294  ILE A CG1 1 
ATOM   1834 C CG2 . ILE A 1 250 ? -28.350 41.376 6.772   1.00 72.19  ? 294  ILE A CG2 1 
ATOM   1835 C CD1 . ILE A 1 250 ? -30.400 40.770 8.829   1.00 72.40  ? 294  ILE A CD1 1 
ATOM   1836 N N   . HIS A 1 251 ? -28.928 44.452 6.122   1.00 84.48  ? 295  HIS A N   1 
ATOM   1837 C CA  . HIS A 1 251 ? -27.847 45.174 5.481   1.00 84.13  ? 295  HIS A CA  1 
ATOM   1838 C C   . HIS A 1 251 ? -26.540 44.746 6.138   1.00 83.12  ? 295  HIS A C   1 
ATOM   1839 O O   . HIS A 1 251 ? -26.529 44.407 7.318   1.00 82.12  ? 295  HIS A O   1 
ATOM   1840 C CB  . HIS A 1 251 ? -28.049 46.677 5.593   1.00 83.90  ? 295  HIS A CB  1 
ATOM   1841 C CG  . HIS A 1 251 ? -29.200 47.191 4.790   1.00 85.24  ? 295  HIS A CG  1 
ATOM   1842 N ND1 . HIS A 1 251 ? -29.041 48.062 3.731   1.00 86.51  ? 295  HIS A ND1 1 
ATOM   1843 C CD2 . HIS A 1 251 ? -30.531 46.963 4.889   1.00 85.77  ? 295  HIS A CD2 1 
ATOM   1844 C CE1 . HIS A 1 251 ? -30.222 48.346 3.212   1.00 87.66  ? 295  HIS A CE1 1 
ATOM   1845 N NE2 . HIS A 1 251 ? -31.146 47.698 3.900   1.00 87.30  ? 295  HIS A NE2 1 
ATOM   1846 N N   . VAL A 1 252 ? -25.443 44.733 5.386   1.00 78.40  ? 296  VAL A N   1 
ATOM   1847 C CA  . VAL A 1 252 ? -24.161 44.239 5.916   1.00 78.31  ? 296  VAL A CA  1 
ATOM   1848 C C   . VAL A 1 252 ? -23.044 45.274 5.761   1.00 78.77  ? 296  VAL A C   1 
ATOM   1849 O O   . VAL A 1 252 ? -23.002 46.005 4.774   1.00 79.34  ? 296  VAL A O   1 
ATOM   1850 C CB  . VAL A 1 252 ? -23.730 42.912 5.236   1.00 79.22  ? 296  VAL A CB  1 
ATOM   1851 C CG1 . VAL A 1 252 ? -23.461 43.119 3.772   1.00 80.36  ? 296  VAL A CG1 1 
ATOM   1852 C CG2 . VAL A 1 252 ? -22.499 42.345 5.905   1.00 79.69  ? 296  VAL A CG2 1 
ATOM   1853 N N   . SER A 1 253 ? -22.165 45.353 6.760   1.00 80.69  ? 297  SER A N   1 
ATOM   1854 C CA  . SER A 1 253 ? -21.060 46.311 6.726   1.00 81.67  ? 297  SER A CA  1 
ATOM   1855 C C   . SER A 1 253 ? -19.735 45.746 7.226   1.00 83.52  ? 297  SER A C   1 
ATOM   1856 O O   . SER A 1 253 ? -19.632 45.169 8.319   1.00 83.63  ? 297  SER A O   1 
ATOM   1857 C CB  . SER A 1 253 ? -21.399 47.553 7.536   1.00 80.57  ? 297  SER A CB  1 
ATOM   1858 O OG  . SER A 1 253 ? -20.289 48.431 7.573   1.00 81.80  ? 297  SER A OG  1 
ATOM   1859 N N   . THR A 1 254 ? -18.728 45.919 6.381   1.00 91.60  ? 298  THR A N   1 
ATOM   1860 C CA  . THR A 1 254 ? -17.383 45.430 6.618   1.00 94.07  ? 298  THR A CA  1 
ATOM   1861 C C   . THR A 1 254 ? -16.425 46.451 7.228   1.00 95.15  ? 298  THR A C   1 
ATOM   1862 O O   . THR A 1 254 ? -15.348 46.085 7.678   1.00 97.17  ? 298  THR A O   1 
ATOM   1863 C CB  . THR A 1 254 ? -16.802 44.972 5.301   1.00 95.95  ? 298  THR A CB  1 
ATOM   1864 O OG1 . THR A 1 254 ? -16.927 46.054 4.364   1.00 96.19  ? 298  THR A OG1 1 
ATOM   1865 C CG2 . THR A 1 254 ? -17.578 43.784 4.774   1.00 96.23  ? 298  THR A CG2 1 
ATOM   1866 N N   . ASP A 1 255 ? -16.810 47.724 7.222   1.00 123.43 ? 299  ASP A N   1 
ATOM   1867 C CA  . ASP A 1 255 ? -15.944 48.813 7.686   1.00 124.58 ? 299  ASP A CA  1 
ATOM   1868 C C   . ASP A 1 255 ? -16.233 49.329 9.095   1.00 123.89 ? 299  ASP A C   1 
ATOM   1869 O O   . ASP A 1 255 ? -15.717 50.382 9.474   1.00 124.55 ? 299  ASP A O   1 
ATOM   1870 C CB  . ASP A 1 255 ? -15.995 49.974 6.707   1.00 124.10 ? 299  ASP A CB  1 
ATOM   1871 C CG  . ASP A 1 255 ? -17.392 50.426 6.433   1.00 121.79 ? 299  ASP A CG  1 
ATOM   1872 O OD1 . ASP A 1 255 ? -18.216 50.414 7.373   1.00 120.65 ? 299  ASP A OD1 1 
ATOM   1873 O OD2 . ASP A 1 255 ? -17.666 50.782 5.269   1.00 121.28 ? 299  ASP A OD2 1 
ATOM   1874 N N   . GLN A 1 256 ? -17.098 48.621 9.822   1.00 106.43 ? 300  GLN A N   1 
ATOM   1875 C CA  . GLN A 1 256 ? -17.669 49.052 11.107  1.00 105.03 ? 300  GLN A CA  1 
ATOM   1876 C C   . GLN A 1 256 ? -18.657 50.203 10.957  1.00 102.78 ? 300  GLN A C   1 
ATOM   1877 O O   . GLN A 1 256 ? -18.710 51.106 11.792  1.00 102.44 ? 300  GLN A O   1 
ATOM   1878 C CB  . GLN A 1 256 ? -16.576 49.450 12.103  1.00 107.23 ? 300  GLN A CB  1 
ATOM   1879 C CG  . GLN A 1 256 ? -15.451 48.450 12.226  1.00 110.32 ? 300  GLN A CG  1 
ATOM   1880 C CD  . GLN A 1 256 ? -14.533 48.771 13.383  1.00 112.47 ? 300  GLN A CD  1 
ATOM   1881 O OE1 . GLN A 1 256 ? -14.637 48.173 14.461  1.00 112.77 ? 300  GLN A OE1 1 
ATOM   1882 N NE2 . GLN A 1 256 ? -13.631 49.730 13.176  1.00 113.97 ? 300  GLN A NE2 1 
ATOM   1883 N N   . GLY A 1 257 ? -19.441 50.155 9.885   1.00 89.82  ? 301  GLY A N   1 
ATOM   1884 C CA  . GLY A 1 257 ? -20.604 51.011 9.746   1.00 88.02  ? 301  GLY A CA  1 
ATOM   1885 C C   . GLY A 1 257 ? -20.510 52.157 8.758   1.00 88.41  ? 301  GLY A C   1 
ATOM   1886 O O   . GLY A 1 257 ? -21.529 52.746 8.408   1.00 87.44  ? 301  GLY A O   1 
ATOM   1887 N N   . ASP A 1 258 ? -19.303 52.479 8.306   1.00 127.15 ? 302  ASP A N   1 
ATOM   1888 C CA  . ASP A 1 258 ? -19.113 53.614 7.402   1.00 127.63 ? 302  ASP A CA  1 
ATOM   1889 C C   . ASP A 1 258 ? -19.849 53.442 6.057   1.00 127.33 ? 302  ASP A C   1 
ATOM   1890 O O   . ASP A 1 258 ? -20.336 54.428 5.490   1.00 127.39 ? 302  ASP A O   1 
ATOM   1891 C CB  . ASP A 1 258 ? -17.619 53.857 7.167   1.00 129.77 ? 302  ASP A CB  1 
ATOM   1892 C CG  . ASP A 1 258 ? -16.920 54.443 8.388   1.00 130.70 ? 302  ASP A CG  1 
ATOM   1893 O OD1 . ASP A 1 258 ? -17.516 55.309 9.064   1.00 129.67 ? 302  ASP A OD1 1 
ATOM   1894 O OD2 . ASP A 1 258 ? -15.773 54.039 8.675   1.00 132.75 ? 302  ASP A OD2 1 
ATOM   1895 N N   . THR A 1 259 ? -19.936 52.203 5.555   1.00 96.62  ? 303  THR A N   1 
ATOM   1896 C CA  . THR A 1 259 ? -20.713 51.890 4.335   1.00 96.61  ? 303  THR A CA  1 
ATOM   1897 C C   . THR A 1 259 ? -21.569 50.597 4.477   1.00 95.88  ? 303  THR A C   1 
ATOM   1898 O O   . THR A 1 259 ? -21.167 49.666 5.172   1.00 95.90  ? 303  THR A O   1 
ATOM   1899 C CB  . THR A 1 259 ? -19.776 51.777 3.074   1.00 98.39  ? 303  THR A CB  1 
ATOM   1900 O OG1 . THR A 1 259 ? -18.702 50.859 3.321   1.00 99.79  ? 303  THR A OG1 1 
ATOM   1901 C CG2 . THR A 1 259 ? -19.179 53.104 2.735   1.00 99.69  ? 303  THR A CG2 1 
ATOM   1902 N N   . TRP A 1 260 ? -22.736 50.563 3.816   1.00 104.62 ? 304  TRP A N   1 
ATOM   1903 C CA  . TRP A 1 260 ? -23.768 49.520 4.002   1.00 104.19 ? 304  TRP A CA  1 
ATOM   1904 C C   . TRP A 1 260 ? -24.348 48.843 2.740   1.00 104.92 ? 304  TRP A C   1 
ATOM   1905 O O   . TRP A 1 260 ? -24.995 49.490 1.924   1.00 105.41 ? 304  TRP A O   1 
ATOM   1906 C CB  . TRP A 1 260 ? -24.946 50.113 4.768   1.00 103.49 ? 304  TRP A CB  1 
ATOM   1907 C CG  . TRP A 1 260 ? -24.658 50.307 6.170   1.00 102.36 ? 304  TRP A CG  1 
ATOM   1908 C CD1 . TRP A 1 260 ? -24.206 51.439 6.765   1.00 101.99 ? 304  TRP A CD1 1 
ATOM   1909 C CD2 . TRP A 1 260 ? -24.783 49.328 7.190   1.00 101.59 ? 304  TRP A CD2 1 
ATOM   1910 N NE1 . TRP A 1 260 ? -24.048 51.228 8.109   1.00 101.14 ? 304  TRP A NE1 1 
ATOM   1911 C CE2 . TRP A 1 260 ? -24.401 49.936 8.396   1.00 100.82 ? 304  TRP A CE2 1 
ATOM   1912 C CE3 . TRP A 1 260 ? -25.195 47.995 7.204   1.00 101.60 ? 304  TRP A CE3 1 
ATOM   1913 C CZ2 . TRP A 1 260 ? -24.414 49.257 9.602   1.00 100.05 ? 304  TRP A CZ2 1 
ATOM   1914 C CZ3 . TRP A 1 260 ? -25.203 47.327 8.392   1.00 100.75 ? 304  TRP A CZ3 1 
ATOM   1915 C CH2 . TRP A 1 260 ? -24.816 47.953 9.579   1.00 99.95  ? 304  TRP A CH2 1 
ATOM   1916 N N   . SER A 1 261 ? -24.181 47.531 2.617   1.00 89.29  ? 305  SER A N   1 
ATOM   1917 C CA  . SER A 1 261 ? -24.845 46.779 1.546   1.00 90.12  ? 305  SER A CA  1 
ATOM   1918 C C   . SER A 1 261 ? -26.121 46.062 1.947   1.00 90.21  ? 305  SER A C   1 
ATOM   1919 O O   . SER A 1 261 ? -26.176 45.407 2.979   1.00 89.33  ? 305  SER A O   1 
ATOM   1920 C CB  . SER A 1 261 ? -23.917 45.718 0.979   1.00 90.50  ? 305  SER A CB  1 
ATOM   1921 O OG  . SER A 1 261 ? -23.009 46.306 0.098   1.00 91.93  ? 305  SER A OG  1 
ATOM   1922 N N   . MET A 1 262 ? -27.127 46.134 1.088   1.00 92.24  ? 306  MET A N   1 
ATOM   1923 C CA  . MET A 1 262 ? -28.256 45.243 1.233   1.00 92.96  ? 306  MET A CA  1 
ATOM   1924 C C   . MET A 1 262 ? -27.808 43.828 0.858   1.00 93.37  ? 306  MET A C   1 
ATOM   1925 O O   . MET A 1 262 ? -27.244 43.618 -0.209  1.00 94.27  ? 306  MET A O   1 
ATOM   1926 C CB  . MET A 1 262 ? -29.424 45.706 0.370   1.00 94.70  ? 306  MET A CB  1 
ATOM   1927 C CG  . MET A 1 262 ? -30.426 44.628 0.095   1.00 96.12  ? 306  MET A CG  1 
ATOM   1928 S SD  . MET A 1 262 ? -31.543 45.192 -1.166  1.00 98.42  ? 306  MET A SD  1 
ATOM   1929 C CE  . MET A 1 262 ? -32.315 46.563 -0.313  1.00 98.20  ? 306  MET A CE  1 
ATOM   1930 N N   . ALA A 1 263 ? -28.030 42.870 1.752   1.00 78.39  ? 307  ALA A N   1 
ATOM   1931 C CA  . ALA A 1 263 ? -27.716 41.465 1.496   1.00 78.65  ? 307  ALA A CA  1 
ATOM   1932 C C   . ALA A 1 263 ? -28.651 40.878 0.441   1.00 80.65  ? 307  ALA A C   1 
ATOM   1933 O O   . ALA A 1 263 ? -29.772 41.348 0.304   1.00 82.01  ? 307  ALA A O   1 
ATOM   1934 C CB  . ALA A 1 263 ? -27.816 40.669 2.785   1.00 77.53  ? 307  ALA A CB  1 
ATOM   1935 N N   . GLN A 1 264 ? -28.233 39.855 -0.301  1.00 94.52  ? 308  GLN A N   1 
ATOM   1936 C CA  . GLN A 1 264 ? -29.234 39.199 -1.113  1.00 96.41  ? 308  GLN A CA  1 
ATOM   1937 C C   . GLN A 1 264 ? -29.807 38.084 -0.272  1.00 96.19  ? 308  GLN A C   1 
ATOM   1938 O O   . GLN A 1 264 ? -29.406 36.931 -0.371  1.00 95.66  ? 308  GLN A O   1 
ATOM   1939 C CB  . GLN A 1 264 ? -28.623 38.647 -2.391  1.00 97.16  ? 308  GLN A CB  1 
ATOM   1940 C CG  . GLN A 1 264 ? -29.573 37.811 -3.248  1.00 99.24  ? 308  GLN A CG  1 
ATOM   1941 C CD  . GLN A 1 264 ? -28.890 36.600 -3.890  1.00 99.23  ? 308  GLN A CD  1 
ATOM   1942 O OE1 . GLN A 1 264 ? -27.830 36.146 -3.431  1.00 97.08  ? 308  GLN A OE1 1 
ATOM   1943 N NE2 . GLN A 1 264 ? -29.492 36.080 -4.966  1.00 101.65 ? 308  GLN A NE2 1 
ATOM   1944 N N   . LEU A 1 265 ? -30.876 38.445 0.426   1.00 70.87  ? 309  LEU A N   1 
ATOM   1945 C CA  . LEU A 1 265 ? -31.610 37.607 1.371   1.00 71.01  ? 309  LEU A CA  1 
ATOM   1946 C C   . LEU A 1 265 ? -33.065 38.048 1.303   1.00 73.24  ? 309  LEU A C   1 
ATOM   1947 O O   . LEU A 1 265 ? -33.359 39.221 1.011   1.00 73.55  ? 309  LEU A O   1 
ATOM   1948 C CB  . LEU A 1 265 ? -31.078 37.748 2.791   1.00 68.66  ? 309  LEU A CB  1 
ATOM   1949 C CG  . LEU A 1 265 ? -29.805 37.002 3.171   1.00 66.14  ? 309  LEU A CG  1 
ATOM   1950 C CD1 . LEU A 1 265 ? -29.431 37.319 4.614   1.00 64.06  ? 309  LEU A CD1 1 
ATOM   1951 C CD2 . LEU A 1 265 ? -30.015 35.523 2.987   1.00 65.66  ? 309  LEU A CD2 1 
ATOM   1952 N N   . PRO A 1 266 ? -33.987 37.116 1.542   1.00 69.74  ? 310  PRO A N   1 
ATOM   1953 C CA  . PRO A 1 266 ? -35.383 37.558 1.524   1.00 70.72  ? 310  PRO A CA  1 
ATOM   1954 C C   . PRO A 1 266 ? -35.696 38.465 2.717   1.00 68.88  ? 310  PRO A C   1 
ATOM   1955 O O   . PRO A 1 266 ? -35.126 38.317 3.801   1.00 66.66  ? 310  PRO A O   1 
ATOM   1956 C CB  . PRO A 1 266 ? -36.175 36.248 1.588   1.00 71.30  ? 310  PRO A CB  1 
ATOM   1957 C CG  . PRO A 1 266 ? -35.239 35.267 2.201   1.00 69.20  ? 310  PRO A CG  1 
ATOM   1958 C CD  . PRO A 1 266 ? -33.852 35.665 1.741   1.00 69.19  ? 310  PRO A CD  1 
ATOM   1959 N N   . SER A 1 267 ? -36.579 39.428 2.490   1.00 77.40  ? 311  SER A N   1 
ATOM   1960 C CA  . SER A 1 267 ? -37.129 40.229 3.563   1.00 76.23  ? 311  SER A CA  1 
ATOM   1961 C C   . SER A 1 267 ? -38.031 39.363 4.425   1.00 75.84  ? 311  SER A C   1 
ATOM   1962 O O   . SER A 1 267 ? -38.518 38.319 3.983   1.00 76.93  ? 311  SER A O   1 
ATOM   1963 C CB  . SER A 1 267 ? -37.908 41.413 2.994   1.00 77.61  ? 311  SER A CB  1 
ATOM   1964 O OG  . SER A 1 267 ? -38.602 40.997 1.838   1.00 79.80  ? 311  SER A OG  1 
ATOM   1965 N N   . VAL A 1 268 ? -38.245 39.797 5.660   1.00 78.26  ? 312  VAL A N   1 
ATOM   1966 C CA  . VAL A 1 268 ? -39.146 39.095 6.557   1.00 78.56  ? 312  VAL A CA  1 
ATOM   1967 C C   . VAL A 1 268 ? -40.223 40.012 7.152   1.00 79.74  ? 312  VAL A C   1 
ATOM   1968 O O   . VAL A 1 268 ? -40.079 41.240 7.153   1.00 79.59  ? 312  VAL A O   1 
ATOM   1969 C CB  . VAL A 1 268 ? -38.372 38.444 7.683   1.00 76.52  ? 312  VAL A CB  1 
ATOM   1970 C CG1 . VAL A 1 268 ? -37.325 37.508 7.109   1.00 75.34  ? 312  VAL A CG1 1 
ATOM   1971 C CG2 . VAL A 1 268 ? -37.742 39.517 8.564   1.00 75.13  ? 312  VAL A CG2 1 
ATOM   1972 N N   . GLY A 1 269 ? -41.301 39.401 7.650   1.00 81.89  ? 313  GLY A N   1 
ATOM   1973 C CA  . GLY A 1 269 ? -42.356 40.115 8.355   1.00 83.35  ? 313  GLY A CA  1 
ATOM   1974 C C   . GLY A 1 269 ? -41.974 40.404 9.795   1.00 82.43  ? 313  GLY A C   1 
ATOM   1975 O O   . GLY A 1 269 ? -40.790 40.421 10.129  1.00 80.32  ? 313  GLY A O   1 
ATOM   1976 N N   . GLN A 1 270 ? -42.950 40.668 10.657  1.00 102.28 ? 314  GLN A N   1 
ATOM   1977 C CA  . GLN A 1 270 ? -42.628 40.858 12.069  1.00 101.93 ? 314  GLN A CA  1 
ATOM   1978 C C   . GLN A 1 270 ? -42.813 39.577 12.866  1.00 103.25 ? 314  GLN A C   1 
ATOM   1979 O O   . GLN A 1 270 ? -42.412 39.463 14.013  1.00 103.02 ? 314  GLN A O   1 
ATOM   1980 C CB  . GLN A 1 270 ? -43.457 41.990 12.643  1.00 103.46 ? 314  GLN A CB  1 
ATOM   1981 C CG  . GLN A 1 270 ? -42.749 43.306 12.451  1.00 101.86 ? 314  GLN A CG  1 
ATOM   1982 C CD  . GLN A 1 270 ? -43.557 44.505 12.888  1.00 103.52 ? 314  GLN A CD  1 
ATOM   1983 O OE1 . GLN A 1 270 ? -44.796 44.525 12.810  1.00 105.57 ? 314  GLN A OE1 1 
ATOM   1984 N NE2 . GLN A 1 270 ? -42.853 45.526 13.360  1.00 102.73 ? 314  GLN A NE2 1 
ATOM   1985 N N   . GLU A 1 271 ? -43.424 38.623 12.187  1.00 121.48 ? 315  GLU A N   1 
ATOM   1986 C CA  . GLU A 1 271 ? -43.527 37.228 12.593  1.00 123.03 ? 315  GLU A CA  1 
ATOM   1987 C C   . GLU A 1 271 ? -42.186 36.453 12.622  1.00 120.37 ? 315  GLU A C   1 
ATOM   1988 O O   . GLU A 1 271 ? -42.010 35.451 13.345  1.00 121.24 ? 315  GLU A O   1 
ATOM   1989 C CB  . GLU A 1 271 ? -44.462 36.547 11.602  1.00 124.78 ? 315  GLU A CB  1 
ATOM   1990 C CG  . GLU A 1 271 ? -45.847 37.146 11.741  1.00 118.85 ? 315  GLU A CG  1 
ATOM   1991 C CD  . GLU A 1 271 ? -46.473 37.055 13.102  1.00 119.16 ? 315  GLU A CD  1 
ATOM   1992 O OE1 . GLU A 1 271 ? -46.348 36.015 13.796  1.00 121.56 ? 315  GLU A OE1 1 
ATOM   1993 O OE2 . GLU A 1 271 ? -47.054 38.082 13.489  1.00 116.76 ? 315  GLU A OE2 1 
ATOM   1994 N N   . GLN A 1 272 ? -41.255 36.926 11.807  1.00 79.79  ? 316  GLN A N   1 
ATOM   1995 C CA  . GLN A 1 272 ? -40.100 36.132 11.439  1.00 77.56  ? 316  GLN A CA  1 
ATOM   1996 C C   . GLN A 1 272 ? -38.828 36.694 12.047  1.00 74.91  ? 316  GLN A C   1 
ATOM   1997 O O   . GLN A 1 272 ? -38.839 37.759 12.642  1.00 74.42  ? 316  GLN A O   1 
ATOM   1998 C CB  . GLN A 1 272 ? -39.982 36.102 9.912   1.00 76.62  ? 316  GLN A CB  1 
ATOM   1999 C CG  . GLN A 1 272 ? -41.061 35.303 9.218   1.00 79.40  ? 316  GLN A CG  1 
ATOM   2000 C CD  . GLN A 1 272 ? -41.124 35.591 7.742   1.00 79.56  ? 316  GLN A CD  1 
ATOM   2001 O OE1 . GLN A 1 272 ? -41.833 36.503 7.317   1.00 80.77  ? 316  GLN A OE1 1 
ATOM   2002 N NE2 . GLN A 1 272 ? -40.395 34.813 6.945   1.00 78.82  ? 316  GLN A NE2 1 
ATOM   2003 N N   . PHE A 1 273 ? -37.722 36.005 11.869  1.00 61.08  ? 317  PHE A N   1 
ATOM   2004 C CA  . PHE A 1 273 ? -36.456 36.506 12.407  1.00 58.56  ? 317  PHE A CA  1 
ATOM   2005 C C   . PHE A 1 273 ? -35.306 36.044 11.551  1.00 56.27  ? 317  PHE A C   1 
ATOM   2006 O O   . PHE A 1 273 ? -35.446 35.095 10.775  1.00 56.67  ? 317  PHE A O   1 
ATOM   2007 C CB  . PHE A 1 273 ? -36.232 36.027 13.835  1.00 59.55  ? 317  PHE A CB  1 
ATOM   2008 C CG  . PHE A 1 273 ? -36.196 34.538 13.955  1.00 61.13  ? 317  PHE A CG  1 
ATOM   2009 C CD1 . PHE A 1 273 ? -37.366 33.817 14.160  1.00 64.61  ? 317  PHE A CD1 1 
ATOM   2010 C CD2 . PHE A 1 273 ? -35.004 33.848 13.832  1.00 59.65  ? 317  PHE A CD2 1 
ATOM   2011 C CE1 . PHE A 1 273 ? -37.345 32.432 14.250  1.00 66.93  ? 317  PHE A CE1 1 
ATOM   2012 C CE2 . PHE A 1 273 ? -34.979 32.464 13.922  1.00 61.80  ? 317  PHE A CE2 1 
ATOM   2013 C CZ  . PHE A 1 273 ? -36.163 31.757 14.129  1.00 65.69  ? 317  PHE A CZ  1 
ATOM   2014 N N   . TYR A 1 274 ? -34.171 36.718 11.696  1.00 58.88  ? 318  TYR A N   1 
ATOM   2015 C CA  . TYR A 1 274 ? -32.900 36.222 11.190  1.00 58.63  ? 318  TYR A CA  1 
ATOM   2016 C C   . TYR A 1 274 ? -32.102 35.687 12.370  1.00 56.87  ? 318  TYR A C   1 
ATOM   2017 O O   . TYR A 1 274 ? -32.203 36.186 13.484  1.00 55.98  ? 318  TYR A O   1 
ATOM   2018 C CB  . TYR A 1 274 ? -32.119 37.316 10.505  1.00 59.54  ? 318  TYR A CB  1 
ATOM   2019 C CG  . TYR A 1 274 ? -32.827 37.956 9.377   1.00 60.98  ? 318  TYR A CG  1 
ATOM   2020 C CD1 . TYR A 1 274 ? -32.913 37.322 8.146   1.00 61.90  ? 318  TYR A CD1 1 
ATOM   2021 C CD2 . TYR A 1 274 ? -33.392 39.205 9.514   1.00 61.27  ? 318  TYR A CD2 1 
ATOM   2022 C CE1 . TYR A 1 274 ? -33.553 37.904 7.090   1.00 63.00  ? 318  TYR A CE1 1 
ATOM   2023 C CE2 . TYR A 1 274 ? -34.032 39.809 8.455   1.00 62.55  ? 318  TYR A CE2 1 
ATOM   2024 C CZ  . TYR A 1 274 ? -34.109 39.152 7.246   1.00 63.45  ? 318  TYR A CZ  1 
ATOM   2025 O OH  . TYR A 1 274 ? -34.759 39.748 6.189   1.00 65.05  ? 318  TYR A OH  1 
ATOM   2026 N N   . SER A 1 275 ? -31.300 34.676 12.139  1.00 78.09  ? 319  SER A N   1 
ATOM   2027 C CA  . SER A 1 275 ? -30.427 34.232 13.188  1.00 76.42  ? 319  SER A CA  1 
ATOM   2028 C C   . SER A 1 275 ? -29.082 34.012 12.532  1.00 76.41  ? 319  SER A C   1 
ATOM   2029 O O   . SER A 1 275 ? -29.006 33.396 11.470  1.00 76.84  ? 319  SER A O   1 
ATOM   2030 C CB  . SER A 1 275 ? -30.983 32.966 13.829  1.00 75.43  ? 319  SER A CB  1 
ATOM   2031 O OG  . SER A 1 275 ? -30.531 32.796 15.153  1.00 73.77  ? 319  SER A OG  1 
ATOM   2032 N N   . ILE A 1 276 ? -28.020 34.549 13.125  1.00 46.01  ? 320  ILE A N   1 
ATOM   2033 C CA  . ILE A 1 276 ? -26.666 34.252 12.638  1.00 46.53  ? 320  ILE A CA  1 
ATOM   2034 C C   . ILE A 1 276 ? -26.274 32.943 13.272  1.00 44.27  ? 320  ILE A C   1 
ATOM   2035 O O   . ILE A 1 276 ? -26.064 32.864 14.476  1.00 43.10  ? 320  ILE A O   1 
ATOM   2036 C CB  . ILE A 1 276 ? -25.668 35.325 13.048  1.00 48.01  ? 320  ILE A CB  1 
ATOM   2037 C CG1 . ILE A 1 276 ? -26.009 36.639 12.358  1.00 50.06  ? 320  ILE A CG1 1 
ATOM   2038 C CG2 . ILE A 1 276 ? -24.207 34.875 12.748  1.00 49.20  ? 320  ILE A CG2 1 
ATOM   2039 C CD1 . ILE A 1 276 ? -25.345 37.804 13.013  1.00 50.25  ? 320  ILE A CD1 1 
ATOM   2040 N N   . LEU A 1 277 ? -26.166 31.905 12.470  1.00 52.34  ? 321  LEU A N   1 
ATOM   2041 C CA  . LEU A 1 277 ? -25.911 30.604 13.043  1.00 50.56  ? 321  LEU A CA  1 
ATOM   2042 C C   . LEU A 1 277 ? -24.415 30.422 13.343  1.00 50.56  ? 321  LEU A C   1 
ATOM   2043 O O   . LEU A 1 277 ? -24.054 29.836 14.353  1.00 49.39  ? 321  LEU A O   1 
ATOM   2044 C CB  . LEU A 1 277 ? -26.414 29.526 12.095  1.00 49.94  ? 321  LEU A CB  1 
ATOM   2045 C CG  . LEU A 1 277 ? -27.918 29.480 11.860  1.00 51.04  ? 321  LEU A CG  1 
ATOM   2046 C CD1 . LEU A 1 277 ? -28.228 28.435 10.814  1.00 51.48  ? 321  LEU A CD1 1 
ATOM   2047 C CD2 . LEU A 1 277 ? -28.636 29.163 13.180  1.00 51.17  ? 321  LEU A CD2 1 
ATOM   2048 N N   . ALA A 1 278 ? -23.549 30.857 12.428  1.00 49.39  ? 322  ALA A N   1 
ATOM   2049 C CA  . ALA A 1 278 ? -22.121 30.784 12.647  1.00 50.83  ? 322  ALA A CA  1 
ATOM   2050 C C   . ALA A 1 278 ? -21.432 31.801 11.762  1.00 54.97  ? 322  ALA A C   1 
ATOM   2051 O O   . ALA A 1 278 ? -21.872 32.035 10.631  1.00 55.47  ? 322  ALA A O   1 
ATOM   2052 C CB  . ALA A 1 278 ? -21.586 29.382 12.363  1.00 49.62  ? 322  ALA A CB  1 
ATOM   2053 N N   . ALA A 1 279 ? -20.334 32.364 12.248  1.00 52.14  ? 323  ALA A N   1 
ATOM   2054 C CA  . ALA A 1 279 ? -19.589 33.330 11.469  1.00 54.51  ? 323  ALA A CA  1 
ATOM   2055 C C   . ALA A 1 279 ? -18.048 33.165 11.682  1.00 53.72  ? 323  ALA A C   1 
ATOM   2056 O O   . ALA A 1 279 ? -17.572 32.789 12.783  1.00 51.33  ? 323  ALA A O   1 
ATOM   2057 C CB  . ALA A 1 279 ? -20.043 34.719 11.822  1.00 53.95  ? 323  ALA A CB  1 
ATOM   2058 N N   . ASN A 1 280 ? -17.295 33.391 10.600  1.00 51.15  ? 324  ASN A N   1 
ATOM   2059 C CA  . ASN A 1 280 ? -15.828 33.257 10.548  1.00 50.36  ? 324  ASN A CA  1 
ATOM   2060 C C   . ASN A 1 280 ? -15.256 34.296 9.576   1.00 50.73  ? 324  ASN A C   1 
ATOM   2061 O O   . ASN A 1 280 ? -16.011 34.833 8.766   1.00 51.09  ? 324  ASN A O   1 
ATOM   2062 C CB  . ASN A 1 280 ? -15.427 31.846 10.120  1.00 50.53  ? 324  ASN A CB  1 
ATOM   2063 C CG  . ASN A 1 280 ? -15.914 31.499 8.727   1.00 52.15  ? 324  ASN A CG  1 
ATOM   2064 O OD1 . ASN A 1 280 ? -16.319 32.375 7.962   1.00 52.47  ? 324  ASN A OD1 1 
ATOM   2065 N ND2 . ASN A 1 280 ? -15.878 30.215 8.391   1.00 52.34  ? 324  ASN A ND2 1 
ATOM   2066 N N   . ASP A 1 281 ? -13.959 34.618 9.639   1.00 101.40 ? 325  ASP A N   1 
ATOM   2067 C CA  . ASP A 1 281 ? -13.520 35.769 8.852   1.00 101.54 ? 325  ASP A CA  1 
ATOM   2068 C C   . ASP A 1 281 ? -13.810 35.596 7.371   1.00 102.64 ? 325  ASP A C   1 
ATOM   2069 O O   . ASP A 1 281 ? -13.768 36.558 6.616   1.00 102.61 ? 325  ASP A O   1 
ATOM   2070 C CB  . ASP A 1 281 ? -12.040 36.065 9.063   1.00 100.81 ? 325  ASP A CB  1 
ATOM   2071 C CG  . ASP A 1 281 ? -11.767 36.761 10.391  1.00 99.16  ? 325  ASP A CG  1 
ATOM   2072 O OD1 . ASP A 1 281 ? -12.724 37.296 11.013  1.00 98.23  ? 325  ASP A OD1 1 
ATOM   2073 O OD2 . ASP A 1 281 ? -10.584 36.789 10.801  1.00 98.83  ? 325  ASP A OD2 1 
ATOM   2074 N N   . ASP A 1 282 ? -14.106 34.370 6.961   1.00 73.65  ? 326  ASP A N   1 
ATOM   2075 C CA  . ASP A 1 282 ? -14.539 34.095 5.588   1.00 73.80  ? 326  ASP A CA  1 
ATOM   2076 C C   . ASP A 1 282 ? -16.028 34.325 5.255   1.00 73.22  ? 326  ASP A C   1 
ATOM   2077 O O   . ASP A 1 282 ? -16.306 34.806 4.163   1.00 72.65  ? 326  ASP A O   1 
ATOM   2078 C CB  . ASP A 1 282 ? -14.203 32.660 5.202   1.00 73.94  ? 326  ASP A CB  1 
ATOM   2079 C CG  . ASP A 1 282 ? -12.811 32.267 5.602   1.00 74.49  ? 326  ASP A CG  1 
ATOM   2080 O OD1 . ASP A 1 282 ? -11.838 32.782 4.998   1.00 74.67  ? 326  ASP A OD1 1 
ATOM   2081 O OD2 . ASP A 1 282 ? -12.695 31.437 6.537   1.00 74.51  ? 326  ASP A OD2 1 
ATOM   2082 N N   . MET A 1 283 ? -16.968 33.949 6.143   1.00 67.02  ? 327  MET A N   1 
ATOM   2083 C CA  . MET A 1 283 ? -18.400 33.942 5.808   1.00 66.09  ? 327  MET A CA  1 
ATOM   2084 C C   . MET A 1 283 ? -19.372 33.738 6.986   1.00 66.26  ? 327  MET A C   1 
ATOM   2085 O O   . MET A 1 283 ? -18.949 33.417 8.104   1.00 67.07  ? 327  MET A O   1 
ATOM   2086 C CB  . MET A 1 283 ? -18.671 32.836 4.788   1.00 64.20  ? 327  MET A CB  1 
ATOM   2087 C CG  . MET A 1 283 ? -18.214 31.457 5.230   1.00 63.78  ? 327  MET A CG  1 
ATOM   2088 S SD  . MET A 1 283 ? -19.337 30.556 6.349   1.00 62.04  ? 327  MET A SD  1 
ATOM   2089 C CE  . MET A 1 283 ? -20.452 29.813 5.166   1.00 58.15  ? 327  MET A CE  1 
ATOM   2090 N N   . VAL A 1 284 ? -20.679 33.852 6.713   1.00 58.93  ? 328  VAL A N   1 
ATOM   2091 C CA  . VAL A 1 284 ? -21.711 33.503 7.707   1.00 58.45  ? 328  VAL A CA  1 
ATOM   2092 C C   . VAL A 1 284 ? -22.699 32.465 7.241   1.00 54.88  ? 328  VAL A C   1 
ATOM   2093 O O   . VAL A 1 284 ? -23.011 32.327 6.049   1.00 53.84  ? 328  VAL A O   1 
ATOM   2094 C CB  . VAL A 1 284 ? -22.573 34.710 8.165   1.00 60.45  ? 328  VAL A CB  1 
ATOM   2095 C CG1 . VAL A 1 284 ? -21.739 35.696 8.940   1.00 61.25  ? 328  VAL A CG1 1 
ATOM   2096 C CG2 . VAL A 1 284 ? -23.226 35.385 6.989   1.00 60.14  ? 328  VAL A CG2 1 
ATOM   2097 N N   . PHE A 1 285 ? -23.193 31.732 8.216   1.00 54.96  ? 329  PHE A N   1 
ATOM   2098 C CA  . PHE A 1 285 ? -24.382 30.924 8.034   1.00 52.46  ? 329  PHE A CA  1 
ATOM   2099 C C   . PHE A 1 285 ? -25.568 31.734 8.517   1.00 53.86  ? 329  PHE A C   1 
ATOM   2100 O O   . PHE A 1 285 ? -25.689 32.001 9.711   1.00 53.84  ? 329  PHE A O   1 
ATOM   2101 C CB  . PHE A 1 285 ? -24.290 29.627 8.826   1.00 50.14  ? 329  PHE A CB  1 
ATOM   2102 C CG  . PHE A 1 285 ? -23.455 28.578 8.192   1.00 49.10  ? 329  PHE A CG  1 
ATOM   2103 C CD1 . PHE A 1 285 ? -22.099 28.515 8.435   1.00 50.65  ? 329  PHE A CD1 1 
ATOM   2104 C CD2 . PHE A 1 285 ? -24.026 27.631 7.381   1.00 47.67  ? 329  PHE A CD2 1 
ATOM   2105 C CE1 . PHE A 1 285 ? -21.338 27.526 7.876   1.00 50.47  ? 329  PHE A CE1 1 
ATOM   2106 C CE2 . PHE A 1 285 ? -23.273 26.633 6.825   1.00 47.04  ? 329  PHE A CE2 1 
ATOM   2107 C CZ  . PHE A 1 285 ? -21.928 26.576 7.076   1.00 48.31  ? 329  PHE A CZ  1 
ATOM   2108 N N   . MET A 1 286 ? -26.449 32.129 7.618   1.00 55.24  ? 330  MET A N   1 
ATOM   2109 C CA  . MET A 1 286 ? -27.605 32.875 8.070   1.00 57.30  ? 330  MET A CA  1 
ATOM   2110 C C   . MET A 1 286 ? -28.894 32.045 8.024   1.00 57.25  ? 330  MET A C   1 
ATOM   2111 O O   . MET A 1 286 ? -29.228 31.423 7.012   1.00 58.45  ? 330  MET A O   1 
ATOM   2112 C CB  . MET A 1 286 ? -27.749 34.136 7.247   1.00 60.81  ? 330  MET A CB  1 
ATOM   2113 C CG  . MET A 1 286 ? -28.881 35.022 7.705   1.00 61.12  ? 330  MET A CG  1 
ATOM   2114 S SD  . MET A 1 286 ? -28.441 36.028 9.125   1.00 60.39  ? 330  MET A SD  1 
ATOM   2115 C CE  . MET A 1 286 ? -27.318 37.231 8.400   1.00 61.91  ? 330  MET A CE  1 
ATOM   2116 N N   . HIS A 1 287 ? -29.603 32.012 9.139   1.00 53.39  ? 331  HIS A N   1 
ATOM   2117 C CA  . HIS A 1 287 ? -30.930 31.392 9.172   1.00 54.23  ? 331  HIS A CA  1 
ATOM   2118 C C   . HIS A 1 287 ? -32.037 32.419 8.933   1.00 55.81  ? 331  HIS A C   1 
ATOM   2119 O O   . HIS A 1 287 ? -32.160 33.398 9.667   1.00 55.45  ? 331  HIS A O   1 
ATOM   2120 C CB  . HIS A 1 287 ? -31.172 30.688 10.510  1.00 52.72  ? 331  HIS A CB  1 
ATOM   2121 C CG  . HIS A 1 287 ? -32.534 30.077 10.630  1.00 54.11  ? 331  HIS A CG  1 
ATOM   2122 N ND1 . HIS A 1 287 ? -32.800 28.769 10.286  1.00 54.81  ? 331  HIS A ND1 1 
ATOM   2123 C CD2 . HIS A 1 287 ? -33.709 30.597 11.054  1.00 55.03  ? 331  HIS A CD2 1 
ATOM   2124 C CE1 . HIS A 1 287 ? -34.073 28.503 10.510  1.00 56.00  ? 331  HIS A CE1 1 
ATOM   2125 N NE2 . HIS A 1 287 ? -34.643 29.595 10.979  1.00 56.18  ? 331  HIS A NE2 1 
ATOM   2126 N N   . VAL A 1 288 ? -32.852 32.200 7.912   1.00 53.86  ? 332  VAL A N   1 
ATOM   2127 C CA  . VAL A 1 288 ? -34.061 33.030 7.728   1.00 54.82  ? 332  VAL A CA  1 
ATOM   2128 C C   . VAL A 1 288 ? -35.331 32.257 8.097   1.00 55.21  ? 332  VAL A C   1 
ATOM   2129 O O   . VAL A 1 288 ? -35.576 31.170 7.555   1.00 55.35  ? 332  VAL A O   1 
ATOM   2130 C CB  . VAL A 1 288 ? -34.176 33.532 6.287   1.00 55.81  ? 332  VAL A CB  1 
ATOM   2131 C CG1 . VAL A 1 288 ? -35.503 34.259 6.076   1.00 56.84  ? 332  VAL A CG1 1 
ATOM   2132 C CG2 . VAL A 1 288 ? -32.979 34.421 5.940   1.00 55.85  ? 332  VAL A CG2 1 
ATOM   2133 N N   . ASP A 1 289 ? -36.130 32.804 9.019   1.00 70.30  ? 333  ASP A N   1 
ATOM   2134 C CA  . ASP A 1 289 ? -37.382 32.155 9.404   1.00 71.21  ? 333  ASP A CA  1 
ATOM   2135 C C   . ASP A 1 289 ? -38.396 32.143 8.278   1.00 72.67  ? 333  ASP A C   1 
ATOM   2136 O O   . ASP A 1 289 ? -38.533 33.114 7.546   1.00 73.21  ? 333  ASP A O   1 
ATOM   2137 C CB  . ASP A 1 289 ? -38.033 32.821 10.609  1.00 71.31  ? 333  ASP A CB  1 
ATOM   2138 C CG  . ASP A 1 289 ? -39.070 31.903 11.260  1.00 72.27  ? 333  ASP A CG  1 
ATOM   2139 O OD1 . ASP A 1 289 ? -38.690 30.708 11.394  1.00 71.82  ? 333  ASP A OD1 1 
ATOM   2140 O OD2 . ASP A 1 289 ? -40.210 32.323 11.610  1.00 73.54  ? 333  ASP A OD2 1 
ATOM   2141 N N   . GLU A 1 290 ? -39.120 31.040 8.169   1.00 84.82  ? 334  GLU A N   1 
ATOM   2142 C CA  . GLU A 1 290 ? -40.170 30.896 7.176   1.00 86.18  ? 334  GLU A CA  1 
ATOM   2143 C C   . GLU A 1 290 ? -41.476 31.608 7.604   1.00 87.96  ? 334  GLU A C   1 
ATOM   2144 O O   . GLU A 1 290 ? -41.830 31.620 8.805   1.00 88.27  ? 334  GLU A O   1 
ATOM   2145 C CB  . GLU A 1 290 ? -40.418 29.408 6.933   1.00 86.12  ? 334  GLU A CB  1 
ATOM   2146 C CG  . GLU A 1 290 ? -40.994 29.070 5.588   1.00 86.83  ? 334  GLU A CG  1 
ATOM   2147 C CD  . GLU A 1 290 ? -40.053 29.438 4.467   1.00 85.78  ? 334  GLU A CD  1 
ATOM   2148 O OE1 . GLU A 1 290 ? -38.806 29.327 4.667   1.00 84.24  ? 334  GLU A OE1 1 
ATOM   2149 O OE2 . GLU A 1 290 ? -40.562 29.854 3.397   1.00 86.64  ? 334  GLU A OE2 1 
ATOM   2150 N N   . PRO A 1 291 ? -42.193 32.214 6.624   1.00 74.86  ? 335  PRO A N   1 
ATOM   2151 C CA  . PRO A 1 291 ? -43.510 32.849 6.869   1.00 78.24  ? 335  PRO A CA  1 
ATOM   2152 C C   . PRO A 1 291 ? -44.486 31.817 7.410   1.00 80.90  ? 335  PRO A C   1 
ATOM   2153 O O   . PRO A 1 291 ? -44.432 30.669 6.962   1.00 80.78  ? 335  PRO A O   1 
ATOM   2154 C CB  . PRO A 1 291 ? -43.948 33.342 5.489   1.00 81.60  ? 335  PRO A CB  1 
ATOM   2155 C CG  . PRO A 1 291 ? -42.729 33.413 4.685   1.00 78.20  ? 335  PRO A CG  1 
ATOM   2156 C CD  . PRO A 1 291 ? -41.781 32.349 5.216   1.00 74.87  ? 335  PRO A CD  1 
ATOM   2157 N N   . GLY A 1 292 ? -45.329 32.207 8.364   1.00 90.35  ? 336  GLY A N   1 
ATOM   2158 C CA  . GLY A 1 292 ? -46.250 31.296 9.036   1.00 93.41  ? 336  GLY A CA  1 
ATOM   2159 C C   . GLY A 1 292 ? -45.602 30.631 10.241  1.00 89.90  ? 336  GLY A C   1 
ATOM   2160 O O   . GLY A 1 292 ? -44.374 30.540 10.300  1.00 85.14  ? 336  GLY A O   1 
ATOM   2161 N N   . ASP A 1 293 ? -46.363 30.031 11.147  1.00 138.34 ? 337  ASP A N   1 
ATOM   2162 C CA  . ASP A 1 293 ? -45.699 29.410 12.295  1.00 136.51 ? 337  ASP A CA  1 
ATOM   2163 C C   . ASP A 1 293 ? -45.144 28.027 11.933  1.00 135.55 ? 337  ASP A C   1 
ATOM   2164 O O   . ASP A 1 293 ? -45.590 27.003 12.450  1.00 138.17 ? 337  ASP A O   1 
ATOM   2165 C CB  . ASP A 1 293 ? -46.663 29.298 13.478  1.00 140.03 ? 337  ASP A CB  1 
ATOM   2166 C CG  . ASP A 1 293 ? -45.986 28.789 14.735  1.00 137.93 ? 337  ASP A CG  1 
ATOM   2167 O OD1 . ASP A 1 293 ? -44.816 28.362 14.651  1.00 134.33 ? 337  ASP A OD1 1 
ATOM   2168 O OD2 . ASP A 1 293 ? -46.625 28.816 15.808  1.00 140.66 ? 337  ASP A OD2 1 
ATOM   2169 N N   . THR A 1 294 ? -44.162 28.027 11.031  1.00 79.38  ? 338  THR A N   1 
ATOM   2170 C CA  . THR A 1 294 ? -43.505 26.812 10.532  1.00 78.61  ? 338  THR A CA  1 
ATOM   2171 C C   . THR A 1 294 ? -42.663 25.981 11.515  1.00 77.42  ? 338  THR A C   1 
ATOM   2172 O O   . THR A 1 294 ? -42.722 24.752 11.496  1.00 77.93  ? 338  THR A O   1 
ATOM   2173 C CB  . THR A 1 294 ? -42.634 27.124 9.298   1.00 76.91  ? 338  THR A CB  1 
ATOM   2174 O OG1 . THR A 1 294 ? -41.662 28.121 9.635   1.00 75.52  ? 338  THR A OG1 1 
ATOM   2175 C CG2 . THR A 1 294 ? -43.496 27.629 8.151   1.00 78.26  ? 338  THR A CG2 1 
ATOM   2176 N N   . GLY A 1 295 ? -41.874 26.645 12.358  1.00 79.67  ? 339  GLY A N   1 
ATOM   2177 C CA  . GLY A 1 295 ? -40.918 25.956 13.215  1.00 78.33  ? 339  GLY A CA  1 
ATOM   2178 C C   . GLY A 1 295 ? -39.618 25.612 12.497  1.00 76.76  ? 339  GLY A C   1 
ATOM   2179 O O   . GLY A 1 295 ? -38.761 24.904 13.026  1.00 75.83  ? 339  GLY A O   1 
ATOM   2180 N N   . PHE A 1 296 ? -39.489 26.129 11.280  1.00 71.20  ? 340  PHE A N   1 
ATOM   2181 C CA  . PHE A 1 296 ? -38.362 25.928 10.405  1.00 69.52  ? 340  PHE A CA  1 
ATOM   2182 C C   . PHE A 1 296 ? -38.120 27.141 9.521   1.00 69.14  ? 340  PHE A C   1 
ATOM   2183 O O   . PHE A 1 296 ? -38.971 28.018 9.363   1.00 70.21  ? 340  PHE A O   1 
ATOM   2184 C CB  . PHE A 1 296 ? -38.537 24.673 9.546   1.00 69.21  ? 340  PHE A CB  1 
ATOM   2185 C CG  . PHE A 1 296 ? -39.611 24.786 8.508   1.00 70.17  ? 340  PHE A CG  1 
ATOM   2186 C CD1 . PHE A 1 296 ? -39.355 25.360 7.274   1.00 69.45  ? 340  PHE A CD1 1 
ATOM   2187 C CD2 . PHE A 1 296 ? -40.892 24.292 8.763   1.00 71.98  ? 340  PHE A CD2 1 
ATOM   2188 C CE1 . PHE A 1 296 ? -40.359 25.447 6.308   1.00 70.39  ? 340  PHE A CE1 1 
ATOM   2189 C CE2 . PHE A 1 296 ? -41.903 24.368 7.799   1.00 73.79  ? 340  PHE A CE2 1 
ATOM   2190 C CZ  . PHE A 1 296 ? -41.636 24.946 6.567   1.00 73.30  ? 340  PHE A CZ  1 
ATOM   2191 N N   . GLY A 1 297 ? -36.943 27.134 8.913   1.00 59.30  ? 341  GLY A N   1 
ATOM   2192 C CA  . GLY A 1 297 ? -36.450 28.231 8.127   1.00 58.95  ? 341  GLY A CA  1 
ATOM   2193 C C   . GLY A 1 297 ? -35.518 27.653 7.087   1.00 57.83  ? 341  GLY A C   1 
ATOM   2194 O O   . GLY A 1 297 ? -35.437 26.430 6.870   1.00 57.05  ? 341  GLY A O   1 
ATOM   2195 N N   . THR A 1 298 ? -34.852 28.564 6.402   1.00 59.46  ? 342  THR A N   1 
ATOM   2196 C CA  . THR A 1 298 ? -33.885 28.214 5.404   1.00 58.29  ? 342  THR A CA  1 
ATOM   2197 C C   . THR A 1 298 ? -32.553 28.739 5.839   1.00 58.16  ? 342  THR A C   1 
ATOM   2198 O O   . THR A 1 298 ? -32.481 29.844 6.386   1.00 59.08  ? 342  THR A O   1 
ATOM   2199 C CB  . THR A 1 298 ? -34.285 28.790 4.079   1.00 58.39  ? 342  THR A CB  1 
ATOM   2200 O OG1 . THR A 1 298 ? -35.633 28.361 3.809   1.00 59.05  ? 342  THR A OG1 1 
ATOM   2201 C CG2 . THR A 1 298 ? -33.337 28.356 2.965   1.00 56.56  ? 342  THR A CG2 1 
ATOM   2202 N N   . ILE A 1 299 ? -31.517 27.923 5.629   1.00 49.57  ? 343  ILE A N   1 
ATOM   2203 C CA  . ILE A 1 299 ? -30.126 28.310 5.894   1.00 48.76  ? 343  ILE A CA  1 
ATOM   2204 C C   . ILE A 1 299 ? -29.476 28.896 4.655   1.00 47.21  ? 343  ILE A C   1 
ATOM   2205 O O   . ILE A 1 299 ? -29.483 28.251 3.612   1.00 45.57  ? 343  ILE A O   1 
ATOM   2206 C CB  . ILE A 1 299 ? -29.295 27.123 6.327   1.00 46.07  ? 343  ILE A CB  1 
ATOM   2207 C CG1 . ILE A 1 299 ? -29.751 26.651 7.706   1.00 47.72  ? 343  ILE A CG1 1 
ATOM   2208 C CG2 . ILE A 1 299 ? -27.821 27.512 6.325   1.00 43.23  ? 343  ILE A CG2 1 
ATOM   2209 C CD1 . ILE A 1 299 ? -28.829 25.633 8.355   1.00 44.91  ? 343  ILE A CD1 1 
ATOM   2210 N N   . PHE A 1 300 ? -28.934 30.106 4.735   1.00 56.11  ? 344  PHE A N   1 
ATOM   2211 C CA  . PHE A 1 300 ? -28.115 30.612 3.626   1.00 54.87  ? 344  PHE A CA  1 
ATOM   2212 C C   . PHE A 1 300 ? -26.639 30.743 4.050   1.00 53.37  ? 344  PHE A C   1 
ATOM   2213 O O   . PHE A 1 300 ? -26.341 31.105 5.193   1.00 53.83  ? 344  PHE A O   1 
ATOM   2214 C CB  . PHE A 1 300 ? -28.617 31.961 3.123   1.00 57.08  ? 344  PHE A CB  1 
ATOM   2215 C CG  . PHE A 1 300 ? -30.043 31.948 2.605   1.00 58.13  ? 344  PHE A CG  1 
ATOM   2216 C CD1 . PHE A 1 300 ? -31.123 31.831 3.478   1.00 59.60  ? 344  PHE A CD1 1 
ATOM   2217 C CD2 . PHE A 1 300 ? -30.311 32.123 1.248   1.00 57.61  ? 344  PHE A CD2 1 
ATOM   2218 C CE1 . PHE A 1 300 ? -32.421 31.826 3.002   1.00 60.19  ? 344  PHE A CE1 1 
ATOM   2219 C CE2 . PHE A 1 300 ? -31.628 32.128 0.784   1.00 58.51  ? 344  PHE A CE2 1 
ATOM   2220 C CZ  . PHE A 1 300 ? -32.668 31.976 1.665   1.00 59.75  ? 344  PHE A CZ  1 
ATOM   2221 N N   . THR A 1 301 ? -25.722 30.436 3.140   1.00 45.13  ? 345  THR A N   1 
ATOM   2222 C CA  . THR A 1 301 ? -24.297 30.720 3.368   1.00 44.93  ? 345  THR A CA  1 
ATOM   2223 C C   . THR A 1 301 ? -23.861 31.918 2.510   1.00 46.66  ? 345  THR A C   1 
ATOM   2224 O O   . THR A 1 301 ? -24.233 32.005 1.341   1.00 46.58  ? 345  THR A O   1 
ATOM   2225 C CB  . THR A 1 301 ? -23.405 29.497 3.039   1.00 43.11  ? 345  THR A CB  1 
ATOM   2226 O OG1 . THR A 1 301 ? -23.701 29.007 1.730   1.00 43.24  ? 345  THR A OG1 1 
ATOM   2227 C CG2 . THR A 1 301 ? -23.665 28.394 3.996   1.00 41.59  ? 345  THR A CG2 1 
ATOM   2228 N N   . SER A 1 302 ? -23.090 32.848 3.063   1.00 56.95  ? 346  SER A N   1 
ATOM   2229 C CA  . SER A 1 302 ? -22.685 33.991 2.250   1.00 58.40  ? 346  SER A CA  1 
ATOM   2230 C C   . SER A 1 302 ? -21.373 33.780 1.495   1.00 58.09  ? 346  SER A C   1 
ATOM   2231 O O   . SER A 1 302 ? -20.674 32.762 1.640   1.00 57.31  ? 346  SER A O   1 
ATOM   2232 C CB  . SER A 1 302 ? -22.523 35.226 3.109   1.00 60.64  ? 346  SER A CB  1 
ATOM   2233 O OG  . SER A 1 302 ? -21.434 35.021 3.986   1.00 61.29  ? 346  SER A OG  1 
ATOM   2234 N N   . ASP A 1 303 ? -21.060 34.790 0.690   1.00 65.82  ? 347  ASP A N   1 
ATOM   2235 C CA  . ASP A 1 303 ? -19.786 34.944 0.056   1.00 66.21  ? 347  ASP A CA  1 
ATOM   2236 C C   . ASP A 1 303 ? -18.920 35.716 1.052   1.00 67.84  ? 347  ASP A C   1 
ATOM   2237 O O   . ASP A 1 303 ? -19.363 35.985 2.183   1.00 68.45  ? 347  ASP A O   1 
ATOM   2238 C CB  . ASP A 1 303 ? -19.940 35.638 -1.312  1.00 66.04  ? 347  ASP A CB  1 
ATOM   2239 C CG  . ASP A 1 303 ? -20.132 37.160 -1.225  1.00 67.21  ? 347  ASP A CG  1 
ATOM   2240 O OD1 . ASP A 1 303 ? -20.507 37.695 -0.153  1.00 68.01  ? 347  ASP A OD1 1 
ATOM   2241 O OD2 . ASP A 1 303 ? -19.916 37.834 -2.270  1.00 67.30  ? 347  ASP A OD2 1 
ATOM   2242 N N   . ASP A 1 304 ? -17.692 36.057 0.659   1.00 92.80  ? 348  ASP A N   1 
ATOM   2243 C CA  . ASP A 1 304 ? -16.742 36.640 1.600   1.00 94.05  ? 348  ASP A CA  1 
ATOM   2244 C C   . ASP A 1 304 ? -17.052 38.096 1.888   1.00 94.39  ? 348  ASP A C   1 
ATOM   2245 O O   . ASP A 1 304 ? -16.406 38.706 2.733   1.00 94.81  ? 348  ASP A O   1 
ATOM   2246 C CB  . ASP A 1 304 ? -15.309 36.503 1.089   1.00 94.50  ? 348  ASP A CB  1 
ATOM   2247 C CG  . ASP A 1 304 ? -15.075 37.242 -0.212  1.00 94.27  ? 348  ASP A CG  1 
ATOM   2248 O OD1 . ASP A 1 304 ? -15.927 37.129 -1.125  1.00 93.35  ? 348  ASP A OD1 1 
ATOM   2249 O OD2 . ASP A 1 304 ? -14.040 37.939 -0.322  1.00 94.96  ? 348  ASP A OD2 1 
ATOM   2250 N N   . ARG A 1 305 ? -18.025 38.649 1.168   1.00 79.23  ? 349  ARG A N   1 
ATOM   2251 C CA  . ARG A 1 305 ? -18.514 39.998 1.429   1.00 79.47  ? 349  ARG A CA  1 
ATOM   2252 C C   . ARG A 1 305 ? -19.725 40.056 2.370   1.00 79.57  ? 349  ARG A C   1 
ATOM   2253 O O   . ARG A 1 305 ? -20.062 41.125 2.869   1.00 79.68  ? 349  ARG A O   1 
ATOM   2254 C CB  . ARG A 1 305 ? -18.876 40.679 0.120   1.00 79.20  ? 349  ARG A CB  1 
ATOM   2255 C CG  . ARG A 1 305 ? -17.700 41.011 -0.751  1.00 79.25  ? 349  ARG A CG  1 
ATOM   2256 C CD  . ARG A 1 305 ? -18.157 41.539 -2.096  1.00 81.05  ? 349  ARG A CD  1 
ATOM   2257 N NE  . ARG A 1 305 ? -18.978 40.551 -2.787  1.00 80.33  ? 349  ARG A NE  1 
ATOM   2258 C CZ  . ARG A 1 305 ? -19.445 40.704 -4.024  1.00 81.99  ? 349  ARG A CZ  1 
ATOM   2259 N NH1 . ARG A 1 305 ? -19.174 41.807 -4.720  1.00 85.62  ? 349  ARG A NH1 1 
ATOM   2260 N NH2 . ARG A 1 305 ? -20.169 39.743 -4.577  1.00 81.35  ? 349  ARG A NH2 1 
ATOM   2261 N N   . GLY A 1 306 ? -20.437 38.956 2.481   1.00 72.41  ? 350  GLY A N   1 
ATOM   2262 C CA  . GLY A 1 306 ? -21.651 38.895 3.262   1.00 72.59  ? 350  GLY A CA  1 
ATOM   2263 C C   . GLY A 1 306 ? -22.830 39.380 2.462   1.00 72.43  ? 350  GLY A C   1 
ATOM   2264 O O   . GLY A 1 306 ? -23.961 39.291 2.885   1.00 72.81  ? 350  GLY A O   1 
ATOM   2265 N N   . ILE A 1 307 ? -22.538 39.925 1.297   1.00 78.48  ? 351  ILE A N   1 
ATOM   2266 C CA  . ILE A 1 307 ? -23.522 40.397 0.350   1.00 78.59  ? 351  ILE A CA  1 
ATOM   2267 C C   . ILE A 1 307 ? -24.329 39.345 -0.361  1.00 77.93  ? 351  ILE A C   1 
ATOM   2268 O O   . ILE A 1 307 ? -25.515 39.474 -0.508  1.00 78.00  ? 351  ILE A O   1 
ATOM   2269 C CB  . ILE A 1 307 ? -22.864 41.254 -0.726  1.00 78.59  ? 351  ILE A CB  1 
ATOM   2270 C CG1 . ILE A 1 307 ? -22.299 42.552 -0.133  1.00 78.94  ? 351  ILE A CG1 1 
ATOM   2271 C CG2 . ILE A 1 307 ? -23.836 41.487 -1.855  1.00 78.92  ? 351  ILE A CG2 1 
ATOM   2272 C CD1 . ILE A 1 307 ? -21.405 43.363 -1.031  1.00 78.80  ? 351  ILE A CD1 1 
ATOM   2273 N N   . VAL A 1 308 ? -23.673 38.296 -0.810  1.00 78.00  ? 352  VAL A N   1 
ATOM   2274 C CA  . VAL A 1 308 ? -24.270 37.384 -1.759  1.00 76.86  ? 352  VAL A CA  1 
ATOM   2275 C C   . VAL A 1 308 ? -24.543 36.081 -1.113  1.00 76.05  ? 352  VAL A C   1 
ATOM   2276 O O   . VAL A 1 308 ? -23.695 35.527 -0.469  1.00 75.80  ? 352  VAL A O   1 
ATOM   2277 C CB  . VAL A 1 308 ? -23.326 37.065 -2.907  1.00 75.92  ? 352  VAL A CB  1 
ATOM   2278 C CG1 . VAL A 1 308 ? -23.945 36.022 -3.798  1.00 75.55  ? 352  VAL A CG1 1 
ATOM   2279 C CG2 . VAL A 1 308 ? -22.999 38.303 -3.692  1.00 78.08  ? 352  VAL A CG2 1 
ATOM   2280 N N   . TYR A 1 309 ? -25.735 35.572 -1.287  1.00 58.08  ? 353  TYR A N   1 
ATOM   2281 C CA  . TYR A 1 309 ? -26.111 34.418 -0.453  1.00 57.30  ? 353  TYR A CA  1 
ATOM   2282 C C   . TYR A 1 309 ? -26.492 33.223 -1.297  1.00 55.73  ? 353  TYR A C   1 
ATOM   2283 O O   . TYR A 1 309 ? -26.981 33.362 -2.411  1.00 56.63  ? 353  TYR A O   1 
ATOM   2284 C CB  . TYR A 1 309 ? -27.235 34.794 0.502   1.00 58.89  ? 353  TYR A CB  1 
ATOM   2285 C CG  . TYR A 1 309 ? -26.692 35.560 1.668   1.00 60.05  ? 353  TYR A CG  1 
ATOM   2286 C CD1 . TYR A 1 309 ? -26.422 36.913 1.567   1.00 61.11  ? 353  TYR A CD1 1 
ATOM   2287 C CD2 . TYR A 1 309 ? -26.401 34.919 2.858   1.00 59.91  ? 353  TYR A CD2 1 
ATOM   2288 C CE1 . TYR A 1 309 ? -25.895 37.616 2.627   1.00 61.98  ? 353  TYR A CE1 1 
ATOM   2289 C CE2 . TYR A 1 309 ? -25.864 35.605 3.926   1.00 61.14  ? 353  TYR A CE2 1 
ATOM   2290 C CZ  . TYR A 1 309 ? -25.604 36.948 3.805   1.00 62.09  ? 353  TYR A CZ  1 
ATOM   2291 O OH  . TYR A 1 309 ? -25.069 37.618 4.879   1.00 62.82  ? 353  TYR A OH  1 
ATOM   2292 N N   . SER A 1 310 ? -26.230 32.047 -0.775  1.00 74.84  ? 354  SER A N   1 
ATOM   2293 C CA  . SER A 1 310 ? -26.484 30.828 -1.494  1.00 73.52  ? 354  SER A CA  1 
ATOM   2294 C C   . SER A 1 310 ? -27.400 29.984 -0.622  1.00 73.61  ? 354  SER A C   1 
ATOM   2295 O O   . SER A 1 310 ? -27.151 29.809 0.561   1.00 73.67  ? 354  SER A O   1 
ATOM   2296 C CB  . SER A 1 310 ? -25.158 30.126 -1.808  1.00 72.07  ? 354  SER A CB  1 
ATOM   2297 O OG  . SER A 1 310 ? -25.346 28.778 -2.202  1.00 70.86  ? 354  SER A OG  1 
ATOM   2298 N N   . LYS A 1 311 ? -28.455 29.436 -1.175  1.00 74.97  ? 355  LYS A N   1 
ATOM   2299 C CA  . LYS A 1 311 ? -29.348 28.673 -0.352  1.00 75.45  ? 355  LYS A CA  1 
ATOM   2300 C C   . LYS A 1 311 ? -28.686 27.362 -0.019  1.00 73.57  ? 355  LYS A C   1 
ATOM   2301 O O   . LYS A 1 311 ? -28.320 26.628 -0.903  1.00 72.28  ? 355  LYS A O   1 
ATOM   2302 C CB  . LYS A 1 311 ? -30.621 28.418 -1.130  1.00 76.44  ? 355  LYS A CB  1 
ATOM   2303 C CG  . LYS A 1 311 ? -31.692 27.684 -0.370  1.00 77.02  ? 355  LYS A CG  1 
ATOM   2304 C CD  . LYS A 1 311 ? -32.936 27.521 -1.210  1.00 77.82  ? 355  LYS A CD  1 
ATOM   2305 C CE  . LYS A 1 311 ? -34.009 26.760 -0.454  1.00 79.20  ? 355  LYS A CE  1 
ATOM   2306 N NZ  . LYS A 1 311 ? -35.235 26.598 -1.281  1.00 81.97  ? 355  LYS A NZ  1 
ATOM   2307 N N   . SER A 1 312 ? -28.546 27.050 1.261   1.00 51.85  ? 356  SER A N   1 
ATOM   2308 C CA  . SER A 1 312 ? -27.869 25.835 1.652   1.00 50.13  ? 356  SER A CA  1 
ATOM   2309 C C   . SER A 1 312 ? -28.760 24.730 2.122   1.00 50.24  ? 356  SER A C   1 
ATOM   2310 O O   . SER A 1 312 ? -28.599 23.609 1.717   1.00 48.93  ? 356  SER A O   1 
ATOM   2311 C CB  . SER A 1 312 ? -26.848 26.125 2.739   1.00 49.75  ? 356  SER A CB  1 
ATOM   2312 O OG  . SER A 1 312 ? -26.218 24.943 3.158   1.00 48.28  ? 356  SER A OG  1 
ATOM   2313 N N   . LEU A 1 313 ? -29.683 25.042 3.012   1.00 54.61  ? 357  LEU A N   1 
ATOM   2314 C CA  . LEU A 1 313 ? -30.532 24.021 3.585   1.00 54.90  ? 357  LEU A CA  1 
ATOM   2315 C C   . LEU A 1 313 ? -31.971 24.453 3.738   1.00 57.05  ? 357  LEU A C   1 
ATOM   2316 O O   . LEU A 1 313 ? -32.264 25.517 4.218   1.00 58.85  ? 357  LEU A O   1 
ATOM   2317 C CB  . LEU A 1 313 ? -29.969 23.584 4.926   1.00 54.61  ? 357  LEU A CB  1 
ATOM   2318 C CG  . LEU A 1 313 ? -30.421 22.283 5.556   1.00 54.45  ? 357  LEU A CG  1 
ATOM   2319 C CD1 . LEU A 1 313 ? -30.398 21.146 4.576   1.00 52.90  ? 357  LEU A CD1 1 
ATOM   2320 C CD2 . LEU A 1 313 ? -29.611 21.947 6.778   1.00 54.27  ? 357  LEU A CD2 1 
ATOM   2321 N N   . ASP A 1 314 ? -32.868 23.580 3.338   1.00 77.93  ? 358  ASP A N   1 
ATOM   2322 C CA  . ASP A 1 314 ? -34.300 23.775 3.471   1.00 79.76  ? 358  ASP A CA  1 
ATOM   2323 C C   . ASP A 1 314 ? -34.851 23.185 4.751   1.00 80.64  ? 358  ASP A C   1 
ATOM   2324 O O   . ASP A 1 314 ? -34.351 22.166 5.234   1.00 79.59  ? 358  ASP A O   1 
ATOM   2325 C CB  . ASP A 1 314 ? -35.022 23.138 2.294   1.00 79.33  ? 358  ASP A CB  1 
ATOM   2326 C CG  . ASP A 1 314 ? -35.302 24.117 1.181   1.00 79.99  ? 358  ASP A CG  1 
ATOM   2327 O OD1 . ASP A 1 314 ? -35.492 25.317 1.478   1.00 81.30  ? 358  ASP A OD1 1 
ATOM   2328 O OD2 . ASP A 1 314 ? -35.335 23.679 0.007   1.00 80.63  ? 358  ASP A OD2 1 
ATOM   2329 N N   . ARG A 1 315 ? -35.880 23.846 5.288   1.00 57.78  ? 359  ARG A N   1 
ATOM   2330 C CA  . ARG A 1 315 ? -36.679 23.332 6.396   1.00 58.97  ? 359  ARG A CA  1 
ATOM   2331 C C   . ARG A 1 315 ? -35.812 23.040 7.566   1.00 58.53  ? 359  ARG A C   1 
ATOM   2332 O O   . ARG A 1 315 ? -35.879 21.963 8.176   1.00 58.32  ? 359  ARG A O   1 
ATOM   2333 C CB  . ARG A 1 315 ? -37.450 22.089 5.986   1.00 59.97  ? 359  ARG A CB  1 
ATOM   2334 C CG  . ARG A 1 315 ? -38.484 22.420 4.957   1.00 62.33  ? 359  ARG A CG  1 
ATOM   2335 C CD  . ARG A 1 315 ? -39.177 21.199 4.432   1.00 65.52  ? 359  ARG A CD  1 
ATOM   2336 N NE  . ARG A 1 315 ? -40.060 20.593 5.416   1.00 67.69  ? 359  ARG A NE  1 
ATOM   2337 C CZ  . ARG A 1 315 ? -41.307 20.999 5.642   1.00 71.45  ? 359  ARG A CZ  1 
ATOM   2338 N NH1 . ARG A 1 315 ? -41.799 22.030 4.964   1.00 73.28  ? 359  ARG A NH1 1 
ATOM   2339 N NH2 . ARG A 1 315 ? -42.040 20.377 6.552   1.00 73.72  ? 359  ARG A NH2 1 
ATOM   2340 N N   . HIS A 1 316 ? -34.980 24.021 7.865   1.00 50.54  ? 360  HIS A N   1 
ATOM   2341 C CA  . HIS A 1 316 ? -34.026 23.887 8.929   1.00 50.21  ? 360  HIS A CA  1 
ATOM   2342 C C   . HIS A 1 316 ? -34.776 24.145 10.207  1.00 51.59  ? 360  HIS A C   1 
ATOM   2343 O O   . HIS A 1 316 ? -35.286 25.240 10.403  1.00 52.24  ? 360  HIS A O   1 
ATOM   2344 C CB  . HIS A 1 316 ? -32.876 24.878 8.749   1.00 49.90  ? 360  HIS A CB  1 
ATOM   2345 C CG  . HIS A 1 316 ? -31.915 24.894 9.889   1.00 49.75  ? 360  HIS A CG  1 
ATOM   2346 N ND1 . HIS A 1 316 ? -31.467 26.060 10.464  1.00 49.29  ? 360  HIS A ND1 1 
ATOM   2347 C CD2 . HIS A 1 316 ? -31.321 23.884 10.567  1.00 49.22  ? 360  HIS A CD2 1 
ATOM   2348 C CE1 . HIS A 1 316 ? -30.629 25.771 11.448  1.00 47.82  ? 360  HIS A CE1 1 
ATOM   2349 N NE2 . HIS A 1 316 ? -30.527 24.457 11.533  1.00 48.79  ? 360  HIS A NE2 1 
ATOM   2350 N N   . LEU A 1 317 ? -34.825 23.160 11.088  1.00 68.17  ? 361  LEU A N   1 
ATOM   2351 C CA  . LEU A 1 317 ? -35.605 23.312 12.300  1.00 69.46  ? 361  LEU A CA  1 
ATOM   2352 C C   . LEU A 1 317 ? -34.940 24.376 13.161  1.00 68.70  ? 361  LEU A C   1 
ATOM   2353 O O   . LEU A 1 317 ? -33.759 24.258 13.539  1.00 67.61  ? 361  LEU A O   1 
ATOM   2354 C CB  . LEU A 1 317 ? -35.686 21.967 13.017  1.00 70.07  ? 361  LEU A CB  1 
ATOM   2355 C CG  . LEU A 1 317 ? -36.579 21.768 14.222  1.00 71.63  ? 361  LEU A CG  1 
ATOM   2356 C CD1 . LEU A 1 317 ? -36.875 20.279 14.402  1.00 72.72  ? 361  LEU A CD1 1 
ATOM   2357 C CD2 . LEU A 1 317 ? -35.914 22.319 15.458  1.00 71.00  ? 361  LEU A CD2 1 
ATOM   2358 N N   . TYR A 1 318 ? -35.642 25.471 13.377  1.00 74.82  ? 362  TYR A N   1 
ATOM   2359 C CA  . TYR A 1 318 ? -35.321 26.440 14.395  1.00 73.69  ? 362  TYR A CA  1 
ATOM   2360 C C   . TYR A 1 318 ? -36.648 26.892 14.914  1.00 74.82  ? 362  TYR A C   1 
ATOM   2361 O O   . TYR A 1 318 ? -37.433 27.383 14.143  1.00 75.52  ? 362  TYR A O   1 
ATOM   2362 C CB  . TYR A 1 318 ? -34.610 27.615 13.761  1.00 72.15  ? 362  TYR A CB  1 
ATOM   2363 C CG  . TYR A 1 318 ? -33.827 28.465 14.711  1.00 70.35  ? 362  TYR A CG  1 
ATOM   2364 C CD1 . TYR A 1 318 ? -34.391 28.952 15.857  1.00 66.52  ? 362  TYR A CD1 1 
ATOM   2365 C CD2 . TYR A 1 318 ? -32.527 28.786 14.454  1.00 72.32  ? 362  TYR A CD2 1 
ATOM   2366 C CE1 . TYR A 1 318 ? -33.674 29.733 16.720  1.00 64.83  ? 362  TYR A CE1 1 
ATOM   2367 C CE2 . TYR A 1 318 ? -31.805 29.562 15.314  1.00 70.54  ? 362  TYR A CE2 1 
ATOM   2368 C CZ  . TYR A 1 318 ? -32.379 30.027 16.437  1.00 66.86  ? 362  TYR A CZ  1 
ATOM   2369 O OH  . TYR A 1 318 ? -31.654 30.799 17.286  1.00 65.18  ? 362  TYR A OH  1 
ATOM   2370 N N   . THR A 1 319 ? -36.898 26.790 16.209  1.00 71.47  ? 363  THR A N   1 
ATOM   2371 C CA  . THR A 1 319 ? -38.221 27.109 16.740  1.00 72.75  ? 363  THR A CA  1 
ATOM   2372 C C   . THR A 1 319 ? -38.419 28.589 17.046  1.00 71.61  ? 363  THR A C   1 
ATOM   2373 O O   . THR A 1 319 ? -37.527 29.257 17.581  1.00 69.61  ? 363  THR A O   1 
ATOM   2374 C CB  . THR A 1 319 ? -38.547 26.323 18.023  1.00 73.39  ? 363  THR A CB  1 
ATOM   2375 O OG1 . THR A 1 319 ? -37.829 26.877 19.134  1.00 71.45  ? 363  THR A OG1 1 
ATOM   2376 C CG2 . THR A 1 319 ? -38.218 24.866 17.849  1.00 74.49  ? 363  THR A CG2 1 
ATOM   2377 N N   . THR A 1 320 ? -39.611 29.075 16.699  1.00 146.44 ? 364  THR A N   1 
ATOM   2378 C CA  . THR A 1 320 ? -40.021 30.450 16.940  1.00 145.77 ? 364  THR A CA  1 
ATOM   2379 C C   . THR A 1 320 ? -40.215 30.674 18.438  1.00 144.73 ? 364  THR A C   1 
ATOM   2380 O O   . THR A 1 320 ? -40.114 31.797 18.928  1.00 144.08 ? 364  THR A O   1 
ATOM   2381 C CB  . THR A 1 320 ? -41.326 30.781 16.175  1.00 147.80 ? 364  THR A CB  1 
ATOM   2382 O OG1 . THR A 1 320 ? -41.228 30.305 14.825  1.00 148.88 ? 364  THR A OG1 1 
ATOM   2383 C CG2 . THR A 1 320 ? -41.576 32.278 16.156  1.00 147.23 ? 364  THR A CG2 1 
ATOM   2384 N N   . THR A 1 321 ? -40.469 29.583 19.156  1.00 127.34 ? 365  THR A N   1 
ATOM   2385 C CA  . THR A 1 321 ? -40.714 29.614 20.596  1.00 128.38 ? 365  THR A CA  1 
ATOM   2386 C C   . THR A 1 321 ? -39.585 29.018 21.439  1.00 126.42 ? 365  THR A C   1 
ATOM   2387 O O   . THR A 1 321 ? -39.469 27.797 21.544  1.00 126.80 ? 365  THR A O   1 
ATOM   2388 C CB  . THR A 1 321 ? -41.971 28.822 20.920  1.00 132.41 ? 365  THR A CB  1 
ATOM   2389 O OG1 . THR A 1 321 ? -41.763 27.454 20.535  1.00 132.05 ? 365  THR A OG1 1 
ATOM   2390 C CG2 . THR A 1 321 ? -43.155 29.382 20.155  1.00 135.24 ? 365  THR A CG2 1 
ATOM   2391 N N   . GLY A 1 322 ? -38.805 29.863 22.102  1.00 144.39 ? 366  GLY A N   1 
ATOM   2392 C CA  . GLY A 1 322 ? -37.689 29.372 22.892  1.00 142.70 ? 366  GLY A CA  1 
ATOM   2393 C C   . GLY A 1 322 ? -36.354 29.336 22.164  1.00 139.76 ? 366  GLY A C   1 
ATOM   2394 O O   . GLY A 1 322 ? -35.308 29.181 22.793  1.00 138.59 ? 366  GLY A O   1 
ATOM   2395 N N   . GLY A 1 323 ? -36.382 29.466 20.840  1.00 100.95 ? 367  GLY A N   1 
ATOM   2396 C CA  . GLY A 1 323 ? -35.162 29.599 20.050  1.00 99.99  ? 367  GLY A CA  1 
ATOM   2397 C C   . GLY A 1 323 ? -34.199 28.421 20.043  1.00 100.26 ? 367  GLY A C   1 
ATOM   2398 O O   . GLY A 1 323 ? -32.999 28.600 20.216  1.00 98.62  ? 367  GLY A O   1 
ATOM   2399 N N   . GLU A 1 324 ? -34.728 27.219 19.835  1.00 115.81 ? 368  GLU A N   1 
ATOM   2400 C CA  . GLU A 1 324 ? -33.902 26.029 19.738  1.00 116.35 ? 368  GLU A CA  1 
ATOM   2401 C C   . GLU A 1 324 ? -33.607 25.735 18.300  1.00 116.62 ? 368  GLU A C   1 
ATOM   2402 O O   . GLU A 1 324 ? -34.504 25.706 17.463  1.00 117.93 ? 368  GLU A O   1 
ATOM   2403 C CB  . GLU A 1 324 ? -34.577 24.799 20.341  1.00 118.27 ? 368  GLU A CB  1 
ATOM   2404 C CG  . GLU A 1 324 ? -35.561 25.053 21.465  1.00 118.89 ? 368  GLU A CG  1 
ATOM   2405 C CD  . GLU A 1 324 ? -34.956 25.817 22.633  1.00 117.23 ? 368  GLU A CD  1 
ATOM   2406 O OE1 . GLU A 1 324 ? -33.703 25.798 22.789  1.00 115.96 ? 368  GLU A OE1 1 
ATOM   2407 O OE2 . GLU A 1 324 ? -35.749 26.420 23.402  1.00 117.31 ? 368  GLU A OE2 1 
ATOM   2408 N N   . THR A 1 325 ? -32.331 25.528 18.024  1.00 58.44  ? 369  THR A N   1 
ATOM   2409 C CA  . THR A 1 325 ? -31.890 24.850 16.818  1.00 58.84  ? 369  THR A CA  1 
ATOM   2410 C C   . THR A 1 325 ? -30.874 23.791 17.203  1.00 58.92  ? 369  THR A C   1 
ATOM   2411 O O   . THR A 1 325 ? -30.277 23.843 18.266  1.00 58.03  ? 369  THR A O   1 
ATOM   2412 C CB  . THR A 1 325 ? -31.310 25.802 15.821  1.00 57.27  ? 369  THR A CB  1 
ATOM   2413 O OG1 . THR A 1 325 ? -31.032 25.083 14.621  1.00 58.05  ? 369  THR A OG1 1 
ATOM   2414 C CG2 . THR A 1 325 ? -30.062 26.409 16.362  1.00 54.78  ? 369  THR A CG2 1 
ATOM   2415 N N   . ASP A 1 326 ? -30.748 22.786 16.363  1.00 49.57  ? 370  ASP A N   1 
ATOM   2416 C CA  . ASP A 1 326 ? -29.767 21.739 16.571  1.00 50.16  ? 370  ASP A CA  1 
ATOM   2417 C C   . ASP A 1 326 ? -28.451 22.099 15.891  1.00 48.70  ? 370  ASP A C   1 
ATOM   2418 O O   . ASP A 1 326 ? -27.562 21.269 15.845  1.00 49.64  ? 370  ASP A O   1 
ATOM   2419 C CB  . ASP A 1 326 ? -30.275 20.400 16.045  1.00 51.67  ? 370  ASP A CB  1 
ATOM   2420 C CG  . ASP A 1 326 ? -31.220 19.734 16.998  1.00 52.95  ? 370  ASP A CG  1 
ATOM   2421 O OD1 . ASP A 1 326 ? -31.130 20.067 18.205  1.00 53.02  ? 370  ASP A OD1 1 
ATOM   2422 O OD2 . ASP A 1 326 ? -32.041 18.881 16.570  1.00 53.56  ? 370  ASP A OD2 1 
ATOM   2423 N N   . PHE A 1 327 ? -28.343 23.317 15.359  1.00 50.96  ? 371  PHE A N   1 
ATOM   2424 C CA  . PHE A 1 327 ? -27.254 23.648 14.452  1.00 48.66  ? 371  PHE A CA  1 
ATOM   2425 C C   . PHE A 1 327 ? -25.883 23.630 15.148  1.00 46.76  ? 371  PHE A C   1 
ATOM   2426 O O   . PHE A 1 327 ? -25.630 24.380 16.095  1.00 45.65  ? 371  PHE A O   1 
ATOM   2427 C CB  . PHE A 1 327 ? -27.452 25.016 13.790  1.00 46.93  ? 371  PHE A CB  1 
ATOM   2428 C CG  . PHE A 1 327 ? -26.355 25.364 12.816  1.00 44.92  ? 371  PHE A CG  1 
ATOM   2429 C CD1 . PHE A 1 327 ? -25.139 25.889 13.253  1.00 43.49  ? 371  PHE A CD1 1 
ATOM   2430 C CD2 . PHE A 1 327 ? -26.510 25.126 11.464  1.00 45.18  ? 371  PHE A CD2 1 
ATOM   2431 C CE1 . PHE A 1 327 ? -24.103 26.182 12.343  1.00 43.04  ? 371  PHE A CE1 1 
ATOM   2432 C CE2 . PHE A 1 327 ? -25.478 25.431 10.559  1.00 43.65  ? 371  PHE A CE2 1 
ATOM   2433 C CZ  . PHE A 1 327 ? -24.290 25.961 10.998  1.00 43.02  ? 371  PHE A CZ  1 
ATOM   2434 N N   . THR A 1 328 ? -24.988 22.816 14.610  1.00 51.62  ? 372  THR A N   1 
ATOM   2435 C CA  . THR A 1 328 ? -23.768 22.513 15.311  1.00 50.82  ? 372  THR A CA  1 
ATOM   2436 C C   . THR A 1 328 ? -22.529 22.587 14.406  1.00 49.00  ? 372  THR A C   1 
ATOM   2437 O O   . THR A 1 328 ? -22.417 21.891 13.382  1.00 48.65  ? 372  THR A O   1 
ATOM   2438 C CB  . THR A 1 328 ? -23.864 21.113 15.967  1.00 53.24  ? 372  THR A CB  1 
ATOM   2439 O OG1 . THR A 1 328 ? -24.824 21.137 17.043  1.00 56.18  ? 372  THR A OG1 1 
ATOM   2440 C CG2 . THR A 1 328 ? -22.516 20.701 16.515  1.00 52.21  ? 372  THR A CG2 1 
ATOM   2441 N N   . ASN A 1 329 ? -21.602 23.460 14.788  1.00 47.18  ? 373  ASN A N   1 
ATOM   2442 C CA  . ASN A 1 329 ? -20.262 23.410 14.219  1.00 47.15  ? 373  ASN A CA  1 
ATOM   2443 C C   . ASN A 1 329 ? -19.516 22.243 14.833  1.00 46.95  ? 373  ASN A C   1 
ATOM   2444 O O   . ASN A 1 329 ? -19.283 22.197 16.031  1.00 46.98  ? 373  ASN A O   1 
ATOM   2445 C CB  . ASN A 1 329 ? -19.534 24.720 14.461  1.00 47.55  ? 373  ASN A CB  1 
ATOM   2446 C CG  . ASN A 1 329 ? -18.170 24.773 13.812  1.00 48.94  ? 373  ASN A CG  1 
ATOM   2447 O OD1 . ASN A 1 329 ? -17.606 23.771 13.327  1.00 49.27  ? 373  ASN A OD1 1 
ATOM   2448 N ND2 . ASN A 1 329 ? -17.611 25.972 13.804  1.00 50.22  ? 373  ASN A ND2 1 
ATOM   2449 N N   . VAL A 1 330 ? -19.115 21.311 13.990  1.00 46.32  ? 374  VAL A N   1 
ATOM   2450 C CA  . VAL A 1 330 ? -18.320 20.207 14.464  1.00 46.48  ? 374  VAL A CA  1 
ATOM   2451 C C   . VAL A 1 330 ? -16.859 20.706 14.386  1.00 46.89  ? 374  VAL A C   1 
ATOM   2452 O O   . VAL A 1 330 ? -16.228 20.786 13.303  1.00 48.21  ? 374  VAL A O   1 
ATOM   2453 C CB  . VAL A 1 330 ? -18.537 18.951 13.606  1.00 46.93  ? 374  VAL A CB  1 
ATOM   2454 C CG1 . VAL A 1 330 ? -17.693 17.797 14.115  1.00 47.58  ? 374  VAL A CG1 1 
ATOM   2455 C CG2 . VAL A 1 330 ? -19.998 18.587 13.614  1.00 46.78  ? 374  VAL A CG2 1 
ATOM   2456 N N   . THR A 1 331 ? -16.337 21.032 15.560  1.00 44.75  ? 375  THR A N   1 
ATOM   2457 C CA  . THR A 1 331 ? -15.206 21.889 15.590  1.00 44.97  ? 375  THR A CA  1 
ATOM   2458 C C   . THR A 1 331 ? -13.922 21.094 15.553  1.00 45.86  ? 375  THR A C   1 
ATOM   2459 O O   . THR A 1 331 ? -12.867 21.683 15.666  1.00 46.37  ? 375  THR A O   1 
ATOM   2460 C CB  . THR A 1 331 ? -15.198 22.815 16.818  1.00 44.32  ? 375  THR A CB  1 
ATOM   2461 O OG1 . THR A 1 331 ? -15.310 22.059 18.031  1.00 44.66  ? 375  THR A OG1 1 
ATOM   2462 C CG2 . THR A 1 331 ? -16.306 23.828 16.685  1.00 44.04  ? 375  THR A CG2 1 
ATOM   2463 N N   . SER A 1 332 ? -14.035 19.775 15.422  1.00 52.20  ? 376  SER A N   1 
ATOM   2464 C CA  . SER A 1 332 ? -12.888 18.896 15.365  1.00 53.76  ? 376  SER A CA  1 
ATOM   2465 C C   . SER A 1 332 ? -12.522 18.462 13.937  1.00 55.54  ? 376  SER A C   1 
ATOM   2466 O O   . SER A 1 332 ? -11.638 17.615 13.751  1.00 57.50  ? 376  SER A O   1 
ATOM   2467 C CB  . SER A 1 332 ? -13.142 17.660 16.228  1.00 54.66  ? 376  SER A CB  1 
ATOM   2468 O OG  . SER A 1 332 ? -14.315 16.995 15.801  1.00 54.31  ? 376  SER A OG  1 
ATOM   2469 N N   . LEU A 1 333 ? -13.274 18.919 12.951  1.00 42.43  ? 377  LEU A N   1 
ATOM   2470 C CA  . LEU A 1 333 ? -12.866 18.788 11.561  1.00 42.89  ? 377  LEU A CA  1 
ATOM   2471 C C   . LEU A 1 333 ? -13.400 19.958 10.709  1.00 41.51  ? 377  LEU A C   1 
ATOM   2472 O O   . LEU A 1 333 ? -14.624 20.235 10.698  1.00 39.67  ? 377  LEU A O   1 
ATOM   2473 C CB  . LEU A 1 333 ? -13.336 17.474 10.992  1.00 42.93  ? 377  LEU A CB  1 
ATOM   2474 C CG  . LEU A 1 333 ? -12.827 17.130 9.603   1.00 44.67  ? 377  LEU A CG  1 
ATOM   2475 C CD1 . LEU A 1 333 ? -11.390 16.920 9.731   1.00 46.63  ? 377  LEU A CD1 1 
ATOM   2476 C CD2 . LEU A 1 333 ? -13.454 15.844 9.107   1.00 45.75  ? 377  LEU A CD2 1 
ATOM   2477 N N   . ARG A 1 334 ? -12.506 20.596 9.966   1.00 45.36  ? 378  ARG A N   1 
ATOM   2478 C CA  . ARG A 1 334 ? -12.790 21.760 9.147   1.00 47.01  ? 378  ARG A CA  1 
ATOM   2479 C C   . ARG A 1 334 ? -13.877 21.445 8.132   1.00 48.15  ? 378  ARG A C   1 
ATOM   2480 O O   . ARG A 1 334 ? -13.880 20.364 7.526   1.00 48.86  ? 378  ARG A O   1 
ATOM   2481 C CB  . ARG A 1 334 ? -11.502 22.211 8.439   1.00 48.82  ? 378  ARG A CB  1 
ATOM   2482 C CG  . ARG A 1 334 ? -11.598 23.305 7.380   1.00 49.82  ? 378  ARG A CG  1 
ATOM   2483 C CD  . ARG A 1 334 ? -10.211 23.545 6.722   1.00 50.58  ? 378  ARG A CD  1 
ATOM   2484 N NE  . ARG A 1 334 ? -9.736  22.366 6.005   1.00 51.24  ? 378  ARG A NE  1 
ATOM   2485 C CZ  . ARG A 1 334 ? -9.896  22.198 4.697   1.00 51.34  ? 378  ARG A CZ  1 
ATOM   2486 N NH1 . ARG A 1 334 ? -10.504 23.149 4.007   1.00 50.67  ? 378  ARG A NH1 1 
ATOM   2487 N NH2 . ARG A 1 334 ? -9.465  21.099 4.080   1.00 52.62  ? 378  ARG A NH2 1 
ATOM   2488 N N   . GLY A 1 335 ? -14.799 22.384 7.951   1.00 48.26  ? 379  GLY A N   1 
ATOM   2489 C CA  . GLY A 1 335 ? -15.844 22.219 6.962   1.00 47.35  ? 379  GLY A CA  1 
ATOM   2490 C C   . GLY A 1 335 ? -17.121 21.563 7.475   1.00 45.34  ? 379  GLY A C   1 
ATOM   2491 O O   . GLY A 1 335 ? -18.120 21.559 6.739   1.00 42.40  ? 379  GLY A O   1 
ATOM   2492 N N   . VAL A 1 336 ? -17.110 21.034 8.707   1.00 49.30  ? 380  VAL A N   1 
ATOM   2493 C CA  . VAL A 1 336 ? -18.138 20.085 9.103   1.00 45.73  ? 380  VAL A CA  1 
ATOM   2494 C C   . VAL A 1 336 ? -19.185 20.619 10.114  1.00 42.71  ? 380  VAL A C   1 
ATOM   2495 O O   . VAL A 1 336 ? -18.856 21.094 11.216  1.00 42.24  ? 380  VAL A O   1 
ATOM   2496 C CB  . VAL A 1 336 ? -17.539 18.809 9.698   1.00 45.31  ? 380  VAL A CB  1 
ATOM   2497 C CG1 . VAL A 1 336 ? -18.667 17.803 9.982   1.00 42.84  ? 380  VAL A CG1 1 
ATOM   2498 C CG2 . VAL A 1 336 ? -16.542 18.183 8.762   1.00 49.15  ? 380  VAL A CG2 1 
ATOM   2499 N N   . TYR A 1 337 ? -20.455 20.531 9.705   1.00 46.24  ? 381  TYR A N   1 
ATOM   2500 C CA  . TYR A 1 337 ? -21.551 21.023 10.511  1.00 44.99  ? 381  TYR A CA  1 
ATOM   2501 C C   . TYR A 1 337 ? -22.722 20.035 10.498  1.00 44.43  ? 381  TYR A C   1 
ATOM   2502 O O   . TYR A 1 337 ? -23.038 19.392 9.464   1.00 44.18  ? 381  TYR A O   1 
ATOM   2503 C CB  . TYR A 1 337 ? -22.004 22.383 9.998   1.00 45.16  ? 381  TYR A CB  1 
ATOM   2504 C CG  . TYR A 1 337 ? -20.916 23.420 9.913   1.00 46.71  ? 381  TYR A CG  1 
ATOM   2505 C CD1 . TYR A 1 337 ? -19.997 23.432 8.857   1.00 48.85  ? 381  TYR A CD1 1 
ATOM   2506 C CD2 . TYR A 1 337 ? -20.805 24.404 10.883  1.00 46.85  ? 381  TYR A CD2 1 
ATOM   2507 C CE1 . TYR A 1 337 ? -19.001 24.381 8.791   1.00 51.91  ? 381  TYR A CE1 1 
ATOM   2508 C CE2 . TYR A 1 337 ? -19.809 25.360 10.809  1.00 49.30  ? 381  TYR A CE2 1 
ATOM   2509 C CZ  . TYR A 1 337 ? -18.918 25.344 9.764   1.00 52.37  ? 381  TYR A CZ  1 
ATOM   2510 O OH  . TYR A 1 337 ? -17.947 26.317 9.720   1.00 56.35  ? 381  TYR A OH  1 
ATOM   2511 N N   . ILE A 1 338 ? -23.371 19.885 11.638  1.00 45.81  ? 382  ILE A N   1 
ATOM   2512 C CA  . ILE A 1 338 ? -24.570 19.066 11.643  1.00 46.66  ? 382  ILE A CA  1 
ATOM   2513 C C   . ILE A 1 338 ? -25.754 19.902 12.106  1.00 48.56  ? 382  ILE A C   1 
ATOM   2514 O O   . ILE A 1 338 ? -25.594 20.914 12.806  1.00 49.48  ? 382  ILE A O   1 
ATOM   2515 C CB  . ILE A 1 338 ? -24.425 17.820 12.524  1.00 47.75  ? 382  ILE A CB  1 
ATOM   2516 C CG1 . ILE A 1 338 ? -24.300 18.228 13.960  1.00 46.38  ? 382  ILE A CG1 1 
ATOM   2517 C CG2 . ILE A 1 338 ? -23.198 17.012 12.160  1.00 49.11  ? 382  ILE A CG2 1 
ATOM   2518 C CD1 . ILE A 1 338 ? -24.688 17.092 14.915  1.00 47.98  ? 382  ILE A CD1 1 
ATOM   2519 N N   . THR A 1 339 ? -26.948 19.529 11.639  1.00 43.29  ? 383  THR A N   1 
ATOM   2520 C CA  . THR A 1 339 ? -28.183 20.274 11.918  1.00 46.08  ? 383  THR A CA  1 
ATOM   2521 C C   . THR A 1 339 ? -29.443 19.414 11.733  1.00 46.70  ? 383  THR A C   1 
ATOM   2522 O O   . THR A 1 339 ? -29.380 18.348 11.119  1.00 45.20  ? 383  THR A O   1 
ATOM   2523 C CB  . THR A 1 339 ? -28.297 21.529 11.033  1.00 46.46  ? 383  THR A CB  1 
ATOM   2524 O OG1 . THR A 1 339 ? -29.398 22.332 11.477  1.00 49.39  ? 383  THR A OG1 1 
ATOM   2525 C CG2 . THR A 1 339 ? -28.514 21.139 9.579   1.00 45.03  ? 383  THR A CG2 1 
ATOM   2526 N N   . SER A 1 340 ? -30.583 19.871 12.256  1.00 55.58  ? 384  SER A N   1 
ATOM   2527 C CA  . SER A 1 340 ? -31.824 19.139 12.092  1.00 56.30  ? 384  SER A CA  1 
ATOM   2528 C C   . SER A 1 340 ? -32.698 19.764 11.034  1.00 56.21  ? 384  SER A C   1 
ATOM   2529 O O   . SER A 1 340 ? -32.723 20.980 10.877  1.00 56.75  ? 384  SER A O   1 
ATOM   2530 C CB  . SER A 1 340 ? -32.564 19.062 13.414  1.00 58.78  ? 384  SER A CB  1 
ATOM   2531 O OG  . SER A 1 340 ? -31.918 18.131 14.267  1.00 59.02  ? 384  SER A OG  1 
ATOM   2532 N N   . VAL A 1 341 ? -33.381 18.925 10.272  1.00 48.06  ? 385  VAL A N   1 
ATOM   2533 C CA  . VAL A 1 341 ? -34.421 19.439 9.384   1.00 50.16  ? 385  VAL A CA  1 
ATOM   2534 C C   . VAL A 1 341 ? -35.789 18.794 9.622   1.00 53.93  ? 385  VAL A C   1 
ATOM   2535 O O   . VAL A 1 341 ? -35.905 17.653 10.082  1.00 55.18  ? 385  VAL A O   1 
ATOM   2536 C CB  . VAL A 1 341 ? -34.057 19.249 7.933   1.00 50.12  ? 385  VAL A CB  1 
ATOM   2537 C CG1 . VAL A 1 341 ? -32.779 20.046 7.607   1.00 47.06  ? 385  VAL A CG1 1 
ATOM   2538 C CG2 . VAL A 1 341 ? -33.912 17.776 7.644   1.00 51.19  ? 385  VAL A CG2 1 
ATOM   2539 N N   . LEU A 1 342 ? -36.827 19.556 9.321   1.00 64.13  ? 386  LEU A N   1 
ATOM   2540 C CA  . LEU A 1 342 ? -38.187 19.078 9.481   1.00 65.89  ? 386  LEU A CA  1 
ATOM   2541 C C   . LEU A 1 342 ? -38.650 18.507 8.147   1.00 64.76  ? 386  LEU A C   1 
ATOM   2542 O O   . LEU A 1 342 ? -38.730 19.241 7.172   1.00 64.35  ? 386  LEU A O   1 
ATOM   2543 C CB  . LEU A 1 342 ? -39.078 20.224 9.948   1.00 68.12  ? 386  LEU A CB  1 
ATOM   2544 C CG  . LEU A 1 342 ? -40.578 19.970 10.092  1.00 70.06  ? 386  LEU A CG  1 
ATOM   2545 C CD1 . LEU A 1 342 ? -40.825 18.818 11.033  1.00 70.83  ? 386  LEU A CD1 1 
ATOM   2546 C CD2 . LEU A 1 342 ? -41.268 21.230 10.583  1.00 71.66  ? 386  LEU A CD2 1 
ATOM   2547 N N   . SER A 1 343 ? -38.911 17.209 8.058   1.00 85.53  ? 387  SER A N   1 
ATOM   2548 C CA  . SER A 1 343 ? -39.281 16.674 6.750   1.00 87.14  ? 387  SER A CA  1 
ATOM   2549 C C   . SER A 1 343 ? -40.711 17.084 6.387   1.00 87.73  ? 387  SER A C   1 
ATOM   2550 O O   . SER A 1 343 ? -41.381 17.783 7.167   1.00 87.27  ? 387  SER A O   1 
ATOM   2551 C CB  . SER A 1 343 ? -39.116 15.156 6.713   1.00 89.04  ? 387  SER A CB  1 
ATOM   2552 O OG  . SER A 1 343 ? -39.515 14.632 5.468   1.00 88.94  ? 387  SER A OG  1 
ATOM   2553 N N   . GLU A 1 344 ? -41.173 16.671 5.205   1.00 127.80 ? 388  GLU A N   1 
ATOM   2554 C CA  . GLU A 1 344 ? -42.522 17.013 4.736   1.00 129.36 ? 388  GLU A CA  1 
ATOM   2555 C C   . GLU A 1 344 ? -43.561 16.413 5.662   1.00 130.71 ? 388  GLU A C   1 
ATOM   2556 O O   . GLU A 1 344 ? -44.473 17.094 6.107   1.00 132.43 ? 388  GLU A O   1 
ATOM   2557 C CB  . GLU A 1 344 ? -42.735 16.536 3.304   1.00 131.56 ? 388  GLU A CB  1 
ATOM   2558 C CG  . GLU A 1 344 ? -41.839 17.238 2.288   1.00 130.83 ? 388  GLU A CG  1 
ATOM   2559 C CD  . GLU A 1 344 ? -42.040 18.743 2.288   1.00 130.43 ? 388  GLU A CD  1 
ATOM   2560 O OE1 . GLU A 1 344 ? -43.191 19.187 2.518   1.00 133.28 ? 388  GLU A OE1 1 
ATOM   2561 O OE2 . GLU A 1 344 ? -41.047 19.473 2.059   1.00 128.15 ? 388  GLU A OE2 1 
ATOM   2562 N N   . ASP A 1 345 ? -43.413 15.127 5.942   1.00 126.51 ? 389  ASP A N   1 
ATOM   2563 C CA  . ASP A 1 345 ? -44.032 14.509 7.106   1.00 126.59 ? 389  ASP A CA  1 
ATOM   2564 C C   . ASP A 1 345 ? -43.451 15.167 8.364   1.00 122.51 ? 389  ASP A C   1 
ATOM   2565 O O   . ASP A 1 345 ? -42.292 15.592 8.337   1.00 118.42 ? 389  ASP A O   1 
ATOM   2566 C CB  . ASP A 1 345 ? -43.754 13.007 7.070   1.00 129.15 ? 389  ASP A CB  1 
ATOM   2567 C CG  . ASP A 1 345 ? -42.280 12.665 7.117   1.00 127.80 ? 389  ASP A CG  1 
ATOM   2568 O OD1 . ASP A 1 345 ? -41.439 13.592 7.103   1.00 127.48 ? 389  ASP A OD1 1 
ATOM   2569 O OD2 . ASP A 1 345 ? -41.969 11.448 7.143   1.00 127.17 ? 389  ASP A OD2 1 
ATOM   2570 N N   . ASN A 1 346 ? -44.174 15.243 9.484   1.00 118.16 ? 390  ASN A N   1 
ATOM   2571 C CA  . ASN A 1 346 ? -43.500 15.924 10.591  1.00 114.78 ? 390  ASN A CA  1 
ATOM   2572 C C   . ASN A 1 346 ? -42.709 15.000 11.490  1.00 114.00 ? 390  ASN A C   1 
ATOM   2573 O O   . ASN A 1 346 ? -43.128 14.551 12.549  1.00 114.72 ? 390  ASN A O   1 
ATOM   2574 C CB  . ASN A 1 346 ? -44.502 16.682 11.440  1.00 115.01 ? 390  ASN A CB  1 
ATOM   2575 C CG  . ASN A 1 346 ? -45.106 17.824 10.703  1.00 117.08 ? 390  ASN A CG  1 
ATOM   2576 O OD1 . ASN A 1 346 ? -44.427 18.509 9.929   1.00 115.43 ? 390  ASN A OD1 1 
ATOM   2577 N ND2 . ASN A 1 346 ? -46.404 18.042 10.918  1.00 121.24 ? 390  ASN A ND2 1 
ATOM   2578 N N   . SER A 1 347 ? -41.459 14.923 11.123  1.00 68.41  ? 391  SER A N   1 
ATOM   2579 C CA  . SER A 1 347 ? -40.484 14.091 11.773  1.00 65.80  ? 391  SER A CA  1 
ATOM   2580 C C   . SER A 1 347 ? -39.130 14.782 11.543  1.00 63.12  ? 391  SER A C   1 
ATOM   2581 O O   . SER A 1 347 ? -38.917 15.481 10.534  1.00 62.68  ? 391  SER A O   1 
ATOM   2582 C CB  . SER A 1 347 ? -40.510 12.685 11.212  1.00 67.73  ? 391  SER A CB  1 
ATOM   2583 O OG  . SER A 1 347 ? -40.175 12.732 9.846   1.00 68.05  ? 391  SER A OG  1 
ATOM   2584 N N   . ILE A 1 348 ? -38.241 14.616 12.501  1.00 62.55  ? 392  ILE A N   1 
ATOM   2585 C CA  . ILE A 1 348 ? -36.983 15.331 12.452  1.00 60.03  ? 392  ILE A CA  1 
ATOM   2586 C C   . ILE A 1 348 ? -35.810 14.426 12.034  1.00 59.42  ? 392  ILE A C   1 
ATOM   2587 O O   . ILE A 1 348 ? -35.525 13.407 12.677  1.00 59.65  ? 392  ILE A O   1 
ATOM   2588 C CB  . ILE A 1 348 ? -36.752 15.997 13.816  1.00 58.25  ? 392  ILE A CB  1 
ATOM   2589 C CG1 . ILE A 1 348 ? -38.016 16.809 14.164  1.00 59.58  ? 392  ILE A CG1 1 
ATOM   2590 C CG2 . ILE A 1 348 ? -35.559 16.887 13.795  1.00 56.02  ? 392  ILE A CG2 1 
ATOM   2591 C CD1 . ILE A 1 348 ? -38.343 16.904 15.669  1.00 59.28  ? 392  ILE A CD1 1 
ATOM   2592 N N   . GLN A 1 349 ? -35.157 14.788 10.927  1.00 71.36  ? 393  GLN A N   1 
ATOM   2593 C CA  . GLN A 1 349 ? -33.900 14.133 10.532  1.00 71.79  ? 393  GLN A CA  1 
ATOM   2594 C C   . GLN A 1 349 ? -32.646 14.974 10.730  1.00 69.43  ? 393  GLN A C   1 
ATOM   2595 O O   . GLN A 1 349 ? -32.653 16.188 10.554  1.00 68.03  ? 393  GLN A O   1 
ATOM   2596 C CB  . GLN A 1 349 ? -33.952 13.701 9.074   1.00 74.04  ? 393  GLN A CB  1 
ATOM   2597 C CG  . GLN A 1 349 ? -35.012 12.688 8.808   1.00 76.62  ? 393  GLN A CG  1 
ATOM   2598 C CD  . GLN A 1 349 ? -36.211 13.320 8.201   1.00 76.63  ? 393  GLN A CD  1 
ATOM   2599 O OE1 . GLN A 1 349 ? -36.095 14.034 7.196   1.00 76.44  ? 393  GLN A OE1 1 
ATOM   2600 N NE2 . GLN A 1 349 ? -37.389 13.079 8.796   1.00 76.98  ? 393  GLN A NE2 1 
ATOM   2601 N N   . THR A 1 350 ? -31.559 14.301 11.077  1.00 55.62  ? 394  THR A N   1 
ATOM   2602 C CA  . THR A 1 350 ? -30.274 14.974 11.182  1.00 53.53  ? 394  THR A CA  1 
ATOM   2603 C C   . THR A 1 350 ? -29.574 15.018 9.815   1.00 54.21  ? 394  THR A C   1 
ATOM   2604 O O   . THR A 1 350 ? -29.686 14.061 9.022   1.00 57.06  ? 394  THR A O   1 
ATOM   2605 C CB  . THR A 1 350 ? -29.365 14.308 12.226  1.00 53.28  ? 394  THR A CB  1 
ATOM   2606 O OG1 . THR A 1 350 ? -29.953 14.440 13.522  1.00 53.04  ? 394  THR A OG1 1 
ATOM   2607 C CG2 . THR A 1 350 ? -28.014 14.990 12.261  1.00 51.26  ? 394  THR A CG2 1 
ATOM   2608 N N   . MET A 1 351 ? -28.919 16.151 9.530   1.00 54.06  ? 395  MET A N   1 
ATOM   2609 C CA  . MET A 1 351 ? -28.126 16.316 8.318   1.00 54.78  ? 395  MET A CA  1 
ATOM   2610 C C   . MET A 1 351 ? -26.706 16.815 8.628   1.00 52.65  ? 395  MET A C   1 
ATOM   2611 O O   . MET A 1 351 ? -26.465 17.641 9.536   1.00 50.85  ? 395  MET A O   1 
ATOM   2612 C CB  . MET A 1 351 ? -28.799 17.279 7.345   1.00 55.73  ? 395  MET A CB  1 
ATOM   2613 C CG  . MET A 1 351 ? -30.244 16.892 6.922   1.00 57.79  ? 395  MET A CG  1 
ATOM   2614 S SD  . MET A 1 351 ? -30.383 15.401 5.909   1.00 61.70  ? 395  MET A SD  1 
ATOM   2615 C CE  . MET A 1 351 ? -29.840 15.999 4.293   1.00 63.56  ? 395  MET A CE  1 
ATOM   2616 N N   . ILE A 1 352 ? -25.762 16.314 7.854   1.00 50.13  ? 396  ILE A N   1 
ATOM   2617 C CA  . ILE A 1 352 ? -24.382 16.701 8.034   1.00 48.51  ? 396  ILE A CA  1 
ATOM   2618 C C   . ILE A 1 352 ? -23.874 17.265 6.725   1.00 49.16  ? 396  ILE A C   1 
ATOM   2619 O O   . ILE A 1 352 ? -24.235 16.751 5.663   1.00 51.89  ? 396  ILE A O   1 
ATOM   2620 C CB  . ILE A 1 352 ? -23.534 15.492 8.506   1.00 48.36  ? 396  ILE A CB  1 
ATOM   2621 C CG1 . ILE A 1 352 ? -22.068 15.869 8.673   1.00 46.97  ? 396  ILE A CG1 1 
ATOM   2622 C CG2 . ILE A 1 352 ? -23.700 14.319 7.560   1.00 51.58  ? 396  ILE A CG2 1 
ATOM   2623 C CD1 . ILE A 1 352 ? -21.346 14.961 9.674   1.00 46.78  ? 396  ILE A CD1 1 
ATOM   2624 N N   . THR A 1 353 ? -23.086 18.347 6.803   1.00 44.13  ? 397  THR A N   1 
ATOM   2625 C CA  . THR A 1 353 ? -22.383 18.908 5.641   1.00 45.24  ? 397  THR A CA  1 
ATOM   2626 C C   . THR A 1 353 ? -20.910 18.756 5.913   1.00 43.81  ? 397  THR A C   1 
ATOM   2627 O O   . THR A 1 353 ? -20.484 18.964 7.066   1.00 42.32  ? 397  THR A O   1 
ATOM   2628 C CB  . THR A 1 353 ? -22.719 20.396 5.385   1.00 46.22  ? 397  THR A CB  1 
ATOM   2629 O OG1 . THR A 1 353 ? -21.983 20.871 4.249   1.00 47.76  ? 397  THR A OG1 1 
ATOM   2630 C CG2 . THR A 1 353 ? -22.425 21.257 6.590   1.00 45.02  ? 397  THR A CG2 1 
ATOM   2631 N N   . PHE A 1 354 ? -20.122 18.307 4.930   1.00 48.72  ? 398  PHE A N   1 
ATOM   2632 C CA  . PHE A 1 354 ? -18.660 18.308 5.104   1.00 47.57  ? 398  PHE A CA  1 
ATOM   2633 C C   . PHE A 1 354 ? -17.945 19.473 4.431   1.00 48.10  ? 398  PHE A C   1 
ATOM   2634 O O   . PHE A 1 354 ? -16.753 19.670 4.651   1.00 47.32  ? 398  PHE A O   1 
ATOM   2635 C CB  . PHE A 1 354 ? -18.079 16.999 4.587   1.00 48.12  ? 398  PHE A CB  1 
ATOM   2636 C CG  . PHE A 1 354 ? -18.640 15.796 5.254   1.00 48.42  ? 398  PHE A CG  1 
ATOM   2637 C CD1 . PHE A 1 354 ? -18.250 15.457 6.552   1.00 47.22  ? 398  PHE A CD1 1 
ATOM   2638 C CD2 . PHE A 1 354 ? -19.608 15.005 4.617   1.00 50.62  ? 398  PHE A CD2 1 
ATOM   2639 C CE1 . PHE A 1 354 ? -18.802 14.309 7.207   1.00 47.99  ? 398  PHE A CE1 1 
ATOM   2640 C CE2 . PHE A 1 354 ? -20.168 13.867 5.261   1.00 51.72  ? 398  PHE A CE2 1 
ATOM   2641 C CZ  . PHE A 1 354 ? -19.753 13.518 6.555   1.00 50.32  ? 398  PHE A CZ  1 
ATOM   2642 N N   . ASP A 1 355 ? -18.633 20.173 3.543   1.00 60.83  ? 399  ASP A N   1 
ATOM   2643 C CA  . ASP A 1 355 ? -18.020 21.228 2.727   1.00 62.22  ? 399  ASP A CA  1 
ATOM   2644 C C   . ASP A 1 355 ? -18.438 22.669 3.073   1.00 63.74  ? 399  ASP A C   1 
ATOM   2645 O O   . ASP A 1 355 ? -18.589 23.499 2.174   1.00 66.19  ? 399  ASP A O   1 
ATOM   2646 C CB  . ASP A 1 355 ? -18.184 20.936 1.231   1.00 64.02  ? 399  ASP A CB  1 
ATOM   2647 C CG  . ASP A 1 355 ? -19.599 20.748 0.814   1.00 65.76  ? 399  ASP A CG  1 
ATOM   2648 O OD1 . ASP A 1 355 ? -20.507 20.659 1.682   1.00 65.21  ? 399  ASP A OD1 1 
ATOM   2649 O OD2 . ASP A 1 355 ? -19.794 20.668 -0.414  1.00 67.81  ? 399  ASP A OD2 1 
ATOM   2650 N N   . GLN A 1 356 ? -18.849 22.905 4.306   1.00 46.85  ? 400  GLN A N   1 
ATOM   2651 C CA  . GLN A 1 356 ? -19.324 24.236 4.706   1.00 49.01  ? 400  GLN A CA  1 
ATOM   2652 C C   . GLN A 1 356 ? -20.679 24.596 4.048   1.00 51.34  ? 400  GLN A C   1 
ATOM   2653 O O   . GLN A 1 356 ? -20.939 25.752 3.703   1.00 54.51  ? 400  GLN A O   1 
ATOM   2654 C CB  . GLN A 1 356 ? -18.265 25.302 4.378   1.00 50.87  ? 400  GLN A CB  1 
ATOM   2655 C CG  . GLN A 1 356 ? -18.337 26.541 5.244   1.00 52.90  ? 400  GLN A CG  1 
ATOM   2656 C CD  . GLN A 1 356 ? -17.213 27.544 4.960   1.00 54.48  ? 400  GLN A CD  1 
ATOM   2657 O OE1 . GLN A 1 356 ? -17.137 28.157 3.876   1.00 56.56  ? 400  GLN A OE1 1 
ATOM   2658 N NE2 . GLN A 1 356 ? -16.338 27.723 5.950   1.00 53.28  ? 400  GLN A NE2 1 
ATOM   2659 N N   . GLY A 1 357 ? -21.548 23.605 3.901   1.00 51.07  ? 401  GLY A N   1 
ATOM   2660 C CA  . GLY A 1 357 ? -22.925 23.882 3.535   1.00 53.19  ? 401  GLY A CA  1 
ATOM   2661 C C   . GLY A 1 357 ? -23.217 23.865 2.051   1.00 55.98  ? 401  GLY A C   1 
ATOM   2662 O O   . GLY A 1 357 ? -24.312 24.221 1.599   1.00 58.04  ? 401  GLY A O   1 
ATOM   2663 N N   . GLY A 1 358 ? -22.212 23.452 1.293   1.00 45.64  ? 402  GLY A N   1 
ATOM   2664 C CA  . GLY A 1 358 ? -22.332 23.313 -0.127  1.00 47.70  ? 402  GLY A CA  1 
ATOM   2665 C C   . GLY A 1 358 ? -23.134 22.071 -0.375  1.00 47.60  ? 402  GLY A C   1 
ATOM   2666 O O   . GLY A 1 358 ? -23.795 21.992 -1.400  1.00 49.83  ? 402  GLY A O   1 
ATOM   2667 N N   . ARG A 1 359 ? -23.075 21.084 0.509   1.00 72.81  ? 403  ARG A N   1 
ATOM   2668 C CA  . ARG A 1 359 ? -24.002 19.981 0.383   1.00 73.85  ? 403  ARG A CA  1 
ATOM   2669 C C   . ARG A 1 359 ? -24.305 19.281 1.684   1.00 72.32  ? 403  ARG A C   1 
ATOM   2670 O O   . ARG A 1 359 ? -23.423 19.059 2.499   1.00 69.39  ? 403  ARG A O   1 
ATOM   2671 C CB  . ARG A 1 359 ? -23.479 18.993 -0.628  1.00 74.50  ? 403  ARG A CB  1 
ATOM   2672 C CG  . ARG A 1 359 ? -23.786 17.570 -0.330  1.00 74.97  ? 403  ARG A CG  1 
ATOM   2673 C CD  . ARG A 1 359 ? -23.077 16.687 -1.307  1.00 75.60  ? 403  ARG A CD  1 
ATOM   2674 N NE  . ARG A 1 359 ? -21.813 17.295 -1.730  1.00 75.67  ? 403  ARG A NE  1 
ATOM   2675 C CZ  . ARG A 1 359 ? -21.613 17.906 -2.904  1.00 76.07  ? 403  ARG A CZ  1 
ATOM   2676 N NH1 . ARG A 1 359 ? -22.616 17.989 -3.792  1.00 76.26  ? 403  ARG A NH1 1 
ATOM   2677 N NH2 . ARG A 1 359 ? -20.418 18.440 -3.183  1.00 75.99  ? 403  ARG A NH2 1 
ATOM   2678 N N   . TRP A 1 360 ? -25.570 18.896 1.857   1.00 53.99  ? 404  TRP A N   1 
ATOM   2679 C CA  . TRP A 1 360 ? -25.991 18.191 3.064   1.00 51.92  ? 404  TRP A CA  1 
ATOM   2680 C C   . TRP A 1 360 ? -26.430 16.786 2.742   1.00 54.77  ? 404  TRP A C   1 
ATOM   2681 O O   . TRP A 1 360 ? -26.810 16.501 1.632   1.00 57.15  ? 404  TRP A O   1 
ATOM   2682 C CB  . TRP A 1 360 ? -27.091 18.953 3.746   1.00 50.26  ? 404  TRP A CB  1 
ATOM   2683 C CG  . TRP A 1 360 ? -26.692 20.293 4.196   1.00 48.66  ? 404  TRP A CG  1 
ATOM   2684 C CD1 . TRP A 1 360 ? -26.625 21.428 3.443   1.00 50.27  ? 404  TRP A CD1 1 
ATOM   2685 C CD2 . TRP A 1 360 ? -26.338 20.665 5.528   1.00 46.68  ? 404  TRP A CD2 1 
ATOM   2686 N NE1 . TRP A 1 360 ? -26.230 22.486 4.230   1.00 49.26  ? 404  TRP A NE1 1 
ATOM   2687 C CE2 . TRP A 1 360 ? -26.071 22.043 5.519   1.00 47.23  ? 404  TRP A CE2 1 
ATOM   2688 C CE3 . TRP A 1 360 ? -26.254 19.970 6.730   1.00 45.01  ? 404  TRP A CE3 1 
ATOM   2689 C CZ2 . TRP A 1 360 ? -25.722 22.739 6.666   1.00 46.37  ? 404  TRP A CZ2 1 
ATOM   2690 C CZ3 . TRP A 1 360 ? -25.890 20.661 7.867   1.00 43.82  ? 404  TRP A CZ3 1 
ATOM   2691 C CH2 . TRP A 1 360 ? -25.628 22.033 7.827   1.00 44.58  ? 404  TRP A CH2 1 
ATOM   2692 N N   . THR A 1 361 ? -26.322 15.905 3.715   1.00 48.18  ? 405  THR A N   1 
ATOM   2693 C CA  . THR A 1 361 ? -26.542 14.497 3.480   1.00 50.50  ? 405  THR A CA  1 
ATOM   2694 C C   . THR A 1 361 ? -26.921 13.848 4.809   1.00 49.76  ? 405  THR A C   1 
ATOM   2695 O O   . THR A 1 361 ? -26.873 14.499 5.861   1.00 47.19  ? 405  THR A O   1 
ATOM   2696 C CB  . THR A 1 361 ? -25.267 13.826 2.846   1.00 50.96  ? 405  THR A CB  1 
ATOM   2697 O OG1 . THR A 1 361 ? -25.501 12.445 2.572   1.00 53.95  ? 405  THR A OG1 1 
ATOM   2698 C CG2 . THR A 1 361 ? -24.022 13.944 3.743   1.00 47.77  ? 405  THR A CG2 1 
ATOM   2699 N N   . HIS A 1 362 ? -27.298 12.575 4.782   1.00 74.41  ? 406  HIS A N   1 
ATOM   2700 C CA  . HIS A 1 362 ? -27.628 11.869 6.009   1.00 73.72  ? 406  HIS A CA  1 
ATOM   2701 C C   . HIS A 1 362 ? -26.320 11.295 6.593   1.00 72.79  ? 406  HIS A C   1 
ATOM   2702 O O   . HIS A 1 362 ? -25.474 10.837 5.853   1.00 74.16  ? 406  HIS A O   1 
ATOM   2703 C CB  . HIS A 1 362 ? -28.662 10.764 5.748   1.00 77.80  ? 406  HIS A CB  1 
ATOM   2704 C CG  . HIS A 1 362 ? -30.040 11.263 5.383   1.00 76.86  ? 406  HIS A CG  1 
ATOM   2705 N ND1 . HIS A 1 362 ? -31.089 11.305 6.284   1.00 75.64  ? 406  HIS A ND1 1 
ATOM   2706 C CD2 . HIS A 1 362 ? -30.559 11.681 4.198   1.00 77.15  ? 406  HIS A CD2 1 
ATOM   2707 C CE1 . HIS A 1 362 ? -32.179 11.751 5.680   1.00 75.28  ? 406  HIS A CE1 1 
ATOM   2708 N NE2 . HIS A 1 362 ? -31.886 11.987 4.417   1.00 76.14  ? 406  HIS A NE2 1 
ATOM   2709 N N   . LEU A 1 363 ? -26.144 11.370 7.909   1.00 49.97  ? 407  LEU A N   1 
ATOM   2710 C CA  . LEU A 1 363 ? -25.067 10.689 8.617   1.00 49.35  ? 407  LEU A CA  1 
ATOM   2711 C C   . LEU A 1 363 ? -25.169 9.214  8.403   1.00 53.19  ? 407  LEU A C   1 
ATOM   2712 O O   . LEU A 1 363 ? -26.267 8.674  8.485   1.00 56.39  ? 407  LEU A O   1 
ATOM   2713 C CB  . LEU A 1 363 ? -25.110 10.949 10.116  1.00 47.20  ? 407  LEU A CB  1 
ATOM   2714 C CG  . LEU A 1 363 ? -24.744 12.352 10.545  1.00 43.87  ? 407  LEU A CG  1 
ATOM   2715 C CD1 . LEU A 1 363 ? -25.847 13.311 10.197  1.00 43.69  ? 407  LEU A CD1 1 
ATOM   2716 C CD2 . LEU A 1 363 ? -24.493 12.404 12.039  1.00 42.37  ? 407  LEU A CD2 1 
ATOM   2717 N N   . ARG A 1 364 ? -24.042 8.551  8.189   1.00 85.10  ? 408  ARG A N   1 
ATOM   2718 C CA  . ARG A 1 364 ? -24.042 7.129  7.960   1.00 89.76  ? 408  ARG A CA  1 
ATOM   2719 C C   . ARG A 1 364 ? -24.200 6.386  9.269   1.00 91.72  ? 408  ARG A C   1 
ATOM   2720 O O   . ARG A 1 364 ? -23.566 6.714  10.255  1.00 88.48  ? 408  ARG A O   1 
ATOM   2721 C CB  . ARG A 1 364 ? -22.768 6.714  7.233   1.00 87.78  ? 408  ARG A CB  1 
ATOM   2722 C CG  . ARG A 1 364 ? -22.372 5.281  7.461   1.00 89.28  ? 408  ARG A CG  1 
ATOM   2723 C CD  . ARG A 1 364 ? -21.483 4.769  6.336   1.00 87.56  ? 408  ARG A CD  1 
ATOM   2724 N NE  . ARG A 1 364 ? -20.909 5.854  5.533   1.00 84.25  ? 408  ARG A NE  1 
ATOM   2725 C CZ  . ARG A 1 364 ? -19.757 6.492  5.828   1.00 79.02  ? 408  ARG A CZ  1 
ATOM   2726 N NH1 . ARG A 1 364 ? -19.081 6.173  6.933   1.00 76.69  ? 408  ARG A NH1 1 
ATOM   2727 N NH2 . ARG A 1 364 ? -19.277 7.481  5.055   1.00 76.09  ? 408  ARG A NH2 1 
ATOM   2728 N N   . LYS A 1 365 ? -25.080 5.393  9.276   1.00 79.21  ? 409  LYS A N   1 
ATOM   2729 C CA  . LYS A 1 365 ? -25.329 4.607  10.473  1.00 80.64  ? 409  LYS A CA  1 
ATOM   2730 C C   . LYS A 1 365 ? -24.150 3.680  10.758  1.00 80.77  ? 409  LYS A C   1 
ATOM   2731 O O   . LYS A 1 365 ? -23.460 3.249  9.830   1.00 79.28  ? 409  LYS A O   1 
ATOM   2732 C CB  . LYS A 1 365 ? -26.626 3.800  10.332  1.00 82.39  ? 409  LYS A CB  1 
ATOM   2733 C CG  . LYS A 1 365 ? -26.494 2.489  9.600   1.00 83.48  ? 409  LYS A CG  1 
ATOM   2734 C CD  . LYS A 1 365 ? -27.606 1.544  10.015  1.00 84.27  ? 409  LYS A CD  1 
ATOM   2735 C CE  . LYS A 1 365 ? -27.634 0.296  9.154   1.00 84.89  ? 409  LYS A CE  1 
ATOM   2736 N NZ  . LYS A 1 365 ? -26.518 -0.641 9.494   1.00 85.06  ? 409  LYS A NZ  1 
ATOM   2737 N N   . PRO A 1 366 ? -23.926 3.357  12.041  1.00 72.84  ? 410  PRO A N   1 
ATOM   2738 C CA  . PRO A 1 366 ? -22.831 2.473  12.427  1.00 73.53  ? 410  PRO A CA  1 
ATOM   2739 C C   . PRO A 1 366 ? -22.909 1.168  11.671  1.00 75.36  ? 410  PRO A C   1 
ATOM   2740 O O   . PRO A 1 366 ? -24.004 0.793  11.308  1.00 76.99  ? 410  PRO A O   1 
ATOM   2741 C CB  . PRO A 1 366 ? -23.062 2.266  13.920  1.00 73.04  ? 410  PRO A CB  1 
ATOM   2742 C CG  . PRO A 1 366 ? -23.768 3.498  14.345  1.00 69.81  ? 410  PRO A CG  1 
ATOM   2743 C CD  . PRO A 1 366 ? -24.710 3.780  13.212  1.00 70.91  ? 410  PRO A CD  1 
ATOM   2744 N N   . GLU A 1 367 ? -21.783 0.512  11.413  1.00 143.20 ? 411  GLU A N   1 
ATOM   2745 C CA  . GLU A 1 367 ? -21.787 -0.706 10.613  1.00 143.15 ? 411  GLU A CA  1 
ATOM   2746 C C   . GLU A 1 367 ? -22.753 -1.745 11.182  1.00 145.40 ? 411  GLU A C   1 
ATOM   2747 O O   . GLU A 1 367 ? -23.530 -2.361 10.451  1.00 146.58 ? 411  GLU A O   1 
ATOM   2748 C CB  . GLU A 1 367 ? -20.370 -1.284 10.528  1.00 139.69 ? 411  GLU A CB  1 
ATOM   2749 C CG  . GLU A 1 367 ? -20.308 -2.803 10.648  1.00 142.30 ? 411  GLU A CG  1 
ATOM   2750 C CD  . GLU A 1 367 ? -18.890 -3.369 10.573  1.00 140.71 ? 411  GLU A CD  1 
ATOM   2751 O OE1 . GLU A 1 367 ? -17.933 -2.596 10.334  1.00 136.70 ? 411  GLU A OE1 1 
ATOM   2752 O OE2 . GLU A 1 367 ? -18.738 -4.598 10.768  1.00 143.28 ? 411  GLU A OE2 1 
ATOM   2753 N N   . ASN A 1 368 ? -22.698 -1.922 12.495  1.00 109.33 ? 412  ASN A N   1 
ATOM   2754 C CA  . ASN A 1 368 ? -23.440 -2.972 13.166  1.00 110.77 ? 412  ASN A CA  1 
ATOM   2755 C C   . ASN A 1 368 ? -24.746 -2.551 13.818  1.00 112.73 ? 412  ASN A C   1 
ATOM   2756 O O   . ASN A 1 368 ? -25.445 -3.382 14.405  1.00 113.74 ? 412  ASN A O   1 
ATOM   2757 C CB  . ASN A 1 368 ? -22.553 -3.610 14.219  1.00 109.33 ? 412  ASN A CB  1 
ATOM   2758 C CG  . ASN A 1 368 ? -21.379 -4.331 13.616  1.00 106.89 ? 412  ASN A CG  1 
ATOM   2759 O OD1 . ASN A 1 368 ? -21.528 -5.101 12.656  1.00 107.00 ? 412  ASN A OD1 1 
ATOM   2760 N ND2 . ASN A 1 368 ? -20.192 -4.081 14.163  1.00 104.23 ? 412  ASN A ND2 1 
ATOM   2761 N N   . SER A 1 369 ? -25.072 -1.266 13.748  1.00 94.17  ? 413  SER A N   1 
ATOM   2762 C CA  . SER A 1 369 ? -26.340 -0.782 14.283  1.00 94.83  ? 413  SER A CA  1 
ATOM   2763 C C   . SER A 1 369 ? -27.507 -1.272 13.431  1.00 96.39  ? 413  SER A C   1 
ATOM   2764 O O   . SER A 1 369 ? -27.400 -1.337 12.206  1.00 96.92  ? 413  SER A O   1 
ATOM   2765 C CB  . SER A 1 369 ? -26.344 0.746  14.354  1.00 93.49  ? 413  SER A CB  1 
ATOM   2766 O OG  . SER A 1 369 ? -25.464 1.213  15.362  1.00 91.60  ? 413  SER A OG  1 
ATOM   2767 N N   . GLU A 1 370 ? -28.624 -1.609 14.071  1.00 115.20 ? 414  GLU A N   1 
ATOM   2768 C CA  . GLU A 1 370 ? -29.812 -1.988 13.333  1.00 116.31 ? 414  GLU A CA  1 
ATOM   2769 C C   . GLU A 1 370 ? -30.864 -0.918 13.523  1.00 115.34 ? 414  GLU A C   1 
ATOM   2770 O O   . GLU A 1 370 ? -30.808 -0.133 14.472  1.00 113.77 ? 414  GLU A O   1 
ATOM   2771 C CB  . GLU A 1 370 ? -30.308 -3.357 13.782  1.00 117.74 ? 414  GLU A CB  1 
ATOM   2772 C CG  . GLU A 1 370 ? -29.184 -4.196 14.369  1.00 118.13 ? 414  GLU A CG  1 
ATOM   2773 C CD  . GLU A 1 370 ? -29.467 -5.690 14.371  1.00 122.43 ? 414  GLU A CD  1 
ATOM   2774 O OE1 . GLU A 1 370 ? -30.659 -6.092 14.376  1.00 125.51 ? 414  GLU A OE1 1 
ATOM   2775 O OE2 . GLU A 1 370 ? -28.478 -6.461 14.358  1.00 122.54 ? 414  GLU A OE2 1 
ATOM   2776 N N   . CYS A 1 371 ? -31.805 -0.869 12.583  1.00 87.24  ? 415  CYS A N   1 
ATOM   2777 C CA  . CYS A 1 371 ? -32.825 0.179  12.512  1.00 85.81  ? 415  CYS A CA  1 
ATOM   2778 C C   . CYS A 1 371 ? -33.899 0.102  13.596  1.00 85.56  ? 415  CYS A C   1 
ATOM   2779 O O   . CYS A 1 371 ? -34.199 -0.973 14.116  1.00 87.28  ? 415  CYS A O   1 
ATOM   2780 C CB  . CYS A 1 371 ? -33.484 0.184  11.130  1.00 86.18  ? 415  CYS A CB  1 
ATOM   2781 S SG  . CYS A 1 371 ? -32.346 0.498  9.761   1.00 86.13  ? 415  CYS A SG  1 
ATOM   2782 N N   . ASP A 1 372 ? -34.475 1.256  13.926  1.00 83.08  ? 416  ASP A N   1 
ATOM   2783 C CA  . ASP A 1 372 ? -35.546 1.334  14.917  1.00 82.21  ? 416  ASP A CA  1 
ATOM   2784 C C   . ASP A 1 372 ? -36.913 1.403  14.241  1.00 82.33  ? 416  ASP A C   1 
ATOM   2785 O O   . ASP A 1 372 ? -37.009 1.274  13.020  1.00 83.33  ? 416  ASP A O   1 
ATOM   2786 C CB  . ASP A 1 372 ? -35.335 2.530  15.881  1.00 79.18  ? 416  ASP A CB  1 
ATOM   2787 C CG  . ASP A 1 372 ? -35.385 3.904  15.199  1.00 76.58  ? 416  ASP A CG  1 
ATOM   2788 O OD1 . ASP A 1 372 ? -35.852 4.030  14.041  1.00 77.07  ? 416  ASP A OD1 1 
ATOM   2789 O OD2 . ASP A 1 372 ? -34.945 4.876  15.872  1.00 73.88  ? 416  ASP A OD2 1 
ATOM   2790 N N   . ALA A 1 373 ? -37.965 1.602  15.029  1.00 87.00  ? 417  ALA A N   1 
ATOM   2791 C CA  . ALA A 1 373 ? -39.325 1.554  14.498  1.00 88.03  ? 417  ALA A CA  1 
ATOM   2792 C C   . ALA A 1 373 ? -39.609 2.716  13.573  1.00 86.17  ? 417  ALA A C   1 
ATOM   2793 O O   . ALA A 1 373 ? -40.548 2.674  12.791  1.00 87.26  ? 417  ALA A O   1 
ATOM   2794 C CB  . ALA A 1 373 ? -40.337 1.532  15.617  1.00 87.93  ? 417  ALA A CB  1 
ATOM   2795 N N   . THR A 1 374 ? -38.800 3.754  13.679  1.00 88.16  ? 418  THR A N   1 
ATOM   2796 C CA  . THR A 1 374 ? -38.889 4.905  12.801  1.00 86.20  ? 418  THR A CA  1 
ATOM   2797 C C   . THR A 1 374 ? -38.590 4.534  11.352  1.00 87.75  ? 418  THR A C   1 
ATOM   2798 O O   . THR A 1 374 ? -39.103 5.151  10.418  1.00 87.46  ? 418  THR A O   1 
ATOM   2799 C CB  . THR A 1 374 ? -37.899 5.996  13.244  1.00 83.49  ? 418  THR A CB  1 
ATOM   2800 O OG1 . THR A 1 374 ? -38.231 6.460  14.556  1.00 85.64  ? 418  THR A OG1 1 
ATOM   2801 C CG2 . THR A 1 374 ? -37.951 7.127  12.327  1.00 80.83  ? 418  THR A CG2 1 
ATOM   2802 N N   . ALA A 1 375 ? -37.743 3.525  11.173  1.00 76.56  ? 419  ALA A N   1 
ATOM   2803 C CA  . ALA A 1 375 ? -37.226 3.192  9.853   1.00 77.35  ? 419  ALA A CA  1 
ATOM   2804 C C   . ALA A 1 375 ? -38.218 2.353  9.088   1.00 82.68  ? 419  ALA A C   1 
ATOM   2805 O O   . ALA A 1 375 ? -38.620 1.298  9.559   1.00 85.99  ? 419  ALA A O   1 
ATOM   2806 C CB  . ALA A 1 375 ? -35.883 2.459  9.959   1.00 75.99  ? 419  ALA A CB  1 
ATOM   2807 N N   . LYS A 1 376 ? -38.590 2.811  7.898   1.00 118.55 ? 420  LYS A N   1 
ATOM   2808 C CA  . LYS A 1 376 ? -39.525 2.059  7.080   1.00 119.66 ? 420  LYS A CA  1 
ATOM   2809 C C   . LYS A 1 376 ? -38.855 0.844  6.451   1.00 121.46 ? 420  LYS A C   1 
ATOM   2810 O O   . LYS A 1 376 ? -39.527 -0.106 6.061   1.00 122.72 ? 420  LYS A O   1 
ATOM   2811 C CB  . LYS A 1 376 ? -40.141 2.946  6.000   1.00 118.39 ? 420  LYS A CB  1 
ATOM   2812 C CG  . LYS A 1 376 ? -39.180 3.493  4.969   1.00 118.09 ? 420  LYS A CG  1 
ATOM   2813 C CD  . LYS A 1 376 ? -39.961 4.322  3.972   1.00 117.38 ? 420  LYS A CD  1 
ATOM   2814 C CE  . LYS A 1 376 ? -39.096 4.925  2.885   1.00 117.32 ? 420  LYS A CE  1 
ATOM   2815 N NZ  . LYS A 1 376 ? -39.939 5.730  1.938   1.00 117.61 ? 420  LYS A NZ  1 
ATOM   2816 N N   . ASN A 1 377 ? -37.532 0.883  6.349   1.00 110.27 ? 421  ASN A N   1 
ATOM   2817 C CA  . ASN A 1 377 ? -36.757 -0.285 5.953   1.00 111.72 ? 421  ASN A CA  1 
ATOM   2818 C C   . ASN A 1 377 ? -35.799 -0.662 7.059   1.00 112.45 ? 421  ASN A C   1 
ATOM   2819 O O   . ASN A 1 377 ? -35.143 0.198  7.652   1.00 111.55 ? 421  ASN A O   1 
ATOM   2820 C CB  . ASN A 1 377 ? -35.987 -0.032 4.662   1.00 111.20 ? 421  ASN A CB  1 
ATOM   2821 C CG  . ASN A 1 377 ? -35.234 -1.265 4.175   1.00 111.99 ? 421  ASN A CG  1 
ATOM   2822 O OD1 . ASN A 1 377 ? -34.752 -2.079 4.968   1.00 113.05 ? 421  ASN A OD1 1 
ATOM   2823 N ND2 . ASN A 1 377 ? -35.117 -1.398 2.860   1.00 111.14 ? 421  ASN A ND2 1 
ATOM   2824 N N   . LYS A 1 378 ? -35.704 -1.960 7.314   1.00 109.19 ? 422  LYS A N   1 
ATOM   2825 C CA  . LYS A 1 378 ? -35.019 -2.458 8.498   1.00 110.09 ? 422  LYS A CA  1 
ATOM   2826 C C   . LYS A 1 378 ? -33.494 -2.591 8.411   1.00 109.79 ? 422  LYS A C   1 
ATOM   2827 O O   . LYS A 1 378 ? -32.819 -2.465 9.430   1.00 110.02 ? 422  LYS A O   1 
ATOM   2828 C CB  . LYS A 1 378 ? -35.638 -3.796 8.906   1.00 111.79 ? 422  LYS A CB  1 
ATOM   2829 C CG  . LYS A 1 378 ? -35.026 -4.369 10.197  1.00 111.41 ? 422  LYS A CG  1 
ATOM   2830 C CD  . LYS A 1 378 ? -35.702 -5.683 10.603  1.00 111.23 ? 422  LYS A CD  1 
ATOM   2831 C CE  . LYS A 1 378 ? -35.102 -6.279 11.857  1.00 109.90 ? 422  LYS A CE  1 
ATOM   2832 N NZ  . LYS A 1 378 ? -35.797 -7.551 12.202  1.00 108.68 ? 422  LYS A NZ  1 
ATOM   2833 N N   . ASN A 1 379 ? -32.947 -2.877 7.233   1.00 154.96 ? 423  ASN A N   1 
ATOM   2834 C CA  . ASN A 1 379 ? -31.485 -2.891 7.063   1.00 153.96 ? 423  ASN A CA  1 
ATOM   2835 C C   . ASN A 1 379 ? -30.913 -1.506 6.706   1.00 152.91 ? 423  ASN A C   1 
ATOM   2836 O O   . ASN A 1 379 ? -29.714 -1.277 6.843   1.00 152.18 ? 423  ASN A O   1 
ATOM   2837 C CB  . ASN A 1 379 ? -31.061 -3.883 5.964   1.00 153.39 ? 423  ASN A CB  1 
ATOM   2838 C CG  . ASN A 1 379 ? -30.964 -5.319 6.441   1.00 154.23 ? 423  ASN A CG  1 
ATOM   2839 O OD1 . ASN A 1 379 ? -31.626 -5.718 7.392   1.00 155.64 ? 423  ASN A OD1 1 
ATOM   2840 N ND2 . ASN A 1 379 ? -30.147 -6.115 5.749   1.00 153.18 ? 423  ASN A ND2 1 
ATOM   2841 N N   . GLU A 1 380 ? -31.779 -0.599 6.238   1.00 122.26 ? 424  GLU A N   1 
ATOM   2842 C CA  . GLU A 1 380 ? -31.369 0.725  5.741   1.00 121.27 ? 424  GLU A CA  1 
ATOM   2843 C C   . GLU A 1 380 ? -31.974 1.930  6.464   1.00 120.53 ? 424  GLU A C   1 
ATOM   2844 O O   . GLU A 1 380 ? -33.168 2.194  6.381   1.00 120.09 ? 424  GLU A O   1 
ATOM   2845 C CB  . GLU A 1 380 ? -31.696 0.896  4.250   1.00 120.66 ? 424  GLU A CB  1 
ATOM   2846 C CG  . GLU A 1 380 ? -30.925 0.026  3.279   1.00 119.73 ? 424  GLU A CG  1 
ATOM   2847 C CD  . GLU A 1 380 ? -31.352 0.199  1.838   1.00 122.49 ? 424  GLU A CD  1 
ATOM   2848 O OE1 . GLU A 1 380 ? -32.386 0.862  1.590   1.00 125.43 ? 424  GLU A OE1 1 
ATOM   2849 O OE2 . GLU A 1 380 ? -30.646 -0.325 0.947   1.00 121.40 ? 424  GLU A OE2 1 
ATOM   2850 N N   . CYS A 1 381 ? -31.096 2.583  7.230   1.00 79.77  ? 425  CYS A N   1 
ATOM   2851 C CA  . CYS A 1 381 ? -31.407 3.700  8.121   1.00 78.01  ? 425  CYS A CA  1 
ATOM   2852 C C   . CYS A 1 381 ? -30.149 4.539  8.410   1.00 77.19  ? 425  CYS A C   1 
ATOM   2853 O O   . CYS A 1 381 ? -29.029 4.107  8.136   1.00 78.43  ? 425  CYS A O   1 
ATOM   2854 C CB  . CYS A 1 381 ? -32.014 3.191  9.430   1.00 77.71  ? 425  CYS A CB  1 
ATOM   2855 S SG  . CYS A 1 381 ? -31.002 1.968  10.296  1.00 79.66  ? 425  CYS A SG  1 
ATOM   2856 N N   . SER A 1 382 ? -30.349 5.736  8.957   1.00 71.30  ? 426  SER A N   1 
ATOM   2857 C CA  . SER A 1 382 ? -29.298 6.686  9.226   1.00 70.95  ? 426  SER A CA  1 
ATOM   2858 C C   . SER A 1 382 ? -29.039 6.793  10.702  1.00 69.20  ? 426  SER A C   1 
ATOM   2859 O O   . SER A 1 382 ? -29.705 6.147  11.513  1.00 68.37  ? 426  SER A O   1 
ATOM   2860 C CB  . SER A 1 382 ? -29.684 8.064  8.711   1.00 71.09  ? 426  SER A CB  1 
ATOM   2861 O OG  . SER A 1 382 ? -30.196 7.975  7.405   1.00 72.15  ? 426  SER A OG  1 
ATOM   2862 N N   . LEU A 1 383 ? -28.060 7.632  11.042  1.00 65.91  ? 427  LEU A N   1 
ATOM   2863 C CA  . LEU A 1 383 ? -27.909 8.121  12.394  1.00 64.12  ? 427  LEU A CA  1 
ATOM   2864 C C   . LEU A 1 383 ? -28.535 9.515  12.487  1.00 63.57  ? 427  LEU A C   1 
ATOM   2865 O O   . LEU A 1 383 ? -28.446 10.320 11.568  1.00 64.60  ? 427  LEU A O   1 
ATOM   2866 C CB  . LEU A 1 383 ? -26.441 8.145  12.793  1.00 63.99  ? 427  LEU A CB  1 
ATOM   2867 C CG  . LEU A 1 383 ? -26.103 8.610  14.213  1.00 62.19  ? 427  LEU A CG  1 
ATOM   2868 C CD1 . LEU A 1 383 ? -26.603 7.641  15.278  1.00 61.43  ? 427  LEU A CD1 1 
ATOM   2869 C CD2 . LEU A 1 383 ? -24.596 8.832  14.335  1.00 62.30  ? 427  LEU A CD2 1 
ATOM   2870 N N   . HIS A 1 384 ? -29.186 9.776  13.608  1.00 53.25  ? 428  HIS A N   1 
ATOM   2871 C CA  . HIS A 1 384 ? -29.816 11.048 13.892  1.00 53.06  ? 428  HIS A CA  1 
ATOM   2872 C C   . HIS A 1 384 ? -29.321 11.486 15.264  1.00 51.90  ? 428  HIS A C   1 
ATOM   2873 O O   . HIS A 1 384 ? -29.033 10.663 16.116  1.00 51.07  ? 428  HIS A O   1 
ATOM   2874 C CB  . HIS A 1 384 ? -31.354 10.902 13.812  1.00 53.35  ? 428  HIS A CB  1 
ATOM   2875 C CG  . HIS A 1 384 ? -31.813 10.449 12.463  1.00 54.46  ? 428  HIS A CG  1 
ATOM   2876 N ND1 . HIS A 1 384 ? -31.968 11.320 11.403  1.00 55.38  ? 428  HIS A ND1 1 
ATOM   2877 C CD2 . HIS A 1 384 ? -32.044 9.211  11.969  1.00 55.33  ? 428  HIS A CD2 1 
ATOM   2878 C CE1 . HIS A 1 384 ? -32.315 10.641 10.328  1.00 56.25  ? 428  HIS A CE1 1 
ATOM   2879 N NE2 . HIS A 1 384 ? -32.367 9.357  10.643  1.00 56.52  ? 428  HIS A NE2 1 
ATOM   2880 N N   . ILE A 1 385 ? -29.198 12.782 15.474  1.00 53.85  ? 429  ILE A N   1 
ATOM   2881 C CA  . ILE A 1 385 ? -28.478 13.262 16.628  1.00 52.96  ? 429  ILE A CA  1 
ATOM   2882 C C   . ILE A 1 385 ? -29.396 14.033 17.538  1.00 53.52  ? 429  ILE A C   1 
ATOM   2883 O O   . ILE A 1 385 ? -30.122 14.913 17.071  1.00 55.03  ? 429  ILE A O   1 
ATOM   2884 C CB  . ILE A 1 385 ? -27.279 14.195 16.220  1.00 53.17  ? 429  ILE A CB  1 
ATOM   2885 C CG1 . ILE A 1 385 ? -26.269 13.444 15.368  1.00 53.12  ? 429  ILE A CG1 1 
ATOM   2886 C CG2 . ILE A 1 385 ? -26.626 14.794 17.436  1.00 52.23  ? 429  ILE A CG2 1 
ATOM   2887 C CD1 . ILE A 1 385 ? -25.738 12.245 16.048  1.00 52.07  ? 429  ILE A CD1 1 
ATOM   2888 N N   . HIS A 1 386 ? -29.345 13.719 18.831  1.00 61.88  ? 430  HIS A N   1 
ATOM   2889 C CA  . HIS A 1 386 ? -29.977 14.537 19.846  1.00 62.93  ? 430  HIS A CA  1 
ATOM   2890 C C   . HIS A 1 386 ? -29.132 15.758 20.143  1.00 63.63  ? 430  HIS A C   1 
ATOM   2891 O O   . HIS A 1 386 ? -27.961 15.640 20.482  1.00 62.31  ? 430  HIS A O   1 
ATOM   2892 C CB  . HIS A 1 386 ? -30.185 13.732 21.117  1.00 62.31  ? 430  HIS A CB  1 
ATOM   2893 C CG  . HIS A 1 386 ? -31.153 12.614 20.953  1.00 62.10  ? 430  HIS A CG  1 
ATOM   2894 N ND1 . HIS A 1 386 ? -32.517 12.814 20.887  1.00 63.22  ? 430  HIS A ND1 1 
ATOM   2895 C CD2 . HIS A 1 386 ? -30.958 11.284 20.812  1.00 61.18  ? 430  HIS A CD2 1 
ATOM   2896 C CE1 . HIS A 1 386 ? -33.120 11.652 20.721  1.00 62.73  ? 430  HIS A CE1 1 
ATOM   2897 N NE2 . HIS A 1 386 ? -32.196 10.705 20.685  1.00 61.65  ? 430  HIS A NE2 1 
ATOM   2898 N N   . ALA A 1 387 ? -29.744 16.931 20.057  1.00 50.91  ? 431  ALA A N   1 
ATOM   2899 C CA  . ALA A 1 387 ? -29.066 18.196 20.339  1.00 52.56  ? 431  ALA A CA  1 
ATOM   2900 C C   . ALA A 1 387 ? -30.088 19.122 21.032  1.00 55.78  ? 431  ALA A C   1 
ATOM   2901 O O   . ALA A 1 387 ? -31.007 18.619 21.694  1.00 55.75  ? 431  ALA A O   1 
ATOM   2902 C CB  . ALA A 1 387 ? -28.482 18.811 19.083  1.00 53.24  ? 431  ALA A CB  1 
ATOM   2903 N N   . SER A 1 388 ? -29.866 20.438 21.005  1.00 63.74  ? 432  SER A N   1 
ATOM   2904 C CA  . SER A 1 388 ? -30.691 21.379 21.756  1.00 66.96  ? 432  SER A CA  1 
ATOM   2905 C C   . SER A 1 388 ? -32.177 21.123 21.641  1.00 66.77  ? 432  SER A C   1 
ATOM   2906 O O   . SER A 1 388 ? -32.912 21.159 22.639  1.00 67.74  ? 432  SER A O   1 
ATOM   2907 C CB  . SER A 1 388 ? -30.423 22.797 21.305  1.00 69.34  ? 432  SER A CB  1 
ATOM   2908 O OG  . SER A 1 388 ? -29.141 23.176 21.722  1.00 69.71  ? 432  SER A OG  1 
ATOM   2909 N N   . TYR A 1 389 ? -32.621 20.851 20.428  1.00 83.39  ? 433  TYR A N   1 
ATOM   2910 C CA  . TYR A 1 389 ? -34.020 20.652 20.237  1.00 83.02  ? 433  TYR A CA  1 
ATOM   2911 C C   . TYR A 1 389 ? -34.546 19.447 21.033  1.00 81.73  ? 433  TYR A C   1 
ATOM   2912 O O   . TYR A 1 389 ? -35.570 19.556 21.723  1.00 82.54  ? 433  TYR A O   1 
ATOM   2913 C CB  . TYR A 1 389 ? -34.347 20.493 18.766  1.00 81.77  ? 433  TYR A CB  1 
ATOM   2914 C CG  . TYR A 1 389 ? -35.834 20.463 18.631  1.00 81.72  ? 433  TYR A CG  1 
ATOM   2915 C CD1 . TYR A 1 389 ? -36.568 21.628 18.686  1.00 82.99  ? 433  TYR A CD1 1 
ATOM   2916 C CD2 . TYR A 1 389 ? -36.511 19.259 18.549  1.00 80.31  ? 433  TYR A CD2 1 
ATOM   2917 C CE1 . TYR A 1 389 ? -37.922 21.593 18.614  1.00 82.88  ? 433  TYR A CE1 1 
ATOM   2918 C CE2 . TYR A 1 389 ? -37.860 19.216 18.476  1.00 80.42  ? 433  TYR A CE2 1 
ATOM   2919 C CZ  . TYR A 1 389 ? -38.560 20.383 18.512  1.00 81.70  ? 433  TYR A CZ  1 
ATOM   2920 O OH  . TYR A 1 389 ? -39.919 20.337 18.440  1.00 81.71  ? 433  TYR A OH  1 
ATOM   2921 N N   . SER A 1 390 ? -33.861 18.308 20.936  1.00 61.02  ? 434  SER A N   1 
ATOM   2922 C CA  . SER A 1 390 ? -34.229 17.136 21.724  1.00 59.67  ? 434  SER A CA  1 
ATOM   2923 C C   . SER A 1 390 ? -34.324 17.460 23.210  1.00 61.19  ? 434  SER A C   1 
ATOM   2924 O O   . SER A 1 390 ? -35.347 17.182 23.868  1.00 61.74  ? 434  SER A O   1 
ATOM   2925 C CB  . SER A 1 390 ? -33.227 16.016 21.532  1.00 57.14  ? 434  SER A CB  1 
ATOM   2926 O OG  . SER A 1 390 ? -33.509 15.277 20.371  1.00 55.94  ? 434  SER A OG  1 
ATOM   2927 N N   . ILE A 1 391 ? -33.245 18.043 23.734  1.00 55.36  ? 435  ILE A N   1 
ATOM   2928 C CA  . ILE A 1 391 ? -33.147 18.404 25.148  1.00 57.02  ? 435  ILE A CA  1 
ATOM   2929 C C   . ILE A 1 391 ? -34.344 19.254 25.572  1.00 59.67  ? 435  ILE A C   1 
ATOM   2930 O O   . ILE A 1 391 ? -34.954 19.002 26.597  1.00 60.20  ? 435  ILE A O   1 
ATOM   2931 C CB  . ILE A 1 391 ? -31.806 19.136 25.431  1.00 57.82  ? 435  ILE A CB  1 
ATOM   2932 C CG1 . ILE A 1 391 ? -30.665 18.121 25.396  1.00 54.26  ? 435  ILE A CG1 1 
ATOM   2933 C CG2 . ILE A 1 391 ? -31.825 19.813 26.770  1.00 60.39  ? 435  ILE A CG2 1 
ATOM   2934 C CD1 . ILE A 1 391 ? -29.341 18.668 24.897  1.00 53.42  ? 435  ILE A CD1 1 
ATOM   2935 N N   . SER A 1 392 ? -34.705 20.229 24.753  1.00 67.90  ? 436  SER A N   1 
ATOM   2936 C CA  . SER A 1 392 ? -35.767 21.142 25.107  1.00 69.64  ? 436  SER A CA  1 
ATOM   2937 C C   . SER A 1 392 ? -37.125 20.432 25.164  1.00 68.73  ? 436  SER A C   1 
ATOM   2938 O O   . SER A 1 392 ? -38.069 20.908 25.802  1.00 69.88  ? 436  SER A O   1 
ATOM   2939 C CB  . SER A 1 392 ? -35.819 22.296 24.112  1.00 70.11  ? 436  SER A CB  1 
ATOM   2940 O OG  . SER A 1 392 ? -36.560 21.927 22.966  1.00 68.58  ? 436  SER A OG  1 
ATOM   2941 N N   . GLN A 1 393 ? -37.236 19.290 24.504  1.00 85.97  ? 437  GLN A N   1 
ATOM   2942 C CA  . GLN A 1 393 ? -38.510 18.587 24.494  1.00 85.18  ? 437  GLN A CA  1 
ATOM   2943 C C   . GLN A 1 393 ? -38.584 17.610 25.643  1.00 84.83  ? 437  GLN A C   1 
ATOM   2944 O O   . GLN A 1 393 ? -39.493 16.787 25.694  1.00 84.04  ? 437  GLN A O   1 
ATOM   2945 C CB  . GLN A 1 393 ? -38.755 17.874 23.167  1.00 83.28  ? 437  GLN A CB  1 
ATOM   2946 C CG  . GLN A 1 393 ? -38.895 18.828 21.998  1.00 83.66  ? 437  GLN A CG  1 
ATOM   2947 C CD  . GLN A 1 393 ? -39.819 19.989 22.293  1.00 85.17  ? 437  GLN A CD  1 
ATOM   2948 O OE1 . GLN A 1 393 ? -41.032 19.871 22.155  1.00 84.99  ? 437  GLN A OE1 1 
ATOM   2949 N NE2 . GLN A 1 393 ? -39.250 21.124 22.691  1.00 86.59  ? 437  GLN A NE2 1 
ATOM   2950 N N   . LYS A 1 394 ? -37.606 17.683 26.538  1.00 92.23  ? 438  LYS A N   1 
ATOM   2951 C CA  . LYS A 1 394 ? -37.574 16.865 27.752  1.00 92.04  ? 438  LYS A CA  1 
ATOM   2952 C C   . LYS A 1 394 ? -37.394 15.378 27.412  1.00 89.31  ? 438  LYS A C   1 
ATOM   2953 O O   . LYS A 1 394 ? -37.722 14.505 28.206  1.00 88.78  ? 438  LYS A O   1 
ATOM   2954 C CB  . LYS A 1 394 ? -38.842 17.079 28.604  1.00 93.80  ? 438  LYS A CB  1 
ATOM   2955 C CG  . LYS A 1 394 ? -39.147 18.533 29.021  1.00 96.46  ? 438  LYS A CG  1 
ATOM   2956 C CD  . LYS A 1 394 ? -37.912 19.219 29.607  1.00 97.74  ? 438  LYS A CD  1 
ATOM   2957 C CE  . LYS A 1 394 ? -37.995 20.758 29.556  1.00 99.80  ? 438  LYS A CE  1 
ATOM   2958 N NZ  . LYS A 1 394 ? -36.626 21.397 29.502  1.00 100.48 ? 438  LYS A NZ  1 
ATOM   2959 N N   . LEU A 1 395 ? -36.808 15.110 26.247  1.00 73.19  ? 439  LEU A N   1 
ATOM   2960 C CA  . LEU A 1 395 ? -36.274 13.780 25.924  1.00 70.78  ? 439  LEU A CA  1 
ATOM   2961 C C   . LEU A 1 395 ? -35.144 13.444 26.880  1.00 70.17  ? 439  LEU A C   1 
ATOM   2962 O O   . LEU A 1 395 ? -34.584 14.350 27.528  1.00 71.42  ? 439  LEU A O   1 
ATOM   2963 C CB  . LEU A 1 395 ? -35.730 13.712 24.503  1.00 69.42  ? 439  LEU A CB  1 
ATOM   2964 C CG  . LEU A 1 395 ? -36.715 13.738 23.355  1.00 69.48  ? 439  LEU A CG  1 
ATOM   2965 C CD1 . LEU A 1 395 ? -36.017 13.180 22.142  1.00 67.82  ? 439  LEU A CD1 1 
ATOM   2966 C CD2 . LEU A 1 395 ? -37.970 12.942 23.705  1.00 69.62  ? 439  LEU A CD2 1 
ATOM   2967 N N   . ASN A 1 396 ? -34.780 12.166 26.974  1.00 89.08  ? 440  ASN A N   1 
ATOM   2968 C CA  . ASN A 1 396 ? -33.778 11.830 27.966  1.00 88.69  ? 440  ASN A CA  1 
ATOM   2969 C C   . ASN A 1 396 ? -32.402 11.963 27.345  1.00 87.37  ? 440  ASN A C   1 
ATOM   2970 O O   . ASN A 1 396 ? -31.800 10.998 26.895  1.00 85.93  ? 440  ASN A O   1 
ATOM   2971 C CB  . ASN A 1 396 ? -34.017 10.400 28.458  1.00 88.00  ? 440  ASN A CB  1 
ATOM   2972 C CG  . ASN A 1 396 ? -33.348 10.112 29.781  1.00 88.41  ? 440  ASN A CG  1 
ATOM   2973 O OD1 . ASN A 1 396 ? -32.155 10.368 29.960  1.00 87.98  ? 440  ASN A OD1 1 
ATOM   2974 N ND2 . ASN A 1 396 ? -34.113 9.576  30.719  1.00 89.36  ? 440  ASN A ND2 1 
ATOM   2975 N N   . VAL A 1 397 ? -31.872 13.172 27.470  1.00 60.23  ? 441  VAL A N   1 
ATOM   2976 C CA  . VAL A 1 397 ? -30.617 13.586 26.847  1.00 59.16  ? 441  VAL A CA  1 
ATOM   2977 C C   . VAL A 1 397 ? -29.787 14.431 27.797  1.00 60.13  ? 441  VAL A C   1 
ATOM   2978 O O   . VAL A 1 397 ? -30.050 15.619 27.921  1.00 62.13  ? 441  VAL A O   1 
ATOM   2979 C CB  . VAL A 1 397 ? -30.846 14.378 25.559  1.00 59.40  ? 441  VAL A CB  1 
ATOM   2980 C CG1 . VAL A 1 397 ? -29.492 14.577 24.828  1.00 58.14  ? 441  VAL A CG1 1 
ATOM   2981 C CG2 . VAL A 1 397 ? -31.869 13.662 24.669  1.00 58.88  ? 441  VAL A CG2 1 
ATOM   2982 N N   . PRO A 1 398 ? -28.850 13.822 28.528  1.00 65.54  ? 442  PRO A N   1 
ATOM   2983 C CA  . PRO A 1 398 ? -28.083 14.669 29.447  1.00 66.61  ? 442  PRO A CA  1 
ATOM   2984 C C   . PRO A 1 398 ? -27.138 15.679 28.751  1.00 65.95  ? 442  PRO A C   1 
ATOM   2985 O O   . PRO A 1 398 ? -26.907 16.722 29.350  1.00 67.46  ? 442  PRO A O   1 
ATOM   2986 C CB  . PRO A 1 398 ? -27.289 13.652 30.282  1.00 66.10  ? 442  PRO A CB  1 
ATOM   2987 C CG  . PRO A 1 398 ? -27.187 12.433 29.417  1.00 64.42  ? 442  PRO A CG  1 
ATOM   2988 C CD  . PRO A 1 398 ? -28.428 12.411 28.558  1.00 64.24  ? 442  PRO A CD  1 
ATOM   2989 N N   . MET A 1 399 ? -26.619 15.399 27.551  1.00 62.82  ? 443  MET A N   1 
ATOM   2990 C CA  . MET A 1 399 ? -25.671 16.306 26.873  1.00 61.91  ? 443  MET A CA  1 
ATOM   2991 C C   . MET A 1 399 ? -25.844 16.443 25.366  1.00 61.12  ? 443  MET A C   1 
ATOM   2992 O O   . MET A 1 399 ? -26.093 15.467 24.667  1.00 60.18  ? 443  MET A O   1 
ATOM   2993 C CB  . MET A 1 399 ? -24.223 15.856 27.097  1.00 60.30  ? 443  MET A CB  1 
ATOM   2994 C CG  . MET A 1 399 ? -23.566 16.375 28.324  1.00 61.43  ? 443  MET A CG  1 
ATOM   2995 S SD  . MET A 1 399 ? -21.822 15.898 28.371  1.00 60.56  ? 443  MET A SD  1 
ATOM   2996 C CE  . MET A 1 399 ? -21.166 17.036 27.159  1.00 58.88  ? 443  MET A CE  1 
ATOM   2997 N N   . ALA A 1 400 ? -25.585 17.646 24.866  1.00 48.02  ? 444  ALA A N   1 
ATOM   2998 C CA  . ALA A 1 400 ? -25.531 17.911 23.427  1.00 47.72  ? 444  ALA A CA  1 
ATOM   2999 C C   . ALA A 1 400 ? -24.287 17.268 22.786  1.00 44.80  ? 444  ALA A C   1 
ATOM   3000 O O   . ALA A 1 400 ? -23.420 16.718 23.484  1.00 43.47  ? 444  ALA A O   1 
ATOM   3001 C CB  . ALA A 1 400 ? -25.543 19.396 23.176  1.00 49.93  ? 444  ALA A CB  1 
ATOM   3002 N N   . PRO A 1 401 ? -24.158 17.331 21.466  1.00 49.02  ? 445  PRO A N   1 
ATOM   3003 C CA  . PRO A 1 401 ? -22.978 16.733 20.821  1.00 47.05  ? 445  PRO A CA  1 
ATOM   3004 C C   . PRO A 1 401 ? -21.689 17.438 21.255  1.00 45.87  ? 445  PRO A C   1 
ATOM   3005 O O   . PRO A 1 401 ? -21.705 18.662 21.384  1.00 46.44  ? 445  PRO A O   1 
ATOM   3006 C CB  . PRO A 1 401 ? -23.237 16.975 19.334  1.00 47.87  ? 445  PRO A CB  1 
ATOM   3007 C CG  . PRO A 1 401 ? -24.723 17.037 19.221  1.00 49.98  ? 445  PRO A CG  1 
ATOM   3008 C CD  . PRO A 1 401 ? -25.206 17.680 20.491  1.00 51.09  ? 445  PRO A CD  1 
ATOM   3009 N N   . LEU A 1 402 ? -20.598 16.701 21.479  1.00 44.47  ? 446  LEU A N   1 
ATOM   3010 C CA  . LEU A 1 402 ? -19.367 17.351 21.914  1.00 44.04  ? 446  LEU A CA  1 
ATOM   3011 C C   . LEU A 1 402 ? -18.213 17.092 20.961  1.00 44.08  ? 446  LEU A C   1 
ATOM   3012 O O   . LEU A 1 402 ? -17.974 15.956 20.522  1.00 44.96  ? 446  LEU A O   1 
ATOM   3013 C CB  . LEU A 1 402 ? -18.985 16.894 23.327  1.00 44.90  ? 446  LEU A CB  1 
ATOM   3014 C CG  . LEU A 1 402 ? -17.519 17.062 23.797  1.00 45.94  ? 446  LEU A CG  1 
ATOM   3015 C CD1 . LEU A 1 402 ? -17.200 18.487 24.166  1.00 45.66  ? 446  LEU A CD1 1 
ATOM   3016 C CD2 . LEU A 1 402 ? -17.193 16.123 24.944  1.00 48.20  ? 446  LEU A CD2 1 
ATOM   3017 N N   . SER A 1 403 ? -17.481 18.148 20.653  1.00 55.37  ? 447  SER A N   1 
ATOM   3018 C CA  . SER A 1 403 ? -16.231 18.004 19.919  1.00 56.02  ? 447  SER A CA  1 
ATOM   3019 C C   . SER A 1 403 ? -15.250 19.090 20.324  1.00 55.88  ? 447  SER A C   1 
ATOM   3020 O O   . SER A 1 403 ? -15.648 20.193 20.687  1.00 55.08  ? 447  SER A O   1 
ATOM   3021 C CB  . SER A 1 403 ? -16.495 18.074 18.431  1.00 56.24  ? 447  SER A CB  1 
ATOM   3022 O OG  . SER A 1 403 ? -17.120 19.316 18.123  1.00 55.74  ? 447  SER A OG  1 
ATOM   3023 N N   . GLU A 1 404 ? -13.964 18.778 20.277  1.00 64.99  ? 448  GLU A N   1 
ATOM   3024 C CA  . GLU A 1 404 ? -12.948 19.784 20.546  1.00 65.10  ? 448  GLU A CA  1 
ATOM   3025 C C   . GLU A 1 404 ? -11.960 19.880 19.381  1.00 65.69  ? 448  GLU A C   1 
ATOM   3026 O O   . GLU A 1 404 ? -11.539 18.868 18.841  1.00 67.36  ? 448  GLU A O   1 
ATOM   3027 C CB  . GLU A 1 404 ? -12.221 19.442 21.845  1.00 67.16  ? 448  GLU A CB  1 
ATOM   3028 C CG  . GLU A 1 404 ? -13.132 19.145 23.029  1.00 67.37  ? 448  GLU A CG  1 
ATOM   3029 C CD  . GLU A 1 404 ? -13.433 20.371 23.889  1.00 66.57  ? 448  GLU A CD  1 
ATOM   3030 O OE1 . GLU A 1 404 ? -12.991 21.486 23.530  1.00 65.89  ? 448  GLU A OE1 1 
ATOM   3031 O OE2 . GLU A 1 404 ? -14.084 20.209 24.957  1.00 67.08  ? 448  GLU A OE2 1 
ATOM   3032 N N   . PRO A 1 405 ? -11.574 21.108 19.006  1.00 53.98  ? 449  PRO A N   1 
ATOM   3033 C CA  . PRO A 1 405 ? -10.549 21.344 17.974  1.00 54.76  ? 449  PRO A CA  1 
ATOM   3034 C C   . PRO A 1 405 ? -9.206  20.633 18.257  1.00 56.73  ? 449  PRO A C   1 
ATOM   3035 O O   . PRO A 1 405 ? -8.598  20.160 17.288  1.00 57.92  ? 449  PRO A O   1 
ATOM   3036 C CB  . PRO A 1 405 ? -10.353 22.866 17.993  1.00 53.75  ? 449  PRO A CB  1 
ATOM   3037 C CG  . PRO A 1 405 ? -11.478 23.425 18.644  1.00 52.53  ? 449  PRO A CG  1 
ATOM   3038 C CD  . PRO A 1 405 ? -12.068 22.369 19.583  1.00 52.69  ? 449  PRO A CD  1 
ATOM   3039 N N   . ASN A 1 406 ? -8.758  20.538 19.512  1.00 74.47  ? 450  ASN A N   1 
ATOM   3040 C CA  . ASN A 1 406 ? -7.512  19.816 19.788  1.00 76.88  ? 450  ASN A CA  1 
ATOM   3041 C C   . ASN A 1 406 ? -7.591  18.348 19.510  1.00 79.01  ? 450  ASN A C   1 
ATOM   3042 O O   . ASN A 1 406 ? -6.563  17.695 19.328  1.00 80.84  ? 450  ASN A O   1 
ATOM   3043 C CB  . ASN A 1 406 ? -7.085  19.926 21.230  1.00 77.78  ? 450  ASN A CB  1 
ATOM   3044 C CG  . ASN A 1 406 ? -7.485  21.204 21.851  1.00 76.96  ? 450  ASN A CG  1 
ATOM   3045 O OD1 . ASN A 1 406 ? -8.150  21.185 22.887  1.00 75.84  ? 450  ASN A OD1 1 
ATOM   3046 N ND2 . ASN A 1 406 ? -7.059  22.346 21.259  1.00 77.84  ? 450  ASN A ND2 1 
ATOM   3047 N N   . ALA A 1 407 ? -8.795  17.789 19.573  1.00 56.84  ? 451  ALA A N   1 
ATOM   3048 C CA  . ALA A 1 407 ? -8.874  16.358 19.366  1.00 59.57  ? 451  ALA A CA  1 
ATOM   3049 C C   . ALA A 1 407 ? -9.446  16.128 17.985  1.00 59.06  ? 451  ALA A C   1 
ATOM   3050 O O   . ALA A 1 407 ? -10.630 15.942 17.795  1.00 58.05  ? 451  ALA A O   1 
ATOM   3051 C CB  . ALA A 1 407 ? -9.704  15.696 20.448  1.00 60.89  ? 451  ALA A CB  1 
ATOM   3052 N N   . VAL A 1 408 ? -8.531  15.977 17.050  1.00 56.68  ? 452  VAL A N   1 
ATOM   3053 C CA  . VAL A 1 408 ? -8.842  15.892 15.646  1.00 56.60  ? 452  VAL A CA  1 
ATOM   3054 C C   . VAL A 1 408 ? -9.838  14.777 15.359  1.00 58.29  ? 452  VAL A C   1 
ATOM   3055 O O   . VAL A 1 408 ? -9.673  13.664 15.832  1.00 60.56  ? 452  VAL A O   1 
ATOM   3056 C CB  . VAL A 1 408 ? -7.543  15.687 14.849  1.00 57.88  ? 452  VAL A CB  1 
ATOM   3057 C CG1 . VAL A 1 408 ? -7.854  15.442 13.399  1.00 56.83  ? 452  VAL A CG1 1 
ATOM   3058 C CG2 . VAL A 1 408 ? -6.717  16.914 14.988  1.00 57.90  ? 452  VAL A CG2 1 
ATOM   3059 N N   . GLY A 1 409 ? -10.899 15.105 14.631  1.00 63.29  ? 453  GLY A N   1 
ATOM   3060 C CA  . GLY A 1 409 ? -11.834 14.103 14.148  1.00 64.99  ? 453  GLY A CA  1 
ATOM   3061 C C   . GLY A 1 409 ? -12.911 13.636 15.114  1.00 64.11  ? 453  GLY A C   1 
ATOM   3062 O O   . GLY A 1 409 ? -13.889 13.015 14.702  1.00 64.62  ? 453  GLY A O   1 
ATOM   3063 N N   . ILE A 1 410 ? -12.764 13.942 16.397  1.00 57.18  ? 454  ILE A N   1 
ATOM   3064 C CA  . ILE A 1 410 ? -13.633 13.320 17.377  1.00 56.54  ? 454  ILE A CA  1 
ATOM   3065 C C   . ILE A 1 410 ? -14.980 14.011 17.567  1.00 52.51  ? 454  ILE A C   1 
ATOM   3066 O O   . ILE A 1 410 ? -15.059 15.216 17.811  1.00 50.18  ? 454  ILE A O   1 
ATOM   3067 C CB  . ILE A 1 410 ? -12.937 13.228 18.741  1.00 57.83  ? 454  ILE A CB  1 
ATOM   3068 C CG1 . ILE A 1 410 ? -11.823 12.199 18.670  1.00 61.69  ? 454  ILE A CG1 1 
ATOM   3069 C CG2 . ILE A 1 410 ? -13.976 12.850 19.855  1.00 55.91  ? 454  ILE A CG2 1 
ATOM   3070 C CD1 . ILE A 1 410 ? -11.190 11.962 20.007  1.00 62.76  ? 454  ILE A CD1 1 
ATOM   3071 N N   . VAL A 1 411 ? -16.046 13.233 17.447  1.00 48.55  ? 455  VAL A N   1 
ATOM   3072 C CA  . VAL A 1 411 ? -17.396 13.749 17.758  1.00 45.86  ? 455  VAL A CA  1 
ATOM   3073 C C   . VAL A 1 411 ? -18.141 12.761 18.619  1.00 45.82  ? 455  VAL A C   1 
ATOM   3074 O O   . VAL A 1 411 ? -18.199 11.560 18.300  1.00 47.51  ? 455  VAL A O   1 
ATOM   3075 C CB  . VAL A 1 411 ? -18.256 14.020 16.520  1.00 46.02  ? 455  VAL A CB  1 
ATOM   3076 C CG1 . VAL A 1 411 ? -19.363 14.954 16.906  1.00 44.29  ? 455  VAL A CG1 1 
ATOM   3077 C CG2 . VAL A 1 411 ? -17.453 14.619 15.400  1.00 47.24  ? 455  VAL A CG2 1 
ATOM   3078 N N   . ILE A 1 412 ? -18.689 13.259 19.721  1.00 52.47  ? 456  ILE A N   1 
ATOM   3079 C CA  . ILE A 1 412 ? -19.479 12.420 20.629  1.00 52.66  ? 456  ILE A CA  1 
ATOM   3080 C C   . ILE A 1 412 ? -20.878 12.960 20.790  1.00 51.58  ? 456  ILE A C   1 
ATOM   3081 O O   . ILE A 1 412 ? -21.048 14.151 21.027  1.00 50.69  ? 456  ILE A O   1 
ATOM   3082 C CB  . ILE A 1 412 ? -18.824 12.339 22.008  1.00 53.32  ? 456  ILE A CB  1 
ATOM   3083 C CG1 . ILE A 1 412 ? -17.361 11.895 21.865  1.00 55.53  ? 456  ILE A CG1 1 
ATOM   3084 C CG2 . ILE A 1 412 ? -19.658 11.435 22.956  1.00 53.93  ? 456  ILE A CG2 1 
ATOM   3085 C CD1 . ILE A 1 412 ? -16.607 11.864 23.179  1.00 57.18  ? 456  ILE A CD1 1 
ATOM   3086 N N   . ALA A 1 413 ? -21.877 12.099 20.639  1.00 47.95  ? 457  ALA A N   1 
ATOM   3087 C CA  . ALA A 1 413 ? -23.294 12.538 20.722  1.00 47.88  ? 457  ALA A CA  1 
ATOM   3088 C C   . ALA A 1 413 ? -24.280 11.443 21.091  1.00 48.51  ? 457  ALA A C   1 
ATOM   3089 O O   . ALA A 1 413 ? -24.102 10.271 20.743  1.00 49.08  ? 457  ALA A O   1 
ATOM   3090 C CB  . ALA A 1 413 ? -23.736 13.164 19.382  1.00 48.17  ? 457  ALA A CB  1 
ATOM   3091 N N   . HIS A 1 414 ? -25.365 11.839 21.739  1.00 56.23  ? 458  HIS A N   1 
ATOM   3092 C CA  . HIS A 1 414 ? -26.492 10.929 21.871  1.00 56.68  ? 458  HIS A CA  1 
ATOM   3093 C C   . HIS A 1 414 ? -27.168 10.883 20.507  1.00 56.95  ? 458  HIS A C   1 
ATOM   3094 O O   . HIS A 1 414 ? -27.192 11.882 19.761  1.00 57.16  ? 458  HIS A O   1 
ATOM   3095 C CB  . HIS A 1 414 ? -27.474 11.370 22.964  1.00 57.25  ? 458  HIS A CB  1 
ATOM   3096 C CG  . HIS A 1 414 ? -26.905 11.305 24.350  1.00 57.50  ? 458  HIS A CG  1 
ATOM   3097 N ND1 . HIS A 1 414 ? -26.180 12.336 24.910  1.00 57.60  ? 458  HIS A ND1 1 
ATOM   3098 C CD2 . HIS A 1 414 ? -26.959 10.333 25.290  1.00 57.99  ? 458  HIS A CD2 1 
ATOM   3099 C CE1 . HIS A 1 414 ? -25.816 12.000 26.133  1.00 58.23  ? 458  HIS A CE1 1 
ATOM   3100 N NE2 . HIS A 1 414 ? -26.275 10.787 26.388  1.00 58.54  ? 458  HIS A NE2 1 
ATOM   3101 N N   . GLY A 1 415 ? -27.682 9.719  20.153  1.00 58.04  ? 459  GLY A N   1 
ATOM   3102 C CA  . GLY A 1 415 ? -28.332 9.607  18.878  1.00 58.59  ? 459  GLY A CA  1 
ATOM   3103 C C   . GLY A 1 415 ? -29.309 8.469  18.840  1.00 59.02  ? 459  GLY A C   1 
ATOM   3104 O O   . GLY A 1 415 ? -29.522 7.757  19.826  1.00 58.90  ? 459  GLY A O   1 
ATOM   3105 N N   . SER A 1 416 ? -29.925 8.301  17.683  1.00 61.15  ? 460  SER A N   1 
ATOM   3106 C CA  . SER A 1 416 ? -30.690 7.107  17.439  1.00 61.69  ? 460  SER A CA  1 
ATOM   3107 C C   . SER A 1 416 ? -30.506 6.740  15.975  1.00 62.71  ? 460  SER A C   1 
ATOM   3108 O O   . SER A 1 416 ? -30.124 7.580  15.153  1.00 63.04  ? 460  SER A O   1 
ATOM   3109 C CB  . SER A 1 416 ? -32.172 7.301  17.820  1.00 61.72  ? 460  SER A CB  1 
ATOM   3110 O OG  . SER A 1 416 ? -32.843 8.279  17.033  1.00 62.30  ? 460  SER A OG  1 
ATOM   3111 N N   . VAL A 1 417 ? -30.777 5.470  15.670  1.00 56.05  ? 461  VAL A N   1 
ATOM   3112 C CA  . VAL A 1 417 ? -30.570 4.920  14.332  1.00 57.43  ? 461  VAL A CA  1 
ATOM   3113 C C   . VAL A 1 417 ? -31.929 4.486  13.739  1.00 60.76  ? 461  VAL A C   1 
ATOM   3114 O O   . VAL A 1 417 ? -32.560 3.527  14.214  1.00 63.79  ? 461  VAL A O   1 
ATOM   3115 C CB  . VAL A 1 417 ? -29.571 3.716  14.366  1.00 58.75  ? 461  VAL A CB  1 
ATOM   3116 C CG1 . VAL A 1 417 ? -29.363 3.133  12.985  1.00 60.52  ? 461  VAL A CG1 1 
ATOM   3117 C CG2 . VAL A 1 417 ? -28.251 4.120  15.055  1.00 55.93  ? 461  VAL A CG2 1 
ATOM   3118 N N   . GLY A 1 418 ? -32.334 5.187  12.682  1.00 62.67  ? 462  GLY A N   1 
ATOM   3119 C CA  . GLY A 1 418 ? -33.612 4.977  12.033  1.00 63.67  ? 462  GLY A CA  1 
ATOM   3120 C C   . GLY A 1 418 ? -33.824 6.022  10.957  1.00 63.90  ? 462  GLY A C   1 
ATOM   3121 O O   . GLY A 1 418 ? -32.859 6.543  10.407  1.00 64.27  ? 462  GLY A O   1 
ATOM   3122 N N   . ASP A 1 419 ? -35.081 6.323  10.631  1.00 81.04  ? 463  ASP A N   1 
ATOM   3123 C CA  . ASP A 1 419 ? -35.338 7.352  9.632   1.00 81.75  ? 463  ASP A CA  1 
ATOM   3124 C C   . ASP A 1 419 ? -35.589 8.730  10.235  1.00 81.08  ? 463  ASP A C   1 
ATOM   3125 O O   . ASP A 1 419 ? -35.715 9.715  9.519   1.00 81.66  ? 463  ASP A O   1 
ATOM   3126 C CB  . ASP A 1 419 ? -36.495 6.931  8.747   1.00 83.73  ? 463  ASP A CB  1 
ATOM   3127 C CG  . ASP A 1 419 ? -36.146 5.727  7.900   1.00 85.43  ? 463  ASP A CG  1 
ATOM   3128 O OD1 . ASP A 1 419 ? -35.091 5.134  8.187   1.00 84.63  ? 463  ASP A OD1 1 
ATOM   3129 O OD2 . ASP A 1 419 ? -36.895 5.362  6.961   1.00 88.00  ? 463  ASP A OD2 1 
ATOM   3130 N N   . ALA A 1 420 ? -35.608 8.805  11.557  1.00 66.80  ? 464  ALA A N   1 
ATOM   3131 C CA  . ALA A 1 420 ? -35.826 10.067 12.239  1.00 66.23  ? 464  ALA A CA  1 
ATOM   3132 C C   . ALA A 1 420 ? -35.345 9.985  13.674  1.00 65.24  ? 464  ALA A C   1 
ATOM   3133 O O   . ALA A 1 420 ? -35.024 8.894  14.192  1.00 64.87  ? 464  ALA A O   1 
ATOM   3134 C CB  . ALA A 1 420 ? -37.317 10.450 12.215  1.00 66.73  ? 464  ALA A CB  1 
ATOM   3135 N N   . ILE A 1 421 ? -35.368 11.145 14.323  1.00 63.80  ? 465  ILE A N   1 
ATOM   3136 C CA  . ILE A 1 421 ? -35.065 11.241 15.730  1.00 63.12  ? 465  ILE A CA  1 
ATOM   3137 C C   . ILE A 1 421 ? -36.111 10.465 16.514  1.00 63.00  ? 465  ILE A C   1 
ATOM   3138 O O   . ILE A 1 421 ? -37.340 10.658 16.398  1.00 63.66  ? 465  ILE A O   1 
ATOM   3139 C CB  . ILE A 1 421 ? -34.965 12.722 16.189  1.00 63.70  ? 465  ILE A CB  1 
ATOM   3140 C CG1 . ILE A 1 421 ? -33.786 13.382 15.442  1.00 63.91  ? 465  ILE A CG1 1 
ATOM   3141 C CG2 . ILE A 1 421 ? -34.781 12.819 17.699  1.00 63.30  ? 465  ILE A CG2 1 
ATOM   3142 C CD1 . ILE A 1 421 ? -33.353 14.759 15.932  1.00 64.52  ? 465  ILE A CD1 1 
ATOM   3143 N N   . SER A 1 422 ? -35.592 9.555  17.311  1.00 88.98  ? 466  SER A N   1 
ATOM   3144 C CA  . SER A 1 422 ? -36.391 8.649  18.082  1.00 88.95  ? 466  SER A CA  1 
ATOM   3145 C C   . SER A 1 422 ? -36.565 9.196  19.484  1.00 89.03  ? 466  SER A C   1 
ATOM   3146 O O   . SER A 1 422 ? -35.618 9.726  20.061  1.00 88.91  ? 466  SER A O   1 
ATOM   3147 C CB  . SER A 1 422 ? -35.712 7.290  18.100  1.00 88.60  ? 466  SER A CB  1 
ATOM   3148 O OG  . SER A 1 422 ? -36.347 6.423  18.998  1.00 90.34  ? 466  SER A OG  1 
ATOM   3149 N N   . VAL A 1 423 ? -37.776 9.074  20.021  1.00 63.10  ? 467  VAL A N   1 
ATOM   3150 C CA  . VAL A 1 423 ? -38.080 9.449  21.398  1.00 63.22  ? 467  VAL A CA  1 
ATOM   3151 C C   . VAL A 1 423 ? -37.532 8.445  22.376  1.00 63.71  ? 467  VAL A C   1 
ATOM   3152 O O   . VAL A 1 423 ? -37.578 8.694  23.555  1.00 63.66  ? 467  VAL A O   1 
ATOM   3153 C CB  . VAL A 1 423 ? -39.639 9.574  21.716  1.00 66.69  ? 467  VAL A CB  1 
ATOM   3154 C CG1 . VAL A 1 423 ? -40.345 10.524 20.780  1.00 67.08  ? 467  VAL A CG1 1 
ATOM   3155 C CG2 . VAL A 1 423 ? -40.316 8.225  21.713  1.00 70.51  ? 467  VAL A CG2 1 
ATOM   3156 N N   . MET A 1 424 ? -37.033 7.310  21.930  1.00 96.10  ? 468  MET A N   1 
ATOM   3157 C CA  . MET A 1 424 ? -36.504 6.354  22.888  1.00 96.30  ? 468  MET A CA  1 
ATOM   3158 C C   . MET A 1 424 ? -35.224 6.795  23.616  1.00 94.46  ? 468  MET A C   1 
ATOM   3159 O O   . MET A 1 424 ? -34.532 7.734  23.205  1.00 93.85  ? 468  MET A O   1 
ATOM   3160 C CB  . MET A 1 424 ? -36.279 5.043  22.186  1.00 97.18  ? 468  MET A CB  1 
ATOM   3161 C CG  . MET A 1 424 ? -37.574 4.513  21.664  1.00 100.35 ? 468  MET A CG  1 
ATOM   3162 S SD  . MET A 1 424 ? -37.329 2.913  20.928  1.00 103.25 ? 468  MET A SD  1 
ATOM   3163 C CE  . MET A 1 424 ? -36.085 2.233  22.048  1.00 102.35 ? 468  MET A CE  1 
ATOM   3164 N N   . VAL A 1 425 ? -34.934 6.123  24.723  1.00 70.06  ? 469  VAL A N   1 
ATOM   3165 C CA  . VAL A 1 425 ? -33.750 6.434  25.518  1.00 69.08  ? 469  VAL A CA  1 
ATOM   3166 C C   . VAL A 1 425 ? -32.459 6.138  24.721  1.00 68.30  ? 469  VAL A C   1 
ATOM   3167 O O   . VAL A 1 425 ? -32.123 4.990  24.431  1.00 68.28  ? 469  VAL A O   1 
ATOM   3168 C CB  . VAL A 1 425 ? -33.778 5.643  26.867  1.00 70.19  ? 469  VAL A CB  1 
ATOM   3169 C CG1 . VAL A 1 425 ? -32.604 6.010  27.730  1.00 69.74  ? 469  VAL A CG1 1 
ATOM   3170 C CG2 . VAL A 1 425 ? -35.059 5.952  27.627  1.00 71.86  ? 469  VAL A CG2 1 
ATOM   3171 N N   . PRO A 1 426 ? -31.715 7.186  24.377  1.00 67.84  ? 470  PRO A N   1 
ATOM   3172 C CA  . PRO A 1 426 ? -30.686 7.019  23.354  1.00 67.29  ? 470  PRO A CA  1 
ATOM   3173 C C   . PRO A 1 426 ? -29.385 6.416  23.884  1.00 67.31  ? 470  PRO A C   1 
ATOM   3174 O O   . PRO A 1 426 ? -29.048 6.616  25.058  1.00 67.64  ? 470  PRO A O   1 
ATOM   3175 C CB  . PRO A 1 426 ? -30.491 8.448  22.866  1.00 67.00  ? 470  PRO A CB  1 
ATOM   3176 C CG  . PRO A 1 426 ? -30.731 9.274  24.096  1.00 67.48  ? 470  PRO A CG  1 
ATOM   3177 C CD  . PRO A 1 426 ? -31.625 8.503  25.020  1.00 68.13  ? 470  PRO A CD  1 
ATOM   3178 N N   . ASP A 1 427 ? -28.674 5.682  23.029  1.00 69.00  ? 471  ASP A N   1 
ATOM   3179 C CA  . ASP A 1 427 ? -27.306 5.271  23.330  1.00 69.46  ? 471  ASP A CA  1 
ATOM   3180 C C   . ASP A 1 427 ? -26.405 6.429  23.014  1.00 68.94  ? 471  ASP A C   1 
ATOM   3181 O O   . ASP A 1 427 ? -26.877 7.459  22.551  1.00 68.24  ? 471  ASP A O   1 
ATOM   3182 C CB  . ASP A 1 427 ? -26.889 4.070  22.503  1.00 70.32  ? 471  ASP A CB  1 
ATOM   3183 C CG  . ASP A 1 427 ? -27.941 3.021  22.457  1.00 70.71  ? 471  ASP A CG  1 
ATOM   3184 O OD1 . ASP A 1 427 ? -28.464 2.717  23.549  1.00 70.79  ? 471  ASP A OD1 1 
ATOM   3185 O OD2 . ASP A 1 427 ? -28.246 2.520  21.341  1.00 71.09  ? 471  ASP A OD2 1 
ATOM   3186 N N   . VAL A 1 428 ? -25.106 6.251  23.231  1.00 57.97  ? 472  VAL A N   1 
ATOM   3187 C CA  . VAL A 1 428 ? -24.127 7.292  22.913  1.00 57.60  ? 472  VAL A CA  1 
ATOM   3188 C C   . VAL A 1 428 ? -23.237 6.823  21.743  1.00 58.32  ? 472  VAL A C   1 
ATOM   3189 O O   . VAL A 1 428 ? -22.721 5.688  21.745  1.00 59.70  ? 472  VAL A O   1 
ATOM   3190 C CB  . VAL A 1 428 ? -23.269 7.654  24.134  1.00 58.16  ? 472  VAL A CB  1 
ATOM   3191 C CG1 . VAL A 1 428 ? -22.139 8.599  23.743  1.00 57.87  ? 472  VAL A CG1 1 
ATOM   3192 C CG2 . VAL A 1 428 ? -24.102 8.282  25.224  1.00 57.93  ? 472  VAL A CG2 1 
ATOM   3193 N N   . TYR A 1 429 ? -23.098 7.678  20.727  1.00 57.06  ? 473  TYR A N   1 
ATOM   3194 C CA  . TYR A 1 429 ? -22.368 7.309  19.522  1.00 58.15  ? 473  TYR A CA  1 
ATOM   3195 C C   . TYR A 1 429 ? -21.140 8.186  19.368  1.00 58.13  ? 473  TYR A C   1 
ATOM   3196 O O   . TYR A 1 429 ? -21.166 9.364  19.731  1.00 56.71  ? 473  TYR A O   1 
ATOM   3197 C CB  . TYR A 1 429 ? -23.265 7.415  18.286  1.00 58.11  ? 473  TYR A CB  1 
ATOM   3198 C CG  . TYR A 1 429 ? -24.431 6.463  18.313  1.00 58.37  ? 473  TYR A CG  1 
ATOM   3199 C CD1 . TYR A 1 429 ? -25.626 6.810  18.951  1.00 57.31  ? 473  TYR A CD1 1 
ATOM   3200 C CD2 . TYR A 1 429 ? -24.348 5.215  17.711  1.00 59.90  ? 473  TYR A CD2 1 
ATOM   3201 C CE1 . TYR A 1 429 ? -26.707 5.933  18.986  1.00 57.64  ? 473  TYR A CE1 1 
ATOM   3202 C CE2 . TYR A 1 429 ? -25.415 4.337  17.742  1.00 60.09  ? 473  TYR A CE2 1 
ATOM   3203 C CZ  . TYR A 1 429 ? -26.586 4.706  18.378  1.00 58.88  ? 473  TYR A CZ  1 
ATOM   3204 O OH  . TYR A 1 429 ? -27.632 3.830  18.405  1.00 59.20  ? 473  TYR A OH  1 
ATOM   3205 N N   . ILE A 1 430 ? -20.066 7.597  18.844  1.00 55.62  ? 474  ILE A N   1 
ATOM   3206 C CA  . ILE A 1 430 ? -18.810 8.303  18.625  1.00 56.18  ? 474  ILE A CA  1 
ATOM   3207 C C   . ILE A 1 430 ? -18.281 8.164  17.201  1.00 57.93  ? 474  ILE A C   1 
ATOM   3208 O O   . ILE A 1 430 ? -18.463 7.132  16.547  1.00 59.46  ? 474  ILE A O   1 
ATOM   3209 C CB  . ILE A 1 430 ? -17.704 7.811  19.591  1.00 57.66  ? 474  ILE A CB  1 
ATOM   3210 C CG1 . ILE A 1 430 ? -16.559 8.824  19.649  1.00 58.02  ? 474  ILE A CG1 1 
ATOM   3211 C CG2 . ILE A 1 430 ? -17.198 6.431  19.193  1.00 60.04  ? 474  ILE A CG2 1 
ATOM   3212 C CD1 . ILE A 1 430 ? -15.527 8.486  20.650  1.00 59.74  ? 474  ILE A CD1 1 
ATOM   3213 N N   . SER A 1 431 ? -17.611 9.214  16.735  1.00 56.66  ? 475  SER A N   1 
ATOM   3214 C CA  . SER A 1 431 ? -16.961 9.243  15.426  1.00 58.84  ? 475  SER A CA  1 
ATOM   3215 C C   . SER A 1 431 ? -15.534 9.722  15.598  1.00 60.12  ? 475  SER A C   1 
ATOM   3216 O O   . SER A 1 431 ? -15.315 10.699 16.318  1.00 58.66  ? 475  SER A O   1 
ATOM   3217 C CB  . SER A 1 431 ? -17.714 10.180 14.467  1.00 58.13  ? 475  SER A CB  1 
ATOM   3218 O OG  . SER A 1 431 ? -16.962 10.392 13.275  1.00 60.63  ? 475  SER A OG  1 
ATOM   3219 N N   . ASP A 1 432 ? -14.552 9.040  15.008  1.00 63.49  ? 476  ASP A N   1 
ATOM   3220 C CA  . ASP A 1 432 ? -13.186 9.607  15.019  1.00 64.59  ? 476  ASP A CA  1 
ATOM   3221 C C   . ASP A 1 432 ? -12.764 10.337 13.741  1.00 65.27  ? 476  ASP A C   1 
ATOM   3222 O O   . ASP A 1 432 ? -11.763 11.008 13.747  1.00 65.39  ? 476  ASP A O   1 
ATOM   3223 C CB  . ASP A 1 432 ? -12.153 8.539  15.359  1.00 66.15  ? 476  ASP A CB  1 
ATOM   3224 C CG  . ASP A 1 432 ? -12.087 7.436  14.342  1.00 67.63  ? 476  ASP A CG  1 
ATOM   3225 O OD1 . ASP A 1 432 ? -12.467 7.648  13.171  1.00 67.91  ? 476  ASP A OD1 1 
ATOM   3226 O OD2 . ASP A 1 432 ? -11.645 6.330  14.720  1.00 68.67  ? 476  ASP A OD2 1 
ATOM   3227 N N   . ASP A 1 433 ? -13.524 10.208 12.658  1.00 54.64  ? 477  ASP A N   1 
ATOM   3228 C CA  . ASP A 1 433 ? -13.203 10.877 11.399  1.00 55.25  ? 477  ASP A CA  1 
ATOM   3229 C C   . ASP A 1 433 ? -13.966 12.163 11.121  1.00 54.15  ? 477  ASP A C   1 
ATOM   3230 O O   . ASP A 1 433 ? -14.104 12.546 9.975   1.00 54.82  ? 477  ASP A O   1 
ATOM   3231 C CB  . ASP A 1 433 ? -13.329 9.939  10.202  1.00 56.87  ? 477  ASP A CB  1 
ATOM   3232 C CG  . ASP A 1 433 ? -14.582 9.118  10.214  1.00 57.03  ? 477  ASP A CG  1 
ATOM   3233 O OD1 . ASP A 1 433 ? -15.630 9.575  10.744  1.00 55.73  ? 477  ASP A OD1 1 
ATOM   3234 O OD2 . ASP A 1 433 ? -14.519 8.000  9.653   1.00 58.36  ? 477  ASP A OD2 1 
ATOM   3235 N N   . GLY A 1 434 ? -14.574 12.767 12.123  1.00 51.51  ? 478  GLY A N   1 
ATOM   3236 C CA  . GLY A 1 434 ? -15.258 14.030 11.891  1.00 49.47  ? 478  GLY A CA  1 
ATOM   3237 C C   . GLY A 1 434 ? -16.704 13.834 11.406  1.00 49.98  ? 478  GLY A C   1 
ATOM   3238 O O   . GLY A 1 434 ? -17.331 14.755 10.906  1.00 49.59  ? 478  GLY A O   1 
ATOM   3239 N N   . GLY A 1 435 ? -17.245 12.635 11.565  1.00 54.09  ? 479  GLY A N   1 
ATOM   3240 C CA  . GLY A 1 435 ? -18.636 12.420 11.262  1.00 53.62  ? 479  GLY A CA  1 
ATOM   3241 C C   . GLY A 1 435 ? -18.940 11.660 9.988   1.00 56.35  ? 479  GLY A C   1 
ATOM   3242 O O   . GLY A 1 435 ? -20.081 11.574 9.600   1.00 56.31  ? 479  GLY A O   1 
ATOM   3243 N N   . TYR A 1 436 ? -17.940 11.099 9.329   1.00 46.21  ? 480  TYR A N   1 
ATOM   3244 C CA  . TYR A 1 436 ? -18.192 10.268 8.168   1.00 47.84  ? 480  TYR A CA  1 
ATOM   3245 C C   . TYR A 1 436 ? -18.656 8.888  8.631   1.00 47.56  ? 480  TYR A C   1 
ATOM   3246 O O   . TYR A 1 436 ? -19.489 8.238  7.978   1.00 48.12  ? 480  TYR A O   1 
ATOM   3247 C CB  . TYR A 1 436 ? -16.947 10.135 7.281   1.00 49.19  ? 480  TYR A CB  1 
ATOM   3248 C CG  . TYR A 1 436 ? -16.617 11.350 6.437   1.00 49.45  ? 480  TYR A CG  1 
ATOM   3249 C CD1 . TYR A 1 436 ? -15.972 12.451 6.994   1.00 48.39  ? 480  TYR A CD1 1 
ATOM   3250 C CD2 . TYR A 1 436 ? -16.932 11.401 5.085   1.00 50.70  ? 480  TYR A CD2 1 
ATOM   3251 C CE1 . TYR A 1 436 ? -15.636 13.569 6.229   1.00 48.69  ? 480  TYR A CE1 1 
ATOM   3252 C CE2 . TYR A 1 436 ? -16.618 12.532 4.307   1.00 50.96  ? 480  TYR A CE2 1 
ATOM   3253 C CZ  . TYR A 1 436 ? -15.959 13.609 4.890   1.00 50.08  ? 480  TYR A CZ  1 
ATOM   3254 O OH  . TYR A 1 436 ? -15.616 14.731 4.152   1.00 50.18  ? 480  TYR A OH  1 
ATOM   3255 N N   . SER A 1 437 ? -18.120 8.421  9.751   1.00 47.83  ? 481  SER A N   1 
ATOM   3256 C CA  . SER A 1 437 ? -18.470 7.083  10.222  1.00 47.84  ? 481  SER A CA  1 
ATOM   3257 C C   . SER A 1 437 ? -18.669 7.107  11.721  1.00 46.32  ? 481  SER A C   1 
ATOM   3258 O O   . SER A 1 437 ? -18.134 7.990  12.402  1.00 44.94  ? 481  SER A O   1 
ATOM   3259 C CB  . SER A 1 437 ? -17.402 6.069  9.831   1.00 49.71  ? 481  SER A CB  1 
ATOM   3260 O OG  . SER A 1 437 ? -16.164 6.412  10.403  1.00 49.55  ? 481  SER A OG  1 
ATOM   3261 N N   . TRP A 1 438 ? -19.451 6.150  12.220  1.00 50.33  ? 482  TRP A N   1 
ATOM   3262 C CA  . TRP A 1 438 ? -19.839 6.132  13.622  1.00 48.43  ? 482  TRP A CA  1 
ATOM   3263 C C   . TRP A 1 438 ? -19.928 4.761  14.231  1.00 49.47  ? 482  TRP A C   1 
ATOM   3264 O O   . TRP A 1 438 ? -20.151 3.772  13.543  1.00 51.91  ? 482  TRP A O   1 
ATOM   3265 C CB  . TRP A 1 438 ? -21.187 6.783  13.805  1.00 46.52  ? 482  TRP A CB  1 
ATOM   3266 C CG  . TRP A 1 438 ? -21.288 8.170  13.350  1.00 45.75  ? 482  TRP A CG  1 
ATOM   3267 C CD1 . TRP A 1 438 ? -21.476 8.614  12.063  1.00 47.07  ? 482  TRP A CD1 1 
ATOM   3268 C CD2 . TRP A 1 438 ? -21.250 9.333  14.185  1.00 43.62  ? 482  TRP A CD2 1 
ATOM   3269 N NE1 . TRP A 1 438 ? -21.552 9.997  12.055  1.00 46.10  ? 482  TRP A NE1 1 
ATOM   3270 C CE2 . TRP A 1 438 ? -21.431 10.459 13.343  1.00 43.77  ? 482  TRP A CE2 1 
ATOM   3271 C CE3 . TRP A 1 438 ? -21.081 9.531  15.560  1.00 41.86  ? 482  TRP A CE3 1 
ATOM   3272 C CZ2 . TRP A 1 438 ? -21.447 11.764 13.837  1.00 42.04  ? 482  TRP A CZ2 1 
ATOM   3273 C CZ3 . TRP A 1 438 ? -21.112 10.831 16.058  1.00 40.01  ? 482  TRP A CZ3 1 
ATOM   3274 C CH2 . TRP A 1 438 ? -21.285 11.935 15.196  1.00 40.01  ? 482  TRP A CH2 1 
ATOM   3275 N N   . THR A 1 439 ? -19.766 4.705  15.544  1.00 69.29  ? 483  THR A N   1 
ATOM   3276 C CA  . THR A 1 439 ? -20.041 3.478  16.273  1.00 69.62  ? 483  THR A CA  1 
ATOM   3277 C C   . THR A 1 439 ? -20.704 3.848  17.579  1.00 67.65  ? 483  THR A C   1 
ATOM   3278 O O   . THR A 1 439 ? -20.550 4.985  18.051  1.00 66.30  ? 483  THR A O   1 
ATOM   3279 C CB  . THR A 1 439 ? -18.778 2.654  16.553  1.00 71.52  ? 483  THR A CB  1 
ATOM   3280 O OG1 . THR A 1 439 ? -17.724 3.528  16.960  1.00 71.35  ? 483  THR A OG1 1 
ATOM   3281 C CG2 . THR A 1 439 ? -18.344 1.923  15.314  1.00 73.91  ? 483  THR A CG2 1 
ATOM   3282 N N   . LYS A 1 440 ? -21.440 2.893  18.153  1.00 74.07  ? 484  LYS A N   1 
ATOM   3283 C CA  . LYS A 1 440 ? -21.991 3.076  19.483  1.00 72.73  ? 484  LYS A CA  1 
ATOM   3284 C C   . LYS A 1 440 ? -20.822 3.098  20.479  1.00 73.54  ? 484  LYS A C   1 
ATOM   3285 O O   . LYS A 1 440 ? -20.039 2.151  20.561  1.00 75.32  ? 484  LYS A O   1 
ATOM   3286 C CB  . LYS A 1 440 ? -22.997 1.956  19.817  1.00 72.86  ? 484  LYS A CB  1 
ATOM   3287 C CG  . LYS A 1 440 ? -23.967 2.279  20.960  1.00 71.44  ? 484  LYS A CG  1 
ATOM   3288 C CD  . LYS A 1 440 ? -24.952 1.155  21.209  1.00 71.74  ? 484  LYS A CD  1 
ATOM   3289 C CE  . LYS A 1 440 ? -25.838 0.919  19.997  1.00 71.64  ? 484  LYS A CE  1 
ATOM   3290 N NZ  . LYS A 1 440 ? -26.907 -0.092 20.254  1.00 72.13  ? 484  LYS A NZ  1 
ATOM   3291 N N   . MET A 1 441 ? -20.696 4.198  21.208  1.00 71.71  ? 485  MET A N   1 
ATOM   3292 C CA  . MET A 1 441 ? -19.693 4.304  22.248  1.00 72.62  ? 485  MET A CA  1 
ATOM   3293 C C   . MET A 1 441 ? -20.127 3.562  23.510  1.00 73.02  ? 485  MET A C   1 
ATOM   3294 O O   . MET A 1 441 ? -19.418 2.716  24.047  1.00 74.70  ? 485  MET A O   1 
ATOM   3295 C CB  . MET A 1 441 ? -19.450 5.771  22.571  1.00 71.36  ? 485  MET A CB  1 
ATOM   3296 C CG  . MET A 1 441 ? -18.078 6.089  23.117  1.00 72.65  ? 485  MET A CG  1 
ATOM   3297 S SD  . MET A 1 441 ? -17.981 7.845  23.548  1.00 70.86  ? 485  MET A SD  1 
ATOM   3298 C CE  . MET A 1 441 ? -18.797 7.801  25.140  1.00 70.71  ? 485  MET A CE  1 
ATOM   3299 N N   . LEU A 1 442 ? -21.325 3.885  23.968  1.00 74.00  ? 486  LEU A N   1 
ATOM   3300 C CA  . LEU A 1 442 ? -21.839 3.370  25.224  1.00 74.32  ? 486  LEU A CA  1 
ATOM   3301 C C   . LEU A 1 442 ? -23.325 3.195  25.061  1.00 73.08  ? 486  LEU A C   1 
ATOM   3302 O O   . LEU A 1 442 ? -23.979 4.020  24.429  1.00 71.68  ? 486  LEU A O   1 
ATOM   3303 C CB  . LEU A 1 442 ? -21.543 4.322  26.391  1.00 74.40  ? 486  LEU A CB  1 
ATOM   3304 C CG  . LEU A 1 442 ? -20.094 4.659  26.773  1.00 75.84  ? 486  LEU A CG  1 
ATOM   3305 C CD1 . LEU A 1 442 ? -20.106 5.712  27.867  1.00 75.79  ? 486  LEU A CD1 1 
ATOM   3306 C CD2 . LEU A 1 442 ? -19.261 3.430  27.188  1.00 77.95  ? 486  LEU A CD2 1 
ATOM   3307 N N   . GLU A 1 443 ? -23.870 2.130  25.617  1.00 95.63  ? 487  GLU A N   1 
ATOM   3308 C CA  . GLU A 1 443 ? -25.304 1.965  25.570  1.00 94.66  ? 487  GLU A CA  1 
ATOM   3309 C C   . GLU A 1 443 ? -25.897 2.700  26.759  1.00 94.23  ? 487  GLU A C   1 
ATOM   3310 O O   . GLU A 1 443 ? -25.435 2.542  27.885  1.00 95.14  ? 487  GLU A O   1 
ATOM   3311 C CB  . GLU A 1 443 ? -25.674 0.486  25.567  1.00 95.63  ? 487  GLU A CB  1 
ATOM   3312 C CG  . GLU A 1 443 ? -24.585 -0.390 26.139  1.00 97.51  ? 487  GLU A CG  1 
ATOM   3313 C CD  . GLU A 1 443 ? -24.949 -1.868 26.152  1.00 100.82 ? 487  GLU A CD  1 
ATOM   3314 O OE1 . GLU A 1 443 ? -24.176 -2.664 26.739  1.00 103.03 ? 487  GLU A OE1 1 
ATOM   3315 O OE2 . GLU A 1 443 ? -26.008 -2.243 25.586  1.00 101.91 ? 487  GLU A OE2 1 
ATOM   3316 N N   . GLY A 1 444 ? -26.897 3.532  26.497  1.00 64.48  ? 488  GLY A N   1 
ATOM   3317 C CA  . GLY A 1 444 ? -27.549 4.291  27.546  1.00 64.08  ? 488  GLY A CA  1 
ATOM   3318 C C   . GLY A 1 444 ? -27.032 5.705  27.563  1.00 62.59  ? 488  GLY A C   1 
ATOM   3319 O O   . GLY A 1 444 ? -25.995 5.997  26.969  1.00 62.42  ? 488  GLY A O   1 
ATOM   3320 N N   . PRO A 1 445 ? -27.755 6.611  28.230  1.00 63.38  ? 489  PRO A N   1 
ATOM   3321 C CA  . PRO A 1 445 ? -27.306 8.009  28.199  1.00 63.06  ? 489  PRO A CA  1 
ATOM   3322 C C   . PRO A 1 445 ? -26.140 8.209  29.149  1.00 64.06  ? 489  PRO A C   1 
ATOM   3323 O O   . PRO A 1 445 ? -26.028 7.488  30.133  1.00 65.26  ? 489  PRO A O   1 
ATOM   3324 C CB  . PRO A 1 445 ? -28.549 8.799  28.652  1.00 63.40  ? 489  PRO A CB  1 
ATOM   3325 C CG  . PRO A 1 445 ? -29.613 7.760  28.945  1.00 63.83  ? 489  PRO A CG  1 
ATOM   3326 C CD  . PRO A 1 445 ? -28.932 6.433  29.080  1.00 63.99  ? 489  PRO A CD  1 
ATOM   3327 N N   . HIS A 1 446 ? -25.288 9.178  28.846  1.00 62.31  ? 490  HIS A N   1 
ATOM   3328 C CA  . HIS A 1 446 ? -24.078 9.419  29.625  1.00 63.44  ? 490  HIS A CA  1 
ATOM   3329 C C   . HIS A 1 446 ? -23.744 10.884 29.593  1.00 62.87  ? 490  HIS A C   1 
ATOM   3330 O O   . HIS A 1 446 ? -24.166 11.601 28.684  1.00 61.59  ? 490  HIS A O   1 
ATOM   3331 C CB  . HIS A 1 446 ? -22.891 8.616  29.079  1.00 63.96  ? 490  HIS A CB  1 
ATOM   3332 C CG  . HIS A 1 446 ? -22.935 7.162  29.417  1.00 65.18  ? 490  HIS A CG  1 
ATOM   3333 N ND1 . HIS A 1 446 ? -23.683 6.253  28.702  1.00 64.33  ? 490  HIS A ND1 1 
ATOM   3334 C CD2 . HIS A 1 446 ? -22.328 6.456  30.401  1.00 67.09  ? 490  HIS A CD2 1 
ATOM   3335 C CE1 . HIS A 1 446 ? -23.529 5.049  29.225  1.00 65.53  ? 490  HIS A CE1 1 
ATOM   3336 N NE2 . HIS A 1 446 ? -22.706 5.142  30.253  1.00 67.15  ? 490  HIS A NE2 1 
ATOM   3337 N N   . TYR A 1 447 ? -23.000 11.328 30.600  1.00 60.79  ? 491  TYR A N   1 
ATOM   3338 C CA  . TYR A 1 447 ? -22.265 12.589 30.493  1.00 60.45  ? 491  TYR A CA  1 
ATOM   3339 C C   . TYR A 1 447 ? -20.867 12.252 30.005  1.00 60.47  ? 491  TYR A C   1 
ATOM   3340 O O   . TYR A 1 447 ? -20.311 11.232 30.414  1.00 61.97  ? 491  TYR A O   1 
ATOM   3341 C CB  . TYR A 1 447 ? -22.192 13.324 31.828  1.00 62.36  ? 491  TYR A CB  1 
ATOM   3342 C CG  . TYR A 1 447 ? -23.532 13.724 32.382  1.00 63.11  ? 491  TYR A CG  1 
ATOM   3343 C CD1 . TYR A 1 447 ? -24.369 12.779 32.989  1.00 63.86  ? 491  TYR A CD1 1 
ATOM   3344 C CD2 . TYR A 1 447 ? -23.955 15.040 32.332  1.00 63.57  ? 491  TYR A CD2 1 
ATOM   3345 C CE1 . TYR A 1 447 ? -25.558 13.138 33.504  1.00 64.84  ? 491  TYR A CE1 1 
ATOM   3346 C CE2 . TYR A 1 447 ? -25.163 15.409 32.859  1.00 65.10  ? 491  TYR A CE2 1 
ATOM   3347 C CZ  . TYR A 1 447 ? -25.962 14.458 33.436  1.00 65.61  ? 491  TYR A CZ  1 
ATOM   3348 O OH  . TYR A 1 447 ? -27.188 14.821 33.962  1.00 67.27  ? 491  TYR A OH  1 
ATOM   3349 N N   . TYR A 1 448 ? -20.299 13.094 29.149  1.00 63.72  ? 492  TYR A N   1 
ATOM   3350 C CA  . TYR A 1 448 ? -18.948 12.840 28.634  1.00 64.26  ? 492  TYR A CA  1 
ATOM   3351 C C   . TYR A 1 448 ? -18.080 14.113 28.557  1.00 64.45  ? 492  TYR A C   1 
ATOM   3352 O O   . TYR A 1 448 ? -18.585 15.221 28.352  1.00 63.04  ? 492  TYR A O   1 
ATOM   3353 C CB  . TYR A 1 448 ? -19.030 12.144 27.254  1.00 62.92  ? 492  TYR A CB  1 
ATOM   3354 C CG  . TYR A 1 448 ? -20.190 12.600 26.371  1.00 60.67  ? 492  TYR A CG  1 
ATOM   3355 C CD1 . TYR A 1 448 ? -20.094 13.764 25.635  1.00 59.16  ? 492  TYR A CD1 1 
ATOM   3356 C CD2 . TYR A 1 448 ? -21.370 11.871 26.289  1.00 60.62  ? 492  TYR A CD2 1 
ATOM   3357 C CE1 . TYR A 1 448 ? -21.119 14.207 24.845  1.00 57.95  ? 492  TYR A CE1 1 
ATOM   3358 C CE2 . TYR A 1 448 ? -22.435 12.306 25.488  1.00 59.54  ? 492  TYR A CE2 1 
ATOM   3359 C CZ  . TYR A 1 448 ? -22.298 13.488 24.767  1.00 58.38  ? 492  TYR A CZ  1 
ATOM   3360 O OH  . TYR A 1 448 ? -23.302 13.967 23.943  1.00 58.18  ? 492  TYR A OH  1 
ATOM   3361 N N   . THR A 1 449 ? -16.781 13.966 28.797  1.00 67.25  ? 493  THR A N   1 
ATOM   3362 C CA  . THR A 1 449 ? -15.845 15.018 28.425  1.00 67.84  ? 493  THR A CA  1 
ATOM   3363 C C   . THR A 1 449 ? -14.635 14.411 27.754  1.00 69.69  ? 493  THR A C   1 
ATOM   3364 O O   . THR A 1 449 ? -14.434 13.187 27.777  1.00 70.78  ? 493  THR A O   1 
ATOM   3365 C CB  . THR A 1 449 ? -15.332 15.888 29.612  1.00 70.65  ? 493  THR A CB  1 
ATOM   3366 O OG1 . THR A 1 449 ? -14.299 15.192 30.311  1.00 73.76  ? 493  THR A OG1 1 
ATOM   3367 C CG2 . THR A 1 449 ? -16.438 16.264 30.572  1.00 70.27  ? 493  THR A CG2 1 
ATOM   3368 N N   . ILE A 1 450 ? -13.842 15.297 27.152  1.00 53.15  ? 494  ILE A N   1 
ATOM   3369 C CA  . ILE A 1 450 ? -12.546 14.951 26.562  1.00 56.09  ? 494  ILE A CA  1 
ATOM   3370 C C   . ILE A 1 450 ? -11.387 15.629 27.288  1.00 58.47  ? 494  ILE A C   1 
ATOM   3371 O O   . ILE A 1 450 ? -11.355 16.846 27.485  1.00 57.01  ? 494  ILE A O   1 
ATOM   3372 C CB  . ILE A 1 450 ? -12.512 15.325 25.059  1.00 53.24  ? 494  ILE A CB  1 
ATOM   3373 C CG1 . ILE A 1 450 ? -13.609 14.532 24.302  1.00 50.59  ? 494  ILE A CG1 1 
ATOM   3374 C CG2 . ILE A 1 450 ? -11.108 15.133 24.473  1.00 55.84  ? 494  ILE A CG2 1 
ATOM   3375 C CD1 . ILE A 1 450 ? -14.131 15.233 23.068  1.00 46.90  ? 494  ILE A CD1 1 
ATOM   3376 N N   . LEU A 1 451 ? -10.415 14.820 27.673  1.00 66.46  ? 495  LEU A N   1 
ATOM   3377 C CA  . LEU A 1 451 ? -9.226  15.311 28.348  1.00 67.15  ? 495  LEU A CA  1 
ATOM   3378 C C   . LEU A 1 451 ? -8.025  15.075 27.451  1.00 66.83  ? 495  LEU A C   1 
ATOM   3379 O O   . LEU A 1 451 ? -8.105  14.252 26.532  1.00 66.77  ? 495  LEU A O   1 
ATOM   3380 C CB  . LEU A 1 451 ? -9.039  14.606 29.690  1.00 68.80  ? 495  LEU A CB  1 
ATOM   3381 C CG  . LEU A 1 451 ? -10.228 14.706 30.644  1.00 68.95  ? 495  LEU A CG  1 
ATOM   3382 C CD1 . LEU A 1 451 ? -10.075 13.768 31.844  1.00 70.29  ? 495  LEU A CD1 1 
ATOM   3383 C CD2 . LEU A 1 451 ? -10.380 16.151 31.077  1.00 68.64  ? 495  LEU A CD2 1 
ATOM   3384 N N   . ASP A 1 452 ? -6.942  15.828 27.701  1.00 74.39  ? 496  ASP A N   1 
ATOM   3385 C CA  . ASP A 1 452 ? -5.654  15.669 27.027  1.00 74.20  ? 496  ASP A CA  1 
ATOM   3386 C C   . ASP A 1 452 ? -5.748  15.558 25.507  1.00 72.84  ? 496  ASP A C   1 
ATOM   3387 O O   . ASP A 1 452 ? -5.202  14.624 24.919  1.00 73.61  ? 496  ASP A O   1 
ATOM   3388 C CB  . ASP A 1 452 ? -4.935  14.441 27.567  1.00 76.15  ? 496  ASP A CB  1 
ATOM   3389 C CG  . ASP A 1 452 ? -3.487  14.355 27.090  1.00 76.11  ? 496  ASP A CG  1 
ATOM   3390 O OD1 . ASP A 1 452 ? -2.787  15.403 27.073  1.00 75.15  ? 496  ASP A OD1 1 
ATOM   3391 O OD2 . ASP A 1 452 ? -3.058  13.241 26.707  1.00 76.99  ? 496  ASP A OD2 1 
ATOM   3392 N N   . SER A 1 453 ? -6.454  16.496 24.879  1.00 63.09  ? 497  SER A N   1 
ATOM   3393 C CA  . SER A 1 453 ? -6.585  16.530 23.424  1.00 61.59  ? 497  SER A CA  1 
ATOM   3394 C C   . SER A 1 453 ? -6.952  15.162 22.856  1.00 63.16  ? 497  SER A C   1 
ATOM   3395 O O   . SER A 1 453 ? -6.376  14.730 21.840  1.00 63.30  ? 497  SER A O   1 
ATOM   3396 C CB  . SER A 1 453 ? -5.288  17.019 22.769  1.00 60.85  ? 497  SER A CB  1 
ATOM   3397 O OG  . SER A 1 453 ? -4.948  18.322 23.197  1.00 59.39  ? 497  SER A OG  1 
ATOM   3398 N N   . GLY A 1 454 ? -7.866  14.470 23.544  1.00 63.40  ? 498  GLY A N   1 
ATOM   3399 C CA  . GLY A 1 454 ? -8.334  13.151 23.138  1.00 64.48  ? 498  GLY A CA  1 
ATOM   3400 C C   . GLY A 1 454 ? -7.594  11.973 23.758  1.00 66.10  ? 498  GLY A C   1 
ATOM   3401 O O   . GLY A 1 454 ? -7.933  10.809 23.497  1.00 66.58  ? 498  GLY A O   1 
ATOM   3402 N N   . GLY A 1 455 ? -6.585  12.258 24.579  1.00 77.04  ? 499  GLY A N   1 
ATOM   3403 C CA  . GLY A 1 455 ? -5.814  11.202 25.201  1.00 78.54  ? 499  GLY A CA  1 
ATOM   3404 C C   . GLY A 1 455 ? -6.688  10.337 26.086  1.00 79.19  ? 499  GLY A C   1 
ATOM   3405 O O   . GLY A 1 455 ? -6.462  9.128  26.240  1.00 80.13  ? 499  GLY A O   1 
ATOM   3406 N N   . ILE A 1 456 ? -7.691  10.970 26.683  1.00 83.87  ? 500  ILE A N   1 
ATOM   3407 C CA  . ILE A 1 456 ? -8.625  10.287 27.560  1.00 84.05  ? 500  ILE A CA  1 
ATOM   3408 C C   . ILE A 1 456 ? -10.012 10.729 27.217  1.00 82.41  ? 500  ILE A C   1 
ATOM   3409 O O   . ILE A 1 456 ? -10.227 11.892 26.907  1.00 81.64  ? 500  ILE A O   1 
ATOM   3410 C CB  . ILE A 1 456 ? -8.363  10.597 29.049  1.00 85.08  ? 500  ILE A CB  1 
ATOM   3411 C CG1 . ILE A 1 456 ? -6.951  10.206 29.433  1.00 86.51  ? 500  ILE A CG1 1 
ATOM   3412 C CG2 . ILE A 1 456 ? -9.342  9.864  29.955  1.00 85.16  ? 500  ILE A CG2 1 
ATOM   3413 C CD1 . ILE A 1 456 ? -6.741  10.302 30.882  1.00 87.71  ? 500  ILE A CD1 1 
ATOM   3414 N N   . ILE A 1 457 ? -10.957 9.801  27.262  1.00 66.45  ? 501  ILE A N   1 
ATOM   3415 C CA  . ILE A 1 457 ? -12.357 10.177 27.229  1.00 64.34  ? 501  ILE A CA  1 
ATOM   3416 C C   . ILE A 1 457 ? -13.032 9.659  28.481  1.00 64.48  ? 501  ILE A C   1 
ATOM   3417 O O   . ILE A 1 457 ? -12.799 8.532  28.901  1.00 65.73  ? 501  ILE A O   1 
ATOM   3418 C CB  . ILE A 1 457 ? -13.069 9.645  25.995  1.00 62.70  ? 501  ILE A CB  1 
ATOM   3419 C CG1 . ILE A 1 457 ? -12.302 10.054 24.748  1.00 63.10  ? 501  ILE A CG1 1 
ATOM   3420 C CG2 . ILE A 1 457 ? -14.489 10.195 25.946  1.00 59.84  ? 501  ILE A CG2 1 
ATOM   3421 C CD1 . ILE A 1 457 ? -13.041 9.767  23.487  1.00 61.55  ? 501  ILE A CD1 1 
ATOM   3422 N N   . VAL A 1 458 ? -13.872 10.486 29.079  1.00 68.70  ? 502  VAL A N   1 
ATOM   3423 C CA  . VAL A 1 458 ? -14.450 10.151 30.366  1.00 69.28  ? 502  VAL A CA  1 
ATOM   3424 C C   . VAL A 1 458 ? -15.991 10.174 30.302  1.00 66.97  ? 502  VAL A C   1 
ATOM   3425 O O   . VAL A 1 458 ? -16.579 11.002 29.622  1.00 64.84  ? 502  VAL A O   1 
ATOM   3426 C CB  . VAL A 1 458 ? -13.872 11.110 31.427  1.00 70.91  ? 502  VAL A CB  1 
ATOM   3427 C CG1 . VAL A 1 458 ? -14.714 11.152 32.658  1.00 71.08  ? 502  VAL A CG1 1 
ATOM   3428 C CG2 . VAL A 1 458 ? -12.461 10.673 31.764  1.00 73.34  ? 502  VAL A CG2 1 
ATOM   3429 N N   . ALA A 1 459 ? -16.645 9.241  30.977  1.00 60.42  ? 503  ALA A N   1 
ATOM   3430 C CA  . ALA A 1 459 ? -18.096 9.143  30.870  1.00 58.62  ? 503  ALA A CA  1 
ATOM   3431 C C   . ALA A 1 459 ? -18.770 8.774  32.209  1.00 59.85  ? 503  ALA A C   1 
ATOM   3432 O O   . ALA A 1 459 ? -18.230 7.976  32.977  1.00 61.95  ? 503  ALA A O   1 
ATOM   3433 C CB  . ALA A 1 459 ? -18.461 8.142  29.797  1.00 57.80  ? 503  ALA A CB  1 
ATOM   3434 N N   . ILE A 1 460 ? -19.931 9.376  32.489  1.00 71.37  ? 504  ILE A N   1 
ATOM   3435 C CA  . ILE A 1 460 ? -20.701 9.083  33.703  1.00 72.56  ? 504  ILE A CA  1 
ATOM   3436 C C   . ILE A 1 460 ? -22.081 8.577  33.320  1.00 71.26  ? 504  ILE A C   1 
ATOM   3437 O O   . ILE A 1 460 ? -22.783 9.236  32.549  1.00 69.47  ? 504  ILE A O   1 
ATOM   3438 C CB  . ILE A 1 460 ? -20.866 10.325 34.606  1.00 73.16  ? 504  ILE A CB  1 
ATOM   3439 C CG1 . ILE A 1 460 ? -19.505 10.844 35.071  1.00 74.79  ? 504  ILE A CG1 1 
ATOM   3440 C CG2 . ILE A 1 460 ? -21.728 9.988  35.818  1.00 74.48  ? 504  ILE A CG2 1 
ATOM   3441 C CD1 . ILE A 1 460 ? -18.921 10.032 36.198  1.00 77.24  ? 504  ILE A CD1 1 
ATOM   3442 N N   . GLU A 1 461 ? -22.474 7.416  33.827  1.00 113.25 ? 505  GLU A N   1 
ATOM   3443 C CA  . GLU A 1 461 ? -23.789 6.906  33.485  1.00 111.95 ? 505  GLU A CA  1 
ATOM   3444 C C   . GLU A 1 461 ? -24.852 7.871  33.976  1.00 111.62 ? 505  GLU A C   1 
ATOM   3445 O O   . GLU A 1 461 ? -24.759 8.399  35.082  1.00 113.08 ? 505  GLU A O   1 
ATOM   3446 C CB  . GLU A 1 461 ? -24.036 5.524  34.075  1.00 112.92 ? 505  GLU A CB  1 
ATOM   3447 C CG  . GLU A 1 461 ? -25.407 4.989  33.709  1.00 111.89 ? 505  GLU A CG  1 
ATOM   3448 C CD  . GLU A 1 461 ? -25.745 3.688  34.400  1.00 112.76 ? 505  GLU A CD  1 
ATOM   3449 O OE1 . GLU A 1 461 ? -24.895 3.189  35.172  1.00 114.30 ? 505  GLU A OE1 1 
ATOM   3450 O OE2 . GLU A 1 461 ? -26.866 3.172  34.184  1.00 112.04 ? 505  GLU A OE2 1 
ATOM   3451 N N   . HIS A 1 462 ? -25.856 8.113  33.145  1.00 81.74  ? 506  HIS A N   1 
ATOM   3452 C CA  . HIS A 1 462 ? -26.941 8.973  33.550  1.00 81.94  ? 506  HIS A CA  1 
ATOM   3453 C C   . HIS A 1 462 ? -28.047 8.127  34.127  1.00 82.48  ? 506  HIS A C   1 
ATOM   3454 O O   . HIS A 1 462 ? -28.768 7.431  33.422  1.00 81.50  ? 506  HIS A O   1 
ATOM   3455 C CB  . HIS A 1 462 ? -27.466 9.785  32.388  1.00 80.52  ? 506  HIS A CB  1 
ATOM   3456 C CG  . HIS A 1 462 ? -28.698 10.559 32.720  1.00 81.33  ? 506  HIS A CG  1 
ATOM   3457 N ND1 . HIS A 1 462 ? -29.966 10.081 32.471  1.00 81.15  ? 506  HIS A ND1 1 
ATOM   3458 C CD2 . HIS A 1 462 ? -28.858 11.768 33.309  1.00 82.78  ? 506  HIS A CD2 1 
ATOM   3459 C CE1 . HIS A 1 462 ? -30.856 10.971 32.870  1.00 82.49  ? 506  HIS A CE1 1 
ATOM   3460 N NE2 . HIS A 1 462 ? -30.211 12.003 33.380  1.00 83.62  ? 506  HIS A NE2 1 
ATOM   3461 N N   . SER A 1 463 ? -28.200 8.208  35.431  1.00 82.07  ? 507  SER A N   1 
ATOM   3462 C CA  . SER A 1 463 ? -29.081 7.291  36.086  1.00 82.70  ? 507  SER A CA  1 
ATOM   3463 C C   . SER A 1 463 ? -30.155 8.100  36.761  1.00 83.72  ? 507  SER A C   1 
ATOM   3464 O O   . SER A 1 463 ? -29.943 9.248  37.134  1.00 84.67  ? 507  SER A O   1 
ATOM   3465 C CB  . SER A 1 463 ? -28.317 6.426  37.082  1.00 84.01  ? 507  SER A CB  1 
ATOM   3466 O OG  . SER A 1 463 ? -29.135 5.355  37.546  1.00 84.37  ? 507  SER A OG  1 
ATOM   3467 N N   . SER A 1 464 ? -31.321 7.515  36.926  1.00 101.31 ? 508  SER A N   1 
ATOM   3468 C CA  . SER A 1 464 ? -32.303 8.183  37.743  1.00 102.75 ? 508  SER A CA  1 
ATOM   3469 C C   . SER A 1 464 ? -31.871 8.369  39.242  1.00 104.15 ? 508  SER A C   1 
ATOM   3470 O O   . SER A 1 464 ? -32.627 9.051  39.971  1.00 105.53 ? 508  SER A O   1 
ATOM   3471 C CB  . SER A 1 464 ? -33.665 7.454  37.650  1.00 102.94 ? 508  SER A CB  1 
ATOM   3472 O OG  . SER A 1 464 ? -33.591 6.134  38.158  1.00 103.69 ? 508  SER A OG  1 
ATOM   3473 N N   . ARG A 1 465 ? -30.743 7.742  39.646  1.00 121.70 ? 509  ARG A N   1 
ATOM   3474 C CA  . ARG A 1 465 ? -30.304 7.453  41.048  1.00 123.24 ? 509  ARG A CA  1 
ATOM   3475 C C   . ARG A 1 465 ? -28.754 7.306  41.226  1.00 124.31 ? 509  ARG A C   1 
ATOM   3476 O O   . ARG A 1 465 ? -28.040 7.313  40.224  1.00 123.36 ? 509  ARG A O   1 
ATOM   3477 C CB  . ARG A 1 465 ? -31.017 6.212  41.588  1.00 124.05 ? 509  ARG A CB  1 
ATOM   3478 C CG  . ARG A 1 465 ? -32.305 6.511  42.337  1.00 126.84 ? 509  ARG A CG  1 
ATOM   3479 C CD  . ARG A 1 465 ? -32.854 5.265  43.012  1.00 132.00 ? 509  ARG A CD  1 
ATOM   3480 N NE  . ARG A 1 465 ? -34.297 5.134  42.828  1.00 135.92 ? 509  ARG A NE  1 
ATOM   3481 C CZ  . ARG A 1 465 ? -34.970 3.999  42.985  1.00 139.14 ? 509  ARG A CZ  1 
ATOM   3482 N NH1 . ARG A 1 465 ? -34.332 2.889  43.330  1.00 139.77 ? 509  ARG A NH1 1 
ATOM   3483 N NH2 . ARG A 1 465 ? -36.282 3.973  42.797  1.00 142.68 ? 509  ARG A NH2 1 
ATOM   3484 N N   . PRO A 1 466 ? -28.223 7.209  42.465  1.00 90.81  ? 510  PRO A N   1 
ATOM   3485 C CA  . PRO A 1 466 ? -26.811 7.481  42.672  1.00 91.77  ? 510  PRO A CA  1 
ATOM   3486 C C   . PRO A 1 466 ? -25.819 6.536  42.019  1.00 91.26  ? 510  PRO A C   1 
ATOM   3487 O O   . PRO A 1 466 ? -26.037 5.339  41.870  1.00 90.87  ? 510  PRO A O   1 
ATOM   3488 C CB  . PRO A 1 466 ? -26.696 7.375  44.200  1.00 94.15  ? 510  PRO A CB  1 
ATOM   3489 C CG  . PRO A 1 466 ? -28.072 7.533  44.700  1.00 94.55  ? 510  PRO A CG  1 
ATOM   3490 C CD  . PRO A 1 466 ? -28.820 6.848  43.772  1.00 92.83  ? 510  PRO A CD  1 
ATOM   3491 N N   . ILE A 1 467 ? -24.688 7.115  41.668  1.00 94.85  ? 511  ILE A N   1 
ATOM   3492 C CA  . ILE A 1 467 ? -23.637 6.422  40.969  1.00 94.60  ? 511  ILE A CA  1 
ATOM   3493 C C   . ILE A 1 467 ? -22.354 6.623  41.758  1.00 96.75  ? 511  ILE A C   1 
ATOM   3494 O O   . ILE A 1 467 ? -22.090 7.722  42.245  1.00 97.44  ? 511  ILE A O   1 
ATOM   3495 C CB  . ILE A 1 467 ? -23.503 6.950  39.528  1.00 92.57  ? 511  ILE A CB  1 
ATOM   3496 C CG1 . ILE A 1 467 ? -23.502 8.475  39.515  1.00 92.36  ? 511  ILE A CG1 1 
ATOM   3497 C CG2 . ILE A 1 467 ? -24.675 6.504  38.697  1.00 90.69  ? 511  ILE A CG2 1 
ATOM   3498 C CD1 . ILE A 1 467 ? -22.127 9.079  39.426  1.00 92.98  ? 511  ILE A CD1 1 
ATOM   3499 N N   . ASN A 1 468 ? -21.608 5.553  41.987  1.00 96.92  ? 512  ASN A N   1 
ATOM   3500 C CA  . ASN A 1 468 ? -20.267 5.700  42.535  1.00 99.08  ? 512  ASN A CA  1 
ATOM   3501 C C   . ASN A 1 468 ? -19.162 5.562  41.477  1.00 98.56  ? 512  ASN A C   1 
ATOM   3502 O O   . ASN A 1 468 ? -17.979 5.522  41.816  1.00 100.00 ? 512  ASN A O   1 
ATOM   3503 C CB  . ASN A 1 468 ? -20.044 4.723  43.689  1.00 100.92 ? 512  ASN A CB  1 
ATOM   3504 C CG  . ASN A 1 468 ? -20.266 3.295  43.299  1.00 99.94  ? 512  ASN A CG  1 
ATOM   3505 O OD1 . ASN A 1 468 ? -21.047 2.995  42.405  1.00 97.90  ? 512  ASN A OD1 1 
ATOM   3506 N ND2 . ASN A 1 468 ? -19.573 2.395  43.971  1.00 101.57 ? 512  ASN A ND2 1 
ATOM   3507 N N   . VAL A 1 469 ? -19.542 5.458  40.204  1.00 93.14  ? 513  VAL A N   1 
ATOM   3508 C CA  . VAL A 1 469 ? -18.578 5.059  39.174  1.00 92.68  ? 513  VAL A CA  1 
ATOM   3509 C C   . VAL A 1 469 ? -18.402 5.989  37.955  1.00 90.91  ? 513  VAL A C   1 
ATOM   3510 O O   . VAL A 1 469 ? -19.364 6.481  37.360  1.00 88.97  ? 513  VAL A O   1 
ATOM   3511 C CB  . VAL A 1 469 ? -18.936 3.649  38.657  1.00 91.76  ? 513  VAL A CB  1 
ATOM   3512 C CG1 . VAL A 1 469 ? -18.192 3.335  37.383  1.00 90.83  ? 513  VAL A CG1 1 
ATOM   3513 C CG2 . VAL A 1 469 ? -18.616 2.614  39.717  1.00 93.31  ? 513  VAL A CG2 1 
ATOM   3514 N N   . ILE A 1 470 ? -17.139 6.203  37.592  1.00 87.88  ? 514  ILE A N   1 
ATOM   3515 C CA  . ILE A 1 470 ? -16.761 6.942  36.392  1.00 86.23  ? 514  ILE A CA  1 
ATOM   3516 C C   . ILE A 1 470 ? -16.114 5.977  35.386  1.00 86.05  ? 514  ILE A C   1 
ATOM   3517 O O   . ILE A 1 470 ? -15.417 5.038  35.779  1.00 87.54  ? 514  ILE A O   1 
ATOM   3518 C CB  . ILE A 1 470 ? -15.800 8.102  36.748  1.00 86.96  ? 514  ILE A CB  1 
ATOM   3519 C CG1 . ILE A 1 470 ? -15.537 8.996  35.549  1.00 85.25  ? 514  ILE A CG1 1 
ATOM   3520 C CG2 . ILE A 1 470 ? -14.488 7.576  37.324  1.00 89.19  ? 514  ILE A CG2 1 
ATOM   3521 C CD1 . ILE A 1 470 ? -14.886 10.297 35.942  1.00 85.95  ? 514  ILE A CD1 1 
ATOM   3522 N N   . LYS A 1 471 ? -16.374 6.187  34.100  1.00 82.74  ? 515  LYS A N   1 
ATOM   3523 C CA  . LYS A 1 471 ? -15.790 5.368  33.045  1.00 82.61  ? 515  LYS A CA  1 
ATOM   3524 C C   . LYS A 1 471 ? -14.771 6.157  32.241  1.00 82.40  ? 515  LYS A C   1 
ATOM   3525 O O   . LYS A 1 471 ? -14.978 7.347  31.969  1.00 81.12  ? 515  LYS A O   1 
ATOM   3526 C CB  . LYS A 1 471 ? -16.859 4.858  32.091  1.00 80.74  ? 515  LYS A CB  1 
ATOM   3527 C CG  . LYS A 1 471 ? -18.042 4.235  32.744  1.00 80.70  ? 515  LYS A CG  1 
ATOM   3528 C CD  . LYS A 1 471 ? -19.141 4.022  31.711  1.00 78.34  ? 515  LYS A CD  1 
ATOM   3529 C CE  . LYS A 1 471 ? -20.236 3.110  32.251  1.00 78.34  ? 515  LYS A CE  1 
ATOM   3530 N NZ  . LYS A 1 471 ? -21.195 2.714  31.179  1.00 76.05  ? 515  LYS A NZ  1 
ATOM   3531 N N   . PHE A 1 472 ? -13.687 5.494  31.832  1.00 74.84  ? 516  PHE A N   1 
ATOM   3532 C CA  . PHE A 1 472 ? -12.668 6.162  31.015  1.00 74.88  ? 516  PHE A CA  1 
ATOM   3533 C C   . PHE A 1 472 ? -12.092 5.264  29.935  1.00 75.19  ? 516  PHE A C   1 
ATOM   3534 O O   . PHE A 1 472 ? -12.107 4.045  30.039  1.00 75.93  ? 516  PHE A O   1 
ATOM   3535 C CB  . PHE A 1 472 ? -11.549 6.726  31.899  1.00 76.52  ? 516  PHE A CB  1 
ATOM   3536 C CG  . PHE A 1 472 ? -10.687 5.689  32.552  1.00 78.41  ? 516  PHE A CG  1 
ATOM   3537 C CD1 . PHE A 1 472 ? -11.197 4.861  33.530  1.00 79.30  ? 516  PHE A CD1 1 
ATOM   3538 C CD2 . PHE A 1 472 ? -9.347  5.601  32.244  1.00 79.28  ? 516  PHE A CD2 1 
ATOM   3539 C CE1 . PHE A 1 472 ? -10.391 3.911  34.160  1.00 80.93  ? 516  PHE A CE1 1 
ATOM   3540 C CE2 . PHE A 1 472 ? -8.532  4.672  32.874  1.00 80.86  ? 516  PHE A CE2 1 
ATOM   3541 C CZ  . PHE A 1 472 ? -9.054  3.820  33.829  1.00 81.63  ? 516  PHE A CZ  1 
ATOM   3542 N N   . SER A 1 473 ? -11.624 5.905  28.875  1.00 74.33  ? 517  SER A N   1 
ATOM   3543 C CA  . SER A 1 473 ? -11.107 5.229  27.693  1.00 74.60  ? 517  SER A CA  1 
ATOM   3544 C C   . SER A 1 473 ? -9.875  5.954  27.167  1.00 75.19  ? 517  SER A C   1 
ATOM   3545 O O   . SER A 1 473 ? -9.917  7.167  26.963  1.00 74.34  ? 517  SER A O   1 
ATOM   3546 C CB  . SER A 1 473 ? -12.184 5.180  26.612  1.00 72.85  ? 517  SER A CB  1 
ATOM   3547 O OG  . SER A 1 473 ? -11.615 4.962  25.335  1.00 73.06  ? 517  SER A OG  1 
ATOM   3548 N N   . THR A 1 474 ? -8.776  5.231  26.973  1.00 83.39  ? 518  THR A N   1 
ATOM   3549 C CA  . THR A 1 474 ? -7.570  5.848  26.408  1.00 83.84  ? 518  THR A CA  1 
ATOM   3550 C C   . THR A 1 474 ? -7.368  5.609  24.911  1.00 83.59  ? 518  THR A C   1 
ATOM   3551 O O   . THR A 1 474 ? -6.410  6.117  24.334  1.00 83.82  ? 518  THR A O   1 
ATOM   3552 C CB  . THR A 1 474 ? -6.301  5.376  27.138  1.00 85.41  ? 518  THR A CB  1 
ATOM   3553 O OG1 . THR A 1 474 ? -6.357  3.961  27.337  1.00 86.26  ? 518  THR A OG1 1 
ATOM   3554 C CG2 . THR A 1 474 ? -6.189  6.055  28.481  1.00 85.81  ? 518  THR A CG2 1 
ATOM   3555 N N   . ASP A 1 475 ? -8.230  4.804  24.298  1.00 85.66  ? 519  ASP A N   1 
ATOM   3556 C CA  . ASP A 1 475 ? -8.161  4.524  22.861  1.00 85.53  ? 519  ASP A CA  1 
ATOM   3557 C C   . ASP A 1 475 ? -9.183  5.298  22.016  1.00 83.99  ? 519  ASP A C   1 
ATOM   3558 O O   . ASP A 1 475 ? -9.548  4.843  20.928  1.00 83.89  ? 519  ASP A O   1 
ATOM   3559 C CB  . ASP A 1 475 ? -8.261  3.028  22.580  1.00 86.41  ? 519  ASP A CB  1 
ATOM   3560 C CG  . ASP A 1 475 ? -9.506  2.409  23.138  1.00 85.76  ? 519  ASP A CG  1 
ATOM   3561 O OD1 . ASP A 1 475 ? -10.460 3.163  23.445  1.00 84.29  ? 519  ASP A OD1 1 
ATOM   3562 O OD2 . ASP A 1 475 ? -9.521  1.161  23.254  1.00 86.64  ? 519  ASP A OD2 1 
ATOM   3563 N N   . GLU A 1 476 ? -9.737  6.373  22.570  1.00 83.22  ? 520  GLU A N   1 
ATOM   3564 C CA  . GLU A 1 476 ? -10.782 7.176  21.894  1.00 81.46  ? 520  GLU A CA  1 
ATOM   3565 C C   . GLU A 1 476 ? -12.145 6.482  21.777  1.00 80.27  ? 520  GLU A C   1 
ATOM   3566 O O   . GLU A 1 476 ? -12.810 6.574  20.749  1.00 79.34  ? 520  GLU A O   1 
ATOM   3567 C CB  . GLU A 1 476 ? -10.329 7.609  20.487  1.00 81.58  ? 520  GLU A CB  1 
ATOM   3568 C CG  . GLU A 1 476 ? -9.152  8.540  20.494  1.00 81.98  ? 520  GLU A CG  1 
ATOM   3569 C CD  . GLU A 1 476 ? -8.758  9.011  19.119  1.00 81.82  ? 520  GLU A CD  1 
ATOM   3570 O OE1 . GLU A 1 476 ? -9.364  8.555  18.130  1.00 81.77  ? 520  GLU A OE1 1 
ATOM   3571 O OE2 . GLU A 1 476 ? -7.827  9.844  19.032  1.00 81.67  ? 520  GLU A OE2 1 
ATOM   3572 N N   . GLY A 1 477 ? -12.540 5.784  22.834  1.00 88.90  ? 521  GLY A N   1 
ATOM   3573 C CA  . GLY A 1 477 ? -13.881 5.256  22.937  1.00 87.57  ? 521  GLY A CA  1 
ATOM   3574 C C   . GLY A 1 477 ? -14.095 3.862  22.388  1.00 88.47  ? 521  GLY A C   1 
ATOM   3575 O O   . GLY A 1 477 ? -15.240 3.411  22.307  1.00 87.46  ? 521  GLY A O   1 
ATOM   3576 N N   . GLN A 1 478 ? -13.020 3.188  21.984  1.00 89.67  ? 522  GLN A N   1 
ATOM   3577 C CA  . GLN A 1 478 ? -13.133 1.811  21.515  1.00 90.67  ? 522  GLN A CA  1 
ATOM   3578 C C   . GLN A 1 478 ? -13.159 0.828  22.683  1.00 91.37  ? 522  GLN A C   1 
ATOM   3579 O O   . GLN A 1 478 ? -13.711 -0.257 22.566  1.00 91.59  ? 522  GLN A O   1 
ATOM   3580 C CB  . GLN A 1 478 ? -11.997 1.468  20.546  1.00 92.19  ? 522  GLN A CB  1 
ATOM   3581 C CG  . GLN A 1 478 ? -12.376 1.599  19.055  1.00 91.84  ? 522  GLN A CG  1 
ATOM   3582 C CD  . GLN A 1 478 ? -11.164 1.593  18.102  1.00 93.20  ? 522  GLN A CD  1 
ATOM   3583 O OE1 . GLN A 1 478 ? -10.178 0.869  18.317  1.00 94.69  ? 522  GLN A OE1 1 
ATOM   3584 N NE2 . GLN A 1 478 ? -11.239 2.411  17.044  1.00 92.63  ? 522  GLN A NE2 1 
ATOM   3585 N N   . CYS A 1 479 ? -12.552 1.210  23.805  1.00 99.51  ? 523  CYS A N   1 
ATOM   3586 C CA  . CYS A 1 479 ? -12.497 0.357  24.993  1.00 100.35 ? 523  CYS A CA  1 
ATOM   3587 C C   . CYS A 1 479 ? -12.636 1.155  26.271  1.00 99.99  ? 523  CYS A C   1 
ATOM   3588 O O   . CYS A 1 479 ? -12.137 2.265  26.378  1.00 99.85  ? 523  CYS A O   1 
ATOM   3589 C CB  . CYS A 1 479 ? -11.198 -0.438 25.048  1.00 102.26 ? 523  CYS A CB  1 
ATOM   3590 S SG  . CYS A 1 479 ? -11.112 -1.735 23.829  1.00 103.13 ? 523  CYS A SG  1 
ATOM   3591 N N   . TRP A 1 480 ? -13.292 0.557  27.255  1.00 70.43  ? 524  TRP A N   1 
ATOM   3592 C CA  . TRP A 1 480 ? -13.631 1.268  28.471  1.00 70.22  ? 524  TRP A CA  1 
ATOM   3593 C C   . TRP A 1 480 ? -13.228 0.502  29.719  1.00 71.81  ? 524  TRP A C   1 
ATOM   3594 O O   . TRP A 1 480 ? -13.218 -0.718 29.729  1.00 74.80  ? 524  TRP A O   1 
ATOM   3595 C CB  . TRP A 1 480 ? -15.131 1.572  28.481  1.00 68.33  ? 524  TRP A CB  1 
ATOM   3596 C CG  . TRP A 1 480 ? -15.449 2.590  27.478  1.00 66.76  ? 524  TRP A CG  1 
ATOM   3597 C CD1 . TRP A 1 480 ? -15.721 2.378  26.165  1.00 65.97  ? 524  TRP A CD1 1 
ATOM   3598 C CD2 . TRP A 1 480 ? -15.472 4.010  27.673  1.00 65.85  ? 524  TRP A CD2 1 
ATOM   3599 N NE1 . TRP A 1 480 ? -15.927 3.580  25.523  1.00 64.52  ? 524  TRP A NE1 1 
ATOM   3600 C CE2 . TRP A 1 480 ? -15.778 4.598  26.429  1.00 64.29  ? 524  TRP A CE2 1 
ATOM   3601 C CE3 . TRP A 1 480 ? -15.273 4.839  28.778  1.00 66.23  ? 524  TRP A CE3 1 
ATOM   3602 C CZ2 . TRP A 1 480 ? -15.902 5.980  26.260  1.00 62.83  ? 524  TRP A CZ2 1 
ATOM   3603 C CZ3 . TRP A 1 480 ? -15.378 6.212  28.605  1.00 64.92  ? 524  TRP A CZ3 1 
ATOM   3604 C CH2 . TRP A 1 480 ? -15.694 6.768  27.356  1.00 63.11  ? 524  TRP A CH2 1 
ATOM   3605 N N   . GLN A 1 481 ? -12.868 1.242  30.759  1.00 123.76 ? 525  GLN A N   1 
ATOM   3606 C CA  . GLN A 1 481 ? -12.554 0.654  32.044  1.00 125.38 ? 525  GLN A CA  1 
ATOM   3607 C C   . GLN A 1 481 ? -13.367 1.404  33.098  1.00 124.94 ? 525  GLN A C   1 
ATOM   3608 O O   . GLN A 1 481 ? -13.524 2.620  33.029  1.00 124.19 ? 525  GLN A O   1 
ATOM   3609 C CB  . GLN A 1 481 ? -11.045 0.717  32.333  1.00 127.18 ? 525  GLN A CB  1 
ATOM   3610 C CG  . GLN A 1 481 ? -10.117 0.497  31.116  1.00 126.20 ? 525  GLN A CG  1 
ATOM   3611 C CD  . GLN A 1 481 ? -9.751  1.811  30.421  1.00 119.22 ? 525  GLN A CD  1 
ATOM   3612 O OE1 . GLN A 1 481 ? -9.794  2.874  31.035  1.00 116.64 ? 525  GLN A OE1 1 
ATOM   3613 N NE2 . GLN A 1 481 ? -9.371  1.737  29.146  1.00 117.30 ? 525  GLN A NE2 1 
ATOM   3614 N N   . THR A 1 482 ? -13.911 0.664  34.054  1.00 97.45  ? 526  THR A N   1 
ATOM   3615 C CA  . THR A 1 482 ? -14.750 1.229  35.107  1.00 97.22  ? 526  THR A CA  1 
ATOM   3616 C C   . THR A 1 482 ? -13.943 1.488  36.387  1.00 99.03  ? 526  THR A C   1 
ATOM   3617 O O   . THR A 1 482 ? -13.199 0.616  36.851  1.00 100.32 ? 526  THR A O   1 
ATOM   3618 C CB  . THR A 1 482 ? -15.950 0.281  35.417  1.00 96.56  ? 526  THR A CB  1 
ATOM   3619 O OG1 . THR A 1 482 ? -17.038 0.566  34.532  1.00 94.42  ? 526  THR A OG1 1 
ATOM   3620 C CG2 . THR A 1 482 ? -16.428 0.424  36.852  1.00 97.54  ? 526  THR A CG2 1 
ATOM   3621 N N   . TYR A 1 483 ? -14.085 2.688  36.947  1.00 94.17  ? 527  TYR A N   1 
ATOM   3622 C CA  . TYR A 1 483 ? -13.457 3.025  38.224  1.00 95.97  ? 527  TYR A CA  1 
ATOM   3623 C C   . TYR A 1 483 ? -14.474 3.550  39.245  1.00 96.25  ? 527  TYR A C   1 
ATOM   3624 O O   . TYR A 1 483 ? -15.294 4.419  38.920  1.00 95.09  ? 527  TYR A O   1 
ATOM   3625 C CB  . TYR A 1 483 ? -12.347 4.058  38.015  1.00 96.37  ? 527  TYR A CB  1 
ATOM   3626 C CG  . TYR A 1 483 ? -11.873 4.722  39.291  1.00 97.99  ? 527  TYR A CG  1 
ATOM   3627 C CD1 . TYR A 1 483 ? -11.307 3.976  40.314  1.00 99.69  ? 527  TYR A CD1 1 
ATOM   3628 C CD2 . TYR A 1 483 ? -11.977 6.094  39.468  1.00 97.77  ? 527  TYR A CD2 1 
ATOM   3629 C CE1 . TYR A 1 483 ? -10.871 4.573  41.483  1.00 101.21 ? 527  TYR A CE1 1 
ATOM   3630 C CE2 . TYR A 1 483 ? -11.541 6.704  40.631  1.00 99.30  ? 527  TYR A CE2 1 
ATOM   3631 C CZ  . TYR A 1 483 ? -10.993 5.935  41.639  1.00 101.05 ? 527  TYR A CZ  1 
ATOM   3632 O OH  . TYR A 1 483 ? -10.551 6.516  42.808  1.00 102.65 ? 527  TYR A OH  1 
ATOM   3633 N N   . THR A 1 484 ? -14.409 3.023  40.472  1.00 99.65  ? 528  THR A N   1 
ATOM   3634 C CA  . THR A 1 484 ? -15.263 3.476  41.575  1.00 100.31 ? 528  THR A CA  1 
ATOM   3635 C C   . THR A 1 484 ? -14.540 4.566  42.347  1.00 101.67 ? 528  THR A C   1 
ATOM   3636 O O   . THR A 1 484 ? -13.545 4.301  43.007  1.00 103.16 ? 528  THR A O   1 
ATOM   3637 C CB  . THR A 1 484 ? -15.627 2.320  42.542  1.00 101.16 ? 528  THR A CB  1 
ATOM   3638 O OG1 . THR A 1 484 ? -16.724 1.565  42.013  1.00 99.68  ? 528  THR A OG1 1 
ATOM   3639 C CG2 . THR A 1 484 ? -16.020 2.855  43.912  1.00 102.57 ? 528  THR A CG2 1 
ATOM   3640 N N   . PHE A 1 485 ? -15.031 5.796  42.250  1.00 99.76  ? 529  PHE A N   1 
ATOM   3641 C CA  . PHE A 1 485 ? -14.310 6.936  42.807  1.00 100.71 ? 529  PHE A CA  1 
ATOM   3642 C C   . PHE A 1 485 ? -14.726 7.315  44.213  1.00 102.23 ? 529  PHE A C   1 
ATOM   3643 O O   . PHE A 1 485 ? -14.067 8.139  44.849  1.00 103.32 ? 529  PHE A O   1 
ATOM   3644 C CB  . PHE A 1 485 ? -14.479 8.157  41.908  1.00 99.00  ? 529  PHE A CB  1 
ATOM   3645 C CG  . PHE A 1 485 ? -15.906 8.569  41.700  1.00 97.51  ? 529  PHE A CG  1 
ATOM   3646 C CD1 . PHE A 1 485 ? -16.532 9.414  42.594  1.00 97.99  ? 529  PHE A CD1 1 
ATOM   3647 C CD2 . PHE A 1 485 ? -16.606 8.128  40.594  1.00 95.62  ? 529  PHE A CD2 1 
ATOM   3648 C CE1 . PHE A 1 485 ? -17.825 9.796  42.396  1.00 96.59  ? 529  PHE A CE1 1 
ATOM   3649 C CE2 . PHE A 1 485 ? -17.899 8.506  40.391  1.00 94.11  ? 529  PHE A CE2 1 
ATOM   3650 C CZ  . PHE A 1 485 ? -18.515 9.342  41.294  1.00 94.57  ? 529  PHE A CZ  1 
ATOM   3651 N N   . THR A 1 486 ? -15.832 6.739  44.677  1.00 108.04 ? 530  THR A N   1 
ATOM   3652 C CA  . THR A 1 486 ? -16.350 6.990  46.014  1.00 109.60 ? 530  THR A CA  1 
ATOM   3653 C C   . THR A 1 486 ? -17.079 5.737  46.440  1.00 109.71 ? 530  THR A C   1 
ATOM   3654 O O   . THR A 1 486 ? -17.705 5.081  45.614  1.00 107.94 ? 530  THR A O   1 
ATOM   3655 C CB  . THR A 1 486 ? -17.305 8.212  46.056  1.00 108.86 ? 530  THR A CB  1 
ATOM   3656 O OG1 . THR A 1 486 ? -17.677 8.497  47.409  1.00 110.58 ? 530  THR A OG1 1 
ATOM   3657 C CG2 . THR A 1 486 ? -18.563 7.955  45.249  1.00 106.67 ? 530  THR A CG2 1 
ATOM   3658 N N   . ARG A 1 487 ? -16.991 5.358  47.704  1.00 150.26 ? 531  ARG A N   1 
ATOM   3659 C CA  . ARG A 1 487 ? -17.761 4.201  48.120  1.00 151.03 ? 531  ARG A CA  1 
ATOM   3660 C C   . ARG A 1 487 ? -19.056 4.640  48.843  1.00 151.17 ? 531  ARG A C   1 
ATOM   3661 O O   . ARG A 1 487 ? -19.895 3.812  49.201  1.00 153.05 ? 531  ARG A O   1 
ATOM   3662 C CB  . ARG A 1 487 ? -16.869 3.257  48.933  1.00 155.49 ? 531  ARG A CB  1 
ATOM   3663 C CG  . ARG A 1 487 ? -17.455 2.608  50.151  1.00 159.79 ? 531  ARG A CG  1 
ATOM   3664 C CD  . ARG A 1 487 ? -16.367 1.854  50.882  1.00 164.56 ? 531  ARG A CD  1 
ATOM   3665 N NE  . ARG A 1 487 ? -15.289 2.750  51.286  1.00 165.08 ? 531  ARG A NE  1 
ATOM   3666 C CZ  . ARG A 1 487 ? -15.370 3.616  52.291  1.00 166.06 ? 531  ARG A CZ  1 
ATOM   3667 N NH1 . ARG A 1 487 ? -16.485 3.705  53.006  1.00 166.78 ? 531  ARG A NH1 1 
ATOM   3668 N NH2 . ARG A 1 487 ? -14.334 4.392  52.581  1.00 166.66 ? 531  ARG A NH2 1 
ATOM   3669 N N   . ASP A 1 488 ? -19.243 5.950  49.003  1.00 124.16 ? 532  ASP A N   1 
ATOM   3670 C CA  . ASP A 1 488 ? -20.569 6.483  49.332  1.00 123.80 ? 532  ASP A CA  1 
ATOM   3671 C C   . ASP A 1 488 ? -21.119 7.209  48.114  1.00 121.48 ? 532  ASP A C   1 
ATOM   3672 O O   . ASP A 1 488 ? -20.717 8.338  47.837  1.00 121.11 ? 532  ASP A O   1 
ATOM   3673 C CB  . ASP A 1 488 ? -20.518 7.440  50.524  1.00 125.64 ? 532  ASP A CB  1 
ATOM   3674 C CG  . ASP A 1 488 ? -20.058 6.766  51.803  1.00 128.61 ? 532  ASP A CG  1 
ATOM   3675 O OD1 . ASP A 1 488 ? -20.823 5.955  52.377  1.00 130.81 ? 532  ASP A OD1 1 
ATOM   3676 O OD2 . ASP A 1 488 ? -18.935 7.065  52.254  1.00 130.42 ? 532  ASP A OD2 1 
ATOM   3677 N N   . PRO A 1 489 ? -22.070 6.579  47.401  1.00 99.71  ? 533  PRO A N   1 
ATOM   3678 C CA  . PRO A 1 489 ? -22.526 7.046  46.080  1.00 97.21  ? 533  PRO A CA  1 
ATOM   3679 C C   . PRO A 1 489 ? -23.150 8.437  46.111  1.00 96.66  ? 533  PRO A C   1 
ATOM   3680 O O   . PRO A 1 489 ? -23.599 8.876  47.168  1.00 98.05  ? 533  PRO A O   1 
ATOM   3681 C CB  . PRO A 1 489 ? -23.566 5.996  45.675  1.00 95.82  ? 533  PRO A CB  1 
ATOM   3682 C CG  . PRO A 1 489 ? -23.190 4.782  46.443  1.00 97.22  ? 533  PRO A CG  1 
ATOM   3683 C CD  . PRO A 1 489 ? -22.672 5.285  47.762  1.00 99.73  ? 533  PRO A CD  1 
ATOM   3684 N N   . ILE A 1 490 ? -23.167 9.117  44.966  1.00 90.16  ? 534  ILE A N   1 
ATOM   3685 C CA  . ILE A 1 490 ? -23.747 10.458 44.867  1.00 89.72  ? 534  ILE A CA  1 
ATOM   3686 C C   . ILE A 1 490 ? -24.845 10.537 43.808  1.00 87.60  ? 534  ILE A C   1 
ATOM   3687 O O   . ILE A 1 490 ? -24.845 9.764  42.858  1.00 86.01  ? 534  ILE A O   1 
ATOM   3688 C CB  . ILE A 1 490 ? -22.677 11.510 44.529  1.00 89.81  ? 534  ILE A CB  1 
ATOM   3689 C CG1 . ILE A 1 490 ? -22.055 11.227 43.162  1.00 87.98  ? 534  ILE A CG1 1 
ATOM   3690 C CG2 . ILE A 1 490 ? -21.603 11.507 45.569  1.00 91.99  ? 534  ILE A CG2 1 
ATOM   3691 C CD1 . ILE A 1 490 ? -21.048 12.261 42.740  1.00 87.99  ? 534  ILE A CD1 1 
ATOM   3692 N N   . TYR A 1 491 ? -25.782 11.468 43.984  1.00 91.67  ? 535  TYR A N   1 
ATOM   3693 C CA  . TYR A 1 491 ? -26.713 11.845 42.925  1.00 90.09  ? 535  TYR A CA  1 
ATOM   3694 C C   . TYR A 1 491 ? -25.964 12.801 41.992  1.00 89.21  ? 535  TYR A C   1 
ATOM   3695 O O   . TYR A 1 491 ? -25.550 13.882 42.411  1.00 90.67  ? 535  TYR A O   1 
ATOM   3696 C CB  . TYR A 1 491 ? -27.952 12.522 43.499  1.00 91.50  ? 535  TYR A CB  1 
ATOM   3697 C CG  . TYR A 1 491 ? -29.076 11.621 43.984  1.00 91.66  ? 535  TYR A CG  1 
ATOM   3698 C CD1 . TYR A 1 491 ? -30.088 11.219 43.121  1.00 90.13  ? 535  TYR A CD1 1 
ATOM   3699 C CD2 . TYR A 1 491 ? -29.157 11.223 45.319  1.00 93.46  ? 535  TYR A CD2 1 
ATOM   3700 C CE1 . TYR A 1 491 ? -31.124 10.437 43.557  1.00 90.32  ? 535  TYR A CE1 1 
ATOM   3701 C CE2 . TYR A 1 491 ? -30.187 10.433 45.763  1.00 93.61  ? 535  TYR A CE2 1 
ATOM   3702 C CZ  . TYR A 1 491 ? -31.170 10.047 44.887  1.00 92.07  ? 535  TYR A CZ  1 
ATOM   3703 O OH  . TYR A 1 491 ? -32.203 9.282  45.384  1.00 92.42  ? 535  TYR A OH  1 
ATOM   3704 N N   . PHE A 1 492 ? -25.723 12.394 40.749  1.00 81.43  ? 536  PHE A N   1 
ATOM   3705 C CA  . PHE A 1 492 ? -24.765 13.119 39.911  1.00 80.54  ? 536  PHE A CA  1 
ATOM   3706 C C   . PHE A 1 492 ? -25.383 14.016 38.842  1.00 80.37  ? 536  PHE A C   1 
ATOM   3707 O O   . PHE A 1 492 ? -26.156 13.561 37.999  1.00 79.78  ? 536  PHE A O   1 
ATOM   3708 C CB  . PHE A 1 492 ? -23.787 12.137 39.258  1.00 78.33  ? 536  PHE A CB  1 
ATOM   3709 C CG  . PHE A 1 492 ? -22.809 12.788 38.322  1.00 77.09  ? 536  PHE A CG  1 
ATOM   3710 C CD1 . PHE A 1 492 ? -21.686 13.434 38.811  1.00 78.02  ? 536  PHE A CD1 1 
ATOM   3711 C CD2 . PHE A 1 492 ? -23.014 12.755 36.953  1.00 75.14  ? 536  PHE A CD2 1 
ATOM   3712 C CE1 . PHE A 1 492 ? -20.784 14.034 37.952  1.00 76.99  ? 536  PHE A CE1 1 
ATOM   3713 C CE2 . PHE A 1 492 ? -22.117 13.352 36.088  1.00 73.95  ? 536  PHE A CE2 1 
ATOM   3714 C CZ  . PHE A 1 492 ? -21.000 13.993 36.588  1.00 74.85  ? 536  PHE A CZ  1 
ATOM   3715 N N   . THR A 1 493 ? -25.029 15.299 38.891  1.00 78.20  ? 537  THR A N   1 
ATOM   3716 C CA  . THR A 1 493 ? -25.525 16.275 37.926  1.00 78.33  ? 537  THR A CA  1 
ATOM   3717 C C   . THR A 1 493 ? -24.559 16.648 36.794  1.00 76.48  ? 537  THR A C   1 
ATOM   3718 O O   . THR A 1 493 ? -24.963 16.716 35.634  1.00 74.59  ? 537  THR A O   1 
ATOM   3719 C CB  . THR A 1 493 ? -25.978 17.571 38.629  1.00 81.37  ? 537  THR A CB  1 
ATOM   3720 O OG1 . THR A 1 493 ? -24.877 18.135 39.352  1.00 82.24  ? 537  THR A OG1 1 
ATOM   3721 C CG2 . THR A 1 493 ? -27.118 17.284 39.593  1.00 83.09  ? 537  THR A CG2 1 
ATOM   3722 N N   . GLY A 1 494 ? -23.293 16.903 37.126  1.00 84.83  ? 538  GLY A N   1 
ATOM   3723 C CA  . GLY A 1 494 ? -22.367 17.443 36.142  1.00 83.11  ? 538  GLY A CA  1 
ATOM   3724 C C   . GLY A 1 494 ? -20.868 17.231 36.295  1.00 83.11  ? 538  GLY A C   1 
ATOM   3725 O O   . GLY A 1 494 ? -20.365 16.916 37.373  1.00 84.81  ? 538  GLY A O   1 
ATOM   3726 N N   . LEU A 1 495 ? -20.163 17.422 35.181  1.00 66.82  ? 539  LEU A N   1 
ATOM   3727 C CA  . LEU A 1 495 ? -18.711 17.401 35.109  1.00 67.54  ? 539  LEU A CA  1 
ATOM   3728 C C   . LEU A 1 495 ? -18.225 18.813 34.941  1.00 69.17  ? 539  LEU A C   1 
ATOM   3729 O O   . LEU A 1 495 ? -18.756 19.565 34.137  1.00 68.01  ? 539  LEU A O   1 
ATOM   3730 C CB  . LEU A 1 495 ? -18.220 16.558 33.943  1.00 64.89  ? 539  LEU A CB  1 
ATOM   3731 C CG  . LEU A 1 495 ? -18.799 15.152 33.882  1.00 63.39  ? 539  LEU A CG  1 
ATOM   3732 C CD1 . LEU A 1 495 ? -18.836 14.655 32.433  1.00 60.42  ? 539  LEU A CD1 1 
ATOM   3733 C CD2 . LEU A 1 495 ? -18.021 14.199 34.759  1.00 65.34  ? 539  LEU A CD2 1 
ATOM   3734 N N   . ALA A 1 496 ? -17.228 19.180 35.720  1.00 61.28  ? 540  ALA A N   1 
ATOM   3735 C CA  . ALA A 1 496 ? -16.465 20.389 35.460  1.00 62.54  ? 540  ALA A CA  1 
ATOM   3736 C C   . ALA A 1 496 ? -15.055 19.986 35.014  1.00 62.09  ? 540  ALA A C   1 
ATOM   3737 O O   . ALA A 1 496 ? -14.464 19.053 35.563  1.00 62.43  ? 540  ALA A O   1 
ATOM   3738 C CB  . ALA A 1 496 ? -16.412 21.278 36.699  1.00 65.12  ? 540  ALA A CB  1 
ATOM   3739 N N   . SER A 1 497 ? -14.527 20.645 33.996  1.00 61.75  ? 541  SER A N   1 
ATOM   3740 C CA  . SER A 1 497 ? -13.131 20.442 33.660  1.00 61.27  ? 541  SER A CA  1 
ATOM   3741 C C   . SER A 1 497 ? -12.628 21.641 32.894  1.00 59.54  ? 541  SER A C   1 
ATOM   3742 O O   . SER A 1 497 ? -13.413 22.352 32.283  1.00 57.64  ? 541  SER A O   1 
ATOM   3743 C CB  . SER A 1 497 ? -12.931 19.172 32.853  1.00 60.20  ? 541  SER A CB  1 
ATOM   3744 O OG  . SER A 1 497 ? -13.085 19.433 31.479  1.00 57.63  ? 541  SER A OG  1 
ATOM   3745 N N   . GLU A 1 498 ? -11.319 21.858 32.908  1.00 74.20  ? 542  GLU A N   1 
ATOM   3746 C CA  . GLU A 1 498 ? -10.741 23.045 32.295  1.00 72.48  ? 542  GLU A CA  1 
ATOM   3747 C C   . GLU A 1 498 ? -11.054 23.129 30.797  1.00 69.25  ? 542  GLU A C   1 
ATOM   3748 O O   . GLU A 1 498 ? -10.779 22.192 30.029  1.00 68.54  ? 542  GLU A O   1 
ATOM   3749 C CB  . GLU A 1 498 ? -9.229  23.080 32.527  1.00 73.15  ? 542  GLU A CB  1 
ATOM   3750 C CG  . GLU A 1 498 ? -8.647  24.467 32.510  1.00 72.36  ? 542  GLU A CG  1 
ATOM   3751 C CD  . GLU A 1 498 ? -7.149  24.460 32.214  1.00 72.26  ? 542  GLU A CD  1 
ATOM   3752 O OE1 . GLU A 1 498 ? -6.789  23.713 31.283  1.00 71.33  ? 542  GLU A OE1 1 
ATOM   3753 O OE2 . GLU A 1 498 ? -6.351  25.178 32.895  1.00 73.25  ? 542  GLU A OE2 1 
ATOM   3754 N N   . PRO A 1 499 ? -11.622 24.270 30.415  1.00 56.28  ? 543  PRO A N   1 
ATOM   3755 C CA  . PRO A 1 499 ? -12.000 24.542 29.028  1.00 52.89  ? 543  PRO A CA  1 
ATOM   3756 C C   . PRO A 1 499 ? -10.762 24.561 28.155  1.00 52.06  ? 543  PRO A C   1 
ATOM   3757 O O   . PRO A 1 499 ? -9.704  25.032 28.573  1.00 53.60  ? 543  PRO A O   1 
ATOM   3758 C CB  . PRO A 1 499 ? -12.612 25.941 29.105  1.00 52.57  ? 543  PRO A CB  1 
ATOM   3759 C CG  . PRO A 1 499 ? -13.149 26.034 30.492  1.00 55.36  ? 543  PRO A CG  1 
ATOM   3760 C CD  . PRO A 1 499 ? -12.196 25.253 31.351  1.00 57.72  ? 543  PRO A CD  1 
ATOM   3761 N N   . GLY A 1 500 ? -10.900 24.031 26.949  1.00 59.81  ? 544  GLY A N   1 
ATOM   3762 C CA  . GLY A 1 500 ? -9.765  23.804 26.081  1.00 59.45  ? 544  GLY A CA  1 
ATOM   3763 C C   . GLY A 1 500 ? -9.330  22.350 26.069  1.00 61.15  ? 544  GLY A C   1 
ATOM   3764 O O   . GLY A 1 500 ? -8.408  22.007 25.324  1.00 61.28  ? 544  GLY A O   1 
ATOM   3765 N N   . ALA A 1 501 ? -9.961  21.517 26.903  1.00 55.71  ? 545  ALA A N   1 
ATOM   3766 C CA  . ALA A 1 501 ? -9.792  20.064 26.850  1.00 57.00  ? 545  ALA A CA  1 
ATOM   3767 C C   . ALA A 1 501 ? -8.315  19.628 26.867  1.00 59.12  ? 545  ALA A C   1 
ATOM   3768 O O   . ALA A 1 501 ? -7.912  18.716 26.112  1.00 59.44  ? 545  ALA A O   1 
ATOM   3769 C CB  . ALA A 1 501 ? -10.466 19.522 25.633  1.00 54.57  ? 545  ALA A CB  1 
ATOM   3770 N N   . ARG A 1 502 ? -7.493  20.373 27.613  1.00 65.07  ? 546  ARG A N   1 
ATOM   3771 C CA  . ARG A 1 502 ? -6.097  20.053 27.757  1.00 66.64  ? 546  ARG A CA  1 
ATOM   3772 C C   . ARG A 1 502 ? -5.654  19.476 29.103  1.00 69.12  ? 546  ARG A C   1 
ATOM   3773 O O   . ARG A 1 502 ? -4.469  19.156 29.278  1.00 70.38  ? 546  ARG A O   1 
ATOM   3774 C CB  . ARG A 1 502 ? -5.288  21.297 27.453  1.00 65.68  ? 546  ARG A CB  1 
ATOM   3775 C CG  . ARG A 1 502 ? -5.187  21.517 25.993  1.00 63.76  ? 546  ARG A CG  1 
ATOM   3776 C CD  . ARG A 1 502 ? -4.431  22.738 25.592  1.00 62.67  ? 546  ARG A CD  1 
ATOM   3777 N NE  . ARG A 1 502 ? -4.576  22.851 24.148  1.00 60.69  ? 546  ARG A NE  1 
ATOM   3778 C CZ  . ARG A 1 502 ? -3.662  22.496 23.243  1.00 60.98  ? 546  ARG A CZ  1 
ATOM   3779 N NH1 . ARG A 1 502 ? -2.461  22.031 23.626  1.00 63.06  ? 546  ARG A NH1 1 
ATOM   3780 N NH2 . ARG A 1 502 ? -3.942  22.637 21.941  1.00 59.22  ? 546  ARG A NH2 1 
ATOM   3781 N N   . SER A 1 503 ? -6.542  19.380 30.087  1.00 70.36  ? 547  SER A N   1 
ATOM   3782 C CA  . SER A 1 503 ? -6.014  19.002 31.379  1.00 72.54  ? 547  SER A CA  1 
ATOM   3783 C C   . SER A 1 503 ? -6.299  17.541 31.567  1.00 73.54  ? 547  SER A C   1 
ATOM   3784 O O   . SER A 1 503 ? -6.954  16.927 30.731  1.00 72.71  ? 547  SER A O   1 
ATOM   3785 C CB  . SER A 1 503 ? -6.612  19.836 32.505  1.00 73.35  ? 547  SER A CB  1 
ATOM   3786 O OG  . SER A 1 503 ? -7.902  19.395 32.861  1.00 73.22  ? 547  SER A OG  1 
ATOM   3787 N N   . MET A 1 504 ? -5.736  16.966 32.618  1.00 93.11  ? 548  MET A N   1 
ATOM   3788 C CA  . MET A 1 504 ? -6.003  15.591 32.987  1.00 94.01  ? 548  MET A CA  1 
ATOM   3789 C C   . MET A 1 504 ? -6.848  15.531 34.232  1.00 94.79  ? 548  MET A C   1 
ATOM   3790 O O   . MET A 1 504 ? -7.057  14.471 34.809  1.00 95.60  ? 548  MET A O   1 
ATOM   3791 C CB  . MET A 1 504 ? -4.701  14.843 33.126  1.00 95.20  ? 548  MET A CB  1 
ATOM   3792 C CG  . MET A 1 504 ? -3.899  15.010 31.863  1.00 94.44  ? 548  MET A CG  1 
ATOM   3793 S SD  . MET A 1 504 ? -2.798  13.648 31.573  1.00 95.60  ? 548  MET A SD  1 
ATOM   3794 C CE  . MET A 1 504 ? -3.994  12.335 31.526  1.00 95.77  ? 548  MET A CE  1 
ATOM   3795 N N   . ASN A 1 505 ? -7.267  16.706 34.677  1.00 75.66  ? 549  ASN A N   1 
ATOM   3796 C CA  . ASN A 1 505 ? -8.143  16.825 35.827  1.00 76.49  ? 549  ASN A CA  1 
ATOM   3797 C C   . ASN A 1 505 ? -9.636  16.911 35.428  1.00 75.33  ? 549  ASN A C   1 
ATOM   3798 O O   . ASN A 1 505 ? -10.013 17.722 34.577  1.00 74.15  ? 549  ASN A O   1 
ATOM   3799 C CB  . ASN A 1 505 ? -7.742  18.051 36.653  1.00 77.41  ? 549  ASN A CB  1 
ATOM   3800 C CG  . ASN A 1 505 ? -6.344  17.937 37.254  1.00 78.66  ? 549  ASN A CG  1 
ATOM   3801 O OD1 . ASN A 1 505 ? -6.093  17.070 38.080  1.00 79.89  ? 549  ASN A OD1 1 
ATOM   3802 N ND2 . ASN A 1 505 ? -5.435  18.834 36.848  1.00 78.27  ? 549  ASN A ND2 1 
ATOM   3803 N N   . ILE A 1 506 ? -10.460 16.056 36.044  1.00 66.51  ? 550  ILE A N   1 
ATOM   3804 C CA  . ILE A 1 506 ? -11.921 16.073 35.896  1.00 65.42  ? 550  ILE A CA  1 
ATOM   3805 C C   . ILE A 1 506 ? -12.617 16.161 37.275  1.00 66.63  ? 550  ILE A C   1 
ATOM   3806 O O   . ILE A 1 506 ? -12.200 15.506 38.230  1.00 67.89  ? 550  ILE A O   1 
ATOM   3807 C CB  . ILE A 1 506 ? -12.439 14.816 35.139  1.00 63.80  ? 550  ILE A CB  1 
ATOM   3808 C CG1 . ILE A 1 506 ? -13.963 14.844 35.010  1.00 62.17  ? 550  ILE A CG1 1 
ATOM   3809 C CG2 . ILE A 1 506 ? -12.028 13.545 35.848  1.00 64.81  ? 550  ILE A CG2 1 
ATOM   3810 C CD1 . ILE A 1 506 ? -14.443 15.853 34.021  1.00 60.83  ? 550  ILE A CD1 1 
ATOM   3811 N N   . SER A 1 507 ? -13.666 16.980 37.363  1.00 69.90  ? 551  SER A N   1 
ATOM   3812 C CA  . SER A 1 507 ? -14.438 17.182 38.594  1.00 71.12  ? 551  SER A CA  1 
ATOM   3813 C C   . SER A 1 507 ? -15.852 16.609 38.500  1.00 69.84  ? 551  SER A C   1 
ATOM   3814 O O   . SER A 1 507 ? -16.652 17.115 37.722  1.00 68.57  ? 551  SER A O   1 
ATOM   3815 C CB  . SER A 1 507 ? -14.537 18.670 38.911  1.00 72.33  ? 551  SER A CB  1 
ATOM   3816 O OG  . SER A 1 507 ? -13.282 19.182 39.290  1.00 73.51  ? 551  SER A OG  1 
ATOM   3817 N N   . ILE A 1 508 ? -16.158 15.574 39.279  1.00 76.49  ? 552  ILE A N   1 
ATOM   3818 C CA  . ILE A 1 508 ? -17.505 15.003 39.299  1.00 75.34  ? 552  ILE A CA  1 
ATOM   3819 C C   . ILE A 1 508 ? -18.375 15.662 40.374  1.00 76.96  ? 552  ILE A C   1 
ATOM   3820 O O   . ILE A 1 508 ? -18.065 15.580 41.567  1.00 78.85  ? 552  ILE A O   1 
ATOM   3821 C CB  . ILE A 1 508 ? -17.484 13.499 39.576  1.00 75.11  ? 552  ILE A CB  1 
ATOM   3822 C CG1 . ILE A 1 508 ? -16.552 12.765 38.630  1.00 74.17  ? 552  ILE A CG1 1 
ATOM   3823 C CG2 . ILE A 1 508 ? -18.885 12.900 39.497  1.00 73.89  ? 552  ILE A CG2 1 
ATOM   3824 C CD1 . ILE A 1 508 ? -16.391 11.310 39.052  1.00 74.84  ? 552  ILE A CD1 1 
ATOM   3825 N N   . TRP A 1 509 ? -19.470 16.295 39.969  1.00 74.15  ? 553  TRP A N   1 
ATOM   3826 C CA  . TRP A 1 509 ? -20.282 17.020 40.936  1.00 76.01  ? 553  TRP A CA  1 
ATOM   3827 C C   . TRP A 1 509 ? -21.623 16.332 41.244  1.00 75.58  ? 553  TRP A C   1 
ATOM   3828 O O   . TRP A 1 509 ? -22.227 15.689 40.376  1.00 73.55  ? 553  TRP A O   1 
ATOM   3829 C CB  . TRP A 1 509 ? -20.547 18.441 40.446  1.00 76.59  ? 553  TRP A CB  1 
ATOM   3830 C CG  . TRP A 1 509 ? -19.393 19.388 40.545  1.00 77.91  ? 553  TRP A CG  1 
ATOM   3831 C CD1 . TRP A 1 509 ? -18.365 19.514 39.665  1.00 76.98  ? 553  TRP A CD1 1 
ATOM   3832 C CD2 . TRP A 1 509 ? -19.177 20.377 41.558  1.00 80.34  ? 553  TRP A CD2 1 
ATOM   3833 N NE1 . TRP A 1 509 ? -17.511 20.508 40.071  1.00 78.68  ? 553  TRP A NE1 1 
ATOM   3834 C CE2 . TRP A 1 509 ? -17.989 21.057 41.229  1.00 80.64  ? 553  TRP A CE2 1 
ATOM   3835 C CE3 . TRP A 1 509 ? -19.873 20.753 42.708  1.00 82.18  ? 553  TRP A CE3 1 
ATOM   3836 C CZ2 . TRP A 1 509 ? -17.476 22.085 42.004  1.00 82.52  ? 553  TRP A CZ2 1 
ATOM   3837 C CZ3 . TRP A 1 509 ? -19.361 21.767 43.483  1.00 84.09  ? 553  TRP A CZ3 1 
ATOM   3838 C CH2 . TRP A 1 509 ? -18.170 22.427 43.125  1.00 84.19  ? 553  TRP A CH2 1 
ATOM   3839 N N   . GLY A 1 510 ? -22.090 16.487 42.477  1.00 86.47  ? 554  GLY A N   1 
ATOM   3840 C CA  . GLY A 1 510 ? -23.385 15.964 42.852  1.00 86.49  ? 554  GLY A CA  1 
ATOM   3841 C C   . GLY A 1 510 ? -23.654 16.120 44.333  1.00 88.87  ? 554  GLY A C   1 
ATOM   3842 O O   . GLY A 1 510 ? -22.878 16.766 45.038  1.00 90.51  ? 554  GLY A O   1 
ATOM   3843 N N   . PHE A 1 511 ? -24.752 15.538 44.809  1.00 106.02 ? 555  PHE A N   1 
ATOM   3844 C CA  . PHE A 1 511 ? -25.085 15.601 46.231  1.00 108.12 ? 555  PHE A CA  1 
ATOM   3845 C C   . PHE A 1 511 ? -25.340 14.216 46.819  1.00 107.98 ? 555  PHE A C   1 
ATOM   3846 O O   . PHE A 1 511 ? -25.589 13.256 46.095  1.00 106.25 ? 555  PHE A O   1 
ATOM   3847 C CB  . PHE A 1 511 ? -26.296 16.516 46.476  1.00 109.22 ? 555  PHE A CB  1 
ATOM   3848 C CG  . PHE A 1 511 ? -27.475 16.266 45.558  1.00 107.93 ? 555  PHE A CG  1 
ATOM   3849 C CD1 . PHE A 1 511 ? -27.571 16.906 44.320  1.00 106.93 ? 555  PHE A CD1 1 
ATOM   3850 C CD2 . PHE A 1 511 ? -28.512 15.432 45.949  1.00 107.89 ? 555  PHE A CD2 1 
ATOM   3851 C CE1 . PHE A 1 511 ? -28.676 16.690 43.480  1.00 105.93 ? 555  PHE A CE1 1 
ATOM   3852 C CE2 . PHE A 1 511 ? -29.615 15.215 45.116  1.00 106.84 ? 555  PHE A CE2 1 
ATOM   3853 C CZ  . PHE A 1 511 ? -29.697 15.843 43.884  1.00 105.88 ? 555  PHE A CZ  1 
ATOM   3854 N N   . THR A 1 512 ? -25.251 14.120 48.140  1.00 95.30  ? 556  THR A N   1 
ATOM   3855 C CA  . THR A 1 512 ? -25.470 12.859 48.838  1.00 95.68  ? 556  THR A CA  1 
ATOM   3856 C C   . THR A 1 512 ? -26.965 12.613 49.035  1.00 95.49  ? 556  THR A C   1 
ATOM   3857 O O   . THR A 1 512 ? -27.777 13.491 48.727  1.00 95.34  ? 556  THR A O   1 
ATOM   3858 C CB  . THR A 1 512 ? -24.769 12.878 50.178  1.00 98.00  ? 556  THR A CB  1 
ATOM   3859 O OG1 . THR A 1 512 ? -25.307 13.949 50.962  1.00 99.74  ? 556  THR A OG1 1 
ATOM   3860 C CG2 . THR A 1 512 ? -23.278 13.116 49.958  1.00 98.01  ? 556  THR A CG2 1 
ATOM   3861 N N   . GLU A 1 513 ? -27.359 11.455 49.560  1.00 145.79 ? 557  GLU A N   1 
ATOM   3862 C CA  . GLU A 1 513 ? -28.792 11.198 49.598  1.00 145.05 ? 557  GLU A CA  1 
ATOM   3863 C C   . GLU A 1 513 ? -29.410 11.609 50.929  1.00 147.72 ? 557  GLU A C   1 
ATOM   3864 O O   . GLU A 1 513 ? -28.688 11.879 51.895  1.00 149.07 ? 557  GLU A O   1 
ATOM   3865 C CB  . GLU A 1 513 ? -29.094 9.725  49.298  1.00 143.38 ? 557  GLU A CB  1 
ATOM   3866 C CG  . GLU A 1 513 ? -27.959 8.751  49.578  1.00 145.09 ? 557  GLU A CG  1 
ATOM   3867 C CD  . GLU A 1 513 ? -28.305 7.330  49.154  1.00 143.42 ? 557  GLU A CD  1 
ATOM   3868 O OE1 . GLU A 1 513 ? -29.473 7.088  48.778  1.00 142.98 ? 557  GLU A OE1 1 
ATOM   3869 O OE2 . GLU A 1 513 ? -27.410 6.457  49.197  1.00 144.50 ? 557  GLU A OE2 1 
ATOM   3870 N N   . SER A 1 514 ? -30.746 11.551 50.965  1.00 136.32 ? 558  SER A N   1 
ATOM   3871 C CA  . SER A 1 514 ? -31.614 12.222 51.950  1.00 138.13 ? 558  SER A CA  1 
ATOM   3872 C C   . SER A 1 514 ? -31.639 13.747 51.749  1.00 136.29 ? 558  SER A C   1 
ATOM   3873 O O   . SER A 1 514 ? -32.679 14.334 51.429  1.00 137.73 ? 558  SER A O   1 
ATOM   3874 C CB  . SER A 1 514 ? -31.194 11.891 53.385  1.00 143.67 ? 558  SER A CB  1 
ATOM   3875 O OG  . SER A 1 514 ? -31.370 10.517 53.670  1.00 146.16 ? 558  SER A OG  1 
ATOM   3876 N N   . THR A 1 517 ? -31.317 17.270 54.925  1.00 153.46 ? 561  THR A N   1 
ATOM   3877 C CA  . THR A 1 517 ? -30.282 16.350 55.382  1.00 153.88 ? 561  THR A CA  1 
ATOM   3878 C C   . THR A 1 517 ? -29.339 15.957 54.239  1.00 151.69 ? 561  THR A C   1 
ATOM   3879 O O   . THR A 1 517 ? -29.327 14.816 53.786  1.00 149.52 ? 561  THR A O   1 
ATOM   3880 C CB  . THR A 1 517 ? -30.905 15.098 56.000  1.00 153.89 ? 561  THR A CB  1 
ATOM   3881 O OG1 . THR A 1 517 ? -29.923 14.056 56.068  1.00 153.94 ? 561  THR A OG1 1 
ATOM   3882 C CG2 . THR A 1 517 ? -32.109 14.639 55.175  1.00 151.62 ? 561  THR A CG2 1 
ATOM   3883 N N   . SER A 1 518 ? -28.542 16.923 53.792  1.00 177.90 ? 562  SER A N   1 
ATOM   3884 C CA  . SER A 1 518 ? -27.690 16.745 52.620  1.00 175.76 ? 562  SER A CA  1 
ATOM   3885 C C   . SER A 1 518 ? -26.502 17.698 52.550  1.00 176.28 ? 562  SER A C   1 
ATOM   3886 O O   . SER A 1 518 ? -26.408 18.632 53.347  1.00 178.12 ? 562  SER A O   1 
ATOM   3887 C CB  . SER A 1 518 ? -28.483 16.944 51.356  1.00 174.25 ? 562  SER A CB  1 
ATOM   3888 O OG  . SER A 1 518 ? -27.585 17.467 50.403  1.00 172.31 ? 562  SER A OG  1 
ATOM   3889 N N   . GLN A 1 519 ? -25.571 17.410 51.632  1.00 143.21 ? 563  GLN A N   1 
ATOM   3890 C CA  . GLN A 1 519 ? -24.605 18.409 51.121  1.00 143.12 ? 563  GLN A CA  1 
ATOM   3891 C C   . GLN A 1 519 ? -24.149 18.127 49.670  1.00 140.90 ? 563  GLN A C   1 
ATOM   3892 O O   . GLN A 1 519 ? -24.076 16.973 49.241  1.00 139.42 ? 563  GLN A O   1 
ATOM   3893 C CB  . GLN A 1 519 ? -23.336 18.520 51.997  1.00 144.35 ? 563  GLN A CB  1 
ATOM   3894 C CG  . GLN A 1 519 ? -23.457 18.298 53.500  1.00 147.26 ? 563  GLN A CG  1 
ATOM   3895 C CD  . GLN A 1 519 ? -23.662 16.840 53.866  1.00 146.56 ? 563  GLN A CD  1 
ATOM   3896 O OE1 . GLN A 1 519 ? -22.934 15.962 53.401  1.00 144.39 ? 563  GLN A OE1 1 
ATOM   3897 N NE2 . GLN A 1 519 ? -24.663 16.572 54.701  1.00 148.26 ? 563  GLN A NE2 1 
ATOM   3898 N N   . TRP A 1 520 ? -23.829 19.188 48.925  1.00 112.98 ? 564  TRP A N   1 
ATOM   3899 C CA  . TRP A 1 520 ? -23.169 19.050 47.625  1.00 111.18 ? 564  TRP A CA  1 
ATOM   3900 C C   . TRP A 1 520 ? -21.716 18.595 47.783  1.00 111.26 ? 564  TRP A C   1 
ATOM   3901 O O   . TRP A 1 520 ? -21.016 19.037 48.681  1.00 112.90 ? 564  TRP A O   1 
ATOM   3902 C CB  . TRP A 1 520 ? -23.184 20.366 46.854  1.00 111.02 ? 564  TRP A CB  1 
ATOM   3903 C CG  . TRP A 1 520 ? -24.519 20.836 46.371  1.00 110.82 ? 564  TRP A CG  1 
ATOM   3904 C CD1 . TRP A 1 520 ? -25.390 21.631 47.046  1.00 112.42 ? 564  TRP A CD1 1 
ATOM   3905 C CD2 . TRP A 1 520 ? -25.119 20.584 45.089  1.00 108.97 ? 564  TRP A CD2 1 
ATOM   3906 N NE1 . TRP A 1 520 ? -26.505 21.880 46.278  1.00 111.81 ? 564  TRP A NE1 1 
ATOM   3907 C CE2 . TRP A 1 520 ? -26.363 21.248 45.073  1.00 109.72 ? 564  TRP A CE2 1 
ATOM   3908 C CE3 . TRP A 1 520 ? -24.730 19.856 43.961  1.00 106.72 ? 564  TRP A CE3 1 
ATOM   3909 C CZ2 . TRP A 1 520 ? -27.221 21.209 43.975  1.00 108.47 ? 564  TRP A CZ2 1 
ATOM   3910 C CZ3 . TRP A 1 520 ? -25.587 19.823 42.865  1.00 105.31 ? 564  TRP A CZ3 1 
ATOM   3911 C CH2 . TRP A 1 520 ? -26.818 20.495 42.884  1.00 106.29 ? 564  TRP A CH2 1 
ATOM   3912 N N   . VAL A 1 521 ? -21.244 17.745 46.884  1.00 96.39  ? 565  VAL A N   1 
ATOM   3913 C CA  . VAL A 1 521 ? -19.882 17.235 46.981  1.00 96.46  ? 565  VAL A CA  1 
ATOM   3914 C C   . VAL A 1 521 ? -19.230 17.253 45.584  1.00 94.60  ? 565  VAL A C   1 
ATOM   3915 O O   . VAL A 1 521 ? -19.938 17.269 44.582  1.00 93.18  ? 565  VAL A O   1 
ATOM   3916 C CB  . VAL A 1 521 ? -19.897 15.821 47.585  1.00 96.63  ? 565  VAL A CB  1 
ATOM   3917 C CG1 . VAL A 1 521 ? -20.710 14.894 46.703  1.00 93.49  ? 565  VAL A CG1 1 
ATOM   3918 C CG2 . VAL A 1 521 ? -18.494 15.290 47.815  1.00 97.91  ? 565  VAL A CG2 1 
ATOM   3919 N N   . SER A 1 522 ? -17.900 17.306 45.509  1.00 104.06 ? 566  SER A N   1 
ATOM   3920 C CA  . SER A 1 522 ? -17.208 17.183 44.224  1.00 102.28 ? 566  SER A CA  1 
ATOM   3921 C C   . SER A 1 522 ? -16.007 16.257 44.364  1.00 102.34 ? 566  SER A C   1 
ATOM   3922 O O   . SER A 1 522 ? -15.193 16.413 45.271  1.00 103.87 ? 566  SER A O   1 
ATOM   3923 C CB  . SER A 1 522 ? -16.762 18.551 43.686  1.00 101.91 ? 566  SER A CB  1 
ATOM   3924 O OG  . SER A 1 522 ? -15.707 19.108 44.453  1.00 104.73 ? 566  SER A OG  1 
ATOM   3925 N N   . TYR A 1 523 ? -15.905 15.276 43.477  1.00 90.31  ? 567  TYR A N   1 
ATOM   3926 C CA  . TYR A 1 523 ? -14.725 14.423 43.441  1.00 90.50  ? 567  TYR A CA  1 
ATOM   3927 C C   . TYR A 1 523 ? -13.893 14.788 42.212  1.00 89.22  ? 567  TYR A C   1 
ATOM   3928 O O   . TYR A 1 523 ? -14.316 14.554 41.078  1.00 87.36  ? 567  TYR A O   1 
ATOM   3929 C CB  . TYR A 1 523 ? -15.117 12.942 43.427  1.00 90.08  ? 567  TYR A CB  1 
ATOM   3930 C CG  . TYR A 1 523 ? -15.767 12.468 44.714  1.00 91.56  ? 567  TYR A CG  1 
ATOM   3931 C CD1 . TYR A 1 523 ? -17.137 12.595 44.916  1.00 91.19  ? 567  TYR A CD1 1 
ATOM   3932 C CD2 . TYR A 1 523 ? -15.014 11.889 45.725  1.00 93.42  ? 567  TYR A CD2 1 
ATOM   3933 C CE1 . TYR A 1 523 ? -17.740 12.161 46.093  1.00 92.62  ? 567  TYR A CE1 1 
ATOM   3934 C CE2 . TYR A 1 523 ? -15.608 11.447 46.909  1.00 94.87  ? 567  TYR A CE2 1 
ATOM   3935 C CZ  . TYR A 1 523 ? -16.975 11.587 47.089  1.00 94.46  ? 567  TYR A CZ  1 
ATOM   3936 O OH  . TYR A 1 523 ? -17.573 11.156 48.260  1.00 95.96  ? 567  TYR A OH  1 
ATOM   3937 N N   . THR A 1 524 ? -12.725 15.387 42.432  1.00 80.74  ? 568  THR A N   1 
ATOM   3938 C CA  . THR A 1 524 ? -11.840 15.718 41.316  1.00 79.76  ? 568  THR A CA  1 
ATOM   3939 C C   . THR A 1 524 ? -10.713 14.689 41.164  1.00 80.05  ? 568  THR A C   1 
ATOM   3940 O O   . THR A 1 524 ? -9.888  14.492 42.063  1.00 81.62  ? 568  THR A O   1 
ATOM   3941 C CB  . THR A 1 524 ? -11.225 17.130 41.454  1.00 80.41  ? 568  THR A CB  1 
ATOM   3942 O OG1 . THR A 1 524 ? -12.241 18.117 41.247  1.00 80.03  ? 568  THR A OG1 1 
ATOM   3943 C CG2 . THR A 1 524 ? -10.142 17.336 40.419  1.00 79.55  ? 568  THR A CG2 1 
ATOM   3944 N N   . ILE A 1 525 ? -10.697 14.038 40.006  1.00 89.86  ? 569  ILE A N   1 
ATOM   3945 C CA  . ILE A 1 525 ? -9.734  12.991 39.711  1.00 90.17  ? 569  ILE A CA  1 
ATOM   3946 C C   . ILE A 1 525 ? -8.623  13.501 38.803  1.00 89.76  ? 569  ILE A C   1 
ATOM   3947 O O   . ILE A 1 525 ? -8.888  14.078 37.744  1.00 88.31  ? 569  ILE A O   1 
ATOM   3948 C CB  . ILE A 1 525 ? -10.423 11.794 39.042  1.00 89.05  ? 569  ILE A CB  1 
ATOM   3949 C CG1 . ILE A 1 525 ? -11.571 11.289 39.918  1.00 89.36  ? 569  ILE A CG1 1 
ATOM   3950 C CG2 . ILE A 1 525 ? -9.424  10.696 38.763  1.00 89.71  ? 569  ILE A CG2 1 
ATOM   3951 C CD1 . ILE A 1 525 ? -12.395 10.203 39.272  1.00 88.21  ? 569  ILE A CD1 1 
ATOM   3952 N N   . ASP A 1 526 ? -7.380  13.300 39.223  1.00 96.26  ? 570  ASP A N   1 
ATOM   3953 C CA  . ASP A 1 526 ? -6.238  13.598 38.371  1.00 95.88  ? 570  ASP A CA  1 
ATOM   3954 C C   . ASP A 1 526 ? -5.827  12.305 37.688  1.00 95.82  ? 570  ASP A C   1 
ATOM   3955 O O   . ASP A 1 526 ? -5.596  11.287 38.338  1.00 96.98  ? 570  ASP A O   1 
ATOM   3956 C CB  . ASP A 1 526 ? -5.076  14.193 39.176  1.00 97.17  ? 570  ASP A CB  1 
ATOM   3957 C CG  . ASP A 1 526 ? -4.082  14.983 38.309  1.00 96.32  ? 570  ASP A CG  1 
ATOM   3958 O OD1 . ASP A 1 526 ? -3.987  14.729 37.083  1.00 95.00  ? 570  ASP A OD1 1 
ATOM   3959 O OD2 . ASP A 1 526 ? -3.387  15.868 38.868  1.00 97.01  ? 570  ASP A OD2 1 
ATOM   3960 N N   . PHE A 1 527 ? -5.749  12.351 36.365  1.00 90.96  ? 571  PHE A N   1 
ATOM   3961 C CA  . PHE A 1 527 ? -5.345  11.199 35.564  1.00 90.11  ? 571  PHE A CA  1 
ATOM   3962 C C   . PHE A 1 527 ? -3.838  11.193 35.392  1.00 91.63  ? 571  PHE A C   1 
ATOM   3963 O O   . PHE A 1 527 ? -3.294  10.484 34.550  1.00 91.57  ? 571  PHE A O   1 
ATOM   3964 C CB  . PHE A 1 527 ? -6.078  11.181 34.229  1.00 88.32  ? 571  PHE A CB  1 
ATOM   3965 C CG  . PHE A 1 527 ? -7.422  10.546 34.325  1.00 86.64  ? 571  PHE A CG  1 
ATOM   3966 C CD1 . PHE A 1 527 ? -8.543  11.305 34.636  1.00 85.85  ? 571  PHE A CD1 1 
ATOM   3967 C CD2 . PHE A 1 527 ? -7.559  9.173  34.192  1.00 85.85  ? 571  PHE A CD2 1 
ATOM   3968 C CE1 . PHE A 1 527 ? -9.790  10.708 34.764  1.00 84.00  ? 571  PHE A CE1 1 
ATOM   3969 C CE2 . PHE A 1 527 ? -8.807  8.568  34.322  1.00 84.14  ? 571  PHE A CE2 1 
ATOM   3970 C CZ  . PHE A 1 527 ? -9.922  9.338  34.608  1.00 83.10  ? 571  PHE A CZ  1 
ATOM   3971 N N   . LYS A 1 528 ? -3.193  12.026 36.197  1.00 116.34 ? 572  LYS A N   1 
ATOM   3972 C CA  . LYS A 1 528 ? -1.764  12.274 36.144  1.00 117.40 ? 572  LYS A CA  1 
ATOM   3973 C C   . LYS A 1 528 ? -0.936  11.011 35.943  1.00 117.34 ? 572  LYS A C   1 
ATOM   3974 O O   . LYS A 1 528 ? -0.077  10.968 35.071  1.00 116.95 ? 572  LYS A O   1 
ATOM   3975 C CB  . LYS A 1 528 ? -1.353  12.963 37.447  1.00 119.10 ? 572  LYS A CB  1 
ATOM   3976 C CG  . LYS A 1 528 ? 0.105   12.918 37.767  1.00 121.15 ? 572  LYS A CG  1 
ATOM   3977 C CD  . LYS A 1 528 ? 0.399   13.675 39.058  1.00 122.36 ? 572  LYS A CD  1 
ATOM   3978 C CE  . LYS A 1 528 ? -0.775  13.644 40.034  1.00 121.10 ? 572  LYS A CE  1 
ATOM   3979 N NZ  . LYS A 1 528 ? -0.436  14.408 41.277  1.00 122.06 ? 572  LYS A NZ  1 
ATOM   3980 N N   . ASP A 1 529 ? -1.192  9.982  36.739  1.00 111.59 ? 573  ASP A N   1 
ATOM   3981 C CA  . ASP A 1 529 ? -0.425  8.753  36.615  1.00 111.78 ? 573  ASP A CA  1 
ATOM   3982 C C   . ASP A 1 529 ? -1.072  7.650  35.761  1.00 110.66 ? 573  ASP A C   1 
ATOM   3983 O O   . ASP A 1 529 ? -0.421  6.660  35.452  1.00 111.38 ? 573  ASP A O   1 
ATOM   3984 C CB  . ASP A 1 529 ? -0.092  8.226  38.014  1.00 114.01 ? 573  ASP A CB  1 
ATOM   3985 C CG  . ASP A 1 529 ? 0.711   9.240  38.848  1.00 116.43 ? 573  ASP A CG  1 
ATOM   3986 O OD1 . ASP A 1 529 ? 1.721   9.775  38.333  1.00 117.22 ? 573  ASP A OD1 1 
ATOM   3987 O OD2 . ASP A 1 529 ? 0.348   9.497  40.020  1.00 117.82 ? 573  ASP A OD2 1 
ATOM   3988 N N   . ILE A 1 530 ? -2.329  7.810  35.365  1.00 96.84  ? 574  ILE A N   1 
ATOM   3989 C CA  . ILE A 1 530 ? -2.935  6.872  34.410  1.00 95.58  ? 574  ILE A CA  1 
ATOM   3990 C C   . ILE A 1 530 ? -2.215  6.937  33.057  1.00 95.42  ? 574  ILE A C   1 
ATOM   3991 O O   . ILE A 1 530 ? -1.960  5.910  32.435  1.00 95.35  ? 574  ILE A O   1 
ATOM   3992 C CB  . ILE A 1 530 ? -4.458  7.142  34.200  1.00 93.99  ? 574  ILE A CB  1 
ATOM   3993 C CG1 . ILE A 1 530 ? -5.294  6.482  35.300  1.00 93.71  ? 574  ILE A CG1 1 
ATOM   3994 C CG2 . ILE A 1 530 ? -4.944  6.611  32.857  1.00 92.40  ? 574  ILE A CG2 1 
ATOM   3995 C CD1 . ILE A 1 530 ? -5.572  5.013  35.080  1.00 92.71  ? 574  ILE A CD1 1 
ATOM   3996 N N   . LEU A 1 531 ? -1.908  8.140  32.582  1.00 106.16 ? 575  LEU A N   1 
ATOM   3997 C CA  . LEU A 1 531 ? -0.987  8.257  31.460  1.00 106.08 ? 575  LEU A CA  1 
ATOM   3998 C C   . LEU A 1 531 ? 0.339   8.713  32.024  1.00 107.33 ? 575  LEU A C   1 
ATOM   3999 O O   . LEU A 1 531 ? 0.541   9.907  32.256  1.00 107.64 ? 575  LEU A O   1 
ATOM   4000 C CB  . LEU A 1 531 ? -1.492  9.259  30.415  1.00 105.02 ? 575  LEU A CB  1 
ATOM   4001 C CG  . LEU A 1 531 ? -2.930  9.124  29.903  1.00 103.66 ? 575  LEU A CG  1 
ATOM   4002 C CD1 . LEU A 1 531 ? -3.249  10.165 28.838  1.00 102.80 ? 575  LEU A CD1 1 
ATOM   4003 C CD2 . LEU A 1 531 ? -3.148  7.736  29.354  1.00 103.30 ? 575  LEU A CD2 1 
ATOM   4004 N N   . GLU A 1 532 ? 1.258   7.765  32.188  1.00 138.44 ? 576  GLU A N   1 
ATOM   4005 C CA  . GLU A 1 532 ? 2.511   8.022  32.879  1.00 140.09 ? 576  GLU A CA  1 
ATOM   4006 C C   . GLU A 1 532 ? 3.570   8.621  31.972  1.00 140.66 ? 576  GLU A C   1 
ATOM   4007 O O   . GLU A 1 532 ? 4.274   9.554  32.361  1.00 142.10 ? 576  GLU A O   1 
ATOM   4008 C CB  . GLU A 1 532 ? 3.037   6.734  33.515  1.00 144.33 ? 576  GLU A CB  1 
ATOM   4009 C CG  . GLU A 1 532 ? 3.224   5.575  32.549  1.00 144.35 ? 576  GLU A CG  1 
ATOM   4010 C CD  . GLU A 1 532 ? 4.278   4.592  33.023  1.00 149.92 ? 576  GLU A CD  1 
ATOM   4011 O OE1 . GLU A 1 532 ? 5.484   4.885  32.858  1.00 153.21 ? 576  GLU A OE1 1 
ATOM   4012 O OE2 . GLU A 1 532 ? 3.899   3.529  33.560  1.00 151.69 ? 576  GLU A OE2 1 
ATOM   4013 N N   . ARG A 1 533 ? 3.681   8.078  30.762  1.00 102.15 ? 577  ARG A N   1 
ATOM   4014 C CA  . ARG A 1 533 ? 4.744   8.488  29.855  1.00 103.12 ? 577  ARG A CA  1 
ATOM   4015 C C   . ARG A 1 533 ? 4.218   9.484  28.860  1.00 100.13 ? 577  ARG A C   1 
ATOM   4016 O O   . ARG A 1 533 ? 3.082   9.397  28.410  1.00 99.43  ? 577  ARG A O   1 
ATOM   4017 C CB  . ARG A 1 533 ? 5.364   7.299  29.116  1.00 105.54 ? 577  ARG A CB  1 
ATOM   4018 C CG  . ARG A 1 533 ? 4.438   6.559  28.190  1.00 102.42 ? 577  ARG A CG  1 
ATOM   4019 C CD  . ARG A 1 533 ? 5.204   5.615  27.276  1.00 105.32 ? 577  ARG A CD  1 
ATOM   4020 N NE  . ARG A 1 533 ? 4.319   5.049  26.266  1.00 102.53 ? 577  ARG A NE  1 
ATOM   4021 C CZ  . ARG A 1 533 ? 4.156   5.563  25.050  1.00 99.95  ? 577  ARG A CZ  1 
ATOM   4022 N NH1 . ARG A 1 533 ? 4.838   6.645  24.698  1.00 100.66 ? 577  ARG A NH1 1 
ATOM   4023 N NH2 . ARG A 1 533 ? 3.310   5.005  24.184  1.00 98.03  ? 577  ARG A NH2 1 
ATOM   4024 N N   . ASN A 1 534 ? 5.049   10.454 28.529  1.00 105.00 ? 578  ASN A N   1 
ATOM   4025 C CA  . ASN A 1 534 ? 4.672   11.442 27.557  1.00 103.63 ? 578  ASN A CA  1 
ATOM   4026 C C   . ASN A 1 534 ? 4.724   10.913 26.168  1.00 102.65 ? 578  ASN A C   1 
ATOM   4027 O O   . ASN A 1 534 ? 5.496   10.021 25.825  1.00 103.21 ? 578  ASN A O   1 
ATOM   4028 C CB  . ASN A 1 534 ? 5.560   12.669 27.651  1.00 103.50 ? 578  ASN A CB  1 
ATOM   4029 C CG  . ASN A 1 534 ? 5.459   13.338 28.985  1.00 104.52 ? 578  ASN A CG  1 
ATOM   4030 O OD1 . ASN A 1 534 ? 4.416   13.274 29.638  1.00 104.47 ? 578  ASN A OD1 1 
ATOM   4031 N ND2 . ASN A 1 534 ? 6.537   13.997 29.405  1.00 107.34 ? 578  ASN A ND2 1 
ATOM   4032 N N   . CYS A 1 535 ? 3.858   11.493 25.356  1.00 96.31  ? 579  CYS A N   1 
ATOM   4033 C CA  . CYS A 1 535 ? 3.883   11.286 23.915  1.00 95.19  ? 579  CYS A CA  1 
ATOM   4034 C C   . CYS A 1 535 ? 5.041   12.000 23.240  1.00 94.59  ? 579  CYS A C   1 
ATOM   4035 O O   . CYS A 1 535 ? 5.499   13.011 23.763  1.00 94.66  ? 579  CYS A O   1 
ATOM   4036 C CB  . CYS A 1 535 ? 2.542   11.721 23.313  1.00 93.88  ? 579  CYS A CB  1 
ATOM   4037 S SG  . CYS A 1 535 ? 1.045   10.691 23.745  1.00 94.48  ? 579  CYS A SG  1 
ATOM   4038 N N   . GLU A 1 536 ? 5.454   11.382 22.132  1.00 130.87 ? 580  GLU A N   1 
ATOM   4039 C CA  . GLU A 1 536 ? 6.574   11.720 21.271  1.00 130.54 ? 580  GLU A CA  1 
ATOM   4040 C C   . GLU A 1 536 ? 6.209   11.157 19.891  1.00 130.25 ? 580  GLU A C   1 
ATOM   4041 O O   . GLU A 1 536 ? 5.268   10.372 19.764  1.00 129.27 ? 580  GLU A O   1 
ATOM   4042 C CB  . GLU A 1 536 ? 7.865   11.088 21.785  1.00 134.75 ? 580  GLU A CB  1 
ATOM   4043 C CG  . GLU A 1 536 ? 7.852   9.568  21.792  1.00 137.31 ? 580  GLU A CG  1 
ATOM   4044 C CD  . GLU A 1 536 ? 9.100   8.978  22.419  1.00 140.74 ? 580  GLU A CD  1 
ATOM   4045 O OE1 . GLU A 1 536 ? 10.108  9.706  22.537  1.00 145.61 ? 580  GLU A OE1 1 
ATOM   4046 O OE2 . GLU A 1 536 ? 9.073   7.786  22.793  1.00 138.82 ? 580  GLU A OE2 1 
ATOM   4047 N N   . GLU A 1 537 ? 6.941   11.572 18.865  1.00 147.55 ? 581  GLU A N   1 
ATOM   4048 C CA  . GLU A 1 537 ? 6.568   11.386 17.465  1.00 146.72 ? 581  GLU A CA  1 
ATOM   4049 C C   . GLU A 1 537 ? 6.046   9.985  17.114  1.00 147.22 ? 581  GLU A C   1 
ATOM   4050 O O   . GLU A 1 537 ? 5.159   9.850  16.271  1.00 146.23 ? 581  GLU A O   1 
ATOM   4051 C CB  . GLU A 1 537 ? 7.744   11.744 16.551  1.00 150.01 ? 581  GLU A CB  1 
ATOM   4052 C CG  . GLU A 1 537 ? 8.965   10.859 16.736  1.00 149.83 ? 581  GLU A CG  1 
ATOM   4053 C CD  . GLU A 1 537 ? 10.147  11.317 15.904  1.00 150.70 ? 581  GLU A CD  1 
ATOM   4054 O OE1 . GLU A 1 537 ? 9.938   12.090 14.945  1.00 154.38 ? 581  GLU A OE1 1 
ATOM   4055 O OE2 . GLU A 1 537 ? 11.286  10.903 16.209  1.00 148.00 ? 581  GLU A OE2 1 
ATOM   4056 N N   . LYS A 1 538 ? 6.585   8.995  17.797  1.00 132.11 ? 582  LYS A N   1 
ATOM   4057 C CA  . LYS A 1 538 ? 6.390   7.608  17.442  1.00 132.39 ? 582  LYS A CA  1 
ATOM   4058 C C   . LYS A 1 538 ? 4.964   7.192  17.536  1.00 132.00 ? 582  LYS A C   1 
ATOM   4059 O O   . LYS A 1 538 ? 4.510   6.366  16.779  1.00 133.46 ? 582  LYS A O   1 
ATOM   4060 C CB  . LYS A 1 538 ? 7.213   6.710  18.349  1.00 132.63 ? 582  LYS A CB  1 
ATOM   4061 C CG  . LYS A 1 538 ? 7.115   5.240  17.989  1.00 127.95 ? 582  LYS A CG  1 
ATOM   4062 C CD  . LYS A 1 538 ? 7.996   4.400  18.898  1.00 127.82 ? 582  LYS A CD  1 
ATOM   4063 C CE  . LYS A 1 538 ? 7.897   2.913  18.573  1.00 121.54 ? 582  LYS A CE  1 
ATOM   4064 N NZ  . LYS A 1 538 ? 8.755   2.074  19.456  1.00 120.27 ? 582  LYS A NZ  1 
ATOM   4065 N N   . ASP A 1 539 ? 4.288   7.706  18.539  1.00 95.45  ? 583  ASP A N   1 
ATOM   4066 C CA  . ASP A 1 539 ? 2.896   7.404  18.768  1.00 95.53  ? 583  ASP A CA  1 
ATOM   4067 C C   . ASP A 1 539 ? 1.949   7.886  17.685  1.00 93.93  ? 583  ASP A C   1 
ATOM   4068 O O   . ASP A 1 539 ? 0.968   7.236  17.396  1.00 93.80  ? 583  ASP A O   1 
ATOM   4069 C CB  . ASP A 1 539 ? 2.489   7.938  20.113  1.00 95.59  ? 583  ASP A CB  1 
ATOM   4070 C CG  . ASP A 1 539 ? 3.091   7.160  21.229  1.00 97.34  ? 583  ASP A CG  1 
ATOM   4071 O OD1 . ASP A 1 539 ? 3.582   6.057  20.970  1.00 99.81  ? 583  ASP A OD1 1 
ATOM   4072 O OD2 . ASP A 1 539 ? 3.076   7.652  22.361  1.00 96.25  ? 583  ASP A OD2 1 
ATOM   4073 N N   . TYR A 1 540 ? 2.228   9.048  17.123  1.00 82.23  ? 584  TYR A N   1 
ATOM   4074 C CA  . TYR A 1 540 ? 1.406   9.631  16.083  1.00 80.69  ? 584  TYR A CA  1 
ATOM   4075 C C   . TYR A 1 540 ? 1.485   8.942  14.755  1.00 81.50  ? 584  TYR A C   1 
ATOM   4076 O O   . TYR A 1 540 ? 2.433   8.267  14.471  1.00 82.92  ? 584  TYR A O   1 
ATOM   4077 C CB  . TYR A 1 540 ? 1.785   11.069 15.923  1.00 78.75  ? 584  TYR A CB  1 
ATOM   4078 C CG  . TYR A 1 540 ? 1.770   11.759 17.233  1.00 78.39  ? 584  TYR A CG  1 
ATOM   4079 C CD1 . TYR A 1 540 ? 0.631   12.338 17.701  1.00 77.43  ? 584  TYR A CD1 1 
ATOM   4080 C CD2 . TYR A 1 540 ? 2.878   11.802 18.014  1.00 79.29  ? 584  TYR A CD2 1 
ATOM   4081 C CE1 . TYR A 1 540 ? 0.598   12.965 18.911  1.00 77.55  ? 584  TYR A CE1 1 
ATOM   4082 C CE2 . TYR A 1 540 ? 2.853   12.428 19.225  1.00 79.39  ? 584  TYR A CE2 1 
ATOM   4083 C CZ  . TYR A 1 540 ? 1.703   13.003 19.662  1.00 78.61  ? 584  TYR A CZ  1 
ATOM   4084 O OH  . TYR A 1 540 ? 1.656   13.635 20.859  1.00 79.07  ? 584  TYR A OH  1 
ATOM   4085 N N   . THR A 1 541 ? 0.460   9.110  13.942  1.00 75.36  ? 585  THR A N   1 
ATOM   4086 C CA  . THR A 1 541 ? 0.391   8.416  12.686  1.00 76.55  ? 585  THR A CA  1 
ATOM   4087 C C   . THR A 1 541 ? -0.172  9.394  11.673  1.00 74.80  ? 585  THR A C   1 
ATOM   4088 O O   . THR A 1 541 ? -0.798  10.378 12.035  1.00 72.81  ? 585  THR A O   1 
ATOM   4089 C CB  . THR A 1 541 ? -0.454  7.122  12.802  1.00 78.47  ? 585  THR A CB  1 
ATOM   4090 O OG1 . THR A 1 541 ? -0.135  6.241  11.716  1.00 80.35  ? 585  THR A OG1 1 
ATOM   4091 C CG2 . THR A 1 541 ? -1.942  7.421  12.833  1.00 77.65  ? 585  THR A CG2 1 
ATOM   4092 N N   . ILE A 1 542 ? 0.122   9.153  10.406  1.00 77.91  ? 586  ILE A N   1 
ATOM   4093 C CA  . ILE A 1 542 ? -0.261  10.064 9.339   1.00 76.36  ? 586  ILE A CA  1 
ATOM   4094 C C   . ILE A 1 542 ? -1.737  9.829  9.004   1.00 76.52  ? 586  ILE A C   1 
ATOM   4095 O O   . ILE A 1 542 ? -2.129  8.711  8.710   1.00 78.98  ? 586  ILE A O   1 
ATOM   4096 C CB  . ILE A 1 542 ? 0.649   9.860  8.101   1.00 77.69  ? 586  ILE A CB  1 
ATOM   4097 C CG1 . ILE A 1 542 ? 2.075   9.707  8.564   1.00 78.23  ? 586  ILE A CG1 1 
ATOM   4098 C CG2 . ILE A 1 542 ? 0.571   11.029 7.179   1.00 76.07  ? 586  ILE A CG2 1 
ATOM   4099 C CD1 . ILE A 1 542 ? 3.113   9.601  7.433   1.00 79.66  ? 586  ILE A CD1 1 
ATOM   4100 N N   . TRP A 1 543 ? -2.555  10.869 9.100   1.00 60.13  ? 587  TRP A N   1 
ATOM   4101 C CA  . TRP A 1 543 ? -3.987  10.755 8.798   1.00 59.89  ? 587  TRP A CA  1 
ATOM   4102 C C   . TRP A 1 543 ? -4.469  11.793 7.826   1.00 57.38  ? 587  TRP A C   1 
ATOM   4103 O O   . TRP A 1 543 ? -4.529  12.962 8.180   1.00 54.12  ? 587  TRP A O   1 
ATOM   4104 C CB  . TRP A 1 543 ? -4.808  10.912 10.061  1.00 58.93  ? 587  TRP A CB  1 
ATOM   4105 C CG  . TRP A 1 543 ? -6.330  10.728 9.876   1.00 59.34  ? 587  TRP A CG  1 
ATOM   4106 C CD1 . TRP A 1 543 ? -6.963  9.582  9.525   1.00 62.73  ? 587  TRP A CD1 1 
ATOM   4107 C CD2 . TRP A 1 543 ? -7.364  11.711 10.078  1.00 56.11  ? 587  TRP A CD2 1 
ATOM   4108 N NE1 . TRP A 1 543 ? -8.304  9.781  9.486   1.00 62.57  ? 587  TRP A NE1 1 
ATOM   4109 C CE2 . TRP A 1 543 ? -8.587  11.073 9.832   1.00 57.89  ? 587  TRP A CE2 1 
ATOM   4110 C CE3 . TRP A 1 543 ? -7.364  13.063 10.439  1.00 51.83  ? 587  TRP A CE3 1 
ATOM   4111 C CZ2 . TRP A 1 543 ? -9.821  11.733 9.928   1.00 54.32  ? 587  TRP A CZ2 1 
ATOM   4112 C CZ3 . TRP A 1 543 ? -8.560  13.726 10.535  1.00 48.80  ? 587  TRP A CZ3 1 
ATOM   4113 C CH2 . TRP A 1 543 ? -9.801  13.054 10.279  1.00 49.57  ? 587  TRP A CH2 1 
ATOM   4114 N N   . LEU A 1 544 ? -4.853  11.388 6.623   1.00 56.57  ? 588  LEU A N   1 
ATOM   4115 C CA  . LEU A 1 544 ? -5.501  12.335 5.702   1.00 54.27  ? 588  LEU A CA  1 
ATOM   4116 C C   . LEU A 1 544 ? -6.965  12.575 6.109   1.00 52.39  ? 588  LEU A C   1 
ATOM   4117 O O   . LEU A 1 544 ? -7.764  11.633 6.167   1.00 54.99  ? 588  LEU A O   1 
ATOM   4118 C CB  . LEU A 1 544 ? -5.424  11.812 4.261   1.00 57.10  ? 588  LEU A CB  1 
ATOM   4119 C CG  . LEU A 1 544 ? -6.206  12.595 3.210   1.00 55.79  ? 588  LEU A CG  1 
ATOM   4120 C CD1 . LEU A 1 544 ? -5.720  14.033 3.160   1.00 52.88  ? 588  LEU A CD1 1 
ATOM   4121 C CD2 . LEU A 1 544 ? -6.071  11.951 1.857   1.00 59.74  ? 588  LEU A CD2 1 
ATOM   4122 N N   . ALA A 1 545 ? -7.317  13.825 6.411   1.00 58.13  ? 589  ALA A N   1 
ATOM   4123 C CA  . ALA A 1 545 ? -8.717  14.168 6.734   1.00 55.73  ? 589  ALA A CA  1 
ATOM   4124 C C   . ALA A 1 545 ? -9.551  14.111 5.480   1.00 56.38  ? 589  ALA A C   1 
ATOM   4125 O O   . ALA A 1 545 ? -9.027  14.249 4.372   1.00 57.82  ? 589  ALA A O   1 
ATOM   4126 C CB  . ALA A 1 545 ? -8.824  15.541 7.349   1.00 51.61  ? 589  ALA A CB  1 
ATOM   4127 N N   . HIS A 1 546 ? -10.855 13.915 5.669   1.00 57.84  ? 590  HIS A N   1 
ATOM   4128 C CA  . HIS A 1 546 ? -11.833 13.928 4.601   1.00 58.06  ? 590  HIS A CA  1 
ATOM   4129 C C   . HIS A 1 546 ? -11.580 12.857 3.540   1.00 63.18  ? 590  HIS A C   1 
ATOM   4130 O O   . HIS A 1 546 ? -11.973 13.034 2.397   1.00 64.18  ? 590  HIS A O   1 
ATOM   4131 C CB  . HIS A 1 546 ? -11.865 15.314 3.962   1.00 55.55  ? 590  HIS A CB  1 
ATOM   4132 C CG  . HIS A 1 546 ? -12.504 16.370 4.818   1.00 51.64  ? 590  HIS A CG  1 
ATOM   4133 N ND1 . HIS A 1 546 ? -13.876 16.423 5.063   1.00 50.10  ? 590  HIS A ND1 1 
ATOM   4134 C CD2 . HIS A 1 546 ? -11.968 17.436 5.460   1.00 49.57  ? 590  HIS A CD2 1 
ATOM   4135 C CE1 . HIS A 1 546 ? -14.143 17.471 5.823   1.00 47.51  ? 590  HIS A CE1 1 
ATOM   4136 N NE2 . HIS A 1 546 ? -13.002 18.103 6.080   1.00 47.31  ? 590  HIS A NE2 1 
ATOM   4137 N N   . SER A 1 547 ? -11.014 11.716 3.881   1.00 47.89  ? 591  SER A N   1 
ATOM   4138 C CA  . SER A 1 547 ? -10.747 10.744 2.834   1.00 53.74  ? 591  SER A CA  1 
ATOM   4139 C C   . SER A 1 547 ? -11.907 9.859  2.459   1.00 56.42  ? 591  SER A C   1 
ATOM   4140 O O   . SER A 1 547 ? -12.439 9.129  3.263   1.00 56.00  ? 591  SER A O   1 
ATOM   4141 C CB  . SER A 1 547 ? -9.572  9.861  3.195   1.00 57.65  ? 591  SER A CB  1 
ATOM   4142 O OG  . SER A 1 547 ? -9.366  8.903  2.186   1.00 62.29  ? 591  SER A OG  1 
ATOM   4143 N N   . THR A 1 548 ? -12.274 9.928  1.195   1.00 80.01  ? 592  THR A N   1 
ATOM   4144 C CA  . THR A 1 548 ? -13.328 9.119  0.640   1.00 81.32  ? 592  THR A CA  1 
ATOM   4145 C C   . THR A 1 548 ? -12.820 7.986  -0.217  1.00 87.83  ? 592  THR A C   1 
ATOM   4146 O O   . THR A 1 548 ? -13.287 6.872  -0.116  1.00 87.88  ? 592  THR A O   1 
ATOM   4147 C CB  . THR A 1 548 ? -14.196 9.973  -0.261  1.00 78.09  ? 592  THR A CB  1 
ATOM   4148 O OG1 . THR A 1 548 ? -14.774 11.017 0.510   1.00 71.78  ? 592  THR A OG1 1 
ATOM   4149 C CG2 . THR A 1 548 ? -15.284 9.157  -0.859  1.00 78.90  ? 592  THR A CG2 1 
ATOM   4150 N N   . ASP A 1 549 ? -11.884 8.294  -1.101  1.00 118.78 ? 593  ASP A N   1 
ATOM   4151 C CA  . ASP A 1 549 ? -11.375 7.318  -2.045  1.00 122.05 ? 593  ASP A CA  1 
ATOM   4152 C C   . ASP A 1 549 ? -9.863  7.403  -2.182  1.00 121.49 ? 593  ASP A C   1 
ATOM   4153 O O   . ASP A 1 549 ? -9.361  8.273  -2.849  1.00 120.65 ? 593  ASP A O   1 
ATOM   4154 C CB  . ASP A 1 549 ? -12.030 7.622  -3.379  1.00 123.50 ? 593  ASP A CB  1 
ATOM   4155 C CG  . ASP A 1 549 ? -11.676 6.639  -4.436  1.00 125.38 ? 593  ASP A CG  1 
ATOM   4156 O OD1 . ASP A 1 549 ? -10.927 5.690  -4.145  1.00 125.70 ? 593  ASP A OD1 1 
ATOM   4157 O OD2 . ASP A 1 549 ? -12.166 6.813  -5.565  1.00 126.46 ? 593  ASP A OD2 1 
ATOM   4158 N N   . PRO A 1 550 ? -9.143  6.452  -1.621  1.00 97.86  ? 594  PRO A N   1 
ATOM   4159 C CA  . PRO A 1 550 ? -7.675  6.552  -1.505  1.00 96.74  ? 594  PRO A CA  1 
ATOM   4160 C C   . PRO A 1 550 ? -6.993  6.839  -2.840  1.00 98.34  ? 594  PRO A C   1 
ATOM   4161 O O   . PRO A 1 550 ? -6.021  7.592  -2.898  1.00 96.90  ? 594  PRO A O   1 
ATOM   4162 C CB  . PRO A 1 550 ? -7.252  5.174  -0.981  1.00 97.28  ? 594  PRO A CB  1 
ATOM   4163 C CG  . PRO A 1 550 ? -8.254  4.243  -1.539  1.00 97.03  ? 594  PRO A CG  1 
ATOM   4164 C CD  . PRO A 1 550 ? -9.519  4.991  -1.277  1.00 98.03  ? 594  PRO A CD  1 
ATOM   4165 N N   . GLU A 1 551 ? -7.502  6.216  -3.897  1.00 126.33 ? 595  GLU A N   1 
ATOM   4166 C CA  . GLU A 1 551 ? -6.798  6.122  -5.178  1.00 128.19 ? 595  GLU A CA  1 
ATOM   4167 C C   . GLU A 1 551 ? -6.740  7.460  -5.912  1.00 127.18 ? 595  GLU A C   1 
ATOM   4168 O O   . GLU A 1 551 ? -6.032  7.612  -6.902  1.00 128.18 ? 595  GLU A O   1 
ATOM   4169 C CB  . GLU A 1 551 ? -7.477  5.081  -6.082  1.00 131.00 ? 595  GLU A CB  1 
ATOM   4170 C CG  . GLU A 1 551 ? -7.417  3.638  -5.584  1.00 131.91 ? 595  GLU A CG  1 
ATOM   4171 C CD  . GLU A 1 551 ? -6.044  2.988  -5.781  1.00 133.90 ? 595  GLU A CD  1 
ATOM   4172 O OE1 . GLU A 1 551 ? -5.121  3.650  -6.309  1.00 134.32 ? 595  GLU A OE1 1 
ATOM   4173 O OE2 . GLU A 1 551 ? -5.889  1.803  -5.412  1.00 134.88 ? 595  GLU A OE2 1 
ATOM   4174 N N   . ASP A 1 552 ? -7.490  8.429  -5.412  1.00 101.09 ? 596  ASP A N   1 
ATOM   4175 C CA  . ASP A 1 552 ? -7.818  9.628  -6.169  1.00 100.23 ? 596  ASP A CA  1 
ATOM   4176 C C   . ASP A 1 552 ? -6.877  10.793 -5.907  1.00 96.70  ? 596  ASP A C   1 
ATOM   4177 O O   . ASP A 1 552 ? -6.576  11.119 -4.762  1.00 93.55  ? 596  ASP A O   1 
ATOM   4178 C CB  . ASP A 1 552 ? -9.252  10.056 -5.855  1.00 99.88  ? 596  ASP A CB  1 
ATOM   4179 C CG  . ASP A 1 552 ? -9.962  10.640 -7.048  1.00 101.05 ? 596  ASP A CG  1 
ATOM   4180 O OD1 . ASP A 1 552 ? -9.321  10.801 -8.103  1.00 102.44 ? 596  ASP A OD1 1 
ATOM   4181 O OD2 . ASP A 1 552 ? -11.167 10.953 -6.932  1.00 100.53 ? 596  ASP A OD2 1 
ATOM   4182 N N   . TYR A 1 553 ? -6.429  11.422 -6.985  1.00 79.57  ? 597  TYR A N   1 
ATOM   4183 C CA  . TYR A 1 553 ? -5.643  12.639 -6.909  1.00 76.52  ? 597  TYR A CA  1 
ATOM   4184 C C   . TYR A 1 553 ? -6.290  13.699 -6.028  1.00 72.38  ? 597  TYR A C   1 
ATOM   4185 O O   . TYR A 1 553 ? -5.612  14.385 -5.260  1.00 69.31  ? 597  TYR A O   1 
ATOM   4186 C CB  . TYR A 1 553 ? -5.447  13.203 -8.301  1.00 78.13  ? 597  TYR A CB  1 
ATOM   4187 C CG  . TYR A 1 553 ? -4.322  14.194 -8.439  1.00 76.40  ? 597  TYR A CG  1 
ATOM   4188 C CD1 . TYR A 1 553 ? -3.056  13.920 -7.924  1.00 75.91  ? 597  TYR A CD1 1 
ATOM   4189 C CD2 . TYR A 1 553 ? -4.501  15.370 -9.146  1.00 75.85  ? 597  TYR A CD2 1 
ATOM   4190 C CE1 . TYR A 1 553 ? -2.024  14.806 -8.076  1.00 74.77  ? 597  TYR A CE1 1 
ATOM   4191 C CE2 . TYR A 1 553 ? -3.476  16.267 -9.307  1.00 74.83  ? 597  TYR A CE2 1 
ATOM   4192 C CZ  . TYR A 1 553 ? -2.240  15.980 -8.772  1.00 74.25  ? 597  TYR A CZ  1 
ATOM   4193 O OH  . TYR A 1 553 ? -1.205  16.869 -8.954  1.00 73.54  ? 597  TYR A OH  1 
ATOM   4194 N N   . GLU A 1 554 ? -7.608  13.836 -6.148  1.00 93.54  ? 598  GLU A N   1 
ATOM   4195 C CA  . GLU A 1 554 ? -8.315  14.933 -5.512  1.00 89.46  ? 598  GLU A CA  1 
ATOM   4196 C C   . GLU A 1 554 ? -8.884  14.542 -4.165  1.00 87.10  ? 598  GLU A C   1 
ATOM   4197 O O   . GLU A 1 554 ? -9.615  15.299 -3.556  1.00 83.58  ? 598  GLU A O   1 
ATOM   4198 C CB  . GLU A 1 554 ? -9.405  15.438 -6.440  1.00 90.42  ? 598  GLU A CB  1 
ATOM   4199 C CG  . GLU A 1 554 ? -8.846  15.848 -7.805  1.00 94.13  ? 598  GLU A CG  1 
ATOM   4200 C CD  . GLU A 1 554 ? -9.155  17.301 -8.157  1.00 95.64  ? 598  GLU A CD  1 
ATOM   4201 O OE1 . GLU A 1 554 ? -9.760  18.010 -7.309  1.00 94.07  ? 598  GLU A OE1 1 
ATOM   4202 O OE2 . GLU A 1 554 ? -8.785  17.730 -9.274  1.00 98.46  ? 598  GLU A OE2 1 
ATOM   4203 N N   . ASP A 1 555 ? -8.547  13.347 -3.706  1.00 61.08  ? 599  ASP A N   1 
ATOM   4204 C CA  . ASP A 1 555 ? -9.104  12.827 -2.471  1.00 59.49  ? 599  ASP A CA  1 
ATOM   4205 C C   . ASP A 1 555 ? -8.843  13.713 -1.266  1.00 54.24  ? 599  ASP A C   1 
ATOM   4206 O O   . ASP A 1 555 ? -7.705  14.082 -0.965  1.00 53.17  ? 599  ASP A O   1 
ATOM   4207 C CB  . ASP A 1 555 ? -8.570  11.431 -2.162  1.00 63.19  ? 599  ASP A CB  1 
ATOM   4208 C CG  . ASP A 1 555 ? -9.264  10.808 -0.947  1.00 62.72  ? 599  ASP A CG  1 
ATOM   4209 O OD1 . ASP A 1 555 ? -10.521 10.755 -0.937  1.00 62.90  ? 599  ASP A OD1 1 
ATOM   4210 O OD2 . ASP A 1 555 ? -8.583  10.397 0.019   1.00 62.08  ? 599  ASP A OD2 1 
ATOM   4211 N N   . GLY A 1 556 ? -9.916  14.022 -0.547  1.00 52.26  ? 600  GLY A N   1 
ATOM   4212 C CA  . GLY A 1 556 ? -9.809  14.816 0.647   1.00 47.96  ? 600  GLY A CA  1 
ATOM   4213 C C   . GLY A 1 556 ? -9.681  16.291 0.372   1.00 47.38  ? 600  GLY A C   1 
ATOM   4214 O O   . GLY A 1 556 ? -9.414  17.018 1.307   1.00 46.16  ? 600  GLY A O   1 
ATOM   4215 N N   . CYS A 1 557 ? -9.873  16.752 -0.868  1.00 77.18  ? 601  CYS A N   1 
ATOM   4216 C CA  . CYS A 1 557 ? -9.982  18.196 -1.068  1.00 75.79  ? 601  CYS A CA  1 
ATOM   4217 C C   . CYS A 1 557 ? -11.335 18.669 -0.541  1.00 73.28  ? 601  CYS A C   1 
ATOM   4218 O O   . CYS A 1 557 ? -12.388 18.272 -1.015  1.00 73.97  ? 601  CYS A O   1 
ATOM   4219 C CB  . CYS A 1 557 ? -9.859  18.599 -2.530  1.00 78.84  ? 601  CYS A CB  1 
ATOM   4220 S SG  . CYS A 1 557 ? -8.351  18.069 -3.334  1.00 82.07  ? 601  CYS A SG  1 
ATOM   4221 N N   . ILE A 1 558 ? -11.277 19.535 0.447   1.00 58.31  ? 602  ILE A N   1 
ATOM   4222 C CA  . ILE A 1 558 ? -12.410 20.273 0.897   1.00 56.53  ? 602  ILE A CA  1 
ATOM   4223 C C   . ILE A 1 558 ? -12.047 21.740 0.854   1.00 57.04  ? 602  ILE A C   1 
ATOM   4224 O O   . ILE A 1 558 ? -11.119 22.184 1.555   1.00 56.25  ? 602  ILE A O   1 
ATOM   4225 C CB  . ILE A 1 558 ? -12.816 19.891 2.323   1.00 53.50  ? 602  ILE A CB  1 
ATOM   4226 C CG1 . ILE A 1 558 ? -13.493 18.513 2.318   1.00 53.66  ? 602  ILE A CG1 1 
ATOM   4227 C CG2 . ILE A 1 558 ? -13.725 20.980 2.905   1.00 52.08  ? 602  ILE A CG2 1 
ATOM   4228 C CD1 . ILE A 1 558 ? -14.810 18.453 1.566   1.00 54.31  ? 602  ILE A CD1 1 
ATOM   4229 N N   . LEU A 1 559 ? -12.779 22.479 0.034   1.00 52.35  ? 603  LEU A N   1 
ATOM   4230 C CA  . LEU A 1 559 ? -12.574 23.903 -0.116  1.00 54.06  ? 603  LEU A CA  1 
ATOM   4231 C C   . LEU A 1 559 ? -11.192 24.101 -0.700  1.00 55.98  ? 603  LEU A C   1 
ATOM   4232 O O   . LEU A 1 559 ? -10.454 24.995 -0.321  1.00 56.71  ? 603  LEU A O   1 
ATOM   4233 C CB  . LEU A 1 559 ? -12.776 24.652 1.215   1.00 52.63  ? 603  LEU A CB  1 
ATOM   4234 C CG  . LEU A 1 559 ? -14.221 25.225 1.378   1.00 52.82  ? 603  LEU A CG  1 
ATOM   4235 C CD1 . LEU A 1 559 ? -15.332 24.174 1.312   1.00 50.73  ? 603  LEU A CD1 1 
ATOM   4236 C CD2 . LEU A 1 559 ? -14.387 26.070 2.630   1.00 52.66  ? 603  LEU A CD2 1 
ATOM   4237 N N   . GLY A 1 560 ? -10.860 23.267 -1.669  1.00 52.88  ? 604  GLY A N   1 
ATOM   4238 C CA  . GLY A 1 560 ? -9.693  23.537 -2.477  1.00 55.35  ? 604  GLY A CA  1 
ATOM   4239 C C   . GLY A 1 560 ? -8.380  22.976 -1.957  1.00 54.41  ? 604  GLY A C   1 
ATOM   4240 O O   . GLY A 1 560 ? -7.349  23.133 -2.605  1.00 56.32  ? 604  GLY A O   1 
ATOM   4241 N N   . TYR A 1 561 ? -8.417  22.321 -0.798  1.00 60.53  ? 605  TYR A N   1 
ATOM   4242 C CA  . TYR A 1 561 ? -7.204  21.732 -0.279  1.00 59.99  ? 605  TYR A CA  1 
ATOM   4243 C C   . TYR A 1 561 ? -7.374  20.557 0.683   1.00 58.12  ? 605  TYR A C   1 
ATOM   4244 O O   . TYR A 1 561 ? -8.439  20.348 1.268   1.00 56.38  ? 605  TYR A O   1 
ATOM   4245 C CB  . TYR A 1 561 ? -6.380  22.817 0.376   1.00 59.35  ? 605  TYR A CB  1 
ATOM   4246 C CG  . TYR A 1 561 ? -6.880  23.457 1.651   1.00 57.15  ? 605  TYR A CG  1 
ATOM   4247 C CD1 . TYR A 1 561 ? -7.869  24.453 1.641   1.00 57.67  ? 605  TYR A CD1 1 
ATOM   4248 C CD2 . TYR A 1 561 ? -6.286  23.141 2.862   1.00 55.29  ? 605  TYR A CD2 1 
ATOM   4249 C CE1 . TYR A 1 561 ? -8.264  25.082 2.819   1.00 56.42  ? 605  TYR A CE1 1 
ATOM   4250 C CE2 . TYR A 1 561 ? -6.671  23.747 4.033   1.00 53.88  ? 605  TYR A CE2 1 
ATOM   4251 C CZ  . TYR A 1 561 ? -7.648  24.717 4.013   1.00 54.47  ? 605  TYR A CZ  1 
ATOM   4252 O OH  . TYR A 1 561 ? -7.961  25.310 5.214   1.00 53.74  ? 605  TYR A OH  1 
ATOM   4253 N N   . LYS A 1 562 ? -6.306  19.780 0.820   1.00 56.63  ? 606  LYS A N   1 
ATOM   4254 C CA  . LYS A 1 562 ? -6.296  18.623 1.715   1.00 55.74  ? 606  LYS A CA  1 
ATOM   4255 C C   . LYS A 1 562 ? -5.536  18.978 2.984   1.00 53.93  ? 606  LYS A C   1 
ATOM   4256 O O   . LYS A 1 562 ? -4.630  19.834 2.944   1.00 54.20  ? 606  LYS A O   1 
ATOM   4257 C CB  . LYS A 1 562 ? -5.634  17.406 1.064   1.00 58.79  ? 606  LYS A CB  1 
ATOM   4258 C CG  . LYS A 1 562 ? -5.694  17.369 -0.442  1.00 61.85  ? 606  LYS A CG  1 
ATOM   4259 C CD  . LYS A 1 562 ? -4.879  16.202 -0.969  1.00 65.16  ? 606  LYS A CD  1 
ATOM   4260 C CE  . LYS A 1 562 ? -5.273  15.858 -2.395  1.00 68.52  ? 606  LYS A CE  1 
ATOM   4261 N NZ  . LYS A 1 562 ? -5.233  14.386 -2.615  1.00 71.61  ? 606  LYS A NZ  1 
ATOM   4262 N N   . GLU A 1 563 ? -5.909  18.354 4.095   1.00 62.73  ? 607  GLU A N   1 
ATOM   4263 C CA  . GLU A 1 563 ? -5.068  18.361 5.265   1.00 62.17  ? 607  GLU A CA  1 
ATOM   4264 C C   . GLU A 1 563 ? -4.711  16.960 5.698   1.00 63.99  ? 607  GLU A C   1 
ATOM   4265 O O   . GLU A 1 563 ? -5.576  16.089 5.866   1.00 64.56  ? 607  GLU A O   1 
ATOM   4266 C CB  . GLU A 1 563 ? -5.721  19.101 6.407   1.00 59.85  ? 607  GLU A CB  1 
ATOM   4267 C CG  . GLU A 1 563 ? -5.721  20.597 6.198   1.00 59.19  ? 607  GLU A CG  1 
ATOM   4268 C CD  . GLU A 1 563 ? -6.478  21.354 7.286   1.00 57.60  ? 607  GLU A CD  1 
ATOM   4269 O OE1 . GLU A 1 563 ? -7.544  20.851 7.733   1.00 56.36  ? 607  GLU A OE1 1 
ATOM   4270 O OE2 . GLU A 1 563 ? -6.024  22.447 7.697   1.00 58.10  ? 607  GLU A OE2 1 
ATOM   4271 N N   . GLN A 1 564 ? -3.403  16.757 5.844   1.00 69.41  ? 608  GLN A N   1 
ATOM   4272 C CA  . GLN A 1 564 ? -2.842  15.580 6.505   1.00 71.54  ? 608  GLN A CA  1 
ATOM   4273 C C   . GLN A 1 564 ? -2.319  15.920 7.877   1.00 70.85  ? 608  GLN A C   1 
ATOM   4274 O O   . GLN A 1 564 ? -1.541  16.844 8.059   1.00 70.14  ? 608  GLN A O   1 
ATOM   4275 C CB  . GLN A 1 564 ? -1.735  14.965 5.684   1.00 74.19  ? 608  GLN A CB  1 
ATOM   4276 C CG  . GLN A 1 564 ? -2.292  14.058 4.658   1.00 76.33  ? 608  GLN A CG  1 
ATOM   4277 C CD  . GLN A 1 564 ? -1.268  13.112 4.158   1.00 79.51  ? 608  GLN A CD  1 
ATOM   4278 O OE1 . GLN A 1 564 ? -0.136  13.089 4.656   1.00 79.83  ? 608  GLN A OE1 1 
ATOM   4279 N NE2 . GLN A 1 564 ? -1.645  12.309 3.158   1.00 82.12  ? 608  GLN A NE2 1 
ATOM   4280 N N   . PHE A 1 565 ? -2.766  15.118 8.821   1.00 58.67  ? 609  PHE A N   1 
ATOM   4281 C CA  . PHE A 1 565 ? -2.631  15.344 10.239  1.00 58.36  ? 609  PHE A CA  1 
ATOM   4282 C C   . PHE A 1 565 ? -1.670  14.329 10.762  1.00 61.19  ? 609  PHE A C   1 
ATOM   4283 O O   . PHE A 1 565 ? -1.470  13.281 10.133  1.00 63.38  ? 609  PHE A O   1 
ATOM   4284 C CB  . PHE A 1 565 ? -3.972  15.178 10.944  1.00 57.64  ? 609  PHE A CB  1 
ATOM   4285 C CG  . PHE A 1 565 ? -4.862  16.357 10.809  1.00 54.48  ? 609  PHE A CG  1 
ATOM   4286 C CD1 . PHE A 1 565 ? -5.567  16.585 9.625   1.00 53.20  ? 609  PHE A CD1 1 
ATOM   4287 C CD2 . PHE A 1 565 ? -4.995  17.259 11.853  1.00 53.26  ? 609  PHE A CD2 1 
ATOM   4288 C CE1 . PHE A 1 565 ? -6.378  17.684 9.495   1.00 50.57  ? 609  PHE A CE1 1 
ATOM   4289 C CE2 . PHE A 1 565 ? -5.822  18.363 11.716  1.00 50.84  ? 609  PHE A CE2 1 
ATOM   4290 C CZ  . PHE A 1 565 ? -6.504  18.577 10.534  1.00 49.43  ? 609  PHE A CZ  1 
ATOM   4291 N N   . LEU A 1 566 ? -1.019  14.653 11.869  1.00 64.30  ? 610  LEU A N   1 
ATOM   4292 C CA  . LEU A 1 566 ? -0.345  13.629 12.645  1.00 66.89  ? 610  LEU A CA  1 
ATOM   4293 C C   . LEU A 1 566 ? -1.285  13.466 13.809  1.00 67.16  ? 610  LEU A C   1 
ATOM   4294 O O   . LEU A 1 566 ? -1.749  14.450 14.394  1.00 65.57  ? 610  LEU A O   1 
ATOM   4295 C CB  . LEU A 1 566 ? 1.077   14.011 13.064  1.00 67.44  ? 610  LEU A CB  1 
ATOM   4296 C CG  . LEU A 1 566 ? 2.206   13.793 12.033  1.00 68.32  ? 610  LEU A CG  1 
ATOM   4297 C CD1 . LEU A 1 566 ? 3.586   14.106 12.630  1.00 69.97  ? 610  LEU A CD1 1 
ATOM   4298 C CD2 . LEU A 1 566 ? 2.233   12.397 11.390  1.00 70.58  ? 610  LEU A CD2 1 
ATOM   4299 N N   . ARG A 1 567 ? -1.572  12.211 14.121  1.00 69.41  ? 611  ARG A N   1 
ATOM   4300 C CA  . ARG A 1 567 ? -2.663  11.847 14.982  1.00 70.15  ? 611  ARG A CA  1 
ATOM   4301 C C   . ARG A 1 567 ? -2.234  10.740 15.930  1.00 72.78  ? 611  ARG A C   1 
ATOM   4302 O O   . ARG A 1 567 ? -1.589  9.787  15.526  1.00 74.43  ? 611  ARG A O   1 
ATOM   4303 C CB  . ARG A 1 567 ? -3.813  11.397 14.117  1.00 70.19  ? 611  ARG A CB  1 
ATOM   4304 C CG  . ARG A 1 567 ? -5.115  11.971 14.498  1.00 69.13  ? 611  ARG A CG  1 
ATOM   4305 C CD  . ARG A 1 567 ? -6.207  11.228 13.821  1.00 69.94  ? 611  ARG A CD  1 
ATOM   4306 N NE  . ARG A 1 567 ? -7.423  11.440 14.586  1.00 70.21  ? 611  ARG A NE  1 
ATOM   4307 C CZ  . ARG A 1 567 ? -8.611  10.968 14.247  1.00 71.18  ? 611  ARG A CZ  1 
ATOM   4308 N NH1 . ARG A 1 567 ? -8.743  10.280 13.128  1.00 72.02  ? 611  ARG A NH1 1 
ATOM   4309 N NH2 . ARG A 1 567 ? -9.657  11.200 15.025  1.00 70.47  ? 611  ARG A NH2 1 
ATOM   4310 N N   . LEU A 1 568 ? -2.606  10.857 17.191  1.00 66.12  ? 612  LEU A N   1 
ATOM   4311 C CA  . LEU A 1 568 ? -2.168  9.906  18.199  1.00 68.52  ? 612  LEU A CA  1 
ATOM   4312 C C   . LEU A 1 568 ? -2.748  8.519  17.978  1.00 69.62  ? 612  LEU A C   1 
ATOM   4313 O O   . LEU A 1 568 ? -3.969  8.376  17.938  1.00 68.42  ? 612  LEU A O   1 
ATOM   4314 C CB  . LEU A 1 568 ? -2.572  10.413 19.581  1.00 68.28  ? 612  LEU A CB  1 
ATOM   4315 C CG  . LEU A 1 568 ? -2.144  9.567  20.762  1.00 70.59  ? 612  LEU A CG  1 
ATOM   4316 C CD1 . LEU A 1 568 ? -0.637  9.532  20.782  1.00 72.54  ? 612  LEU A CD1 1 
ATOM   4317 C CD2 . LEU A 1 568 ? -2.695  10.149 22.023  1.00 70.19  ? 612  LEU A CD2 1 
ATOM   4318 N N   . ARG A 1 569 ? -1.889  7.502  17.884  1.00 87.92  ? 613  ARG A N   1 
ATOM   4319 C CA  . ARG A 1 569 ? -2.345  6.127  17.672  1.00 90.20  ? 613  ARG A CA  1 
ATOM   4320 C C   . ARG A 1 569 ? -3.325  5.684  18.744  1.00 92.98  ? 613  ARG A C   1 
ATOM   4321 O O   . ARG A 1 569 ? -3.118  5.906  19.939  1.00 93.76  ? 613  ARG A O   1 
ATOM   4322 C CB  . ARG A 1 569 ? -1.171  5.146  17.635  1.00 89.83  ? 613  ARG A CB  1 
ATOM   4323 C CG  . ARG A 1 569 ? -0.626  4.868  16.239  1.00 88.34  ? 613  ARG A CG  1 
ATOM   4324 C CD  . ARG A 1 569 ? 0.662   4.009  16.261  1.00 87.63  ? 613  ARG A CD  1 
ATOM   4325 N NE  . ARG A 1 569 ? 1.723   4.638  15.472  1.00 84.69  ? 613  ARG A NE  1 
ATOM   4326 C CZ  . ARG A 1 569 ? 1.808   4.566  14.145  1.00 84.04  ? 613  ARG A CZ  1 
ATOM   4327 N NH1 . ARG A 1 569 ? 0.897   3.877  13.452  1.00 86.23  ? 613  ARG A NH1 1 
ATOM   4328 N NH2 . ARG A 1 569 ? 2.791   5.189  13.503  1.00 81.35  ? 613  ARG A NH2 1 
ATOM   4329 N N   . LYS A 1 570 ? -4.408  5.061  18.308  1.00 83.07  ? 614  LYS A N   1 
ATOM   4330 C CA  . LYS A 1 570 ? -5.362  4.538  19.257  1.00 85.36  ? 614  LYS A CA  1 
ATOM   4331 C C   . LYS A 1 570 ? -4.627  3.635  20.242  1.00 88.65  ? 614  LYS A C   1 
ATOM   4332 O O   . LYS A 1 570 ? -4.851  3.720  21.441  1.00 90.49  ? 614  LYS A O   1 
ATOM   4333 C CB  . LYS A 1 570 ? -6.483  3.785  18.543  1.00 86.75  ? 614  LYS A CB  1 
ATOM   4334 C CG  . LYS A 1 570 ? -7.179  4.604  17.470  1.00 85.78  ? 614  LYS A CG  1 
ATOM   4335 C CD  . LYS A 1 570 ? -8.698  4.469  17.557  1.00 86.97  ? 614  LYS A CD  1 
ATOM   4336 C CE  . LYS A 1 570 ? -9.396  5.151  16.387  1.00 85.93  ? 614  LYS A CE  1 
ATOM   4337 N NZ  . LYS A 1 570 ? -8.832  6.517  16.120  1.00 83.98  ? 614  LYS A NZ  1 
ATOM   4338 N N   . SER A 1 571 ? -3.707  2.815  19.736  1.00 97.46  ? 615  SER A N   1 
ATOM   4339 C CA  . SER A 1 571 ? -3.013  1.818  20.560  1.00 98.24  ? 615  SER A CA  1 
ATOM   4340 C C   . SER A 1 571 ? -2.096  2.454  21.609  1.00 97.57  ? 615  SER A C   1 
ATOM   4341 O O   . SER A 1 571 ? -1.873  1.908  22.683  1.00 98.83  ? 615  SER A O   1 
ATOM   4342 C CB  . SER A 1 571 ? -2.198  0.870  19.675  1.00 97.37  ? 615  SER A CB  1 
ATOM   4343 O OG  . SER A 1 571 ? -0.857  1.317  19.541  1.00 95.85  ? 615  SER A OG  1 
ATOM   4344 N N   . SER A 1 572 ? -1.572  3.624  21.297  1.00 91.16  ? 616  SER A N   1 
ATOM   4345 C CA  . SER A 1 572 ? -0.662  4.284  22.204  1.00 91.67  ? 616  SER A CA  1 
ATOM   4346 C C   . SER A 1 572 ? -1.349  4.943  23.367  1.00 92.16  ? 616  SER A C   1 
ATOM   4347 O O   . SER A 1 572 ? -2.155  5.866  23.212  1.00 89.41  ? 616  SER A O   1 
ATOM   4348 C CB  . SER A 1 572 ? 0.123   5.307  21.444  1.00 88.38  ? 616  SER A CB  1 
ATOM   4349 O OG  . SER A 1 572 ? 0.817   4.608  20.444  1.00 88.61  ? 616  SER A OG  1 
ATOM   4350 N N   . MET A 1 573 ? -0.979  4.497  24.548  1.00 116.89 ? 617  MET A N   1 
ATOM   4351 C CA  . MET A 1 573 ? -1.572  5.034  25.735  1.00 119.01 ? 617  MET A CA  1 
ATOM   4352 C C   . MET A 1 573 ? -0.595  5.964  26.407  1.00 118.31 ? 617  MET A C   1 
ATOM   4353 O O   . MET A 1 573 ? 0.298   5.516  27.104  1.00 118.60 ? 617  MET A O   1 
ATOM   4354 C CB  . MET A 1 573 ? -1.942  3.885  26.647  1.00 121.55 ? 617  MET A CB  1 
ATOM   4355 C CG  . MET A 1 573 ? -2.376  4.267  28.011  1.00 123.90 ? 617  MET A CG  1 
ATOM   4356 S SD  . MET A 1 573 ? -2.442  2.741  28.947  1.00 126.28 ? 617  MET A SD  1 
ATOM   4357 C CE  . MET A 1 573 ? -3.262  1.651  27.778  1.00 125.91 ? 617  MET A CE  1 
ATOM   4358 N N   . CYS A 1 574 ? -0.808  7.265  26.250  1.00 94.20  ? 618  CYS A N   1 
ATOM   4359 C CA  . CYS A 1 574 ? 0.121   8.246  26.780  1.00 94.39  ? 618  CYS A CA  1 
ATOM   4360 C C   . CYS A 1 574 ? -0.439  9.651  26.691  1.00 91.34  ? 618  CYS A C   1 
ATOM   4361 O O   . CYS A 1 574 ? -1.457  9.877  26.052  1.00 88.60  ? 618  CYS A O   1 
ATOM   4362 C CB  . CYS A 1 574 ? 1.441   8.181  26.018  1.00 93.70  ? 618  CYS A CB  1 
ATOM   4363 S SG  . CYS A 1 574 ? 1.269   8.741  24.338  1.00 88.62  ? 618  CYS A SG  1 
ATOM   4364 N N   . GLN A 1 575 ? 0.293   10.604 27.250  1.00 93.12  ? 619  GLN A N   1 
ATOM   4365 C CA  . GLN A 1 575 ? -0.169  11.982 27.372  1.00 93.32  ? 619  GLN A CA  1 
ATOM   4366 C C   . GLN A 1 575 ? 0.393   12.913 26.295  1.00 89.84  ? 619  GLN A C   1 
ATOM   4367 O O   . GLN A 1 575 ? 1.616   13.012 26.126  1.00 87.83  ? 619  GLN A O   1 
ATOM   4368 C CB  . GLN A 1 575 ? 0.191   12.521 28.758  1.00 95.67  ? 619  GLN A CB  1 
ATOM   4369 C CG  . GLN A 1 575 ? -0.037  14.011 28.959  1.00 95.99  ? 619  GLN A CG  1 
ATOM   4370 C CD  . GLN A 1 575 ? 0.382   14.492 30.351  1.00 98.67  ? 619  GLN A CD  1 
ATOM   4371 O OE1 . GLN A 1 575 ? 0.899   13.717 31.172  1.00 100.24 ? 619  GLN A OE1 1 
ATOM   4372 N NE2 . GLN A 1 575 ? 0.144   15.777 30.626  1.00 99.54  ? 619  GLN A NE2 1 
ATOM   4373 N N   . ASN A 1 576 ? -0.513  13.578 25.573  1.00 83.15  ? 620  ASN A N   1 
ATOM   4374 C CA  . ASN A 1 576 ? -0.162  14.614 24.610  1.00 80.19  ? 620  ASN A CA  1 
ATOM   4375 C C   . ASN A 1 576 ? 0.471   15.836 25.277  1.00 81.40  ? 620  ASN A C   1 
ATOM   4376 O O   . ASN A 1 576 ? 1.297   16.504 24.674  1.00 80.53  ? 620  ASN A O   1 
ATOM   4377 C CB  . ASN A 1 576 ? -1.397  15.078 23.826  1.00 78.93  ? 620  ASN A CB  1 
ATOM   4378 C CG  . ASN A 1 576 ? -1.939  14.017 22.868  1.00 78.28  ? 620  ASN A CG  1 
ATOM   4379 O OD1 . ASN A 1 576 ? -1.184  13.354 22.146  1.00 76.40  ? 620  ASN A OD1 1 
ATOM   4380 N ND2 . ASN A 1 576 ? -3.271  13.861 22.857  1.00 80.06  ? 620  ASN A ND2 1 
ATOM   4381 N N   . GLY A 1 577 ? 0.056   16.146 26.504  1.00 83.71  ? 621  GLY A N   1 
ATOM   4382 C CA  . GLY A 1 577 ? 0.605   17.265 27.252  1.00 85.59  ? 621  GLY A CA  1 
ATOM   4383 C C   . GLY A 1 577 ? -0.050  18.610 27.019  1.00 83.52  ? 621  GLY A C   1 
ATOM   4384 O O   . GLY A 1 577 ? -0.583  18.863 25.949  1.00 80.04  ? 621  GLY A O   1 
ATOM   4385 N N   . ARG A 1 578 ? -0.011  19.486 28.019  1.00 85.95  ? 622  ARG A N   1 
ATOM   4386 C CA  . ARG A 1 578 ? -0.648  20.796 27.911  1.00 84.55  ? 622  ARG A CA  1 
ATOM   4387 C C   . ARG A 1 578 ? -0.106  21.634 26.752  1.00 82.11  ? 622  ARG A C   1 
ATOM   4388 O O   . ARG A 1 578 ? -0.774  22.536 26.276  1.00 80.02  ? 622  ARG A O   1 
ATOM   4389 C CB  . ARG A 1 578 ? -0.499  21.588 29.215  1.00 88.38  ? 622  ARG A CB  1 
ATOM   4390 C CG  . ARG A 1 578 ? -1.194  20.990 30.416  1.00 91.17  ? 622  ARG A CG  1 
ATOM   4391 C CD  . ARG A 1 578 ? -1.388  22.024 31.519  1.00 94.35  ? 622  ARG A CD  1 
ATOM   4392 N NE  . ARG A 1 578 ? -2.256  23.128 31.110  1.00 91.99  ? 622  ARG A NE  1 
ATOM   4393 C CZ  . ARG A 1 578 ? -3.589  23.122 31.201  1.00 90.74  ? 622  ARG A CZ  1 
ATOM   4394 N NH1 . ARG A 1 578 ? -4.230  22.072 31.696  1.00 91.74  ? 622  ARG A NH1 1 
ATOM   4395 N NH2 . ARG A 1 578 ? -4.291  24.170 30.795  1.00 88.79  ? 622  ARG A NH2 1 
ATOM   4396 N N   . ASP A 1 579 ? 1.100   21.348 26.287  1.00 102.83 ? 623  ASP A N   1 
ATOM   4397 C CA  . ASP A 1 579 ? 1.690   22.167 25.234  1.00 99.00  ? 623  ASP A CA  1 
ATOM   4398 C C   . ASP A 1 579 ? 1.475   21.596 23.819  1.00 95.45  ? 623  ASP A C   1 
ATOM   4399 O O   . ASP A 1 579 ? 1.995   22.137 22.844  1.00 92.15  ? 623  ASP A O   1 
ATOM   4400 C CB  . ASP A 1 579 ? 3.178   22.373 25.512  1.00 98.17  ? 623  ASP A CB  1 
ATOM   4401 C CG  . ASP A 1 579 ? 3.956   21.072 25.567  1.00 98.06  ? 623  ASP A CG  1 
ATOM   4402 O OD1 . ASP A 1 579 ? 3.330   19.993 25.452  1.00 98.43  ? 623  ASP A OD1 1 
ATOM   4403 O OD2 . ASP A 1 579 ? 5.209   21.138 25.747  1.00 97.70  ? 623  ASP A OD2 1 
ATOM   4404 N N   . TYR A 1 580 ? 0.703   20.511 23.723  1.00 76.10  ? 624  TYR A N   1 
ATOM   4405 C CA  . TYR A 1 580 ? 0.437   19.805 22.462  1.00 73.25  ? 624  TYR A CA  1 
ATOM   4406 C C   . TYR A 1 580 ? -0.150  20.702 21.364  1.00 70.22  ? 624  TYR A C   1 
ATOM   4407 O O   . TYR A 1 580 ? -0.997  21.560 21.625  1.00 70.51  ? 624  TYR A O   1 
ATOM   4408 C CB  . TYR A 1 580 ? -0.490  18.618 22.733  1.00 74.62  ? 624  TYR A CB  1 
ATOM   4409 C CG  . TYR A 1 580 ? -1.025  17.927 21.501  1.00 72.52  ? 624  TYR A CG  1 
ATOM   4410 C CD1 . TYR A 1 580 ? -0.273  16.958 20.834  1.00 71.08  ? 624  TYR A CD1 1 
ATOM   4411 C CD2 . TYR A 1 580 ? -2.312  18.229 21.015  1.00 72.21  ? 624  TYR A CD2 1 
ATOM   4412 C CE1 . TYR A 1 580 ? -0.767  16.327 19.722  1.00 69.69  ? 624  TYR A CE1 1 
ATOM   4413 C CE2 . TYR A 1 580 ? -2.812  17.607 19.909  1.00 70.43  ? 624  TYR A CE2 1 
ATOM   4414 C CZ  . TYR A 1 580 ? -2.038  16.656 19.272  1.00 69.40  ? 624  TYR A CZ  1 
ATOM   4415 O OH  . TYR A 1 580 ? -2.553  16.038 18.176  1.00 68.22  ? 624  TYR A OH  1 
ATOM   4416 N N   . VAL A 1 581 ? 0.324   20.489 20.139  1.00 84.81  ? 625  VAL A N   1 
ATOM   4417 C CA  . VAL A 1 581 ? 0.001   21.316 18.979  1.00 82.00  ? 625  VAL A CA  1 
ATOM   4418 C C   . VAL A 1 581 ? -0.422  20.384 17.864  1.00 80.31  ? 625  VAL A C   1 
ATOM   4419 O O   . VAL A 1 581 ? 0.336   19.506 17.475  1.00 79.81  ? 625  VAL A O   1 
ATOM   4420 C CB  . VAL A 1 581 ? 1.228   22.174 18.514  1.00 80.06  ? 625  VAL A CB  1 
ATOM   4421 C CG1 . VAL A 1 581 ? 0.975   22.838 17.187  1.00 77.74  ? 625  VAL A CG1 1 
ATOM   4422 C CG2 . VAL A 1 581 ? 1.569   23.217 19.538  1.00 80.00  ? 625  VAL A CG2 1 
ATOM   4423 N N   . VAL A 1 582 ? -1.642  20.546 17.370  1.00 69.36  ? 626  VAL A N   1 
ATOM   4424 C CA  . VAL A 1 582 ? -2.126  19.715 16.274  1.00 67.83  ? 626  VAL A CA  1 
ATOM   4425 C C   . VAL A 1 582 ? -1.211  19.957 15.083  1.00 65.07  ? 626  VAL A C   1 
ATOM   4426 O O   . VAL A 1 582 ? -1.030  21.099 14.656  1.00 63.47  ? 626  VAL A O   1 
ATOM   4427 C CB  . VAL A 1 582 ? -3.596  20.042 15.922  1.00 67.07  ? 626  VAL A CB  1 
ATOM   4428 C CG1 . VAL A 1 582 ? -4.029  19.312 14.657  1.00 65.37  ? 626  VAL A CG1 1 
ATOM   4429 C CG2 . VAL A 1 582 ? -4.507  19.709 17.087  1.00 70.37  ? 626  VAL A CG2 1 
ATOM   4430 N N   . THR A 1 583 ? -0.619  18.890 14.564  1.00 67.60  ? 627  THR A N   1 
ATOM   4431 C CA  . THR A 1 583 ? 0.283   19.014 13.430  1.00 68.13  ? 627  THR A CA  1 
ATOM   4432 C C   . THR A 1 583 ? -0.457  18.618 12.177  1.00 65.39  ? 627  THR A C   1 
ATOM   4433 O O   . THR A 1 583 ? -1.087  17.554 12.141  1.00 64.16  ? 627  THR A O   1 
ATOM   4434 C CB  . THR A 1 583 ? 1.536   18.125 13.572  1.00 71.52  ? 627  THR A CB  1 
ATOM   4435 O OG1 . THR A 1 583 ? 2.290   18.541 14.717  1.00 73.22  ? 627  THR A OG1 1 
ATOM   4436 C CG2 . THR A 1 583 ? 2.406   18.222 12.328  1.00 71.69  ? 627  THR A CG2 1 
ATOM   4437 N N   . LYS A 1 584 ? -0.406  19.465 11.158  1.00 75.02  ? 628  LYS A N   1 
ATOM   4438 C CA  . LYS A 1 584 ? -1.073  19.140 9.915   1.00 71.46  ? 628  LYS A CA  1 
ATOM   4439 C C   . LYS A 1 584 ? -0.395  19.829 8.770   1.00 71.32  ? 628  LYS A C   1 
ATOM   4440 O O   . LYS A 1 584 ? 0.193   20.881 8.954   1.00 72.98  ? 628  LYS A O   1 
ATOM   4441 C CB  . LYS A 1 584 ? -2.535  19.568 9.974   1.00 68.12  ? 628  LYS A CB  1 
ATOM   4442 C CG  . LYS A 1 584 ? -2.631  21.061 10.024  1.00 68.25  ? 628  LYS A CG  1 
ATOM   4443 C CD  . LYS A 1 584 ? -3.971  21.540 10.449  1.00 65.61  ? 628  LYS A CD  1 
ATOM   4444 C CE  . LYS A 1 584 ? -4.016  23.041 10.283  1.00 65.41  ? 628  LYS A CE  1 
ATOM   4445 N NZ  . LYS A 1 584 ? -5.398  23.567 10.111  1.00 62.14  ? 628  LYS A NZ  1 
ATOM   4446 N N   . GLN A 1 585 ? -0.466  19.271 7.574   1.00 77.31  ? 629  GLN A N   1 
ATOM   4447 C CA  . GLN A 1 585 ? 0.014   20.061 6.460   1.00 77.18  ? 629  GLN A CA  1 
ATOM   4448 C C   . GLN A 1 585 ? -0.970  20.029 5.306   1.00 73.98  ? 629  GLN A C   1 
ATOM   4449 O O   . GLN A 1 585 ? -1.555  18.992 4.983   1.00 71.73  ? 629  GLN A O   1 
ATOM   4450 C CB  . GLN A 1 585 ? 1.421   19.608 6.021   1.00 78.62  ? 629  GLN A CB  1 
ATOM   4451 C CG  . GLN A 1 585 ? 1.663   18.125 5.945   1.00 77.31  ? 629  GLN A CG  1 
ATOM   4452 C CD  . GLN A 1 585 ? 3.147   17.763 6.100   1.00 79.30  ? 629  GLN A CD  1 
ATOM   4453 O OE1 . GLN A 1 585 ? 3.984   18.586 6.526   1.00 82.42  ? 629  GLN A OE1 1 
ATOM   4454 N NE2 . GLN A 1 585 ? 3.482   16.517 5.760   1.00 77.48  ? 629  GLN A NE2 1 
ATOM   4455 N N   . PRO A 1 586 ? -1.178  21.202 4.704   1.00 58.96  ? 630  PRO A N   1 
ATOM   4456 C CA  . PRO A 1 586 ? -2.097  21.424 3.570   1.00 57.69  ? 630  PRO A CA  1 
ATOM   4457 C C   . PRO A 1 586 ? -1.529  20.962 2.195   1.00 59.45  ? 630  PRO A C   1 
ATOM   4458 O O   . PRO A 1 586 ? -0.356  21.254 1.904   1.00 61.03  ? 630  PRO A O   1 
ATOM   4459 C CB  . PRO A 1 586 ? -2.289  22.946 3.589   1.00 58.13  ? 630  PRO A CB  1 
ATOM   4460 C CG  . PRO A 1 586 ? -0.926  23.450 4.136   1.00 60.54  ? 630  PRO A CG  1 
ATOM   4461 C CD  . PRO A 1 586 ? -0.536  22.450 5.168   1.00 61.27  ? 630  PRO A CD  1 
ATOM   4462 N N   . SER A 1 587 ? -2.347  20.307 1.362   1.00 69.90  ? 631  SER A N   1 
ATOM   4463 C CA  . SER A 1 587 ? -1.996  20.157 -0.049  1.00 71.75  ? 631  SER A CA  1 
ATOM   4464 C C   . SER A 1 587 ? -2.969  21.032 -0.819  1.00 72.79  ? 631  SER A C   1 
ATOM   4465 O O   . SER A 1 587 ? -4.160  20.943 -0.602  1.00 71.87  ? 631  SER A O   1 
ATOM   4466 C CB  . SER A 1 587 ? -2.073  18.704 -0.527  1.00 72.33  ? 631  SER A CB  1 
ATOM   4467 O OG  . SER A 1 587 ? -1.476  17.786 0.368   1.00 70.77  ? 631  SER A OG  1 
ATOM   4468 N N   . ILE A 1 588 ? -2.484  21.889 -1.700  1.00 66.45  ? 632  ILE A N   1 
ATOM   4469 C CA  . ILE A 1 588 ? -3.361  22.846 -2.366  1.00 67.57  ? 632  ILE A CA  1 
ATOM   4470 C C   . ILE A 1 588 ? -3.846  22.312 -3.705  1.00 70.88  ? 632  ILE A C   1 
ATOM   4471 O O   . ILE A 1 588 ? -3.052  22.162 -4.657  1.00 73.58  ? 632  ILE A O   1 
ATOM   4472 C CB  . ILE A 1 588 ? -2.661  24.190 -2.611  1.00 68.32  ? 632  ILE A CB  1 
ATOM   4473 C CG1 . ILE A 1 588 ? -2.077  24.722 -1.305  1.00 66.89  ? 632  ILE A CG1 1 
ATOM   4474 C CG2 . ILE A 1 588 ? -3.642  25.181 -3.207  1.00 69.27  ? 632  ILE A CG2 1 
ATOM   4475 C CD1 . ILE A 1 588 ? -3.147  25.076 -0.288  1.00 65.32  ? 632  ILE A CD1 1 
ATOM   4476 N N   . CYS A 1 589 ? -5.151  22.054 -3.779  1.00 63.77  ? 633  CYS A N   1 
ATOM   4477 C CA  . CYS A 1 589 ? -5.726  21.348 -4.904  1.00 65.59  ? 633  CYS A CA  1 
ATOM   4478 C C   . CYS A 1 589 ? -5.927  22.262 -6.069  1.00 67.53  ? 633  CYS A C   1 
ATOM   4479 O O   . CYS A 1 589 ? -5.991  23.481 -5.903  1.00 67.00  ? 633  CYS A O   1 
ATOM   4480 C CB  . CYS A 1 589 ? -7.039  20.704 -4.512  1.00 64.39  ? 633  CYS A CB  1 
ATOM   4481 S SG  . CYS A 1 589 ? -6.784  19.347 -3.362  1.00 63.21  ? 633  CYS A SG  1 
ATOM   4482 N N   . LEU A 1 590 ? -5.984  21.665 -7.254  1.00 71.62  ? 634  LEU A N   1 
ATOM   4483 C CA  . LEU A 1 590 ? -6.334  22.392 -8.464  1.00 74.67  ? 634  LEU A CA  1 
ATOM   4484 C C   . LEU A 1 590 ? -7.792  22.836 -8.428  1.00 74.62  ? 634  LEU A C   1 
ATOM   4485 O O   . LEU A 1 590 ? -8.657  22.051 -8.040  1.00 75.39  ? 634  LEU A O   1 
ATOM   4486 C CB  . LEU A 1 590 ? -6.093  21.522 -9.689  1.00 80.78  ? 634  LEU A CB  1 
ATOM   4487 C CG  . LEU A 1 590 ? -4.840  21.816 -10.496 1.00 81.49  ? 634  LEU A CG  1 
ATOM   4488 C CD1 . LEU A 1 590 ? -3.550  21.442 -9.741  1.00 78.46  ? 634  LEU A CD1 1 
ATOM   4489 C CD2 . LEU A 1 590 ? -4.971  21.056 -11.784 1.00 87.89  ? 634  LEU A CD2 1 
ATOM   4490 N N   . CYS A 1 591 ? -8.052  24.082 -8.834  1.00 84.62  ? 635  CYS A N   1 
ATOM   4491 C CA  . CYS A 1 591 ? -9.415  24.618 -8.936  1.00 84.87  ? 635  CYS A CA  1 
ATOM   4492 C C   . CYS A 1 591 ? -10.273 23.934 -9.986  1.00 90.24  ? 635  CYS A C   1 
ATOM   4493 O O   . CYS A 1 591 ? -9.875  23.787 -11.141 1.00 93.93  ? 635  CYS A O   1 
ATOM   4494 C CB  . CYS A 1 591 ? -9.388  26.112 -9.241  1.00 83.54  ? 635  CYS A CB  1 
ATOM   4495 S SG  . CYS A 1 591 ? -8.961  27.155 -7.837  1.00 78.23  ? 635  CYS A SG  1 
ATOM   4496 N N   . SER A 1 592 ? -11.450 23.501 -9.563  1.00 76.35  ? 636  SER A N   1 
ATOM   4497 C CA  . SER A 1 592 ? -12.504 23.096 -10.483 1.00 81.25  ? 636  SER A CA  1 
ATOM   4498 C C   . SER A 1 592 ? -13.691 24.073 -10.323 1.00 79.21  ? 636  SER A C   1 
ATOM   4499 O O   . SER A 1 592 ? -13.659 24.949 -9.463  1.00 74.42  ? 636  SER A O   1 
ATOM   4500 C CB  . SER A 1 592 ? -12.918 21.642 -10.217 1.00 83.97  ? 636  SER A CB  1 
ATOM   4501 O OG  . SER A 1 592 ? -13.446 21.482 -8.909  1.00 79.29  ? 636  SER A OG  1 
ATOM   4502 N N   . LEU A 1 593 ? -14.735 23.932 -11.129 1.00 77.51  ? 637  LEU A N   1 
ATOM   4503 C CA  . LEU A 1 593 ? -15.886 24.849 -11.023 1.00 77.20  ? 637  LEU A CA  1 
ATOM   4504 C C   . LEU A 1 593 ? -16.538 24.711 -9.655  1.00 73.77  ? 637  LEU A C   1 
ATOM   4505 O O   . LEU A 1 593 ? -17.130 25.647 -9.127  1.00 72.36  ? 637  LEU A O   1 
ATOM   4506 C CB  . LEU A 1 593 ? -16.916 24.575 -12.115 1.00 80.82  ? 637  LEU A CB  1 
ATOM   4507 C CG  . LEU A 1 593 ? -16.480 24.772 -13.564 1.00 85.00  ? 637  LEU A CG  1 
ATOM   4508 C CD1 . LEU A 1 593 ? -17.525 24.225 -14.506 1.00 88.74  ? 637  LEU A CD1 1 
ATOM   4509 C CD2 . LEU A 1 593 ? -16.258 26.241 -13.837 1.00 85.43  ? 637  LEU A CD2 1 
ATOM   4510 N N   . GLU A 1 594 ? -16.366 23.543 -9.061  1.00 103.65 ? 638  GLU A N   1 
ATOM   4511 C CA  . GLU A 1 594 ? -16.989 23.232 -7.805  1.00 99.08  ? 638  GLU A CA  1 
ATOM   4512 C C   . GLU A 1 594 ? -16.382 23.999 -6.650  1.00 93.16  ? 638  GLU A C   1 
ATOM   4513 O O   . GLU A 1 594 ? -16.825 23.889 -5.519  1.00 88.60  ? 638  GLU A O   1 
ATOM   4514 C CB  . GLU A 1 594 ? -16.918 21.742 -7.587  1.00 100.43 ? 638  GLU A CB  1 
ATOM   4515 C CG  . GLU A 1 594 ? -17.575 21.040 -8.741  1.00 106.58 ? 638  GLU A CG  1 
ATOM   4516 C CD  . GLU A 1 594 ? -18.223 19.740 -8.342  1.00 106.40 ? 638  GLU A CD  1 
ATOM   4517 O OE1 . GLU A 1 594 ? -17.646 19.062 -7.455  1.00 103.42 ? 638  GLU A OE1 1 
ATOM   4518 O OE2 . GLU A 1 594 ? -19.323 19.430 -8.887  1.00 108.70 ? 638  GLU A OE2 1 
ATOM   4519 N N   . ASP A 1 595 ? -15.355 24.775 -6.941  1.00 71.31  ? 639  ASP A N   1 
ATOM   4520 C CA  . ASP A 1 595 ? -14.772 25.690 -5.971  1.00 66.36  ? 639  ASP A CA  1 
ATOM   4521 C C   . ASP A 1 595 ? -15.404 27.078 -6.109  1.00 65.59  ? 639  ASP A C   1 
ATOM   4522 O O   . ASP A 1 595 ? -15.033 28.006 -5.401  1.00 63.30  ? 639  ASP A O   1 
ATOM   4523 C CB  . ASP A 1 595 ? -13.242 25.781 -6.153  1.00 66.71  ? 639  ASP A CB  1 
ATOM   4524 C CG  . ASP A 1 595 ? -12.542 24.451 -5.913  1.00 67.15  ? 639  ASP A CG  1 
ATOM   4525 O OD1 . ASP A 1 595 ? -12.489 24.019 -4.730  1.00 63.18  ? 639  ASP A OD1 1 
ATOM   4526 O OD2 . ASP A 1 595 ? -12.068 23.836 -6.900  1.00 71.59  ? 639  ASP A OD2 1 
ATOM   4527 N N   . PHE A 1 596 ? -16.360 27.230 -7.015  1.00 78.06  ? 640  PHE A N   1 
ATOM   4528 C CA  . PHE A 1 596 ? -16.959 28.541 -7.222  1.00 77.68  ? 640  PHE A CA  1 
ATOM   4529 C C   . PHE A 1 596 ? -18.459 28.534 -6.920  1.00 76.67  ? 640  PHE A C   1 
ATOM   4530 O O   . PHE A 1 596 ? -19.156 27.562 -7.237  1.00 78.70  ? 640  PHE A O   1 
ATOM   4531 C CB  . PHE A 1 596 ? -16.718 29.018 -8.662  1.00 82.12  ? 640  PHE A CB  1 
ATOM   4532 C CG  . PHE A 1 596 ? -15.272 29.276 -8.981  1.00 82.63  ? 640  PHE A CG  1 
ATOM   4533 C CD1 . PHE A 1 596 ? -14.426 28.229 -9.345  1.00 84.47  ? 640  PHE A CD1 1 
ATOM   4534 C CD2 . PHE A 1 596 ? -14.749 30.555 -8.903  1.00 81.54  ? 640  PHE A CD2 1 
ATOM   4535 C CE1 . PHE A 1 596 ? -13.087 28.453 -9.618  1.00 84.57  ? 640  PHE A CE1 1 
ATOM   4536 C CE2 . PHE A 1 596 ? -13.403 30.783 -9.180  1.00 82.07  ? 640  PHE A CE2 1 
ATOM   4537 C CZ  . PHE A 1 596 ? -12.573 29.729 -9.539  1.00 83.28  ? 640  PHE A CZ  1 
ATOM   4538 N N   . LEU A 1 597 ? -18.959 29.613 -6.317  1.00 79.19  ? 641  LEU A N   1 
ATOM   4539 C CA  . LEU A 1 597 ? -20.404 29.773 -6.114  1.00 78.30  ? 641  LEU A CA  1 
ATOM   4540 C C   . LEU A 1 597 ? -20.955 30.744 -7.145  1.00 81.32  ? 641  LEU A C   1 
ATOM   4541 O O   . LEU A 1 597 ? -20.256 31.671 -7.560  1.00 82.28  ? 641  LEU A O   1 
ATOM   4542 C CB  . LEU A 1 597 ? -20.729 30.269 -4.698  1.00 73.06  ? 641  LEU A CB  1 
ATOM   4543 C CG  . LEU A 1 597 ? -20.281 31.704 -4.373  1.00 71.79  ? 641  LEU A CG  1 
ATOM   4544 C CD1 . LEU A 1 597 ? -21.420 32.731 -4.326  1.00 71.44  ? 641  LEU A CD1 1 
ATOM   4545 C CD2 . LEU A 1 597 ? -19.485 31.731 -3.081  1.00 68.13  ? 641  LEU A CD2 1 
ATOM   4546 N N   . CYS A 1 598 ? -22.199 30.514 -7.566  1.00 79.11  ? 642  CYS A N   1 
ATOM   4547 C CA  . CYS A 1 598 ? -22.936 31.422 -8.454  1.00 81.38  ? 642  CYS A CA  1 
ATOM   4548 C C   . CYS A 1 598 ? -23.055 32.831 -7.908  1.00 78.74  ? 642  CYS A C   1 
ATOM   4549 O O   . CYS A 1 598 ? -23.467 33.045 -6.770  1.00 74.81  ? 642  CYS A O   1 
ATOM   4550 C CB  . CYS A 1 598 ? -24.325 30.869 -8.722  1.00 82.30  ? 642  CYS A CB  1 
ATOM   4551 S SG  . CYS A 1 598 ? -24.289 29.420 -9.775  1.00 87.16  ? 642  CYS A SG  1 
ATOM   4552 N N   . ASP A 1 599 ? -22.678 33.790 -8.732  1.00 78.07  ? 643  ASP A N   1 
ATOM   4553 C CA  . ASP A 1 599 ? -22.701 35.181 -8.348  1.00 76.93  ? 643  ASP A CA  1 
ATOM   4554 C C   . ASP A 1 599 ? -24.141 35.695 -8.524  1.00 77.77  ? 643  ASP A C   1 
ATOM   4555 O O   . ASP A 1 599 ? -25.049 34.926 -8.880  1.00 79.06  ? 643  ASP A O   1 
ATOM   4556 C CB  . ASP A 1 599 ? -21.710 35.953 -9.210  1.00 79.44  ? 643  ASP A CB  1 
ATOM   4557 C CG  . ASP A 1 599 ? -21.199 37.225 -8.550  1.00 77.87  ? 643  ASP A CG  1 
ATOM   4558 O OD1 . ASP A 1 599 ? -21.959 37.868 -7.765  1.00 76.22  ? 643  ASP A OD1 1 
ATOM   4559 O OD2 . ASP A 1 599 ? -20.013 37.578 -8.856  1.00 78.89  ? 643  ASP A OD2 1 
ATOM   4560 N N   . PHE A 1 600 ? -24.377 36.981 -8.298  1.00 89.58  ? 644  PHE A N   1 
ATOM   4561 C CA  . PHE A 1 600 ? -25.734 37.458 -8.462  1.00 89.35  ? 644  PHE A CA  1 
ATOM   4562 C C   . PHE A 1 600 ? -26.253 37.295 -9.894  1.00 93.38  ? 644  PHE A C   1 
ATOM   4563 O O   . PHE A 1 600 ? -25.557 37.576 -10.865 1.00 96.46  ? 644  PHE A O   1 
ATOM   4564 C CB  . PHE A 1 600 ? -25.862 38.913 -8.051  1.00 88.32  ? 644  PHE A CB  1 
ATOM   4565 C CG  . PHE A 1 600 ? -27.263 39.417 -8.146  1.00 90.02  ? 644  PHE A CG  1 
ATOM   4566 C CD1 . PHE A 1 600 ? -28.288 38.733 -7.506  1.00 88.71  ? 644  PHE A CD1 1 
ATOM   4567 C CD2 . PHE A 1 600 ? -27.562 40.555 -8.878  1.00 93.42  ? 644  PHE A CD2 1 
ATOM   4568 C CE1 . PHE A 1 600 ? -29.597 39.181 -7.584  1.00 90.68  ? 644  PHE A CE1 1 
ATOM   4569 C CE2 . PHE A 1 600 ? -28.862 41.009 -8.958  1.00 95.35  ? 644  PHE A CE2 1 
ATOM   4570 C CZ  . PHE A 1 600 ? -29.881 40.314 -8.313  1.00 93.93  ? 644  PHE A CZ  1 
ATOM   4571 N N   . GLY A 1 601 ? -27.496 36.842 -10.017 1.00 87.22  ? 645  GLY A N   1 
ATOM   4572 C CA  . GLY A 1 601 ? -28.103 36.700 -11.323 1.00 91.38  ? 645  GLY A CA  1 
ATOM   4573 C C   . GLY A 1 601 ? -27.592 35.539 -12.152 1.00 92.52  ? 645  GLY A C   1 
ATOM   4574 O O   . GLY A 1 601 ? -27.706 35.579 -13.374 1.00 96.44  ? 645  GLY A O   1 
ATOM   4575 N N   . TYR A 1 602 ? -27.041 34.519 -11.488 1.00 91.10  ? 646  TYR A N   1 
ATOM   4576 C CA  . TYR A 1 602 ? -26.618 33.268 -12.125 1.00 93.93  ? 646  TYR A CA  1 
ATOM   4577 C C   . TYR A 1 602 ? -27.091 32.060 -11.313 1.00 92.06  ? 646  TYR A C   1 
ATOM   4578 O O   . TYR A 1 602 ? -27.384 32.189 -10.131 1.00 88.13  ? 646  TYR A O   1 
ATOM   4579 C CB  . TYR A 1 602 ? -25.092 33.229 -12.285 1.00 95.21  ? 646  TYR A CB  1 
ATOM   4580 C CG  . TYR A 1 602 ? -24.573 34.016 -13.472 1.00 98.37  ? 646  TYR A CG  1 
ATOM   4581 C CD1 . TYR A 1 602 ? -24.635 35.404 -13.493 1.00 97.58  ? 646  TYR A CD1 1 
ATOM   4582 C CD2 . TYR A 1 602 ? -24.026 33.371 -14.568 1.00 102.18 ? 646  TYR A CD2 1 
ATOM   4583 C CE1 . TYR A 1 602 ? -24.181 36.126 -14.574 1.00 100.34 ? 646  TYR A CE1 1 
ATOM   4584 C CE2 . TYR A 1 602 ? -23.564 34.082 -15.647 1.00 104.82 ? 646  TYR A CE2 1 
ATOM   4585 C CZ  . TYR A 1 602 ? -23.641 35.459 -15.649 1.00 103.82 ? 646  TYR A CZ  1 
ATOM   4586 O OH  . TYR A 1 602 ? -23.172 36.166 -16.733 1.00 106.33 ? 646  TYR A OH  1 
ATOM   4587 N N   . TYR A 1 603 ? -27.159 30.889 -11.936 1.00 102.83 ? 647  TYR A N   1 
ATOM   4588 C CA  . TYR A 1 603 ? -27.675 29.701 -11.254 1.00 101.52 ? 647  TYR A CA  1 
ATOM   4589 C C   . TYR A 1 603 ? -27.184 28.419 -11.898 1.00 105.05 ? 647  TYR A C   1 
ATOM   4590 O O   . TYR A 1 603 ? -26.658 28.445 -13.000 1.00 108.73 ? 647  TYR A O   1 
ATOM   4591 C CB  . TYR A 1 603 ? -29.204 29.712 -11.236 1.00 100.60 ? 647  TYR A CB  1 
ATOM   4592 C CG  . TYR A 1 603 ? -29.867 29.291 -12.533 1.00 104.35 ? 647  TYR A CG  1 
ATOM   4593 C CD1 . TYR A 1 603 ? -29.714 30.046 -13.681 1.00 106.80 ? 647  TYR A CD1 1 
ATOM   4594 C CD2 . TYR A 1 603 ? -30.669 28.160 -12.602 1.00 105.29 ? 647  TYR A CD2 1 
ATOM   4595 C CE1 . TYR A 1 603 ? -30.331 29.706 -14.858 1.00 109.78 ? 647  TYR A CE1 1 
ATOM   4596 C CE2 . TYR A 1 603 ? -31.284 27.796 -13.793 1.00 108.43 ? 647  TYR A CE2 1 
ATOM   4597 C CZ  . TYR A 1 603 ? -31.104 28.576 -14.920 1.00 110.55 ? 647  TYR A CZ  1 
ATOM   4598 O OH  . TYR A 1 603 ? -31.709 28.247 -16.117 1.00 113.37 ? 647  TYR A OH  1 
ATOM   4599 N N   . ARG A 1 604 ? -27.284 27.317 -11.173 1.00 105.31 ? 648  ARG A N   1 
ATOM   4600 C CA  . ARG A 1 604 ? -26.970 26.043 -11.768 1.00 108.45 ? 648  ARG A CA  1 
ATOM   4601 C C   . ARG A 1 604 ? -28.315 25.408 -12.002 1.00 109.65 ? 648  ARG A C   1 
ATOM   4602 O O   . ARG A 1 604 ? -29.012 25.043 -11.055 1.00 107.52 ? 648  ARG A O   1 
ATOM   4603 C CB  . ARG A 1 604 ? -26.134 25.190 -10.815 1.00 106.47 ? 648  ARG A CB  1 
ATOM   4604 C CG  . ARG A 1 604 ? -24.773 25.781 -10.485 1.00 105.49 ? 648  ARG A CG  1 
ATOM   4605 C CD  . ARG A 1 604 ? -24.077 24.988 -9.392  1.00 103.33 ? 648  ARG A CD  1 
ATOM   4606 N NE  . ARG A 1 604 ? -22.623 25.083 -9.489  1.00 104.92 ? 648  ARG A NE  1 
ATOM   4607 C CZ  . ARG A 1 604 ? -21.884 25.953 -8.808  1.00 101.77 ? 648  ARG A CZ  1 
ATOM   4608 N NH1 . ARG A 1 604 ? -22.461 26.808 -7.975  1.00 96.96  ? 648  ARG A NH1 1 
ATOM   4609 N NH2 . ARG A 1 604 ? -20.567 25.968 -8.959  1.00 103.29 ? 648  ARG A NH2 1 
ATOM   4610 N N   . PRO A 1 605 ? -28.756 25.425 -13.262 1.00 177.66 ? 649  PRO A N   1 
ATOM   4611 C CA  . PRO A 1 605 ? -29.973 24.730 -13.721 1.00 178.54 ? 649  PRO A CA  1 
ATOM   4612 C C   . PRO A 1 605 ? -29.927 23.191 -13.752 1.00 179.68 ? 649  PRO A C   1 
ATOM   4613 O O   . PRO A 1 605 ? -30.885 22.531 -13.349 1.00 178.06 ? 649  PRO A O   1 
ATOM   4614 C CB  . PRO A 1 605 ? -30.161 25.270 -15.142 1.00 181.91 ? 649  PRO A CB  1 
ATOM   4615 C CG  . PRO A 1 605 ? -28.786 25.635 -15.586 1.00 183.35 ? 649  PRO A CG  1 
ATOM   4616 C CD  . PRO A 1 605 ? -28.077 26.137 -14.359 1.00 180.70 ? 649  PRO A CD  1 
ATOM   4617 N N   . GLU A 1 606 ? -28.814 22.647 -14.237 1.00 169.03 ? 650  GLU A N   1 
ATOM   4618 C CA  . GLU A 1 606 ? -28.622 21.233 -14.438 1.00 170.05 ? 650  GLU A CA  1 
ATOM   4619 C C   . GLU A 1 606 ? -27.795 20.725 -13.290 1.00 167.74 ? 650  GLU A C   1 
ATOM   4620 O O   . GLU A 1 606 ? -27.447 21.489 -12.409 1.00 165.26 ? 650  GLU A O   1 
ATOM   4621 C CB  . GLU A 1 606 ? -27.937 20.993 -15.768 1.00 174.98 ? 650  GLU A CB  1 
ATOM   4622 C CG  . GLU A 1 606 ? -28.784 21.355 -16.953 1.00 178.52 ? 650  GLU A CG  1 
ATOM   4623 C CD  . GLU A 1 606 ? -28.032 21.166 -18.236 1.00 179.24 ? 650  GLU A CD  1 
ATOM   4624 O OE1 . GLU A 1 606 ? -26.811 20.939 -18.174 1.00 179.30 ? 650  GLU A OE1 1 
ATOM   4625 O OE2 . GLU A 1 606 ? -28.666 21.234 -19.302 1.00 179.84 ? 650  GLU A OE2 1 
ATOM   4626 N N   . ASN A 1 607 ? -27.478 19.443 -13.284 1.00 171.28 ? 651  ASN A N   1 
ATOM   4627 C CA  . ASN A 1 607 ? -26.627 18.918 -12.236 1.00 168.41 ? 651  ASN A CA  1 
ATOM   4628 C C   . ASN A 1 607 ? -25.312 19.660 -12.333 1.00 169.75 ? 651  ASN A C   1 
ATOM   4629 O O   . ASN A 1 607 ? -24.653 19.917 -11.335 1.00 166.02 ? 651  ASN A O   1 
ATOM   4630 C CB  . ASN A 1 607 ? -26.406 17.412 -12.392 1.00 168.46 ? 651  ASN A CB  1 
ATOM   4631 C CG  . ASN A 1 607 ? -25.209 16.912 -11.599 1.00 162.99 ? 651  ASN A CG  1 
ATOM   4632 O OD1 . ASN A 1 607 ? -24.879 17.465 -10.555 1.00 159.00 ? 651  ASN A OD1 1 
ATOM   4633 N ND2 . ASN A 1 607 ? -24.534 15.897 -12.114 1.00 162.62 ? 651  ASN A ND2 1 
ATOM   4634 N N   . ASP A 1 608 ? -24.935 19.977 -13.558 1.00 198.16 ? 652  ASP A N   1 
ATOM   4635 C CA  . ASP A 1 608 ? -23.596 20.403 -13.875 1.00 200.26 ? 652  ASP A CA  1 
ATOM   4636 C C   . ASP A 1 608 ? -23.269 21.628 -13.067 1.00 196.99 ? 652  ASP A C   1 
ATOM   4637 O O   . ASP A 1 608 ? -24.112 22.473 -12.828 1.00 194.39 ? 652  ASP A O   1 
ATOM   4638 C CB  . ASP A 1 608 ? -23.477 20.721 -15.363 1.00 205.43 ? 652  ASP A CB  1 
ATOM   4639 C CG  . ASP A 1 608 ? -22.065 21.082 -15.767 1.00 207.70 ? 652  ASP A CG  1 
ATOM   4640 O OD1 . ASP A 1 608 ? -21.176 21.066 -14.891 1.00 208.20 ? 652  ASP A OD1 1 
ATOM   4641 O OD2 . ASP A 1 608 ? -21.844 21.345 -16.968 1.00 208.73 ? 652  ASP A OD2 1 
ATOM   4642 N N   . SER A 1 609 ? -22.023 21.691 -12.648 1.00 148.46 ? 653  SER A N   1 
ATOM   4643 C CA  . SER A 1 609 ? -21.537 22.710 -11.761 1.00 145.90 ? 653  SER A CA  1 
ATOM   4644 C C   . SER A 1 609 ? -21.666 24.072 -12.391 1.00 146.19 ? 653  SER A C   1 
ATOM   4645 O O   . SER A 1 609 ? -21.851 25.060 -11.696 1.00 143.29 ? 653  SER A O   1 
ATOM   4646 C CB  . SER A 1 609 ? -20.088 22.414 -11.438 1.00 145.92 ? 653  SER A CB  1 
ATOM   4647 O OG  . SER A 1 609 ? -20.004 21.203 -10.715 1.00 149.45 ? 653  SER A OG  1 
ATOM   4648 N N   . LYS A 1 610 ? -21.496 24.120 -13.702 1.00 120.72 ? 654  LYS A N   1 
ATOM   4649 C CA  . LYS A 1 610 ? -21.464 25.376 -14.457 1.00 121.09 ? 654  LYS A CA  1 
ATOM   4650 C C   . LYS A 1 610 ? -22.619 26.363 -14.140 1.00 118.70 ? 654  LYS A C   1 
ATOM   4651 O O   . LYS A 1 610 ? -23.798 26.007 -14.175 1.00 118.49 ? 654  LYS A O   1 
ATOM   4652 C CB  . LYS A 1 610 ? -21.438 25.073 -15.951 1.00 124.96 ? 654  LYS A CB  1 
ATOM   4653 C CG  . LYS A 1 610 ? -21.332 26.305 -16.818 1.00 127.40 ? 654  LYS A CG  1 
ATOM   4654 C CD  . LYS A 1 610 ? -21.261 25.922 -18.293 1.00 130.88 ? 654  LYS A CD  1 
ATOM   4655 C CE  . LYS A 1 610 ? -21.178 27.157 -19.189 1.00 132.17 ? 654  LYS A CE  1 
ATOM   4656 N NZ  . LYS A 1 610 ? -21.108 26.811 -20.639 1.00 138.71 ? 654  LYS A NZ  1 
ATOM   4657 N N   . CYS A 1 611 ? -22.238 27.599 -13.818 1.00 99.47  ? 655  CYS A N   1 
ATOM   4658 C CA  . CYS A 1 611 ? -23.146 28.670 -13.446 1.00 96.86  ? 655  CYS A CA  1 
ATOM   4659 C C   . CYS A 1 611 ? -23.570 29.448 -14.695 1.00 99.71  ? 655  CYS A C   1 
ATOM   4660 O O   . CYS A 1 611 ? -22.729 30.032 -15.375 1.00 101.53 ? 655  CYS A O   1 
ATOM   4661 C CB  . CYS A 1 611 ? -22.475 29.618 -12.446 1.00 93.08  ? 655  CYS A CB  1 
ATOM   4662 S SG  . CYS A 1 611 ? -22.420 29.112 -10.666 1.00 87.88  ? 655  CYS A SG  1 
ATOM   4663 N N   . VAL A 1 612 ? -24.869 29.461 -14.988 1.00 100.42 ? 656  VAL A N   1 
ATOM   4664 C CA  . VAL A 1 612 ? -25.402 30.184 -16.144 1.00 102.76 ? 656  VAL A CA  1 
ATOM   4665 C C   . VAL A 1 612 ? -26.339 31.335 -15.738 1.00 101.77 ? 656  VAL A C   1 
ATOM   4666 O O   . VAL A 1 612 ? -26.929 31.321 -14.653 1.00 98.74  ? 656  VAL A O   1 
ATOM   4667 C CB  . VAL A 1 612 ? -26.169 29.228 -17.099 1.00 106.59 ? 656  VAL A CB  1 
ATOM   4668 C CG1 . VAL A 1 612 ? -27.490 28.813 -16.489 1.00 106.18 ? 656  VAL A CG1 1 
ATOM   4669 C CG2 . VAL A 1 612 ? -26.387 29.870 -18.482 1.00 112.00 ? 656  VAL A CG2 1 
ATOM   4670 N N   . GLU A 1 613 ? -26.446 32.334 -16.608 1.00 129.98 ? 657  GLU A N   1 
ATOM   4671 C CA  . GLU A 1 613 ? -27.302 33.497 -16.392 1.00 127.98 ? 657  GLU A CA  1 
ATOM   4672 C C   . GLU A 1 613 ? -28.781 33.110 -16.236 1.00 126.95 ? 657  GLU A C   1 
ATOM   4673 O O   . GLU A 1 613 ? -29.294 32.302 -17.004 1.00 129.12 ? 657  GLU A O   1 
ATOM   4674 C CB  . GLU A 1 613 ? -27.124 34.466 -17.559 1.00 130.02 ? 657  GLU A CB  1 
ATOM   4675 C CG  . GLU A 1 613 ? -27.379 35.916 -17.249 1.00 128.15 ? 657  GLU A CG  1 
ATOM   4676 C CD  . GLU A 1 613 ? -26.935 36.826 -18.385 1.00 131.12 ? 657  GLU A CD  1 
ATOM   4677 O OE1 . GLU A 1 613 ? -26.253 36.335 -19.315 1.00 133.74 ? 657  GLU A OE1 1 
ATOM   4678 O OE2 . GLU A 1 613 ? -27.297 38.026 -18.368 1.00 131.78 ? 657  GLU A OE2 1 
ATOM   4679 N N   . GLN A 1 614 ? -29.456 33.613 -15.207 1.00 128.28 ? 658  GLN A N   1 
ATOM   4680 C CA  . GLN A 1 614 ? -30.871 33.278 -15.010 1.00 127.14 ? 658  GLN A CA  1 
ATOM   4681 C C   . GLN A 1 614 ? -31.689 33.916 -16.126 1.00 130.36 ? 658  GLN A C   1 
ATOM   4682 O O   . GLN A 1 614 ? -31.352 35.016 -16.563 1.00 131.62 ? 658  GLN A O   1 
ATOM   4683 C CB  . GLN A 1 614 ? -31.358 33.769 -13.646 1.00 123.13 ? 658  GLN A CB  1 
ATOM   4684 C CG  . GLN A 1 614 ? -31.996 32.688 -12.789 1.00 121.00 ? 658  GLN A CG  1 
ATOM   4685 C CD  . GLN A 1 614 ? -31.680 32.851 -11.315 1.00 117.29 ? 658  GLN A CD  1 
ATOM   4686 O OE1 . GLN A 1 614 ? -30.693 33.487 -10.947 1.00 115.36 ? 658  GLN A OE1 1 
ATOM   4687 N NE2 . GLN A 1 614 ? -32.520 32.275 -10.463 1.00 116.05 ? 658  GLN A NE2 1 
ATOM   4688 N N   . PRO A 1 615 ? -32.765 33.278 -16.569 1.00 143.28 ? 659  PRO A N   1 
ATOM   4689 C CA  . PRO A 1 615 ? -33.531 33.832 -17.691 1.00 148.23 ? 659  PRO A CA  1 
ATOM   4690 C C   . PRO A 1 615 ? -34.053 35.209 -17.304 1.00 148.40 ? 659  PRO A C   1 
ATOM   4691 O O   . PRO A 1 615 ? -34.048 36.143 -18.106 1.00 152.65 ? 659  PRO A O   1 
ATOM   4692 C CB  . PRO A 1 615 ? -34.691 32.848 -17.838 1.00 149.51 ? 659  PRO A CB  1 
ATOM   4693 C CG  . PRO A 1 615 ? -34.150 31.558 -17.325 1.00 146.56 ? 659  PRO A CG  1 
ATOM   4694 C CD  . PRO A 1 615 ? -33.213 31.922 -16.208 1.00 141.69 ? 659  PRO A CD  1 
ATOM   4695 N N   . GLU A 1 616 ? -34.491 35.313 -16.057 1.00 170.03 ? 660  GLU A N   1 
ATOM   4696 C CA  . GLU A 1 616 ? -34.868 36.571 -15.432 1.00 167.97 ? 660  GLU A CA  1 
ATOM   4697 C C   . GLU A 1 616 ? -34.820 36.476 -13.911 1.00 164.51 ? 660  GLU A C   1 
ATOM   4698 O O   . GLU A 1 616 ? -34.963 35.394 -13.340 1.00 164.17 ? 660  GLU A O   1 
ATOM   4699 C CB  . GLU A 1 616 ? -36.264 36.999 -15.889 1.00 172.35 ? 660  GLU A CB  1 
ATOM   4700 C CG  . GLU A 1 616 ? -36.351 37.368 -17.361 1.00 171.68 ? 660  GLU A CG  1 
ATOM   4701 C CD  . GLU A 1 616 ? -37.762 37.716 -17.792 1.00 172.93 ? 660  GLU A CD  1 
ATOM   4702 O OE1 . GLU A 1 616 ? -38.700 37.488 -17.000 1.00 175.82 ? 660  GLU A OE1 1 
ATOM   4703 O OE2 . GLU A 1 616 ? -37.933 38.216 -18.924 1.00 171.11 ? 660  GLU A OE2 1 
ATOM   4704 N N   . LEU A 1 617 ? -34.638 37.620 -13.261 1.00 106.02 ? 661  LEU A N   1 
ATOM   4705 C CA  . LEU A 1 617 ? -34.819 37.735 -11.812 1.00 101.93 ? 661  LEU A CA  1 
ATOM   4706 C C   . LEU A 1 617 ? -36.249 37.789 -11.204 1.00 102.75 ? 661  LEU A C   1 
ATOM   4707 O O   . LEU A 1 617 ? -37.106 38.569 -11.622 1.00 106.01 ? 661  LEU A O   1 
ATOM   4708 C CB  . LEU A 1 617 ? -34.059 38.978 -11.366 1.00 100.15 ? 661  LEU A CB  1 
ATOM   4709 C CG  . LEU A 1 617 ? -32.644 38.968 -11.931 1.00 99.66  ? 661  LEU A CG  1 
ATOM   4710 C CD1 . LEU A 1 617 ? -32.011 40.343 -11.908 1.00 99.98  ? 661  LEU A CD1 1 
ATOM   4711 C CD2 . LEU A 1 617 ? -31.775 37.967 -11.151 1.00 95.39  ? 661  LEU A CD2 1 
ATOM   4712 N N   . LYS A 1 618 ? -36.436 36.994 -10.156 1.00 130.78 ? 662  LYS A N   1 
ATOM   4713 C CA  . LYS A 1 618 ? -37.694 36.809 -9.442  1.00 131.30 ? 662  LYS A CA  1 
ATOM   4714 C C   . LYS A 1 618 ? -37.471 37.171 -7.969  1.00 127.20 ? 662  LYS A C   1 
ATOM   4715 O O   . LYS A 1 618 ? -36.335 37.369 -7.559  1.00 124.38 ? 662  LYS A O   1 
ATOM   4716 C CB  . LYS A 1 618 ? -38.173 35.354 -9.597  1.00 132.46 ? 662  LYS A CB  1 
ATOM   4717 C CG  . LYS A 1 618 ? -39.455 34.962 -8.850  1.00 133.37 ? 662  LYS A CG  1 
ATOM   4718 C CD  . LYS A 1 618 ? -40.216 33.826 -9.544  1.00 137.16 ? 662  LYS A CD  1 
ATOM   4719 C CE  . LYS A 1 618 ? -40.964 32.950 -8.530  1.00 136.65 ? 662  LYS A CE  1 
ATOM   4720 N NZ  . LYS A 1 618 ? -40.067 32.513 -7.399  1.00 131.75 ? 662  LYS A NZ  1 
ATOM   4721 N N   . GLY A 1 619 ? -38.547 37.329 -7.200  1.00 101.49 ? 663  GLY A N   1 
ATOM   4722 C CA  . GLY A 1 619 ? -38.473 37.399 -5.744  1.00 96.99  ? 663  GLY A CA  1 
ATOM   4723 C C   . GLY A 1 619 ? -37.490 38.401 -5.181  1.00 95.69  ? 663  GLY A C   1 
ATOM   4724 O O   . GLY A 1 619 ? -37.438 39.538 -5.642  1.00 98.10  ? 663  GLY A O   1 
ATOM   4725 N N   . HIS A 1 620 ? -36.688 37.978 -4.204  1.00 111.69 ? 664  HIS A N   1 
ATOM   4726 C CA  . HIS A 1 620 ? -35.760 38.899 -3.564  1.00 111.23 ? 664  HIS A CA  1 
ATOM   4727 C C   . HIS A 1 620 ? -34.550 39.140 -4.467  1.00 113.03 ? 664  HIS A C   1 
ATOM   4728 O O   . HIS A 1 620 ? -33.744 40.032 -4.210  1.00 114.05 ? 664  HIS A O   1 
ATOM   4729 C CB  . HIS A 1 620 ? -35.351 38.393 -2.169  1.00 107.77 ? 664  HIS A CB  1 
ATOM   4730 C CG  . HIS A 1 620 ? -34.521 37.142 -2.175  1.00 105.79 ? 664  HIS A CG  1 
ATOM   4731 N ND1 . HIS A 1 620 ? -33.143 37.155 -2.290  1.00 105.97 ? 664  HIS A ND1 1 
ATOM   4732 C CD2 . HIS A 1 620 ? -34.873 35.839 -2.045  1.00 103.81 ? 664  HIS A CD2 1 
ATOM   4733 C CE1 . HIS A 1 620 ? -32.685 35.915 -2.257  1.00 104.06 ? 664  HIS A CE1 1 
ATOM   4734 N NE2 . HIS A 1 620 ? -33.713 35.098 -2.106  1.00 102.90 ? 664  HIS A NE2 1 
ATOM   4735 N N   . ASP A 1 621 ? -34.436 38.369 -5.544  1.00 97.59  ? 665  ASP A N   1 
ATOM   4736 C CA  . ASP A 1 621 ? -33.417 38.658 -6.547  1.00 99.30  ? 665  ASP A CA  1 
ATOM   4737 C C   . ASP A 1 621 ? -33.774 39.939 -7.259  1.00 102.45 ? 665  ASP A C   1 
ATOM   4738 O O   . ASP A 1 621 ? -32.904 40.746 -7.597  1.00 103.61 ? 665  ASP A O   1 
ATOM   4739 C CB  . ASP A 1 621 ? -33.276 37.527 -7.565  1.00 100.41 ? 665  ASP A CB  1 
ATOM   4740 C CG  . ASP A 1 621 ? -32.400 36.406 -7.068  1.00 97.72  ? 665  ASP A CG  1 
ATOM   4741 O OD1 . ASP A 1 621 ? -31.183 36.639 -6.874  1.00 96.16  ? 665  ASP A OD1 1 
ATOM   4742 O OD2 . ASP A 1 621 ? -32.931 35.291 -6.877  1.00 97.48  ? 665  ASP A OD2 1 
ATOM   4743 N N   . LEU A 1 622 ? -35.075 40.114 -7.484  1.00 90.80  ? 666  LEU A N   1 
ATOM   4744 C CA  . LEU A 1 622 ? -35.579 41.302 -8.132  1.00 94.28  ? 666  LEU A CA  1 
ATOM   4745 C C   . LEU A 1 622 ? -35.538 42.483 -7.185  1.00 93.20  ? 666  LEU A C   1 
ATOM   4746 O O   . LEU A 1 622 ? -35.283 43.598 -7.601  1.00 95.15  ? 666  LEU A O   1 
ATOM   4747 C CB  . LEU A 1 622 ? -36.986 41.062 -8.643  1.00 97.74  ? 666  LEU A CB  1 
ATOM   4748 C CG  . LEU A 1 622 ? -37.607 42.178 -9.465  1.00 102.06 ? 666  LEU A CG  1 
ATOM   4749 C CD1 . LEU A 1 622 ? -36.780 42.468 -10.691 1.00 104.27 ? 666  LEU A CD1 1 
ATOM   4750 C CD2 . LEU A 1 622 ? -38.997 41.750 -9.846  1.00 105.32 ? 666  LEU A CD2 1 
ATOM   4751 N N   . GLU A 1 623 ? -35.767 42.245 -5.906  1.00 92.98  ? 667  GLU A N   1 
ATOM   4752 C CA  . GLU A 1 623 ? -35.711 43.347 -4.959  1.00 94.03  ? 667  GLU A CA  1 
ATOM   4753 C C   . GLU A 1 623 ? -34.296 43.871 -4.932  1.00 95.84  ? 667  GLU A C   1 
ATOM   4754 O O   . GLU A 1 623 ? -34.080 45.066 -5.097  1.00 99.83  ? 667  GLU A O   1 
ATOM   4755 C CB  . GLU A 1 623 ? -36.127 42.930 -3.545  1.00 90.83  ? 667  GLU A CB  1 
ATOM   4756 C CG  . GLU A 1 623 ? -37.581 42.688 -3.305  1.00 89.77  ? 667  GLU A CG  1 
ATOM   4757 C CD  . GLU A 1 623 ? -37.833 42.123 -1.911  1.00 86.36  ? 667  GLU A CD  1 
ATOM   4758 O OE1 . GLU A 1 623 ? -36.879 41.591 -1.291  1.00 83.42  ? 667  GLU A OE1 1 
ATOM   4759 O OE2 . GLU A 1 623 ? -38.989 42.235 -1.422  1.00 87.86  ? 667  GLU A OE2 1 
ATOM   4760 N N   . PHE A 1 624 ? -33.342 42.965 -4.723  1.00 121.40 ? 668  PHE A N   1 
ATOM   4761 C CA  . PHE A 1 624 ? -31.930 43.323 -4.684  1.00 123.01 ? 668  PHE A CA  1 
ATOM   4762 C C   . PHE A 1 624 ? -31.555 44.103 -5.928  1.00 126.29 ? 668  PHE A C   1 
ATOM   4763 O O   . PHE A 1 624 ? -31.000 45.179 -5.820  1.00 130.06 ? 668  PHE A O   1 
ATOM   4764 C CB  . PHE A 1 624 ? -31.035 42.090 -4.553  1.00 119.39 ? 668  PHE A CB  1 
ATOM   4765 C CG  . PHE A 1 624 ? -29.574 42.421 -4.353  1.00 121.01 ? 668  PHE A CG  1 
ATOM   4766 C CD1 . PHE A 1 624 ? -29.183 43.670 -3.883  1.00 125.18 ? 668  PHE A CD1 1 
ATOM   4767 C CD2 . PHE A 1 624 ? -28.585 41.484 -4.635  1.00 118.47 ? 668  PHE A CD2 1 
ATOM   4768 C CE1 . PHE A 1 624 ? -27.835 43.981 -3.703  1.00 126.33 ? 668  PHE A CE1 1 
ATOM   4769 C CE2 . PHE A 1 624 ? -27.228 41.784 -4.450  1.00 120.01 ? 668  PHE A CE2 1 
ATOM   4770 C CZ  . PHE A 1 624 ? -26.858 43.034 -3.986  1.00 124.05 ? 668  PHE A CZ  1 
ATOM   4771 N N   . CYS A 1 625 ? -31.881 43.581 -7.106  1.00 104.09 ? 669  CYS A N   1 
ATOM   4772 C CA  . CYS A 1 625 ? -31.610 44.316 -8.340  1.00 106.87 ? 669  CYS A CA  1 
ATOM   4773 C C   . CYS A 1 625 ? -32.249 45.710 -8.374  1.00 111.32 ? 669  CYS A C   1 
ATOM   4774 O O   . CYS A 1 625 ? -31.643 46.664 -8.839  1.00 114.67 ? 669  CYS A O   1 
ATOM   4775 C CB  . CYS A 1 625 ? -32.074 43.523 -9.557  1.00 106.10 ? 669  CYS A CB  1 
ATOM   4776 S SG  . CYS A 1 625 ? -31.221 44.044 -11.078 1.00 108.22 ? 669  CYS A SG  1 
ATOM   4777 N N   . LEU A 1 626 ? -33.466 45.845 -7.885  1.00 120.59 ? 670  LEU A N   1 
ATOM   4778 C CA  . LEU A 1 626 ? -34.095 47.145 -7.983  1.00 125.17 ? 670  LEU A CA  1 
ATOM   4779 C C   . LEU A 1 626 ? -33.370 48.171 -7.108  1.00 128.37 ? 670  LEU A C   1 
ATOM   4780 O O   . LEU A 1 626 ? -32.907 49.190 -7.612  1.00 132.12 ? 670  LEU A O   1 
ATOM   4781 C CB  . LEU A 1 626 ? -35.583 47.054 -7.625  1.00 124.30 ? 670  LEU A CB  1 
ATOM   4782 C CG  . LEU A 1 626 ? -36.430 46.265 -8.631  1.00 123.02 ? 670  LEU A CG  1 
ATOM   4783 C CD1 . LEU A 1 626 ? -37.850 46.137 -8.147  1.00 122.43 ? 670  LEU A CD1 1 
ATOM   4784 C CD2 . LEU A 1 626 ? -36.385 46.901 -9.999  1.00 126.49 ? 670  LEU A CD2 1 
ATOM   4785 N N   . TYR A 1 627 ? -33.254 47.899 -5.814  1.00 157.98 ? 671  TYR A N   1 
ATOM   4786 C CA  . TYR A 1 627 ? -32.683 48.864 -4.872  1.00 158.92 ? 671  TYR A CA  1 
ATOM   4787 C C   . TYR A 1 627 ? -31.226 48.615 -4.509  1.00 157.16 ? 671  TYR A C   1 
ATOM   4788 O O   . TYR A 1 627 ? -30.668 49.314 -3.667  1.00 156.02 ? 671  TYR A O   1 
ATOM   4789 C CB  . TYR A 1 627 ? -33.529 48.901 -3.605  1.00 156.48 ? 671  TYR A CB  1 
ATOM   4790 C CG  . TYR A 1 627 ? -34.987 48.753 -3.921  1.00 156.72 ? 671  TYR A CG  1 
ATOM   4791 C CD1 . TYR A 1 627 ? -35.771 49.861 -4.200  1.00 159.72 ? 671  TYR A CD1 1 
ATOM   4792 C CD2 . TYR A 1 627 ? -35.580 47.501 -3.969  1.00 153.08 ? 671  TYR A CD2 1 
ATOM   4793 C CE1 . TYR A 1 627 ? -37.109 49.725 -4.506  1.00 159.87 ? 671  TYR A CE1 1 
ATOM   4794 C CE2 . TYR A 1 627 ? -36.914 47.356 -4.282  1.00 152.28 ? 671  TYR A CE2 1 
ATOM   4795 C CZ  . TYR A 1 627 ? -37.676 48.473 -4.553  1.00 155.89 ? 671  TYR A CZ  1 
ATOM   4796 O OH  . TYR A 1 627 ? -39.015 48.347 -4.863  1.00 155.25 ? 671  TYR A OH  1 
ATOM   4797 N N   . GLY A 1 628 ? -30.619 47.611 -5.127  1.00 137.91 ? 672  GLY A N   1 
ATOM   4798 C CA  . GLY A 1 628 ? -29.284 47.184 -4.748  1.00 135.92 ? 672  GLY A CA  1 
ATOM   4799 C C   . GLY A 1 628 ? -28.137 48.138 -4.971  1.00 136.93 ? 672  GLY A C   1 
ATOM   4800 O O   . GLY A 1 628 ? -28.168 49.004 -5.848  1.00 139.51 ? 672  GLY A O   1 
ATOM   4801 N N   . ARG A 1 629 ? -27.110 47.967 -4.151  1.00 181.46 ? 673  ARG A N   1 
ATOM   4802 C CA  . ARG A 1 629 ? -25.904 48.744 -4.313  1.00 181.26 ? 673  ARG A CA  1 
ATOM   4803 C C   . ARG A 1 629 ? -25.265 48.403 -5.641  1.00 182.17 ? 673  ARG A C   1 
ATOM   4804 O O   . ARG A 1 629 ? -25.197 47.236 -6.010  1.00 181.11 ? 673  ARG A O   1 
ATOM   4805 C CB  . ARG A 1 629 ? -24.928 48.485 -3.186  1.00 177.93 ? 673  ARG A CB  1 
ATOM   4806 C CG  . ARG A 1 629 ? -23.976 49.623 -3.079  1.00 177.62 ? 673  ARG A CG  1 
ATOM   4807 C CD  . ARG A 1 629 ? -22.808 49.295 -2.222  1.00 172.99 ? 673  ARG A CD  1 
ATOM   4808 N NE  . ARG A 1 629 ? -22.803 50.143 -1.050  1.00 169.91 ? 673  ARG A NE  1 
ATOM   4809 C CZ  . ARG A 1 629 ? -22.648 49.700 0.187   1.00 163.72 ? 673  ARG A CZ  1 
ATOM   4810 N NH1 . ARG A 1 629 ? -22.431 48.413 0.435   1.00 160.58 ? 673  ARG A NH1 1 
ATOM   4811 N NH2 . ARG A 1 629 ? -22.676 50.571 1.177   1.00 160.44 ? 673  ARG A NH2 1 
ATOM   4812 N N   . GLU A 1 630 ? -24.803 49.409 -6.374  1.00 160.11 ? 674  GLU A N   1 
ATOM   4813 C CA  . GLU A 1 630 ? -24.488 49.189 -7.779  1.00 161.57 ? 674  GLU A CA  1 
ATOM   4814 C C   . GLU A 1 630 ? -23.132 48.553 -8.063  1.00 158.30 ? 674  GLU A C   1 
ATOM   4815 O O   . GLU A 1 630 ? -22.983 47.917 -9.102  1.00 156.31 ? 674  GLU A O   1 
ATOM   4816 C CB  . GLU A 1 630 ? -24.627 50.492 -8.587  1.00 164.70 ? 674  GLU A CB  1 
ATOM   4817 C CG  . GLU A 1 630 ? -24.287 51.803 -7.879  1.00 164.11 ? 674  GLU A CG  1 
ATOM   4818 C CD  . GLU A 1 630 ? -25.379 52.275 -6.926  1.00 162.89 ? 674  GLU A CD  1 
ATOM   4819 O OE1 . GLU A 1 630 ? -26.050 51.429 -6.298  1.00 159.96 ? 674  GLU A OE1 1 
ATOM   4820 O OE2 . GLU A 1 630 ? -25.584 53.501 -6.816  1.00 164.35 ? 674  GLU A OE2 1 
ATOM   4821 N N   . GLU A 1 631 ? -22.155 48.681 -7.171  1.00 231.66 ? 675  GLU A N   1 
ATOM   4822 C CA  . GLU A 1 631 ? -20.853 48.076 -7.463  1.00 229.19 ? 675  GLU A CA  1 
ATOM   4823 C C   . GLU A 1 631 ? -20.979 46.541 -7.607  1.00 227.07 ? 675  GLU A C   1 
ATOM   4824 O O   . GLU A 1 631 ? -20.272 45.937 -8.410  1.00 225.10 ? 675  GLU A O   1 
ATOM   4825 C CB  . GLU A 1 631 ? -19.803 48.449 -6.399  1.00 225.50 ? 675  GLU A CB  1 
ATOM   4826 C CG  . GLU A 1 631 ? -18.565 47.541 -6.363  1.00 221.12 ? 675  GLU A CG  1 
ATOM   4827 C CD  . GLU A 1 631 ? -18.641 46.458 -5.301  1.00 213.53 ? 675  GLU A CD  1 
ATOM   4828 O OE1 . GLU A 1 631 ? -18.802 46.817 -4.117  1.00 210.26 ? 675  GLU A OE1 1 
ATOM   4829 O OE2 . GLU A 1 631 ? -18.545 45.256 -5.639  1.00 210.94 ? 675  GLU A OE2 1 
ATOM   4830 N N   . HIS A 1 632 ? -21.904 45.924 -6.868  1.00 179.97 ? 676  HIS A N   1 
ATOM   4831 C CA  . HIS A 1 632 ? -22.082 44.459 -6.912  1.00 176.16 ? 676  HIS A CA  1 
ATOM   4832 C C   . HIS A 1 632 ? -22.932 43.967 -8.070  1.00 175.34 ? 676  HIS A C   1 
ATOM   4833 O O   . HIS A 1 632 ? -23.091 42.760 -8.250  1.00 171.62 ? 676  HIS A O   1 
ATOM   4834 C CB  . HIS A 1 632 ? -22.741 43.940 -5.634  1.00 175.21 ? 676  HIS A CB  1 
ATOM   4835 C CG  . HIS A 1 632 ? -22.292 44.632 -4.386  1.00 177.11 ? 676  HIS A CG  1 
ATOM   4836 N ND1 . HIS A 1 632 ? -20.978 44.771 -4.063  1.00 177.30 ? 676  HIS A ND1 1 
ATOM   4837 C CD2 . HIS A 1 632 ? -23.013 45.236 -3.406  1.00 177.53 ? 676  HIS A CD2 1 
ATOM   4838 C CE1 . HIS A 1 632 ? -20.882 45.425 -2.905  1.00 177.42 ? 676  HIS A CE1 1 
ATOM   4839 N NE2 . HIS A 1 632 ? -22.093 45.715 -2.500  1.00 177.54 ? 676  HIS A NE2 1 
ATOM   4840 N N   . LEU A 1 633 ? -23.510 44.890 -8.828  1.00 167.50 ? 677  LEU A N   1 
ATOM   4841 C CA  . LEU A 1 633 ? -24.513 44.512 -9.812  1.00 166.35 ? 677  LEU A CA  1 
ATOM   4842 C C   . LEU A 1 633 ? -23.906 43.793 -11.001 1.00 164.05 ? 677  LEU A C   1 
ATOM   4843 O O   . LEU A 1 633 ? -24.465 42.807 -11.483 1.00 161.91 ? 677  LEU A O   1 
ATOM   4844 C CB  . LEU A 1 633 ? -25.292 45.740 -10.265 1.00 169.11 ? 677  LEU A CB  1 
ATOM   4845 C CG  . LEU A 1 633 ? -26.184 46.225 -9.122  1.00 169.34 ? 677  LEU A CG  1 
ATOM   4846 C CD1 . LEU A 1 633 ? -27.043 47.398 -9.551  1.00 175.21 ? 677  LEU A CD1 1 
ATOM   4847 C CD2 . LEU A 1 633 ? -27.049 45.081 -8.599  1.00 163.08 ? 677  LEU A CD2 1 
ATOM   4848 N N   . THR A 1 634 ? -22.764 44.279 -11.474 1.00 164.90 ? 678  THR A N   1 
ATOM   4849 C CA  . THR A 1 634 ? -22.031 43.548 -12.491 1.00 162.41 ? 678  THR A CA  1 
ATOM   4850 C C   . THR A 1 634 ? -21.444 42.326 -11.828 1.00 159.22 ? 678  THR A C   1 
ATOM   4851 O O   . THR A 1 634 ? -20.778 42.428 -10.799 1.00 159.00 ? 678  THR A O   1 
ATOM   4852 C CB  . THR A 1 634 ? -20.899 44.365 -13.134 1.00 163.27 ? 678  THR A CB  1 
ATOM   4853 O OG1 . THR A 1 634 ? -19.798 44.457 -12.219 1.00 162.61 ? 678  THR A OG1 1 
ATOM   4854 C CG2 . THR A 1 634 ? -21.376 45.758 -13.525 1.00 167.14 ? 678  THR A CG2 1 
ATOM   4855 N N   . THR A 1 635 ? -21.696 41.166 -12.408 1.00 119.59 ? 679  THR A N   1 
ATOM   4856 C CA  . THR A 1 635 ? -21.171 39.950 -11.833 1.00 116.73 ? 679  THR A CA  1 
ATOM   4857 C C   . THR A 1 635 ? -20.274 39.223 -12.802 1.00 114.96 ? 679  THR A C   1 
ATOM   4858 O O   . THR A 1 635 ? -20.320 39.426 -14.021 1.00 115.88 ? 679  THR A O   1 
ATOM   4859 C CB  . THR A 1 635 ? -22.276 39.004 -11.410 1.00 116.10 ? 679  THR A CB  1 
ATOM   4860 O OG1 . THR A 1 635 ? -22.932 38.501 -12.580 1.00 117.00 ? 679  THR A OG1 1 
ATOM   4861 C CG2 . THR A 1 635 ? -23.275 39.737 -10.532 1.00 117.59 ? 679  THR A CG2 1 
ATOM   4862 N N   . ASN A 1 636 ? -19.454 38.360 -12.230 1.00 139.12 ? 680  ASN A N   1 
ATOM   4863 C CA  . ASN A 1 636 ? -18.553 37.537 -12.995 1.00 137.34 ? 680  ASN A CA  1 
ATOM   4864 C C   . ASN A 1 636 ? -19.230 36.200 -13.244 1.00 137.34 ? 680  ASN A C   1 
ATOM   4865 O O   . ASN A 1 636 ? -18.652 35.281 -13.822 1.00 136.43 ? 680  ASN A O   1 
ATOM   4866 C CB  . ASN A 1 636 ? -17.251 37.409 -12.228 1.00 135.19 ? 680  ASN A CB  1 
ATOM   4867 C CG  . ASN A 1 636 ? -16.923 38.682 -11.468 1.00 136.12 ? 680  ASN A CG  1 
ATOM   4868 O OD1 . ASN A 1 636 ? -17.373 38.881 -10.342 1.00 137.05 ? 680  ASN A OD1 1 
ATOM   4869 N ND2 . ASN A 1 636 ? -16.177 39.572 -12.104 1.00 136.31 ? 680  ASN A ND2 1 
ATOM   4870 N N   . GLY A 1 637 ? -20.470 36.105 -12.760 1.00 98.94  ? 681  GLY A N   1 
ATOM   4871 C CA  . GLY A 1 637 ? -21.266 34.890 -12.823 1.00 99.63  ? 681  GLY A CA  1 
ATOM   4872 C C   . GLY A 1 637 ? -20.800 33.887 -11.778 1.00 97.50  ? 681  GLY A C   1 
ATOM   4873 O O   . GLY A 1 637 ? -21.495 32.930 -11.436 1.00 98.10  ? 681  GLY A O   1 
ATOM   4874 N N   . TYR A 1 638 ? -19.602 34.148 -11.265 1.00 76.56  ? 682  TYR A N   1 
ATOM   4875 C CA  . TYR A 1 638 ? -18.807 33.211 -10.484 1.00 75.17  ? 682  TYR A CA  1 
ATOM   4876 C C   . TYR A 1 638 ? -17.989 33.898 -9.427  1.00 74.01  ? 682  TYR A C   1 
ATOM   4877 O O   . TYR A 1 638 ? -17.251 34.867 -9.707  1.00 76.26  ? 682  TYR A O   1 
ATOM   4878 C CB  . TYR A 1 638 ? -17.842 32.469 -11.364 1.00 78.23  ? 682  TYR A CB  1 
ATOM   4879 C CG  . TYR A 1 638 ? -18.385 31.397 -12.237 1.00 79.59  ? 682  TYR A CG  1 
ATOM   4880 C CD1 . TYR A 1 638 ? -18.690 30.149 -11.728 1.00 77.66  ? 682  TYR A CD1 1 
ATOM   4881 C CD2 . TYR A 1 638 ? -18.495 31.599 -13.599 1.00 83.36  ? 682  TYR A CD2 1 
ATOM   4882 C CE1 . TYR A 1 638 ? -19.138 29.140 -12.549 1.00 79.49  ? 682  TYR A CE1 1 
ATOM   4883 C CE2 . TYR A 1 638 ? -18.933 30.604 -14.433 1.00 85.23  ? 682  TYR A CE2 1 
ATOM   4884 C CZ  . TYR A 1 638 ? -19.262 29.377 -13.908 1.00 83.34  ? 682  TYR A CZ  1 
ATOM   4885 O OH  . TYR A 1 638 ? -19.704 28.393 -14.765 1.00 85.73  ? 682  TYR A OH  1 
ATOM   4886 N N   . ARG A 1 639 ? -18.066 33.330 -8.235  1.00 79.82  ? 683  ARG A N   1 
ATOM   4887 C CA  . ARG A 1 639 ? -17.205 33.711 -7.132  1.00 80.14  ? 683  ARG A CA  1 
ATOM   4888 C C   . ARG A 1 639 ? -16.633 32.500 -6.414  1.00 79.15  ? 683  ARG A C   1 
ATOM   4889 O O   . ARG A 1 639 ? -17.355 31.539 -6.112  1.00 78.05  ? 683  ARG A O   1 
ATOM   4890 C CB  . ARG A 1 639 ? -17.961 34.579 -6.136  1.00 80.91  ? 683  ARG A CB  1 
ATOM   4891 C CG  . ARG A 1 639 ? -17.954 36.024 -6.503  1.00 82.83  ? 683  ARG A CG  1 
ATOM   4892 C CD  . ARG A 1 639 ? -18.432 36.833 -5.335  1.00 84.92  ? 683  ARG A CD  1 
ATOM   4893 N NE  . ARG A 1 639 ? -17.331 37.341 -4.527  1.00 87.53  ? 683  ARG A NE  1 
ATOM   4894 C CZ  . ARG A 1 639 ? -16.748 38.506 -4.763  1.00 89.91  ? 683  ARG A CZ  1 
ATOM   4895 N NH1 . ARG A 1 639 ? -17.145 39.254 -5.793  1.00 90.15  ? 683  ARG A NH1 1 
ATOM   4896 N NH2 . ARG A 1 639 ? -15.770 38.919 -3.978  1.00 91.78  ? 683  ARG A NH2 1 
ATOM   4897 N N   . LYS A 1 640 ? -15.334 32.571 -6.131  1.00 79.88  ? 684  LYS A N   1 
ATOM   4898 C CA  . LYS A 1 640 ? -14.682 31.586 -5.283  1.00 78.99  ? 684  LYS A CA  1 
ATOM   4899 C C   . LYS A 1 640 ? -15.379 31.449 -3.930  1.00 78.47  ? 684  LYS A C   1 
ATOM   4900 O O   . LYS A 1 640 ? -15.576 32.429 -3.209  1.00 79.97  ? 684  LYS A O   1 
ATOM   4901 C CB  . LYS A 1 640 ? -13.227 31.955 -5.067  1.00 79.76  ? 684  LYS A CB  1 
ATOM   4902 C CG  . LYS A 1 640 ? -12.308 30.796 -5.225  1.00 78.70  ? 684  LYS A CG  1 
ATOM   4903 C CD  . LYS A 1 640 ? -10.895 31.291 -5.368  1.00 79.25  ? 684  LYS A CD  1 
ATOM   4904 C CE  . LYS A 1 640 ? -10.022 30.219 -5.914  1.00 78.16  ? 684  LYS A CE  1 
ATOM   4905 N NZ  . LYS A 1 640 ? -8.648  30.726 -5.855  1.00 80.84  ? 684  LYS A NZ  1 
ATOM   4906 N N   . ILE A 1 641 ? -15.733 30.211 -3.608  1.00 62.23  ? 685  ILE A N   1 
ATOM   4907 C CA  . ILE A 1 641 ? -16.304 29.873 -2.327  1.00 59.32  ? 685  ILE A CA  1 
ATOM   4908 C C   . ILE A 1 641 ? -15.420 30.482 -1.245  1.00 58.83  ? 685  ILE A C   1 
ATOM   4909 O O   . ILE A 1 641 ? -14.201 30.372 -1.306  1.00 59.97  ? 685  ILE A O   1 
ATOM   4910 C CB  . ILE A 1 641 ? -16.422 28.341 -2.155  1.00 58.09  ? 685  ILE A CB  1 
ATOM   4911 C CG1 . ILE A 1 641 ? -17.516 27.782 -3.076  1.00 58.73  ? 685  ILE A CG1 1 
ATOM   4912 C CG2 . ILE A 1 641 ? -16.679 27.996 -0.717  1.00 55.49  ? 685  ILE A CG2 1 
ATOM   4913 C CD1 . ILE A 1 641 ? -17.474 26.258 -3.282  1.00 58.74  ? 685  ILE A CD1 1 
ATOM   4914 N N   . PRO A 1 642 ? -16.028 31.176 -0.270  1.00 61.03  ? 686  PRO A N   1 
ATOM   4915 C CA  . PRO A 1 642 ? -15.197 31.790 0.783   1.00 62.90  ? 686  PRO A CA  1 
ATOM   4916 C C   . PRO A 1 642 ? -14.416 30.754 1.594   1.00 61.53  ? 686  PRO A C   1 
ATOM   4917 O O   . PRO A 1 642 ? -14.980 29.732 2.008   1.00 59.17  ? 686  PRO A O   1 
ATOM   4918 C CB  . PRO A 1 642 ? -16.217 32.517 1.658   1.00 63.97  ? 686  PRO A CB  1 
ATOM   4919 C CG  . PRO A 1 642 ? -17.583 31.918 1.260   1.00 61.30  ? 686  PRO A CG  1 
ATOM   4920 C CD  . PRO A 1 642 ? -17.460 31.518 -0.154  1.00 60.46  ? 686  PRO A CD  1 
ATOM   4921 N N   . GLY A 1 643 ? -13.123 31.016 1.785   1.00 62.62  ? 687  GLY A N   1 
ATOM   4922 C CA  . GLY A 1 643 ? -12.259 30.143 2.546   1.00 61.46  ? 687  GLY A CA  1 
ATOM   4923 C C   . GLY A 1 643 ? -11.714 29.047 1.657   1.00 59.44  ? 687  GLY A C   1 
ATOM   4924 O O   . GLY A 1 643 ? -11.061 28.115 2.134   1.00 57.95  ? 687  GLY A O   1 
ATOM   4925 N N   . ASP A 1 644 ? -12.007 29.136 0.366   1.00 69.37  ? 688  ASP A N   1 
ATOM   4926 C CA  . ASP A 1 644 ? -11.518 28.139 -0.564  1.00 68.00  ? 688  ASP A CA  1 
ATOM   4927 C C   . ASP A 1 644 ? -10.109 28.548 -1.040  1.00 68.64  ? 688  ASP A C   1 
ATOM   4928 O O   . ASP A 1 644 ? -9.911  29.636 -1.556  1.00 70.18  ? 688  ASP A O   1 
ATOM   4929 C CB  . ASP A 1 644 ? -12.489 27.965 -1.734  1.00 68.41  ? 688  ASP A CB  1 
ATOM   4930 C CG  . ASP A 1 644 ? -12.121 26.788 -2.625  1.00 68.30  ? 688  ASP A CG  1 
ATOM   4931 O OD1 . ASP A 1 644 ? -10.940 26.682 -3.065  1.00 68.74  ? 688  ASP A OD1 1 
ATOM   4932 O OD2 . ASP A 1 644 ? -13.010 25.946 -2.861  1.00 68.19  ? 688  ASP A OD2 1 
ATOM   4933 N N   . LYS A 1 645 ? -9.131  27.690 -0.795  1.00 86.54  ? 689  LYS A N   1 
ATOM   4934 C CA  . LYS A 1 645 ? -7.736  27.993 -1.083  1.00 86.67  ? 689  LYS A CA  1 
ATOM   4935 C C   . LYS A 1 645 ? -7.155  27.371 -2.365  1.00 87.11  ? 689  LYS A C   1 
ATOM   4936 O O   . LYS A 1 645 ? -5.954  27.419 -2.590  1.00 86.91  ? 689  LYS A O   1 
ATOM   4937 C CB  . LYS A 1 645 ? -6.902  27.602 0.123   1.00 84.85  ? 689  LYS A CB  1 
ATOM   4938 C CG  . LYS A 1 645 ? -7.229  28.458 1.328   1.00 85.10  ? 689  LYS A CG  1 
ATOM   4939 C CD  . LYS A 1 645 ? -6.360  28.091 2.518   1.00 82.93  ? 689  LYS A CD  1 
ATOM   4940 C CE  . LYS A 1 645 ? -6.715  28.929 3.756   1.00 83.60  ? 689  LYS A CE  1 
ATOM   4941 N NZ  . LYS A 1 645 ? -6.511  28.159 5.046   1.00 81.47  ? 689  LYS A NZ  1 
ATOM   4942 N N   . CYS A 1 646 ? -7.991  26.742 -3.176  1.00 67.93  ? 690  CYS A N   1 
ATOM   4943 C CA  . CYS A 1 646 ? -7.531  26.055 -4.384  1.00 70.88  ? 690  CYS A CA  1 
ATOM   4944 C C   . CYS A 1 646 ? -6.717  26.955 -5.324  1.00 75.22  ? 690  CYS A C   1 
ATOM   4945 O O   . CYS A 1 646 ? -6.927  28.159 -5.398  1.00 76.13  ? 690  CYS A O   1 
ATOM   4946 C CB  . CYS A 1 646 ? -8.730  25.483 -5.146  1.00 70.69  ? 690  CYS A CB  1 
ATOM   4947 S SG  . CYS A 1 646 ? -9.725  26.760 -5.958  1.00 72.13  ? 690  CYS A SG  1 
ATOM   4948 N N   . GLN A 1 647 ? -5.768  26.388 -6.043  1.00 112.72 ? 691  GLN A N   1 
ATOM   4949 C CA  . GLN A 1 647 ? -5.017  27.238 -6.958  1.00 112.99 ? 691  GLN A CA  1 
ATOM   4950 C C   . GLN A 1 647 ? -4.740  26.606 -8.293  1.00 114.25 ? 691  GLN A C   1 
ATOM   4951 O O   . GLN A 1 647 ? -4.583  25.397 -8.426  1.00 114.91 ? 691  GLN A O   1 
ATOM   4952 C CB  . GLN A 1 647 ? -3.702  27.717 -6.324  1.00 111.97 ? 691  GLN A CB  1 
ATOM   4953 C CG  . GLN A 1 647 ? -3.939  28.866 -5.330  1.00 110.41 ? 691  GLN A CG  1 
ATOM   4954 C CD  . GLN A 1 647 ? -3.548  30.254 -5.869  1.00 113.77 ? 691  GLN A CD  1 
ATOM   4955 O OE1 . GLN A 1 647 ? -3.199  30.419 -7.059  1.00 115.13 ? 691  GLN A OE1 1 
ATOM   4956 N NE2 . GLN A 1 647 ? -3.618  31.268 -4.988  1.00 115.52 ? 691  GLN A NE2 1 
ATOM   4957 N N   . GLY A 1 648 ? -4.717  27.470 -9.293  1.00 102.65 ? 692  GLY A N   1 
ATOM   4958 C CA  . GLY A 1 648 ? -4.501  27.041 -10.648 1.00 105.38 ? 692  GLY A CA  1 
ATOM   4959 C C   . GLY A 1 648 ? -5.776  26.445 -11.181 1.00 105.22 ? 692  GLY A C   1 
ATOM   4960 O O   . GLY A 1 648 ? -6.875  26.864 -10.796 1.00 103.94 ? 692  GLY A O   1 
ATOM   4961 N N   . GLY A 1 649 ? -5.630  25.467 -12.066 1.00 96.79  ? 693  GLY A N   1 
ATOM   4962 C CA  . GLY A 1 649 ? -6.758  24.818 -12.699 1.00 96.66  ? 693  GLY A CA  1 
ATOM   4963 C C   . GLY A 1 649 ? -7.662  25.780 -13.447 1.00 98.01  ? 693  GLY A C   1 
ATOM   4964 O O   . GLY A 1 649 ? -7.202  26.691 -14.137 1.00 101.75 ? 693  GLY A O   1 
ATOM   4965 N N   . VAL A 1 650 ? -8.964  25.572 -13.282 1.00 97.18  ? 694  VAL A N   1 
ATOM   4966 C CA  . VAL A 1 650 ? -10.003 26.334 -13.968 1.00 97.65  ? 694  VAL A CA  1 
ATOM   4967 C C   . VAL A 1 650 ? -10.161 27.732 -13.387 1.00 96.15  ? 694  VAL A C   1 
ATOM   4968 O O   . VAL A 1 650 ? -10.069 27.914 -12.182 1.00 95.61  ? 694  VAL A O   1 
ATOM   4969 C CB  . VAL A 1 650 ? -11.337 25.582 -13.877 1.00 98.32  ? 694  VAL A CB  1 
ATOM   4970 C CG1 . VAL A 1 650 ? -12.475 26.390 -14.465 1.00 98.28  ? 694  VAL A CG1 1 
ATOM   4971 C CG2 . VAL A 1 650 ? -11.218 24.243 -14.572 1.00 99.81  ? 694  VAL A CG2 1 
ATOM   4972 N N   . ASN A 1 651 ? -10.373 28.724 -14.239 1.00 135.79 ? 695  ASN A N   1 
ATOM   4973 C CA  . ASN A 1 651 ? -10.708 30.050 -13.753 1.00 134.61 ? 695  ASN A CA  1 
ATOM   4974 C C   . ASN A 1 651 ? -11.910 30.607 -14.492 1.00 135.05 ? 695  ASN A C   1 
ATOM   4975 O O   . ASN A 1 651 ? -11.757 31.379 -15.441 1.00 137.08 ? 695  ASN A O   1 
ATOM   4976 C CB  . ASN A 1 651 ? -9.526  30.997 -13.889 1.00 136.15 ? 695  ASN A CB  1 
ATOM   4977 C CG  . ASN A 1 651 ? -9.825  32.373 -13.341 1.00 135.54 ? 695  ASN A CG  1 
ATOM   4978 O OD1 . ASN A 1 651 ? -9.765  32.593 -12.136 1.00 133.78 ? 695  ASN A OD1 1 
ATOM   4979 N ND2 . ASN A 1 651 ? -10.156 33.309 -14.226 1.00 137.60 ? 695  ASN A ND2 1 
ATOM   4980 N N   . PRO A 1 652 ? -13.116 30.195 -14.072 1.00 114.96 ? 696  PRO A N   1 
ATOM   4981 C CA  . PRO A 1 652 ? -14.387 30.609 -14.669 1.00 115.45 ? 696  PRO A CA  1 
ATOM   4982 C C   . PRO A 1 652 ? -14.751 32.038 -14.338 1.00 114.73 ? 696  PRO A C   1 
ATOM   4983 O O   . PRO A 1 652 ? -15.618 32.582 -15.017 1.00 115.04 ? 696  PRO A O   1 
ATOM   4984 C CB  . PRO A 1 652 ? -15.397 29.653 -14.038 1.00 116.06 ? 696  PRO A CB  1 
ATOM   4985 C CG  . PRO A 1 652 ? -14.849 29.415 -12.691 1.00 115.16 ? 696  PRO A CG  1 
ATOM   4986 C CD  . PRO A 1 652 ? -13.332 29.384 -12.864 1.00 114.84 ? 696  PRO A CD  1 
ATOM   4987 N N   . VAL A 1 653 ? -14.145 32.613 -13.299 1.00 127.54 ? 697  VAL A N   1 
ATOM   4988 C CA  . VAL A 1 653 ? -14.490 33.969 -12.887 1.00 127.50 ? 697  VAL A CA  1 
ATOM   4989 C C   . VAL A 1 653 ? -14.298 34.862 -14.103 1.00 127.83 ? 697  VAL A C   1 
ATOM   4990 O O   . VAL A 1 653 ? -13.306 34.741 -14.837 1.00 129.67 ? 697  VAL A O   1 
ATOM   4991 C CB  . VAL A 1 653 ? -13.663 34.455 -11.671 1.00 127.39 ? 697  VAL A CB  1 
ATOM   4992 C CG1 . VAL A 1 653 ? -12.189 34.443 -11.979 1.00 127.29 ? 697  VAL A CG1 1 
ATOM   4993 C CG2 . VAL A 1 653 ? -14.096 35.844 -11.244 1.00 128.14 ? 697  VAL A CG2 1 
ATOM   4994 N N   . ARG A 1 654 ? -15.278 35.729 -14.333 1.00 151.14 ? 698  ARG A N   1 
ATOM   4995 C CA  . ARG A 1 654 ? -15.509 36.282 -15.660 1.00 152.68 ? 698  ARG A CA  1 
ATOM   4996 C C   . ARG A 1 654 ? -15.330 37.788 -15.735 1.00 153.90 ? 698  ARG A C   1 
ATOM   4997 O O   . ARG A 1 654 ? -15.331 38.486 -14.719 1.00 152.91 ? 698  ARG A O   1 
ATOM   4998 C CB  . ARG A 1 654 ? -16.917 35.912 -16.141 1.00 152.07 ? 698  ARG A CB  1 
ATOM   4999 C CG  . ARG A 1 654 ? -16.990 34.692 -17.044 1.00 153.19 ? 698  ARG A CG  1 
ATOM   5000 C CD  . ARG A 1 654 ? -16.668 35.101 -18.452 1.00 156.67 ? 698  ARG A CD  1 
ATOM   5001 N NE  . ARG A 1 654 ? -17.374 36.336 -18.759 1.00 156.95 ? 698  ARG A NE  1 
ATOM   5002 C CZ  . ARG A 1 654 ? -17.019 37.190 -19.711 1.00 160.72 ? 698  ARG A CZ  1 
ATOM   5003 N NH1 . ARG A 1 654 ? -15.955 36.945 -20.462 1.00 164.73 ? 698  ARG A NH1 1 
ATOM   5004 N NH2 . ARG A 1 654 ? -17.733 38.293 -19.907 1.00 160.65 ? 698  ARG A NH2 1 
ATOM   5005 N N   . GLU A 1 655 ? -15.139 38.263 -16.961 1.00 170.22 ? 699  GLU A N   1 
ATOM   5006 C CA  . GLU A 1 655 ? -15.102 39.684 -17.259 1.00 172.37 ? 699  GLU A CA  1 
ATOM   5007 C C   . GLU A 1 655 ? -16.467 40.298 -16.915 1.00 169.13 ? 699  GLU A C   1 
ATOM   5008 O O   . GLU A 1 655 ? -17.510 39.857 -17.415 1.00 167.74 ? 699  GLU A O   1 
ATOM   5009 C CB  . GLU A 1 655 ? -14.737 39.901 -18.735 1.00 177.16 ? 699  GLU A CB  1 
ATOM   5010 C CG  . GLU A 1 655 ? -13.330 39.396 -19.151 1.00 181.02 ? 699  GLU A CG  1 
ATOM   5011 C CD  . GLU A 1 655 ? -13.199 37.868 -19.248 1.00 180.14 ? 699  GLU A CD  1 
ATOM   5012 O OE1 . GLU A 1 655 ? -14.096 37.142 -18.761 1.00 176.22 ? 699  GLU A OE1 1 
ATOM   5013 O OE2 . GLU A 1 655 ? -12.189 37.395 -19.816 1.00 183.98 ? 699  GLU A OE2 1 
ATOM   5014 N N   . VAL A 1 656 ? -16.444 41.321 -16.066 1.00 132.93 ? 700  VAL A N   1 
ATOM   5015 C CA  . VAL A 1 656 ? -17.643 41.816 -15.408 1.00 131.37 ? 700  VAL A CA  1 
ATOM   5016 C C   . VAL A 1 656 ? -18.724 42.270 -16.404 1.00 132.09 ? 700  VAL A C   1 
ATOM   5017 O O   . VAL A 1 656 ? -18.424 42.785 -17.484 1.00 135.19 ? 700  VAL A O   1 
ATOM   5018 C CB  . VAL A 1 656 ? -17.290 42.964 -14.430 1.00 133.45 ? 700  VAL A CB  1 
ATOM   5019 C CG1 . VAL A 1 656 ? -16.183 42.527 -13.499 1.00 133.57 ? 700  VAL A CG1 1 
ATOM   5020 C CG2 . VAL A 1 656 ? -16.858 44.201 -15.179 1.00 135.29 ? 700  VAL A CG2 1 
ATOM   5021 N N   . LYS A 1 657 ? -19.982 42.030 -16.035 1.00 156.66 ? 701  LYS A N   1 
ATOM   5022 C CA  . LYS A 1 657 ? -21.125 42.246 -16.919 1.00 156.38 ? 701  LYS A CA  1 
ATOM   5023 C C   . LYS A 1 657 ? -22.327 42.818 -16.163 1.00 156.76 ? 701  LYS A C   1 
ATOM   5024 O O   . LYS A 1 657 ? -22.776 42.230 -15.186 1.00 156.52 ? 701  LYS A O   1 
ATOM   5025 C CB  . LYS A 1 657 ? -21.498 40.927 -17.602 1.00 155.70 ? 701  LYS A CB  1 
ATOM   5026 C CG  . LYS A 1 657 ? -22.765 40.977 -18.433 1.00 157.42 ? 701  LYS A CG  1 
ATOM   5027 C CD  . LYS A 1 657 ? -23.004 39.657 -19.155 1.00 157.56 ? 701  LYS A CD  1 
ATOM   5028 C CE  . LYS A 1 657 ? -24.249 39.731 -20.034 1.00 160.03 ? 701  LYS A CE  1 
ATOM   5029 N NZ  . LYS A 1 657 ? -24.517 38.473 -20.791 1.00 161.35 ? 701  LYS A NZ  1 
ATOM   5030 N N   . ASP A 1 658 ? -22.872 43.936 -16.641 1.00 158.81 ? 702  ASP A N   1 
ATOM   5031 C CA  . ASP A 1 658 ? -23.831 44.717 -15.855 1.00 159.52 ? 702  ASP A CA  1 
ATOM   5032 C C   . ASP A 1 658 ? -25.282 44.251 -15.964 1.00 158.34 ? 702  ASP A C   1 
ATOM   5033 O O   . ASP A 1 658 ? -25.929 44.378 -17.008 1.00 157.81 ? 702  ASP A O   1 
ATOM   5034 C CB  . ASP A 1 658 ? -23.747 46.192 -16.252 1.00 160.78 ? 702  ASP A CB  1 
ATOM   5035 C CG  . ASP A 1 658 ? -24.730 47.064 -15.485 1.00 162.46 ? 702  ASP A CG  1 
ATOM   5036 O OD1 . ASP A 1 658 ? -25.216 46.633 -14.418 1.00 160.75 ? 702  ASP A OD1 1 
ATOM   5037 O OD2 . ASP A 1 658 ? -25.026 48.182 -15.957 1.00 165.51 ? 702  ASP A OD2 1 
ATOM   5038 N N   . LEU A 1 659 ? -25.802 43.790 -14.833 1.00 93.03  ? 703  LEU A N   1 
ATOM   5039 C CA  . LEU A 1 659 ? -27.136 43.222 -14.765 1.00 91.72  ? 703  LEU A CA  1 
ATOM   5040 C C   . LEU A 1 659 ? -28.186 44.254 -14.322 1.00 92.06  ? 703  LEU A C   1 
ATOM   5041 O O   . LEU A 1 659 ? -29.359 43.920 -14.168 1.00 91.04  ? 703  LEU A O   1 
ATOM   5042 C CB  . LEU A 1 659 ? -27.139 42.012 -13.814 1.00 90.91  ? 703  LEU A CB  1 
ATOM   5043 C CG  . LEU A 1 659 ? -26.472 40.716 -14.291 1.00 90.75  ? 703  LEU A CG  1 
ATOM   5044 C CD1 . LEU A 1 659 ? -26.976 39.502 -13.516 1.00 89.96  ? 703  LEU A CD1 1 
ATOM   5045 C CD2 . LEU A 1 659 ? -26.670 40.515 -15.788 1.00 91.06  ? 703  LEU A CD2 1 
ATOM   5046 N N   . LYS A 1 660 ? -27.755 45.495 -14.107 1.00 166.41 ? 704  LYS A N   1 
ATOM   5047 C CA  . LYS A 1 660 ? -28.663 46.577 -13.734 1.00 167.51 ? 704  LYS A CA  1 
ATOM   5048 C C   . LYS A 1 660 ? -29.773 46.736 -14.757 1.00 165.93 ? 704  LYS A C   1 
ATOM   5049 O O   . LYS A 1 660 ? -30.956 46.762 -14.418 1.00 165.04 ? 704  LYS A O   1 
ATOM   5050 C CB  . LYS A 1 660 ? -27.898 47.894 -13.597 1.00 170.78 ? 704  LYS A CB  1 
ATOM   5051 C CG  . LYS A 1 660 ? -28.764 49.137 -13.684 1.00 172.45 ? 704  LYS A CG  1 
ATOM   5052 C CD  . LYS A 1 660 ? -27.953 50.311 -14.209 1.00 174.82 ? 704  LYS A CD  1 
ATOM   5053 C CE  . LYS A 1 660 ? -27.519 50.088 -15.655 1.00 172.83 ? 704  LYS A CE  1 
ATOM   5054 N NZ  . LYS A 1 660 ? -28.688 49.974 -16.581 1.00 170.95 ? 704  LYS A NZ  1 
ATOM   5055 N N   . LYS A 1 661 ? -29.367 46.820 -16.016 1.00 135.75 ? 705  LYS A N   1 
ATOM   5056 C CA  . LYS A 1 661 ? -30.281 47.081 -17.106 1.00 134.89 ? 705  LYS A CA  1 
ATOM   5057 C C   . LYS A 1 661 ? -31.281 45.958 -17.299 1.00 133.67 ? 705  LYS A C   1 
ATOM   5058 O O   . LYS A 1 661 ? -32.342 46.182 -17.881 1.00 133.52 ? 705  LYS A O   1 
ATOM   5059 C CB  . LYS A 1 661 ? -29.510 47.308 -18.412 1.00 135.11 ? 705  LYS A CB  1 
ATOM   5060 C CG  . LYS A 1 661 ? -29.157 46.031 -19.167 1.00 134.40 ? 705  LYS A CG  1 
ATOM   5061 C CD  . LYS A 1 661 ? -28.652 46.335 -20.569 1.00 134.60 ? 705  LYS A CD  1 
ATOM   5062 C CE  . LYS A 1 661 ? -27.345 47.113 -20.527 1.00 135.94 ? 705  LYS A CE  1 
ATOM   5063 N NZ  . LYS A 1 661 ? -26.941 47.578 -21.876 1.00 139.30 ? 705  LYS A NZ  1 
ATOM   5064 N N   . LYS A 1 662 ? -30.974 44.751 -16.841 1.00 118.12 ? 706  LYS A N   1 
ATOM   5065 C CA  . LYS A 1 662 ? -31.873 43.658 -17.180 1.00 118.26 ? 706  LYS A CA  1 
ATOM   5066 C C   . LYS A 1 662 ? -33.060 43.511 -16.211 1.00 117.32 ? 706  LYS A C   1 
ATOM   5067 O O   . LYS A 1 662 ? -34.065 42.874 -16.543 1.00 117.65 ? 706  LYS A O   1 
ATOM   5068 C CB  . LYS A 1 662 ? -31.087 42.354 -17.298 1.00 119.52 ? 706  LYS A CB  1 
ATOM   5069 C CG  . LYS A 1 662 ? -31.145 41.827 -18.738 1.00 122.53 ? 706  LYS A CG  1 
ATOM   5070 C CD  . LYS A 1 662 ? -30.078 40.769 -19.037 1.00 125.51 ? 706  LYS A CD  1 
ATOM   5071 C CE  . LYS A 1 662 ? -29.441 40.950 -20.408 1.00 129.92 ? 706  LYS A CE  1 
ATOM   5072 N NZ  . LYS A 1 662 ? -28.844 39.660 -20.867 1.00 133.23 ? 706  LYS A NZ  1 
ATOM   5073 N N   . CYS A 1 663 ? -32.966 44.119 -15.033 1.00 160.91 ? 707  CYS A N   1 
ATOM   5074 C CA  . CYS A 1 663 ? -34.157 44.294 -14.212 1.00 160.05 ? 707  CYS A CA  1 
ATOM   5075 C C   . CYS A 1 663 ? -35.044 45.331 -14.843 1.00 160.21 ? 707  CYS A C   1 
ATOM   5076 O O   . CYS A 1 663 ? -36.214 45.095 -15.136 1.00 160.01 ? 707  CYS A O   1 
ATOM   5077 C CB  . CYS A 1 663 ? -33.810 44.750 -12.801 1.00 159.92 ? 707  CYS A CB  1 
ATOM   5078 S SG  . CYS A 1 663 ? -33.032 43.513 -11.798 1.00 159.41 ? 707  CYS A SG  1 
ATOM   5079 N N   . THR A 1 664 ? -34.436 46.485 -15.068 1.00 81.97  ? 708  THR A N   1 
ATOM   5080 C CA  . THR A 1 664 ? -35.146 47.695 -15.429 1.00 82.37  ? 708  THR A CA  1 
ATOM   5081 C C   . THR A 1 664 ? -35.621 47.697 -16.867 1.00 82.61  ? 708  THR A C   1 
ATOM   5082 O O   . THR A 1 664 ? -36.356 48.598 -17.265 1.00 82.71  ? 708  THR A O   1 
ATOM   5083 C CB  . THR A 1 664 ? -34.259 48.916 -15.216 1.00 84.40  ? 708  THR A CB  1 
ATOM   5084 O OG1 . THR A 1 664 ? -33.087 48.757 -16.017 1.00 85.21  ? 708  THR A OG1 1 
ATOM   5085 C CG2 . THR A 1 664 ? -33.842 49.028 -13.762 1.00 85.58  ? 708  THR A CG2 1 
ATOM   5086 N N   . SER A 1 665 ? -35.189 46.715 -17.658 1.00 80.95  ? 709  SER A N   1 
ATOM   5087 C CA  . SER A 1 665 ? -35.603 46.669 -19.062 1.00 83.43  ? 709  SER A CA  1 
ATOM   5088 C C   . SER A 1 665 ? -37.095 46.392 -19.180 1.00 82.73  ? 709  SER A C   1 
ATOM   5089 O O   . SER A 1 665 ? -37.716 46.734 -20.183 1.00 84.33  ? 709  SER A O   1 
ATOM   5090 C CB  . SER A 1 665 ? -34.813 45.618 -19.846 1.00 85.67  ? 709  SER A CB  1 
ATOM   5091 O OG  . SER A 1 665 ? -34.918 44.344 -19.241 1.00 83.97  ? 709  SER A OG  1 
ATOM   5092 N N   . ASN A 1 666 ? -37.658 45.770 -18.152 1.00 79.98  ? 710  ASN A N   1 
ATOM   5093 C CA  . ASN A 1 666 ? -39.086 45.499 -18.102 1.00 79.20  ? 710  ASN A CA  1 
ATOM   5094 C C   . ASN A 1 666 ? -39.909 46.728 -17.732 1.00 78.19  ? 710  ASN A C   1 
ATOM   5095 O O   . ASN A 1 666 ? -41.007 46.895 -18.235 1.00 78.74  ? 710  ASN A O   1 
ATOM   5096 C CB  . ASN A 1 666 ? -39.380 44.378 -17.104 1.00 77.24  ? 710  ASN A CB  1 
ATOM   5097 C CG  . ASN A 1 666 ? -38.707 43.085 -17.482 1.00 78.35  ? 710  ASN A CG  1 
ATOM   5098 O OD1 . ASN A 1 666 ? -38.613 42.742 -18.667 1.00 80.95  ? 710  ASN A OD1 1 
ATOM   5099 N ND2 . ASN A 1 666 ? -38.223 42.356 -16.475 1.00 76.96  ? 710  ASN A ND2 1 
ATOM   5100 N N   . PHE A 1 667 ? -39.363 47.559 -16.840 1.00 76.54  ? 711  PHE A N   1 
ATOM   5101 C CA  . PHE A 1 667 ? -40.007 48.775 -16.338 1.00 75.74  ? 711  PHE A CA  1 
ATOM   5102 C C   . PHE A 1 667 ? -39.960 49.906 -17.365 1.00 77.81  ? 711  PHE A C   1 
ATOM   5103 O O   . PHE A 1 667 ? -39.007 50.019 -18.128 1.00 79.78  ? 711  PHE A O   1 
ATOM   5104 C CB  . PHE A 1 667 ? -39.328 49.259 -15.046 1.00 75.04  ? 711  PHE A CB  1 
ATOM   5105 C CG  . PHE A 1 667 ? -39.298 48.245 -13.959 1.00 74.38  ? 711  PHE A CG  1 
ATOM   5106 C CD1 . PHE A 1 667 ? -38.327 47.265 -13.932 1.00 75.03  ? 711  PHE A CD1 1 
ATOM   5107 C CD2 . PHE A 1 667 ? -40.209 48.290 -12.932 1.00 73.10  ? 711  PHE A CD2 1 
ATOM   5108 C CE1 . PHE A 1 667 ? -38.293 46.322 -12.911 1.00 74.45  ? 711  PHE A CE1 1 
ATOM   5109 C CE2 . PHE A 1 667 ? -40.184 47.359 -11.896 1.00 72.40  ? 711  PHE A CE2 1 
ATOM   5110 C CZ  . PHE A 1 667 ? -39.245 46.368 -11.896 1.00 73.11  ? 711  PHE A CZ  1 
ATOM   5111 N N   . LEU A 1 668 ? -41.001 50.730 -17.384 1.00 77.59  ? 712  LEU A N   1 
ATOM   5112 C CA  . LEU A 1 668 ? -40.957 52.006 -18.076 1.00 79.27  ? 712  LEU A CA  1 
ATOM   5113 C C   . LEU A 1 668 ? -40.179 52.987 -17.209 1.00 79.02  ? 712  LEU A C   1 
ATOM   5114 O O   . LEU A 1 668 ? -40.417 53.061 -16.022 1.00 77.23  ? 712  LEU A O   1 
ATOM   5115 C CB  . LEU A 1 668 ? -42.372 52.527 -18.339 1.00 79.08  ? 712  LEU A CB  1 
ATOM   5116 C CG  . LEU A 1 668 ? -42.514 53.803 -19.159 1.00 80.89  ? 712  LEU A CG  1 
ATOM   5117 C CD1 . LEU A 1 668 ? -42.092 53.529 -20.577 1.00 83.49  ? 712  LEU A CD1 1 
ATOM   5118 C CD2 . LEU A 1 668 ? -43.941 54.339 -19.114 1.00 80.21  ? 712  LEU A CD2 1 
ATOM   5119 N N   . SER A 1 669 ? -39.297 53.785 -17.792 1.00 93.81  ? 713  SER A N   1 
ATOM   5120 C CA  . SER A 1 669 ? -38.486 54.675 -16.977 1.00 97.01  ? 713  SER A CA  1 
ATOM   5121 C C   . SER A 1 669 ? -38.860 56.136 -17.180 1.00 99.25  ? 713  SER A C   1 
ATOM   5122 O O   . SER A 1 669 ? -39.305 56.523 -18.256 1.00 98.14  ? 713  SER A O   1 
ATOM   5123 C CB  . SER A 1 669 ? -37.017 54.464 -17.308 1.00 98.35  ? 713  SER A CB  1 
ATOM   5124 O OG  . SER A 1 669 ? -36.717 53.081 -17.306 1.00 96.12  ? 713  SER A OG  1 
ATOM   5125 N N   . PRO A 1 670 ? -38.675 56.959 -16.143 1.00 84.82  ? 714  PRO A N   1 
ATOM   5126 C CA  . PRO A 1 670 ? -38.929 58.396 -16.310 1.00 87.78  ? 714  PRO A CA  1 
ATOM   5127 C C   . PRO A 1 670 ? -37.760 59.185 -16.949 1.00 90.84  ? 714  PRO A C   1 
ATOM   5128 O O   . PRO A 1 670 ? -36.655 58.631 -17.144 1.00 90.86  ? 714  PRO A O   1 
ATOM   5129 C CB  . PRO A 1 670 ? -39.162 58.862 -14.876 1.00 89.78  ? 714  PRO A CB  1 
ATOM   5130 C CG  . PRO A 1 670 ? -38.336 57.925 -14.052 1.00 89.65  ? 714  PRO A CG  1 
ATOM   5131 C CD  . PRO A 1 670 ? -38.401 56.594 -14.743 1.00 86.11  ? 714  PRO A CD  1 
ATOM   5132 N N   . GLU A 1 671 ? -37.999 60.472 -17.216 1.00 136.60 ? 715  GLU A N   1 
ATOM   5133 C CA  . GLU A 1 671 ? -36.997 61.379 -17.783 1.00 138.07 ? 715  GLU A CA  1 
ATOM   5134 C C   . GLU A 1 671 ? -36.406 60.869 -19.106 1.00 136.73 ? 715  GLU A C   1 
ATOM   5135 O O   . GLU A 1 671 ? -35.464 60.075 -19.132 1.00 136.20 ? 715  GLU A O   1 
ATOM   5136 C CB  . GLU A 1 671 ? -35.876 61.635 -16.767 1.00 139.24 ? 715  GLU A CB  1 
ATOM   5137 C CG  . GLU A 1 671 ? -34.733 62.491 -17.294 1.00 139.96 ? 715  GLU A CG  1 
ATOM   5138 C CD  . GLU A 1 671 ? -33.473 61.687 -17.543 1.00 139.67 ? 715  GLU A CD  1 
ATOM   5139 O OE1 . GLU A 1 671 ? -33.333 60.595 -16.947 1.00 139.28 ? 715  GLU A OE1 1 
ATOM   5140 O OE2 . GLU A 1 671 ? -32.630 62.148 -18.341 1.00 139.69 ? 715  GLU A OE2 1 
HETATM 5141 C C1  . NAG B 2 .   ? -16.294 26.172 13.272  1.00 50.08  ? 801  NAG A C1  1 
HETATM 5142 C C2  . NAG B 2 .   ? -16.123 27.617 12.881  1.00 50.08  ? 801  NAG A C2  1 
HETATM 5143 C C3  . NAG B 2 .   ? -14.666 27.888 12.488  1.00 50.08  ? 801  NAG A C3  1 
HETATM 5144 C C4  . NAG B 2 .   ? -13.687 27.368 13.524  1.00 50.08  ? 801  NAG A C4  1 
HETATM 5145 C C5  . NAG B 2 .   ? -14.015 25.907 13.833  1.00 50.08  ? 801  NAG A C5  1 
HETATM 5146 C C6  . NAG B 2 .   ? -13.156 25.317 14.927  1.00 50.08  ? 801  NAG A C6  1 
HETATM 5147 C C7  . NAG B 2 .   ? -17.683 29.099 11.706  1.00 50.08  ? 801  NAG A C7  1 
HETATM 5148 C C8  . NAG B 2 .   ? -18.450 29.317 10.454  1.00 50.08  ? 801  NAG A C8  1 
HETATM 5149 N N2  . NAG B 2 .   ? -16.996 27.946 11.786  1.00 50.08  ? 801  NAG A N2  1 
HETATM 5150 O O3  . NAG B 2 .   ? -14.494 29.294 12.295  1.00 50.08  ? 801  NAG A O3  1 
HETATM 5151 O O4  . NAG B 2 .   ? -12.357 27.439 13.016  1.00 50.08  ? 801  NAG A O4  1 
HETATM 5152 O O5  . NAG B 2 .   ? -15.372 25.831 14.276  1.00 50.08  ? 801  NAG A O5  1 
HETATM 5153 O O6  . NAG B 2 .   ? -13.155 26.161 16.069  1.00 50.08  ? 801  NAG A O6  1 
HETATM 5154 O O7  . NAG B 2 .   ? -17.664 29.916 12.636  1.00 50.08  ? 801  NAG A O7  1 
HETATM 5155 C C1  . NAG C 2 .   ? -11.636 28.447 13.747  1.00 92.63  ? 802  NAG A C1  1 
HETATM 5156 C C2  . NAG C 2 .   ? -10.138 28.196 13.613  1.00 92.63  ? 802  NAG A C2  1 
HETATM 5157 C C3  . NAG C 2 .   ? -9.337  29.255 14.360  1.00 92.63  ? 802  NAG A C3  1 
HETATM 5158 C C4  . NAG C 2 .   ? -9.816  30.657 14.001  1.00 92.63  ? 802  NAG A C4  1 
HETATM 5159 C C5  . NAG C 2 .   ? -11.333 30.761 14.113  1.00 92.63  ? 802  NAG A C5  1 
HETATM 5160 C C6  . NAG C 2 .   ? -11.819 32.139 13.681  1.00 92.63  ? 802  NAG A C6  1 
HETATM 5161 C C7  . NAG C 2 .   ? -9.300  25.937 13.327  1.00 92.63  ? 802  NAG A C7  1 
HETATM 5162 C C8  . NAG C 2 .   ? -8.924  24.652 14.004  1.00 92.63  ? 802  NAG A C8  1 
HETATM 5163 N N2  . NAG C 2 .   ? -9.809  26.877 14.118  1.00 92.63  ? 802  NAG A N2  1 
HETATM 5164 O O3  . NAG C 2 .   ? -7.950  29.126 14.030  1.00 92.63  ? 802  NAG A O3  1 
HETATM 5165 O O4  . NAG C 2 .   ? -9.206  31.609 14.879  1.00 92.63  ? 802  NAG A O4  1 
HETATM 5166 O O5  . NAG C 2 .   ? -11.939 29.765 13.293  1.00 92.63  ? 802  NAG A O5  1 
HETATM 5167 O O6  . NAG C 2 .   ? -11.742 32.247 12.255  1.00 92.63  ? 802  NAG A O6  1 
HETATM 5168 O O7  . NAG C 2 .   ? -9.148  26.109 12.129  1.00 92.63  ? 802  NAG A O7  1 
HETATM 5169 C C1  . BMA D 3 .   ? -7.787  31.868 15.029  1.00 166.34 ? 803  BMA A C1  1 
HETATM 5170 C C2  . BMA D 3 .   ? -7.130  31.988 13.660  1.00 166.34 ? 803  BMA A C2  1 
HETATM 5171 C C3  . BMA D 3 .   ? -5.708  32.525 13.781  1.00 166.34 ? 803  BMA A C3  1 
HETATM 5172 C C4  . BMA D 3 .   ? -5.668  33.772 14.656  1.00 166.34 ? 803  BMA A C4  1 
HETATM 5173 C C5  . BMA D 3 .   ? -6.413  33.545 15.966  1.00 166.34 ? 803  BMA A C5  1 
HETATM 5174 C C6  . BMA D 3 .   ? -6.439  34.815 16.807  1.00 166.34 ? 803  BMA A C6  1 
HETATM 5175 O O2  . BMA D 3 .   ? -7.902  32.868 12.835  1.00 166.34 ? 803  BMA A O2  1 
HETATM 5176 O O3  . BMA D 3 .   ? -5.203  32.839 12.479  1.00 166.34 ? 803  BMA A O3  1 
HETATM 5177 O O4  . BMA D 3 .   ? -4.306  34.116 14.935  1.00 166.34 ? 803  BMA A O4  1 
HETATM 5178 O O5  . BMA D 3 .   ? -7.750  33.132 15.687  1.00 166.34 ? 803  BMA A O5  1 
HETATM 5179 O O6  . BMA D 3 .   ? -7.026  34.532 18.082  1.00 166.34 ? 803  BMA A O6  1 
HETATM 5180 C C1  . NAG E 2 .   ? -4.070  18.918 37.321  1.00 78.65  ? 804  NAG A C1  1 
HETATM 5181 C C2  . NAG E 2 .   ? -3.210  19.597 36.257  1.00 78.65  ? 804  NAG A C2  1 
HETATM 5182 C C3  . NAG E 2 .   ? -1.842  20.001 36.819  1.00 78.65  ? 804  NAG A C3  1 
HETATM 5183 C C4  . NAG E 2 .   ? -1.970  20.766 38.129  1.00 78.65  ? 804  NAG A C4  1 
HETATM 5184 C C5  . NAG E 2 .   ? -2.829  19.957 39.083  1.00 78.65  ? 804  NAG A C5  1 
HETATM 5185 C C6  . NAG E 2 .   ? -3.106  20.684 40.374  1.00 78.65  ? 804  NAG A C6  1 
HETATM 5186 C C7  . NAG E 2 .   ? -3.135  19.190 33.851  1.00 78.65  ? 804  NAG A C7  1 
HETATM 5187 C C8  . NAG E 2 .   ? -2.878  18.188 32.773  1.00 78.65  ? 804  NAG A C8  1 
HETATM 5188 N N2  . NAG E 2 .   ? -3.034  18.740 35.104  1.00 78.65  ? 804  NAG A N2  1 
HETATM 5189 O O3  . NAG E 2 .   ? -1.213  20.811 35.829  1.00 78.65  ? 804  NAG A O3  1 
HETATM 5190 O O4  . NAG E 2 .   ? -0.700  20.967 38.750  1.00 78.65  ? 804  NAG A O4  1 
HETATM 5191 O O5  . NAG E 2 .   ? -4.102  19.705 38.480  1.00 78.65  ? 804  NAG A O5  1 
HETATM 5192 O O6  . NAG E 2 .   ? -3.529  19.765 41.370  1.00 78.65  ? 804  NAG A O6  1 
HETATM 5193 O O7  . NAG E 2 .   ? -3.433  20.359 33.605  1.00 78.65  ? 804  NAG A O7  1 
HETATM 5194 C C1  . NAG F 2 .   ? -0.047  22.198 38.357  1.00 96.48  ? 805  NAG A C1  1 
HETATM 5195 C C2  . NAG F 2 .   ? 0.654   22.886 39.532  1.00 96.48  ? 805  NAG A C2  1 
HETATM 5196 C C3  . NAG F 2 .   ? 1.378   24.135 39.039  1.00 96.48  ? 805  NAG A C3  1 
HETATM 5197 C C4  . NAG F 2 .   ? 2.377   23.757 37.955  1.00 96.48  ? 805  NAG A C4  1 
HETATM 5198 C C5  . NAG F 2 .   ? 1.644   23.064 36.806  1.00 96.48  ? 805  NAG A C5  1 
HETATM 5199 C C6  . NAG F 2 .   ? 2.577   22.537 35.743  1.00 96.48  ? 805  NAG A C6  1 
HETATM 5200 C C7  . NAG F 2 .   ? -0.416  22.495 41.708  1.00 96.48  ? 805  NAG A C7  1 
HETATM 5201 C C8  . NAG F 2 .   ? -1.402  23.014 42.709  1.00 96.48  ? 805  NAG A C8  1 
HETATM 5202 N N2  . NAG F 2 .   ? -0.271  23.226 40.597  1.00 96.48  ? 805  NAG A N2  1 
HETATM 5203 O O3  . NAG F 2 .   ? 2.036   24.792 40.116  1.00 96.48  ? 805  NAG A O3  1 
HETATM 5204 O O4  . NAG F 2 .   ? 3.065   24.919 37.502  1.00 96.48  ? 805  NAG A O4  1 
HETATM 5205 O O5  . NAG F 2 .   ? 0.917   21.925 37.301  1.00 96.48  ? 805  NAG A O5  1 
HETATM 5206 O O6  . NAG F 2 .   ? 2.572   21.116 35.721  1.00 96.48  ? 805  NAG A O6  1 
HETATM 5207 O O7  . NAG F 2 .   ? 0.214   21.453 41.891  1.00 96.48  ? 805  NAG A O7  1 
HETATM 5208 C C1  . PGE G 4 .   ? -25.038 22.849 39.851  1.00 83.09  ? 806  PGE A C1  1 
HETATM 5209 O O1  . PGE G 4 .   ? -26.268 22.133 39.949  1.00 83.09  ? 806  PGE A O1  1 
HETATM 5210 C C2  . PGE G 4 .   ? -23.903 21.844 39.925  1.00 83.09  ? 806  PGE A C2  1 
HETATM 5211 O O2  . PGE G 4 .   ? -22.713 22.464 40.384  1.00 83.09  ? 806  PGE A O2  1 
HETATM 5212 C C3  . PGE G 4 .   ? -21.543 21.947 39.772  1.00 83.09  ? 806  PGE A C3  1 
HETATM 5213 C C4  . PGE G 4 .   ? -21.285 22.594 38.420  1.00 83.09  ? 806  PGE A C4  1 
HETATM 5214 O O4  . PGE G 4 .   ? -22.681 21.831 34.230  1.00 83.09  ? 806  PGE A O4  1 
HETATM 5215 C C6  . PGE G 4 .   ? -22.138 21.131 35.353  1.00 83.09  ? 806  PGE A C6  1 
HETATM 5216 C C5  . PGE G 4 .   ? -21.204 22.045 36.125  1.00 83.09  ? 806  PGE A C5  1 
HETATM 5217 O O3  . PGE G 4 .   ? -21.041 21.588 37.452  1.00 83.09  ? 806  PGE A O3  1 
HETATM 5218 C C13 . 2JQ H 5 .   ? -29.777 39.799 14.393  1.00 72.69  ? 807  2JQ A C13 1 
HETATM 5219 C C15 . 2JQ H 5 .   ? -31.340 40.577 12.767  1.00 72.69  ? 807  2JQ A C15 1 
HETATM 5220 C C17 . 2JQ H 5 .   ? -33.802 40.142 13.042  1.00 72.69  ? 807  2JQ A C17 1 
HETATM 5221 C C20 . 2JQ H 5 .   ? -28.881 41.029 12.433  1.00 72.69  ? 807  2JQ A C20 1 
HETATM 5222 O O01 . 2JQ H 5 .   ? -33.981 39.497 16.062  1.00 72.69  ? 807  2JQ A O01 1 
HETATM 5223 C C02 . 2JQ H 5 .   ? -33.167 38.770 15.540  1.00 72.69  ? 807  2JQ A C02 1 
HETATM 5224 N N03 . 2JQ H 5 .   ? -33.143 37.369 15.722  1.00 72.69  ? 807  2JQ A N03 1 
HETATM 5225 C C04 . 2JQ H 5 .   ? -34.067 36.628 16.498  1.00 72.69  ? 807  2JQ A C04 1 
HETATM 5226 C C05 . 2JQ H 5 .   ? -35.257 37.184 16.951  1.00 72.69  ? 807  2JQ A C05 1 
HETATM 5227 C C06 . 2JQ H 5 .   ? -36.156 36.439 17.693  1.00 72.69  ? 807  2JQ A C06 1 
HETATM 5228 C C07 . 2JQ H 5 .   ? -35.803 35.123 17.961  1.00 72.69  ? 807  2JQ A C07 1 
HETATM 5229 C C08 . 2JQ H 5 .   ? -34.599 34.595 17.500  1.00 72.69  ? 807  2JQ A C08 1 
HETATM 5230 C C09 . 2JQ H 5 .   ? -34.242 33.161 17.814  1.00 72.69  ? 807  2JQ A C09 1 
HETATM 5231 N N10 . 2JQ H 5 .   ? -33.761 35.349 16.782  1.00 72.69  ? 807  2JQ A N10 1 
HETATM 5232 C C11 . 2JQ H 5 .   ? -32.085 39.373 14.692  1.00 72.69  ? 807  2JQ A C11 1 
HETATM 5233 C C12 . 2JQ H 5 .   ? -30.792 39.257 15.136  1.00 72.69  ? 807  2JQ A C12 1 
HETATM 5234 C C14 . 2JQ H 5 .   ? -30.044 40.466 13.223  1.00 72.69  ? 807  2JQ A C14 1 
HETATM 5235 C C16 . 2JQ H 5 .   ? -32.370 40.034 13.516  1.00 72.69  ? 807  2JQ A C16 1 
HETATM 5236 O O18 . 2JQ H 5 .   ? -34.199 41.206 12.493  1.00 72.69  ? 807  2JQ A O18 1 
HETATM 5237 O O19 . 2JQ H 5 .   ? -34.583 39.158 13.180  1.00 72.69  1 807  2JQ A O19 1 
HETATM 5238 F F21 . 2JQ H 5 .   ? -27.845 41.329 13.235  1.00 72.69  ? 807  2JQ A F21 1 
HETATM 5239 F F22 . 2JQ H 5 .   ? -29.239 42.098 11.701  1.00 72.69  ? 807  2JQ A F22 1 
HETATM 5240 F F23 . 2JQ H 5 .   ? -28.496 40.042 11.624  1.00 72.69  ? 807  2JQ A F23 1 
HETATM 5241 O O   . HOH I 6 .   ? -16.133 22.580 11.606  1.00 57.42  ? 1000 HOH A O   1 
HETATM 5242 O O   . HOH I 6 .   ? -26.213 14.181 22.241  1.00 47.09  ? 1001 HOH A O   1 
HETATM 5243 O O   . HOH I 6 .   ? -8.360  16.735 3.816   1.00 40.45  ? 1002 HOH A O   1 
HETATM 5244 O O   . HOH I 6 .   ? -17.166 31.140 14.796  1.00 54.53  ? 1003 HOH A O   1 
HETATM 5245 O O   . HOH I 6 .   ? -18.820 28.011 15.310  1.00 50.44  ? 1004 HOH A O   1 
HETATM 5246 O O   . HOH I 6 .   ? -12.115 30.287 10.402  1.00 60.00  ? 1005 HOH A O   1 
HETATM 5247 O O   . HOH I 6 .   ? -11.340 24.551 10.982  1.00 79.11  ? 1006 HOH A O   1 
HETATM 5248 O O   . HOH I 6 .   ? -7.171  23.938 23.523  1.00 40.49  ? 1007 HOH A O   1 
HETATM 5249 O O   . HOH I 6 .   ? -29.784 2.861  19.339  1.00 69.81  ? 1008 HOH A O   1 
HETATM 5250 O O   . HOH I 6 .   ? -17.347 40.426 28.480  1.00 66.99  ? 1009 HOH A O   1 
HETATM 5251 O O   . HOH I 6 .   ? -13.990 24.958 10.419  1.00 76.90  ? 1010 HOH A O   1 
HETATM 5252 O O   . HOH I 6 .   ? -30.032 16.320 15.000  1.00 51.85  ? 1011 HOH A O   1 
HETATM 5253 O O   . HOH I 6 .   ? -32.191 17.518 18.856  1.00 40.74  ? 1012 HOH A O   1 
HETATM 5254 O O   . HOH I 6 .   ? -4.502  6.310  23.144  1.00 66.95  ? 1013 HOH A O   1 
HETATM 5255 O O   . HOH I 6 .   ? -3.991  8.140  25.224  1.00 58.79  ? 1014 HOH A O   1 
HETATM 5256 O O   . HOH I 6 .   ? -13.383 23.708 25.727  1.00 55.41  ? 1015 HOH A O   1 
HETATM 5257 O O   . HOH I 6 .   ? -12.110 19.034 28.970  1.00 43.93  ? 1016 HOH A O   1 
HETATM 5258 O O   . HOH I 6 .   ? -36.540 50.699 -17.944 1.00 83.63  ? 1017 HOH A O   1 
HETATM 5259 O O   . HOH I 6 .   ? -10.224 20.117 34.745  1.00 47.57  ? 1018 HOH A O   1 
HETATM 5260 O O   . HOH I 6 .   ? -14.951 46.029 54.681  1.00 91.01  ? 1019 HOH A O   1 
HETATM 5261 O O   . HOH I 6 .   ? -15.610 46.011 14.738  1.00 76.59  ? 1020 HOH A O   1 
HETATM 5262 O O   . HOH I 6 .   ? -8.389  22.644 10.040  1.00 52.31  ? 1021 HOH A O   1 
HETATM 5263 O O   . HOH I 6 .   ? -20.688 18.092 2.428   1.00 47.90  ? 1022 HOH A O   1 
HETATM 5264 O O   . HOH I 6 .   ? -28.219 0.973  17.792  1.00 58.13  ? 1023 HOH A O   1 
HETATM 5265 O O   . HOH I 6 .   ? -28.152 -1.635 17.597  1.00 57.60  ? 1024 HOH A O   1 
HETATM 5266 O O   . HOH I 6 .   ? -29.939 4.962  20.506  1.00 77.40  ? 1025 HOH A O   1 
HETATM 5267 O O   . HOH I 6 .   ? 5.115   25.948 36.827  1.00 101.62 ? 1026 HOH A O   1 
HETATM 5268 O O   . HOH I 6 .   ? -4.461  4.156  15.182  1.00 63.11  ? 1027 HOH A O   1 
HETATM 5269 O O   . HOH I 6 .   ? -2.865  2.105  16.499  1.00 81.04  ? 1028 HOH A O   1 
HETATM 5270 O O   . HOH I 6 .   ? -6.313  42.657 28.728  1.00 80.58  ? 1029 HOH A O   1 
HETATM 5271 O O   . HOH I 6 .   ? -14.065 45.781 52.219  1.00 86.14  ? 1030 HOH A O   1 
HETATM 5272 O O   . HOH I 6 .   ? -19.759 31.592 14.878  1.00 51.76  ? 1031 HOH A O   1 
HETATM 5273 O O   . HOH I 6 .   ? -9.149  19.892 13.592  1.00 59.42  ? 1032 HOH A O   1 
HETATM 5274 O O   . HOH I 6 .   ? -10.391 26.883 16.918  1.00 55.15  ? 1033 HOH A O   1 
HETATM 5275 O O   . HOH I 6 .   ? -32.346 22.042 0.858   1.00 71.10  ? 1034 HOH A O   1 
HETATM 5276 O O   . HOH I 6 .   ? -22.362 18.062 32.650  1.00 63.58  ? 1035 HOH A O   1 
HETATM 5277 O O   . HOH I 6 .   ? -7.187  26.199 24.963  1.00 65.88  ? 1036 HOH A O   1 
HETATM 5278 O O   . HOH I 6 .   ? -16.043 57.784 16.963  1.00 85.40  ? 1037 HOH A O   1 
HETATM 5279 O O   . HOH I 6 .   ? -13.151 16.398 19.533  1.00 45.04  ? 1038 HOH A O   1 
HETATM 5280 O O   . HOH I 6 .   ? -6.836  24.999 7.660   1.00 64.66  ? 1039 HOH A O   1 
HETATM 5281 O O   . HOH I 6 .   ? -27.510 19.461 -0.156  1.00 72.82  ? 1040 HOH A O   1 
HETATM 5282 O O   . HOH I 6 .   ? -15.231 21.686 -1.679  1.00 71.02  ? 1041 HOH A O   1 
HETATM 5283 O O   . HOH I 6 .   ? -12.854 21.251 -3.356  1.00 65.92  ? 1042 HOH A O   1 
HETATM 5284 O O   . HOH I 6 .   ? -22.747 21.010 21.527  1.00 68.41  ? 1043 HOH A O   1 
HETATM 5285 O O   . HOH I 6 .   ? -8.962  19.189 5.724   1.00 56.68  ? 1044 HOH A O   1 
HETATM 5286 O O   . HOH I 6 .   ? -24.925 19.568 26.615  1.00 69.59  ? 1045 HOH A O   1 
HETATM 5287 O O   . HOH I 6 .   ? 1.741   6.252  9.742   1.00 67.34  ? 1046 HOH A O   1 
HETATM 5288 O O   . HOH I 6 .   ? 2.341   18.645 29.817  1.00 64.66  ? 1047 HOH A O   1 
HETATM 5289 O O   . HOH I 6 .   ? -2.685  17.011 29.333  1.00 72.04  ? 1048 HOH A O   1 
HETATM 5290 O O   . HOH I 6 .   ? -2.764  22.621 18.070  1.00 82.50  ? 1049 HOH A O   1 
HETATM 5291 O O   . HOH I 6 .   ? -11.179 26.151 5.356   1.00 65.58  ? 1050 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLY A 10  ? 2.0800 1.2024 2.0676 0.2487  -0.2876 0.1441  54  GLY A N   
2    C CA  . GLY A 10  ? 2.0425 1.2582 2.0275 0.2468  -0.2700 0.1725  54  GLY A CA  
3    C C   . GLY A 10  ? 2.0558 1.3092 2.0012 0.2861  -0.2604 0.1761  54  GLY A C   
4    O O   . GLY A 10  ? 2.0371 1.3434 1.9676 0.2844  -0.2612 0.1632  54  GLY A O   
5    N N   . ARG A 11  ? 2.4561 1.6822 2.3883 0.3216  -0.2495 0.1954  55  ARG A N   
6    C CA  . ARG A 11  ? 2.4708 1.7303 2.3737 0.3639  -0.2372 0.2034  55  ARG A CA  
7    C C   . ARG A 11  ? 2.4147 1.7799 2.3284 0.3595  -0.2259 0.2285  55  ARG A C   
8    O O   . ARG A 11  ? 2.4018 1.8144 2.3014 0.3758  -0.2204 0.2217  55  ARG A O   
9    C CB  . ARG A 11  ? 2.4990 1.7296 2.3645 0.3839  -0.2447 0.1651  55  ARG A CB  
10   C CG  . ARG A 11  ? 2.5557 1.7330 2.3868 0.4350  -0.2364 0.1624  55  ARG A CG  
11   C CD  . ARG A 11  ? 2.6293 1.6953 2.4439 0.4384  -0.2538 0.1323  55  ARG A CD  
12   N NE  . ARG A 11  ? 2.5887 1.6341 2.3955 0.4118  -0.2767 0.0927  55  ARG A NE  
13   C CZ  . ARG A 11  ? 2.6220 1.5832 2.4282 0.3994  -0.3008 0.0616  55  ARG A CZ  
14   N NH1 . ARG A 11  ? 2.6985 1.5831 2.5116 0.4096  -0.3029 0.0653  55  ARG A NH1 
15   N NH2 . ARG A 11  ? 2.5767 1.5296 2.3773 0.3772  -0.3238 0.0266  55  ARG A NH2 
16   N N   . VAL A 12  ? 2.0703 1.4694 2.0086 0.3379  -0.2222 0.2573  56  VAL A N   
17   C CA  . VAL A 12  ? 2.0160 1.5094 1.9629 0.3350  -0.2154 0.2818  56  VAL A CA  
18   C C   . VAL A 12  ? 2.0038 1.4980 1.9585 0.3470  -0.2075 0.3221  56  VAL A C   
19   O O   . VAL A 12  ? 2.0218 1.4555 1.9840 0.3371  -0.2058 0.3314  56  VAL A O   
20   C CB  . VAL A 12  ? 1.9632 1.5050 1.9230 0.2914  -0.2214 0.2717  56  VAL A CB  
21   C CG1 . VAL A 12  ? 1.9184 1.5534 1.8841 0.2886  -0.2177 0.2924  56  VAL A CG1 
22   C CG2 . VAL A 12  ? 1.9756 1.5064 1.9251 0.2807  -0.2295 0.2328  56  VAL A CG2 
23   N N   . ARG A 13  ? 2.2133 1.7724 2.1675 0.3706  -0.2026 0.3470  57  ARG A N   
24   C CA  . ARG A 13  ? 2.1959 1.7661 2.1524 0.3807  -0.1976 0.3868  57  ARG A CA  
25   C C   . ARG A 13  ? 2.1321 1.7719 2.0940 0.3499  -0.2022 0.3958  57  ARG A C   
26   O O   . ARG A 13  ? 2.1055 1.7656 2.0728 0.3164  -0.2076 0.3706  57  ARG A O   
27   C CB  . ARG A 13  ? 2.2104 1.8076 2.1630 0.4285  -0.1929 0.4100  57  ARG A CB  
28   C CG  . ARG A 13  ? 2.2304 1.7943 2.1757 0.4582  -0.1885 0.3881  57  ARG A CG  
29   C CD  . ARG A 13  ? 2.2666 1.8100 2.2062 0.5091  -0.1792 0.4128  57  ARG A CD  
30   N NE  . ARG A 13  ? 2.2180 1.8537 2.1725 0.5324  -0.1798 0.4396  57  ARG A NE  
31   C CZ  . ARG A 13  ? 2.2258 1.8774 2.1811 0.5535  -0.1798 0.4771  57  ARG A CZ  
32   N NH1 . ARG A 13  ? 2.2844 1.8623 2.2252 0.5541  -0.1747 0.4950  57  ARG A NH1 
33   N NH2 . ARG A 13  ? 2.1749 1.9159 2.1474 0.5748  -0.1854 0.4974  57  ARG A NH2 
34   N N   . ASP A 14  ? 2.1625 1.8342 2.1189 0.3621  -0.2005 0.4309  58  ASP A N   
35   C CA  . ASP A 14  ? 2.1054 1.8671 2.0615 0.3528  -0.2096 0.4377  58  ASP A CA  
36   C C   . ASP A 14  ? 2.0688 1.8516 2.0202 0.3118  -0.2117 0.4335  58  ASP A C   
37   O O   . ASP A 14  ? 2.0356 1.8742 1.9761 0.3116  -0.2180 0.4503  58  ASP A O   
38   C CB  . ASP A 14  ? 2.0851 1.8983 2.0556 0.3549  -0.2157 0.4103  58  ASP A CB  
39   C CG  . ASP A 14  ? 2.0754 1.9706 2.0578 0.3815  -0.2230 0.4259  58  ASP A CG  
40   O OD1 . ASP A 14  ? 2.0857 2.0089 2.0619 0.3988  -0.2285 0.4560  58  ASP A OD1 
41   O OD2 . ASP A 14  ? 2.0602 1.9954 2.0606 0.3849  -0.2233 0.4072  58  ASP A OD2 
42   N N   . PHE A 15  ? 1.7634 1.5008 1.7215 0.2800  -0.2072 0.4127  59  PHE A N   
43   C CA  . PHE A 15  ? 1.7179 1.4959 1.6779 0.2422  -0.2117 0.3937  59  PHE A CA  
44   C C   . PHE A 15  ? 1.6848 1.4889 1.6293 0.2255  -0.2083 0.4143  59  PHE A C   
45   O O   . PHE A 15  ? 1.6429 1.5071 1.5808 0.2102  -0.2167 0.4042  59  PHE A O   
46   C CB  . PHE A 15  ? 1.7294 1.4563 1.7044 0.2147  -0.2100 0.3626  59  PHE A CB  
47   C CG  . PHE A 15  ? 1.7491 1.4086 1.7346 0.2002  -0.1997 0.3731  59  PHE A CG  
48   C CD1 . PHE A 15  ? 1.7921 1.3796 1.7857 0.2169  -0.1958 0.3773  59  PHE A CD1 
49   C CD2 . PHE A 15  ? 1.7287 1.3947 1.7195 0.1693  -0.1928 0.3775  59  PHE A CD2 
50   C CE1 . PHE A 15  ? 1.8140 1.3385 1.8268 0.2006  -0.1860 0.3864  59  PHE A CE1 
51   C CE2 . PHE A 15  ? 1.7529 1.3592 1.7636 0.1549  -0.1803 0.3887  59  PHE A CE2 
52   C CZ  . PHE A 15  ? 1.7949 1.3310 1.8196 0.1691  -0.1774 0.3932  59  PHE A CZ  
53   N N   . VAL A 16  ? 1.6029 1.3608 1.5394 0.2286  -0.1949 0.4424  60  VAL A N   
54   C CA  . VAL A 16  ? 1.5825 1.3602 1.4972 0.2152  -0.1876 0.4624  60  VAL A CA  
55   C C   . VAL A 16  ? 1.5519 1.4025 1.4379 0.2329  -0.2018 0.4749  60  VAL A C   
56   O O   . VAL A 16  ? 1.5198 1.4096 1.3859 0.2163  -0.2054 0.4722  60  VAL A O   
57   C CB  . VAL A 16  ? 1.6238 1.3391 1.5326 0.2231  -0.1663 0.4981  60  VAL A CB  
58   C CG1 . VAL A 16  ? 1.6081 1.3397 1.4910 0.2093  -0.1541 0.5174  60  VAL A CG1 
59   C CG2 . VAL A 16  ? 1.6576 1.2998 1.6036 0.2055  -0.1560 0.4848  60  VAL A CG2 
60   N N   . ALA A 17  ? 1.7898 1.6578 1.6751 0.2675  -0.2112 0.4872  61  ALA A N   
61   C CA  . ALA A 17  ? 1.7597 1.7025 1.6286 0.2866  -0.2305 0.4961  61  ALA A CA  
62   C C   . ALA A 17  ? 1.7112 1.7199 1.5924 0.2609  -0.2466 0.4626  61  ALA A C   
63   O O   . ALA A 17  ? 1.6811 1.7411 1.5412 0.2553  -0.2600 0.4638  61  ALA A O   
64   C CB  . ALA A 17  ? 1.7764 1.7280 1.6571 0.3271  -0.2372 0.5099  61  ALA A CB  
65   N N   . LYS A 18  ? 1.5764 1.5794 1.4884 0.2467  -0.2452 0.4327  62  LYS A N   
66   C CA  . LYS A 18  ? 1.5357 1.5957 1.4634 0.2237  -0.2568 0.4021  62  LYS A CA  
67   C C   . LYS A 18  ? 1.5051 1.5692 1.4178 0.1885  -0.2550 0.3877  62  LYS A C   
68   O O   . LYS A 18  ? 1.4621 1.5815 1.3741 0.1734  -0.2678 0.3725  62  LYS A O   
69   C CB  . LYS A 18  ? 1.5510 1.5941 1.5074 0.2178  -0.2512 0.3746  62  LYS A CB  
70   C CG  . LYS A 18  ? 1.5645 1.6285 1.5431 0.2481  -0.2538 0.3761  62  LYS A CG  
71   C CD  . LYS A 18  ? 1.6698 1.7056 1.6376 0.2810  -0.2510 0.4067  62  LYS A CD  
72   C CE  . LYS A 18  ? 1.7004 1.6921 1.6791 0.3065  -0.2414 0.4057  62  LYS A CE  
73   N NZ  . LYS A 18  ? 1.8095 1.7599 1.7680 0.3263  -0.2368 0.4384  62  LYS A NZ  
74   N N   . LEU A 19  ? 1.1735 1.1767 1.0818 0.1736  -0.2382 0.3888  63  LEU A N   
75   C CA  . LEU A 19  ? 1.1433 1.1427 1.0448 0.1399  -0.2321 0.3728  63  LEU A CA  
76   C C   . LEU A 19  ? 1.1470 1.1574 1.0107 0.1387  -0.2292 0.3940  63  LEU A C   
77   O O   . LEU A 19  ? 1.1254 1.1504 0.9762 0.1148  -0.2275 0.3806  63  LEU A O   
78   C CB  . LEU A 19  ? 1.1679 1.1018 1.0894 0.1244  -0.2168 0.3636  63  LEU A CB  
79   C CG  . LEU A 19  ? 1.1795 1.0996 1.1276 0.1238  -0.2215 0.3359  63  LEU A CG  
80   C CD1 . LEU A 19  ? 1.2137 1.0642 1.1802 0.1141  -0.2122 0.3287  63  LEU A CD1 
81   C CD2 . LEU A 19  ? 1.1375 1.1016 1.0899 0.1029  -0.2289 0.3068  63  LEU A CD2 
82   N N   . ALA A 20  ? 1.4484 1.4497 1.2899 0.1672  -0.2277 0.4275  64  ALA A N   
83   C CA  . ALA A 20  ? 1.4571 1.4607 1.2523 0.1729  -0.2223 0.4521  64  ALA A CA  
84   C C   . ALA A 20  ? 1.4182 1.4861 1.1863 0.1656  -0.2434 0.4368  64  ALA A C   
85   O O   . ALA A 20  ? 1.4105 1.4777 1.1513 0.1474  -0.2363 0.4311  64  ALA A O   
86   C CB  . ALA A 20  ? 1.4949 1.4808 1.2685 0.2105  -0.2199 0.4909  64  ALA A CB  
87   N N   . ASN A 21  ? 2.6717 2.7939 2.4502 0.1804  -0.2691 0.4300  65  ASN A N   
88   C CA  . ASN A 21  ? 2.6285 2.8157 2.3958 0.1706  -0.2946 0.4095  65  ASN A CA  
89   C C   . ASN A 21  ? 2.5938 2.7831 2.3760 0.1320  -0.2891 0.3749  65  ASN A C   
90   O O   . ASN A 21  ? 2.5745 2.7795 2.3255 0.1165  -0.2943 0.3633  65  ASN A O   
91   C CB  . ASN A 21  ? 2.6014 2.8454 2.4030 0.1894  -0.3196 0.4058  65  ASN A CB  
92   C CG  . ASN A 21  ? 2.5584 2.8679 2.3829 0.1675  -0.3428 0.3732  65  ASN A CG  
93   O OD1 . ASN A 21  ? 2.5528 2.8697 2.3565 0.1418  -0.3460 0.3536  65  ASN A OD1 
94   N ND2 . ASN A 21  ? 2.5355 2.8922 2.4065 0.1790  -0.3576 0.3685  65  ASN A ND2 
95   N N   . ASN A 22  ? 1.3484 1.5168 1.1736 0.1193  -0.2782 0.3588  66  ASN A N   
96   C CA  . ASN A 22  ? 1.3137 1.4948 1.1601 0.0883  -0.2778 0.3248  66  ASN A CA  
97   C C   . ASN A 22  ? 1.3093 1.4503 1.1420 0.0630  -0.2582 0.3159  66  ASN A C   
98   O O   . ASN A 22  ? 1.2767 1.4256 1.1216 0.0385  -0.2572 0.2888  66  ASN A O   
99   C CB  . ASN A 22  ? 1.3205 1.4970 1.2125 0.0909  -0.2752 0.3121  66  ASN A CB  
100  C CG  . ASN A 22  ? 1.3212 1.5513 1.2365 0.1117  -0.2933 0.3155  66  ASN A CG  
101  O OD1 . ASN A 22  ? 1.2935 1.5804 1.2098 0.1066  -0.3126 0.3075  66  ASN A OD1 
102  N ND2 . ASN A 22  ? 1.3562 1.5681 1.2927 0.1359  -0.2877 0.3270  66  ASN A ND2 
103  N N   . THR A 23  ? 1.1849 1.2837 0.9950 0.0699  -0.2408 0.3403  67  THR A N   
104  C CA  . THR A 23  ? 1.1900 1.2560 0.9909 0.0485  -0.2201 0.3364  67  THR A CA  
105  C C   . THR A 23  ? 1.1766 1.2688 0.9308 0.0416  -0.2241 0.3323  67  THR A C   
106  O O   . THR A 23  ? 1.2052 1.3070 0.9167 0.0614  -0.2293 0.3534  67  THR A O   
107  C CB  . THR A 23  ? 1.2402 1.2522 1.0405 0.0580  -0.1964 0.3669  67  THR A CB  
108  O OG1 . THR A 23  ? 1.2610 1.2456 1.0978 0.0692  -0.1967 0.3716  67  THR A OG1 
109  C CG2 . THR A 23  ? 1.2482 1.2292 1.0581 0.0338  -0.1733 0.3614  67  THR A CG2 
110  N N   . HIS A 24  ? 1.2326 1.3328 0.9896 0.0161  -0.2221 0.3050  68  HIS A N   
111  C CA  . HIS A 24  ? 1.2243 1.3447 0.9335 0.0100  -0.2268 0.2968  68  HIS A CA  
112  C C   . HIS A 24  ? 1.2418 1.3296 0.9394 -0.0063 -0.1999 0.2948  68  HIS A C   
113  O O   . HIS A 24  ? 1.2211 1.2990 0.9527 -0.0274 -0.1918 0.2740  68  HIS A O   
114  C CB  . HIS A 24  ? 1.1706 1.3366 0.8891 -0.0047 -0.2513 0.2640  68  HIS A CB  
115  C CG  . HIS A 24  ? 1.1643 1.3727 0.8999 0.0105  -0.2782 0.2655  68  HIS A CG  
116  N ND1 . HIS A 24  ? 1.1276 1.3442 0.9151 0.0121  -0.2814 0.2603  68  HIS A ND1 
117  C CD2 . HIS A 24  ? 1.1949 1.4419 0.9036 0.0265  -0.3037 0.2713  68  HIS A CD2 
118  C CE1 . HIS A 24  ? 1.1372 1.3977 0.9345 0.0280  -0.3046 0.2647  68  HIS A CE1 
119  N NE2 . HIS A 24  ? 1.1751 1.4566 0.9277 0.0363  -0.3206 0.2709  68  HIS A NE2 
120  N N   . GLN A 25  ? 1.4612 1.5331 1.1095 0.0062  -0.1851 0.3175  69  GLN A N   
121  C CA  . GLN A 25  ? 1.4889 1.5323 1.1242 -0.0052 -0.1553 0.3202  69  GLN A CA  
122  C C   . GLN A 25  ? 1.4791 1.5408 1.0636 -0.0125 -0.1618 0.2982  69  GLN A C   
123  O O   . GLN A 25  ? 1.4755 1.5624 1.0113 0.0002  -0.1849 0.2950  69  GLN A O   
124  C CB  . GLN A 25  ? 1.5474 1.5558 1.1595 0.0141  -0.1272 0.3613  69  GLN A CB  
125  C CG  . GLN A 25  ? 1.5641 1.5502 1.1478 0.0094  -0.0945 0.3694  69  GLN A CG  
126  C CD  . GLN A 25  ? 1.6218 1.5900 1.1405 0.0376  -0.0766 0.4065  69  GLN A CD  
127  O OE1 . GLN A 25  ? 1.6620 1.5978 1.1971 0.0480  -0.0499 0.4416  69  GLN A OE1 
128  N NE2 . GLN A 25  ? 1.6285 1.6157 1.0712 0.0514  -0.0923 0.3990  69  GLN A NE2 
129  N N   . HIS A 26  ? 1.3378 1.3864 0.9353 -0.0325 -0.1438 0.2814  70  HIS A N   
130  C CA  . HIS A 26  ? 1.3448 1.3973 0.8898 -0.0376 -0.1413 0.2638  70  HIS A CA  
131  C C   . HIS A 26  ? 1.3901 1.4097 0.9363 -0.0422 -0.1012 0.2753  70  HIS A C   
132  O O   . HIS A 26  ? 1.3928 1.3978 1.0009 -0.0551 -0.0851 0.2774  70  HIS A O   
133  C CB  . HIS A 26  ? 1.2902 1.3681 0.8520 -0.0592 -0.1645 0.2232  70  HIS A CB  
134  C CG  . HIS A 26  ? 1.2982 1.3798 0.8002 -0.0628 -0.1693 0.2019  70  HIS A CG  
135  N ND1 . HIS A 26  ? 1.2825 1.3422 0.7744 -0.0739 -0.1450 0.1902  70  HIS A ND1 
136  C CD2 . HIS A 26  ? 1.3276 1.4305 0.7760 -0.0555 -0.1971 0.1891  70  HIS A CD2 
137  C CE1 . HIS A 26  ? 1.3014 1.3642 0.7316 -0.0729 -0.1557 0.1706  70  HIS A CE1 
138  N NE2 . HIS A 26  ? 1.3291 1.4178 0.7321 -0.0627 -0.1890 0.1684  70  HIS A NE2 
139  N N   . VAL A 27  ? 1.7524 1.7607 1.2308 -0.0301 -0.0855 0.2826  71  VAL A N   
140  C CA  . VAL A 27  ? 1.7983 1.7784 1.2766 -0.0316 -0.0433 0.2957  71  VAL A CA  
141  C C   . VAL A 27  ? 1.7995 1.7803 1.2501 -0.0433 -0.0396 0.2647  71  VAL A C   
142  O O   . VAL A 27  ? 1.7787 1.7739 1.1792 -0.0432 -0.0658 0.2391  71  VAL A O   
143  C CB  . VAL A 27  ? 1.8524 1.8096 1.2733 -0.0044 -0.0155 0.3346  71  VAL A CB  
144  C CG1 . VAL A 27  ? 1.8803 1.8276 1.3372 0.0062  -0.0109 0.3691  71  VAL A CG1 
145  C CG2 . VAL A 27  ? 1.9134 1.8798 1.2370 0.0153  -0.0374 0.3260  71  VAL A CG2 
146  N N   . PHE A 28  ? 1.5220 1.4867 1.0100 -0.0534 -0.0075 0.2670  72  PHE A N   
147  C CA  . PHE A 28  ? 1.5305 1.4919 1.0040 -0.0643 0.0005  0.2391  72  PHE A CA  
148  C C   . PHE A 28  ? 1.5879 1.5246 1.0368 -0.0513 0.0475  0.2622  72  PHE A C   
149  O O   . PHE A 28  ? 1.6146 1.5376 1.0452 -0.0328 0.0708  0.2988  72  PHE A O   
150  C CB  . PHE A 28  ? 1.5033 1.4733 1.0549 -0.0885 -0.0074 0.2162  72  PHE A CB  
151  C CG  . PHE A 28  ? 1.4380 1.4306 1.0132 -0.0999 -0.0479 0.1941  72  PHE A CG  
152  C CD1 . PHE A 28  ? 1.4104 1.4109 1.0236 -0.0968 -0.0620 0.2097  72  PHE A CD1 
153  C CD2 . PHE A 28  ? 1.3995 1.4035 0.9620 -0.1131 -0.0688 0.1587  72  PHE A CD2 
154  C CE1 . PHE A 28  ? 1.3477 1.3696 0.9835 -0.1045 -0.0949 0.1913  72  PHE A CE1 
155  C CE2 . PHE A 28  ? 1.3288 1.3548 0.9187 -0.1230 -0.1010 0.1415  72  PHE A CE2 
156  C CZ  . PHE A 28  ? 1.3042 1.3404 0.9300 -0.1177 -0.1132 0.1582  72  PHE A CZ  
157  N N   . ASP A 29  ? 1.9351 1.8649 1.3821 -0.0588 0.0639  0.2428  73  ASP A N   
158  C CA  . ASP A 29  ? 1.9855 1.8938 1.4106 -0.0448 0.1120  0.2633  73  ASP A CA  
159  C C   . ASP A 29  ? 1.9913 1.8980 1.5107 -0.0538 0.1461  0.2851  73  ASP A C   
160  O O   . ASP A 29  ? 1.9657 1.8837 1.5654 -0.0694 0.1318  0.2872  73  ASP A O   
161  C CB  . ASP A 29  ? 2.0130 1.9114 1.3810 -0.0438 0.1156  0.2323  73  ASP A CB  
162  C CG  . ASP A 29  ? 1.9946 1.9031 1.4225 -0.0679 0.1024  0.2000  73  ASP A CG  
163  O OD1 . ASP A 29  ? 2.0033 1.9144 1.5072 -0.0762 0.1243  0.2095  73  ASP A OD1 
164  O OD2 . ASP A 29  ? 1.9692 1.8829 1.3691 -0.0780 0.0698  0.1654  73  ASP A OD2 
165  N N   . ASP A 30  ? 2.9076 2.8000 2.4145 -0.0428 0.1904  0.2993  74  ASP A N   
166  C CA  . ASP A 30  ? 2.9092 2.7992 2.4936 -0.0439 0.2339  0.3310  74  ASP A CA  
167  C C   . ASP A 30  ? 2.8787 2.7855 2.5711 -0.0676 0.2285  0.3160  74  ASP A C   
168  O O   . ASP A 30  ? 2.8707 2.7860 2.5643 -0.0792 0.2028  0.2798  74  ASP A O   
169  C CB  . ASP A 30  ? 2.9339 2.8054 2.4613 -0.0215 0.2833  0.3468  74  ASP A CB  
170  C CG  . ASP A 30  ? 2.9517 2.8141 2.5185 -0.0100 0.3351  0.3965  74  ASP A CG  
171  O OD1 . ASP A 30  ? 2.9634 2.8280 2.5818 -0.0164 0.3302  0.4202  74  ASP A OD1 
172  O OD2 . ASP A 30  ? 2.9506 2.8017 2.4963 0.0066  0.3831  0.4127  74  ASP A OD2 
173  N N   . LEU A 31  ? 2.2112 2.1218 1.9945 -0.0742 0.2522  0.3437  75  LEU A N   
174  C CA  . LEU A 31  ? 2.1782 2.1045 2.0589 -0.0908 0.2562  0.3328  75  LEU A CA  
175  C C   . LEU A 31  ? 2.1888 2.1123 2.0587 -0.0774 0.3041  0.3435  75  LEU A C   
176  O O   . LEU A 31  ? 2.2003 2.1104 2.0372 -0.0591 0.3469  0.3770  75  LEU A O   
177  C CB  . LEU A 31  ? 2.1265 2.0596 2.1198 -0.1054 0.2593  0.3544  75  LEU A CB  
178  C CG  . LEU A 31  ? 2.1063 2.0362 2.1382 -0.1166 0.2274  0.3580  75  LEU A CG  
179  C CD1 . LEU A 31  ? 2.1431 2.0556 2.1229 -0.0995 0.2550  0.3929  75  LEU A CD1 
180  C CD2 . LEU A 31  ? 2.0762 2.0119 2.2313 -0.1341 0.2300  0.3692  75  LEU A CD2 
181  N N   . ARG A 32  ? 2.1743 2.1095 2.0767 -0.0846 0.2996  0.3178  76  ARG A N   
182  C CA  . ARG A 32  ? 2.1549 2.1042 2.1082 -0.1046 0.2534  0.2856  76  ARG A CA  
183  C C   . ARG A 32  ? 2.1979 2.1420 2.0855 -0.1028 0.2343  0.2482  76  ARG A C   
184  O O   . ARG A 32  ? 2.2226 2.1586 2.0720 -0.0900 0.2629  0.2454  76  ARG A O   
185  C CB  . ARG A 32  ? 2.1033 2.0724 2.1753 -0.1163 0.2608  0.2898  76  ARG A CB  
186  C CG  . ARG A 32  ? 2.1495 2.1235 2.3036 -0.1207 0.2858  0.3279  76  ARG A CG  
187  C CD  . ARG A 32  ? 2.0930 2.0901 2.3708 -0.1362 0.2781  0.3233  76  ARG A CD  
188  N NE  . ARG A 32  ? 2.1359 2.1375 2.5056 -0.1453 0.2972  0.3564  76  ARG A NE  
189  C CZ  . ARG A 32  ? 2.1145 2.1050 2.5076 -0.1564 0.2735  0.3626  76  ARG A CZ  
190  N NH1 . ARG A 32  ? 2.0452 2.0230 2.3733 -0.1572 0.2322  0.3398  76  ARG A NH1 
191  N NH2 . ARG A 32  ? 2.1521 2.1434 2.6349 -0.1663 0.2924  0.3919  76  ARG A NH2 
192  N N   . GLY A 33  ? 1.7355 1.6824 1.6148 -0.1152 0.1888  0.2198  77  GLY A N   
193  C CA  . GLY A 33  ? 1.7629 1.7045 1.5981 -0.1171 0.1717  0.1844  77  GLY A CA  
194  C C   . GLY A 33  ? 1.7262 1.6776 1.6087 -0.1327 0.1321  0.1610  77  GLY A C   
195  O O   . GLY A 33  ? 1.6789 1.6380 1.6027 -0.1407 0.1109  0.1680  77  GLY A O   
196  N N   . SER A 34  ? 1.6477 1.5953 1.5217 -0.1349 0.1239  0.1339  78  SER A N   
197  C CA  . SER A 34  ? 1.5601 1.5130 1.4684 -0.1459 0.0890  0.1122  78  SER A CA  
198  C C   . SER A 34  ? 1.5379 1.4876 1.3961 -0.1522 0.0596  0.0999  78  SER A C   
199  O O   . SER A 34  ? 1.5762 1.5167 1.3640 -0.1497 0.0610  0.0912  78  SER A O   
200  C CB  . SER A 34  ? 1.5405 1.4866 1.4493 -0.1438 0.0917  0.0897  78  SER A CB  
201  O OG  . SER A 34  ? 1.5584 1.5152 1.5340 -0.1382 0.1115  0.1010  78  SER A OG  
202  N N   . VAL A 35  ? 1.5448 1.5026 1.4410 -0.1593 0.0323  0.0988  79  VAL A N   
203  C CA  . VAL A 35  ? 1.5129 1.4732 1.3743 -0.1635 0.0064  0.0924  79  VAL A CA  
204  C C   . VAL A 35  ? 1.4003 1.3603 1.2715 -0.1702 -0.0198 0.0681  79  VAL A C   
205  O O   . VAL A 35  ? 1.3486 1.3091 1.2706 -0.1708 -0.0299 0.0654  79  VAL A O   
206  C CB  . VAL A 35  ? 1.5313 1.4978 1.4208 -0.1622 -0.0002 0.1157  79  VAL A CB  
207  C CG1 . VAL A 35  ? 1.5006 1.4728 1.3556 -0.1633 -0.0257 0.1107  79  VAL A CG1 
208  C CG2 . VAL A 35  ? 1.6228 1.5863 1.5047 -0.1539 0.0308  0.1443  79  VAL A CG2 
209  N N   . SER A 36  ? 1.2679 1.2257 1.0904 -0.1747 -0.0304 0.0503  80  SER A N   
210  C CA  . SER A 36  ? 1.1679 1.1258 0.9975 -0.1806 -0.0523 0.0317  80  SER A CA  
211  C C   . SER A 36  ? 1.1335 1.1048 0.9442 -0.1841 -0.0728 0.0323  80  SER A C   
212  O O   . SER A 36  ? 1.1640 1.1411 0.9333 -0.1851 -0.0732 0.0337  80  SER A O   
213  C CB  . SER A 36  ? 1.1430 1.0868 0.9452 -0.1848 -0.0462 0.0093  80  SER A CB  
214  O OG  . SER A 36  ? 1.1619 1.0945 0.9880 -0.1790 -0.0306 0.0074  80  SER A OG  
215  N N   . LEU A 37  ? 0.9458 0.9222 0.7861 -0.1837 -0.0904 0.0311  81  LEU A N   
216  C CA  . LEU A 37  ? 0.9052 0.8972 0.7366 -0.1852 -0.1093 0.0311  81  LEU A CA  
217  C C   . LEU A 37  ? 0.8328 0.8226 0.6717 -0.1893 -0.1183 0.0135  81  LEU A C   
218  O O   . LEU A 37  ? 0.8116 0.7888 0.6759 -0.1839 -0.1188 0.0103  81  LEU A O   
219  C CB  . LEU A 37  ? 0.9255 0.9230 0.7842 -0.1769 -0.1180 0.0503  81  LEU A CB  
220  C CG  . LEU A 37  ? 0.9016 0.9168 0.7558 -0.1736 -0.1358 0.0558  81  LEU A CG  
221  C CD1 . LEU A 37  ? 0.9571 0.9711 0.8261 -0.1640 -0.1367 0.0792  81  LEU A CD1 
222  C CD2 . LEU A 37  ? 0.8418 0.8577 0.7157 -0.1722 -0.1479 0.0441  81  LEU A CD2 
223  N N   . SER A 38  ? 1.0620 1.0633 0.8799 -0.1979 -0.1254 0.0026  82  SER A N   
224  C CA  . SER A 38  ? 1.0115 1.0112 0.8392 -0.2025 -0.1294 -0.0109 82  SER A CA  
225  C C   . SER A 38  ? 0.9927 1.0186 0.8271 -0.2058 -0.1444 -0.0097 82  SER A C   
226  O O   . SER A 38  ? 1.0010 1.0461 0.8187 -0.2131 -0.1532 -0.0114 82  SER A O   
227  C CB  . SER A 38  ? 1.0039 0.9882 0.8108 -0.2136 -0.1185 -0.0292 82  SER A CB  
228  O OG  . SER A 38  ? 1.0219 0.9823 0.8290 -0.2077 -0.1037 -0.0309 82  SER A OG  
229  N N   . TRP A 39  ? 0.8280 0.8554 0.6864 -0.1985 -0.1477 -0.0073 83  TRP A N   
230  C CA  . TRP A 39  ? 0.8243 0.8790 0.6963 -0.2007 -0.1581 -0.0058 83  TRP A CA  
231  C C   . TRP A 39  ? 0.8125 0.8684 0.6846 -0.2167 -0.1524 -0.0220 83  TRP A C   
232  O O   . TRP A 39  ? 0.8097 0.8386 0.6780 -0.2180 -0.1383 -0.0306 83  TRP A O   
233  C CB  . TRP A 39  ? 0.8345 0.8877 0.7290 -0.1841 -0.1602 0.0038  83  TRP A CB  
234  C CG  . TRP A 39  ? 0.8577 0.9141 0.7565 -0.1713 -0.1692 0.0194  83  TRP A CG  
235  C CD1 . TRP A 39  ? 0.8699 0.9031 0.7697 -0.1633 -0.1673 0.0251  83  TRP A CD1 
236  C CD2 . TRP A 39  ? 0.8796 0.9634 0.7864 -0.1650 -0.1815 0.0323  83  TRP A CD2 
237  N NE1 . TRP A 39  ? 0.9010 0.9411 0.8082 -0.1536 -0.1758 0.0411  83  TRP A NE1 
238  C CE2 . TRP A 39  ? 0.9050 0.9751 0.8133 -0.1528 -0.1843 0.0464  83  TRP A CE2 
239  C CE3 . TRP A 39  ? 0.8869 1.0065 0.8040 -0.1682 -0.1908 0.0337  83  TRP A CE3 
240  C CZ2 . TRP A 39  ? 0.9342 1.0203 0.8475 -0.1418 -0.1942 0.0627  83  TRP A CZ2 
241  C CZ3 . TRP A 39  ? 0.9133 1.0542 0.8371 -0.1561 -0.2028 0.0496  83  TRP A CZ3 
242  C CH2 . TRP A 39  ? 0.9350 1.0568 0.8536 -0.1421 -0.2036 0.0645  83  TRP A CH2 
243  N N   . VAL A 40  ? 0.8589 0.9444 0.7359 -0.2291 -0.1641 -0.0266 84  VAL A N   
244  C CA  . VAL A 40  ? 0.8671 0.9534 0.7541 -0.2472 -0.1592 -0.0423 84  VAL A CA  
245  C C   . VAL A 40  ? 0.8824 1.0028 0.8102 -0.2489 -0.1649 -0.0371 84  VAL A C   
246  O O   . VAL A 40  ? 0.8881 1.0463 0.8290 -0.2529 -0.1838 -0.0348 84  VAL A O   
247  C CB  . VAL A 40  ? 0.8756 0.9632 0.7365 -0.2650 -0.1680 -0.0589 84  VAL A CB  
248  C CG1 . VAL A 40  ? 0.8880 0.9704 0.7641 -0.2859 -0.1627 -0.0768 84  VAL A CG1 
249  C CG2 . VAL A 40  ? 0.8776 0.9312 0.6989 -0.2597 -0.1569 -0.0616 84  VAL A CG2 
250  N N   . GLY A 41  ? 0.8743 0.9812 0.8216 -0.2436 -0.1474 -0.0342 85  GLY A N   
251  C CA  . GLY A 41  ? 0.9077 1.0433 0.8965 -0.2422 -0.1446 -0.0265 85  GLY A CA  
252  C C   . GLY A 41  ? 0.9405 1.0919 0.9407 -0.2178 -0.1492 -0.0081 85  GLY A C   
253  O O   . GLY A 41  ? 0.9257 1.0764 0.9074 -0.2062 -0.1618 -0.0011 85  GLY A O   
254  N N   . ASP A 42  ? 0.7720 0.9348 0.8030 -0.2092 -0.1364 0.0006  86  ASP A N   
255  C CA  . ASP A 42  ? 0.8066 0.9851 0.8506 -0.1846 -0.1389 0.0172  86  ASP A CA  
256  C C   . ASP A 42  ? 0.8258 1.0617 0.9126 -0.1911 -0.1531 0.0232  86  ASP A C   
257  O O   . ASP A 42  ? 0.8159 1.0784 0.9369 -0.2123 -0.1519 0.0162  86  ASP A O   
258  C CB  . ASP A 42  ? 0.8477 1.0010 0.8930 -0.1647 -0.1140 0.0245  86  ASP A CB  
259  C CG  . ASP A 42  ? 0.8958 1.0595 0.9494 -0.1364 -0.1149 0.0401  86  ASP A CG  
260  O OD1 . ASP A 42  ? 0.8858 1.0295 0.9137 -0.1196 -0.1266 0.0431  86  ASP A OD1 
261  O OD2 . ASP A 42  ? 0.9238 1.1153 1.0133 -0.1307 -0.1025 0.0497  86  ASP A OD2 
262  N N   . SER A 43  ? 0.9822 1.2367 1.0696 -0.1731 -0.1678 0.0359  87  SER A N   
263  C CA  . SER A 43  ? 0.9813 1.2931 1.1089 -0.1733 -0.1843 0.0441  87  SER A CA  
264  C C   . SER A 43  ? 0.9247 1.2659 1.0517 -0.1967 -0.2104 0.0322  87  SER A C   
265  O O   . SER A 43  ? 0.9167 1.3084 1.0768 -0.1984 -0.2294 0.0362  87  SER A O   
266  C CB  . SER A 43  ? 1.0045 1.3461 1.1869 -0.1733 -0.1668 0.0500  87  SER A CB  
267  O OG  . SER A 43  ? 1.0504 1.3717 1.2291 -0.1434 -0.1464 0.0644  87  SER A OG  
268  N N   . THR A 44  ? 0.9270 1.2364 1.0155 -0.2128 -0.2116 0.0169  88  THR A N   
269  C CA  . THR A 44  ? 0.8861 1.2112 0.9554 -0.2296 -0.2361 0.0044  88  THR A CA  
270  C C   . THR A 44  ? 0.8744 1.1966 0.9033 -0.2132 -0.2525 0.0151  88  THR A C   
271  O O   . THR A 44  ? 0.8672 1.2227 0.8932 -0.2143 -0.2774 0.0150  88  THR A O   
272  C CB  . THR A 44  ? 0.8566 1.1443 0.8961 -0.2509 -0.2274 -0.0163 88  THR A CB  
273  O OG1 . THR A 44  ? 0.8385 1.0814 0.8294 -0.2394 -0.2176 -0.0131 88  THR A OG1 
274  C CG2 . THR A 44  ? 0.8733 1.1466 0.9427 -0.2625 -0.2033 -0.0227 88  THR A CG2 
275  N N   . GLY A 45  ? 0.8699 1.1519 0.8687 -0.1974 -0.2391 0.0248  89  GLY A N   
276  C CA  . GLY A 45  ? 0.8644 1.1373 0.8272 -0.1841 -0.2489 0.0367  89  GLY A CA  
277  C C   . GLY A 45  ? 0.8404 1.0873 0.7572 -0.1958 -0.2482 0.0255  89  GLY A C   
278  O O   . GLY A 45  ? 0.8489 1.0854 0.7325 -0.1855 -0.2519 0.0364  89  GLY A O   
279  N N   . VAL A 46  ? 0.9871 1.2207 0.9018 -0.2159 -0.2403 0.0051  90  VAL A N   
280  C CA  . VAL A 46  ? 0.9788 1.1854 0.8499 -0.2267 -0.2367 -0.0084 90  VAL A CA  
281  C C   . VAL A 46  ? 0.9778 1.1405 0.8279 -0.2188 -0.2149 -0.0029 90  VAL A C   
282  O O   . VAL A 46  ? 0.9635 1.1051 0.8313 -0.2177 -0.1990 -0.0046 90  VAL A O   
283  C CB  . VAL A 46  ? 0.9704 1.1738 0.8485 -0.2505 -0.2352 -0.0329 90  VAL A CB  
284  C CG1 . VAL A 46  ? 0.9824 1.1504 0.8116 -0.2577 -0.2276 -0.0467 90  VAL A CG1 
285  C CG2 . VAL A 46  ? 0.9798 1.2282 0.8818 -0.2627 -0.2609 -0.0422 90  VAL A CG2 
286  N N   . ILE A 47  ? 0.8526 1.0022 0.6651 -0.2120 -0.2140 0.0041  91  ILE A N   
287  C CA  . ILE A 47  ? 0.8469 0.9604 0.6463 -0.2059 -0.1936 0.0100  91  ILE A CA  
288  C C   . ILE A 47  ? 0.8825 0.9775 0.6377 -0.2124 -0.1858 -0.0005 91  ILE A C   
289  O O   . ILE A 47  ? 0.9206 1.0276 0.6416 -0.2120 -0.1979 -0.0019 91  ILE A O   
290  C CB  . ILE A 47  ? 0.8436 0.9542 0.6469 -0.1879 -0.1922 0.0348  91  ILE A CB  
291  C CG1 . ILE A 47  ? 0.8211 0.9508 0.6592 -0.1780 -0.2029 0.0451  91  ILE A CG1 
292  C CG2 . ILE A 47  ? 0.8479 0.9253 0.6570 -0.1841 -0.1725 0.0397  91  ILE A CG2 
293  C CD1 . ILE A 47  ? 0.8501 0.9677 0.6961 -0.1607 -0.2001 0.0678  91  ILE A CD1 
294  N N   . LEU A 48  ? 0.9286 0.9938 0.6813 -0.2160 -0.1662 -0.0083 92  LEU A N   
295  C CA  . LEU A 48  ? 0.9725 1.0160 0.6831 -0.2178 -0.1534 -0.0157 92  LEU A CA  
296  C C   . LEU A 48  ? 1.0235 1.0489 0.7365 -0.2052 -0.1334 0.0024  92  LEU A C   
297  O O   . LEU A 48  ? 1.0090 1.0232 0.7560 -0.2029 -0.1242 0.0053  92  LEU A O   
298  C CB  . LEU A 48  ? 0.9527 0.9755 0.6577 -0.2315 -0.1446 -0.0398 92  LEU A CB  
299  C CG  . LEU A 48  ? 0.9694 1.0034 0.6604 -0.2480 -0.1621 -0.0620 92  LEU A CG  
300  C CD1 . LEU A 48  ? 0.9882 0.9909 0.6651 -0.2606 -0.1491 -0.0852 92  LEU A CD1 
301  C CD2 . LEU A 48  ? 1.0163 1.0648 0.6643 -0.2447 -0.1795 -0.0626 92  LEU A CD2 
302  N N   . VAL A 49  ? 0.9747 0.9978 0.6532 -0.1960 -0.1270 0.0152  93  VAL A N   
303  C CA  . VAL A 49  ? 1.0478 1.0537 0.7314 -0.1856 -0.1026 0.0335  93  VAL A CA  
304  C C   . VAL A 49  ? 1.1046 1.0894 0.7462 -0.1852 -0.0827 0.0232  93  VAL A C   
305  O O   . VAL A 49  ? 1.1279 1.1111 0.7156 -0.1841 -0.0878 0.0149  93  VAL A O   
306  C CB  . VAL A 49  ? 1.1012 1.1148 0.7785 -0.1718 -0.1013 0.0622  93  VAL A CB  
307  C CG1 . VAL A 49  ? 1.1961 1.1918 0.8759 -0.1631 -0.0714 0.0811  93  VAL A CG1 
308  C CG2 . VAL A 49  ? 1.0608 1.0880 0.7837 -0.1693 -0.1165 0.0742  93  VAL A CG2 
309  N N   . LEU A 50  ? 1.1170 1.0851 0.7818 -0.1845 -0.0615 0.0224  94  LEU A N   
310  C CA  . LEU A 50  ? 1.1790 1.1252 0.8076 -0.1812 -0.0386 0.0135  94  LEU A CA  
311  C C   . LEU A 50  ? 1.2747 1.2138 0.9215 -0.1686 -0.0085 0.0365  94  LEU A C   
312  O O   . LEU A 50  ? 1.2664 1.2099 0.9726 -0.1687 -0.0040 0.0460  94  LEU A O   
313  C CB  . LEU A 50  ? 1.1258 1.0573 0.7649 -0.1907 -0.0378 -0.0109 94  LEU A CB  
314  C CG  . LEU A 50  ? 1.1939 1.0987 0.8034 -0.1858 -0.0125 -0.0214 94  LEU A CG  
315  C CD1 . LEU A 50  ? 1.2258 1.1166 0.7635 -0.1876 -0.0166 -0.0391 94  LEU A CD1 
316  C CD2 . LEU A 50  ? 1.1461 1.0368 0.7839 -0.1910 -0.0090 -0.0371 94  LEU A CD2 
317  N N   . THR A 51  ? 1.1560 1.0839 0.7521 -0.1573 0.0119  0.0447  95  THR A N   
318  C CA  . THR A 51  ? 1.2530 1.1760 0.8645 -0.1438 0.0461  0.0712  95  THR A CA  
319  C C   . THR A 51  ? 1.3110 1.2121 0.8855 -0.1345 0.0763  0.0634  95  THR A C   
320  O O   . THR A 51  ? 1.3180 1.2027 0.8175 -0.1290 0.0766  0.0501  95  THR A O   
321  C CB  . THR A 51  ? 1.2864 1.2133 0.8669 -0.1315 0.0523  0.0983  95  THR A CB  
322  O OG1 . THR A 51  ? 1.2775 1.2221 0.9012 -0.1368 0.0309  0.1113  95  THR A OG1 
323  C CG2 . THR A 51  ? 1.2816 1.2003 0.8730 -0.1172 0.0944  0.1269  95  THR A CG2 
324  N N   . THR A 52  ? 1.7598 1.6599 1.3852 -0.1307 0.1011  0.0713  96  THR A N   
325  C CA  . THR A 52  ? 1.8059 1.6856 1.4006 -0.1186 0.1334  0.0656  96  THR A CA  
326  C C   . THR A 52  ? 1.8504 1.7347 1.4773 -0.1033 0.1753  0.0974  96  THR A C   
327  O O   . THR A 52  ? 1.8400 1.7446 1.5484 -0.1075 0.1782  0.1160  96  THR A O   
328  C CB  . THR A 52  ? 1.7728 1.6448 1.3954 -0.1254 0.1285  0.0414  96  THR A CB  
329  O OG1 . THR A 52  ? 1.7588 1.6504 1.4699 -0.1276 0.1297  0.0540  96  THR A OG1 
330  C CG2 . THR A 52  ? 1.6800 1.5471 1.2803 -0.1415 0.0923  0.0132  96  THR A CG2 
331  N N   . PHE A 53  ? 2.1013 1.9655 1.6653 -0.0852 0.2080  0.1029  97  PHE A N   
332  C CA  . PHE A 53  ? 2.1022 1.9698 1.6924 -0.0681 0.2548  0.1360  97  PHE A CA  
333  C C   . PHE A 53  ? 2.1286 1.9825 1.7152 -0.0533 0.2913  0.1306  97  PHE A C   
334  O O   . PHE A 53  ? 2.1882 2.0125 1.6942 -0.0440 0.2960  0.1079  97  PHE A O   
335  C CB  . PHE A 53  ? 2.1504 2.0055 1.6681 -0.0512 0.2735  0.1583  97  PHE A CB  
336  C CG  . PHE A 53  ? 2.1263 1.9960 1.6559 -0.0594 0.2486  0.1747  97  PHE A CG  
337  C CD1 . PHE A 53  ? 2.0556 1.9491 1.6819 -0.0706 0.2469  0.1971  97  PHE A CD1 
338  C CD2 . PHE A 53  ? 2.1744 2.0327 1.6177 -0.0541 0.2267  0.1679  97  PHE A CD2 
339  C CE1 . PHE A 53  ? 2.0381 1.9400 1.6723 -0.0759 0.2260  0.2125  97  PHE A CE1 
340  C CE2 . PHE A 53  ? 2.1537 2.0255 1.6078 -0.0583 0.2051  0.1848  97  PHE A CE2 
341  C CZ  . PHE A 53  ? 2.0885 1.9801 1.6367 -0.0688 0.2064  0.2076  97  PHE A CZ  
342  N N   . HIS A 54  ? 2.1542 2.0296 1.8306 -0.0503 0.3172  0.1521  98  HIS A N   
343  C CA  . HIS A 54  ? 2.1672 2.0366 1.8546 -0.0323 0.3586  0.1554  98  HIS A CA  
344  C C   . HIS A 54  ? 2.1684 2.0428 1.8672 -0.0124 0.4125  0.1949  98  HIS A C   
345  O O   . HIS A 54  ? 2.1133 2.0187 1.9116 -0.0182 0.4245  0.2221  98  HIS A O   
346  C CB  . HIS A 54  ? 2.1101 2.0067 1.9054 -0.0414 0.3496  0.1520  98  HIS A CB  
347  C CG  . HIS A 54  ? 2.0900 1.9866 1.8949 -0.0604 0.2995  0.1214  98  HIS A CG  
348  N ND1 . HIS A 54  ? 2.1025 1.9737 1.8573 -0.0593 0.2880  0.0895  98  HIS A ND1 
349  C CD2 . HIS A 54  ? 2.0538 1.9690 1.9078 -0.0796 0.2603  0.1188  98  HIS A CD2 
350  C CE1 . HIS A 54  ? 2.0748 1.9513 1.8517 -0.0768 0.2463  0.0711  98  HIS A CE1 
351  N NE2 . HIS A 54  ? 2.0472 1.9503 1.8810 -0.0883 0.2284  0.0877  98  HIS A NE2 
352  N N   . VAL A 55  ? 2.0816 1.9251 1.6840 0.0116  0.4462  0.1981  99  VAL A N   
353  C CA  . VAL A 55  ? 2.0877 1.9328 1.7019 0.0364  0.5086  0.2352  99  VAL A CA  
354  C C   . VAL A 55  ? 2.1572 1.9624 1.6690 0.0655  0.5429  0.2218  99  VAL A C   
355  O O   . VAL A 55  ? 2.2072 1.9778 1.6169 0.0664  0.5164  0.1882  99  VAL A O   
356  C CB  . VAL A 55  ? 2.0845 1.9312 1.6830 0.0423  0.5270  0.2735  99  VAL A CB  
357  C CG1 . VAL A 55  ? 2.0029 1.8849 1.7093 0.0159  0.5004  0.2905  99  VAL A CG1 
358  C CG2 . VAL A 55  ? 2.1407 1.9506 1.6005 0.0535  0.5112  0.2607  99  VAL A CG2 
359  N N   . PRO A 56  ? 2.2722 2.0817 1.8135 0.0897  0.6022  0.2478  100 PRO A N   
360  C CA  . PRO A 56  ? 2.3328 2.1044 1.7877 0.1218  0.6430  0.2381  100 PRO A CA  
361  C C   . PRO A 56  ? 2.4146 2.1320 1.7096 0.1356  0.6300  0.2121  100 PRO A C   
362  O O   . PRO A 56  ? 2.4668 2.1453 1.6834 0.1572  0.6487  0.1903  100 PRO A O   
363  C CB  . PRO A 56  ? 2.3129 2.0989 1.8082 0.1472  0.7129  0.2873  100 PRO A CB  
364  C CG  . PRO A 56  ? 2.2289 2.0707 1.8783 0.1226  0.7060  0.3138  100 PRO A CG  
365  C CD  . PRO A 56  ? 2.2022 2.0553 1.8718 0.0875  0.6358  0.2902  100 PRO A CD  
366  N N   . GLN A 64  ? 1.9845 1.7524 1.2568 -0.0341 0.2579  0.0679  108 GLN A N   
367  C CA  . GLN A 64  ? 1.9847 1.7434 1.2235 -0.0530 0.2118  0.0291  108 GLN A CA  
368  C C   . GLN A 64  ? 1.9271 1.7195 1.2256 -0.0762 0.1711  0.0313  108 GLN A C   
369  O O   . GLN A 64  ? 1.8864 1.7061 1.2598 -0.0795 0.1768  0.0587  108 GLN A O   
370  C CB  . GLN A 64  ? 2.0536 1.7820 1.1759 -0.0410 0.2010  0.0106  108 GLN A CB  
371  C CG  . GLN A 64  ? 2.1281 1.8146 1.1781 -0.0169 0.2383  0.0012  108 GLN A CG  
372  C CD  . GLN A 64  ? 2.2274 1.8811 1.1537 0.0000  0.2278  -0.0149 108 GLN A CD  
373  O OE1 . GLN A 64  ? 2.2333 1.8988 1.1318 -0.0087 0.1877  -0.0220 108 GLN A OE1 
374  N NE2 . GLN A 64  ? 2.3038 1.9160 1.1534 0.0266  0.2631  -0.0210 108 GLN A NE2 
375  N N   . SER A 65  ? 1.7577 1.5472 1.0247 -0.0919 0.1302  0.0022  109 SER A N   
376  C CA  . SER A 65  ? 1.6933 1.5125 1.0224 -0.1140 0.0941  -0.0007 109 SER A CA  
377  C C   . SER A 65  ? 1.6949 1.5272 0.9851 -0.1189 0.0575  -0.0053 109 SER A C   
378  O O   . SER A 65  ? 1.7307 1.5453 0.9466 -0.1168 0.0421  -0.0280 109 SER A O   
379  C CB  . SER A 65  ? 1.6560 1.4668 1.0145 -0.1317 0.0804  -0.0302 109 SER A CB  
380  O OG  . SER A 65  ? 1.6114 1.4476 1.0205 -0.1509 0.0473  -0.0342 109 SER A OG  
381  N N   . LYS A 66  ? 1.5992 1.4622 0.9417 -0.1245 0.0423  0.0154  110 LYS A N   
382  C CA  . LYS A 66  ? 1.5904 1.4721 0.9093 -0.1269 0.0080  0.0160  110 LYS A CA  
383  C C   . LYS A 66  ? 1.5200 1.4272 0.9011 -0.1488 -0.0249 0.0041  110 LYS A C   
384  O O   . LYS A 66  ? 1.4822 1.3980 0.9329 -0.1560 -0.0179 0.0121  110 LYS A O   
385  C CB  . LYS A 66  ? 1.6044 1.4964 0.9234 -0.1094 0.0221  0.0549  110 LYS A CB  
386  C CG  . LYS A 66  ? 1.6802 1.5467 0.9341 -0.0844 0.0589  0.0717  110 LYS A CG  
387  C CD  . LYS A 66  ? 1.7290 1.5945 0.9072 -0.0663 0.0457  0.0831  110 LYS A CD  
388  C CE  . LYS A 66  ? 1.8194 1.6506 0.8928 -0.0447 0.0620  0.0725  110 LYS A CE  
389  N NZ  . LYS A 66  ? 1.8397 1.6475 0.9168 -0.0325 0.1142  0.0849  110 LYS A NZ  
390  N N   . LEU A 67  ? 1.3938 1.3136 0.7510 -0.1579 -0.0609 -0.0148 111 LEU A N   
391  C CA  . LEU A 67  ? 1.3141 1.2582 0.7296 -0.1776 -0.0884 -0.0260 111 LEU A CA  
392  C C   . LEU A 67  ? 1.2811 1.2574 0.6972 -0.1778 -0.1221 -0.0205 111 LEU A C   
393  O O   . LEU A 67  ? 1.2958 1.2761 0.6630 -0.1782 -0.1458 -0.0370 111 LEU A O   
394  C CB  . LEU A 67  ? 1.2871 1.2164 0.6963 -0.1958 -0.0981 -0.0619 111 LEU A CB  
395  C CG  . LEU A 67  ? 1.1935 1.1438 0.6636 -0.2157 -0.1193 -0.0727 111 LEU A CG  
396  C CD1 . LEU A 67  ? 1.1563 1.1067 0.6888 -0.2150 -0.1009 -0.0575 111 LEU A CD1 
397  C CD2 . LEU A 67  ? 1.1874 1.1226 0.6446 -0.2350 -0.1317 -0.1080 111 LEU A CD2 
398  N N   . TYR A 68  ? 1.3811 1.3801 0.8527 -0.1769 -0.1265 0.0009  112 TYR A N   
399  C CA  . TYR A 68  ? 1.3496 1.3800 0.8243 -0.1741 -0.1569 0.0078  112 TYR A CA  
400  C C   . TYR A 68  ? 1.2582 1.3138 0.7898 -0.1915 -0.1793 -0.0059 112 TYR A C   
401  O O   . TYR A 68  ? 1.2156 1.2622 0.7871 -0.2033 -0.1687 -0.0153 112 TYR A O   
402  C CB  . TYR A 68  ? 1.3683 1.4046 0.8572 -0.1564 -0.1463 0.0443  112 TYR A CB  
403  C CG  . TYR A 68  ? 1.4480 1.4594 0.8911 -0.1382 -0.1166 0.0647  112 TYR A CG  
404  C CD1 . TYR A 68  ? 1.4677 1.4572 0.9342 -0.1379 -0.0818 0.0734  112 TYR A CD1 
405  C CD2 . TYR A 68  ? 1.4994 1.5101 0.8768 -0.1192 -0.1223 0.0768  112 TYR A CD2 
406  C CE1 . TYR A 68  ? 1.5257 1.4947 0.9567 -0.1207 -0.0499 0.0950  112 TYR A CE1 
407  C CE2 . TYR A 68  ? 1.5657 1.5513 0.8982 -0.0999 -0.0900 0.0989  112 TYR A CE2 
408  C CZ  . TYR A 68  ? 1.5742 1.5398 0.9365 -0.1014 -0.0520 0.1086  112 TYR A CZ  
409  O OH  . TYR A 68  ? 1.6291 1.5719 0.9522 -0.0815 -0.0155 0.1331  112 TYR A OH  
410  N N   . ARG A 69  ? 1.3808 1.4689 0.9180 -0.1895 -0.2083 -0.0031 113 ARG A N   
411  C CA  . ARG A 69  ? 1.2968 1.4131 0.8891 -0.2040 -0.2277 -0.0140 113 ARG A CA  
412  C C   . ARG A 69  ? 1.2733 1.4253 0.8858 -0.1921 -0.2488 0.0051  113 ARG A C   
413  O O   . ARG A 69  ? 1.3198 1.4817 0.8906 -0.1778 -0.2629 0.0142  113 ARG A O   
414  C CB  . ARG A 69  ? 1.2840 1.4051 0.8651 -0.2236 -0.2467 -0.0472 113 ARG A CB  
415  C CG  . ARG A 69  ? 1.2041 1.3540 0.8478 -0.2404 -0.2615 -0.0576 113 ARG A CG  
416  C CD  . ARG A 69  ? 1.1970 1.3426 0.8361 -0.2636 -0.2739 -0.0911 113 ARG A CD  
417  N NE  . ARG A 69  ? 1.1309 1.3063 0.8362 -0.2811 -0.2853 -0.0993 113 ARG A NE  
418  C CZ  . ARG A 69  ? 1.1084 1.3312 0.8449 -0.2825 -0.3141 -0.0974 113 ARG A CZ  
419  N NH1 . ARG A 69  ? 1.1430 1.3861 0.8454 -0.2657 -0.3361 -0.0877 113 ARG A NH1 
420  N NH2 . ARG A 69  ? 1.0574 1.3078 0.8598 -0.2985 -0.3191 -0.1031 113 ARG A NH2 
421  N N   . SER A 70  ? 1.2186 1.3879 0.8910 -0.1951 -0.2502 0.0114  114 SER A N   
422  C CA  . SER A 70  ? 1.1941 1.3980 0.8926 -0.1827 -0.2689 0.0287  114 SER A CA  
423  C C   . SER A 70  ? 1.1221 1.3567 0.8782 -0.1955 -0.2812 0.0169  114 SER A C   
424  O O   . SER A 70  ? 1.0837 1.3032 0.8700 -0.2062 -0.2647 0.0088  114 SER A O   
425  C CB  . SER A 70  ? 1.2015 1.3896 0.9142 -0.1648 -0.2514 0.0576  114 SER A CB  
426  O OG  . SER A 70  ? 1.1685 1.3854 0.9150 -0.1534 -0.2660 0.0718  114 SER A OG  
427  N N   . GLU A 71  ? 1.2600 1.5379 1.0314 -0.1935 -0.3092 0.0162  115 GLU A N   
428  C CA  . GLU A 71  ? 1.2013 1.5143 1.0364 -0.2024 -0.3176 0.0111  115 GLU A CA  
429  C C   . GLU A 71  ? 1.1817 1.5149 1.0507 -0.1810 -0.3178 0.0368  115 GLU A C   
430  O O   . GLU A 71  ? 1.1435 1.5073 1.0656 -0.1829 -0.3215 0.0371  115 GLU A O   
431  C CB  . GLU A 71  ? 1.1996 1.5540 1.0453 -0.2164 -0.3498 -0.0086 115 GLU A CB  
432  C CG  . GLU A 71  ? 1.2126 1.5467 1.0370 -0.2413 -0.3509 -0.0391 115 GLU A CG  
433  C CD  . GLU A 71  ? 1.2177 1.5914 1.0525 -0.2562 -0.3888 -0.0616 115 GLU A CD  
434  O OE1 . GLU A 71  ? 1.2225 1.6419 1.0715 -0.2438 -0.4173 -0.0522 115 GLU A OE1 
435  O OE2 . GLU A 71  ? 1.2198 1.5783 1.0502 -0.2802 -0.3915 -0.0898 115 GLU A OE2 
436  N N   . ASP A 72  ? 1.0674 1.3834 0.9053 -0.1596 -0.3133 0.0591  116 ASP A N   
437  C CA  . ASP A 72  ? 1.0582 1.3877 0.9204 -0.1365 -0.3149 0.0841  116 ASP A CA  
438  C C   . ASP A 72  ? 1.0482 1.3398 0.9254 -0.1272 -0.2891 0.0971  116 ASP A C   
439  O O   . ASP A 72  ? 1.0556 1.3450 0.9393 -0.1059 -0.2888 0.1189  116 ASP A O   
440  C CB  . ASP A 72  ? 1.1044 1.4422 0.9262 -0.1154 -0.3304 0.1034  116 ASP A CB  
441  C CG  . ASP A 72  ? 1.1662 1.4661 0.9259 -0.1151 -0.3192 0.1051  116 ASP A CG  
442  O OD1 . ASP A 72  ? 1.1738 1.4328 0.9301 -0.1212 -0.2924 0.1054  116 ASP A OD1 
443  O OD2 . ASP A 72  ? 1.2116 1.5235 0.9256 -0.1070 -0.3376 0.1063  116 ASP A OD2 
444  N N   . TYR A 73  ? 1.0167 1.2753 0.8948 -0.1412 -0.2695 0.0838  117 TYR A N   
445  C CA  . TYR A 73  ? 1.0096 1.2298 0.8994 -0.1332 -0.2495 0.0917  117 TYR A CA  
446  C C   . TYR A 73  ? 1.0566 1.2409 0.9165 -0.1271 -0.2380 0.1048  117 TYR A C   
447  O O   . TYR A 73  ? 1.0588 1.2143 0.9318 -0.1185 -0.2270 0.1142  117 TYR A O   
448  C CB  . TYR A 73  ? 0.9869 1.2164 0.9099 -0.1142 -0.2514 0.1054  117 TYR A CB  
449  C CG  . TYR A 73  ? 0.9481 1.1942 0.9067 -0.1197 -0.2477 0.0930  117 TYR A CG  
450  C CD1 . TYR A 73  ? 0.9340 1.2283 0.9174 -0.1267 -0.2608 0.0874  117 TYR A CD1 
451  C CD2 . TYR A 73  ? 0.9325 1.1458 0.9007 -0.1175 -0.2308 0.0870  117 TYR A CD2 
452  C CE1 . TYR A 73  ? 0.9113 1.2206 0.9323 -0.1322 -0.2522 0.0791  117 TYR A CE1 
453  C CE2 . TYR A 73  ? 0.9128 1.1374 0.9077 -0.1197 -0.2228 0.0785  117 TYR A CE2 
454  C CZ  . TYR A 73  ? 0.9056 1.1782 0.9289 -0.1277 -0.2311 0.0759  117 TYR A CZ  
455  O OH  . TYR A 73  ? 0.8995 1.1836 0.9548 -0.1300 -0.2183 0.0708  117 TYR A OH  
456  N N   . GLY A 74  ? 0.8708 1.0576 0.6915 -0.1298 -0.2413 0.1064  118 GLY A N   
457  C CA  . GLY A 74  ? 0.9283 1.0832 0.7213 -0.1246 -0.2253 0.1205  118 GLY A CA  
458  C C   . GLY A 74  ? 0.9746 1.1330 0.7428 -0.1048 -0.2300 0.1470  118 GLY A C   
459  O O   . GLY A 74  ? 1.0251 1.1556 0.7765 -0.0977 -0.2128 0.1651  118 GLY A O   
460  N N   . LYS A 75  ? 1.1922 1.3856 0.9611 -0.0947 -0.2523 0.1512  119 LYS A N   
461  C CA  . LYS A 75  ? 1.2351 1.4330 0.9759 -0.0722 -0.2590 0.1774  119 LYS A CA  
462  C C   . LYS A 75  ? 1.2949 1.4911 0.9736 -0.0707 -0.2610 0.1771  119 LYS A C   
463  O O   . LYS A 75  ? 1.3513 1.5233 0.9949 -0.0557 -0.2466 0.2008  119 LYS A O   
464  C CB  . LYS A 75  ? 1.2015 1.4414 0.9643 -0.0592 -0.2842 0.1818  119 LYS A CB  
465  C CG  . LYS A 75  ? 1.1514 1.3891 0.9679 -0.0549 -0.2794 0.1843  119 LYS A CG  
466  C CD  . LYS A 75  ? 1.1195 1.4048 0.9635 -0.0426 -0.3017 0.1869  119 LYS A CD  
467  C CE  . LYS A 75  ? 1.0839 1.3610 0.9728 -0.0328 -0.2928 0.1918  119 LYS A CE  
468  N NZ  . LYS A 75  ? 1.0502 1.3787 0.9770 -0.0249 -0.3095 0.1897  119 LYS A NZ  
469  N N   . ASN A 76  ? 1.4006 1.6190 1.0639 -0.0853 -0.2775 0.1504  120 ASN A N   
470  C CA  . ASN A 76  ? 1.4629 1.6733 1.0604 -0.0837 -0.2797 0.1445  120 ASN A CA  
471  C C   . ASN A 76  ? 1.4571 1.6577 1.0494 -0.1083 -0.2744 0.1127  120 ASN A C   
472  O O   . ASN A 76  ? 1.4088 1.6335 1.0308 -0.1259 -0.2914 0.0878  120 ASN A O   
473  C CB  . ASN A 76  ? 1.4770 1.7241 1.0422 -0.0697 -0.3148 0.1442  120 ASN A CB  
474  C CG  . ASN A 76  ? 1.5040 1.7518 1.0543 -0.0392 -0.3164 0.1801  120 ASN A CG  
475  O OD1 . ASN A 76  ? 1.5487 1.7688 1.0428 -0.0209 -0.3017 0.2017  120 ASN A OD1 
476  N ND2 . ASN A 76  ? 1.4781 1.7548 1.0783 -0.0318 -0.3308 0.1886  120 ASN A ND2 
477  N N   . PHE A 77  ? 1.1729 1.3365 0.7315 -0.1088 -0.2474 0.1155  121 PHE A N   
478  C CA  . PHE A 77  ? 1.1848 1.3329 0.7226 -0.1265 -0.2401 0.0877  121 PHE A CA  
479  C C   . PHE A 77  ? 1.2474 1.3939 0.7081 -0.1174 -0.2537 0.0791  121 PHE A C   
480  O O   . PHE A 77  ? 1.2987 1.4405 0.7135 -0.0940 -0.2529 0.1024  121 PHE A O   
481  C CB  . PHE A 77  ? 1.2126 1.3227 0.7582 -0.1298 -0.2024 0.0950  121 PHE A CB  
482  C CG  . PHE A 77  ? 1.1545 1.2615 0.7690 -0.1401 -0.1927 0.0953  121 PHE A CG  
483  C CD1 . PHE A 77  ? 1.1390 1.2454 0.7893 -0.1292 -0.1887 0.1198  121 PHE A CD1 
484  C CD2 . PHE A 77  ? 1.1181 1.2181 0.7566 -0.1585 -0.1876 0.0711  121 PHE A CD2 
485  C CE1 . PHE A 77  ? 1.0895 1.1891 0.7954 -0.1362 -0.1828 0.1174  121 PHE A CE1 
486  C CE2 . PHE A 77  ? 1.0662 1.1606 0.7593 -0.1641 -0.1802 0.0712  121 PHE A CE2 
487  C CZ  . PHE A 77  ? 1.0529 1.1473 0.7782 -0.1527 -0.1792 0.0931  121 PHE A CZ  
488  N N   . LYS A 78  ? 1.5816 1.7288 1.0241 -0.1343 -0.2670 0.0455  122 LYS A N   
489  C CA  . LYS A 78  ? 1.6529 1.7847 1.0122 -0.1247 -0.2745 0.0339  122 LYS A CA  
490  C C   . LYS A 78  ? 1.6722 1.7718 1.0150 -0.1416 -0.2563 0.0068  122 LYS A C   
491  O O   . LYS A 78  ? 1.6176 1.7187 1.0142 -0.1640 -0.2525 -0.0102 122 LYS A O   
492  C CB  . LYS A 78  ? 1.6445 1.8131 0.9840 -0.1225 -0.3224 0.0180  122 LYS A CB  
493  C CG  . LYS A 78  ? 1.5928 1.8041 0.9833 -0.1130 -0.3429 0.0397  122 LYS A CG  
494  C CD  . LYS A 78  ? 1.6378 1.8735 0.9775 -0.0883 -0.3775 0.0483  122 LYS A CD  
495  C CE  . LYS A 78  ? 1.7221 1.9216 0.9744 -0.0574 -0.3572 0.0739  122 LYS A CE  
496  N NZ  . LYS A 78  ? 1.7677 1.9902 0.9727 -0.0274 -0.3891 0.0899  122 LYS A NZ  
497  N N   . ASP A 79  ? 1.4911 1.5587 0.7555 -0.1275 -0.2426 0.0046  123 ASP A N   
498  C CA  . ASP A 79  ? 1.5248 1.5530 0.7699 -0.1337 -0.2103 -0.0080 123 ASP A CA  
499  C C   . ASP A 79  ? 1.5263 1.5431 0.7432 -0.1516 -0.2302 -0.0519 123 ASP A C   
500  O O   . ASP A 79  ? 1.5836 1.5890 0.7243 -0.1419 -0.2489 -0.0690 123 ASP A O   
501  C CB  . ASP A 79  ? 1.6131 1.6101 0.7894 -0.1052 -0.1778 0.0176  123 ASP A CB  
502  C CG  . ASP A 79  ? 1.6664 1.6219 0.7962 -0.1039 -0.1483 0.0017  123 ASP A CG  
503  O OD1 . ASP A 79  ? 1.6381 1.5841 0.7940 -0.1249 -0.1475 -0.0261 123 ASP A OD1 
504  O OD2 . ASP A 79  ? 1.7390 1.6688 0.8036 -0.0787 -0.1220 0.0201  123 ASP A OD2 
505  N N   . ILE A 80  ? 1.4322 1.4469 0.7081 -0.1763 -0.2239 -0.0694 124 ILE A N   
506  C CA  . ILE A 80  ? 1.4213 1.4208 0.6881 -0.1978 -0.2375 -0.1098 124 ILE A CA  
507  C C   . ILE A 80  ? 1.4715 1.4213 0.7010 -0.1960 -0.2028 -0.1215 124 ILE A C   
508  O O   . ILE A 80  ? 1.4539 1.3848 0.6901 -0.2153 -0.2057 -0.1518 124 ILE A O   
509  C CB  . ILE A 80  ? 1.3236 1.3487 0.6768 -0.2255 -0.2510 -0.1221 124 ILE A CB  
510  C CG1 . ILE A 80  ? 1.2802 1.2995 0.6939 -0.2274 -0.2178 -0.1019 124 ILE A CG1 
511  C CG2 . ILE A 80  ? 1.2779 1.3534 0.6645 -0.2279 -0.2886 -0.1173 124 ILE A CG2 
512  C CD1 . ILE A 80  ? 1.1927 1.2277 0.6777 -0.2506 -0.2253 -0.1141 124 ILE A CD1 
513  N N   . THR A 81  ? 1.4787 1.4079 0.6767 -0.1728 -0.1676 -0.0956 125 THR A N   
514  C CA  . THR A 81  ? 1.5345 1.4192 0.6937 -0.1655 -0.1320 -0.1032 125 THR A CA  
515  C C   . THR A 81  ? 1.5807 1.4345 0.6653 -0.1685 -0.1492 -0.1424 125 THR A C   
516  O O   . THR A 81  ? 1.6054 1.4219 0.6707 -0.1708 -0.1275 -0.1600 125 THR A O   
517  C CB  . THR A 81  ? 1.6008 1.4717 0.7240 -0.1360 -0.0946 -0.0684 125 THR A CB  
518  O OG1 . THR A 81  ? 1.5575 1.4531 0.7554 -0.1358 -0.0800 -0.0346 125 THR A OG1 
519  C CG2 . THR A 81  ? 1.6553 1.4836 0.7431 -0.1258 -0.0546 -0.0743 125 THR A CG2 
520  N N   . ASP A 82  ? 2.1127 1.9814 1.1561 -0.1677 -0.1900 -0.1571 126 ASP A N   
521  C CA  . ASP A 82  ? 2.1508 1.9945 1.1328 -0.1757 -0.2186 -0.2007 126 ASP A CA  
522  C C   . ASP A 82  ? 2.0984 1.9282 1.1273 -0.2081 -0.2250 -0.2348 126 ASP A C   
523  O O   . ASP A 82  ? 2.1434 1.9308 1.1198 -0.2122 -0.2273 -0.2685 126 ASP A O   
524  C CB  . ASP A 82  ? 2.1507 2.0290 1.1134 -0.1757 -0.2709 -0.2100 126 ASP A CB  
525  C CG  . ASP A 82  ? 2.2196 2.1039 1.1193 -0.1404 -0.2673 -0.1791 126 ASP A CG  
526  O OD1 . ASP A 82  ? 2.3436 2.1867 1.1467 -0.1149 -0.2509 -0.1818 126 ASP A OD1 
527  O OD2 . ASP A 82  ? 2.1520 2.0787 1.0974 -0.1363 -0.2773 -0.1503 126 ASP A OD2 
528  N N   . LEU A 83  ? 1.7489 1.6111 0.8736 -0.2292 -0.2266 -0.2251 127 LEU A N   
529  C CA  . LEU A 83  ? 1.6895 1.5480 0.8679 -0.2613 -0.2385 -0.2535 127 LEU A CA  
530  C C   . LEU A 83  ? 1.6903 1.5046 0.8792 -0.2657 -0.1989 -0.2592 127 LEU A C   
531  O O   . LEU A 83  ? 1.6607 1.4571 0.8766 -0.2894 -0.2038 -0.2852 127 LEU A O   
532  C CB  . LEU A 83  ? 1.5934 1.5051 0.8659 -0.2779 -0.2542 -0.2379 127 LEU A CB  
533  C CG  . LEU A 83  ? 1.5610 1.5223 0.8565 -0.2876 -0.3020 -0.2446 127 LEU A CG  
534  C CD1 . LEU A 83  ? 1.6297 1.6023 0.8532 -0.2620 -0.3239 -0.2370 127 LEU A CD1 
535  C CD2 . LEU A 83  ? 1.4681 1.4756 0.8546 -0.2942 -0.2999 -0.2179 127 LEU A CD2 
536  N N   . ILE A 84  ? 1.8666 1.6648 1.0396 -0.2426 -0.1593 -0.2334 128 ILE A N   
537  C CA  . ILE A 84  ? 1.8772 1.6359 1.0572 -0.2406 -0.1208 -0.2358 128 ILE A CA  
538  C C   . ILE A 84  ? 1.9653 1.6717 1.0549 -0.2243 -0.1053 -0.2556 128 ILE A C   
539  O O   . ILE A 84  ? 1.9917 1.6662 1.0713 -0.2112 -0.0671 -0.2500 128 ILE A O   
540  C CB  . ILE A 84  ? 1.8633 1.6368 1.0906 -0.2256 -0.0867 -0.1975 128 ILE A CB  
541  C CG1 . ILE A 84  ? 1.8711 1.6741 1.0860 -0.2056 -0.0864 -0.1657 128 ILE A CG1 
542  C CG2 . ILE A 84  ? 1.7875 1.5851 1.1020 -0.2436 -0.0906 -0.1902 128 ILE A CG2 
543  C CD1 . ILE A 84  ? 1.8465 1.6666 1.1210 -0.1956 -0.0582 -0.1301 128 ILE A CD1 
544  N N   . ASN A 85  ? 2.2101 1.9100 1.2319 -0.2217 -0.1356 -0.2771 129 ASN A N   
545  C CA  . ASN A 85  ? 2.3066 1.9710 1.2269 -0.1928 -0.1227 -0.2809 129 ASN A CA  
546  C C   . ASN A 85  ? 2.3162 2.0043 1.2527 -0.1682 -0.0894 -0.2335 129 ASN A C   
547  O O   . ASN A 85  ? 2.2621 1.9965 1.2646 -0.1753 -0.0991 -0.2087 129 ASN A O   
548  C CB  . ASN A 85  ? 2.3499 1.9508 1.2209 -0.1885 -0.0976 -0.3083 129 ASN A CB  
549  C CG  . ASN A 85  ? 2.3602 1.9311 1.2006 -0.2118 -0.1356 -0.3587 129 ASN A CG  
550  O OD1 . ASN A 85  ? 2.3719 1.9613 1.1876 -0.2194 -0.1808 -0.3761 129 ASN A OD1 
551  N ND2 . ASN A 85  ? 2.3558 1.8813 1.2028 -0.2235 -0.1189 -0.3821 129 ASN A ND2 
552  N N   . ASN A 86  ? 2.2473 1.9060 1.1310 -0.1394 -0.0492 -0.2185 130 ASN A N   
553  C CA  . ASN A 86  ? 2.2434 1.9288 1.1642 -0.1216 -0.0172 -0.1718 130 ASN A CA  
554  C C   . ASN A 86  ? 2.2273 1.9031 1.2024 -0.1180 0.0276  -0.1559 130 ASN A C   
555  O O   . ASN A 86  ? 2.2389 1.9265 1.2351 -0.0997 0.0614  -0.1203 130 ASN A O   
556  C CB  . ASN A 86  ? 2.3168 1.9952 1.1542 -0.0895 -0.0072 -0.1525 130 ASN A CB  
557  C CG  . ASN A 86  ? 2.3409 2.0365 1.1330 -0.0924 -0.0586 -0.1669 130 ASN A CG  
558  O OD1 . ASN A 86  ? 2.2818 1.9984 1.1140 -0.1202 -0.1002 -0.1908 130 ASN A OD1 
559  N ND2 . ASN A 86  ? 2.4219 2.1124 1.1374 -0.0626 -0.0546 -0.1487 130 ASN A ND2 
560  N N   . THR A 87  ? 2.2028 1.8573 1.2035 -0.1353 0.0269  -0.1821 131 THR A N   
561  C CA  . THR A 87  ? 2.2003 1.8366 1.2356 -0.1278 0.0673  -0.1741 131 THR A CA  
562  C C   . THR A 87  ? 2.1522 1.8292 1.2819 -0.1288 0.0824  -0.1382 131 THR A C   
563  O O   . THR A 87  ? 2.1187 1.8352 1.2883 -0.1363 0.0627  -0.1198 131 THR A O   
564  C CB  . THR A 87  ? 2.1691 1.7767 1.2210 -0.1484 0.0584  -0.2074 131 THR A CB  
565  O OG1 . THR A 87  ? 2.1699 1.7593 1.2510 -0.1365 0.0975  -0.1984 131 THR A OG1 
566  C CG2 . THR A 87  ? 2.0878 1.7313 1.2166 -0.1769 0.0270  -0.2081 131 THR A CG2 
567  N N   . PHE A 88  ? 1.8122 1.4780 0.9778 -0.1201 0.1157  -0.1301 132 PHE A N   
568  C CA  . PHE A 88  ? 1.7807 1.4811 1.0287 -0.1157 0.1332  -0.0964 132 PHE A CA  
569  C C   . PHE A 88  ? 1.7189 1.4337 1.0422 -0.1350 0.1163  -0.1023 132 PHE A C   
570  O O   . PHE A 88  ? 1.7119 1.4015 1.0419 -0.1362 0.1260  -0.1185 132 PHE A O   
571  C CB  . PHE A 88  ? 1.8136 1.4999 1.0610 -0.0902 0.1809  -0.0796 132 PHE A CB  
572  C CG  . PHE A 88  ? 1.7765 1.4999 1.1148 -0.0861 0.1978  -0.0459 132 PHE A CG  
573  C CD1 . PHE A 88  ? 1.7672 1.5218 1.1301 -0.0832 0.1988  -0.0156 132 PHE A CD1 
574  C CD2 . PHE A 88  ? 1.7491 1.4749 1.1490 -0.0844 0.2113  -0.0450 132 PHE A CD2 
575  C CE1 . PHE A 88  ? 1.7254 1.5120 1.1769 -0.0818 0.2119  0.0129  132 PHE A CE1 
576  C CE2 . PHE A 88  ? 1.7097 1.4710 1.1964 -0.0813 0.2216  -0.0171 132 PHE A CE2 
577  C CZ  . PHE A 88  ? 1.6947 1.4860 1.2092 -0.0815 0.2215  0.0109  132 PHE A CZ  
578  N N   . ILE A 89  ? 1.7010 1.4534 1.0763 -0.1474 0.0924  -0.0883 133 ILE A N   
579  C CA  . ILE A 89  ? 1.6442 1.4103 1.0847 -0.1630 0.0752  -0.0921 133 ILE A CA  
580  C C   . ILE A 89  ? 1.6323 1.4155 1.1418 -0.1524 0.0938  -0.0688 133 ILE A C   
581  O O   . ILE A 89  ? 1.6360 1.4382 1.1660 -0.1409 0.1090  -0.0433 133 ILE A O   
582  C CB  . ILE A 89  ? 1.5957 1.3918 1.0562 -0.1798 0.0393  -0.0908 133 ILE A CB  
583  C CG1 . ILE A 89  ? 1.5902 1.3739 0.9926 -0.1919 0.0163  -0.1166 133 ILE A CG1 
584  C CG2 . ILE A 89  ? 1.5284 1.3360 1.0506 -0.1916 0.0258  -0.0924 133 ILE A CG2 
585  C CD1 . ILE A 89  ? 1.5773 1.3250 0.9609 -0.2033 0.0163  -0.1476 133 ILE A CD1 
586  N N   . ARG A 90  ? 1.7502 1.5254 1.2959 -0.1559 0.0923  -0.0778 134 ARG A N   
587  C CA  . ARG A 90  ? 1.7279 1.5162 1.3359 -0.1442 0.1062  -0.0613 134 ARG A CA  
588  C C   . ARG A 90  ? 1.6580 1.4727 1.3263 -0.1523 0.0815  -0.0530 134 ARG A C   
589  O O   . ARG A 90  ? 1.6125 1.4195 1.2832 -0.1623 0.0634  -0.0668 134 ARG A O   
590  C CB  . ARG A 90  ? 1.7438 1.5015 1.3453 -0.1354 0.1237  -0.0755 134 ARG A CB  
591  C CG  . ARG A 90  ? 1.7632 1.5246 1.3864 -0.1140 0.1560  -0.0596 134 ARG A CG  
592  C CD  . ARG A 90  ? 1.7944 1.5209 1.3984 -0.1020 0.1759  -0.0744 134 ARG A CD  
593  N NE  . ARG A 90  ? 1.7473 1.4737 1.3951 -0.1020 0.1629  -0.0782 134 ARG A NE  
594  C CZ  . ARG A 90  ? 1.7553 1.4500 1.3921 -0.0912 0.1763  -0.0899 134 ARG A CZ  
595  N NH1 . ARG A 90  ? 1.8134 1.4737 1.3992 -0.0807 0.2029  -0.1004 134 ARG A NH1 
596  N NH2 . ARG A 90  ? 1.7064 1.4005 1.3787 -0.0877 0.1642  -0.0906 134 ARG A NH2 
597  N N   . THR A 91  ? 1.6417 1.4846 1.3590 -0.1467 0.0829  -0.0300 135 THR A N   
598  C CA  . THR A 91  ? 1.5599 1.4258 1.3272 -0.1533 0.0575  -0.0220 135 THR A CA  
599  C C   . THR A 91  ? 1.5040 1.3667 1.3131 -0.1481 0.0492  -0.0281 135 THR A C   
600  O O   . THR A 91  ? 1.4302 1.3032 1.2681 -0.1519 0.0258  -0.0275 135 THR A O   
601  C CB  . THR A 91  ? 1.5395 1.4312 1.3472 -0.1497 0.0620  0.0038  135 THR A CB  
602  O OG1 . THR A 91  ? 1.4851 1.3930 1.3275 -0.1572 0.0344  0.0085  135 THR A OG1 
603  C CG2 . THR A 91  ? 1.5327 1.4328 1.3932 -0.1371 0.0837  0.0166  135 THR A CG2 
604  N N   . GLU A 92  ? 1.5078 1.3542 1.3157 -0.1366 0.0684  -0.0340 136 GLU A N   
605  C CA  . GLU A 92  ? 1.4714 1.3104 1.3083 -0.1277 0.0607  -0.0406 136 GLU A CA  
606  C C   . GLU A 92  ? 1.4194 1.2426 1.2329 -0.1369 0.0407  -0.0548 136 GLU A C   
607  O O   . GLU A 92  ? 1.3588 1.1888 1.2011 -0.1336 0.0212  -0.0533 136 GLU A O   
608  C CB  . GLU A 92  ? 1.5324 1.3496 1.3561 -0.1131 0.0865  -0.0467 136 GLU A CB  
609  C CG  . GLU A 92  ? 1.5950 1.4181 1.4149 -0.1050 0.1162  -0.0357 136 GLU A CG  
610  C CD  . GLU A 92  ? 1.6500 1.4503 1.4580 -0.0872 0.1431  -0.0416 136 GLU A CD  
611  O OE1 . GLU A 92  ? 1.6445 1.4391 1.4779 -0.0767 0.1369  -0.0460 136 GLU A OE1 
612  O OE2 . GLU A 92  ? 1.6998 1.4871 1.4715 -0.0807 0.1712  -0.0408 136 GLU A OE2 
613  N N   . PHE A 93  ? 1.2886 1.0896 1.0500 -0.1479 0.0461  -0.0688 137 PHE A N   
614  C CA  . PHE A 93  ? 1.2325 1.0186 0.9762 -0.1588 0.0324  -0.0811 137 PHE A CA  
615  C C   . PHE A 93  ? 1.1834 0.9930 0.9298 -0.1732 0.0114  -0.0773 137 PHE A C   
616  O O   . PHE A 93  ? 1.1304 0.9365 0.8746 -0.1814 -0.0008 -0.0833 137 PHE A O   
617  C CB  . PHE A 93  ? 1.2697 1.0204 0.9651 -0.1666 0.0462  -0.0997 137 PHE A CB  
618  C CG  . PHE A 93  ? 1.3274 1.0504 1.0129 -0.1508 0.0700  -0.1039 137 PHE A CG  
619  C CD1 . PHE A 93  ? 1.3011 1.0087 1.0049 -0.1363 0.0730  -0.1029 137 PHE A CD1 
620  C CD2 . PHE A 93  ? 1.4177 1.1278 1.0711 -0.1472 0.0901  -0.1085 137 PHE A CD2 
621  C CE1 . PHE A 93  ? 1.3540 1.0367 1.0498 -0.1192 0.0948  -0.1056 137 PHE A CE1 
622  C CE2 . PHE A 93  ? 1.4709 1.1545 1.1149 -0.1303 0.1141  -0.1120 137 PHE A CE2 
623  C CZ  . PHE A 93  ? 1.4346 1.1059 1.1029 -0.1164 0.1162  -0.1101 137 PHE A CZ  
624  N N   . GLY A 94  ? 1.3441 1.1767 1.0952 -0.1747 0.0099  -0.0656 138 GLY A N   
625  C CA  . GLY A 94  ? 1.3071 1.1625 1.0602 -0.1852 -0.0094 -0.0598 138 GLY A CA  
626  C C   . GLY A 94  ? 1.2897 1.1393 1.0108 -0.2012 -0.0192 -0.0749 138 GLY A C   
627  O O   . GLY A 94  ? 1.3290 1.1575 1.0129 -0.2078 -0.0102 -0.0903 138 GLY A O   
628  N N   . MET A 95  ? 1.2515 1.1197 0.9906 -0.2072 -0.0383 -0.0710 139 MET A N   
629  C CA  . MET A 95  ? 1.2298 1.1028 0.9537 -0.2232 -0.0502 -0.0824 139 MET A CA  
630  C C   . MET A 95  ? 1.1785 1.0431 0.9227 -0.2249 -0.0523 -0.0864 139 MET A C   
631  O O   . MET A 95  ? 1.1423 1.0207 0.9132 -0.2174 -0.0616 -0.0755 139 MET A O   
632  C CB  . MET A 95  ? 1.2217 1.1273 0.9497 -0.2268 -0.0685 -0.0720 139 MET A CB  
633  C CG  . MET A 95  ? 1.2884 1.2006 0.9947 -0.2206 -0.0638 -0.0622 139 MET A CG  
634  S SD  . MET A 95  ? 1.2947 1.2397 0.9924 -0.2228 -0.0850 -0.0508 139 MET A SD  
635  C CE  . MET A 95  ? 1.2716 1.2302 1.0155 -0.2093 -0.0860 -0.0252 139 MET A CE  
636  N N   . ALA A 96  ? 1.1243 0.9634 0.8535 -0.2339 -0.0425 -0.1016 140 ALA A N   
637  C CA  . ALA A 96  ? 1.0954 0.9220 0.8413 -0.2329 -0.0386 -0.1020 140 ALA A CA  
638  C C   . ALA A 96  ? 1.0718 0.9212 0.8321 -0.2494 -0.0512 -0.1041 140 ALA A C   
639  O O   . ALA A 96  ? 1.0825 0.9288 0.8336 -0.2687 -0.0529 -0.1185 140 ALA A O   
640  C CB  . ALA A 96  ? 1.1205 0.9057 0.8482 -0.2339 -0.0189 -0.1142 140 ALA A CB  
641  N N   . ILE A 97  ? 0.9776 0.8492 0.7630 -0.2409 -0.0606 -0.0905 141 ILE A N   
642  C CA  . ILE A 97  ? 0.9599 0.8612 0.7667 -0.2522 -0.0725 -0.0882 141 ILE A CA  
643  C C   . ILE A 97  ? 0.9636 0.8529 0.7885 -0.2532 -0.0598 -0.0870 141 ILE A C   
644  O O   . ILE A 97  ? 0.9710 0.8432 0.7968 -0.2339 -0.0506 -0.0778 141 ILE A O   
645  C CB  . ILE A 97  ? 0.9402 0.8727 0.7627 -0.2402 -0.0884 -0.0725 141 ILE A CB  
646  C CG1 . ILE A 97  ? 0.9503 0.8886 0.7566 -0.2352 -0.0949 -0.0684 141 ILE A CG1 
647  C CG2 . ILE A 97  ? 0.9282 0.8966 0.7729 -0.2514 -0.1018 -0.0704 141 ILE A CG2 
648  C CD1 . ILE A 97  ? 0.9777 0.9221 0.7590 -0.2502 -0.0996 -0.0794 141 ILE A CD1 
649  N N   . GLY A 98  ? 0.9207 0.8186 0.7604 -0.2751 -0.0596 -0.0961 142 GLY A N   
650  C CA  . GLY A 98  ? 0.9383 0.8251 0.8007 -0.2789 -0.0425 -0.0929 142 GLY A CA  
651  C C   . GLY A 98  ? 0.9438 0.8500 0.8281 -0.2611 -0.0416 -0.0745 142 GLY A C   
652  O O   . GLY A 98  ? 0.9238 0.8611 0.8152 -0.2531 -0.0592 -0.0667 142 GLY A O   
653  N N   . PRO A 99  ? 1.0433 0.9272 0.9347 -0.2530 -0.0190 -0.0668 143 PRO A N   
654  C CA  . PRO A 99  ? 1.0750 0.9685 0.9789 -0.2315 -0.0127 -0.0493 143 PRO A CA  
655  C C   . PRO A 99  ? 1.0683 1.0109 1.0151 -0.2425 -0.0214 -0.0431 143 PRO A C   
656  O O   . PRO A 99  ? 1.0536 1.0170 1.0299 -0.2699 -0.0245 -0.0518 143 PRO A O   
657  C CB  . PRO A 99  ? 1.1366 0.9901 1.0341 -0.2239 0.0187  -0.0435 143 PRO A CB  
658  C CG  . PRO A 99  ? 1.1237 0.9635 1.0308 -0.2538 0.0275  -0.0577 143 PRO A CG  
659  C CD  . PRO A 99  ? 1.0717 0.9176 0.9592 -0.2644 0.0044  -0.0739 143 PRO A CD  
660  N N   . GLU A 100 ? 1.3546 1.3144 1.3057 -0.2205 -0.0268 -0.0294 144 GLU A N   
661  C CA  . GLU A 100 ? 1.3586 1.3646 1.3519 -0.2241 -0.0318 -0.0201 144 GLU A CA  
662  C C   . GLU A 100 ? 1.3030 1.3517 1.3214 -0.2508 -0.0565 -0.0304 144 GLU A C   
663  O O   . GLU A 100 ? 1.2630 1.3128 1.2566 -0.2536 -0.0768 -0.0384 144 GLU A O   
664  C CB  . GLU A 100 ? 1.4215 1.4254 1.4459 -0.2264 -0.0020 -0.0105 144 GLU A CB  
665  C CG  . GLU A 100 ? 1.5060 1.4679 1.4989 -0.1942 0.0234  0.0025  144 GLU A CG  
666  C CD  . GLU A 100 ? 1.5829 1.5437 1.6067 -0.1931 0.0581  0.0170  144 GLU A CD  
667  O OE1 . GLU A 100 ? 1.5612 1.5291 1.6221 -0.2226 0.0698  0.0124  144 GLU A OE1 
668  O OE2 . GLU A 100 ? 1.6661 1.6172 1.6774 -0.1622 0.0747  0.0331  144 GLU A OE2 
669  N N   . ASN A 101 ? 1.1126 1.1965 1.1809 -0.2692 -0.0544 -0.0295 145 ASN A N   
670  C CA  . ASN A 101 ? 1.0693 1.1986 1.1645 -0.2922 -0.0822 -0.0398 145 ASN A CA  
671  C C   . ASN A 101 ? 1.0572 1.1770 1.1560 -0.3248 -0.0875 -0.0620 145 ASN A C   
672  O O   . ASN A 101 ? 1.0347 1.1918 1.1584 -0.3450 -0.1121 -0.0732 145 ASN A O   
673  C CB  . ASN A 101 ? 1.0763 1.2592 1.2321 -0.2926 -0.0843 -0.0273 145 ASN A CB  
674  C CG  . ASN A 101 ? 1.0636 1.2742 1.2138 -0.2678 -0.1012 -0.0134 145 ASN A CG  
675  O OD1 . ASN A 101 ? 1.0567 1.2405 1.1600 -0.2484 -0.1061 -0.0107 145 ASN A OD1 
676  N ND2 . ASN A 101 ? 1.0587 1.3233 1.2611 -0.2683 -0.1101 -0.0042 145 ASN A ND2 
677  N N   . SER A 102 ? 1.1060 1.1746 1.1791 -0.3284 -0.0658 -0.0691 146 SER A N   
678  C CA  . SER A 102 ? 1.1009 1.1486 1.1702 -0.3573 -0.0683 -0.0919 146 SER A CA  
679  C C   . SER A 102 ? 1.0739 1.1319 1.1115 -0.3671 -0.1004 -0.1103 146 SER A C   
680  O O   . SER A 102 ? 1.0755 1.1297 1.1164 -0.3928 -0.1119 -0.1321 146 SER A O   
681  C CB  . SER A 102 ? 1.1275 1.1118 1.1598 -0.3505 -0.0400 -0.0940 146 SER A CB  
682  O OG  . SER A 102 ? 1.1181 1.0792 1.0968 -0.3268 -0.0437 -0.0916 146 SER A OG  
683  N N   . GLY A 103 ? 1.0124 1.0794 1.0171 -0.3454 -0.1136 -0.1015 147 GLY A N   
684  C CA  . GLY A 103 ? 1.0024 1.0783 0.9714 -0.3483 -0.1398 -0.1132 147 GLY A CA  
685  C C   . GLY A 103 ? 1.0200 1.0495 0.9393 -0.3545 -0.1340 -0.1314 147 GLY A C   
686  O O   . GLY A 103 ? 1.0316 1.0648 0.9213 -0.3620 -0.1538 -0.1461 147 GLY A O   
687  N N   . LYS A 104 ? 1.0908 1.0751 0.9968 -0.3484 -0.1066 -0.1302 148 LYS A N   
688  C CA  . LYS A 104 ? 1.1126 1.0521 0.9742 -0.3523 -0.0986 -0.1470 148 LYS A CA  
689  C C   . LYS A 104 ? 1.1162 1.0471 0.9351 -0.3297 -0.0997 -0.1391 148 LYS A C   
690  O O   . LYS A 104 ? 1.1020 1.0371 0.9253 -0.3085 -0.0936 -0.1203 148 LYS A O   
691  C CB  . LYS A 104 ? 1.1290 1.0222 0.9934 -0.3531 -0.0684 -0.1481 148 LYS A CB  
692  C CG  . LYS A 104 ? 1.1345 1.0327 1.0484 -0.3734 -0.0590 -0.1495 148 LYS A CG  
693  C CD  . LYS A 104 ? 1.1517 1.0286 1.0672 -0.4036 -0.0631 -0.1761 148 LYS A CD  
694  C CE  . LYS A 104 ? 1.1642 1.0314 1.1321 -0.4234 -0.0431 -0.1750 148 LYS A CE  
695  N NZ  . LYS A 104 ? 1.1534 1.0789 1.1862 -0.4353 -0.0555 -0.1660 148 LYS A NZ  
696  N N   . VAL A 105 ? 1.1113 1.0296 0.8898 -0.3341 -0.1075 -0.1540 149 VAL A N   
697  C CA  . VAL A 105 ? 1.1308 1.0386 0.8722 -0.3143 -0.1029 -0.1461 149 VAL A CA  
698  C C   . VAL A 105 ? 1.1745 1.0369 0.8746 -0.3163 -0.0880 -0.1636 149 VAL A C   
699  O O   . VAL A 105 ? 1.2000 1.0498 0.8814 -0.3339 -0.0961 -0.1860 149 VAL A O   
700  C CB  . VAL A 105 ? 1.1422 1.0842 0.8679 -0.3098 -0.1254 -0.1405 149 VAL A CB  
701  C CG1 . VAL A 105 ? 1.1766 1.1053 0.8691 -0.2899 -0.1146 -0.1294 149 VAL A CG1 
702  C CG2 . VAL A 105 ? 1.1027 1.0879 0.8694 -0.3059 -0.1396 -0.1230 149 VAL A CG2 
703  N N   . VAL A 106 ? 1.0690 0.9064 0.7571 -0.2978 -0.0673 -0.1546 150 VAL A N   
704  C CA  . VAL A 106 ? 1.1177 0.9127 0.7665 -0.2946 -0.0501 -0.1684 150 VAL A CA  
705  C C   . VAL A 106 ? 1.1532 0.9479 0.7823 -0.2723 -0.0397 -0.1551 150 VAL A C   
706  O O   . VAL A 106 ? 1.1318 0.9384 0.7871 -0.2569 -0.0347 -0.1360 150 VAL A O   
707  C CB  . VAL A 106 ? 1.1119 0.8670 0.7699 -0.2941 -0.0280 -0.1728 150 VAL A CB  
708  C CG1 . VAL A 106 ? 1.1642 0.8758 0.7823 -0.2845 -0.0079 -0.1836 150 VAL A CG1 
709  C CG2 . VAL A 106 ? 1.0970 0.8454 0.7757 -0.3189 -0.0323 -0.1866 150 VAL A CG2 
710  N N   . LEU A 107 ? 1.2036 0.9836 0.7871 -0.2705 -0.0365 -0.1659 151 LEU A N   
711  C CA  . LEU A 107 ? 1.2587 1.0368 0.8237 -0.2496 -0.0208 -0.1525 151 LEU A CA  
712  C C   . LEU A 107 ? 1.3133 1.0468 0.8437 -0.2420 0.0035  -0.1660 151 LEU A C   
713  O O   . LEU A 107 ? 1.3387 1.0442 0.8297 -0.2528 0.0017  -0.1897 151 LEU A O   
714  C CB  . LEU A 107 ? 1.3023 1.1024 0.8366 -0.2468 -0.0331 -0.1476 151 LEU A CB  
715  C CG  . LEU A 107 ? 1.2610 1.1027 0.8173 -0.2547 -0.0603 -0.1383 151 LEU A CG  
716  C CD1 . LEU A 107 ? 1.3231 1.1793 0.8418 -0.2449 -0.0667 -0.1294 151 LEU A CD1 
717  C CD2 . LEU A 107 ? 1.2016 1.0662 0.8132 -0.2484 -0.0607 -0.1167 151 LEU A CD2 
718  N N   . THR A 108 ? 1.3817 1.1078 0.9278 -0.2229 0.0251  -0.1523 152 THR A N   
719  C CA  . THR A 108 ? 1.4395 1.1248 0.9530 -0.2118 0.0504  -0.1632 152 THR A CA  
720  C C   . THR A 108 ? 1.5176 1.2053 0.9968 -0.1962 0.0650  -0.1560 152 THR A C   
721  O O   . THR A 108 ? 1.5356 1.2551 1.0396 -0.1857 0.0673  -0.1328 152 THR A O   
722  C CB  . THR A 108 ? 1.4294 1.1023 0.9770 -0.1967 0.0679  -0.1540 152 THR A CB  
723  O OG1 . THR A 108 ? 1.3535 1.0363 0.9388 -0.2049 0.0538  -0.1501 152 THR A OG1 
724  C CG2 . THR A 108 ? 1.4662 1.0877 0.9790 -0.1914 0.0898  -0.1719 152 THR A CG2 
725  N N   . ALA A 109 ? 1.5642 1.2144 0.9849 -0.1938 0.0767  -0.1757 153 ALA A N   
726  C CA  . ALA A 109 ? 1.6325 1.2792 1.0074 -0.1770 0.0927  -0.1702 153 ALA A CA  
727  C C   . ALA A 109 ? 1.6751 1.2904 1.0368 -0.1550 0.1288  -0.1695 153 ALA A C   
728  O O   . ALA A 109 ? 1.6610 1.2453 1.0282 -0.1556 0.1374  -0.1824 153 ALA A O   
729  C CB  . ALA A 109 ? 1.6573 1.2854 0.9635 -0.1870 0.0756  -0.1943 153 ALA A CB  
730  N N   . GLU A 110 ? 1.8065 1.4301 1.1528 -0.1341 0.1523  -0.1520 154 GLU A N   
731  C CA  . GLU A 110 ? 1.8406 1.4400 1.1776 -0.1096 0.1903  -0.1479 154 GLU A CA  
732  C C   . GLU A 110 ? 1.8885 1.4325 1.1387 -0.1030 0.2028  -0.1758 154 GLU A C   
733  O O   . GLU A 110 ? 1.9204 1.4540 1.1082 -0.1073 0.1900  -0.1886 154 GLU A O   
734  C CB  . GLU A 110 ? 1.8583 1.4904 1.2210 -0.0896 0.2146  -0.1155 154 GLU A CB  
735  C CG  . GLU A 110 ? 1.8842 1.5012 1.2532 -0.0627 0.2564  -0.1065 154 GLU A CG  
736  C CD  . GLU A 110 ? 1.8702 1.5309 1.2996 -0.0479 0.2784  -0.0703 154 GLU A CD  
737  O OE1 . GLU A 110 ? 1.8321 1.5332 1.3151 -0.0610 0.2570  -0.0535 154 GLU A OE1 
738  O OE2 . GLU A 110 ? 1.8932 1.5469 1.3195 -0.0232 0.3178  -0.0584 154 GLU A OE2 
739  N N   . VAL A 111 ? 1.6923 1.1988 0.9365 -0.0904 0.2267  -0.1859 155 VAL A N   
740  C CA  . VAL A 111 ? 1.7403 1.1853 0.9028 -0.0828 0.2401  -0.2153 155 VAL A CA  
741  C C   . VAL A 111 ? 1.7841 1.2120 0.9272 -0.0476 0.2864  -0.2029 155 VAL A C   
742  O O   . VAL A 111 ? 1.7630 1.2252 0.9721 -0.0324 0.3068  -0.1743 155 VAL A O   
743  C CB  . VAL A 111 ? 1.7159 1.1182 0.8797 -0.0984 0.2307  -0.2418 155 VAL A CB  
744  C CG1 . VAL A 111 ? 1.6682 1.0876 0.8547 -0.1331 0.1889  -0.2533 155 VAL A CG1 
745  C CG2 . VAL A 111 ? 1.6853 1.0926 0.9113 -0.0840 0.2515  -0.2246 155 VAL A CG2 
746  N N   . SER A 112 ? 1.9587 1.3338 1.0127 -0.0340 0.3021  -0.2254 156 SER A N   
747  C CA  . SER A 112 ? 2.0039 1.3565 1.0286 0.0027  0.3501  -0.2154 156 SER A CA  
748  C C   . SER A 112 ? 1.9706 1.3203 1.0575 0.0146  0.3718  -0.2068 156 SER A C   
749  O O   . SER A 112 ? 1.9355 1.2692 1.0467 -0.0033 0.3521  -0.2218 156 SER A O   
750  C CB  . SER A 112 ? 2.0758 1.3580 0.9863 0.0143  0.3590  -0.2495 156 SER A CB  
751  O OG  . SER A 112 ? 2.0838 1.3613 0.9394 -0.0068 0.3204  -0.2703 156 SER A OG  
752  N N   . GLY A 113 ? 2.3638 1.7305 1.4787 0.0460  0.4127  -0.1807 157 GLY A N   
753  C CA  . GLY A 113 ? 2.3339 1.7106 1.5192 0.0612  0.4315  -0.1671 157 GLY A CA  
754  C C   . GLY A 113 ? 2.3365 1.6536 1.4965 0.0614  0.4314  -0.1945 157 GLY A C   
755  O O   . GLY A 113 ? 2.2955 1.6255 1.5189 0.0587  0.4231  -0.1876 157 GLY A O   
756  N N   . GLY A 114 ? 2.0531 1.3017 1.1185 0.0651  0.4394  -0.2261 158 GLY A N   
757  C CA  . GLY A 114 ? 2.0628 1.2452 1.0998 0.0677  0.4453  -0.2521 158 GLY A CA  
758  C C   . GLY A 114 ? 2.0527 1.1951 1.0619 0.0311  0.4075  -0.2853 158 GLY A C   
759  O O   . GLY A 114 ? 2.0806 1.1524 1.0420 0.0328  0.4155  -0.3129 158 GLY A O   
760  N N   . SER A 115 ? 2.0249 1.2108 1.0680 -0.0015 0.3683  -0.2820 159 SER A N   
761  C CA  . SER A 115 ? 2.0143 1.1706 1.0329 -0.0385 0.3316  -0.3128 159 SER A CA  
762  C C   . SER A 115 ? 1.9854 1.1035 1.0313 -0.0515 0.3279  -0.3241 159 SER A C   
763  O O   . SER A 115 ? 1.9590 1.0873 1.0565 -0.0347 0.3450  -0.3032 159 SER A O   
764  C CB  . SER A 115 ? 1.9703 1.1905 1.0289 -0.0663 0.2937  -0.3011 159 SER A CB  
765  O OG  . SER A 115 ? 2.0132 1.2455 1.0187 -0.0645 0.2862  -0.3050 159 SER A OG  
766  N N   . ARG A 116 ? 2.6653 1.7389 1.6758 -0.0812 0.3047  -0.3574 160 ARG A N   
767  C CA  . ARG A 116 ? 2.6352 1.6740 1.6738 -0.1026 0.2966  -0.3684 160 ARG A CA  
768  C C   . ARG A 116 ? 2.5602 1.6564 1.6837 -0.1105 0.2851  -0.3378 160 ARG A C   
769  O O   . ARG A 116 ? 2.5375 1.6146 1.6931 -0.1030 0.2984  -0.3278 160 ARG A O   
770  C CB  . ARG A 116 ? 2.6408 1.6494 1.6484 -0.1417 0.2638  -0.4045 160 ARG A CB  
771  C CG  . ARG A 116 ? 2.7067 1.6422 1.6796 -0.1452 0.2688  -0.4333 160 ARG A CG  
772  C CD  . ARG A 116 ? 2.6878 1.6258 1.6827 -0.1878 0.2282  -0.4552 160 ARG A CD  
773  N NE  . ARG A 116 ? 2.5939 1.5539 1.6573 -0.2121 0.2207  -0.4404 160 ARG A NE  
774  C CZ  . ARG A 116 ? 2.5496 1.5358 1.6514 -0.2492 0.1870  -0.4489 160 ARG A CZ  
775  N NH1 . ARG A 116 ? 2.5914 1.5874 1.6723 -0.2665 0.1538  -0.4739 160 ARG A NH1 
776  N NH2 . ARG A 116 ? 2.4864 1.4907 1.6486 -0.2664 0.1866  -0.4319 160 ARG A NH2 
777  N N   . GLY A 117 ? 1.7101 0.8733 0.8632 -0.1239 0.2598  -0.3237 161 GLY A N   
778  C CA  . GLY A 117 ? 1.6170 0.8346 0.8413 -0.1364 0.2411  -0.3002 161 GLY A CA  
779  C C   . GLY A 117 ? 1.5702 0.8510 0.8058 -0.1480 0.2157  -0.2905 161 GLY A C   
780  O O   . GLY A 117 ? 1.6131 0.8925 0.7996 -0.1444 0.2145  -0.3007 161 GLY A O   
781  N N   . GLY A 118 ? 1.5436 0.8762 0.8388 -0.1593 0.1962  -0.2705 162 GLY A N   
782  C CA  . GLY A 118 ? 1.5132 0.9066 0.8259 -0.1665 0.1744  -0.2566 162 GLY A CA  
783  C C   . GLY A 118 ? 1.5194 0.9158 0.8079 -0.1965 0.1439  -0.2779 162 GLY A C   
784  O O   . GLY A 118 ? 1.5549 0.9052 0.8114 -0.2134 0.1386  -0.3066 162 GLY A O   
785  N N   . ARG A 119 ? 1.7359 1.1865 1.0421 -0.2028 0.1226  -0.2642 163 ARG A N   
786  C CA  . ARG A 119 ? 1.7239 1.1874 1.0165 -0.2295 0.0897  -0.2814 163 ARG A CA  
787  C C   . ARG A 119 ? 1.6619 1.1875 1.0109 -0.2387 0.0676  -0.2586 163 ARG A C   
788  O O   . ARG A 119 ? 1.6584 1.2192 1.0345 -0.2215 0.0753  -0.2314 163 ARG A O   
789  C CB  . ARG A 119 ? 1.7935 1.2459 1.0150 -0.2223 0.0854  -0.2961 163 ARG A CB  
790  C CG  . ARG A 119 ? 1.7573 1.2405 0.9700 -0.2430 0.0471  -0.3060 163 ARG A CG  
791  C CD  . ARG A 119 ? 1.8530 1.3035 0.9820 -0.2403 0.0374  -0.3341 163 ARG A CD  
792  N NE  . ARG A 119 ? 1.9067 1.3205 0.9765 -0.2093 0.0716  -0.3329 163 ARG A NE  
793  C CZ  . ARG A 119 ? 2.0056 1.3698 0.9912 -0.2015 0.0724  -0.3621 163 ARG A CZ  
794  N NH1 . ARG A 119 ? 2.0604 1.4061 1.0127 -0.2246 0.0363  -0.3972 163 ARG A NH1 
795  N NH2 . ARG A 119 ? 2.0507 1.3837 0.9860 -0.1696 0.1089  -0.3568 163 ARG A NH2 
796  N N   . ILE A 120 ? 1.6094 1.1473 0.9807 -0.2658 0.0413  -0.2697 164 ILE A N   
797  C CA  . ILE A 120 ? 1.5490 1.1435 0.9697 -0.2744 0.0195  -0.2506 164 ILE A CA  
798  C C   . ILE A 120 ? 1.5454 1.1637 0.9538 -0.2950 -0.0143 -0.2655 164 ILE A C   
799  O O   . ILE A 120 ? 1.5731 1.1621 0.9485 -0.3108 -0.0258 -0.2951 164 ILE A O   
800  C CB  . ILE A 120 ? 1.4825 1.0800 0.9596 -0.2834 0.0222  -0.2417 164 ILE A CB  
801  C CG1 . ILE A 120 ? 1.4807 1.0404 0.9560 -0.3082 0.0192  -0.2676 164 ILE A CG1 
802  C CG2 . ILE A 120 ? 1.4843 1.0681 0.9772 -0.2589 0.0491  -0.2234 164 ILE A CG2 
803  C CD1 . ILE A 120 ? 1.4247 0.9861 0.9537 -0.3175 0.0246  -0.2568 164 ILE A CD1 
804  N N   . PHE A 121 ? 1.4903 1.1611 0.9262 -0.2941 -0.0321 -0.2458 165 PHE A N   
805  C CA  . PHE A 121 ? 1.4807 1.1817 0.9133 -0.3110 -0.0666 -0.2565 165 PHE A CA  
806  C C   . PHE A 121 ? 1.4037 1.1412 0.9041 -0.3273 -0.0810 -0.2465 165 PHE A C   
807  O O   . PHE A 121 ? 1.3640 1.1293 0.9019 -0.3160 -0.0747 -0.2200 165 PHE A O   
808  C CB  . PHE A 121 ? 1.5173 1.2472 0.9180 -0.2935 -0.0752 -0.2414 165 PHE A CB  
809  C CG  . PHE A 121 ? 1.6023 1.2966 0.9262 -0.2785 -0.0645 -0.2546 165 PHE A CG  
810  C CD1 . PHE A 121 ? 1.6420 1.3083 0.9473 -0.2567 -0.0286 -0.2442 165 PHE A CD1 
811  C CD2 . PHE A 121 ? 1.6451 1.3336 0.9145 -0.2844 -0.0907 -0.2782 165 PHE A CD2 
812  C CE1 . PHE A 121 ? 1.7204 1.3521 0.9525 -0.2399 -0.0145 -0.2553 165 PHE A CE1 
813  C CE2 . PHE A 121 ? 1.7271 1.3775 0.9161 -0.2670 -0.0797 -0.2913 165 PHE A CE2 
814  C CZ  . PHE A 121 ? 1.7639 1.3850 0.9332 -0.2443 -0.0393 -0.2791 165 PHE A CZ  
815  N N   . ARG A 122 ? 1.5001 1.2365 1.0181 -0.3536 -0.0997 -0.2682 166 ARG A N   
816  C CA  . ARG A 122 ? 1.4364 1.2016 1.0227 -0.3688 -0.1055 -0.2586 166 ARG A CA  
817  C C   . ARG A 122 ? 1.4116 1.2278 1.0233 -0.3830 -0.1404 -0.2610 166 ARG A C   
818  O O   . ARG A 122 ? 1.4382 1.2534 1.0310 -0.3992 -0.1651 -0.2866 166 ARG A O   
819  C CB  . ARG A 122 ? 1.4373 1.1626 1.0443 -0.3890 -0.0923 -0.2760 166 ARG A CB  
820  C CG  . ARG A 122 ? 1.4481 1.1212 1.0327 -0.3732 -0.0573 -0.2726 166 ARG A CG  
821  C CD  . ARG A 122 ? 1.4633 1.0901 1.0601 -0.3937 -0.0451 -0.2919 166 ARG A CD  
822  N NE  . ARG A 122 ? 1.4947 1.1109 1.0757 -0.4195 -0.0698 -0.3251 166 ARG A NE  
823  C CZ  . ARG A 122 ? 1.4906 1.0941 1.1101 -0.4499 -0.0756 -0.3424 166 ARG A CZ  
824  N NH1 . ARG A 122 ? 1.4598 1.0588 1.1323 -0.4559 -0.0538 -0.3260 166 ARG A NH1 
825  N NH2 . ARG A 122 ? 1.5231 1.1178 1.1289 -0.4733 -0.1034 -0.3758 166 ARG A NH2 
826  N N   . SER A 123 ? 1.3185 1.1788 0.9736 -0.3755 -0.1439 -0.2353 167 SER A N   
827  C CA  . SER A 123 ? 1.2890 1.2005 0.9839 -0.3891 -0.1738 -0.2352 167 SER A CA  
828  C C   . SER A 123 ? 1.2409 1.1666 1.0059 -0.4009 -0.1628 -0.2248 167 SER A C   
829  O O   . SER A 123 ? 1.2163 1.1370 0.9980 -0.3851 -0.1393 -0.2025 167 SER A O   
830  C CB  . SER A 123 ? 1.2817 1.2342 0.9670 -0.3686 -0.1879 -0.2131 167 SER A CB  
831  O OG  . SER A 123 ? 1.2590 1.2618 0.9812 -0.3795 -0.2184 -0.2137 167 SER A OG  
832  N N   . SER A 124 ? 1.3070 1.2474 1.1125 -0.4282 -0.1786 -0.2419 168 SER A N   
833  C CA  . SER A 124 ? 1.2746 1.2340 1.1513 -0.4392 -0.1664 -0.2295 168 SER A CA  
834  C C   . SER A 124 ? 1.2430 1.2694 1.1655 -0.4370 -0.1892 -0.2142 168 SER A C   
835  O O   . SER A 124 ? 1.2197 1.2692 1.2009 -0.4395 -0.1772 -0.1982 168 SER A O   
836  C CB  . SER A 124 ? 1.2917 1.2279 1.2008 -0.4718 -0.1640 -0.2533 168 SER A CB  
837  O OG  . SER A 124 ? 1.3004 1.2669 1.2247 -0.4949 -0.2029 -0.2776 168 SER A OG  
838  N N   . ASP A 125 ? 1.2551 1.3114 1.1494 -0.4298 -0.2204 -0.2178 169 ASP A N   
839  C CA  . ASP A 125 ? 1.2273 1.3450 1.1599 -0.4211 -0.2400 -0.1993 169 ASP A CA  
840  C C   . ASP A 125 ? 1.2316 1.3609 1.1178 -0.3923 -0.2482 -0.1816 169 ASP A C   
841  O O   . ASP A 125 ? 1.2577 1.4004 1.1067 -0.3893 -0.2758 -0.1910 169 ASP A O   
842  C CB  . ASP A 125 ? 1.2326 1.3910 1.1980 -0.4447 -0.2784 -0.2205 169 ASP A CB  
843  C CG  . ASP A 125 ? 1.2800 1.4133 1.1796 -0.4513 -0.3037 -0.2506 169 ASP A CG  
844  O OD1 . ASP A 125 ? 1.3096 1.3933 1.1415 -0.4376 -0.2855 -0.2528 169 ASP A OD1 
845  O OD2 . ASP A 125 ? 1.2929 1.4554 1.2089 -0.4674 -0.3412 -0.2722 169 ASP A OD2 
846  N N   . PHE A 126 ? 1.0169 1.1429 0.9091 -0.3707 -0.2257 -0.1553 170 PHE A N   
847  C CA  . PHE A 126 ? 1.0157 1.1558 0.8822 -0.3440 -0.2303 -0.1333 170 PHE A CA  
848  C C   . PHE A 126 ? 1.0584 1.1842 0.8575 -0.3348 -0.2423 -0.1395 170 PHE A C   
849  O O   . PHE A 126 ? 1.0684 1.2204 0.8523 -0.3195 -0.2590 -0.1261 170 PHE A O   
850  C CB  . PHE A 126 ? 0.9911 1.1875 0.9052 -0.3389 -0.2492 -0.1183 170 PHE A CB  
851  C CG  . PHE A 126 ? 0.9645 1.1730 0.9407 -0.3426 -0.2313 -0.1082 170 PHE A CG  
852  C CD1 . PHE A 126 ? 0.9548 1.1452 0.9333 -0.3222 -0.2064 -0.0878 170 PHE A CD1 
853  C CD2 . PHE A 126 ? 0.9592 1.1926 0.9898 -0.3663 -0.2377 -0.1201 170 PHE A CD2 
854  C CE1 . PHE A 126 ? 0.9492 1.1450 0.9743 -0.3214 -0.1871 -0.0780 170 PHE A CE1 
855  C CE2 . PHE A 126 ? 0.9502 1.1918 1.0359 -0.3677 -0.2152 -0.1079 170 PHE A CE2 
856  C CZ  . PHE A 126 ? 0.9501 1.1715 1.0283 -0.3434 -0.1889 -0.0864 170 PHE A CZ  
857  N N   . ALA A 127 ? 1.2196 1.3012 0.9765 -0.3414 -0.2307 -0.1579 171 ALA A N   
858  C CA  . ALA A 127 ? 1.2770 1.3374 0.9643 -0.3300 -0.2344 -0.1633 171 ALA A CA  
859  C C   . ALA A 127 ? 1.3109 1.3980 0.9690 -0.3319 -0.2711 -0.1756 171 ALA A C   
860  O O   . ALA A 127 ? 1.3584 1.4412 0.9621 -0.3127 -0.2750 -0.1670 171 ALA A O   
861  C CB  . ALA A 127 ? 1.2855 1.3403 0.9565 -0.3040 -0.2161 -0.1350 171 ALA A CB  
862  N N   . LYS A 128 ? 1.4063 1.5216 1.1012 -0.3533 -0.2981 -0.1941 172 LYS A N   
863  C CA  . LYS A 128 ? 1.4436 1.5816 1.1075 -0.3559 -0.3386 -0.2119 172 LYS A CA  
864  C C   . LYS A 128 ? 1.5031 1.5981 1.1076 -0.3675 -0.3471 -0.2473 172 LYS A C   
865  O O   . LYS A 128 ? 1.5600 1.6505 1.0980 -0.3553 -0.3690 -0.2572 172 LYS A O   
866  C CB  . LYS A 128 ? 1.4007 1.5958 1.1379 -0.3727 -0.3688 -0.2162 172 LYS A CB  
867  C CG  . LYS A 128 ? 1.3623 1.6016 1.1356 -0.3525 -0.3685 -0.1817 172 LYS A CG  
868  C CD  . LYS A 128 ? 1.3378 1.6405 1.1678 -0.3600 -0.4050 -0.1836 172 LYS A CD  
869  C CE  . LYS A 128 ? 1.2827 1.6098 1.2049 -0.3781 -0.3910 -0.1789 172 LYS A CE  
870  N NZ  . LYS A 128 ? 1.2653 1.6608 1.2494 -0.3847 -0.4274 -0.1802 172 LYS A NZ  
871  N N   . ASN A 129 ? 1.4480 1.5083 1.0728 -0.3890 -0.3295 -0.2662 173 ASN A N   
872  C CA  . ASN A 129 ? 1.5074 1.5138 1.0720 -0.3972 -0.3289 -0.2987 173 ASN A CA  
873  C C   . ASN A 129 ? 1.5052 1.4591 1.0640 -0.3955 -0.2837 -0.2946 173 ASN A C   
874  O O   . ASN A 129 ? 1.4539 1.4096 1.0744 -0.4067 -0.2637 -0.2849 173 ASN A O   
875  C CB  . ASN A 129 ? 1.5072 1.5188 1.1134 -0.4187 -0.3557 -0.3307 173 ASN A CB  
876  C CG  . ASN A 129 ? 1.4976 1.5688 1.1366 -0.4149 -0.3989 -0.3321 173 ASN A CG  
877  O OD1 . ASN A 129 ? 1.5524 1.6228 1.1450 -0.4026 -0.4298 -0.3521 173 ASN A OD1 
878  N ND2 . ASN A 129 ? 1.4323 1.5557 1.1508 -0.4230 -0.4016 -0.3116 173 ASN A ND2 
879  N N   . PHE A 130 ? 1.3332 1.2405 0.8162 -0.3789 -0.2670 -0.3008 174 PHE A N   
880  C CA  . PHE A 130 ? 1.3258 1.1820 0.7974 -0.3740 -0.2258 -0.2989 174 PHE A CA  
881  C C   . PHE A 130 ? 1.4031 1.2045 0.8323 -0.3882 -0.2270 -0.3370 174 PHE A C   
882  O O   . PHE A 130 ? 1.4759 1.2672 0.8490 -0.3890 -0.2541 -0.3623 174 PHE A O   
883  C CB  . PHE A 130 ? 1.3476 1.1922 0.7746 -0.3418 -0.1988 -0.2733 174 PHE A CB  
884  C CG  . PHE A 130 ? 1.2947 1.1750 0.7716 -0.3293 -0.1862 -0.2365 174 PHE A CG  
885  C CD1 . PHE A 130 ? 1.2836 1.2100 0.7692 -0.3198 -0.2067 -0.2175 174 PHE A CD1 
886  C CD2 . PHE A 130 ? 1.2600 1.1247 0.7723 -0.3250 -0.1547 -0.2213 174 PHE A CD2 
887  C CE1 . PHE A 130 ? 1.2391 1.1925 0.7687 -0.3078 -0.1952 -0.1853 174 PHE A CE1 
888  C CE2 . PHE A 130 ? 1.2158 1.1093 0.7704 -0.3125 -0.1462 -0.1905 174 PHE A CE2 
889  C CZ  . PHE A 130 ? 1.2057 1.1417 0.7693 -0.3048 -0.1659 -0.1733 174 PHE A CZ  
890  N N   . VAL A 131 ? 1.7973 1.5602 1.2498 -0.3976 -0.1984 -0.3415 175 VAL A N   
891  C CA  . VAL A 131 ? 1.8504 1.5508 1.2608 -0.4077 -0.1917 -0.3750 175 VAL A CA  
892  C C   . VAL A 131 ? 1.8704 1.5262 1.2527 -0.3849 -0.1467 -0.3613 175 VAL A C   
893  O O   . VAL A 131 ? 1.8205 1.4902 1.2447 -0.3747 -0.1221 -0.3318 175 VAL A O   
894  C CB  . VAL A 131 ? 1.8180 1.5119 1.2955 -0.4377 -0.1991 -0.3930 175 VAL A CB  
895  C CG1 . VAL A 131 ? 1.7472 1.4657 1.2983 -0.4492 -0.1810 -0.3678 175 VAL A CG1 
896  C CG2 . VAL A 131 ? 1.8635 1.4876 1.3123 -0.4393 -0.1792 -0.4167 175 VAL A CG2 
897  N N   . GLN A 132 ? 1.7551 1.3575 1.0647 -0.3751 -0.1375 -0.3836 176 GLN A N   
898  C CA  . GLN A 132 ? 1.7814 1.3469 1.0565 -0.3480 -0.0967 -0.3701 176 GLN A CA  
899  C C   . GLN A 132 ? 1.7816 1.2900 1.0675 -0.3613 -0.0764 -0.3891 176 GLN A C   
900  O O   . GLN A 132 ? 1.8113 1.2848 1.0764 -0.3819 -0.0934 -0.4245 176 GLN A O   
901  C CB  . GLN A 132 ? 1.8691 1.4083 1.0527 -0.3248 -0.0950 -0.3816 176 GLN A CB  
902  C CG  . GLN A 132 ? 1.9247 1.3919 1.0545 -0.3140 -0.0658 -0.4019 176 GLN A CG  
903  C CD  . GLN A 132 ? 2.0044 1.4497 1.0439 -0.2847 -0.0572 -0.4059 176 GLN A CD  
904  O OE1 . GLN A 132 ? 2.1165 1.5268 1.0895 -0.2866 -0.0759 -0.4394 176 GLN A OE1 
905  N NE2 . GLN A 132 ? 1.9411 1.4193 0.9827 -0.2586 -0.0369 -0.3696 176 GLN A NE2 
906  N N   . THR A 133 ? 1.7890 1.2845 1.1055 -0.3495 -0.0420 -0.3676 177 THR A N   
907  C CA  . THR A 133 ? 1.7983 1.2345 1.1199 -0.3587 -0.0204 -0.3833 177 THR A CA  
908  C C   . THR A 133 ? 1.8315 1.2296 1.1217 -0.3271 0.0194  -0.3713 177 THR A C   
909  O O   . THR A 133 ? 1.8098 1.2392 1.1212 -0.3047 0.0351  -0.3397 177 THR A O   
910  C CB  . THR A 133 ? 1.7307 1.1829 1.1317 -0.3787 -0.0176 -0.3700 177 THR A CB  
911  O OG1 . THR A 133 ? 1.7078 1.1886 1.1432 -0.4110 -0.0518 -0.3859 177 THR A OG1 
912  C CG2 . THR A 133 ? 1.7452 1.1326 1.1500 -0.3815 0.0127  -0.3779 177 THR A CG2 
913  N N   . ASP A 134 ? 1.9993 1.3301 1.2422 -0.3247 0.0350  -0.3969 178 ASP A N   
914  C CA  . ASP A 134 ? 2.0293 1.3228 1.2468 -0.2934 0.0744  -0.3860 178 ASP A CA  
915  C C   . ASP A 134 ? 1.9944 1.2626 1.2580 -0.2944 0.0977  -0.3744 178 ASP A C   
916  O O   . ASP A 134 ? 1.9968 1.2225 1.2688 -0.3170 0.0969  -0.3946 178 ASP A O   
917  C CB  . ASP A 134 ? 2.1099 1.3384 1.2460 -0.2835 0.0841  -0.4176 178 ASP A CB  
918  C CG  . ASP A 134 ? 2.1597 1.4073 1.2356 -0.2639 0.0770  -0.4181 178 ASP A CG  
919  O OD1 . ASP A 134 ? 2.1624 1.4281 1.2329 -0.2327 0.1033  -0.3909 178 ASP A OD1 
920  O OD2 . ASP A 134 ? 2.2003 1.4434 1.2345 -0.2787 0.0458  -0.4454 178 ASP A OD2 
921  N N   . LEU A 135 ? 1.6611 0.9544 0.9546 -0.2693 0.1180  -0.3418 179 LEU A N   
922  C CA  . LEU A 135 ? 1.6313 0.9041 0.9629 -0.2629 0.1394  -0.3266 179 LEU A CA  
923  C C   . LEU A 135 ? 1.6821 0.8855 0.9756 -0.2428 0.1718  -0.3367 179 LEU A C   
924  O O   . LEU A 135 ? 1.7319 0.9203 0.9798 -0.2211 0.1850  -0.3423 179 LEU A O   
925  C CB  . LEU A 135 ? 1.5876 0.9151 0.9636 -0.2420 0.1425  -0.2905 179 LEU A CB  
926  C CG  . LEU A 135 ? 1.5431 0.9386 0.9504 -0.2551 0.1132  -0.2784 179 LEU A CG  
927  C CD1 . LEU A 135 ? 1.5204 0.9622 0.9594 -0.2303 0.1172  -0.2470 179 LEU A CD1 
928  C CD2 . LEU A 135 ? 1.4914 0.8973 0.9396 -0.2829 0.0974  -0.2801 179 LEU A CD2 
929  N N   . PRO A 136 ? 1.7686 0.9269 1.0791 -0.2485 0.1871  -0.3381 180 PRO A N   
930  C CA  . PRO A 136 ? 1.8102 0.9003 1.0921 -0.2266 0.2204  -0.3426 180 PRO A CA  
931  C C   . PRO A 136 ? 1.8034 0.9141 1.0980 -0.1853 0.2420  -0.3124 180 PRO A C   
932  O O   . PRO A 136 ? 1.8376 0.9001 1.1088 -0.1605 0.2699  -0.3131 180 PRO A O   
933  C CB  . PRO A 136 ? 1.7949 0.8440 1.1045 -0.2471 0.2272  -0.3449 180 PRO A CB  
934  C CG  . PRO A 136 ? 1.7307 0.8429 1.0964 -0.2648 0.2056  -0.3261 180 PRO A CG  
935  C CD  . PRO A 136 ? 1.7197 0.8898 1.0802 -0.2761 0.1751  -0.3330 180 PRO A CD  
936  N N   . PHE A 137 ? 1.6503 0.8312 0.9861 -0.1786 0.2278  -0.2867 181 PHE A N   
937  C CA  . PHE A 137 ? 1.6421 0.8521 1.0024 -0.1429 0.2410  -0.2587 181 PHE A CA  
938  C C   . PHE A 137 ? 1.6360 0.9141 1.0129 -0.1354 0.2274  -0.2445 181 PHE A C   
939  O O   . PHE A 137 ? 1.6407 0.9408 1.0022 -0.1548 0.2095  -0.2551 181 PHE A O   
940  C CB  . PHE A 137 ? 1.5961 0.8170 0.9999 -0.1385 0.2385  -0.2375 181 PHE A CB  
941  C CG  . PHE A 137 ? 1.5446 0.8120 0.9819 -0.1642 0.2111  -0.2314 181 PHE A CG  
942  C CD1 . PHE A 137 ? 1.5334 0.7800 0.9705 -0.1978 0.2027  -0.2472 181 PHE A CD1 
943  C CD2 . PHE A 137 ? 1.5101 0.8415 0.9826 -0.1553 0.1941  -0.2107 181 PHE A CD2 
944  C CE1 . PHE A 137 ? 1.4863 0.7781 0.9577 -0.2193 0.1796  -0.2405 181 PHE A CE1 
945  C CE2 . PHE A 137 ? 1.4631 0.8341 0.9637 -0.1763 0.1707  -0.2053 181 PHE A CE2 
946  C CZ  . PHE A 137 ? 1.4502 0.8029 0.9501 -0.2073 0.1643  -0.2194 181 PHE A CZ  
947  N N   . HIS A 138 ? 1.6012 0.9122 1.0119 -0.1071 0.2349  -0.2199 182 HIS A N   
948  C CA  . HIS A 138 ? 1.5963 0.9733 1.0369 -0.1016 0.2224  -0.2025 182 HIS A CA  
949  C C   . HIS A 138 ? 1.5424 0.9652 1.0387 -0.1016 0.2017  -0.1815 182 HIS A C   
950  O O   . HIS A 138 ? 1.5301 0.9480 1.0504 -0.0811 0.2075  -0.1691 182 HIS A O   
951  C CB  . HIS A 138 ? 1.6433 1.0273 1.0847 -0.0699 0.2467  -0.1919 182 HIS A CB  
952  C CG  . HIS A 138 ? 1.6957 1.0454 1.0774 -0.0674 0.2655  -0.2101 182 HIS A CG  
953  N ND1 . HIS A 138 ? 1.7173 1.0909 1.0757 -0.0775 0.2578  -0.2133 182 HIS A ND1 
954  C CD2 . HIS A 138 ? 1.7342 1.0232 1.0687 -0.0536 0.2918  -0.2266 182 HIS A CD2 
955  C CE1 . HIS A 138 ? 1.7672 1.0965 1.0631 -0.0690 0.2778  -0.2316 182 HIS A CE1 
956  N NE2 . HIS A 138 ? 1.7785 1.0553 1.0596 -0.0552 0.2986  -0.2409 182 HIS A NE2 
957  N N   . PRO A 139 ? 1.5015 0.9664 1.0146 -0.1225 0.1767  -0.1782 183 PRO A N   
958  C CA  . PRO A 139 ? 1.4482 0.9511 1.0075 -0.1228 0.1563  -0.1611 183 PRO A CA  
959  C C   . PRO A 139 ? 1.4585 0.9965 1.0591 -0.0963 0.1565  -0.1408 183 PRO A C   
960  O O   . PRO A 139 ? 1.4981 1.0631 1.1084 -0.0894 0.1616  -0.1342 183 PRO A O   
961  C CB  . PRO A 139 ? 1.4229 0.9629 0.9864 -0.1477 0.1330  -0.1626 183 PRO A CB  
962  C CG  . PRO A 139 ? 1.4588 0.9716 0.9746 -0.1645 0.1376  -0.1844 183 PRO A CG  
963  C CD  . PRO A 139 ? 1.5182 0.9957 1.0043 -0.1436 0.1654  -0.1900 183 PRO A CD  
964  N N   . LEU A 140 ? 1.2625 0.7980 0.8870 -0.0804 0.1516  -0.1311 184 LEU A N   
965  C CA  . LEU A 140 ? 1.2627 0.8371 0.9349 -0.0583 0.1412  -0.1139 184 LEU A CA  
966  C C   . LEU A 140 ? 1.2133 0.8264 0.9164 -0.0678 0.1116  -0.1053 184 LEU A C   
967  O O   . LEU A 140 ? 1.2115 0.8620 0.9575 -0.0563 0.0975  -0.0937 184 LEU A O   
968  C CB  . LEU A 140 ? 1.2695 0.8172 0.9450 -0.0294 0.1499  -0.1093 184 LEU A CB  
969  C CG  . LEU A 140 ? 1.2734 0.8566 0.9988 -0.0027 0.1356  -0.0947 184 LEU A CG  
970  C CD1 . LEU A 140 ? 1.3134 0.9356 1.0751 0.0019  0.1423  -0.0880 184 LEU A CD1 
971  C CD2 . LEU A 140 ? 1.2860 0.8344 1.0011 0.0273  0.1457  -0.0922 184 LEU A CD2 
972  N N   . THR A 141 ? 1.3438 0.9481 1.0282 -0.0893 0.1024  -0.1116 185 THR A N   
973  C CA  . THR A 141 ? 1.2945 0.9279 1.0023 -0.0950 0.0772  -0.1039 185 THR A CA  
974  C C   . THR A 141 ? 1.2658 0.9105 0.9616 -0.1242 0.0691  -0.1102 185 THR A C   
975  O O   . THR A 141 ? 1.2802 0.9019 0.9458 -0.1408 0.0805  -0.1231 185 THR A O   
976  C CB  . THR A 141 ? 1.2771 0.8864 0.9793 -0.0810 0.0735  -0.1002 185 THR A CB  
977  O OG1 . THR A 141 ? 1.2756 0.8454 0.9454 -0.0956 0.0890  -0.1088 185 THR A OG1 
978  C CG2 . THR A 141 ? 1.3073 0.9030 1.0166 -0.0486 0.0786  -0.0945 185 THR A CG2 
979  N N   . GLN A 142 ? 1.2534 0.9327 0.9733 -0.1295 0.0475  -0.1021 186 GLN A N   
980  C CA  . GLN A 142 ? 1.2206 0.9133 0.9334 -0.1538 0.0375  -0.1062 186 GLN A CA  
981  C C   . GLN A 142 ? 1.2104 0.8720 0.9068 -0.1617 0.0451  -0.1128 186 GLN A C   
982  O O   . GLN A 142 ? 1.2151 0.8555 0.9116 -0.1448 0.0503  -0.1075 186 GLN A O   
983  C CB  . GLN A 142 ? 1.1829 0.9145 0.9252 -0.1537 0.0147  -0.0947 186 GLN A CB  
984  C CG  . GLN A 142 ? 1.1543 0.8997 0.8939 -0.1736 0.0038  -0.0967 186 GLN A CG  
985  C CD  . GLN A 142 ? 1.1163 0.8985 0.8814 -0.1728 -0.0167 -0.0855 186 GLN A CD  
986  O OE1 . GLN A 142 ? 1.0861 0.8724 0.8657 -0.1627 -0.0275 -0.0790 186 GLN A OE1 
987  N NE2 . GLN A 142 ? 1.1276 0.9328 0.8938 -0.1817 -0.0212 -0.0828 186 GLN A NE2 
988  N N   . MET A 143 ? 1.3614 1.0186 1.0439 -0.1866 0.0462  -0.1242 187 MET A N   
989  C CA  . MET A 143 ? 1.3577 0.9877 1.0350 -0.1984 0.0551  -0.1297 187 MET A CA  
990  C C   . MET A 143 ? 1.3281 0.9799 1.0288 -0.1977 0.0442  -0.1176 187 MET A C   
991  O O   . MET A 143 ? 1.3004 0.9919 1.0185 -0.2003 0.0252  -0.1113 187 MET A O   
992  C CB  . MET A 143 ? 1.3668 0.9884 1.0298 -0.2269 0.0556  -0.1479 187 MET A CB  
993  C CG  . MET A 143 ? 1.4090 0.9993 1.0400 -0.2242 0.0695  -0.1615 187 MET A CG  
994  S SD  . MET A 143 ? 1.4292 1.0133 1.0376 -0.2560 0.0609  -0.1864 187 MET A SD  
995  C CE  . MET A 143 ? 1.4927 1.0282 1.0546 -0.2435 0.0829  -0.2012 187 MET A CE  
996  N N   . MET A 144 ? 1.5055 1.1279 1.2039 -0.1918 0.0587  -0.1130 188 MET A N   
997  C CA  . MET A 144 ? 1.4994 1.1354 1.2124 -0.1815 0.0534  -0.0989 188 MET A CA  
998  C C   . MET A 144 ? 1.5103 1.1374 1.2344 -0.2000 0.0661  -0.0983 188 MET A C   
999  O O   . MET A 144 ? 1.5395 1.1257 1.2537 -0.2034 0.0888  -0.1005 188 MET A O   
1000 C CB  . MET A 144 ? 1.5254 1.1375 1.2245 -0.1473 0.0587  -0.0883 188 MET A CB  
1001 C CG  . MET A 144 ? 1.5157 1.1450 1.2185 -0.1304 0.0433  -0.0882 188 MET A CG  
1002 S SD  . MET A 144 ? 1.5449 1.1519 1.2361 -0.0889 0.0411  -0.0788 188 MET A SD  
1003 C CE  . MET A 144 ? 1.5913 1.1416 1.2530 -0.0817 0.0725  -0.0814 188 MET A CE  
1004 N N   . TYR A 145 ? 1.1148 0.7814 0.8638 -0.2119 0.0522  -0.0943 189 TYR A N   
1005 C CA  . TYR A 145 ? 1.1268 0.7981 0.9002 -0.2319 0.0621  -0.0925 189 TYR A CA  
1006 C C   . TYR A 145 ? 1.1765 0.8207 0.9465 -0.2118 0.0851  -0.0756 189 TYR A C   
1007 O O   . TYR A 145 ? 1.1927 0.8403 0.9509 -0.1833 0.0801  -0.0632 189 TYR A O   
1008 C CB  . TYR A 145 ? 1.0955 0.8212 0.8983 -0.2441 0.0401  -0.0902 189 TYR A CB  
1009 C CG  . TYR A 145 ? 1.0586 0.8116 0.8622 -0.2641 0.0183  -0.1049 189 TYR A CG  
1010 C CD1 . TYR A 145 ? 1.0369 0.8066 0.8259 -0.2514 0.0016  -0.1038 189 TYR A CD1 
1011 C CD2 . TYR A 145 ? 1.0547 0.8157 0.8736 -0.2948 0.0141  -0.1198 189 TYR A CD2 
1012 C CE1 . TYR A 145 ? 1.0212 0.8123 0.8038 -0.2658 -0.0148 -0.1144 189 TYR A CE1 
1013 C CE2 . TYR A 145 ? 1.0368 0.8195 0.8464 -0.3092 -0.0074 -0.1339 189 TYR A CE2 
1014 C CZ  . TYR A 145 ? 1.0244 0.8209 0.8125 -0.2931 -0.0200 -0.1297 189 TYR A CZ  
1015 O OH  . TYR A 145 ? 1.0238 0.8384 0.7960 -0.3037 -0.0380 -0.1410 189 TYR A OH  
1016 N N   . SER A 146 ? 1.1988 0.8136 0.9779 -0.2257 0.1105  -0.0750 190 SER A N   
1017 C CA  . SER A 146 ? 1.2565 0.8493 1.0345 -0.2071 0.1359  -0.0550 190 SER A CA  
1018 C C   . SER A 146 ? 1.2644 0.9030 1.0718 -0.2063 0.1274  -0.0436 190 SER A C   
1019 O O   . SER A 146 ? 1.2296 0.9096 1.0753 -0.2340 0.1137  -0.0509 190 SER A O   
1020 C CB  . SER A 146 ? 1.2859 0.8396 1.0771 -0.2259 0.1683  -0.0542 190 SER A CB  
1021 O OG  . SER A 146 ? 1.3451 0.8818 1.1390 -0.2085 0.1966  -0.0313 190 SER A OG  
1022 N N   . PRO A 147 ? 1.3484 0.9790 1.1345 -0.1716 0.1336  -0.0264 191 PRO A N   
1023 C CA  . PRO A 147 ? 1.3772 1.0430 1.1831 -0.1629 0.1298  -0.0137 191 PRO A CA  
1024 C C   . PRO A 147 ? 1.3996 1.0838 1.2552 -0.1863 0.1524  -0.0047 191 PRO A C   
1025 O O   . PRO A 147 ? 1.3844 1.1175 1.2766 -0.1969 0.1388  -0.0032 191 PRO A O   
1026 C CB  . PRO A 147 ? 1.4486 1.0798 1.2077 -0.1178 0.1403  0.0012  191 PRO A CB  
1027 C CG  . PRO A 147 ? 1.4174 1.0197 1.1393 -0.1036 0.1281  -0.0088 191 PRO A CG  
1028 C CD  . PRO A 147 ? 1.3815 0.9700 1.1176 -0.1344 0.1382  -0.0207 191 PRO A CD  
1029 N N   . GLN A 148 ? 1.7195 1.3664 1.5810 -0.1936 0.1869  0.0024  192 GLN A N   
1030 C CA  . GLN A 148 ? 1.7280 1.3961 1.6479 -0.2173 0.2092  0.0121  192 GLN A CA  
1031 C C   . GLN A 148 ? 1.6572 1.3575 1.6302 -0.2655 0.1916  -0.0088 192 GLN A C   
1032 O O   . GLN A 148 ? 1.6426 1.3891 1.6751 -0.2871 0.1892  -0.0063 192 GLN A O   
1033 C CB  . GLN A 148 ? 1.7817 1.3972 1.6951 -0.2078 0.2570  0.0311  192 GLN A CB  
1034 C CG  . GLN A 148 ? 1.7895 1.4293 1.7736 -0.2324 0.2844  0.0443  192 GLN A CG  
1035 C CD  . GLN A 148 ? 1.8488 1.4496 1.8187 -0.2035 0.3342  0.0753  192 GLN A CD  
1036 O OE1 . GLN A 148 ? 1.8874 1.4478 1.7878 -0.1601 0.3429  0.0867  192 GLN A OE1 
1037 N NE2 . GLN A 148 ? 1.8532 1.4663 1.8897 -0.2262 0.3674  0.0898  192 GLN A NE2 
1038 N N   . ASN A 149 ? 1.5402 1.2160 1.4915 -0.2806 0.1789  -0.0297 193 ASN A N   
1039 C CA  . ASN A 149 ? 1.4860 1.1845 1.4760 -0.3235 0.1597  -0.0531 193 ASN A CA  
1040 C C   . ASN A 149 ? 1.4365 1.1447 1.3919 -0.3258 0.1238  -0.0750 193 ASN A C   
1041 O O   . ASN A 149 ? 1.4398 1.1056 1.3495 -0.3148 0.1271  -0.0827 193 ASN A O   
1042 C CB  . ASN A 149 ? 1.5019 1.1519 1.5071 -0.3474 0.1875  -0.0593 193 ASN A CB  
1043 C CG  . ASN A 149 ? 1.4624 1.1364 1.5167 -0.3942 0.1672  -0.0845 193 ASN A CG  
1044 O OD1 . ASN A 149 ? 1.4238 1.1551 1.5029 -0.4075 0.1333  -0.0949 193 ASN A OD1 
1045 N ND2 . ASN A 149 ? 1.4770 1.1054 1.5449 -0.4183 0.1868  -0.0949 193 ASN A ND2 
1046 N N   . SER A 150 ? 1.2581 1.0219 1.2365 -0.3391 0.0915  -0.0836 194 SER A N   
1047 C CA  . SER A 150 ? 1.2159 0.9912 1.1605 -0.3384 0.0602  -0.1002 194 SER A CA  
1048 C C   . SER A 150 ? 1.2062 0.9542 1.1377 -0.3643 0.0544  -0.1264 194 SER A C   
1049 O O   . SER A 150 ? 1.1868 0.9346 1.0827 -0.3617 0.0350  -0.1400 194 SER A O   
1050 C CB  . SER A 150 ? 1.1801 1.0191 1.1496 -0.3433 0.0290  -0.0999 194 SER A CB  
1051 O OG  . SER A 150 ? 1.1629 1.0314 1.1734 -0.3777 0.0129  -0.1157 194 SER A OG  
1052 N N   . ASP A 151 ? 1.5634 1.2862 1.5236 -0.3889 0.0726  -0.1334 195 ASP A N   
1053 C CA  . ASP A 151 ? 1.5688 1.2552 1.5136 -0.4130 0.0689  -0.1605 195 ASP A CA  
1054 C C   . ASP A 151 ? 1.5978 1.2175 1.4913 -0.3928 0.0943  -0.1596 195 ASP A C   
1055 O O   . ASP A 151 ? 1.6105 1.1920 1.4793 -0.4055 0.0940  -0.1815 195 ASP A O   
1056 C CB  . ASP A 151 ? 1.5788 1.2629 1.5822 -0.4509 0.0759  -0.1707 195 ASP A CB  
1057 C CG  . ASP A 151 ? 1.5529 1.3065 1.6121 -0.4740 0.0449  -0.1768 195 ASP A CG  
1058 O OD1 . ASP A 151 ? 1.5208 1.3093 1.5578 -0.4713 0.0102  -0.1880 195 ASP A OD1 
1059 O OD2 . ASP A 151 ? 1.5681 1.3414 1.6950 -0.4940 0.0565  -0.1691 195 ASP A OD2 
1060 N N   . TYR A 152 ? 1.3993 1.0038 1.2746 -0.3594 0.1152  -0.1353 196 TYR A N   
1061 C CA  . TYR A 152 ? 1.4295 0.9737 1.2590 -0.3360 0.1386  -0.1317 196 TYR A CA  
1062 C C   . TYR A 152 ? 1.4142 0.9662 1.2006 -0.3060 0.1231  -0.1302 196 TYR A C   
1063 O O   . TYR A 152 ? 1.3990 0.9882 1.1877 -0.2870 0.1098  -0.1165 196 TYR A O   
1064 C CB  . TYR A 152 ? 1.4719 0.9856 1.3049 -0.3157 0.1733  -0.1058 196 TYR A CB  
1065 C CG  . TYR A 152 ? 1.4950 0.9913 1.3738 -0.3435 0.1983  -0.1030 196 TYR A CG  
1066 C CD1 . TYR A 152 ? 1.4787 0.9773 1.3906 -0.3854 0.1877  -0.1274 196 TYR A CD1 
1067 C CD2 . TYR A 152 ? 1.5381 1.0143 1.4276 -0.3274 0.2328  -0.0758 196 TYR A CD2 
1068 C CE1 . TYR A 152 ? 1.4969 0.9818 1.4614 -0.4140 0.2094  -0.1254 196 TYR A CE1 
1069 C CE2 . TYR A 152 ? 1.5577 1.0186 1.4970 -0.3541 0.2600  -0.0703 196 TYR A CE2 
1070 C CZ  . TYR A 152 ? 1.5334 1.0000 1.5151 -0.3993 0.2476  -0.0956 196 TYR A CZ  
1071 O OH  . TYR A 152 ? 1.5502 1.0035 1.5923 -0.4298 0.2731  -0.0915 196 TYR A OH  
1072 N N   . LEU A 153 ? 1.4244 0.9403 1.1748 -0.3018 0.1261  -0.1444 197 LEU A N   
1073 C CA  . LEU A 153 ? 1.4141 0.9369 1.1315 -0.2750 0.1149  -0.1429 197 LEU A CA  
1074 C C   . LEU A 153 ? 1.4484 0.9165 1.1326 -0.2498 0.1383  -0.1391 197 LEU A C   
1075 O O   . LEU A 153 ? 1.4785 0.8967 1.1542 -0.2597 0.1599  -0.1469 197 LEU A O   
1076 C CB  . LEU A 153 ? 1.3980 0.9407 1.1030 -0.2906 0.0932  -0.1637 197 LEU A CB  
1077 C CG  . LEU A 153 ? 1.3684 0.9610 1.0999 -0.3168 0.0671  -0.1719 197 LEU A CG  
1078 C CD1 . LEU A 153 ? 1.3747 0.9741 1.0782 -0.3259 0.0492  -0.1922 197 LEU A CD1 
1079 C CD2 . LEU A 153 ? 1.3364 0.9786 1.0892 -0.3024 0.0532  -0.1518 197 LEU A CD2 
1080 N N   . LEU A 154 ? 1.2815 0.7581 0.9495 -0.2172 0.1332  -0.1274 198 LEU A N   
1081 C CA  . LEU A 154 ? 1.3109 0.7440 0.9487 -0.1923 0.1495  -0.1269 198 LEU A CA  
1082 C C   . LEU A 154 ? 1.2977 0.7572 0.9274 -0.1765 0.1334  -0.1300 198 LEU A C   
1083 O O   . LEU A 154 ? 1.2682 0.7759 0.9145 -0.1743 0.1111  -0.1247 198 LEU A O   
1084 C CB  . LEU A 154 ? 1.3406 0.7456 0.9682 -0.1615 0.1659  -0.1064 198 LEU A CB  
1085 C CG  . LEU A 154 ? 1.3354 0.7699 0.9657 -0.1327 0.1506  -0.0891 198 LEU A CG  
1086 C CD1 . LEU A 154 ? 1.3369 0.7745 0.9541 -0.1027 0.1402  -0.0879 198 LEU A CD1 
1087 C CD2 . LEU A 154 ? 1.3788 0.7783 0.9967 -0.1149 0.1723  -0.0716 198 LEU A CD2 
1088 N N   . ALA A 155 ? 1.2938 0.7200 0.9002 -0.1657 0.1470  -0.1379 199 ALA A N   
1089 C CA  . ALA A 155 ? 1.2956 0.7450 0.8993 -0.1491 0.1381  -0.1386 199 ALA A CA  
1090 C C   . ALA A 155 ? 1.3301 0.7435 0.9171 -0.1175 0.1561  -0.1337 199 ALA A C   
1091 O O   . ALA A 155 ? 1.3572 0.7173 0.9235 -0.1141 0.1787  -0.1364 199 ALA A O   
1092 C CB  . ALA A 155 ? 1.3028 0.7607 0.8954 -0.1718 0.1339  -0.1570 199 ALA A CB  
1093 N N   . LEU A 156 ? 1.3435 0.7867 0.9439 -0.0939 0.1463  -0.1256 200 LEU A N   
1094 C CA  . LEU A 156 ? 1.3775 0.7957 0.9685 -0.0638 0.1615  -0.1223 200 LEU A CA  
1095 C C   . LEU A 156 ? 1.4039 0.8243 0.9868 -0.0680 0.1714  -0.1337 200 LEU A C   
1096 O O   . LEU A 156 ? 1.3976 0.8608 0.9959 -0.0792 0.1581  -0.1349 200 LEU A O   
1097 C CB  . LEU A 156 ? 1.3728 0.8227 0.9899 -0.0329 0.1442  -0.1066 200 LEU A CB  
1098 C CG  . LEU A 156 ? 1.3960 0.8079 0.9976 0.0008  0.1546  -0.0968 200 LEU A CG  
1099 C CD1 . LEU A 156 ? 1.3994 0.7702 0.9753 -0.0082 0.1666  -0.0943 200 LEU A CD1 
1100 C CD2 . LEU A 156 ? 1.3936 0.8407 1.0213 0.0299  0.1294  -0.0848 200 LEU A CD2 
1101 N N   . SER A 157 ? 1.3460 0.7174 0.9015 -0.0570 0.1966  -0.1411 201 SER A N   
1102 C CA  . SER A 157 ? 1.3817 0.7506 0.9229 -0.0557 0.2097  -0.1517 201 SER A CA  
1103 C C   . SER A 157 ? 1.4043 0.7988 0.9710 -0.0215 0.2143  -0.1382 201 SER A C   
1104 O O   . SER A 157 ? 1.3918 0.8018 0.9852 0.0013  0.2047  -0.1235 201 SER A O   
1105 C CB  . SER A 157 ? 1.4146 0.7150 0.9113 -0.0616 0.2351  -0.1695 201 SER A CB  
1106 O OG  . SER A 157 ? 1.4356 0.6965 0.9244 -0.0305 0.2555  -0.1619 201 SER A OG  
1107 N N   . THR A 158 ? 1.5094 0.9077 1.0680 -0.0164 0.2294  -0.1434 202 THR A N   
1108 C CA  . THR A 158 ? 1.5345 0.9668 1.1295 0.0133  0.2352  -0.1290 202 THR A CA  
1109 C C   . THR A 158 ? 1.5521 0.9443 1.1382 0.0459  0.2564  -0.1259 202 THR A C   
1110 O O   . THR A 158 ? 1.5671 0.9855 1.1897 0.0756  0.2604  -0.1128 202 THR A O   
1111 C CB  . THR A 158 ? 1.5753 1.0261 1.1645 0.0101  0.2493  -0.1322 202 THR A CB  
1112 O OG1 . THR A 158 ? 1.6036 0.9958 1.1331 0.0067  0.2743  -0.1513 202 THR A OG1 
1113 C CG2 . THR A 158 ? 1.5640 1.0553 1.1618 -0.0181 0.2277  -0.1320 202 THR A CG2 
1114 N N   . GLU A 159 ? 1.8142 1.1421 1.3543 0.0399  0.2707  -0.1380 203 GLU A N   
1115 C CA  . GLU A 159 ? 1.8293 1.1089 1.3544 0.0698  0.2904  -0.1340 203 GLU A CA  
1116 C C   . GLU A 159 ? 1.8010 1.0706 1.3319 0.0767  0.2760  -0.1228 203 GLU A C   
1117 O O   . GLU A 159 ? 1.8149 1.0350 1.3246 0.0990  0.2920  -0.1183 203 GLU A O   
1118 C CB  . GLU A 159 ? 1.8621 1.0688 1.3313 0.0618  0.3192  -0.1536 203 GLU A CB  
1119 C CG  . GLU A 159 ? 1.9007 1.1088 1.3569 0.0722  0.3398  -0.1613 203 GLU A CG  
1120 C CD  . GLU A 159 ? 1.9408 1.0691 1.3366 0.0699  0.3680  -0.1830 203 GLU A CD  
1121 O OE1 . GLU A 159 ? 1.9371 1.0266 1.3018 0.0375  0.3625  -0.2010 203 GLU A OE1 
1122 O OE2 . GLU A 159 ? 1.9777 1.0817 1.3599 0.1006  0.3954  -0.1826 203 GLU A OE2 
1123 N N   . ASN A 160 ? 1.6898 1.0022 1.2443 0.0584  0.2478  -0.1179 204 ASN A N   
1124 C CA  . ASN A 160 ? 1.6677 0.9758 1.2250 0.0664  0.2327  -0.1064 204 ASN A CA  
1125 C C   . ASN A 160 ? 1.6735 0.9172 1.1907 0.0528  0.2505  -0.1113 204 ASN A C   
1126 O O   . ASN A 160 ? 1.6821 0.8952 1.1862 0.0745  0.2553  -0.0991 204 ASN A O   
1127 C CB  . ASN A 160 ? 1.6784 0.9938 1.2531 0.1113  0.2277  -0.0907 204 ASN A CB  
1128 C CG  . ASN A 160 ? 1.6699 1.0573 1.2994 0.1218  0.2015  -0.0835 204 ASN A CG  
1129 O OD1 . ASN A 160 ? 1.6436 1.0702 1.2962 0.1122  0.1728  -0.0798 204 ASN A OD1 
1130 N ND2 . ASN A 160 ? 1.6957 1.1001 1.3496 0.1419  0.2125  -0.0812 204 ASN A ND2 
1131 N N   . GLY A 161 ? 1.4877 0.7092 0.9857 0.0176  0.2602  -0.1288 205 GLY A N   
1132 C CA  . GLY A 161 ? 1.4914 0.6626 0.9667 -0.0042 0.2725  -0.1337 205 GLY A CA  
1133 C C   . GLY A 161 ? 1.4546 0.6641 0.9507 -0.0300 0.2503  -0.1301 205 GLY A C   
1134 O O   . GLY A 161 ? 1.4275 0.6931 0.9459 -0.0449 0.2277  -0.1336 205 GLY A O   
1135 N N   . LEU A 162 ? 1.5162 0.6944 1.0052 -0.0339 0.2592  -0.1215 206 LEU A N   
1136 C CA  . LEU A 162 ? 1.4874 0.6962 0.9960 -0.0605 0.2440  -0.1190 206 LEU A CA  
1137 C C   . LEU A 162 ? 1.4902 0.6745 0.9972 -0.1031 0.2533  -0.1382 206 LEU A C   
1138 O O   . LEU A 162 ? 1.5227 0.6457 1.0136 -0.1095 0.2787  -0.1419 206 LEU A O   
1139 C CB  . LEU A 162 ? 1.5003 0.6923 1.0041 -0.0400 0.2503  -0.0974 206 LEU A CB  
1140 C CG  . LEU A 162 ? 1.4781 0.7014 1.0020 -0.0598 0.2385  -0.0907 206 LEU A CG  
1141 C CD1 . LEU A 162 ? 1.4358 0.7301 0.9847 -0.0624 0.2041  -0.0926 206 LEU A CD1 
1142 C CD2 . LEU A 162 ? 1.5101 0.7055 1.0176 -0.0326 0.2517  -0.0679 206 LEU A CD2 
1143 N N   . TRP A 163 ? 1.6082 0.8390 1.1327 -0.1317 0.2313  -0.1509 207 TRP A N   
1144 C CA  . TRP A 163 ? 1.6088 0.8260 1.1359 -0.1728 0.2315  -0.1716 207 TRP A CA  
1145 C C   . TRP A 163 ? 1.5768 0.8317 1.1373 -0.1962 0.2173  -0.1647 207 TRP A C   
1146 O O   . TRP A 163 ? 1.5464 0.8527 1.1243 -0.1854 0.1988  -0.1508 207 TRP A O   
1147 C CB  . TRP A 163 ? 1.6092 0.8468 1.1237 -0.1857 0.2173  -0.1930 207 TRP A CB  
1148 C CG  . TRP A 163 ? 1.6506 0.8450 1.1304 -0.1657 0.2361  -0.2026 207 TRP A CG  
1149 C CD1 . TRP A 163 ? 1.6602 0.8636 1.1341 -0.1288 0.2422  -0.1903 207 TRP A CD1 
1150 C CD2 . TRP A 163 ? 1.6917 0.8268 1.1401 -0.1804 0.2515  -0.2273 207 TRP A CD2 
1151 N NE1 . TRP A 163 ? 1.7036 0.8581 1.1440 -0.1177 0.2634  -0.2038 207 TRP A NE1 
1152 C CE2 . TRP A 163 ? 1.7251 0.8337 1.1451 -0.1485 0.2694  -0.2275 207 TRP A CE2 
1153 C CE3 . TRP A 163 ? 1.7062 0.8077 1.1503 -0.2176 0.2505  -0.2505 207 TRP A CE3 
1154 C CZ2 . TRP A 163 ? 1.7735 0.8191 1.1540 -0.1506 0.2882  -0.2500 207 TRP A CZ2 
1155 C CZ3 . TRP A 163 ? 1.7554 0.7933 1.1615 -0.2220 0.2658  -0.2751 207 TRP A CZ3 
1156 C CH2 . TRP A 163 ? 1.7895 0.7977 1.1604 -0.1876 0.2854  -0.2747 207 TRP A CH2 
1157 N N   . VAL A 164 ? 1.6037 0.8327 1.1770 -0.2279 0.2264  -0.1746 208 VAL A N   
1158 C CA  . VAL A 164 ? 1.5797 0.8440 1.1918 -0.2499 0.2175  -0.1667 208 VAL A CA  
1159 C C   . VAL A 164 ? 1.5722 0.8435 1.2043 -0.2945 0.2046  -0.1920 208 VAL A C   
1160 O O   . VAL A 164 ? 1.6003 0.8258 1.2140 -0.3090 0.2123  -0.2139 208 VAL A O   
1161 C CB  . VAL A 164 ? 1.6086 0.8357 1.2291 -0.2396 0.2468  -0.1443 208 VAL A CB  
1162 C CG1 . VAL A 164 ? 1.5941 0.8571 1.2586 -0.2622 0.2428  -0.1352 208 VAL A CG1 
1163 C CG2 . VAL A 164 ? 1.6209 0.8440 1.2166 -0.1923 0.2531  -0.1206 208 VAL A CG2 
1164 N N   . SER A 165 ? 1.4727 0.8007 1.1411 -0.3143 0.1829  -0.1903 209 SER A N   
1165 C CA  . SER A 165 ? 1.4648 0.8081 1.1593 -0.3559 0.1651  -0.2137 209 SER A CA  
1166 C C   . SER A 165 ? 1.4453 0.8253 1.1970 -0.3760 0.1631  -0.2011 209 SER A C   
1167 O O   . SER A 165 ? 1.4190 0.8480 1.1857 -0.3609 0.1538  -0.1813 209 SER A O   
1168 C CB  . SER A 165 ? 1.4442 0.8314 1.1210 -0.3597 0.1317  -0.2302 209 SER A CB  
1169 O OG  . SER A 165 ? 1.4282 0.8495 1.1366 -0.3949 0.1067  -0.2469 209 SER A OG  
1170 N N   . LYS A 166 ? 1.5782 0.9331 1.3646 -0.4093 0.1732  -0.2123 210 LYS A N   
1171 C CA  . LYS A 166 ? 1.5629 0.9561 1.4147 -0.4326 0.1729  -0.2017 210 LYS A CA  
1172 C C   . LYS A 166 ? 1.5289 0.9844 1.4125 -0.4618 0.1319  -0.2217 210 LYS A C   
1173 O O   . LYS A 166 ? 1.5051 1.0139 1.4402 -0.4716 0.1235  -0.2095 210 LYS A O   
1174 C CB  . LYS A 166 ? 1.5973 0.9372 1.4835 -0.4567 0.2045  -0.2022 210 LYS A CB  
1175 C CG  . LYS A 166 ? 1.5891 0.9680 1.5526 -0.4806 0.2111  -0.1878 210 LYS A CG  
1176 C CD  . LYS A 166 ? 1.6172 0.9530 1.6327 -0.5188 0.2341  -0.1965 210 LYS A CD  
1177 C CE  . LYS A 166 ? 1.5973 0.9946 1.7032 -0.5513 0.2248  -0.1921 210 LYS A CE  
1178 N NZ  . LYS A 166 ? 1.5440 1.0168 1.6583 -0.5301 0.2080  -0.1721 210 LYS A NZ  
1179 N N   . ASN A 167 ? 1.5827 1.0300 1.4316 -0.4721 0.1071  -0.2519 211 ASN A N   
1180 C CA  . ASN A 167 ? 1.5642 1.0596 1.4334 -0.4998 0.0661  -0.2757 211 ASN A CA  
1181 C C   . ASN A 167 ? 1.5341 1.0855 1.3749 -0.4805 0.0357  -0.2724 211 ASN A C   
1182 O O   . ASN A 167 ? 1.5319 1.1099 1.3659 -0.4965 0.0015  -0.2951 211 ASN A O   
1183 C CB  . ASN A 167 ? 1.6016 1.0496 1.4492 -0.5262 0.0547  -0.3147 211 ASN A CB  
1184 C CG  . ASN A 167 ? 1.6294 1.0346 1.3966 -0.5016 0.0577  -0.3270 211 ASN A CG  
1185 O OD1 . ASN A 167 ? 1.6220 1.0250 1.3563 -0.4658 0.0743  -0.3048 211 ASN A OD1 
1186 N ND2 . ASN A 167 ? 1.6717 1.0537 1.4141 -0.5097 0.0395  -0.3568 211 ASN A ND2 
1187 N N   . PHE A 168 ? 1.4530 1.0166 1.2735 -0.4454 0.0479  -0.2455 212 PHE A N   
1188 C CA  . PHE A 168 ? 1.4262 1.0367 1.2225 -0.4247 0.0249  -0.2379 212 PHE A CA  
1189 C C   . PHE A 168 ? 1.4516 1.0376 1.1859 -0.4162 0.0159  -0.2576 212 PHE A C   
1190 O O   . PHE A 168 ? 1.4474 1.0663 1.1629 -0.4169 -0.0110 -0.2665 212 PHE A O   
1191 C CB  . PHE A 168 ? 1.3946 1.0730 1.2338 -0.4419 -0.0065 -0.2381 212 PHE A CB  
1192 C CG  . PHE A 168 ? 1.3717 1.0950 1.1866 -0.4224 -0.0299 -0.2300 212 PHE A CG  
1193 C CD1 . PHE A 168 ? 1.3567 1.0863 1.1563 -0.3903 -0.0184 -0.2054 212 PHE A CD1 
1194 C CD2 . PHE A 168 ? 1.3709 1.1279 1.1784 -0.4358 -0.0643 -0.2471 212 PHE A CD2 
1195 C CE1 . PHE A 168 ? 1.3389 1.1059 1.1215 -0.3745 -0.0377 -0.1971 212 PHE A CE1 
1196 C CE2 . PHE A 168 ? 1.3577 1.1512 1.1415 -0.4168 -0.0823 -0.2368 212 PHE A CE2 
1197 C CZ  . PHE A 168 ? 1.3407 1.1386 1.1146 -0.3873 -0.0675 -0.2112 212 PHE A CZ  
1198 N N   . GLY A 169 ? 1.6794 1.2052 1.3798 -0.4047 0.0416  -0.2622 213 GLY A N   
1199 C CA  . GLY A 169 ? 1.7093 1.2111 1.3508 -0.3859 0.0429  -0.2724 213 GLY A CA  
1200 C C   . GLY A 169 ? 1.7557 1.2198 1.3599 -0.4042 0.0335  -0.3075 213 GLY A C   
1201 O O   . GLY A 169 ? 1.7901 1.2346 1.3409 -0.3872 0.0358  -0.3166 213 GLY A O   
1202 N N   . GLY A 170 ? 1.5393 0.9926 1.1719 -0.4383 0.0228  -0.3280 214 GLY A N   
1203 C CA  . GLY A 170 ? 1.5897 1.0002 1.1859 -0.4570 0.0109  -0.3657 214 GLY A CA  
1204 C C   . GLY A 170 ? 1.6344 0.9651 1.1976 -0.4480 0.0444  -0.3740 214 GLY A C   
1205 O O   . GLY A 170 ? 1.6823 0.9776 1.1869 -0.4330 0.0468  -0.3909 214 GLY A O   
1206 N N   . LYS A 171 ? 1.8320 1.1375 1.4340 -0.4511 0.0721  -0.3577 215 LYS A N   
1207 C CA  . LYS A 171 ? 1.8731 1.1039 1.4521 -0.4393 0.1064  -0.3594 215 LYS A CA  
1208 C C   . LYS A 171 ? 1.8540 1.0818 1.4377 -0.4072 0.1372  -0.3233 215 LYS A C   
1209 O O   . LYS A 171 ? 1.8164 1.0846 1.4447 -0.4065 0.1385  -0.2982 215 LYS A O   
1210 C CB  . LYS A 171 ? 1.9101 1.1158 1.5368 -0.4644 0.1103  -0.3678 215 LYS A CB  
1211 C CG  . LYS A 171 ? 1.9791 1.1063 1.5785 -0.4517 0.1418  -0.3722 215 LYS A CG  
1212 C CD  . LYS A 171 ? 2.0076 1.1079 1.6641 -0.4706 0.1615  -0.3631 215 LYS A CD  
1213 C CE  . LYS A 171 ? 1.9944 1.0643 1.6515 -0.4478 0.2044  -0.3291 215 LYS A CE  
1214 N NZ  . LYS A 171 ? 2.0470 1.0773 1.7470 -0.4604 0.2308  -0.3187 215 LYS A NZ  
1215 N N   . TRP A 172 ? 1.7807 0.9636 1.3186 -0.3769 0.1604  -0.3203 216 TRP A N   
1216 C CA  . TRP A 172 ? 1.7687 0.9506 1.3078 -0.3408 0.1847  -0.2874 216 TRP A CA  
1217 C C   . TRP A 172 ? 1.8110 0.9136 1.3323 -0.3295 0.2204  -0.2863 216 TRP A C   
1218 O O   . TRP A 172 ? 1.8535 0.8987 1.3468 -0.3413 0.2277  -0.3126 216 TRP A O   
1219 C CB  . TRP A 172 ? 1.7626 0.9768 1.2714 -0.3076 0.1784  -0.2783 216 TRP A CB  
1220 C CG  . TRP A 172 ? 1.7226 1.0123 1.2494 -0.3130 0.1478  -0.2725 216 TRP A CG  
1221 C CD1 . TRP A 172 ? 1.7272 1.0427 1.2404 -0.3313 0.1216  -0.2930 216 TRP A CD1 
1222 C CD2 . TRP A 172 ? 1.6773 1.0225 1.2350 -0.2977 0.1398  -0.2444 216 TRP A CD2 
1223 N NE1 . TRP A 172 ? 1.6856 1.0695 1.2216 -0.3284 0.0998  -0.2771 216 TRP A NE1 
1224 C CE2 . TRP A 172 ? 1.6534 1.0557 1.2181 -0.3088 0.1106  -0.2482 216 TRP A CE2 
1225 C CE3 . TRP A 172 ? 1.6608 1.0096 1.2365 -0.2739 0.1535  -0.2173 216 TRP A CE3 
1226 C CZ2 . TRP A 172 ? 1.6104 1.0707 1.2029 -0.2985 0.0963  -0.2260 216 TRP A CZ2 
1227 C CZ3 . TRP A 172 ? 1.6211 1.0277 1.2218 -0.2636 0.1369  -0.1978 216 TRP A CZ3 
1228 C CH2 . TRP A 172 ? 1.5943 1.0551 1.2051 -0.2769 0.1094  -0.2023 216 TRP A CH2 
1229 N N   . GLU A 173 ? 2.2246 1.3197 1.7580 -0.3048 0.2424  -0.2562 217 GLU A N   
1230 C CA  . GLU A 173 ? 2.2668 1.2865 1.7765 -0.2857 0.2773  -0.2508 217 GLU A CA  
1231 C C   . GLU A 173 ? 2.2606 1.2902 1.7588 -0.2391 0.2898  -0.2200 217 GLU A C   
1232 O O   . GLU A 173 ? 2.2282 1.3082 1.7498 -0.2287 0.2794  -0.1979 217 GLU A O   
1233 C CB  . GLU A 173 ? 2.2880 1.2623 1.8279 -0.3120 0.2981  -0.2486 217 GLU A CB  
1234 C CG  . GLU A 173 ? 2.3464 1.2323 1.8588 -0.2937 0.3369  -0.2436 217 GLU A CG  
1235 C CD  . GLU A 173 ? 2.4030 1.2554 1.8797 -0.2900 0.3353  -0.2698 217 GLU A CD  
1236 O OE1 . GLU A 173 ? 2.4067 1.2862 1.8781 -0.3110 0.3072  -0.2973 217 GLU A OE1 
1237 O OE2 . GLU A 173 ? 2.4504 1.2483 1.9009 -0.2629 0.3625  -0.2616 217 GLU A OE2 
1238 N N   . GLU A 174 ? 1.8891 0.8682 1.3509 -0.2100 0.3111  -0.2199 218 GLU A N   
1239 C CA  . GLU A 174 ? 1.8875 0.8772 1.3383 -0.1633 0.3186  -0.1942 218 GLU A CA  
1240 C C   . GLU A 174 ? 1.9103 0.8537 1.3621 -0.1477 0.3458  -0.1705 218 GLU A C   
1241 O O   . GLU A 174 ? 1.9532 0.8228 1.3853 -0.1455 0.3744  -0.1739 218 GLU A O   
1242 C CB  . GLU A 174 ? 1.9166 0.8800 1.3318 -0.1361 0.3288  -0.2037 218 GLU A CB  
1243 C CG  . GLU A 174 ? 1.9074 0.9001 1.3219 -0.0893 0.3277  -0.1804 218 GLU A CG  
1244 C CD  . GLU A 174 ? 1.9399 0.9043 1.3259 -0.0603 0.3434  -0.1872 218 GLU A CD  
1245 O OE1 . GLU A 174 ? 1.9785 0.8807 1.3350 -0.0701 0.3627  -0.2074 218 GLU A OE1 
1246 O OE2 . GLU A 174 ? 1.9295 0.9335 1.3250 -0.0270 0.3366  -0.1728 218 GLU A OE2 
1247 N N   . ILE A 175 ? 1.7824 0.7653 1.2537 -0.1356 0.3380  -0.1463 219 ILE A N   
1248 C CA  . ILE A 175 ? 1.8109 0.7513 1.2794 -0.1211 0.3648  -0.1219 219 ILE A CA  
1249 C C   . ILE A 175 ? 1.8352 0.7527 1.2721 -0.0664 0.3769  -0.0986 219 ILE A C   
1250 O O   . ILE A 175 ? 1.8729 0.7378 1.2938 -0.0485 0.4050  -0.0787 219 ILE A O   
1251 C CB  . ILE A 175 ? 1.7883 0.7742 1.2897 -0.1357 0.3548  -0.1072 219 ILE A CB  
1252 C CG1 . ILE A 175 ? 1.7584 0.8098 1.2607 -0.1070 0.3268  -0.0938 219 ILE A CG1 
1253 C CG2 . ILE A 175 ? 1.7622 0.7759 1.3008 -0.1882 0.3404  -0.1294 219 ILE A CG2 
1254 C CD1 . ILE A 175 ? 1.7543 0.8349 1.2760 -0.1077 0.3244  -0.0742 219 ILE A CD1 
1255 N N   . HIS A 176 ? 1.7833 0.7391 1.2127 -0.0391 0.3564  -0.1000 220 HIS A N   
1256 C CA  . HIS A 176 ? 1.8053 0.7425 1.2093 0.0132  0.3635  -0.0816 220 HIS A CA  
1257 C C   . HIS A 176 ? 1.7863 0.7627 1.1949 0.0277  0.3447  -0.0933 220 HIS A C   
1258 O O   . HIS A 176 ? 1.7536 0.7823 1.1842 0.0023  0.3225  -0.1086 220 HIS A O   
1259 C CB  . HIS A 176 ? 1.8029 0.7669 1.2061 0.0417  0.3516  -0.0562 220 HIS A CB  
1260 C CG  . HIS A 176 ? 1.8461 0.7599 1.2131 0.0911  0.3708  -0.0333 220 HIS A CG  
1261 N ND1 . HIS A 176 ? 1.8511 0.7703 1.2055 0.1337  0.3617  -0.0291 220 HIS A ND1 
1262 C CD2 . HIS A 176 ? 1.8892 0.7482 1.2302 0.1071  0.3986  -0.0113 220 HIS A CD2 
1263 C CE1 . HIS A 176 ? 1.8925 0.7616 1.2114 0.1746  0.3802  -0.0070 220 HIS A CE1 
1264 N NE2 . HIS A 176 ? 1.9190 0.7482 1.2256 0.1601  0.4044  0.0050  220 HIS A NE2 
1265 N N   . LYS A 177 ? 1.8333 0.7861 1.2231 0.0699  0.3547  -0.0845 221 LYS A N   
1266 C CA  . LYS A 177 ? 1.8198 0.8166 1.2233 0.0877  0.3390  -0.0911 221 LYS A CA  
1267 C C   . LYS A 177 ? 1.8084 0.8448 1.2237 0.1315  0.3181  -0.0713 221 LYS A C   
1268 O O   . LYS A 177 ? 1.8167 0.8381 1.2180 0.1521  0.3169  -0.0535 221 LYS A O   
1269 C CB  . LYS A 177 ? 1.8565 0.7998 1.2363 0.0994  0.3665  -0.1018 221 LYS A CB  
1270 C CG  . LYS A 177 ? 1.8793 0.7556 1.2362 0.0642  0.3916  -0.1196 221 LYS A CG  
1271 C CD  . LYS A 177 ? 1.9228 0.7395 1.2505 0.0790  0.4190  -0.1320 221 LYS A CD  
1272 C CE  . LYS A 177 ? 1.9065 0.7434 1.2333 0.0539  0.4122  -0.1593 221 LYS A CE  
1273 N NZ  . LYS A 177 ? 1.9677 0.7313 1.2568 0.0617  0.4420  -0.1764 221 LYS A NZ  
1274 N N   . ALA A 178 ? 1.6354 0.7209 1.0764 0.1464  0.3021  -0.0747 222 ALA A N   
1275 C CA  . ALA A 178 ? 1.6229 0.7579 1.0885 0.1830  0.2747  -0.0605 222 ALA A CA  
1276 C C   . ALA A 178 ? 1.6001 0.7716 1.0759 0.1772  0.2454  -0.0527 222 ALA A C   
1277 O O   . ALA A 178 ? 1.6107 0.7776 1.0745 0.2119  0.2336  -0.0378 222 ALA A O   
1278 C CB  . ALA A 178 ? 1.6537 0.7453 1.0954 0.2325  0.2887  -0.0454 222 ALA A CB  
1279 N N   . VAL A 179 ? 1.5072 0.7128 1.0010 0.1366  0.2332  -0.0628 223 VAL A N   
1280 C CA  . VAL A 179 ? 1.4857 0.7250 0.9891 0.1303  0.2074  -0.0566 223 VAL A CA  
1281 C C   . VAL A 179 ? 1.4594 0.7716 1.0073 0.1327  0.1714  -0.0591 223 VAL A C   
1282 O O   . VAL A 179 ? 1.4457 0.7915 1.0214 0.1111  0.1689  -0.0694 223 VAL A O   
1283 C CB  . VAL A 179 ? 1.4699 0.7030 0.9698 0.0857  0.2154  -0.0641 223 VAL A CB  
1284 C CG1 . VAL A 179 ? 1.4471 0.7213 0.9609 0.0804  0.1888  -0.0582 223 VAL A CG1 
1285 C CG2 . VAL A 179 ? 1.5026 0.6646 0.9676 0.0822  0.2496  -0.0594 223 VAL A CG2 
1286 N N   . CYS A 180 ? 1.5236 0.8568 1.0765 0.1605  0.1442  -0.0496 224 CYS A N   
1287 C CA  . CYS A 180 ? 1.5037 0.9028 1.1032 0.1624  0.1069  -0.0524 224 CYS A CA  
1288 C C   . CYS A 180 ? 1.4731 0.9058 1.0878 0.1294  0.0898  -0.0574 224 CYS A C   
1289 O O   . CYS A 180 ? 1.4534 0.9329 1.1081 0.1088  0.0763  -0.0638 224 CYS A O   
1290 C CB  . CYS A 180 ? 1.5187 0.9238 1.1157 0.2064  0.0792  -0.0438 224 CYS A CB  
1291 S SG  . CYS A 180 ? 1.5431 0.9501 1.1587 0.2483  0.0794  -0.0394 224 CYS A SG  
1292 N N   . LEU A 181 ? 1.5337 0.9410 1.1158 0.1275  0.0925  -0.0522 225 LEU A N   
1293 C CA  . LEU A 181 ? 1.5079 0.9448 1.1011 0.1052  0.0747  -0.0543 225 LEU A CA  
1294 C C   . LEU A 181 ? 1.5178 0.9148 1.0764 0.0910  0.1001  -0.0493 225 LEU A C   
1295 O O   . LEU A 181 ? 1.5528 0.9012 1.0740 0.1137  0.1196  -0.0393 225 LEU A O   
1296 C CB  . LEU A 181 ? 1.5100 0.9709 1.1097 0.1335  0.0379  -0.0512 225 LEU A CB  
1297 C CG  . LEU A 181 ? 1.4883 0.9742 1.0943 0.1186  0.0177  -0.0527 225 LEU A CG  
1298 C CD1 . LEU A 181 ? 1.4507 0.9822 1.1012 0.0807  0.0108  -0.0610 225 LEU A CD1 
1299 C CD2 . LEU A 181 ? 1.4953 0.9933 1.0991 0.1522  -0.0197 -0.0526 225 LEU A CD2 
1300 N N   . ALA A 182 ? 1.2928 0.7101 0.8661 0.0546  0.1010  -0.0545 226 ALA A N   
1301 C CA  . ALA A 182 ? 1.3031 0.6891 0.8567 0.0374  0.1258  -0.0496 226 ALA A CA  
1302 C C   . ALA A 182 ? 1.2831 0.7047 0.8534 0.0189  0.1104  -0.0489 226 ALA A C   
1303 O O   . ALA A 182 ? 1.2490 0.7164 0.8503 -0.0017 0.0900  -0.0576 226 ALA A O   
1304 C CB  . ALA A 182 ? 1.3059 0.6694 0.8620 0.0061  0.1517  -0.0593 226 ALA A CB  
1305 N N   . LYS A 183 ? 1.3745 0.7741 0.9236 0.0283  0.1226  -0.0368 227 LYS A N   
1306 C CA  . LYS A 183 ? 1.3701 0.8021 0.9338 0.0161  0.1101  -0.0346 227 LYS A CA  
1307 C C   . LYS A 183 ? 1.4027 0.8142 0.9640 -0.0009 0.1401  -0.0253 227 LYS A C   
1308 O O   . LYS A 183 ? 1.4393 0.8021 0.9736 0.0129  0.1699  -0.0136 227 LYS A O   
1309 C CB  . LYS A 183 ? 1.3857 0.8240 0.9300 0.0535  0.0854  -0.0285 227 LYS A CB  
1310 C CG  . LYS A 183 ? 1.3487 0.8248 0.9166 0.0599  0.0487  -0.0392 227 LYS A CG  
1311 C CD  . LYS A 183 ? 1.3762 0.8475 0.9208 0.1009  0.0222  -0.0366 227 LYS A CD  
1312 C CE  . LYS A 183 ? 1.3436 0.8524 0.9242 0.1040  -0.0133 -0.0479 227 LYS A CE  
1313 N NZ  . LYS A 183 ? 1.3782 0.8824 0.9410 0.1441  -0.0458 -0.0498 227 LYS A NZ  
1314 N N   . TRP A 184 ? 1.2834 0.7334 0.8768 -0.0307 0.1328  -0.0293 228 TRP A N   
1315 C CA  . TRP A 184 ? 1.3171 0.7607 0.9215 -0.0472 0.1574  -0.0195 228 TRP A CA  
1316 C C   . TRP A 184 ? 1.3643 0.7980 0.9428 -0.0137 0.1620  -0.0022 228 TRP A C   
1317 O O   . TRP A 184 ? 1.3636 0.8262 0.9405 0.0007  0.1350  -0.0036 228 TRP A O   
1318 C CB  . TRP A 184 ? 1.2927 0.7863 0.9422 -0.0863 0.1444  -0.0293 228 TRP A CB  
1319 C CG  . TRP A 184 ? 1.2693 0.7638 0.9402 -0.1231 0.1488  -0.0449 228 TRP A CG  
1320 C CD1 . TRP A 184 ? 1.2304 0.7563 0.9153 -0.1421 0.1256  -0.0614 228 TRP A CD1 
1321 C CD2 . TRP A 184 ? 1.2888 0.7486 0.9677 -0.1452 0.1782  -0.0464 228 TRP A CD2 
1322 N NE1 . TRP A 184 ? 1.2297 0.7415 0.9241 -0.1726 0.1364  -0.0751 228 TRP A NE1 
1323 C CE2 . TRP A 184 ? 1.2628 0.7339 0.9569 -0.1769 0.1673  -0.0677 228 TRP A CE2 
1324 C CE3 . TRP A 184 ? 1.3280 0.7455 1.0027 -0.1412 0.2138  -0.0315 228 TRP A CE3 
1325 C CZ2 . TRP A 184 ? 1.2751 0.7153 0.9803 -0.2058 0.1867  -0.0782 228 TRP A CZ2 
1326 C CZ3 . TRP A 184 ? 1.3344 0.7225 1.0272 -0.1720 0.2360  -0.0393 228 TRP A CZ3 
1327 C CH2 . TRP A 184 ? 1.3085 0.7075 1.0165 -0.2045 0.2204  -0.0642 228 TRP A CH2 
1328 N N   . GLY A 185 ? 1.4266 0.7940 1.1082 -0.1451 0.0365  -0.0067 229 GLY A N   
1329 C CA  . GLY A 185 ? 1.3999 0.8295 1.1497 -0.1539 0.0513  0.0060  229 GLY A CA  
1330 C C   . GLY A 185 ? 1.4219 0.8768 1.2426 -0.1865 0.0235  -0.0104 229 GLY A C   
1331 O O   . GLY A 185 ? 1.4508 0.8863 1.2656 -0.1970 -0.0149 -0.0313 229 GLY A O   
1332 N N   . SER A 186 ? 1.4032 0.9012 1.2908 -0.2008 0.0428  -0.0016 230 SER A N   
1333 C CA  . SER A 186 ? 1.4152 0.9386 1.3864 -0.2338 0.0236  -0.0178 230 SER A CA  
1334 C C   . SER A 186 ? 1.4456 0.9068 1.4247 -0.2608 0.0278  -0.0255 230 SER A C   
1335 O O   . SER A 186 ? 1.4541 0.8611 1.3822 -0.2532 0.0580  -0.0112 230 SER A O   
1336 C CB  . SER A 186 ? 1.3833 0.9763 1.4247 -0.2387 0.0494  -0.0065 230 SER A CB  
1337 O OG  . SER A 186 ? 1.3876 0.9665 1.3986 -0.2268 0.0968  0.0186  230 SER A OG  
1338 N N   . ASP A 187 ? 1.6632 1.1305 1.7069 -0.2911 -0.0053 -0.0495 231 ASP A N   
1339 C CA  . ASP A 187 ? 1.6920 1.1041 1.7580 -0.3230 -0.0069 -0.0619 231 ASP A CA  
1340 C C   . ASP A 187 ? 1.7323 1.0520 1.7002 -0.3120 -0.0137 -0.0656 231 ASP A C   
1341 O O   . ASP A 187 ? 1.7483 1.0099 1.6955 -0.3213 0.0151  -0.0573 231 ASP A O   
1342 C CB  . ASP A 187 ? 1.6759 1.0919 1.7874 -0.3412 0.0472  -0.0426 231 ASP A CB  
1343 C CG  . ASP A 187 ? 1.6290 1.1327 1.8381 -0.3528 0.0623  -0.0398 231 ASP A CG  
1344 O OD1 . ASP A 187 ? 1.5963 1.1479 1.8849 -0.3699 0.0245  -0.0638 231 ASP A OD1 
1345 O OD2 . ASP A 187 ? 1.6235 1.1459 1.8271 -0.3426 0.1109  -0.0144 231 ASP A OD2 
1346 N N   . ASN A 188 ? 1.5605 0.8623 1.4641 -0.2910 -0.0485 -0.0773 232 ASN A N   
1347 C CA  . ASN A 188 ? 1.6027 0.8154 1.4102 -0.2792 -0.0585 -0.0861 232 ASN A CA  
1348 C C   . ASN A 188 ? 1.5964 0.7623 1.3421 -0.2581 -0.0097 -0.0627 232 ASN A C   
1349 O O   . ASN A 188 ? 1.6357 0.7190 1.3258 -0.2586 -0.0072 -0.0694 232 ASN A O   
1350 C CB  . ASN A 188 ? 1.6519 0.8100 1.4797 -0.3127 -0.0948 -0.1151 232 ASN A CB  
1351 C CG  . ASN A 188 ? 1.6595 0.8617 1.5511 -0.3307 -0.1511 -0.1412 232 ASN A CG  
1352 O OD1 . ASN A 188 ? 1.6446 0.8919 1.5281 -0.3114 -0.1707 -0.1404 232 ASN A OD1 
1353 N ND2 . ASN A 188 ? 1.6801 0.8718 1.6395 -0.3660 -0.1773 -0.1648 232 ASN A ND2 
1354 N N   . THR A 189 ? 1.5543 0.7712 1.3090 -0.2380 0.0261  -0.0364 233 THR A N   
1355 C CA  . THR A 189 ? 1.5430 0.7258 1.2390 -0.2098 0.0666  -0.0133 233 THR A CA  
1356 C C   . THR A 189 ? 1.5341 0.7110 1.1577 -0.1727 0.0619  -0.0134 233 THR A C   
1357 O O   . THR A 189 ? 1.5118 0.7415 1.1435 -0.1642 0.0444  -0.0175 233 THR A O   
1358 C CB  . THR A 189 ? 1.5032 0.7405 1.2357 -0.2024 0.1035  0.0136  233 THR A CB  
1359 O OG1 . THR A 189 ? 1.5100 0.7523 1.3114 -0.2387 0.1157  0.0143  233 THR A OG1 
1360 C CG2 . THR A 189 ? 1.4988 0.6963 1.1672 -0.1696 0.1383  0.0366  233 THR A CG2 
1361 N N   . ILE A 190 ? 1.5995 0.7106 1.1544 -0.1505 0.0798  -0.0093 234 ILE A N   
1362 C CA  . ILE A 190 ? 1.5911 0.7002 1.0852 -0.1141 0.0844  -0.0087 234 ILE A CA  
1363 C C   . ILE A 190 ? 1.5571 0.6813 1.0377 -0.0804 0.1211  0.0162  234 ILE A C   
1364 O O   . ILE A 190 ? 1.5774 0.6522 1.0420 -0.0761 0.1422  0.0273  234 ILE A O   
1365 C CB  . ILE A 190 ? 1.6549 0.6752 1.0753 -0.1093 0.0732  -0.0289 234 ILE A CB  
1366 C CG1 . ILE A 190 ? 1.6980 0.6973 1.1272 -0.1419 0.0294  -0.0554 234 ILE A CG1 
1367 C CG2 . ILE A 190 ? 1.6541 0.6747 1.0162 -0.0726 0.0849  -0.0290 234 ILE A CG2 
1368 C CD1 . ILE A 190 ? 1.7729 0.6747 1.1258 -0.1411 0.0151  -0.0777 234 ILE A CD1 
1369 N N   . PHE A 191 ? 1.4951 0.6849 0.9828 -0.0567 0.1265  0.0246  235 PHE A N   
1370 C CA  . PHE A 191 ? 1.4705 0.6747 0.9416 -0.0190 0.1537  0.0432  235 PHE A CA  
1371 C C   . PHE A 191 ? 1.4839 0.6736 0.9087 0.0105  0.1588  0.0340  235 PHE A C   
1372 O O   . PHE A 191 ? 1.4792 0.6931 0.9003 0.0063  0.1456  0.0215  235 PHE A O   
1373 C CB  . PHE A 191 ? 1.4141 0.7048 0.9324 -0.0122 0.1580  0.0584  235 PHE A CB  
1374 C CG  . PHE A 191 ? 1.4111 0.7196 0.9743 -0.0387 0.1602  0.0678  235 PHE A CG  
1375 C CD1 . PHE A 191 ? 1.4303 0.7002 0.9826 -0.0357 0.1830  0.0853  235 PHE A CD1 
1376 C CD2 . PHE A 191 ? 1.3974 0.7583 1.0123 -0.0653 0.1420  0.0596  235 PHE A CD2 
1377 C CE1 . PHE A 191 ? 1.4347 0.7181 1.0269 -0.0615 0.1926  0.0945  235 PHE A CE1 
1378 C CE2 . PHE A 191 ? 1.4031 0.7840 1.0659 -0.0891 0.1494  0.0669  235 PHE A CE2 
1379 C CZ  . PHE A 191 ? 1.4207 0.7629 1.0720 -0.0885 0.1773  0.0845  235 PHE A CZ  
1380 N N   . PHE A 192 ? 1.5200 0.6674 0.9085 0.0413  0.1798  0.0401  236 PHE A N   
1381 C CA  . PHE A 192 ? 1.5414 0.6834 0.8957 0.0717  0.1910  0.0308  236 PHE A CA  
1382 C C   . PHE A 192 ? 1.5423 0.6901 0.8924 0.1154  0.2141  0.0437  236 PHE A C   
1383 O O   . PHE A 192 ? 1.5473 0.6680 0.8945 0.1245  0.2210  0.0586  236 PHE A O   
1384 C CB  . PHE A 192 ? 1.6139 0.6692 0.9078 0.0641  0.1865  0.0099  236 PHE A CB  
1385 C CG  . PHE A 192 ? 1.6615 0.6306 0.9221 0.0657  0.1938  0.0107  236 PHE A CG  
1386 C CD1 . PHE A 192 ? 1.6779 0.6093 0.9493 0.0288  0.1779  0.0086  236 PHE A CD1 
1387 C CD2 . PHE A 192 ? 1.7100 0.6348 0.9324 0.1042  0.2172  0.0125  236 PHE A CD2 
1388 C CE1 . PHE A 192 ? 1.7614 0.6075 1.0020 0.0273  0.1866  0.0096  236 PHE A CE1 
1389 C CE2 . PHE A 192 ? 1.7947 0.6317 0.9816 0.1066  0.2239  0.0137  236 PHE A CE2 
1390 C CZ  . PHE A 192 ? 1.8220 0.6169 1.0155 0.0668  0.2093  0.0127  236 PHE A CZ  
1391 N N   . THR A 193 ? 1.5234 0.7055 0.8741 0.1429  0.2262  0.0376  237 THR A N   
1392 C CA  . THR A 193 ? 1.5348 0.7255 0.8885 0.1880  0.2451  0.0450  237 THR A CA  
1393 C C   . THR A 193 ? 1.6123 0.7294 0.9139 0.2107  0.2632  0.0310  237 THR A C   
1394 O O   . THR A 193 ? 1.6454 0.7325 0.9134 0.1981  0.2661  0.0131  237 THR A O   
1395 C CB  . THR A 193 ? 1.4930 0.7784 0.8971 0.2060  0.2492  0.0459  237 THR A CB  
1396 O OG1 . THR A 193 ? 1.4902 0.7990 0.8959 0.1818  0.2466  0.0325  237 THR A OG1 
1397 C CG2 . THR A 193 ? 1.4375 0.7848 0.8863 0.2025  0.2350  0.0630  237 THR A CG2 
1398 N N   . THR A 194 ? 1.7270 0.8090 1.0156 0.2464  0.2752  0.0389  238 THR A N   
1399 C CA  . THR A 194 ? 1.7887 0.8044 1.0322 0.2756  0.2954  0.0254  238 THR A CA  
1400 C C   . THR A 194 ? 1.7744 0.8384 1.0522 0.3273  0.3117  0.0287  238 THR A C   
1401 O O   . THR A 194 ? 1.7225 0.8599 1.0520 0.3400  0.3022  0.0427  238 THR A O   
1402 C CB  . THR A 194 ? 1.8402 0.7464 1.0283 0.2735  0.2947  0.0275  238 THR A CB  
1403 O OG1 . THR A 194 ? 1.8209 0.7272 1.0240 0.2860  0.2896  0.0513  238 THR A OG1 
1404 C CG2 . THR A 194 ? 1.8597 0.7160 1.0196 0.2226  0.2775  0.0177  238 THR A CG2 
1405 N N   . TYR A 195 ? 1.9276 0.9527 1.1790 0.3580  0.3352  0.0135  239 TYR A N   
1406 C CA  . TYR A 195 ? 1.9126 0.9818 1.2045 0.4111  0.3508  0.0137  239 TYR A CA  
1407 C C   . TYR A 195 ? 1.9669 0.9536 1.2152 0.4454  0.3626  0.0104  239 TYR A C   
1408 O O   . TYR A 195 ? 2.0203 0.9306 1.2098 0.4258  0.3668  0.0002  239 TYR A O   
1409 C CB  . TYR A 195 ? 1.8940 1.0350 1.2265 0.4169  0.3731  -0.0028 239 TYR A CB  
1410 C CG  . TYR A 195 ? 1.9582 1.0346 1.2304 0.4077  0.3990  -0.0243 239 TYR A CG  
1411 C CD1 . TYR A 195 ? 1.9787 1.0302 1.2095 0.3608  0.3905  -0.0308 239 TYR A CD1 
1412 C CD2 . TYR A 195 ? 1.9876 1.0525 1.2574 0.4345  0.4194  -0.0335 239 TYR A CD2 
1413 C CE1 . TYR A 195 ? 2.0413 1.0361 1.2113 0.3499  0.4069  -0.0480 239 TYR A CE1 
1414 C CE2 . TYR A 195 ? 2.0430 1.0605 1.2602 0.4195  0.4369  -0.0489 239 TYR A CE2 
1415 C CZ  . TYR A 195 ? 2.0716 1.0526 1.2357 0.3775  0.4297  -0.0552 239 TYR A CZ  
1416 O OH  . TYR A 195 ? 2.1335 1.0630 1.2372 0.3650  0.4435  -0.0691 239 TYR A OH  
1417 N N   . ALA A 196 ? 2.5185 1.5372 1.8031 0.4880  0.3583  0.0208  240 ALA A N   
1418 C CA  . ALA A 196 ? 2.5901 1.5493 1.8438 0.5140  0.3604  0.0218  240 ALA A CA  
1419 C C   . ALA A 196 ? 2.6337 1.5934 1.8887 0.5306  0.3860  0.0000  240 ALA A C   
1420 O O   . ALA A 196 ? 2.7106 1.5898 1.9051 0.5203  0.3939  -0.0090 240 ALA A O   
1421 C CB  . ALA A 196 ? 2.5877 1.5812 1.8775 0.5559  0.3437  0.0387  240 ALA A CB  
1422 N N   . ASN A 197 ? 2.4994 1.5519 1.8263 0.5542  0.3992  -0.0092 241 ASN A N   
1423 C CA  . ASN A 197 ? 2.5393 1.6043 1.8796 0.5695  0.4283  -0.0295 241 ASN A CA  
1424 C C   . ASN A 197 ? 2.4643 1.6398 1.8874 0.5714  0.4446  -0.0396 241 ASN A C   
1425 O O   . ASN A 197 ? 2.3850 1.6337 1.8644 0.5715  0.4291  -0.0308 241 ASN A O   
1426 C CB  . ASN A 197 ? 2.6085 1.6545 1.9593 0.6156  0.4290  -0.0310 241 ASN A CB  
1427 C CG  . ASN A 197 ? 2.5747 1.6799 1.9877 0.6517  0.4036  -0.0170 241 ASN A CG  
1428 O OD1 . ASN A 197 ? 2.4925 1.6827 1.9671 0.6502  0.3928  -0.0125 241 ASN A OD1 
1429 N ND2 . ASN A 197 ? 2.6442 1.7019 2.0378 0.6846  0.3916  -0.0102 241 ASN A ND2 
1430 N N   . GLY A 198 ? 2.5526 1.7393 1.9831 0.5717  0.4767  -0.0579 242 GLY A N   
1431 C CA  . GLY A 198 ? 2.4984 1.7772 1.9959 0.5603  0.4975  -0.0678 242 GLY A CA  
1432 C C   . GLY A 198 ? 2.4913 1.7482 1.9386 0.5112  0.4979  -0.0653 242 GLY A C   
1433 O O   . GLY A 198 ? 2.5480 1.7138 1.9047 0.4871  0.4980  -0.0674 242 GLY A O   
1434 N N   . SER A 199 ? 2.0682 1.4082 1.5753 0.4962  0.4954  -0.0624 243 SER A N   
1435 C CA  . SER A 199 ? 2.0739 1.4005 1.5400 0.4510  0.4957  -0.0611 243 SER A CA  
1436 C C   . SER A 199 ? 2.0159 1.3928 1.5178 0.4397  0.4692  -0.0484 243 SER A C   
1437 O O   . SER A 199 ? 1.9623 1.4070 1.5370 0.4671  0.4556  -0.0421 243 SER A O   
1438 C CB  . SER A 199 ? 2.0791 1.4513 1.5726 0.4357  0.5300  -0.0731 243 SER A CB  
1439 O OG  . SER A 199 ? 2.0083 1.4933 1.6062 0.4399  0.5329  -0.0731 243 SER A OG  
1440 N N   . CYS A 200 ? 2.2796 1.6237 1.7296 0.4004  0.4599  -0.0456 244 CYS A N   
1441 C CA  . CYS A 200 ? 2.2249 1.6202 1.7084 0.3763  0.4261  -0.0312 244 CYS A CA  
1442 C C   . CYS A 200 ? 2.1537 1.6676 1.7417 0.3880  0.4272  -0.0298 244 CYS A C   
1443 O O   . CYS A 200 ? 2.1043 1.6695 1.7369 0.3885  0.3945  -0.0170 244 CYS A O   
1444 C CB  . CYS A 200 ? 2.2441 1.6096 1.6760 0.3262  0.4151  -0.0312 244 CYS A CB  
1445 S SG  . CYS A 200 ? 2.3100 1.5516 1.6375 0.3021  0.3921  -0.0312 244 CYS A SG  
1446 N N   . LYS A 201 ? 2.0206 1.5751 1.6468 0.3972  0.4662  -0.0443 245 LYS A N   
1447 C CA  . LYS A 201 ? 1.9583 1.6270 1.6947 0.4088  0.4702  -0.0474 245 LYS A CA  
1448 C C   . LYS A 201 ? 1.9327 1.6423 1.7339 0.4587  0.4582  -0.0482 245 LYS A C   
1449 O O   . LYS A 201 ? 1.8762 1.6666 1.7543 0.4716  0.4336  -0.0442 245 LYS A O   
1450 C CB  . LYS A 201 ? 1.9692 1.6727 1.7361 0.3906  0.5084  -0.0609 245 LYS A CB  
1451 C CG  . LYS A 201 ? 1.9662 1.6638 1.7003 0.3437  0.5137  -0.0579 245 LYS A CG  
1452 C CD  . LYS A 201 ? 1.9139 1.7184 1.7490 0.3319  0.5173  -0.0600 245 LYS A CD  
1453 C CE  . LYS A 201 ? 1.9250 1.7167 1.7281 0.2868  0.5352  -0.0599 245 LYS A CE  
1454 N NZ  . LYS A 201 ? 2.0222 1.7197 1.7275 0.2747  0.5567  -0.0629 245 LYS A NZ  
1455 N N   . ALA A 202 ? 1.9335 1.5865 1.7013 0.4830  0.4674  -0.0529 246 ALA A N   
1456 C CA  . ALA A 202 ? 1.9166 1.6020 1.7414 0.5308  0.4538  -0.0548 246 ALA A CA  
1457 C C   . ALA A 202 ? 1.9074 1.5642 1.7063 0.5517  0.4123  -0.0358 246 ALA A C   
1458 O O   . ALA A 202 ? 1.8666 1.5849 1.7308 0.5827  0.3858  -0.0325 246 ALA A O   
1459 C CB  . ALA A 202 ? 1.9707 1.5975 1.7614 0.5498  0.4776  -0.0657 246 ALA A CB  
1460 N N   . ASP A 203 ? 2.1091 1.6688 1.8099 0.5323  0.4057  -0.0242 247 ASP A N   
1461 C CA  . ASP A 203 ? 2.1122 1.6280 1.7738 0.5401  0.3696  -0.0040 247 ASP A CA  
1462 C C   . ASP A 203 ? 2.0655 1.6316 1.7447 0.5016  0.3386  0.0093  247 ASP A C   
1463 O O   . ASP A 203 ? 2.0732 1.5981 1.7093 0.4903  0.3125  0.0271  247 ASP A O   
1464 C CB  . ASP A 203 ? 2.1816 1.5716 1.7398 0.5282  0.3740  0.0009  247 ASP A CB  
1465 C CG  . ASP A 203 ? 2.2109 1.5489 1.7476 0.5675  0.3642  0.0077  247 ASP A CG  
1466 O OD1 . ASP A 203 ? 2.1822 1.5826 1.7845 0.6064  0.3557  0.0054  247 ASP A OD1 
1467 O OD2 . ASP A 203 ? 2.2613 1.4983 1.7188 0.5559  0.3615  0.0148  247 ASP A OD2 
1468 N N   . LEU A 204 ? 1.5998 1.2468 1.3367 0.4783  0.3459  0.0002  248 LEU A N   
1469 C CA  . LEU A 204 ? 1.5530 1.2545 1.3145 0.4457  0.3173  0.0101  248 LEU A CA  
1470 C C   . LEU A 204 ? 1.5245 1.2591 1.3135 0.4746  0.2803  0.0231  248 LEU A C   
1471 O O   . LEU A 204 ? 1.5047 1.2915 1.3542 0.5165  0.2749  0.0162  248 LEU A O   
1472 C CB  . LEU A 204 ? 1.5111 1.2996 1.3432 0.4262  0.3321  -0.0035 248 LEU A CB  
1473 C CG  . LEU A 204 ? 1.4566 1.3060 1.3212 0.3964  0.3022  0.0040  248 LEU A CG  
1474 C CD1 . LEU A 204 ? 1.4820 1.2727 1.2745 0.3524  0.2904  0.0158  248 LEU A CD1 
1475 C CD2 . LEU A 204 ? 1.4063 1.3421 1.3502 0.3825  0.3185  -0.0108 248 LEU A CD2 
1476 N N   . GLY A 205 ? 1.2728 0.9771 1.0175 0.4526  0.2549  0.0409  249 GLY A N   
1477 C CA  . GLY A 205 ? 1.2672 0.9759 1.0087 0.4799  0.2224  0.0564  249 GLY A CA  
1478 C C   . GLY A 205 ? 1.3293 0.9394 1.0001 0.5068  0.2231  0.0699  249 GLY A C   
1479 O O   . GLY A 205 ? 1.3577 0.9393 0.9949 0.5212  0.2006  0.0881  249 GLY A O   
1480 N N   . ALA A 206 ? 1.6827 1.2359 1.3270 0.5159  0.2507  0.0606  250 ALA A N   
1481 C CA  . ALA A 206 ? 1.7394 1.1860 1.3111 0.5372  0.2552  0.0713  250 ALA A CA  
1482 C C   . ALA A 206 ? 1.7741 1.1336 1.2742 0.4903  0.2671  0.0758  250 ALA A C   
1483 O O   . ALA A 206 ? 1.8241 1.0872 1.2625 0.4995  0.2741  0.0821  250 ALA A O   
1484 C CB  . ALA A 206 ? 1.7646 1.1962 1.3509 0.5836  0.2757  0.0562  250 ALA A CB  
1485 N N   . LEU A 207 ? 1.4337 0.8262 0.9449 0.4410  0.2677  0.0710  251 LEU A N   
1486 C CA  . LEU A 207 ? 1.4600 0.7825 0.9162 0.3948  0.2731  0.0714  251 LEU A CA  
1487 C C   . LEU A 207 ? 1.4743 0.7360 0.8866 0.3806  0.2598  0.0925  251 LEU A C   
1488 O O   . LEU A 207 ? 1.4614 0.7455 0.8826 0.3974  0.2449  0.1092  251 LEU A O   
1489 C CB  . LEU A 207 ? 1.4258 0.8038 0.9089 0.3501  0.2704  0.0628  251 LEU A CB  
1490 C CG  . LEU A 207 ? 1.4163 0.8495 0.9376 0.3549  0.2885  0.0438  251 LEU A CG  
1491 C CD1 . LEU A 207 ? 1.4036 0.8565 0.9244 0.3074  0.2853  0.0380  251 LEU A CD1 
1492 C CD2 . LEU A 207 ? 1.4723 0.8433 0.9579 0.3788  0.3157  0.0299  251 LEU A CD2 
1493 N N   . GLU A 208 ? 1.7664 0.9470 1.1293 0.3493  0.2665  0.0905  252 GLU A N   
1494 C CA  . GLU A 208 ? 1.7831 0.8987 1.1079 0.3283  0.2613  0.1082  252 GLU A CA  
1495 C C   . GLU A 208 ? 1.7611 0.8855 1.0942 0.2709  0.2547  0.1029  252 GLU A C   
1496 O O   . GLU A 208 ? 1.7739 0.8847 1.0994 0.2493  0.2571  0.0841  252 GLU A O   
1497 C CB  . GLU A 208 ? 1.8470 0.8512 1.1120 0.3435  0.2738  0.1086  252 GLU A CB  
1498 C CG  . GLU A 208 ? 1.8762 0.8078 1.1008 0.3398  0.2738  0.1319  252 GLU A CG  
1499 C CD  . GLU A 208 ? 1.9641 0.8001 1.1366 0.3632  0.2843  0.1310  252 GLU A CD  
1500 O OE1 . GLU A 208 ? 1.9885 0.8075 1.1530 0.3747  0.2923  0.1100  252 GLU A OE1 
1501 O OE2 . GLU A 208 ? 2.0163 0.8128 1.1617 0.3646  0.2833  0.1481  252 GLU A OE2 
1502 N N   . LEU A 209 ? 1.6067 0.7533 0.9541 0.2483  0.2461  0.1186  253 LEU A N   
1503 C CA  . LEU A 209 ? 1.5802 0.7456 0.9481 0.1968  0.2381  0.1126  253 LEU A CA  
1504 C C   . LEU A 209 ? 1.6162 0.6975 0.9541 0.1651  0.2431  0.1176  253 LEU A C   
1505 O O   . LEU A 209 ? 1.6380 0.6769 0.9539 0.1720  0.2524  0.1375  253 LEU A O   
1506 C CB  . LEU A 209 ? 1.5272 0.7757 0.9384 0.1880  0.2280  0.1226  253 LEU A CB  
1507 C CG  . LEU A 209 ? 1.4979 0.7745 0.9390 0.1392  0.2183  0.1141  253 LEU A CG  
1508 C CD1 . LEU A 209 ? 1.4952 0.7839 0.9416 0.1274  0.2113  0.0915  253 LEU A CD1 
1509 C CD2 . LEU A 209 ? 1.4521 0.8062 0.9334 0.1326  0.2105  0.1229  253 LEU A CD2 
1510 N N   . TRP A 210 ? 1.7518 0.8071 1.0881 0.1298  0.2362  0.0991  254 TRP A N   
1511 C CA  . TRP A 210 ? 1.7909 0.7670 1.1080 0.0955  0.2378  0.0972  254 TRP A CA  
1512 C C   . TRP A 210 ? 1.7664 0.7775 1.1288 0.0456  0.2229  0.0894  254 TRP A C   
1513 O O   . TRP A 210 ? 1.7260 0.8101 1.1229 0.0374  0.2083  0.0805  254 TRP A O   
1514 C CB  . TRP A 210 ? 1.8472 0.7440 1.1177 0.0983  0.2377  0.0773  254 TRP A CB  
1515 C CG  . TRP A 210 ? 1.8831 0.7345 1.1102 0.1463  0.2534  0.0809  254 TRP A CG  
1516 C CD1 . TRP A 210 ? 1.8732 0.7687 1.1026 0.1877  0.2588  0.0766  254 TRP A CD1 
1517 C CD2 . TRP A 210 ? 1.9475 0.6993 1.1264 0.1588  0.2661  0.0874  254 TRP A CD2 
1518 N NE1 . TRP A 210 ? 1.9191 0.7515 1.1078 0.2286  0.2733  0.0797  254 TRP A NE1 
1519 C CE2 . TRP A 210 ? 1.9686 0.7147 1.1237 0.2115  0.2764  0.0864  254 TRP A CE2 
1520 C CE3 . TRP A 210 ? 1.9852 0.6876 1.1588 0.1262  0.2659  0.0901  254 TRP A CE3 
1521 C CZ2 . TRP A 210 ? 2.0426 0.7323 1.1633 0.2332  0.2841  0.0892  254 TRP A CZ2 
1522 C CZ3 . TRP A 210 ? 2.0661 0.7087 1.2024 0.1468  0.2753  0.0935  254 TRP A CZ3 
1523 C CH2 . TRP A 210 ? 2.0950 0.7298 1.2023 0.2002  0.2832  0.0933  254 TRP A CH2 
1524 N N   . ARG A 211 ? 1.6055 0.5614 0.9702 0.0123  0.2269  0.0917  255 ARG A N   
1525 C CA  . ARG A 211 ? 1.5955 0.5780 1.0114 -0.0361 0.2116  0.0803  255 ARG A CA  
1526 C C   . ARG A 211 ? 1.6510 0.5481 1.0530 -0.0682 0.2050  0.0641  255 ARG A C   
1527 O O   . ARG A 211 ? 1.7111 0.5262 1.0721 -0.0608 0.2228  0.0722  255 ARG A O   
1528 C CB  . ARG A 211 ? 1.5705 0.5952 1.0293 -0.0509 0.2265  0.1008  255 ARG A CB  
1529 C CG  . ARG A 211 ? 1.5588 0.6286 1.0860 -0.0967 0.2123  0.0885  255 ARG A CG  
1530 C CD  . ARG A 211 ? 1.5547 0.6455 1.1166 -0.1123 0.2377  0.1091  255 ARG A CD  
1531 N NE  . ARG A 211 ? 1.6011 0.6054 1.1411 -0.1282 0.2634  0.1204  255 ARG A NE  
1532 C CZ  . ARG A 211 ? 1.6138 0.5965 1.1392 -0.1245 0.2975  0.1471  255 ARG A CZ  
1533 N NH1 . ARG A 211 ? 1.5854 0.6278 1.1136 -0.1036 0.3072  0.1636  255 ARG A NH1 
1534 N NH2 . ARG A 211 ? 1.6592 0.5877 1.1748 -0.1369 0.3128  0.1517  255 ARG A NH2 
1535 N N   . THR A 212 ? 1.7754 0.6869 1.2081 -0.1018 0.1765  0.0399  256 THR A N   
1536 C CA  . THR A 212 ? 1.8269 0.6669 1.2624 -0.1396 0.1639  0.0215  256 THR A CA  
1537 C C   . THR A 212 ? 1.8137 0.7084 1.3291 -0.1844 0.1390  0.0071  256 THR A C   
1538 O O   . THR A 212 ? 1.7910 0.7462 1.3274 -0.1845 0.1118  -0.0057 256 THR A O   
1539 C CB  . THR A 212 ? 1.8749 0.6478 1.2452 -0.1275 0.1449  -0.0033 256 THR A CB  
1540 O OG1 . THR A 212 ? 1.9112 0.6470 1.3020 -0.1619 0.1247  -0.0230 256 THR A OG1 
1541 C CG2 . THR A 212 ? 1.8629 0.6804 1.2225 -0.1181 0.1184  -0.0204 256 THR A CG2 
1542 N N   . SER A 213 ? 1.8505 0.7249 1.4136 -0.2210 0.1514  0.0108  257 SER A N   
1543 C CA  . SER A 213 ? 1.8424 0.7690 1.4978 -0.2658 0.1328  -0.0032 257 SER A CA  
1544 C C   . SER A 213 ? 1.8689 0.7694 1.5461 -0.2943 0.0889  -0.0378 257 SER A C   
1545 O O   . SER A 213 ? 1.8539 0.7996 1.5918 -0.3201 0.0553  -0.0582 257 SER A O   
1546 C CB  . SER A 213 ? 1.8405 0.7800 1.5516 -0.2877 0.1692  0.0171  257 SER A CB  
1547 O OG  . SER A 213 ? 1.8109 0.7669 1.4906 -0.2576 0.2070  0.0490  257 SER A OG  
1548 N N   . ASP A 214 ? 2.1202 0.9510 1.7513 -0.2871 0.0883  -0.0442 258 ASP A N   
1549 C CA  . ASP A 214 ? 2.1502 0.9472 1.7978 -0.3108 0.0505  -0.0757 258 ASP A CA  
1550 C C   . ASP A 214 ? 2.1935 0.9574 1.7648 -0.2876 0.0162  -0.0990 258 ASP A C   
1551 O O   . ASP A 214 ? 2.2373 0.9565 1.7960 -0.2972 -0.0093 -0.1230 258 ASP A O   
1552 C CB  . ASP A 214 ? 2.1847 0.9209 1.8294 -0.3200 0.0720  -0.0696 258 ASP A CB  
1553 C CG  . ASP A 214 ? 2.1988 0.8932 1.7648 -0.2807 0.1134  -0.0410 258 ASP A CG  
1554 O OD1 . ASP A 214 ? 2.1852 0.8765 1.6822 -0.2417 0.1153  -0.0371 258 ASP A OD1 
1555 O OD2 . ASP A 214 ? 2.2393 0.9054 1.8145 -0.2876 0.1433  -0.0228 258 ASP A OD2 
1556 N N   . LEU A 215 ? 1.8886 0.6701 1.4046 -0.2554 0.0203  -0.0906 259 LEU A N   
1557 C CA  . LEU A 215 ? 1.9251 0.6767 1.3602 -0.2292 -0.0028 -0.1079 259 LEU A CA  
1558 C C   . LEU A 215 ? 1.9650 0.6420 1.3237 -0.2034 0.0165  -0.1077 259 LEU A C   
1559 O O   . LEU A 215 ? 2.0152 0.6479 1.3296 -0.2014 -0.0078 -0.1308 259 LEU A O   
1560 C CB  . LEU A 215 ? 1.9512 0.7125 1.4099 -0.2524 -0.0573 -0.1402 259 LEU A CB  
1561 C CG  . LEU A 215 ? 1.9183 0.7573 1.4583 -0.2756 -0.0824 -0.1438 259 LEU A CG  
1562 C CD1 . LEU A 215 ? 1.9475 0.7975 1.5193 -0.2956 -0.1383 -0.1766 259 LEU A CD1 
1563 C CD2 . LEU A 215 ? 1.8918 0.7647 1.3938 -0.2494 -0.0743 -0.1294 259 LEU A CD2 
1564 N N   . GLY A 216 ? 2.1169 0.7803 1.4595 -0.1820 0.0593  -0.0816 260 GLY A N   
1565 C CA  . GLY A 216 ? 2.1597 0.7602 1.4275 -0.1483 0.0800  -0.0791 260 GLY A CA  
1566 C C   . GLY A 216 ? 2.2099 0.7527 1.4845 -0.1645 0.0851  -0.0821 260 GLY A C   
1567 O O   . GLY A 216 ? 2.2715 0.7570 1.4859 -0.1380 0.1008  -0.0813 260 GLY A O   
1568 N N   . LYS A 217 ? 2.4074 0.9652 1.7589 -0.2080 0.0729  -0.0863 261 LYS A N   
1569 C CA  . LYS A 217 ? 2.4795 0.9842 1.8475 -0.2270 0.0824  -0.0862 261 LYS A CA  
1570 C C   . LYS A 217 ? 2.4875 0.9758 1.8324 -0.2022 0.1280  -0.0521 261 LYS A C   
1571 O O   . LYS A 217 ? 2.5679 0.9915 1.8722 -0.1897 0.1430  -0.0482 261 LYS A O   
1572 C CB  . LYS A 217 ? 2.4702 1.0047 1.9401 -0.2796 0.0646  -0.0965 261 LYS A CB  
1573 C CG  . LYS A 217 ? 2.4741 1.0268 1.9760 -0.3035 0.0132  -0.1331 261 LYS A CG  
1574 C CD  . LYS A 217 ? 2.4681 1.0536 2.0869 -0.3542 -0.0024 -0.1452 261 LYS A CD  
1575 C CE  . LYS A 217 ? 2.4786 1.0825 2.1325 -0.3748 -0.0569 -0.1855 261 LYS A CE  
1576 N NZ  . LYS A 217 ? 2.4730 1.1179 2.2571 -0.4230 -0.0710 -0.2012 261 LYS A NZ  
1577 N N   . SER A 218 ? 2.4188 0.9654 1.7867 -0.1930 0.1480  -0.0281 262 SER A N   
1578 C CA  . SER A 218 ? 2.4227 0.9624 1.7671 -0.1653 0.1875  0.0050  262 SER A CA  
1579 C C   . SER A 218 ? 2.3375 0.9366 1.6716 -0.1336 0.1992  0.0224  262 SER A C   
1580 O O   . SER A 218 ? 2.2702 0.9276 1.6426 -0.1483 0.1841  0.0160  262 SER A O   
1581 C CB  . SER A 218 ? 2.4389 0.9819 1.8410 -0.1994 0.2070  0.0218  262 SER A CB  
1582 O OG  . SER A 218 ? 2.3594 0.9757 1.8358 -0.2289 0.2020  0.0229  262 SER A OG  
1583 N N   . PHE A 219 ? 2.1133 0.6972 1.3986 -0.0894 0.2240  0.0436  263 PHE A N   
1584 C CA  . PHE A 219 ? 2.0447 0.6818 1.3197 -0.0536 0.2338  0.0594  263 PHE A CA  
1585 C C   . PHE A 219 ? 2.0414 0.6916 1.3163 -0.0349 0.2612  0.0920  263 PHE A C   
1586 O O   . PHE A 219 ? 2.1074 0.7123 1.3713 -0.0401 0.2766  0.1036  263 PHE A O   
1587 C CB  . PHE A 219 ? 2.0630 0.6812 1.2793 -0.0070 0.2326  0.0505  263 PHE A CB  
1588 C CG  . PHE A 219 ? 2.0676 0.6785 1.2703 -0.0181 0.2079  0.0201  263 PHE A CG  
1589 C CD1 . PHE A 219 ? 2.0030 0.6666 1.2180 -0.0173 0.1958  0.0129  263 PHE A CD1 
1590 C CD2 . PHE A 219 ? 2.1599 0.7079 1.3322 -0.0285 0.1959  -0.0013 263 PHE A CD2 
1591 C CE1 . PHE A 219 ? 2.0264 0.6787 1.2182 -0.0259 0.1724  -0.0145 263 PHE A CE1 
1592 C CE2 . PHE A 219 ? 2.1749 0.7139 1.3251 -0.0365 0.1713  -0.0291 263 PHE A CE2 
1593 C CZ  . PHE A 219 ? 2.1073 0.6979 1.2646 -0.0347 0.1597  -0.0352 263 PHE A CZ  
1594 N N   . LYS A 220 ? 2.1819 0.8917 1.4649 -0.0122 0.2659  0.1062  264 LYS A N   
1595 C CA  . LYS A 220 ? 2.1786 0.9057 1.4527 0.0124  0.2864  0.1355  264 LYS A CA  
1596 C C   . LYS A 220 ? 2.1319 0.9040 1.3888 0.0608  0.2836  0.1431  264 LYS A C   
1597 O O   . LYS A 220 ? 2.0848 0.9037 1.3639 0.0578  0.2713  0.1330  264 LYS A O   
1598 C CB  . LYS A 220 ? 2.1430 0.9106 1.4691 -0.0260 0.2961  0.1468  264 LYS A CB  
1599 C CG  . LYS A 220 ? 2.1059 0.9224 1.4290 -0.0006 0.3091  0.1716  264 LYS A CG  
1600 C CD  . LYS A 220 ? 2.1758 0.9487 1.4509 0.0268  0.3277  0.1934  264 LYS A CD  
1601 C CE  . LYS A 220 ? 2.1513 0.9675 1.4309 0.0334  0.3417  0.2153  264 LYS A CE  
1602 N NZ  . LYS A 220 ? 2.1202 0.9692 1.4590 -0.0180 0.3540  0.2138  264 LYS A NZ  
1603 N N   . THR A 221 ? 2.1426 0.9005 1.3622 0.1058  0.2930  0.1602  265 THR A N   
1604 C CA  . THR A 221 ? 2.0990 0.9061 1.3133 0.1533  0.2876  0.1669  265 THR A CA  
1605 C C   . THR A 221 ? 2.0552 0.9171 1.2889 0.1531  0.2909  0.1877  265 THR A C   
1606 O O   . THR A 221 ? 2.0957 0.9384 1.3083 0.1597  0.3014  0.2057  265 THR A O   
1607 C CB  . THR A 221 ? 2.1593 0.9324 1.3308 0.2072  0.2899  0.1712  265 THR A CB  
1608 O OG1 . THR A 221 ? 2.1822 0.9288 1.3414 0.2176  0.2866  0.1485  265 THR A OG1 
1609 C CG2 . THR A 221 ? 2.1119 0.9440 1.2890 0.2552  0.2832  0.1843  265 THR A CG2 
1610 N N   . ILE A 222 ? 1.7633 0.7019 1.0397 0.1421  0.2801  0.1811  266 ILE A N   
1611 C CA  . ILE A 222 ? 1.7301 0.7357 1.0314 0.1400  0.2799  0.1951  266 ILE A CA  
1612 C C   . ILE A 222 ? 1.7038 0.7756 1.0086 0.1874  0.2657  0.1978  266 ILE A C   
1613 O O   . ILE A 222 ? 1.6856 0.8065 1.0004 0.1934  0.2628  0.2091  266 ILE A O   
1614 C CB  . ILE A 222 ? 1.6874 0.7603 1.0508 0.0938  0.2714  0.1801  266 ILE A CB  
1615 C CG1 . ILE A 222 ? 1.6555 0.7781 1.0465 0.0951  0.2502  0.1542  266 ILE A CG1 
1616 C CG2 . ILE A 222 ? 1.7162 0.7332 1.0894 0.0452  0.2844  0.1785  266 ILE A CG2 
1617 C CD1 . ILE A 222 ? 1.6188 0.8027 1.0651 0.0552  0.2363  0.1387  266 ILE A CD1 
1618 N N   . GLY A 223 ? 1.8422 0.9157 1.1413 0.2212  0.2575  0.1860  267 GLY A N   
1619 C CA  . GLY A 223 ? 1.8159 0.9617 1.1350 0.2630  0.2428  0.1844  267 GLY A CA  
1620 C C   . GLY A 223 ? 1.8439 0.9645 1.1453 0.3104  0.2418  0.1785  267 GLY A C   
1621 O O   . GLY A 223 ? 1.8754 0.9353 1.1551 0.3073  0.2517  0.1682  267 GLY A O   
1622 N N   . VAL A 224 ? 1.8055 0.9735 1.1185 0.3557  0.2284  0.1830  268 VAL A N   
1623 C CA  . VAL A 224 ? 1.8234 0.9865 1.1372 0.4061  0.2257  0.1749  268 VAL A CA  
1624 C C   . VAL A 224 ? 1.7821 1.0501 1.1527 0.4358  0.2054  0.1675  268 VAL A C   
1625 O O   . VAL A 224 ? 1.7549 1.0760 1.1430 0.4231  0.1923  0.1738  268 VAL A O   
1626 C CB  . VAL A 224 ? 1.8863 0.9507 1.1333 0.4435  0.2296  0.1946  268 VAL A CB  
1627 C CG1 . VAL A 224 ? 1.8991 0.9786 1.1275 0.4754  0.2115  0.2153  268 VAL A CG1 
1628 C CG2 . VAL A 224 ? 1.9273 0.9667 1.1736 0.4874  0.2333  0.1815  268 VAL A CG2 
1629 N N   . LYS A 225 ? 1.8039 1.1023 1.2072 0.4738  0.2042  0.1523  269 LYS A N   
1630 C CA  . LYS A 225 ? 1.7603 1.1651 1.2339 0.4976  0.1865  0.1401  269 LYS A CA  
1631 C C   . LYS A 225 ? 1.7099 1.1914 1.2324 0.4514  0.1871  0.1278  269 LYS A C   
1632 O O   . LYS A 225 ? 1.6747 1.2328 1.2390 0.4531  0.1679  0.1260  269 LYS A O   
1633 C CB  . LYS A 225 ? 1.7666 1.1869 1.2294 0.5336  0.1580  0.1561  269 LYS A CB  
1634 C CG  . LYS A 225 ? 1.8042 1.1833 1.2441 0.5966  0.1466  0.1625  269 LYS A CG  
1635 C CD  . LYS A 225 ? 1.7664 1.2346 1.2903 0.6358  0.1344  0.1400  269 LYS A CD  
1636 C CE  . LYS A 225 ? 1.8132 1.2641 1.3248 0.6911  0.1091  0.1450  269 LYS A CE  
1637 N NZ  . LYS A 225 ? 1.7834 1.3302 1.3913 0.7251  0.0940  0.1205  269 LYS A NZ  
1638 N N   . ILE A 226 ? 1.3886 0.8445 0.9020 0.4113  0.2064  0.1186  270 ILE A N   
1639 C CA  . ILE A 226 ? 1.3481 0.8598 0.8943 0.3659  0.2048  0.1102  270 ILE A CA  
1640 C C   . ILE A 226 ? 1.3181 0.9041 0.9241 0.3688  0.2108  0.0895  270 ILE A C   
1641 O O   . ILE A 226 ? 1.3379 0.9061 0.9448 0.3830  0.2300  0.0769  270 ILE A O   
1642 C CB  . ILE A 226 ? 1.3630 0.8143 0.8719 0.3198  0.2165  0.1093  270 ILE A CB  
1643 C CG1 . ILE A 226 ? 1.3923 0.7682 0.8491 0.3124  0.2165  0.1295  270 ILE A CG1 
1644 C CG2 . ILE A 226 ? 1.3208 0.8299 0.8634 0.2781  0.2096  0.1020  270 ILE A CG2 
1645 C CD1 . ILE A 226 ? 1.3718 0.7837 0.8359 0.3079  0.2031  0.1449  270 ILE A CD1 
1646 N N   . TYR A 227 ? 1.1885 0.8559 0.8442 0.3579  0.1964  0.0862  271 TYR A N   
1647 C CA  . TYR A 227 ? 1.1566 0.8916 0.8684 0.3465  0.2053  0.0679  271 TYR A CA  
1648 C C   . TYR A 227 ? 1.1573 0.8735 0.8492 0.2978  0.2150  0.0631  271 TYR A C   
1649 O O   . TYR A 227 ? 1.1732 0.8770 0.8611 0.2883  0.2355  0.0506  271 TYR A O   
1650 C CB  . TYR A 227 ? 1.1104 0.9356 0.8842 0.3552  0.1835  0.0648  271 TYR A CB  
1651 C CG  . TYR A 227 ? 1.0745 0.9737 0.9166 0.3461  0.1943  0.0461  271 TYR A CG  
1652 C CD1 . TYR A 227 ? 1.0525 0.9756 0.9049 0.3038  0.1969  0.0415  271 TYR A CD1 
1653 C CD2 . TYR A 227 ? 1.0640 1.0096 0.9643 0.3802  0.2025  0.0329  271 TYR A CD2 
1654 C CE1 . TYR A 227 ? 1.0276 1.0107 0.9379 0.2931  0.2100  0.0262  271 TYR A CE1 
1655 C CE2 . TYR A 227 ? 1.0343 1.0484 1.0032 0.3682  0.2177  0.0158  271 TYR A CE2 
1656 C CZ  . TYR A 227 ? 1.0196 1.0481 0.9888 0.3232  0.2225  0.0136  271 TYR A CZ  
1657 O OH  . TYR A 227 ? 1.0006 1.0876 1.0312 0.3079  0.2409  -0.0013 271 TYR A OH  
1658 N N   . SER A 228 ? 1.2731 0.9818 0.9480 0.2687  0.2003  0.0730  272 SER A N   
1659 C CA  . SER A 228 ? 1.2683 0.9674 0.9330 0.2259  0.2026  0.0672  272 SER A CA  
1660 C C   . SER A 228 ? 1.2579 0.9326 0.9009 0.1995  0.1890  0.0791  272 SER A C   
1661 O O   . SER A 228 ? 1.2581 0.9270 0.8927 0.2134  0.1815  0.0929  272 SER A O   
1662 C CB  . SER A 228 ? 1.2326 1.0065 0.9484 0.2140  0.2008  0.0565  272 SER A CB  
1663 O OG  . SER A 228 ? 1.2392 0.9954 0.9376 0.1779  0.2032  0.0504  272 SER A OG  
1664 N N   . PHE A 229 ? 1.2642 0.9248 0.8988 0.1627  0.1860  0.0736  273 PHE A N   
1665 C CA  . PHE A 229 ? 1.2473 0.8955 0.8770 0.1360  0.1749  0.0819  273 PHE A CA  
1666 C C   . PHE A 229 ? 1.2245 0.8899 0.8683 0.1007  0.1643  0.0722  273 PHE A C   
1667 O O   . PHE A 229 ? 1.2280 0.8943 0.8677 0.0948  0.1667  0.0604  273 PHE A O   
1668 C CB  . PHE A 229 ? 1.2831 0.8521 0.8710 0.1316  0.1819  0.0891  273 PHE A CB  
1669 C CG  . PHE A 229 ? 1.3069 0.8223 0.8690 0.1073  0.1822  0.0767  273 PHE A CG  
1670 C CD1 . PHE A 229 ? 1.3454 0.8208 0.8764 0.1226  0.1935  0.0668  273 PHE A CD1 
1671 C CD2 . PHE A 229 ? 1.3025 0.8057 0.8712 0.0708  0.1699  0.0735  273 PHE A CD2 
1672 C CE1 . PHE A 229 ? 1.3800 0.7976 0.8756 0.1016  0.1908  0.0536  273 PHE A CE1 
1673 C CE2 . PHE A 229 ? 1.3336 0.7852 0.8765 0.0497  0.1629  0.0597  273 PHE A CE2 
1674 C CZ  . PHE A 229 ? 1.3727 0.7777 0.8732 0.0650  0.1725  0.0498  273 PHE A CZ  
1675 N N   . GLY A 230 ? 1.1536 0.8308 0.8125 0.0794  0.1538  0.0775  274 GLY A N   
1676 C CA  . GLY A 230 ? 1.1395 0.8346 0.8166 0.0497  0.1396  0.0685  274 GLY A CA  
1677 C C   . GLY A 230 ? 1.1482 0.8467 0.8446 0.0286  0.1329  0.0741  274 GLY A C   
1678 O O   . GLY A 230 ? 1.1585 0.8564 0.8545 0.0378  0.1423  0.0869  274 GLY A O   
1679 N N   . LEU A 231 ? 1.0067 0.7064 0.7188 0.0015  0.1175  0.0642  275 LEU A N   
1680 C CA  . LEU A 231 ? 1.0285 0.7404 0.7739 -0.0207 0.1115  0.0656  275 LEU A CA  
1681 C C   . LEU A 231 ? 1.0124 0.7810 0.7941 -0.0277 0.0975  0.0601  275 LEU A C   
1682 O O   . LEU A 231 ? 0.9907 0.7683 0.7689 -0.0300 0.0838  0.0507  275 LEU A O   
1683 C CB  . LEU A 231 ? 1.0655 0.7314 0.8102 -0.0464 0.1003  0.0559  275 LEU A CB  
1684 C CG  . LEU A 231 ? 1.0873 0.6849 0.7891 -0.0419 0.1105  0.0567  275 LEU A CG  
1685 C CD1 . LEU A 231 ? 1.1378 0.6912 0.8439 -0.0704 0.0944  0.0437  275 LEU A CD1 
1686 C CD2 . LEU A 231 ? 1.0858 0.6705 0.7788 -0.0276 0.1352  0.0744  275 LEU A CD2 
1687 N N   . GLY A 232 ? 1.0432 0.8442 0.8545 -0.0304 0.1031  0.0663  276 GLY A N   
1688 C CA  . GLY A 232 ? 1.0332 0.8781 0.8839 -0.0420 0.0887  0.0584  276 GLY A CA  
1689 C C   . GLY A 232 ? 1.0624 0.9218 0.9454 -0.0521 0.1012  0.0634  276 GLY A C   
1690 O O   . GLY A 232 ? 1.0716 0.9201 0.9375 -0.0419 0.1236  0.0768  276 GLY A O   
1691 N N   . GLY A 233 ? 0.9132 0.7968 0.8416 -0.0698 0.0875  0.0527  277 GLY A N   
1692 C CA  . GLY A 233 ? 0.9254 0.8243 0.8969 -0.0836 0.1024  0.0540  277 GLY A CA  
1693 C C   . GLY A 233 ? 0.9711 0.8242 0.9315 -0.0940 0.1231  0.0627  277 GLY A C   
1694 O O   . GLY A 233 ? 0.9922 0.8048 0.9359 -0.1020 0.1123  0.0581  277 GLY A O   
1695 N N   . ARG A 234 ? 1.1909 1.0438 1.1524 -0.0928 0.1548  0.0756  278 ARG A N   
1696 C CA  . ARG A 234 ? 1.2131 1.0162 1.1590 -0.1027 0.1815  0.0874  278 ARG A CA  
1697 C C   . ARG A 234 ? 1.2149 0.9731 1.0881 -0.0777 0.1919  0.1033  278 ARG A C   
1698 O O   . ARG A 234 ? 1.2325 0.9396 1.0803 -0.0815 0.2153  0.1159  278 ARG A O   
1699 C CB  . ARG A 234 ? 1.2009 1.0158 1.1720 -0.1118 0.2167  0.0963  278 ARG A CB  
1700 C CG  . ARG A 234 ? 1.1843 1.0438 1.2400 -0.1369 0.2128  0.0802  278 ARG A CG  
1701 C CD  . ARG A 234 ? 1.1634 1.0355 1.2411 -0.1434 0.2561  0.0893  278 ARG A CD  
1702 N NE  . ARG A 234 ? 1.1360 1.0244 1.1655 -0.1142 0.2664  0.0990  278 ARG A NE  
1703 C CZ  . ARG A 234 ? 1.1575 1.0102 1.1226 -0.0985 0.2990  0.1195  278 ARG A CZ  
1704 N NH1 . ARG A 234 ? 1.2020 0.9978 1.1429 -0.1099 0.3289  0.1347  278 ARG A NH1 
1705 N NH2 . ARG A 234 ? 1.1372 1.0060 1.0586 -0.0711 0.3002  0.1242  278 ARG A NH2 
1706 N N   . PHE A 235 ? 1.0413 0.8181 0.8847 -0.0520 0.1756  0.1025  279 PHE A N   
1707 C CA  . PHE A 235 ? 1.0317 0.7791 0.8162 -0.0222 0.1839  0.1164  279 PHE A CA  
1708 C C   . PHE A 235 ? 1.0297 0.7396 0.7870 -0.0150 0.1731  0.1124  279 PHE A C   
1709 O O   . PHE A 235 ? 1.0207 0.7432 0.7922 -0.0222 0.1527  0.0975  279 PHE A O   
1710 C CB  . PHE A 235 ? 1.0009 0.7944 0.7750 0.0041  0.1744  0.1169  279 PHE A CB  
1711 C CG  . PHE A 235 ? 0.9923 0.8219 0.7861 0.0006  0.1828  0.1176  279 PHE A CG  
1712 C CD1 . PHE A 235 ? 1.0131 0.8169 0.7881 -0.0011 0.2123  0.1320  279 PHE A CD1 
1713 C CD2 . PHE A 235 ? 0.9598 0.8435 0.7856 -0.0002 0.1642  0.1041  279 PHE A CD2 
1714 C CE1 . PHE A 235 ? 1.0026 0.8361 0.7904 -0.0027 0.2246  0.1317  279 PHE A CE1 
1715 C CE2 . PHE A 235 ? 0.9410 0.8548 0.7824 -0.0013 0.1730  0.1029  279 PHE A CE2 
1716 C CZ  . PHE A 235 ? 0.9639 0.8537 0.7861 -0.0019 0.2040  0.1161  279 PHE A CZ  
1717 N N   . LEU A 236 ? 1.2197 0.8777 0.9317 0.0013  0.1885  0.1259  280 LEU A N   
1718 C CA  . LEU A 236 ? 1.2106 0.8366 0.8904 0.0194  0.1818  0.1230  280 LEU A CA  
1719 C C   . LEU A 236 ? 1.1944 0.8409 0.8489 0.0586  0.1806  0.1312  280 LEU A C   
1720 O O   . LEU A 236 ? 1.2144 0.8429 0.8393 0.0767  0.1926  0.1474  280 LEU A O   
1721 C CB  . LEU A 236 ? 1.2437 0.7918 0.8928 0.0124  0.1966  0.1295  280 LEU A CB  
1722 C CG  . LEU A 236 ? 1.2488 0.7507 0.8525 0.0402  0.1978  0.1311  280 LEU A CG  
1723 C CD1 . LEU A 236 ? 1.2300 0.7429 0.8400 0.0388  0.1812  0.1118  280 LEU A CD1 
1724 C CD2 . LEU A 236 ? 1.2918 0.7092 0.8616 0.0328  0.2150  0.1400  280 LEU A CD2 
1725 N N   . PHE A 237 ? 1.1454 0.8288 0.8121 0.0714  0.1657  0.1194  281 PHE A N   
1726 C CA  . PHE A 237 ? 1.1321 0.8461 0.7914 0.1071  0.1602  0.1224  281 PHE A CA  
1727 C C   . PHE A 237 ? 1.1403 0.8219 0.7772 0.1313  0.1639  0.1209  281 PHE A C   
1728 O O   . PHE A 237 ? 1.1375 0.7982 0.7742 0.1190  0.1656  0.1100  281 PHE A O   
1729 C CB  . PHE A 237 ? 1.0974 0.8823 0.7966 0.1043  0.1443  0.1092  281 PHE A CB  
1730 C CG  . PHE A 237 ? 1.0940 0.9140 0.8136 0.0892  0.1397  0.1096  281 PHE A CG  
1731 C CD1 . PHE A 237 ? 1.1058 0.9350 0.8083 0.1073  0.1413  0.1200  281 PHE A CD1 
1732 C CD2 . PHE A 237 ? 1.0854 0.9261 0.8369 0.0598  0.1328  0.0987  281 PHE A CD2 
1733 C CE1 . PHE A 237 ? 1.1027 0.9608 0.8195 0.0951  0.1406  0.1189  281 PHE A CE1 
1734 C CE2 . PHE A 237 ? 1.0839 0.9576 0.8575 0.0487  0.1301  0.0975  281 PHE A CE2 
1735 C CZ  . PHE A 237 ? 1.0876 0.9702 0.8440 0.0659  0.1361  0.1072  281 PHE A CZ  
1736 N N   . ALA A 238 ? 1.1703 0.8448 0.7856 0.1679  0.1642  0.1307  282 ALA A N   
1737 C CA  . ALA A 238 ? 1.1852 0.8389 0.7887 0.1974  0.1671  0.1274  282 ALA A CA  
1738 C C   . ALA A 238 ? 1.1839 0.8847 0.8023 0.2372  0.1536  0.1277  282 ALA A C   
1739 O O   . ALA A 238 ? 1.2005 0.9007 0.7986 0.2537  0.1455  0.1401  282 ALA A O   
1740 C CB  . ALA A 238 ? 1.2287 0.7953 0.7815 0.2044  0.1816  0.1398  282 ALA A CB  
1741 N N   . SER A 239 ? 1.1280 0.8685 0.7817 0.2528  0.1511  0.1132  283 SER A N   
1742 C CA  . SER A 239 ? 1.1242 0.9129 0.8043 0.2924  0.1355  0.1102  283 SER A CA  
1743 C C   . SER A 239 ? 1.1584 0.8998 0.8119 0.3319  0.1407  0.1159  283 SER A C   
1744 O O   . SER A 239 ? 1.1709 0.8763 0.8164 0.3307  0.1589  0.1101  283 SER A O   
1745 C CB  . SER A 239 ? 1.0814 0.9482 0.8284 0.2881  0.1318  0.0903  283 SER A CB  
1746 O OG  . SER A 239 ? 1.0800 0.9332 0.8354 0.2756  0.1531  0.0794  283 SER A OG  
1747 N N   . VAL A 240 ? 1.2472 0.9829 0.8806 0.3690  0.1234  0.1269  284 VAL A N   
1748 C CA  . VAL A 240 ? 1.2874 0.9650 0.8835 0.4107  0.1247  0.1363  284 VAL A CA  
1749 C C   . VAL A 240 ? 1.2791 1.0111 0.9176 0.4607  0.1012  0.1271  284 VAL A C   
1750 O O   . VAL A 240 ? 1.2650 1.0524 0.9269 0.4718  0.0744  0.1242  284 VAL A O   
1751 C CB  . VAL A 240 ? 1.3352 0.9334 0.8525 0.4157  0.1252  0.1617  284 VAL A CB  
1752 C CG1 . VAL A 240 ? 1.3815 0.9001 0.8509 0.4518  0.1320  0.1725  284 VAL A CG1 
1753 C CG2 . VAL A 240 ? 1.3320 0.8951 0.8267 0.3632  0.1458  0.1683  284 VAL A CG2 
1754 N N   . MET A 241 ? 1.5585 1.2738 1.2087 0.4918  0.1099  0.1206  285 MET A N   
1755 C CA  . MET A 241 ? 1.5451 1.3160 1.2491 0.5417  0.0884  0.1088  285 MET A CA  
1756 C C   . MET A 241 ? 1.5856 1.3213 1.2413 0.5885  0.0571  0.1253  285 MET A C   
1757 O O   . MET A 241 ? 1.6382 1.2782 1.2113 0.5980  0.0648  0.1465  285 MET A O   
1758 C CB  . MET A 241 ? 1.5486 1.3069 1.2781 0.5635  0.1116  0.0965  285 MET A CB  
1759 C CG  . MET A 241 ? 1.5057 1.3286 1.3062 0.5365  0.1354  0.0736  285 MET A CG  
1760 S SD  . MET A 241 ? 1.4474 1.4009 1.3668 0.5581  0.1139  0.0504  285 MET A SD  
1761 C CE  . MET A 241 ? 1.4026 1.4094 1.3530 0.4929  0.1255  0.0418  285 MET A CE  
1762 N N   . ALA A 242 ? 1.5118 1.3206 1.2167 0.6178  0.0209  0.1150  286 ALA A N   
1763 C CA  . ALA A 242 ? 1.5536 1.3320 1.2152 0.6726  -0.0159 0.1270  286 ALA A CA  
1764 C C   . ALA A 242 ? 1.5816 1.3072 1.2287 0.7101  -0.0079 0.1291  286 ALA A C   
1765 O O   . ALA A 242 ? 1.5516 1.3123 1.2648 0.7159  0.0110  0.1112  286 ALA A O   
1766 C CB  . ALA A 242 ? 1.5201 1.3970 1.2550 0.6982  -0.0608 0.1077  286 ALA A CB  
1767 N N   . ASP A 243 ? 2.1529 1.7940 1.7127 0.7256  -0.0180 0.1486  287 ASP A N   
1768 C CA  . ASP A 243 ? 2.2232 1.8149 1.7675 0.7559  -0.0149 0.1490  287 ASP A CA  
1769 C C   . ASP A 243 ? 2.2166 1.8951 1.8523 0.7937  -0.0489 0.1254  287 ASP A C   
1770 O O   . ASP A 243 ? 2.2352 1.9221 1.9162 0.8148  -0.0390 0.1132  287 ASP A O   
1771 C CB  . ASP A 243 ? 2.3311 1.8166 1.7623 0.7637  -0.0201 0.1744  287 ASP A CB  
1772 C CG  . ASP A 243 ? 2.3413 1.7423 1.6934 0.7207  0.0170  0.1961  287 ASP A CG  
1773 O OD1 . ASP A 243 ? 2.3294 1.6950 1.6833 0.7001  0.0518  0.1953  287 ASP A OD1 
1774 O OD2 . ASP A 243 ? 2.3656 1.7363 1.6567 0.7054  0.0119  0.2119  287 ASP A OD2 
1775 N N   . LYS A 244 ? 2.0360 1.7796 1.7016 0.7992  -0.0883 0.1178  288 LYS A N   
1776 C CA  . LYS A 244 ? 2.0422 1.8665 1.7928 0.8318  -0.1292 0.0959  288 LYS A CA  
1777 C C   . LYS A 244 ? 1.9429 1.8873 1.8306 0.8196  -0.1239 0.0663  288 LYS A C   
1778 O O   . LYS A 244 ? 1.9500 1.9660 1.9295 0.8429  -0.1485 0.0456  288 LYS A O   
1779 C CB  . LYS A 244 ? 2.0796 1.9071 1.7880 0.8406  -0.1764 0.1002  288 LYS A CB  
1780 C CG  . LYS A 244 ? 2.0016 1.8689 1.7114 0.8036  -0.1773 0.0986  288 LYS A CG  
1781 C CD  . LYS A 244 ? 2.0498 1.9108 1.7072 0.8119  -0.2213 0.1010  288 LYS A CD  
1782 C CE  . LYS A 244 ? 2.0581 2.0024 1.8032 0.8388  -0.2711 0.0750  288 LYS A CE  
1783 N NZ  . LYS A 244 ? 2.1143 2.0458 1.8006 0.8463  -0.3144 0.0751  288 LYS A NZ  
1784 N N   . ASP A 245 ? 1.9131 1.8781 1.8170 0.7819  -0.0897 0.0643  289 ASP A N   
1785 C CA  . ASP A 245 ? 1.8317 1.9108 1.8509 0.7613  -0.0894 0.0385  289 ASP A CA  
1786 C C   . ASP A 245 ? 1.7949 1.8862 1.8423 0.7287  -0.0355 0.0326  289 ASP A C   
1787 O O   . ASP A 245 ? 1.8270 1.8380 1.8086 0.7234  0.0007  0.0467  289 ASP A O   
1788 C CB  . ASP A 245 ? 1.8183 1.9298 1.8238 0.7444  -0.1244 0.0392  289 ASP A CB  
1789 C CG  . ASP A 245 ? 1.7602 1.9921 1.8912 0.7338  -0.1463 0.0092  289 ASP A CG  
1790 O OD1 . ASP A 245 ? 1.7117 2.0064 1.9393 0.7210  -0.1164 -0.0097 289 ASP A OD1 
1791 O OD2 . ASP A 245 ? 1.7682 2.0266 1.8975 0.7356  -0.1910 0.0043  289 ASP A OD2 
1792 N N   . THR A 246 ? 1.7949 1.9840 1.9402 0.7054  -0.0302 0.0105  290 THR A N   
1793 C CA  . THR A 246 ? 1.7696 1.9717 1.9333 0.6613  0.0183  0.0050  290 THR A CA  
1794 C C   . THR A 246 ? 1.7666 1.9578 1.8829 0.6089  0.0145  0.0153  290 THR A C   
1795 O O   . THR A 246 ? 1.7534 1.9370 1.8637 0.5604  0.0496  0.0146  290 THR A O   
1796 C CB  . THR A 246 ? 1.7148 2.0234 2.0103 0.6538  0.0350  -0.0248 290 THR A CB  
1797 O OG1 . THR A 246 ? 1.6851 2.0775 2.0472 0.6437  -0.0038 -0.0384 290 THR A OG1 
1798 C CG2 . THR A 246 ? 1.7172 2.0408 2.0719 0.6880  0.0379  -0.0377 290 THR A CG2 
1799 N N   . THR A 247 ? 1.0473 1.2363 1.1282 0.6206  -0.0287 0.0239  291 THR A N   
1800 C CA  . THR A 247 ? 1.0473 1.2266 1.0848 0.5742  -0.0310 0.0324  291 THR A CA  
1801 C C   . THR A 247 ? 1.0897 1.1691 1.0243 0.5482  -0.0017 0.0570  291 THR A C   
1802 O O   . THR A 247 ? 1.1339 1.1372 1.0066 0.5731  0.0065  0.0727  291 THR A O   
1803 C CB  . THR A 247 ? 1.0634 1.2584 1.0786 0.5939  -0.0823 0.0344  291 THR A CB  
1804 O OG1 . THR A 247 ? 1.1282 1.2446 1.0549 0.6378  -0.1013 0.0555  291 THR A OG1 
1805 C CG2 . THR A 247 ? 1.0136 1.3136 1.1397 0.6152  -0.1179 0.0061  291 THR A CG2 
1806 N N   . ARG A 248 ? 0.9692 1.0492 0.8901 0.4975  0.0132  0.0591  292 ARG A N   
1807 C CA  . ARG A 248 ? 1.0037 0.9994 0.8395 0.4692  0.0363  0.0797  292 ARG A CA  
1808 C C   . ARG A 248 ? 1.0079 1.0061 0.8128 0.4402  0.0242  0.0867  292 ARG A C   
1809 O O   . ARG A 248 ? 0.9790 1.0445 0.8304 0.4337  0.0026  0.0729  292 ARG A O   
1810 C CB  . ARG A 248 ? 0.9871 0.9668 0.8343 0.4339  0.0760  0.0741  292 ARG A CB  
1811 C CG  . ARG A 248 ? 0.9368 0.9839 0.8462 0.3952  0.0842  0.0570  292 ARG A CG  
1812 C CD  . ARG A 248 ? 0.9319 0.9629 0.8519 0.3742  0.1211  0.0490  292 ARG A CD  
1813 N NE  . ARG A 248 ? 0.8983 0.9704 0.8532 0.3324  0.1311  0.0381  292 ARG A NE  
1814 C CZ  . ARG A 248 ? 0.8660 1.0103 0.8972 0.3290  0.1349  0.0203  292 ARG A CZ  
1815 N NH1 . ARG A 248 ? 0.8552 1.0493 0.9481 0.3647  0.1289  0.0087  292 ARG A NH1 
1816 N NH2 . ARG A 248 ? 0.8480 1.0140 0.8968 0.2896  0.1452  0.0138  292 ARG A NH2 
1817 N N   . ARG A 249 ? 1.1947 1.1191 0.9245 0.4219  0.0399  0.1065  293 ARG A N   
1818 C CA  . ARG A 249 ? 1.2023 1.1272 0.9048 0.3942  0.0351  0.1125  293 ARG A CA  
1819 C C   . ARG A 249 ? 1.2133 1.0778 0.8724 0.3547  0.0662  0.1257  293 ARG A C   
1820 O O   . ARG A 249 ? 1.2333 1.0335 0.8570 0.3564  0.0859  0.1364  293 ARG A O   
1821 C CB  . ARG A 249 ? 1.2490 1.1528 0.8977 0.4290  0.0076  0.1240  293 ARG A CB  
1822 C CG  . ARG A 249 ? 1.3038 1.1147 0.8694 0.4533  0.0174  0.1483  293 ARG A CG  
1823 C CD  . ARG A 249 ? 1.3528 1.1440 0.8611 0.4928  -0.0138 0.1581  293 ARG A CD  
1824 N NE  . ARG A 249 ? 1.3405 1.1862 0.8656 0.4774  -0.0326 0.1466  293 ARG A NE  
1825 C CZ  . ARG A 249 ? 1.3534 1.2393 0.8856 0.5090  -0.0750 0.1355  293 ARG A CZ  
1826 N NH1 . ARG A 249 ? 1.3769 1.2587 0.9044 0.5607  -0.1060 0.1348  293 ARG A NH1 
1827 N NH2 . ARG A 249 ? 1.3439 1.2725 0.8880 0.4903  -0.0889 0.1237  293 ARG A NH2 
1828 N N   . ILE A 250 ? 1.1120 0.9987 0.7791 0.3195  0.0686  0.1228  294 ILE A N   
1829 C CA  . ILE A 250 ? 1.1121 0.9551 0.7538 0.2809  0.0934  0.1317  294 ILE A CA  
1830 C C   . ILE A 250 ? 1.1562 0.9246 0.7257 0.2852  0.1066  0.1547  294 ILE A C   
1831 O O   . ILE A 250 ? 1.1860 0.9471 0.7175 0.3040  0.0962  0.1639  294 ILE A O   
1832 C CB  . ILE A 250 ? 1.0804 0.9713 0.7557 0.2465  0.0904  0.1212  294 ILE A CB  
1833 C CG1 . ILE A 250 ? 1.0385 0.9902 0.7788 0.2352  0.0839  0.1007  294 ILE A CG1 
1834 C CG2 . ILE A 250 ? 1.0772 0.9291 0.7365 0.2095  0.1123  0.1284  294 ILE A CG2 
1835 C CD1 . ILE A 250 ? 1.0251 0.9519 0.7737 0.2183  0.1032  0.0970  294 ILE A CD1 
1836 N N   . HIS A 251 ? 1.3180 1.0263 0.8656 0.2674  0.1305  0.1634  295 HIS A N   
1837 C CA  . HIS A 251 ? 1.3545 0.9943 0.8476 0.2553  0.1518  0.1833  295 HIS A CA  
1838 C C   . HIS A 251 ? 1.3296 0.9748 0.8536 0.2056  0.1687  0.1773  295 HIS A C   
1839 O O   . HIS A 251 ? 1.2944 0.9648 0.8610 0.1860  0.1656  0.1617  295 HIS A O   
1840 C CB  . HIS A 251 ? 1.3952 0.9537 0.8390 0.2747  0.1645  0.1979  295 HIS A CB  
1841 C CG  . HIS A 251 ? 1.4300 0.9729 0.8357 0.3279  0.1460  0.2066  295 HIS A CG  
1842 N ND1 . HIS A 251 ? 1.4972 0.9651 0.8245 0.3506  0.1530  0.2304  295 HIS A ND1 
1843 C CD2 . HIS A 251 ? 1.4102 1.0018 0.8469 0.3639  0.1198  0.1941  295 HIS A CD2 
1844 C CE1 . HIS A 251 ? 1.5182 0.9871 0.8253 0.4014  0.1268  0.2323  295 HIS A CE1 
1845 N NE2 . HIS A 251 ? 1.4631 1.0113 0.8426 0.4101  0.1060  0.2092  295 HIS A NE2 
1846 N N   . VAL A 252 ? 1.2846 0.9065 0.7877 0.1863  0.1863  0.1888  296 VAL A N   
1847 C CA  . VAL A 252 ? 1.2644 0.9017 0.8093 0.1412  0.1989  0.1808  296 VAL A CA  
1848 C C   . VAL A 252 ? 1.3011 0.8695 0.8222 0.1178  0.2294  0.1952  296 VAL A C   
1849 O O   . VAL A 252 ? 1.3454 0.8599 0.8094 0.1331  0.2470  0.2154  296 VAL A O   
1850 C CB  . VAL A 252 ? 1.2483 0.9437 0.8179 0.1321  0.1935  0.1740  296 VAL A CB  
1851 C CG1 . VAL A 252 ? 1.2914 0.9560 0.8058 0.1468  0.2092  0.1918  296 VAL A CG1 
1852 C CG2 . VAL A 252 ? 1.2287 0.9472 0.8519 0.0903  0.2009  0.1627  296 VAL A CG2 
1853 N N   . SER A 253 ? 1.3122 0.8782 0.8753 0.0810  0.2347  0.1844  297 SER A N   
1854 C CA  . SER A 253 ? 1.3467 0.8529 0.9035 0.0526  0.2623  0.1939  297 SER A CA  
1855 C C   . SER A 253 ? 1.3368 0.8760 0.9606 0.0087  0.2658  0.1797  297 SER A C   
1856 O O   . SER A 253 ? 1.3112 0.8868 0.9796 -0.0058 0.2429  0.1600  297 SER A O   
1857 C CB  . SER A 253 ? 1.3633 0.8037 0.8942 0.0555  0.2636  0.1953  297 SER A CB  
1858 O OG  . SER A 253 ? 1.3970 0.7808 0.9304 0.0225  0.2886  0.2014  297 SER A OG  
1859 N N   . THR A 254 ? 1.4427 0.9666 1.0712 -0.0104 0.2957  0.1904  298 THR A N   
1860 C CA  . THR A 254 ? 1.4386 0.9970 1.1388 -0.0499 0.3036  0.1779  298 THR A CA  
1861 C C   . THR A 254 ? 1.4583 0.9697 1.1874 -0.0865 0.3180  0.1750  298 THR A C   
1862 O O   . THR A 254 ? 1.4485 0.9934 1.2502 -0.1197 0.3153  0.1593  298 THR A O   
1863 C CB  . THR A 254 ? 1.4581 1.0324 1.1552 -0.0506 0.3333  0.1890  298 THR A CB  
1864 O OG1 . THR A 254 ? 1.5098 1.0087 1.1361 -0.0398 0.3674  0.2146  298 THR A OG1 
1865 C CG2 . THR A 254 ? 1.4491 1.0772 1.1301 -0.0202 0.3134  0.1854  298 THR A CG2 
1866 N N   . ASP A 255 ? 1.8605 1.2938 1.5354 -0.0797 0.3315  0.1889  299 ASP A N   
1867 C CA  . ASP A 255 ? 1.8872 1.2637 1.5826 -0.1152 0.3480  0.1873  299 ASP A CA  
1868 C C   . ASP A 255 ? 1.8865 1.2359 1.5847 -0.1210 0.3179  0.1698  299 ASP A C   
1869 O O   . ASP A 255 ? 1.9148 1.2027 1.6149 -0.1455 0.3287  0.1685  299 ASP A O   
1870 C CB  . ASP A 255 ? 1.9315 1.2231 1.5608 -0.1091 0.3888  0.2151  299 ASP A CB  
1871 C CG  . ASP A 255 ? 1.9462 1.1942 1.4869 -0.0609 0.3797  0.2307  299 ASP A CG  
1872 O OD1 . ASP A 255 ? 1.9310 1.1868 1.4664 -0.0431 0.3473  0.2175  299 ASP A OD1 
1873 O OD2 . ASP A 255 ? 1.9644 1.1904 1.4534 -0.0372 0.3953  0.2472  299 ASP A OD2 
1874 N N   . GLN A 256 ? 1.6544 1.0431 1.3465 -0.0978 0.2835  0.1569  300 GLN A N   
1875 C CA  . GLN A 256 ? 1.6533 1.0114 1.3261 -0.0922 0.2580  0.1422  300 GLN A CA  
1876 C C   . GLN A 256 ? 1.6747 0.9576 1.2727 -0.0625 0.2702  0.1572  300 GLN A C   
1877 O O   . GLN A 256 ? 1.6974 0.9199 1.2749 -0.0688 0.2655  0.1491  300 GLN A O   
1878 C CB  . GLN A 256 ? 1.6729 1.0098 1.3915 -0.1342 0.2460  0.1220  300 GLN A CB  
1879 C CG  . GLN A 256 ? 1.6616 1.0678 1.4623 -0.1641 0.2330  0.1064  300 GLN A CG  
1880 C CD  . GLN A 256 ? 1.6798 1.0688 1.5247 -0.1995 0.2079  0.0817  300 GLN A CD  
1881 O OE1 . GLN A 256 ? 1.6747 1.0844 1.5257 -0.1980 0.1704  0.0618  300 GLN A OE1 
1882 N NE2 . GLN A 256 ? 1.7037 1.0499 1.5766 -0.2320 0.2277  0.0824  300 GLN A NE2 
1883 N N   . GLY A 257 ? 1.5243 0.8089 1.0797 -0.0277 0.2831  0.1776  301 GLY A N   
1884 C CA  . GLY A 257 ? 1.5425 0.7715 1.0303 0.0121  0.2859  0.1900  301 GLY A CA  
1885 C C   . GLY A 257 ? 1.5942 0.7401 1.0249 0.0204  0.3165  0.2160  301 GLY A C   
1886 O O   . GLY A 257 ? 1.6154 0.7201 0.9869 0.0614  0.3165  0.2292  301 GLY A O   
1887 N N   . ASP A 258 ? 2.0878 1.2067 1.5366 -0.0175 0.3433  0.2236  302 ASP A N   
1888 C CA  . ASP A 258 ? 2.1252 1.1884 1.5357 -0.0132 0.3660  0.2382  302 ASP A CA  
1889 C C   . ASP A 258 ? 2.1370 1.2076 1.4932 0.0290  0.3706  0.2572  302 ASP A C   
1890 O O   . ASP A 258 ? 2.1761 1.1896 1.4747 0.0542  0.3768  0.2690  302 ASP A O   
1891 C CB  . ASP A 258 ? 2.1355 1.1973 1.5979 -0.0639 0.3909  0.2354  302 ASP A CB  
1892 C CG  . ASP A 258 ? 2.1418 1.1760 1.6481 -0.1031 0.3827  0.2157  302 ASP A CG  
1893 O OD1 . ASP A 258 ? 2.1599 1.1385 1.6285 -0.0893 0.3707  0.2110  302 ASP A OD1 
1894 O OD2 . ASP A 258 ? 2.1312 1.2008 1.7118 -0.1464 0.3859  0.2027  302 ASP A OD2 
1895 N N   . THR A 259 ? 1.7207 0.8581 1.0925 0.0373  0.3650  0.2587  303 THR A N   
1896 C CA  . THR A 259 ? 1.7336 0.8831 1.0539 0.0795  0.3604  0.2720  303 THR A CA  
1897 C C   . THR A 259 ? 1.6968 0.9178 1.0285 0.1057  0.3326  0.2663  303 THR A C   
1898 O O   . THR A 259 ? 1.6580 0.9373 1.0484 0.0816  0.3247  0.2518  303 THR A O   
1899 C CB  . THR A 259 ? 1.7579 0.9076 1.0727 0.0630  0.3895  0.2816  303 THR A CB  
1900 O OG1 . THR A 259 ? 1.7332 0.9396 1.1189 0.0231  0.4010  0.2714  303 THR A OG1 
1901 C CG2 . THR A 259 ? 1.8078 0.8825 1.0973 0.0470  0.4173  0.2906  303 THR A CG2 
1902 N N   . TRP A 260 ? 1.8229 1.0456 1.1065 0.1544  0.3134  0.2732  304 TRP A N   
1903 C CA  . TRP A 260 ? 1.7918 1.0798 1.0871 0.1849  0.2826  0.2660  304 TRP A CA  
1904 C C   . TRP A 260 ? 1.8018 1.1210 1.0638 0.2188  0.2675  0.2716  304 TRP A C   
1905 O O   . TRP A 260 ? 1.8385 1.1196 1.0469 0.2535  0.2593  0.2802  304 TRP A O   
1906 C CB  . TRP A 260 ? 1.7892 1.0642 1.0786 0.2171  0.2610  0.2592  304 TRP A CB  
1907 C CG  . TRP A 260 ? 1.7581 1.0367 1.0946 0.1884  0.2612  0.2412  304 TRP A CG  
1908 C CD1 . TRP A 260 ? 1.7847 0.9872 1.1034 0.1715  0.2785  0.2445  304 TRP A CD1 
1909 C CD2 . TRP A 260 ? 1.7004 1.0561 1.1035 0.1727  0.2423  0.2161  304 TRP A CD2 
1910 N NE1 . TRP A 260 ? 1.7490 0.9772 1.1167 0.1475  0.2686  0.2214  304 TRP A NE1 
1911 C CE2 . TRP A 260 ? 1.6978 1.0181 1.1147 0.1486  0.2475  0.2049  304 TRP A CE2 
1912 C CE3 . TRP A 260 ? 1.6559 1.1011 1.1034 0.1768  0.2214  0.2020  304 TRP A CE3 
1913 C CZ2 . TRP A 260 ? 1.6561 1.0241 1.1213 0.1307  0.2326  0.1816  304 TRP A CZ2 
1914 C CZ3 . TRP A 260 ? 1.6122 1.1042 1.1115 0.1572  0.2097  0.1804  304 TRP A CZ3 
1915 C CH2 . TRP A 260 ? 1.6138 1.0660 1.1180 0.1355  0.2153  0.1710  304 TRP A CH2 
1916 N N   . SER A 261 ? 1.5647 0.9604 0.8677 0.2086  0.2567  0.2593  305 SER A N   
1917 C CA  . SER A 261 ? 1.5749 1.0024 0.8468 0.2423  0.2359  0.2607  305 SER A CA  
1918 C C   . SER A 261 ? 1.5384 1.0382 0.8511 0.2697  0.1937  0.2409  305 SER A C   
1919 O O   . SER A 261 ? 1.4829 1.0434 0.8679 0.2490  0.1836  0.2203  305 SER A O   
1920 C CB  . SER A 261 ? 1.5598 1.0278 0.8511 0.2166  0.2490  0.2558  305 SER A CB  
1921 O OG  . SER A 261 ? 1.6072 1.0222 0.8634 0.2021  0.2810  0.2679  305 SER A OG  
1922 N N   . MET A 262 ? 1.5818 1.0751 0.8479 0.3160  0.1689  0.2465  306 MET A N   
1923 C CA  . MET A 262 ? 1.5482 1.1216 0.8624 0.3386  0.1292  0.2254  306 MET A CA  
1924 C C   . MET A 262 ? 1.5217 1.1588 0.8673 0.3175  0.1229  0.2116  306 MET A C   
1925 O O   . MET A 262 ? 1.5595 1.1708 0.8517 0.3190  0.1328  0.2220  306 MET A O   
1926 C CB  . MET A 262 ? 1.5952 1.1464 0.8566 0.3951  0.0987  0.2327  306 MET A CB  
1927 C CG  . MET A 262 ? 1.5709 1.2053 0.8760 0.4166  0.0564  0.2110  306 MET A CG  
1928 S SD  . MET A 262 ? 1.6377 1.2347 0.8671 0.4836  0.0168  0.2211  306 MET A SD  
1929 C CE  . MET A 262 ? 1.6436 1.2036 0.8838 0.5110  0.0182  0.2270  306 MET A CE  
1930 N N   . ALA A 263 ? 1.2793 0.9927 0.7064 0.2977  0.1097  0.1886  307 ALA A N   
1931 C CA  . ALA A 263 ? 1.2507 1.0251 0.7126 0.2797  0.1003  0.1730  307 ALA A CA  
1932 C C   . ALA A 263 ? 1.2744 1.0761 0.7139 0.3156  0.0651  0.1661  307 ALA A C   
1933 O O   . ALA A 263 ? 1.2941 1.0961 0.7259 0.3518  0.0401  0.1654  307 ALA A O   
1934 C CB  . ALA A 263 ? 1.1872 1.0244 0.7340 0.2519  0.0945  0.1521  307 ALA A CB  
1935 N N   . GLN A 264 ? 1.4451 1.2702 0.8762 0.3080  0.0602  0.1586  308 GLN A N   
1936 C CA  . GLN A 264 ? 1.4605 1.3196 0.8829 0.3396  0.0193  0.1455  308 GLN A CA  
1937 C C   . GLN A 264 ? 1.3981 1.3413 0.9154 0.3223  -0.0014 0.1189  308 GLN A C   
1938 O O   . GLN A 264 ? 1.3707 1.3501 0.9137 0.3014  -0.0042 0.1049  308 GLN A O   
1939 C CB  . GLN A 264 ? 1.4999 1.3356 0.8562 0.3443  0.0218  0.1486  308 GLN A CB  
1940 C CG  . GLN A 264 ? 1.5178 1.3888 0.8641 0.3736  -0.0254 0.1302  308 GLN A CG  
1941 C CD  . GLN A 264 ? 1.5161 1.4034 0.8506 0.3574  -0.0226 0.1177  308 GLN A CD  
1942 O OE1 . GLN A 264 ? 1.4754 1.3722 0.8411 0.3207  0.0102  0.1169  308 GLN A OE1 
1943 N NE2 . GLN A 264 ? 1.5620 1.4501 0.8500 0.3870  -0.0593 0.1064  308 GLN A NE2 
1944 N N   . LEU A 265 ? 1.0528 1.0236 0.6165 0.3368  -0.0175 0.1117  309 LEU A N   
1945 C CA  . LEU A 265 ? 0.9994 1.0438 0.6550 0.3222  -0.0311 0.0887  309 LEU A CA  
1946 C C   . LEU A 265 ? 1.0099 1.0807 0.6920 0.3605  -0.0610 0.0807  309 LEU A C   
1947 O O   . LEU A 265 ? 1.0443 1.0689 0.6812 0.3923  -0.0623 0.0957  309 LEU A O   
1948 C CB  . LEU A 265 ? 0.9561 0.9998 0.6527 0.2874  0.0000  0.0899  309 LEU A CB  
1949 C CG  . LEU A 265 ? 0.9215 0.9646 0.6270 0.2460  0.0213  0.0888  309 LEU A CG  
1950 C CD1 . LEU A 265 ? 0.8874 0.9217 0.6247 0.2190  0.0442  0.0896  309 LEU A CD1 
1951 C CD2 . LEU A 265 ? 0.8826 0.9826 0.6294 0.2342  0.0015  0.0686  309 LEU A CD2 
1952 N N   . PRO A 266 ? 0.9159 1.0600 0.6739 0.3585  -0.0855 0.0564  310 PRO A N   
1953 C CA  . PRO A 266 ? 0.9031 1.0812 0.7027 0.3950  -0.1130 0.0463  310 PRO A CA  
1954 C C   . PRO A 266 ? 0.8719 1.0417 0.7034 0.3953  -0.0859 0.0517  310 PRO A C   
1955 O O   . PRO A 266 ? 0.8384 1.0041 0.6904 0.3598  -0.0526 0.0531  310 PRO A O   
1956 C CB  . PRO A 266 ? 0.8542 1.1156 0.7391 0.3831  -0.1389 0.0173  310 PRO A CB  
1957 C CG  . PRO A 266 ? 0.8208 1.0883 0.7200 0.3345  -0.1126 0.0145  310 PRO A CG  
1958 C CD  . PRO A 266 ? 0.8742 1.0710 0.6837 0.3265  -0.0909 0.0369  310 PRO A CD  
1959 N N   . SER A 267 ? 0.9837 1.1448 0.8122 0.4384  -0.1020 0.0545  311 SER A N   
1960 C CA  . SER A 267 ? 0.9555 1.1174 0.8235 0.4461  -0.0806 0.0542  311 SER A CA  
1961 C C   . SER A 267 ? 0.8853 1.1332 0.8631 0.4299  -0.0794 0.0282  311 SER A C   
1962 O O   . SER A 267 ? 0.8616 1.1714 0.8901 0.4250  -0.1063 0.0094  311 SER A O   
1963 C CB  . SER A 267 ? 0.9918 1.1250 0.8321 0.5018  -0.1024 0.0618  311 SER A CB  
1964 O OG  . SER A 267 ? 1.0066 1.1739 0.8516 0.5336  -0.1519 0.0511  311 SER A OG  
1965 N N   . VAL A 268 ? 0.9052 1.1519 0.9165 0.4204  -0.0459 0.0267  312 VAL A N   
1966 C CA  . VAL A 268 ? 0.8511 1.1713 0.9624 0.4059  -0.0352 0.0040  312 VAL A CA  
1967 C C   . VAL A 268 ? 0.8454 1.1806 1.0038 0.4392  -0.0243 -0.0027 312 VAL A C   
1968 O O   . VAL A 268 ? 0.8818 1.1564 0.9857 0.4666  -0.0170 0.0124  312 VAL A O   
1969 C CB  . VAL A 268 ? 0.8292 1.1379 0.9404 0.3551  0.0024  0.0047  312 VAL A CB  
1970 C CG1 . VAL A 268 ? 0.8302 1.1285 0.9039 0.3252  -0.0085 0.0093  312 VAL A CG1 
1971 C CG2 . VAL A 268 ? 0.8546 1.0905 0.9094 0.3515  0.0372  0.0207  312 VAL A CG2 
1972 N N   . GLY A 269 ? 0.8113 1.2264 1.0739 0.4363  -0.0209 -0.0262 313 GLY A N   
1973 C CA  . GLY A 269 ? 0.8007 1.2413 1.1248 0.4636  -0.0022 -0.0366 313 GLY A CA  
1974 C C   . GLY A 269 ? 0.8093 1.2088 1.1137 0.4371  0.0535  -0.0315 313 GLY A C   
1975 O O   . GLY A 269 ? 0.8310 1.1648 1.0559 0.4075  0.0705  -0.0153 313 GLY A O   
1976 N N   . GLN A 270 ? 1.0258 1.4605 1.3998 0.4489  0.0822  -0.0461 314 GLN A N   
1977 C CA  . GLN A 270 ? 1.0447 1.4361 1.3920 0.4233  0.1362  -0.0434 314 GLN A CA  
1978 C C   . GLN A 270 ? 1.0273 1.4652 1.4304 0.3781  0.1640  -0.0568 314 GLN A C   
1979 O O   . GLN A 270 ? 1.0495 1.4468 1.4180 0.3496  0.2055  -0.0537 314 GLN A O   
1980 C CB  . GLN A 270 ? 1.0596 1.4423 1.4292 0.4627  0.1605  -0.0494 314 GLN A CB  
1981 C CG  . GLN A 270 ? 1.1049 1.3923 1.3730 0.4874  0.1556  -0.0291 314 GLN A CG  
1982 C CD  . GLN A 270 ? 1.1265 1.3970 1.4097 0.5330  0.1745  -0.0348 314 GLN A CD  
1983 O OE1 . GLN A 270 ? 1.0956 1.4394 1.4760 0.5650  0.1718  -0.0534 314 GLN A OE1 
1984 N NE2 . GLN A 270 ? 1.1798 1.3531 1.3705 0.5367  0.1936  -0.0204 314 GLN A NE2 
1985 N N   . GLU A 271 ? 1.2044 1.7225 1.6888 0.3733  0.1371  -0.0717 315 GLU A N   
1986 C CA  . GLU A 271 ? 1.1919 1.7545 1.7280 0.3282  0.1515  -0.0833 315 GLU A CA  
1987 C C   . GLU A 271 ? 1.2027 1.7131 1.6578 0.2859  0.1478  -0.0687 315 GLU A C   
1988 O O   . GLU A 271 ? 1.2094 1.7227 1.6746 0.2450  0.1727  -0.0723 315 GLU A O   
1989 C CB  . GLU A 271 ? 1.1489 1.8048 1.7874 0.3394  0.1112  -0.1038 315 GLU A CB  
1990 C CG  . GLU A 271 ? 1.0767 1.7387 1.7003 0.3013  0.0882  -0.1037 315 GLU A CG  
1991 C CD  . GLU A 271 ? 1.0369 1.7667 1.7239 0.3145  0.0334  -0.1206 315 GLU A CD  
1992 O OE1 . GLU A 271 ? 1.0651 1.8043 1.7493 0.3597  -0.0081 -0.1214 315 GLU A OE1 
1993 O OE2 . GLU A 271 ? 0.9802 1.7456 1.7106 0.2787  0.0302  -0.1328 315 GLU A OE2 
1994 N N   . GLN A 272 ? 0.7313 1.1928 1.1075 0.2977  0.1173  -0.0523 316 GLN A N   
1995 C CA  . GLN A 272 ? 0.7309 1.1638 1.0521 0.2661  0.1018  -0.0426 316 GLN A CA  
1996 C C   . GLN A 272 ? 0.7591 1.1045 0.9826 0.2512  0.1214  -0.0229 316 GLN A C   
1997 O O   . GLN A 272 ? 0.7781 1.0802 0.9693 0.2670  0.1426  -0.0164 316 GLN A O   
1998 C CB  . GLN A 272 ? 0.7172 1.1663 1.0277 0.2887  0.0515  -0.0411 316 GLN A CB  
1999 C CG  . GLN A 272 ? 0.6928 1.2275 1.0964 0.2965  0.0214  -0.0636 316 GLN A CG  
2000 C CD  . GLN A 272 ? 0.7002 1.2410 1.0819 0.3317  -0.0303 -0.0628 316 GLN A CD  
2001 O OE1 . GLN A 272 ? 0.7074 1.2583 1.1033 0.3753  -0.0483 -0.0644 316 GLN A OE1 
2002 N NE2 . GLN A 272 ? 0.7074 1.2378 1.0497 0.3156  -0.0550 -0.0607 316 GLN A NE2 
2003 N N   . PHE A 273 ? 0.6075 0.9266 0.7866 0.2222  0.1122  -0.0149 317 PHE A N   
2004 C CA  . PHE A 273 ? 0.6287 0.8707 0.7256 0.2066  0.1258  0.0012  317 PHE A CA  
2005 C C   . PHE A 273 ? 0.6184 0.8437 0.6758 0.1928  0.1018  0.0103  317 PHE A C   
2006 O O   . PHE A 273 ? 0.5986 0.8677 0.6869 0.1878  0.0796  0.0027  317 PHE A O   
2007 C CB  . PHE A 273 ? 0.6531 0.8701 0.7394 0.1746  0.1583  -0.0015 317 PHE A CB  
2008 C CG  . PHE A 273 ? 0.6512 0.9015 0.7698 0.1432  0.1558  -0.0097 317 PHE A CG  
2009 C CD1 . PHE A 273 ? 0.6505 0.9599 0.8444 0.1389  0.1671  -0.0251 317 PHE A CD1 
2010 C CD2 . PHE A 273 ? 0.6546 0.8781 0.7339 0.1181  0.1424  -0.0030 317 PHE A CD2 
2011 C CE1 . PHE A 273 ? 0.6626 0.9960 0.8846 0.1082  0.1656  -0.0324 317 PHE A CE1 
2012 C CE2 . PHE A 273 ? 0.6646 0.9128 0.7706 0.0914  0.1390  -0.0105 317 PHE A CE2 
2013 C CZ  . PHE A 273 ? 0.6739 0.9739 0.8483 0.0857  0.1507  -0.0247 317 PHE A CZ  
2014 N N   . TYR A 274 ? 0.6945 0.8563 0.6864 0.1861  0.1073  0.0249  318 TYR A N   
2015 C CA  . TYR A 274 ? 0.7092 0.8512 0.6673 0.1655  0.0949  0.0325  318 TYR A CA  
2016 C C   . TYR A 274 ? 0.7019 0.8151 0.6439 0.1308  0.1099  0.0316  318 TYR A C   
2017 O O   . TYR A 274 ? 0.7072 0.7874 0.6324 0.1265  0.1303  0.0314  318 TYR A O   
2018 C CB  . TYR A 274 ? 0.7554 0.8479 0.6590 0.1794  0.0915  0.0485  318 TYR A CB  
2019 C CG  . TYR A 274 ? 0.7709 0.8744 0.6716 0.2171  0.0755  0.0525  318 TYR A CG  
2020 C CD1 . TYR A 274 ? 0.7699 0.9057 0.6762 0.2267  0.0504  0.0502  318 TYR A CD1 
2021 C CD2 . TYR A 274 ? 0.7893 0.8642 0.6743 0.2458  0.0831  0.0582  318 TYR A CD2 
2022 C CE1 . TYR A 274 ? 0.7872 0.9261 0.6805 0.2643  0.0305  0.0538  318 TYR A CE1 
2023 C CE2 . TYR A 274 ? 0.8073 0.8859 0.6834 0.2847  0.0640  0.0628  318 TYR A CE2 
2024 C CZ  . TYR A 274 ? 0.8075 0.9176 0.6858 0.2940  0.0365  0.0609  318 TYR A CZ  
2025 O OH  . TYR A 274 ? 0.8346 0.9422 0.6947 0.3358  0.0126  0.0652  318 TYR A OH  
2026 N N   . SER A 275 ? 0.9679 1.0889 0.9101 0.1085  0.0986  0.0304  319 SER A N   
2027 C CA  . SER A 275 ? 0.9654 1.0525 0.8858 0.0800  0.1063  0.0306  319 SER A CA  
2028 C C   . SER A 275 ? 0.9760 1.0496 0.8777 0.0688  0.0920  0.0367  319 SER A C   
2029 O O   . SER A 275 ? 0.9653 1.0711 0.8831 0.0729  0.0777  0.0348  319 SER A O   
2030 C CB  . SER A 275 ? 0.9336 1.0475 0.8849 0.0623  0.1108  0.0198  319 SER A CB  
2031 O OG  . SER A 275 ? 0.9378 1.0074 0.8576 0.0423  0.1236  0.0203  319 SER A OG  
2032 N N   . ILE A 276 ? 0.6174 0.6436 0.4870 0.0557  0.0958  0.0424  320 ILE A N   
2033 C CA  . ILE A 276 ? 0.6281 0.6468 0.4931 0.0417  0.0852  0.0456  320 ILE A CA  
2034 C C   . ILE A 276 ? 0.5922 0.6197 0.4703 0.0208  0.0758  0.0371  320 ILE A C   
2035 O O   . ILE A 276 ? 0.5935 0.5897 0.4544 0.0076  0.0775  0.0345  320 ILE A O   
2036 C CB  . ILE A 276 ? 0.6728 0.6412 0.5101 0.0336  0.0905  0.0523  320 ILE A CB  
2037 C CG1 . ILE A 276 ? 0.7116 0.6612 0.5294 0.0545  0.1013  0.0627  320 ILE A CG1 
2038 C CG2 . ILE A 276 ? 0.6843 0.6521 0.5328 0.0148  0.0809  0.0519  320 ILE A CG2 
2039 C CD1 . ILE A 276 ? 0.7423 0.6349 0.5319 0.0463  0.1095  0.0670  320 ILE A CD1 
2040 N N   . LEU A 277 ? 0.6745 0.7379 0.5763 0.0193  0.0647  0.0326  321 LEU A N   
2041 C CA  . LEU A 277 ? 0.6468 0.7147 0.5595 0.0020  0.0555  0.0247  321 LEU A CA  
2042 C C   . LEU A 277 ? 0.6570 0.7009 0.5633 -0.0124 0.0448  0.0250  321 LEU A C   
2043 O O   . LEU A 277 ? 0.6531 0.6738 0.5497 -0.0258 0.0369  0.0213  321 LEU A O   
2044 C CB  . LEU A 277 ? 0.6147 0.7268 0.5560 0.0061  0.0464  0.0172  321 LEU A CB  
2045 C CG  . LEU A 277 ? 0.6104 0.7551 0.5736 0.0177  0.0510  0.0122  321 LEU A CG  
2046 C CD1 . LEU A 277 ? 0.5938 0.7784 0.5838 0.0205  0.0357  0.0022  321 LEU A CD1 
2047 C CD2 . LEU A 277 ? 0.6155 0.7475 0.5813 0.0051  0.0646  0.0089  321 LEU A CD2 
2048 N N   . ALA A 278 ? 0.6378 0.6877 0.5511 -0.0089 0.0443  0.0288  322 ALA A N   
2049 C CA  . ALA A 278 ? 0.6577 0.6935 0.5801 -0.0221 0.0357  0.0271  322 ALA A CA  
2050 C C   . ALA A 278 ? 0.7099 0.7432 0.6355 -0.0184 0.0479  0.0346  322 ALA A C   
2051 O O   . ALA A 278 ? 0.7125 0.7625 0.6327 -0.0038 0.0584  0.0399  322 ALA A O   
2052 C CB  . ALA A 278 ? 0.6267 0.6855 0.5732 -0.0270 0.0217  0.0185  322 ALA A CB  
2053 N N   . ALA A 279 ? 0.6789 0.6894 0.6126 -0.0319 0.0458  0.0343  323 ALA A N   
2054 C CA  . ALA A 279 ? 0.7086 0.7125 0.6499 -0.0335 0.0621  0.0415  323 ALA A CA  
2055 C C   . ALA A 279 ? 0.6834 0.6909 0.6670 -0.0520 0.0545  0.0339  323 ALA A C   
2056 O O   . ALA A 279 ? 0.6527 0.6498 0.6478 -0.0632 0.0317  0.0242  323 ALA A O   
2057 C CB  . ALA A 279 ? 0.7250 0.6899 0.6351 -0.0308 0.0736  0.0500  323 ALA A CB  
2058 N N   . ASN A 280 ? 0.6381 0.6601 0.6451 -0.0538 0.0734  0.0375  324 ASN A N   
2059 C CA  . ASN A 280 ? 0.6073 0.6387 0.6676 -0.0715 0.0709  0.0293  324 ASN A CA  
2060 C C   . ASN A 280 ? 0.6134 0.6329 0.6813 -0.0784 0.1043  0.0395  324 ASN A C   
2061 O O   . ASN A 280 ? 0.6431 0.6340 0.6642 -0.0692 0.1216  0.0532  324 ASN A O   
2062 C CB  . ASN A 280 ? 0.5830 0.6543 0.6825 -0.0689 0.0591  0.0175  324 ASN A CB  
2063 C CG  . ASN A 280 ? 0.5990 0.6946 0.6877 -0.0534 0.0799  0.0216  324 ASN A CG  
2064 O OD1 . ASN A 280 ? 0.6156 0.7010 0.6771 -0.0467 0.1070  0.0336  324 ASN A OD1 
2065 N ND2 . ASN A 280 ? 0.5873 0.7091 0.6924 -0.0466 0.0659  0.0110  324 ASN A ND2 
2066 N N   . ASP A 281 ? 1.2304 1.2663 1.3560 -0.0946 0.1146  0.0335  325 ASP A N   
2067 C CA  . ASP A 281 ? 1.2390 1.2542 1.3649 -0.1037 0.1521  0.0455  325 ASP A CA  
2068 C C   . ASP A 281 ? 1.2615 1.2834 1.3551 -0.0868 0.1855  0.0578  325 ASP A C   
2069 O O   . ASP A 281 ? 1.2806 1.2718 1.3465 -0.0880 0.2191  0.0728  325 ASP A O   
2070 C CB  . ASP A 281 ? 1.1985 1.2280 1.4040 -0.1303 0.1580  0.0347  325 ASP A CB  
2071 C CG  . ASP A 281 ? 1.1811 1.1835 1.4029 -0.1490 0.1296  0.0256  325 ASP A CG  
2072 O OD1 . ASP A 281 ? 1.2033 1.1647 1.3642 -0.1420 0.1176  0.0317  325 ASP A OD1 
2073 O OD2 . ASP A 281 ? 1.1454 1.1672 1.4424 -0.1700 0.1192  0.0106  325 ASP A OD2 
2074 N N   . ASP A 282 ? 0.8843 0.9394 0.9747 -0.0706 0.1755  0.0511  326 ASP A N   
2075 C CA  . ASP A 282 ? 0.9005 0.9572 0.9464 -0.0504 0.1995  0.0600  326 ASP A CA  
2076 C C   . ASP A 282 ? 0.9261 0.9598 0.8961 -0.0265 0.1918  0.0714  326 ASP A C   
2077 O O   . ASP A 282 ? 0.9431 0.9539 0.8633 -0.0126 0.2162  0.0847  326 ASP A O   
2078 C CB  . ASP A 282 ? 0.8788 0.9779 0.9527 -0.0424 0.1915  0.0454  326 ASP A CB  
2079 C CG  . ASP A 282 ? 0.8474 0.9775 1.0052 -0.0607 0.1917  0.0308  326 ASP A CG  
2080 O OD1 . ASP A 282 ? 0.8380 0.9707 1.0285 -0.0723 0.2277  0.0335  326 ASP A OD1 
2081 O OD2 . ASP A 282 ? 0.8294 0.9801 1.0216 -0.0629 0.1558  0.0165  326 ASP A OD2 
2082 N N   . MET A 283 ? 0.8485 0.8879 0.8101 -0.0205 0.1591  0.0655  327 MET A N   
2083 C CA  . MET A 283 ? 0.8567 0.8895 0.7651 0.0032  0.1489  0.0712  327 MET A CA  
2084 C C   . MET A 283 ? 0.8574 0.8936 0.7667 0.0044  0.1210  0.0651  327 MET A C   
2085 O O   . MET A 283 ? 0.8556 0.8959 0.7970 -0.0122 0.1060  0.0559  327 MET A O   
2086 C CB  . MET A 283 ? 0.8278 0.8878 0.7236 0.0196  0.1455  0.0646  327 MET A CB  
2087 C CG  . MET A 283 ? 0.7950 0.8912 0.7372 0.0108  0.1271  0.0467  327 MET A CG  
2088 S SD  . MET A 283 ? 0.7650 0.8773 0.7149 0.0115  0.0902  0.0357  327 MET A SD  
2089 C CE  . MET A 283 ? 0.7215 0.8510 0.6370 0.0352  0.0821  0.0312  327 MET A CE  
2090 N N   . VAL A 284 ? 0.7766 0.8116 0.6507 0.0251  0.1138  0.0691  328 VAL A N   
2091 C CA  . VAL A 284 ? 0.7655 0.8104 0.6449 0.0273  0.0934  0.0619  328 VAL A CA  
2092 C C   . VAL A 284 ? 0.7086 0.7877 0.5887 0.0414  0.0778  0.0532  328 VAL A C   
2093 O O   . VAL A 284 ? 0.6994 0.7877 0.5587 0.0589  0.0785  0.0548  328 VAL A O   
2094 C CB  . VAL A 284 ? 0.8098 0.8249 0.6621 0.0376  0.0980  0.0710  328 VAL A CB  
2095 C CG1 . VAL A 284 ? 0.8328 0.8090 0.6856 0.0201  0.1083  0.0757  328 VAL A CG1 
2096 C CG2 . VAL A 284 ? 0.8222 0.8267 0.6363 0.0635  0.1059  0.0824  328 VAL A CG2 
2097 N N   . PHE A 285 ? 0.6979 0.7913 0.5991 0.0330  0.0634  0.0434  329 PHE A N   
2098 C CA  . PHE A 285 ? 0.6538 0.7769 0.5626 0.0430  0.0498  0.0346  329 PHE A CA  
2099 C C   . PHE A 285 ? 0.6756 0.7935 0.5772 0.0545  0.0523  0.0385  329 PHE A C   
2100 O O   . PHE A 285 ? 0.6800 0.7810 0.5847 0.0440  0.0569  0.0386  329 PHE A O   
2101 C CB  . PHE A 285 ? 0.6109 0.7477 0.5465 0.0259  0.0378  0.0225  329 PHE A CB  
2102 C CG  . PHE A 285 ? 0.5892 0.7397 0.5368 0.0215  0.0311  0.0145  329 PHE A CG  
2103 C CD1 . PHE A 285 ? 0.6092 0.7476 0.5677 0.0096  0.0345  0.0150  329 PHE A CD1 
2104 C CD2 . PHE A 285 ? 0.5609 0.7371 0.5134 0.0296  0.0200  0.0042  329 PHE A CD2 
2105 C CE1 . PHE A 285 ? 0.5968 0.7495 0.5713 0.0082  0.0300  0.0061  329 PHE A CE1 
2106 C CE2 . PHE A 285 ? 0.5475 0.7318 0.5079 0.0271  0.0149  -0.0048 329 PHE A CE2 
2107 C CZ  . PHE A 285 ? 0.5637 0.7366 0.5354 0.0175  0.0213  -0.0035 329 PHE A CZ  
2108 N N   . MET A 286 ? 0.6930 0.8230 0.5829 0.0782  0.0483  0.0406  330 MET A N   
2109 C CA  . MET A 286 ? 0.7182 0.8485 0.6104 0.0925  0.0501  0.0423  330 MET A CA  
2110 C C   . MET A 286 ? 0.6898 0.8665 0.6191 0.0993  0.0357  0.0281  330 MET A C   
2111 O O   . MET A 286 ? 0.6936 0.8981 0.6292 0.1098  0.0185  0.0205  330 MET A O   
2112 C CB  . MET A 286 ? 0.7834 0.8884 0.6387 0.1176  0.0549  0.0555  330 MET A CB  
2113 C CG  . MET A 286 ? 0.7874 0.8890 0.6458 0.1369  0.0571  0.0572  330 MET A CG  
2114 S SD  . MET A 286 ? 0.7991 0.8518 0.6438 0.1224  0.0792  0.0641  330 MET A SD  
2115 C CE  . MET A 286 ? 0.8540 0.8498 0.6486 0.1254  0.0917  0.0827  330 MET A CE  
2116 N N   . HIS A 287 ? 0.6305 0.8136 0.5845 0.0918  0.0438  0.0232  331 HIS A N   
2117 C CA  . HIS A 287 ? 0.6102 0.8397 0.6105 0.0969  0.0360  0.0095  331 HIS A CA  
2118 C C   . HIS A 287 ? 0.6226 0.8650 0.6331 0.1265  0.0356  0.0105  331 HIS A C   
2119 O O   . HIS A 287 ? 0.6317 0.8468 0.6285 0.1324  0.0534  0.0179  331 HIS A O   
2120 C CB  . HIS A 287 ? 0.5831 0.8128 0.6071 0.0718  0.0507  0.0030  331 HIS A CB  
2121 C CG  . HIS A 287 ? 0.5661 0.8435 0.6464 0.0722  0.0502  -0.0113 331 HIS A CG  
2122 N ND1 . HIS A 287 ? 0.5525 0.8623 0.6676 0.0581  0.0369  -0.0246 331 HIS A ND1 
2123 C CD2 . HIS A 287 ? 0.5588 0.8585 0.6734 0.0842  0.0627  -0.0160 331 HIS A CD2 
2124 C CE1 . HIS A 287 ? 0.5349 0.8861 0.7067 0.0582  0.0415  -0.0369 331 HIS A CE1 
2125 N NE2 . HIS A 287 ? 0.5369 0.8856 0.7122 0.0747  0.0581  -0.0321 331 HIS A NE2 
2126 N N   . VAL A 288 ? 0.5768 0.8588 0.6107 0.1471  0.0127  0.0016  332 VAL A N   
2127 C CA  . VAL A 288 ? 0.5734 0.8777 0.6318 0.1781  0.0068  -0.0014 332 VAL A CA  
2128 C C   . VAL A 288 ? 0.5311 0.8971 0.6694 0.1731  0.0029  -0.0216 332 VAL A C   
2129 O O   . VAL A 288 ? 0.5098 0.9130 0.6804 0.1637  -0.0174 -0.0359 332 VAL A O   
2130 C CB  . VAL A 288 ? 0.5977 0.8992 0.6238 0.2118  -0.0207 0.0026  332 VAL A CB  
2131 C CG1 . VAL A 288 ? 0.5896 0.9202 0.6498 0.2474  -0.0345 -0.0035 332 VAL A CG1 
2132 C CG2 . VAL A 288 ? 0.6458 0.8819 0.5945 0.2158  -0.0087 0.0242  332 VAL A CG2 
2133 N N   . ASP A 289 ? 0.7077 1.0835 0.8799 0.1783  0.0247  -0.0239 333 ASP A N   
2134 C CA  . ASP A 289 ? 0.6701 1.1075 0.9279 0.1726  0.0282  -0.0434 333 ASP A CA  
2135 C C   . ASP A 289 ? 0.6523 1.1472 0.9615 0.2019  -0.0088 -0.0583 333 ASP A C   
2136 O O   . ASP A 289 ? 0.6717 1.1558 0.9540 0.2384  -0.0278 -0.0518 333 ASP A O   
2137 C CB  . ASP A 289 ? 0.6646 1.0986 0.9464 0.1752  0.0647  -0.0433 333 ASP A CB  
2138 C CG  . ASP A 289 ? 0.6299 1.1187 0.9973 0.1549  0.0826  -0.0618 333 ASP A CG  
2139 O OD1 . ASP A 289 ? 0.6227 1.1125 0.9936 0.1218  0.0826  -0.0658 333 ASP A OD1 
2140 O OD2 . ASP A 289 ? 0.6112 1.1401 1.0427 0.1707  0.0977  -0.0725 333 ASP A OD2 
2141 N N   . GLU A 290 ? 0.7626 1.3150 1.1453 0.1857  -0.0201 -0.0790 334 GLU A N   
2142 C CA  . GLU A 290 ? 0.7380 1.3529 1.1836 0.2103  -0.0602 -0.0988 334 GLU A CA  
2143 C C   . GLU A 290 ? 0.7173 1.3814 1.2433 0.2342  -0.0510 -0.1096 334 GLU A C   
2144 O O   . GLU A 290 ? 0.7062 1.3770 1.2706 0.2162  -0.0072 -0.1106 334 GLU A O   
2145 C CB  . GLU A 290 ? 0.7055 1.3618 1.2049 0.1798  -0.0759 -0.1194 334 GLU A CB  
2146 C CG  . GLU A 290 ? 0.6906 1.3900 1.2186 0.2016  -0.1311 -0.1389 334 GLU A CG  
2147 C CD  . GLU A 290 ? 0.7291 1.3763 1.1540 0.2248  -0.1596 -0.1251 334 GLU A CD  
2148 O OE1 . GLU A 290 ? 0.7543 1.3432 1.1032 0.2068  -0.1383 -0.1069 334 GLU A OE1 
2149 O OE2 . GLU A 290 ? 0.7362 1.3995 1.1562 0.2620  -0.2028 -0.1327 334 GLU A OE2 
2150 N N   . PRO A 291 ? 0.5336 1.2290 1.0818 0.2773  -0.0920 -0.1179 335 PRO A N   
2151 C CA  . PRO A 291 ? 0.5269 1.2801 1.1659 0.3063  -0.0916 -0.1323 335 PRO A CA  
2152 C C   . PRO A 291 ? 0.4931 1.3247 1.2562 0.2764  -0.0781 -0.1587 335 PRO A C   
2153 O O   . PRO A 291 ? 0.4757 1.3311 1.2623 0.2503  -0.0999 -0.1722 335 PRO A O   
2154 C CB  . PRO A 291 ? 0.5661 1.3361 1.1982 0.3548  -0.1527 -0.1388 335 PRO A CB  
2155 C CG  . PRO A 291 ? 0.5883 1.2854 1.0976 0.3569  -0.1701 -0.1186 335 PRO A CG  
2156 C CD  . PRO A 291 ? 0.5626 1.2360 1.0460 0.3041  -0.1414 -0.1141 335 PRO A CD  
2157 N N   . GLY A 292 ? 0.5762 1.4422 1.4143 0.2787  -0.0394 -0.1658 336 GLY A N   
2158 C CA  . GLY A 292 ? 0.5610 1.4828 1.5053 0.2427  -0.0116 -0.1838 336 GLY A CA  
2159 C C   . GLY A 292 ? 0.5363 1.4242 1.4552 0.1962  0.0456  -0.1763 336 GLY A C   
2160 O O   . GLY A 292 ? 0.5375 1.3506 1.3467 0.1821  0.0481  -0.1552 336 GLY A O   
2161 N N   . ASP A 293 ? 1.1152 2.0321 2.1088 0.1678  0.0913  -0.1850 337 ASP A N   
2162 C CA  . ASP A 293 ? 1.1160 1.9927 2.0781 0.1215  0.1428  -0.1779 337 ASP A CA  
2163 C C   . ASP A 293 ? 1.1026 1.9828 2.0647 0.0878  0.1130  -0.1848 337 ASP A C   
2164 O O   . ASP A 293 ? 1.0971 2.0226 2.1300 0.0756  0.0885  -0.2002 337 ASP A O   
2165 C CB  . ASP A 293 ? 1.1388 2.0263 2.1553 0.0995  0.2010  -0.1796 337 ASP A CB  
2166 C CG  . ASP A 293 ? 1.1545 1.9773 2.1088 0.0594  0.2587  -0.1669 337 ASP A CG  
2167 O OD1 . ASP A 293 ? 1.1494 1.9237 2.0310 0.0381  0.2457  -0.1571 337 ASP A OD1 
2168 O OD2 . ASP A 293 ? 1.1942 1.9995 2.1509 0.0504  0.3118  -0.1622 337 ASP A OD2 
2169 N N   . THR A 294 ? 0.4547 1.2575 1.3040 0.0724  0.1110  -0.1643 338 THR A N   
2170 C CA  . THR A 294 ? 0.4572 1.2486 1.2810 0.0507  0.0759  -0.1678 338 THR A CA  
2171 C C   . THR A 294 ? 0.4885 1.2100 1.2430 0.0106  0.1119  -0.1520 338 THR A C   
2172 O O   . THR A 294 ? 0.4825 1.2095 1.2689 -0.0255 0.1190  -0.1613 338 THR A O   
2173 C CB  . THR A 294 ? 0.4685 1.2360 1.2177 0.0838  0.0237  -0.1594 338 THR A CB  
2174 O OG1 . THR A 294 ? 0.5007 1.2075 1.1612 0.1047  0.0416  -0.1348 338 THR A OG1 
2175 C CG2 . THR A 294 ? 0.4386 1.2762 1.2589 0.1203  -0.0246 -0.1797 338 THR A CG2 
2176 N N   . GLY A 295 ? 0.5734 1.2246 1.2290 0.0187  0.1301  -0.1283 339 GLY A N   
2177 C CA  . GLY A 295 ? 0.6074 1.1851 1.1837 -0.0116 0.1535  -0.1123 339 GLY A CA  
2178 C C   . GLY A 295 ? 0.6177 1.1664 1.1323 -0.0101 0.1112  -0.1064 339 GLY A C   
2179 O O   . GLY A 295 ? 0.6398 1.1389 1.1024 -0.0343 0.1159  -0.0981 339 GLY A O   
2180 N N   . PHE A 296 ? 0.5357 1.1141 1.0554 0.0205  0.0698  -0.1114 340 PHE A N   
2181 C CA  . PHE A 296 ? 0.5473 1.0937 1.0005 0.0264  0.0364  -0.1044 340 PHE A CA  
2182 C C   . PHE A 296 ? 0.5558 1.0994 0.9717 0.0666  0.0117  -0.0964 340 PHE A C   
2183 O O   . PHE A 296 ? 0.5464 1.1227 0.9985 0.0935  0.0090  -0.1004 340 PHE A O   
2184 C CB  . PHE A 296 ? 0.5210 1.0977 1.0111 0.0117  0.0048  -0.1234 340 PHE A CB  
2185 C CG  . PHE A 296 ? 0.4868 1.1319 1.0476 0.0334  -0.0309 -0.1449 340 PHE A CG  
2186 C CD1 . PHE A 296 ? 0.4893 1.1364 1.0129 0.0679  -0.0717 -0.1448 340 PHE A CD1 
2187 C CD2 . PHE A 296 ? 0.4542 1.1607 1.1202 0.0188  -0.0243 -0.1663 340 PHE A CD2 
2188 C CE1 . PHE A 296 ? 0.4620 1.1678 1.0447 0.0912  -0.1117 -0.1660 340 PHE A CE1 
2189 C CE2 . PHE A 296 ? 0.4293 1.2042 1.1702 0.0396  -0.0643 -0.1898 340 PHE A CE2 
2190 C CZ  . PHE A 296 ? 0.4388 1.2118 1.1344 0.0775  -0.1114 -0.1898 340 PHE A CZ  
2191 N N   . GLY A 297 ? 0.4689 0.9715 0.8127 0.0707  -0.0055 -0.0855 341 GLY A N   
2192 C CA  . GLY A 297 ? 0.4900 0.9708 0.7791 0.1032  -0.0216 -0.0731 341 GLY A CA  
2193 C C   . GLY A 297 ? 0.4978 0.9597 0.7398 0.1029  -0.0474 -0.0729 341 GLY A C   
2194 O O   . GLY A 297 ? 0.4778 0.9517 0.7383 0.0825  -0.0588 -0.0859 341 GLY A O   
2195 N N   . THR A 298 ? 0.5498 0.9794 0.7299 0.1270  -0.0547 -0.0586 342 THR A N   
2196 C CA  . THR A 298 ? 0.5611 0.9661 0.6874 0.1302  -0.0710 -0.0558 342 THR A CA  
2197 C C   . THR A 298 ? 0.5964 0.9475 0.6658 0.1216  -0.0462 -0.0354 342 THR A C   
2198 O O   . THR A 298 ? 0.6215 0.9492 0.6739 0.1296  -0.0280 -0.0212 342 THR A O   
2199 C CB  . THR A 298 ? 0.5689 0.9804 0.6693 0.1666  -0.1011 -0.0578 342 THR A CB  
2200 O OG1 . THR A 298 ? 0.5355 1.0045 0.7038 0.1748  -0.1282 -0.0800 342 THR A OG1 
2201 C CG2 . THR A 298 ? 0.5758 0.9589 0.6143 0.1710  -0.1146 -0.0567 342 THR A CG2 
2202 N N   . ILE A 299 ? 0.5015 0.8342 0.5476 0.1049  -0.0461 -0.0360 343 ILE A N   
2203 C CA  . ILE A 299 ? 0.5210 0.8090 0.5226 0.0961  -0.0267 -0.0199 343 ILE A CA  
2204 C C   . ILE A 299 ? 0.5267 0.7921 0.4748 0.1173  -0.0308 -0.0110 343 ILE A C   
2205 O O   . ILE A 299 ? 0.5071 0.7823 0.4421 0.1262  -0.0488 -0.0210 343 ILE A O   
2206 C CB  . ILE A 299 ? 0.4868 0.7674 0.4963 0.0697  -0.0238 -0.0259 343 ILE A CB  
2207 C CG1 . ILE A 299 ? 0.4948 0.7790 0.5394 0.0470  -0.0128 -0.0293 343 ILE A CG1 
2208 C CG2 . ILE A 299 ? 0.4753 0.7192 0.4482 0.0652  -0.0097 -0.0129 343 ILE A CG2 
2209 C CD1 . ILE A 299 ? 0.4676 0.7298 0.5091 0.0228  -0.0093 -0.0309 343 ILE A CD1 
2210 N N   . PHE A 300 ? 0.6630 0.8932 0.5758 0.1253  -0.0131 0.0072  344 PHE A N   
2211 C CA  . PHE A 300 ? 0.6763 0.8752 0.5334 0.1395  -0.0076 0.0182  344 PHE A CA  
2212 C C   . PHE A 300 ? 0.6704 0.8398 0.5177 0.1180  0.0175  0.0281  344 PHE A C   
2213 O O   . PHE A 300 ? 0.6736 0.8321 0.5397 0.1012  0.0299  0.0331  344 PHE A O   
2214 C CB  . PHE A 300 ? 0.7251 0.8999 0.5437 0.1682  -0.0068 0.0322  344 PHE A CB  
2215 C CG  . PHE A 300 ? 0.7240 0.9294 0.5552 0.1952  -0.0365 0.0216  344 PHE A CG  
2216 C CD1 . PHE A 300 ? 0.7097 0.9534 0.6014 0.1924  -0.0439 0.0110  344 PHE A CD1 
2217 C CD2 . PHE A 300 ? 0.7380 0.9315 0.5193 0.2252  -0.0567 0.0222  344 PHE A CD2 
2218 C CE1 . PHE A 300 ? 0.6965 0.9761 0.6142 0.2171  -0.0724 -0.0013 344 PHE A CE1 
2219 C CE2 . PHE A 300 ? 0.7334 0.9577 0.5319 0.2522  -0.0910 0.0100  344 PHE A CE2 
2220 C CZ  . PHE A 300 ? 0.7082 0.9799 0.5821 0.2474  -0.0991 -0.0025 344 PHE A CZ  
2221 N N   . THR A 301 ? 0.5794 0.7364 0.3991 0.1191  0.0244  0.0292  345 THR A N   
2222 C CA  . THR A 301 ? 0.5856 0.7184 0.4030 0.1018  0.0500  0.0383  345 THR A CA  
2223 C C   . THR A 301 ? 0.6386 0.7310 0.4033 0.1159  0.0717  0.0565  345 THR A C   
2224 O O   . THR A 301 ? 0.6571 0.7385 0.3743 0.1393  0.0671  0.0588  345 THR A O   
2225 C CB  . THR A 301 ? 0.5526 0.6998 0.3856 0.0906  0.0504  0.0259  345 THR A CB  
2226 O OG1 . THR A 301 ? 0.5653 0.7154 0.3623 0.1103  0.0418  0.0189  345 THR A OG1 
2227 C CG2 . THR A 301 ? 0.5091 0.6826 0.3884 0.0741  0.0329  0.0113  345 THR A CG2 
2228 N N   . SER A 302 ? 0.7772 0.8418 0.5450 0.1020  0.0944  0.0693  346 SER A N   
2229 C CA  . SER A 302 ? 0.8279 0.8471 0.5441 0.1126  0.1191  0.0879  346 SER A CA  
2230 C C   . SER A 302 ? 0.8306 0.8383 0.5384 0.1024  0.1474  0.0907  346 SER A C   
2231 O O   . SER A 302 ? 0.7973 0.8348 0.5453 0.0878  0.1470  0.0771  346 SER A O   
2232 C CB  . SER A 302 ? 0.8654 0.8527 0.5859 0.1023  0.1327  0.1005  346 SER A CB  
2233 O OG  . SER A 302 ? 0.8547 0.8497 0.6242 0.0717  0.1423  0.0950  346 SER A OG  
2234 N N   . ASP A 303 ? 0.9621 0.9226 0.6161 0.1115  0.1744  0.1091  347 ASP A N   
2235 C CA  . ASP A 303 ? 0.9765 0.9165 0.6228 0.0990  0.2132  0.1160  347 ASP A CA  
2236 C C   . ASP A 303 ? 0.9835 0.9140 0.6802 0.0690  0.2318  0.1213  347 ASP A C   
2237 O O   . ASP A 303 ? 0.9787 0.9167 0.7053 0.0614  0.2110  0.1178  347 ASP A O   
2238 C CB  . ASP A 303 ? 1.0234 0.9084 0.5774 0.1234  0.2351  0.1343  347 ASP A CB  
2239 C CG  . ASP A 303 ? 1.0711 0.8978 0.5846 0.1272  0.2512  0.1573  347 ASP A CG  
2240 O OD1 . ASP A 303 ? 1.0684 0.8989 0.6166 0.1189  0.2368  0.1573  347 ASP A OD1 
2241 O OD2 . ASP A 303 ? 1.1165 0.8858 0.5547 0.1403  0.2802  0.1760  347 ASP A OD2 
2242 N N   . ASP A 304 ? 1.3013 1.2153 1.0094 0.0513  0.2710  0.1277  348 ASP A N   
2243 C CA  . ASP A 304 ? 1.2964 1.2097 1.0673 0.0192  0.2845  0.1272  348 ASP A CA  
2244 C C   . ASP A 304 ? 1.3303 1.1883 1.0676 0.0173  0.2943  0.1449  348 ASP A C   
2245 O O   . ASP A 304 ? 1.3232 1.1731 1.1062 -0.0088 0.3005  0.1436  348 ASP A O   
2246 C CB  . ASP A 304 ? 1.2863 1.2077 1.0966 -0.0011 0.3246  0.1254  348 ASP A CB  
2247 C CG  . ASP A 304 ? 1.3244 1.1924 1.0650 0.0075  0.3715  0.1460  348 ASP A CG  
2248 O OD1 . ASP A 304 ? 1.3489 1.1921 1.0059 0.0382  0.3668  0.1542  348 ASP A OD1 
2249 O OD2 . ASP A 304 ? 1.3306 1.1786 1.0987 -0.0169 0.4129  0.1536  348 ASP A OD2 
2250 N N   . ARG A 305 ? 1.1789 0.9962 0.8354 0.0464  0.2936  0.1604  349 ARG A N   
2251 C CA  . ARG A 305 ? 1.2142 0.9746 0.8308 0.0520  0.2980  0.1770  349 ARG A CA  
2252 C C   . ARG A 305 ? 1.2094 0.9832 0.8306 0.0670  0.2580  0.1698  349 ARG A C   
2253 O O   . ARG A 305 ? 1.2307 0.9627 0.8340 0.0687  0.2593  0.1789  349 ARG A O   
2254 C CB  . ARG A 305 ? 1.2633 0.9622 0.7839 0.0789  0.3199  0.1996  349 ARG A CB  
2255 C CG  . ARG A 305 ? 1.2818 0.9450 0.7842 0.0621  0.3722  0.2126  349 ARG A CG  
2256 C CD  . ARG A 305 ? 1.3550 0.9613 0.7632 0.0919  0.3790  0.2277  349 ARG A CD  
2257 N NE  . ARG A 305 ? 1.3509 0.9834 0.7179 0.1246  0.3498  0.2196  349 ARG A NE  
2258 C CZ  . ARG A 305 ? 1.4106 1.0047 0.6999 0.1536  0.3439  0.2258  349 ARG A CZ  
2259 N NH1 . ARG A 305 ? 1.4959 1.0214 0.7357 0.1554  0.3681  0.2420  349 ARG A NH1 
2260 N NH2 . ARG A 305 ? 1.4034 1.0246 0.6629 0.1806  0.3130  0.2146  349 ARG A NH2 
2261 N N   . GLY A 306 ? 1.0914 0.9211 0.7387 0.0764  0.2258  0.1528  350 GLY A N   
2262 C CA  . GLY A 306 ? 1.0857 0.9323 0.7399 0.0913  0.1934  0.1453  350 GLY A CA  
2263 C C   . GLY A 306 ? 1.1136 0.9340 0.7045 0.1298  0.1832  0.1565  350 GLY A C   
2264 O O   . GLY A 306 ? 1.1170 0.9399 0.7095 0.1459  0.1640  0.1541  350 GLY A O   
2265 N N   . ILE A 307 ? 1.2182 1.0120 0.7516 0.1467  0.1961  0.1682  351 ILE A N   
2266 C CA  . ILE A 307 ? 1.2576 1.0110 0.7175 0.1855  0.1869  0.1821  351 ILE A CA  
2267 C C   . ILE A 307 ? 1.2425 1.0333 0.6853 0.2118  0.1566  0.1704  351 ILE A C   
2268 O O   . ILE A 307 ? 1.2337 1.0479 0.6820 0.2368  0.1229  0.1626  351 ILE A O   
2269 C CB  . ILE A 307 ? 1.3078 0.9831 0.6953 0.1874  0.2254  0.2071  351 ILE A CB  
2270 C CG1 . ILE A 307 ? 1.3175 0.9539 0.7278 0.1601  0.2512  0.2162  351 ILE A CG1 
2271 C CG2 . ILE A 307 ? 1.3593 0.9848 0.6546 0.2329  0.2122  0.2225  351 ILE A CG2 
2272 C CD1 . ILE A 307 ? 1.3606 0.9197 0.7137 0.1527  0.2946  0.2400  351 ILE A CD1 
2273 N N   . VAL A 308 ? 1.2476 1.0437 0.6722 0.2062  0.1690  0.1676  352 VAL A N   
2274 C CA  . VAL A 308 ? 1.2286 1.0567 0.6352 0.2279  0.1397  0.1533  352 VAL A CA  
2275 C C   . VAL A 308 ? 1.1655 1.0686 0.6555 0.2111  0.1139  0.1277  352 VAL A C   
2276 O O   . VAL A 308 ? 1.1349 1.0621 0.6829 0.1788  0.1289  0.1207  352 VAL A O   
2277 C CB  . VAL A 308 ? 1.2433 1.0450 0.5964 0.2280  0.1655  0.1577  352 VAL A CB  
2278 C CG1 . VAL A 308 ? 1.2433 1.0653 0.5619 0.2554  0.1304  0.1424  352 VAL A CG1 
2279 C CG2 . VAL A 308 ? 1.3272 1.0452 0.5943 0.2391  0.2006  0.1859  352 VAL A CG2 
2280 N N   . TYR A 309 ? 0.9235 0.8618 0.4213 0.2328  0.0739  0.1131  353 TYR A N   
2281 C CA  . TYR A 309 ? 0.8654 0.8697 0.4422 0.2154  0.0515  0.0898  353 TYR A CA  
2282 C C   . TYR A 309 ? 0.8386 0.8718 0.4072 0.2268  0.0247  0.0711  353 TYR A C   
2283 O O   . TYR A 309 ? 0.8779 0.8895 0.3843 0.2570  0.0080  0.0725  353 TYR A O   
2284 C CB  . TYR A 309 ? 0.8625 0.8916 0.4834 0.2212  0.0320  0.0855  353 TYR A CB  
2285 C CG  . TYR A 309 ? 0.8748 0.8854 0.5214 0.1988  0.0575  0.0957  353 TYR A CG  
2286 C CD1 . TYR A 309 ? 0.9220 0.8759 0.5240 0.2072  0.0782  0.1164  353 TYR A CD1 
2287 C CD2 . TYR A 309 ? 0.8418 0.8840 0.5504 0.1689  0.0600  0.0842  353 TYR A CD2 
2288 C CE1 . TYR A 309 ? 0.9327 0.8656 0.5566 0.1853  0.0990  0.1230  353 TYR A CE1 
2289 C CE2 . TYR A 309 ? 0.8593 0.8794 0.5842 0.1490  0.0790  0.0913  353 TYR A CE2 
2290 C CZ  . TYR A 309 ? 0.9022 0.8695 0.5873 0.1564  0.0978  0.1094  353 TYR A CZ  
2291 O OH  . TYR A 309 ? 0.9143 0.8572 0.6155 0.1354  0.1135  0.1134  353 TYR A OH  
2292 N N   . SER A 310 ? 1.0476 1.1229 0.6729 0.2032  0.0195  0.0532  354 SER A N   
2293 C CA  . SER A 310 ? 1.0241 1.1235 0.6459 0.2093  -0.0042 0.0330  354 SER A CA  
2294 C C   . SER A 310 ? 0.9821 1.1359 0.6790 0.1971  -0.0319 0.0133  354 SER A C   
2295 O O   . SER A 310 ? 0.9591 1.1298 0.7103 0.1715  -0.0204 0.0128  354 SER A O   
2296 C CB  . SER A 310 ? 1.0114 1.1013 0.6258 0.1923  0.0214  0.0300  354 SER A CB  
2297 O OG  . SER A 310 ? 0.9833 1.0997 0.6095 0.1918  -0.0010 0.0068  354 SER A OG  
2298 N N   . LYS A 311 ? 0.9904 1.1688 0.6892 0.2148  -0.0682 -0.0034 355 LYS A N   
2299 C CA  . LYS A 311 ? 0.9539 1.1838 0.7290 0.2010  -0.0902 -0.0222 355 LYS A CA  
2300 C C   . LYS A 311 ? 0.9154 1.1594 0.7205 0.1737  -0.0861 -0.0367 355 LYS A C   
2301 O O   . LYS A 311 ? 0.9116 1.1483 0.6864 0.1790  -0.0959 -0.0486 355 LYS A O   
2302 C CB  . LYS A 311 ? 0.9562 1.2127 0.7356 0.2264  -0.1329 -0.0389 355 LYS A CB  
2303 C CG  . LYS A 311 ? 0.9151 1.2287 0.7826 0.2095  -0.1530 -0.0606 355 LYS A CG  
2304 C CD  . LYS A 311 ? 0.9138 1.2554 0.7876 0.2335  -0.2003 -0.0822 355 LYS A CD  
2305 C CE  . LYS A 311 ? 0.8805 1.2809 0.8477 0.2290  -0.2176 -0.0970 355 LYS A CE  
2306 N NZ  . LYS A 311 ? 0.9026 1.3321 0.8798 0.2599  -0.2687 -0.1168 355 LYS A NZ  
2307 N N   . SER A 312 ? 0.6172 0.8761 0.4768 0.1465  -0.0722 -0.0360 356 SER A N   
2308 C CA  . SER A 312 ? 0.5858 0.8483 0.4706 0.1211  -0.0653 -0.0454 356 SER A CA  
2309 C C   . SER A 312 ? 0.5577 0.8546 0.4965 0.1065  -0.0870 -0.0662 356 SER A C   
2310 O O   . SER A 312 ? 0.5398 0.8391 0.4803 0.1001  -0.0988 -0.0823 356 SER A O   
2311 C CB  . SER A 312 ? 0.5817 0.8272 0.4813 0.1006  -0.0374 -0.0307 356 SER A CB  
2312 O OG  . SER A 312 ? 0.5562 0.8020 0.4764 0.0810  -0.0355 -0.0402 356 SER A OG  
2313 N N   . LEU A 313 ? 0.5904 0.9097 0.5749 0.0986  -0.0869 -0.0656 357 LEU A N   
2314 C CA  . LEU A 313 ? 0.5648 0.9139 0.6073 0.0784  -0.0982 -0.0833 357 LEU A CA  
2315 C C   . LEU A 313 ? 0.5633 0.9507 0.6535 0.0851  -0.1084 -0.0897 357 LEU A C   
2316 O O   . LEU A 313 ? 0.5847 0.9713 0.6801 0.0920  -0.0927 -0.0763 357 LEU A O   
2317 C CB  . LEU A 313 ? 0.5611 0.8926 0.6212 0.0497  -0.0756 -0.0767 357 LEU A CB  
2318 C CG  . LEU A 313 ? 0.5392 0.8843 0.6454 0.0244  -0.0805 -0.0921 357 LEU A CG  
2319 C CD1 . LEU A 313 ? 0.5174 0.8686 0.6238 0.0240  -0.1046 -0.1126 357 LEU A CD1 
2320 C CD2 . LEU A 313 ? 0.5488 0.8617 0.6516 0.0016  -0.0595 -0.0818 357 LEU A CD2 
2321 N N   . ASP A 314 ? 0.8032 1.2246 0.9332 0.0826  -0.1348 -0.1126 358 ASP A N   
2322 C CA  . ASP A 314 ? 0.7890 1.2584 0.9831 0.0875  -0.1484 -0.1250 358 ASP A CA  
2323 C C   . ASP A 314 ? 0.7720 1.2598 1.0320 0.0552  -0.1263 -0.1296 358 ASP A C   
2324 O O   . ASP A 314 ? 0.7650 1.2331 1.0258 0.0279  -0.1158 -0.1322 358 ASP A O   
2325 C CB  . ASP A 314 ? 0.7682 1.2671 0.9788 0.0994  -0.1916 -0.1507 358 ASP A CB  
2326 C CG  . ASP A 314 ? 0.7906 1.2894 0.9591 0.1407  -0.2186 -0.1484 358 ASP A CG  
2327 O OD1 . ASP A 314 ? 0.8103 1.3068 0.9720 0.1590  -0.2060 -0.1315 358 ASP A OD1 
2328 O OD2 . ASP A 314 ? 0.8110 1.3057 0.9467 0.1561  -0.2530 -0.1638 358 ASP A OD2 
2329 N N   . ARG A 315 ? 0.4540 0.9756 0.7658 0.0605  -0.1176 -0.1300 359 ARG A N   
2330 C CA  . ARG A 315 ? 0.4373 0.9835 0.8198 0.0322  -0.0942 -0.1374 359 ARG A CA  
2331 C C   . ARG A 315 ? 0.4595 0.9565 0.8077 0.0063  -0.0583 -0.1208 359 ARG A C   
2332 O O   . ARG A 315 ? 0.4518 0.9410 0.8231 -0.0246 -0.0462 -0.1272 359 ARG A O   
2333 C CB  . ARG A 315 ? 0.4158 1.0000 0.8626 0.0132  -0.1167 -0.1647 359 ARG A CB  
2334 C CG  . ARG A 315 ? 0.4120 1.0513 0.9051 0.0395  -0.1565 -0.1846 359 ARG A CG  
2335 C CD  . ARG A 315 ? 0.4197 1.0949 0.9749 0.0208  -0.1858 -0.2150 359 ARG A CD  
2336 N NE  . ARG A 315 ? 0.4054 1.1140 1.0526 -0.0139 -0.1590 -0.2257 359 ARG A NE  
2337 C CZ  . ARG A 315 ? 0.4011 1.1725 1.1412 -0.0098 -0.1572 -0.2385 359 ARG A CZ  
2338 N NH1 . ARG A 315 ? 0.4098 1.2151 1.1593 0.0307  -0.1857 -0.2417 359 ARG A NH1 
2339 N NH2 . ARG A 315 ? 0.3939 1.1910 1.2160 -0.0454 -0.1250 -0.2475 359 ARG A NH2 
2340 N N   . HIS A 316 ? 0.3904 0.8498 0.6801 0.0196  -0.0435 -0.0995 360 HIS A N   
2341 C CA  . HIS A 316 ? 0.4170 0.8254 0.6654 0.0002  -0.0167 -0.0837 360 HIS A CA  
2342 C C   . HIS A 316 ? 0.4240 0.8339 0.7021 -0.0130 0.0162  -0.0802 360 HIS A C   
2343 O O   . HIS A 316 ? 0.4256 0.8476 0.7118 0.0052  0.0269  -0.0751 360 HIS A O   
2344 C CB  . HIS A 316 ? 0.4478 0.8179 0.6304 0.0177  -0.0147 -0.0652 360 HIS A CB  
2345 C CG  . HIS A 316 ? 0.4751 0.7953 0.6198 0.0006  0.0074  -0.0509 360 HIS A CG  
2346 N ND1 . HIS A 316 ? 0.4907 0.7813 0.6009 0.0091  0.0232  -0.0354 360 HIS A ND1 
2347 C CD2 . HIS A 316 ? 0.4820 0.7728 0.6154 -0.0232 0.0126  -0.0509 360 HIS A CD2 
2348 C CE1 . HIS A 316 ? 0.4963 0.7440 0.5768 -0.0089 0.0346  -0.0278 360 HIS A CE1 
2349 N NE2 . HIS A 316 ? 0.5051 0.7514 0.5974 -0.0272 0.0281  -0.0361 360 HIS A NE2 
2350 N N   . LEU A 317 ? 0.6370 1.0281 0.9249 -0.0431 0.0346  -0.0822 361 LEU A N   
2351 C CA  . LEU A 317 ? 0.6462 1.0346 0.9583 -0.0571 0.0716  -0.0796 361 LEU A CA  
2352 C C   . LEU A 317 ? 0.6735 1.0136 0.9232 -0.0476 0.0921  -0.0603 361 LEU A C   
2353 O O   . LEU A 317 ? 0.6982 0.9850 0.8856 -0.0537 0.0897  -0.0485 361 LEU A O   
2354 C CB  . LEU A 317 ? 0.6593 1.0235 0.9795 -0.0923 0.0880  -0.0834 361 LEU A CB  
2355 C CG  . LEU A 317 ? 0.6723 1.0299 1.0195 -0.1142 0.1318  -0.0829 361 LEU A CG  
2356 C CD1 . LEU A 317 ? 0.6798 1.0286 1.0545 -0.1482 0.1383  -0.0922 361 LEU A CD1 
2357 C CD2 . LEU A 317 ? 0.7127 1.0023 0.9826 -0.1152 0.1596  -0.0629 361 LEU A CD2 
2358 N N   . TYR A 318 ? 0.7377 1.0980 1.0070 -0.0298 0.1078  -0.0592 362 TYR A N   
2359 C CA  . TYR A 318 ? 0.7563 1.0697 0.9738 -0.0236 0.1332  -0.0447 362 TYR A CA  
2360 C C   . TYR A 318 ? 0.7432 1.0881 1.0114 -0.0173 0.1639  -0.0514 362 TYR A C   
2361 O O   . TYR A 318 ? 0.7190 1.1147 1.0356 0.0073  0.1519  -0.0593 362 TYR A O   
2362 C CB  . TYR A 318 ? 0.7582 1.0535 0.9298 0.0019  0.1137  -0.0341 362 TYR A CB  
2363 C CG  . TYR A 318 ? 0.7763 1.0116 0.8852 0.0038  0.1334  -0.0203 362 TYR A CG  
2364 C CD1 . TYR A 318 ? 0.7624 0.9519 0.8130 0.0021  0.1189  -0.0096 362 TYR A CD1 
2365 C CD2 . TYR A 318 ? 0.8044 1.0286 0.9147 0.0072  0.1666  -0.0201 362 TYR A CD2 
2366 C CE1 . TYR A 318 ? 0.7776 0.9117 0.7739 0.0022  0.1316  -0.0001 362 TYR A CE1 
2367 C CE2 . TYR A 318 ? 0.8238 0.9867 0.8697 0.0092  0.1819  -0.0099 362 TYR A CE2 
2368 C CZ  . TYR A 318 ? 0.8112 0.9288 0.8002 0.0060  0.1612  -0.0003 362 TYR A CZ  
2369 O OH  . TYR A 318 ? 0.8313 0.8870 0.7584 0.0064  0.1697  0.0072  362 TYR A OH  
2370 N N   . THR A 319 ? 0.7179 1.0283 0.9694 -0.0355 0.2037  -0.0477 363 THR A N   
2371 C CA  . THR A 319 ? 0.7026 1.0481 1.0135 -0.0328 0.2404  -0.0566 363 THR A CA  
2372 C C   . THR A 319 ? 0.6982 1.0334 0.9892 -0.0029 0.2548  -0.0517 363 THR A C   
2373 O O   . THR A 319 ? 0.7220 0.9925 0.9304 0.0025  0.2574  -0.0383 363 THR A O   
2374 C CB  . THR A 319 ? 0.7273 1.0357 1.0255 -0.0642 0.2867  -0.0548 363 THR A CB  
2375 O OG1 . THR A 319 ? 0.7625 0.9890 0.9634 -0.0637 0.3079  -0.0397 363 THR A OG1 
2376 C CG2 . THR A 319 ? 0.7432 1.0426 1.0446 -0.0946 0.2741  -0.0569 363 THR A CG2 
2377 N N   . THR A 320 ? 1.5974 1.9973 1.9695 0.0168  0.2622  -0.0646 364 THR A N   
2378 C CA  . THR A 320 ? 1.5911 1.9885 1.9591 0.0488  0.2775  -0.0631 364 THR A CA  
2379 C C   . THR A 320 ? 1.6086 1.9540 1.9364 0.0377  0.3330  -0.0588 364 THR A C   
2380 O O   . THR A 320 ? 1.6285 1.9354 1.9104 0.0589  0.3483  -0.0532 364 THR A O   
2381 C CB  . THR A 320 ? 1.5509 2.0373 2.0277 0.0746  0.2684  -0.0807 364 THR A CB  
2382 O OG1 . THR A 320 ? 1.5380 2.0697 2.0490 0.0801  0.2164  -0.0875 364 THR A OG1 
2383 C CG2 . THR A 320 ? 1.5505 2.0292 2.0144 0.1156  0.2715  -0.0776 364 THR A CG2 
2384 N N   . THR A 321 ? 1.3880 1.7248 1.7254 0.0039  0.3634  -0.0612 365 THR A N   
2385 C CA  . THR A 321 ? 1.4349 1.7161 1.7267 -0.0097 0.4209  -0.0571 365 THR A CA  
2386 C C   . THR A 321 ? 1.4789 1.6660 1.6586 -0.0353 0.4235  -0.0418 365 THR A C   
2387 O O   . THR A 321 ? 1.4854 1.6647 1.6677 -0.0650 0.4251  -0.0406 365 THR A O   
2388 C CB  . THR A 321 ? 1.4376 1.7715 1.8218 -0.0301 0.4641  -0.0707 365 THR A CB  
2389 O OG1 . THR A 321 ? 1.4216 1.7674 1.8282 -0.0624 0.4459  -0.0721 365 THR A OG1 
2390 C CG2 . THR A 321 ? 1.3993 1.8325 1.9066 -0.0036 0.4598  -0.0892 365 THR A CG2 
2391 N N   . GLY A 322 ? 1.7640 1.8762 1.8459 -0.0235 0.4246  -0.0313 366 GLY A N   
2392 C CA  . GLY A 322 ? 1.8079 1.8306 1.7834 -0.0433 0.4186  -0.0185 366 GLY A CA  
2393 C C   . GLY A 322 ? 1.7871 1.7954 1.7278 -0.0413 0.3609  -0.0111 366 GLY A C   
2394 O O   . GLY A 322 ? 1.8257 1.7606 1.6794 -0.0507 0.3480  -0.0019 366 GLY A O   
2395 N N   . GLY A 323 ? 1.2502 1.3271 1.2583 -0.0282 0.3261  -0.0160 367 GLY A N   
2396 C CA  . GLY A 323 ? 1.2502 1.3180 1.2308 -0.0228 0.2780  -0.0096 367 GLY A CA  
2397 C C   . GLY A 323 ? 1.2730 1.3133 1.2231 -0.0461 0.2543  -0.0048 367 GLY A C   
2398 O O   . GLY A 323 ? 1.2885 1.2805 1.1783 -0.0468 0.2310  0.0027  367 GLY A O   
2399 N N   . GLU A 324 ? 1.4441 1.5155 1.4406 -0.0647 0.2595  -0.0106 368 GLU A N   
2400 C CA  . GLU A 324 ? 1.4666 1.5138 1.4403 -0.0843 0.2366  -0.0075 368 GLU A CA  
2401 C C   . GLU A 324 ? 1.4341 1.5380 1.4588 -0.0770 0.1978  -0.0137 368 GLU A C   
2402 O O   . GLU A 324 ? 1.4042 1.5747 1.5018 -0.0704 0.1955  -0.0244 368 GLU A O   
2403 C CB  . GLU A 324 ? 1.4905 1.5265 1.4769 -0.1112 0.2649  -0.0098 368 GLU A CB  
2404 C CG  . GLU A 324 ? 1.5092 1.5225 1.4855 -0.1177 0.3191  -0.0092 368 GLU A CG  
2405 C CD  . GLU A 324 ? 1.5503 1.4797 1.4242 -0.1103 0.3323  0.0016  368 GLU A CD  
2406 O OE1 . GLU A 324 ? 1.5741 1.4516 1.3802 -0.1087 0.2989  0.0094  368 GLU A OE1 
2407 O OE2 . GLU A 324 ? 1.5590 1.4750 1.4231 -0.1059 0.3760  0.0004  368 GLU A OE2 
2408 N N   . THR A 325 ? 0.7199 0.7956 0.7049 -0.0770 0.1667  -0.0081 369 THR A N   
2409 C CA  . THR A 325 ? 0.7020 0.8140 0.7197 -0.0762 0.1341  -0.0140 369 THR A CA  
2410 C C   . THR A 325 ? 0.7326 0.7967 0.7094 -0.0922 0.1194  -0.0101 369 THR A C   
2411 O O   . THR A 325 ? 0.7619 0.7643 0.6786 -0.0980 0.1248  -0.0014 369 THR A O   
2412 C CB  . THR A 325 ? 0.6738 0.8087 0.6935 -0.0535 0.1111  -0.0122 369 THR A CB  
2413 O OG1 . THR A 325 ? 0.6624 0.8320 0.7113 -0.0519 0.0846  -0.0196 369 THR A OG1 
2414 C CG2 . THR A 325 ? 0.6800 0.7615 0.6399 -0.0512 0.1035  -0.0018 369 THR A CG2 
2415 N N   . ASP A 326 ? 0.5953 0.6848 0.6033 -0.0980 0.0998  -0.0180 370 ASP A N   
2416 C CA  . ASP A 326 ? 0.6274 0.6751 0.6032 -0.1087 0.0822  -0.0160 370 ASP A CA  
2417 C C   . ASP A 326 ? 0.6128 0.6623 0.5754 -0.0934 0.0529  -0.0144 370 ASP A C   
2418 O O   . ASP A 326 ? 0.6373 0.6635 0.5853 -0.0970 0.0342  -0.0153 370 ASP A O   
2419 C CB  . ASP A 326 ? 0.6271 0.6943 0.6417 -0.1235 0.0777  -0.0270 370 ASP A CB  
2420 C CG  . ASP A 326 ? 0.6518 0.6934 0.6667 -0.1466 0.1090  -0.0260 370 ASP A CG  
2421 O OD1 . ASP A 326 ? 0.6885 0.6763 0.6498 -0.1508 0.1302  -0.0142 370 ASP A OD1 
2422 O OD2 . ASP A 326 ? 0.6331 0.7036 0.6985 -0.1615 0.1137  -0.0374 370 ASP A OD2 
2423 N N   . PHE A 327 ? 0.6302 0.7058 0.6003 -0.0762 0.0513  -0.0122 371 PHE A N   
2424 C CA  . PHE A 327 ? 0.5967 0.6848 0.5675 -0.0632 0.0300  -0.0121 371 PHE A CA  
2425 C C   . PHE A 327 ? 0.6002 0.6419 0.5344 -0.0664 0.0171  -0.0063 371 PHE A C   
2426 O O   . PHE A 327 ? 0.6093 0.6151 0.5101 -0.0674 0.0227  0.0008  371 PHE A O   
2427 C CB  . PHE A 327 ? 0.5630 0.6781 0.5420 -0.0452 0.0347  -0.0085 371 PHE A CB  
2428 C CG  . PHE A 327 ? 0.5350 0.6591 0.5127 -0.0341 0.0202  -0.0072 371 PHE A CG  
2429 C CD1 . PHE A 327 ? 0.5345 0.6278 0.4900 -0.0357 0.0160  -0.0007 371 PHE A CD1 
2430 C CD2 . PHE A 327 ? 0.5187 0.6803 0.5175 -0.0229 0.0113  -0.0137 371 PHE A CD2 
2431 C CE1 . PHE A 327 ? 0.5227 0.6270 0.4855 -0.0282 0.0088  -0.0001 371 PHE A CE1 
2432 C CE2 . PHE A 327 ? 0.5005 0.6654 0.4927 -0.0131 0.0051  -0.0117 371 PHE A CE2 
2433 C CZ  . PHE A 327 ? 0.5059 0.6444 0.4843 -0.0168 0.0068  -0.0045 371 PHE A CZ  
2434 N N   . THR A 328 ? 0.6576 0.7024 0.6015 -0.0657 -0.0023 -0.0113 372 THR A N   
2435 C CA  . THR A 328 ? 0.6688 0.6734 0.5889 -0.0684 -0.0192 -0.0091 372 THR A CA  
2436 C C   . THR A 328 ? 0.6297 0.6571 0.5748 -0.0583 -0.0349 -0.0135 372 THR A C   
2437 O O   . THR A 328 ? 0.6075 0.6633 0.5778 -0.0532 -0.0397 -0.0215 372 THR A O   
2438 C CB  . THR A 328 ? 0.7177 0.6857 0.6196 -0.0795 -0.0261 -0.0112 372 THR A CB  
2439 O OG1 . THR A 328 ? 0.7772 0.7108 0.6464 -0.0911 -0.0061 -0.0048 372 THR A OG1 
2440 C CG2 . THR A 328 ? 0.7238 0.6540 0.6060 -0.0765 -0.0517 -0.0109 372 THR A CG2 
2441 N N   . ASN A 329 ? 0.6132 0.6271 0.5522 -0.0561 -0.0410 -0.0096 373 ASN A N   
2442 C CA  . ASN A 329 ? 0.5981 0.6274 0.5660 -0.0502 -0.0547 -0.0147 373 ASN A CA  
2443 C C   . ASN A 329 ? 0.6056 0.6078 0.5705 -0.0515 -0.0788 -0.0203 373 ASN A C   
2444 O O   . ASN A 329 ? 0.6313 0.5889 0.5647 -0.0561 -0.0929 -0.0174 373 ASN A O   
2445 C CB  . ASN A 329 ? 0.6036 0.6280 0.5749 -0.0507 -0.0536 -0.0105 373 ASN A CB  
2446 C CG  . ASN A 329 ? 0.5991 0.6471 0.6134 -0.0470 -0.0612 -0.0165 373 ASN A CG  
2447 O OD1 . ASN A 329 ? 0.5894 0.6534 0.6292 -0.0417 -0.0704 -0.0248 373 ASN A OD1 
2448 N ND2 . ASN A 329 ? 0.6109 0.6603 0.6368 -0.0502 -0.0548 -0.0133 373 ASN A ND2 
2449 N N   . VAL A 330 ? 0.5810 0.6054 0.5737 -0.0449 -0.0847 -0.0290 374 VAL A N   
2450 C CA  . VAL A 330 ? 0.5911 0.5900 0.5850 -0.0417 -0.1093 -0.0351 374 VAL A CA  
2451 C C   . VAL A 330 ? 0.5778 0.5931 0.6106 -0.0346 -0.1231 -0.0403 374 VAL A C   
2452 O O   . VAL A 330 ? 0.5659 0.6231 0.6429 -0.0270 -0.1141 -0.0472 374 VAL A O   
2453 C CB  . VAL A 330 ? 0.5879 0.5998 0.5955 -0.0366 -0.1093 -0.0444 374 VAL A CB  
2454 C CG1 . VAL A 330 ? 0.6072 0.5866 0.6140 -0.0300 -0.1358 -0.0506 374 VAL A CG1 
2455 C CG2 . VAL A 330 ? 0.5966 0.6009 0.5801 -0.0470 -0.0948 -0.0416 374 VAL A CG2 
2456 N N   . THR A 331 ? 0.5683 0.5484 0.5837 -0.0376 -0.1443 -0.0380 375 THR A N   
2457 C CA  . THR A 331 ? 0.5517 0.5502 0.6069 -0.0366 -0.1539 -0.0425 375 THR A CA  
2458 C C   . THR A 331 ? 0.5439 0.5530 0.6455 -0.0252 -0.1811 -0.0551 375 THR A C   
2459 O O   . THR A 331 ? 0.5291 0.5565 0.6764 -0.0250 -0.1937 -0.0619 375 THR A O   
2460 C CB  . THR A 331 ? 0.5690 0.5271 0.5877 -0.0449 -0.1670 -0.0374 375 THR A CB  
2461 O OG1 . THR A 331 ? 0.6111 0.5098 0.5758 -0.0432 -0.1937 -0.0359 375 THR A OG1 
2462 C CG2 . THR A 331 ? 0.5755 0.5337 0.5642 -0.0531 -0.1359 -0.0270 375 THR A CG2 
2463 N N   . SER A 332 ? 0.6312 0.6279 0.7243 -0.0161 -0.1904 -0.0592 376 SER A N   
2464 C CA  . SER A 332 ? 0.6342 0.6382 0.7704 -0.0007 -0.2166 -0.0720 376 SER A CA  
2465 C C   . SER A 332 ? 0.6211 0.6775 0.8116 0.0092  -0.1948 -0.0823 376 SER A C   
2466 O O   . SER A 332 ? 0.6298 0.6954 0.8596 0.0250  -0.2114 -0.0947 376 SER A O   
2467 C CB  . SER A 332 ? 0.6831 0.6262 0.7675 0.0060  -0.2438 -0.0701 376 SER A CB  
2468 O OG  . SER A 332 ? 0.6955 0.6256 0.7425 0.0001  -0.2210 -0.0647 376 SER A OG  
2469 N N   . LEU A 333 ? 0.4483 0.5315 0.6322 0.0030  -0.1591 -0.0777 377 LEU A N   
2470 C CA  . LEU A 333 ? 0.4249 0.5540 0.6508 0.0123  -0.1342 -0.0868 377 LEU A CA  
2471 C C   . LEU A 333 ? 0.4010 0.5565 0.6197 0.0039  -0.0984 -0.0782 377 LEU A C   
2472 O O   . LEU A 333 ? 0.3984 0.5397 0.5692 -0.0035 -0.0886 -0.0684 377 LEU A O   
2473 C CB  . LEU A 333 ? 0.4354 0.5537 0.6420 0.0221  -0.1343 -0.0942 377 LEU A CB  
2474 C CG  . LEU A 333 ? 0.4335 0.5892 0.6744 0.0359  -0.1118 -0.1070 377 LEU A CG  
2475 C CD1 . LEU A 333 ? 0.4303 0.6061 0.7355 0.0484  -0.1232 -0.1187 377 LEU A CD1 
2476 C CD2 . LEU A 333 ? 0.4640 0.5994 0.6750 0.0437  -0.1150 -0.1155 377 LEU A CD2 
2477 N N   . ARG A 334 ? 0.4214 0.6137 0.6882 0.0062  -0.0777 -0.0822 378 ARG A N   
2478 C CA  . ARG A 334 ? 0.4391 0.6489 0.6980 0.0001  -0.0431 -0.0729 378 ARG A CA  
2479 C C   . ARG A 334 ? 0.4698 0.6785 0.6810 0.0070  -0.0250 -0.0704 378 ARG A C   
2480 O O   . ARG A 334 ? 0.4782 0.6905 0.6877 0.0188  -0.0265 -0.0816 378 ARG A O   
2481 C CB  . ARG A 334 ? 0.4286 0.6749 0.7513 0.0020  -0.0198 -0.0797 378 ARG A CB  
2482 C CG  . ARG A 334 ? 0.4405 0.6993 0.7530 -0.0021 0.0230  -0.0700 378 ARG A CG  
2483 C CD  . ARG A 334 ? 0.4147 0.7088 0.7984 -0.0016 0.0507  -0.0787 378 ARG A CD  
2484 N NE  . ARG A 334 ? 0.4096 0.7222 0.8149 0.0165  0.0570  -0.0941 378 ARG A NE  
2485 C CZ  . ARG A 334 ? 0.4196 0.7358 0.7954 0.0278  0.0924  -0.0950 378 ARG A CZ  
2486 N NH1 . ARG A 334 ? 0.4330 0.7350 0.7571 0.0233  0.1212  -0.0798 378 ARG A NH1 
2487 N NH2 . ARG A 334 ? 0.4266 0.7548 0.8179 0.0457  0.0978  -0.1111 378 ARG A NH2 
2488 N N   . GLY A 335 ? 0.4863 0.6882 0.6591 0.0011  -0.0109 -0.0575 379 GLY A N   
2489 C CA  . GLY A 335 ? 0.4884 0.6916 0.6189 0.0093  0.0015  -0.0563 379 GLY A CA  
2490 C C   . GLY A 335 ? 0.4796 0.6656 0.5774 0.0061  -0.0184 -0.0566 379 GLY A C   
2491 O O   . GLY A 335 ? 0.4509 0.6412 0.5190 0.0115  -0.0128 -0.0565 379 GLY A O   
2492 N N   . VAL A 336 ? 0.5353 0.7003 0.6376 -0.0024 -0.0410 -0.0573 380 VAL A N   
2493 C CA  . VAL A 336 ? 0.5044 0.6507 0.5826 -0.0065 -0.0552 -0.0604 380 VAL A CA  
2494 C C   . VAL A 336 ? 0.4814 0.6081 0.5334 -0.0191 -0.0567 -0.0491 380 VAL A C   
2495 O O   . VAL A 336 ? 0.4845 0.5890 0.5314 -0.0265 -0.0635 -0.0420 380 VAL A O   
2496 C CB  . VAL A 336 ? 0.5027 0.6272 0.5915 -0.0054 -0.0770 -0.0695 380 VAL A CB  
2497 C CG1 . VAL A 336 ? 0.4883 0.5890 0.5504 -0.0127 -0.0859 -0.0723 380 VAL A CG1 
2498 C CG2 . VAL A 336 ? 0.5355 0.6786 0.6534 0.0094  -0.0744 -0.0830 380 VAL A CG2 
2499 N N   . TYR A 337 ? 0.5283 0.6636 0.5649 -0.0204 -0.0506 -0.0496 381 TYR A N   
2500 C CA  . TYR A 337 ? 0.5220 0.6461 0.5414 -0.0303 -0.0459 -0.0410 381 TYR A CA  
2501 C C   . TYR A 337 ? 0.5156 0.6391 0.5334 -0.0376 -0.0492 -0.0483 381 TYR A C   
2502 O O   . TYR A 337 ? 0.5026 0.6462 0.5299 -0.0320 -0.0534 -0.0600 381 TYR A O   
2503 C CB  . TYR A 337 ? 0.5191 0.6633 0.5336 -0.0235 -0.0304 -0.0329 381 TYR A CB  
2504 C CG  . TYR A 337 ? 0.5377 0.6807 0.5563 -0.0196 -0.0228 -0.0257 381 TYR A CG  
2505 C CD1 . TYR A 337 ? 0.5544 0.7147 0.5870 -0.0103 -0.0165 -0.0297 381 TYR A CD1 
2506 C CD2 . TYR A 337 ? 0.5498 0.6720 0.5584 -0.0265 -0.0194 -0.0161 381 TYR A CD2 
2507 C CE1 . TYR A 337 ? 0.5892 0.7493 0.6338 -0.0107 -0.0053 -0.0235 381 TYR A CE1 
2508 C CE2 . TYR A 337 ? 0.5782 0.6983 0.5965 -0.0264 -0.0131 -0.0112 381 TYR A CE2 
2509 C CZ  . TYR A 337 ? 0.6030 0.7438 0.6431 -0.0199 -0.0051 -0.0146 381 TYR A CZ  
2510 O OH  . TYR A 337 ? 0.6484 0.7875 0.7052 -0.0238 0.0054  -0.0100 381 TYR A OH  
2511 N N   . ILE A 338 ? 0.5461 0.6437 0.5509 -0.0512 -0.0463 -0.0428 382 ILE A N   
2512 C CA  . ILE A 338 ? 0.5534 0.6538 0.5656 -0.0622 -0.0435 -0.0496 382 ILE A CA  
2513 C C   . ILE A 338 ? 0.5728 0.6848 0.5873 -0.0677 -0.0259 -0.0432 382 ILE A C   
2514 O O   . ILE A 338 ? 0.5951 0.6934 0.5917 -0.0659 -0.0164 -0.0320 382 ILE A O   
2515 C CB  . ILE A 338 ? 0.5877 0.6420 0.5845 -0.0758 -0.0502 -0.0506 382 ILE A CB  
2516 C CG1 . ILE A 338 ? 0.5964 0.6067 0.5591 -0.0837 -0.0436 -0.0369 382 ILE A CG1 
2517 C CG2 . ILE A 338 ? 0.6096 0.6500 0.6065 -0.0665 -0.0691 -0.0575 382 ILE A CG2 
2518 C CD1 . ILE A 338 ? 0.6429 0.6007 0.5796 -0.1003 -0.0412 -0.0348 382 ILE A CD1 
2519 N N   . THR A 339 ? 0.4886 0.6270 0.5294 -0.0736 -0.0223 -0.0524 383 THR A N   
2520 C CA  . THR A 339 ? 0.5130 0.6689 0.5691 -0.0783 -0.0039 -0.0494 383 THR A CA  
2521 C C   . THR A 339 ? 0.4984 0.6801 0.5958 -0.0917 -0.0015 -0.0629 383 THR A C   
2522 O O   . THR A 339 ? 0.4758 0.6567 0.5849 -0.0989 -0.0155 -0.0750 383 THR A O   
2523 C CB  . THR A 339 ? 0.5048 0.6943 0.5660 -0.0576 -0.0025 -0.0455 383 THR A CB  
2524 O OG1 . THR A 339 ? 0.5387 0.7319 0.6059 -0.0592 0.0177  -0.0395 383 THR A OG1 
2525 C CG2 . THR A 339 ? 0.4632 0.6973 0.5503 -0.0443 -0.0182 -0.0585 383 THR A CG2 
2526 N N   . SER A 340 ? 0.5942 0.7992 0.7183 -0.0954 0.0167  -0.0627 384 SER A N   
2527 C CA  . SER A 340 ? 0.5753 0.8112 0.7527 -0.1108 0.0210  -0.0772 384 SER A CA  
2528 C C   . SER A 340 ? 0.5371 0.8370 0.7618 -0.0936 0.0081  -0.0894 384 SER A C   
2529 O O   . SER A 340 ? 0.5415 0.8568 0.7580 -0.0727 0.0102  -0.0817 384 SER A O   
2530 C CB  . SER A 340 ? 0.6126 0.8264 0.7945 -0.1316 0.0557  -0.0705 384 SER A CB  
2531 O OG  . SER A 340 ? 0.6519 0.8013 0.7894 -0.1497 0.0622  -0.0627 384 SER A OG  
2532 N N   . VAL A 341 ? 0.4075 0.7404 0.6782 -0.1011 -0.0091 -0.1091 385 VAL A N   
2533 C CA  . VAL A 341 ? 0.3958 0.7911 0.7190 -0.0856 -0.0251 -0.1235 385 VAL A CA  
2534 C C   . VAL A 341 ? 0.4039 0.8381 0.8070 -0.1082 -0.0171 -0.1411 385 VAL A C   
2535 O O   . VAL A 341 ? 0.4223 0.8348 0.8395 -0.1379 -0.0070 -0.1469 385 VAL A O   
2536 C CB  . VAL A 341 ? 0.3950 0.8051 0.7043 -0.0661 -0.0629 -0.1361 385 VAL A CB  
2537 C CG1 . VAL A 341 ? 0.3896 0.7688 0.6295 -0.0430 -0.0649 -0.1189 385 VAL A CG1 
2538 C CG2 . VAL A 341 ? 0.4110 0.8058 0.7281 -0.0867 -0.0769 -0.1522 385 VAL A CG2 
2539 N N   . LEU A 342 ? 0.4959 0.9867 0.9542 -0.0937 -0.0207 -0.1496 386 LEU A N   
2540 C CA  . LEU A 342 ? 0.4702 1.0113 1.0219 -0.1132 -0.0135 -0.1691 386 LEU A CA  
2541 C C   . LEU A 342 ? 0.4269 1.0118 1.0219 -0.1072 -0.0606 -0.1963 386 LEU A C   
2542 O O   . LEU A 342 ? 0.4145 1.0278 1.0028 -0.0741 -0.0930 -0.2013 386 LEU A O   
2543 C CB  . LEU A 342 ? 0.4701 1.0518 1.0664 -0.0984 0.0083  -0.1657 386 LEU A CB  
2544 C CG  . LEU A 342 ? 0.4340 1.0830 1.1450 -0.1132 0.0187  -0.1874 386 LEU A CG  
2545 C CD1 . LEU A 342 ? 0.4435 1.0679 1.1799 -0.1588 0.0557  -0.1893 386 LEU A CD1 
2546 C CD2 . LEU A 342 ? 0.4326 1.1143 1.1757 -0.0914 0.0428  -0.1816 386 LEU A CD2 
2547 N N   . SER A 343 ? 0.6251 1.5829 1.0418 -0.0870 -0.0132 -0.1130 387 SER A N   
2548 C CA  . SER A 343 ? 0.6336 1.6355 1.0419 -0.1014 -0.0279 -0.1294 387 SER A CA  
2549 C C   . SER A 343 ? 0.6095 1.6958 1.0280 -0.0871 -0.0341 -0.1240 387 SER A C   
2550 O O   . SER A 343 ? 0.5922 1.6988 1.0248 -0.0644 -0.0262 -0.1074 387 SER A O   
2551 C CB  . SER A 343 ? 0.6690 1.6394 1.0746 -0.1537 -0.0259 -0.1581 387 SER A CB  
2552 O OG  . SER A 343 ? 0.6659 1.6265 1.0871 -0.1795 -0.0135 -0.1621 387 SER A OG  
2553 N N   . GLU A 344 ? 1.1025 2.2400 1.5132 -0.0990 -0.0475 -0.1382 388 GLU A N   
2554 C CA  . GLU A 344 ? 1.0898 2.3157 1.5096 -0.0867 -0.0550 -0.1340 388 GLU A CA  
2555 C C   . GLU A 344 ? 1.0907 2.3403 1.5355 -0.1140 -0.0457 -0.1421 388 GLU A C   
2556 O O   . GLU A 344 ? 1.0915 2.3881 1.5523 -0.0901 -0.0422 -0.1266 388 GLU A O   
2557 C CB  . GLU A 344 ? 1.1065 2.3810 1.5110 -0.1009 -0.0703 -0.1514 388 GLU A CB  
2558 C CG  . GLU A 344 ? 1.1094 2.3738 1.4876 -0.0695 -0.0795 -0.1402 388 GLU A CG  
2559 C CD  . GLU A 344 ? 1.0983 2.3842 1.4734 -0.0122 -0.0798 -0.1056 388 GLU A CD  
2560 O OE1 . GLU A 344 ? 1.1102 2.4537 1.5000 0.0041  -0.0793 -0.0950 388 GLU A OE1 
2561 O OE2 . GLU A 344 ? 1.0895 2.3330 1.4467 0.0167  -0.0794 -0.0888 388 GLU A OE2 
2562 N N   . ASP A 345 ? 1.0486 2.2631 1.4951 -0.1634 -0.0404 -0.1658 389 ASP A N   
2563 C CA  . ASP A 345 ? 1.0459 2.2518 1.5123 -0.1915 -0.0264 -0.1703 389 ASP A CA  
2564 C C   . ASP A 345 ? 1.0110 2.1615 1.4824 -0.1684 -0.0120 -0.1499 389 ASP A C   
2565 O O   . ASP A 345 ? 0.9825 2.0777 1.4391 -0.1500 -0.0119 -0.1419 389 ASP A O   
2566 C CB  . ASP A 345 ? 1.0963 2.2559 1.5548 -0.2464 -0.0224 -0.1979 389 ASP A CB  
2567 C CG  . ASP A 345 ? 1.0955 2.1975 1.5630 -0.2720 -0.0039 -0.1974 389 ASP A CG  
2568 O OD1 . ASP A 345 ? 1.0736 2.2083 1.5616 -0.2648 0.0048  -0.1851 389 ASP A OD1 
2569 O OD2 . ASP A 345 ? 1.1193 2.1412 1.5713 -0.2974 0.0027  -0.2085 389 ASP A OD2 
2570 N N   . ASN A 346 ? 0.9453 2.1083 1.4361 -0.1701 0.0013  -0.1419 390 ASN A N   
2571 C CA  . ASN A 346 ? 0.9210 2.0294 1.4109 -0.1463 0.0152  -0.1239 390 ASN A CA  
2572 C C   . ASN A 346 ? 0.9400 1.9677 1.4236 -0.1814 0.0281  -0.1320 390 ASN A C   
2573 O O   . ASN A 346 ? 0.9498 1.9659 1.4432 -0.2015 0.0428  -0.1316 390 ASN A O   
2574 C CB  . ASN A 346 ? 0.9023 2.0563 1.4113 -0.1211 0.0259  -0.1079 390 ASN A CB  
2575 C CG  . ASN A 346 ? 0.9064 2.1248 1.4172 -0.0747 0.0160  -0.0933 390 ASN A CG  
2576 O OD1 . ASN A 346 ? 0.8962 2.1004 1.3892 -0.0455 0.0063  -0.0846 390 ASN A OD1 
2577 N ND2 . ASN A 346 ? 0.9284 2.2188 1.4594 -0.0667 0.0188  -0.0890 390 ASN A ND2 
2578 N N   . SER A 347 ? 0.3883 1.3576 0.8535 -0.1806 0.0238  -0.1348 391 SER A N   
2579 C CA  . SER A 347 ? 0.3869 1.2726 0.8405 -0.2090 0.0337  -0.1414 391 SER A CA  
2580 C C   . SER A 347 ? 0.3728 1.2134 0.8120 -0.1824 0.0299  -0.1324 391 SER A C   
2581 O O   . SER A 347 ? 0.3594 1.2288 0.7932 -0.1553 0.0169  -0.1285 391 SER A O   
2582 C CB  . SER A 347 ? 0.4212 1.2862 0.8661 -0.2538 0.0305  -0.1655 391 SER A CB  
2583 O OG  . SER A 347 ? 0.4227 1.3066 0.8564 -0.2474 0.0145  -0.1762 391 SER A OG  
2584 N N   . ILE A 348 ? 0.3907 1.1632 0.8229 -0.1897 0.0419  -0.1275 392 ILE A N   
2585 C CA  . ILE A 348 ? 0.3874 1.0978 0.7957 -0.1604 0.0392  -0.1142 392 ILE A CA  
2586 C C   . ILE A 348 ? 0.4113 1.0484 0.7978 -0.1802 0.0356  -0.1253 392 ILE A C   
2587 O O   . ILE A 348 ? 0.4339 1.0179 0.8146 -0.2098 0.0449  -0.1323 392 ILE A O   
2588 C CB  . ILE A 348 ? 0.3852 1.0466 0.7816 -0.1411 0.0526  -0.0947 392 ILE A CB  
2589 C CG1 . ILE A 348 ? 0.3684 1.1078 0.7877 -0.1206 0.0586  -0.0866 392 ILE A CG1 
2590 C CG2 . ILE A 348 ? 0.3883 0.9845 0.7558 -0.1093 0.0490  -0.0792 392 ILE A CG2 
2591 C CD1 . ILE A 348 ? 0.3727 1.0892 0.7904 -0.1225 0.0773  -0.0776 392 ILE A CD1 
2592 N N   . GLN A 349 ? 0.5672 1.2032 0.9409 -0.1622 0.0234  -0.1260 393 GLN A N   
2593 C CA  . GLN A 349 ? 0.6038 1.1689 0.9550 -0.1709 0.0217  -0.1330 393 GLN A CA  
2594 C C   . GLN A 349 ? 0.6016 1.1061 0.9305 -0.1396 0.0214  -0.1128 393 GLN A C   
2595 O O   . GLN A 349 ? 0.5787 1.1021 0.9040 -0.1078 0.0176  -0.0967 393 GLN A O   
2596 C CB  . GLN A 349 ? 0.6196 1.2240 0.9697 -0.1805 0.0100  -0.1529 393 GLN A CB  
2597 C CG  . GLN A 349 ? 0.6291 1.2846 0.9977 -0.2203 0.0096  -0.1782 393 GLN A CG  
2598 C CD  . GLN A 349 ? 0.5899 1.3455 0.9762 -0.2092 -0.0008 -0.1776 393 GLN A CD  
2599 O OE1 . GLN A 349 ? 0.5757 1.3721 0.9564 -0.1837 -0.0132 -0.1734 393 GLN A OE1 
2600 N NE2 . GLN A 349 ? 0.5799 1.3658 0.9793 -0.2227 0.0046  -0.1774 393 GLN A NE2 
2601 N N   . THR A 350 ? 0.4562 0.8875 0.7696 -0.1493 0.0258  -0.1138 394 THR A N   
2602 C CA  . THR A 350 ? 0.4531 0.8330 0.7478 -0.1251 0.0245  -0.0972 394 THR A CA  
2603 C C   . THR A 350 ? 0.4625 0.8493 0.7478 -0.1158 0.0162  -0.1033 394 THR A C   
2604 O O   . THR A 350 ? 0.4944 0.8930 0.7807 -0.1347 0.0141  -0.1241 394 THR A O   
2605 C CB  . THR A 350 ? 0.4780 0.7845 0.7618 -0.1352 0.0322  -0.0920 394 THR A CB  
2606 O OG1 . THR A 350 ? 0.4760 0.7761 0.7631 -0.1401 0.0403  -0.0831 394 THR A OG1 
2607 C CG2 . THR A 350 ? 0.4714 0.7368 0.7396 -0.1132 0.0291  -0.0764 394 THR A CG2 
2608 N N   . MET A 351 ? 0.4664 0.8469 0.7409 -0.0881 0.0126  -0.0859 395 MET A N   
2609 C CA  . MET A 351 ? 0.4785 0.8617 0.7412 -0.0770 0.0071  -0.0871 395 MET A CA  
2610 C C   . MET A 351 ? 0.4741 0.8029 0.7235 -0.0635 0.0099  -0.0706 395 MET A C   
2611 O O   . MET A 351 ? 0.4611 0.7642 0.7067 -0.0531 0.0127  -0.0534 395 MET A O   
2612 C CB  . MET A 351 ? 0.4706 0.9143 0.7325 -0.0568 -0.0003 -0.0811 395 MET A CB  
2613 C CG  . MET A 351 ? 0.4670 0.9834 0.7454 -0.0684 -0.0059 -0.0966 395 MET A CG  
2614 S SD  . MET A 351 ? 0.5093 1.0474 0.7878 -0.1007 -0.0104 -0.1303 395 MET A SD  
2615 C CE  . MET A 351 ? 0.5296 1.0979 0.7874 -0.0781 -0.0195 -0.1273 395 MET A CE  
2616 N N   . ILE A 352 ? 0.4495 0.7639 0.6915 -0.0646 0.0095  -0.0773 396 ILE A N   
2617 C CA  . ILE A 352 ? 0.4449 0.7195 0.6786 -0.0541 0.0120  -0.0630 396 ILE A CA  
2618 C C   . ILE A 352 ? 0.4489 0.7464 0.6724 -0.0397 0.0096  -0.0592 396 ILE A C   
2619 O O   . ILE A 352 ? 0.4738 0.8035 0.6942 -0.0431 0.0070  -0.0750 396 ILE A O   
2620 C CB  . ILE A 352 ? 0.4568 0.6882 0.6923 -0.0662 0.0169  -0.0711 396 ILE A CB  
2621 C CG1 . ILE A 352 ? 0.4500 0.6530 0.6816 -0.0549 0.0184  -0.0560 396 ILE A CG1 
2622 C CG2 . ILE A 352 ? 0.4950 0.7358 0.7290 -0.0776 0.0186  -0.0952 396 ILE A CG2 
2623 C CD1 . ILE A 352 ? 0.4607 0.6208 0.6959 -0.0614 0.0223  -0.0547 396 ILE A CD1 
2624 N N   . THR A 353 ? 0.3931 0.6747 0.6089 -0.0257 0.0109  -0.0387 397 THR A N   
2625 C CA  . THR A 353 ? 0.4064 0.7019 0.6106 -0.0134 0.0115  -0.0310 397 THR A CA  
2626 C C   . THR A 353 ? 0.3988 0.6611 0.6046 -0.0155 0.0163  -0.0245 397 THR A C   
2627 O O   . THR A 353 ? 0.3887 0.6193 0.5998 -0.0199 0.0171  -0.0152 397 THR A O   
2628 C CB  . THR A 353 ? 0.4192 0.7254 0.6115 0.0042  0.0110  -0.0101 397 THR A CB  
2629 O OG1 . THR A 353 ? 0.4398 0.7565 0.6184 0.0140  0.0135  -0.0010 397 THR A OG1 
2630 C CG2 . THR A 353 ? 0.4181 0.6834 0.6090 0.0053  0.0143  0.0061  397 THR A CG2 
2631 N N   . PHE A 354 ? 0.4587 0.7313 0.6610 -0.0129 0.0197  -0.0305 398 PHE A N   
2632 C CA  . PHE A 354 ? 0.4493 0.7019 0.6563 -0.0117 0.0250  -0.0212 398 PHE A CA  
2633 C C   . PHE A 354 ? 0.4556 0.7185 0.6533 -0.0033 0.0287  -0.0022 398 PHE A C   
2634 O O   . PHE A 354 ? 0.4470 0.6997 0.6514 -0.0050 0.0329  0.0082  398 PHE A O   
2635 C CB  . PHE A 354 ? 0.4550 0.7077 0.6658 -0.0127 0.0299  -0.0391 398 PHE A CB  
2636 C CG  . PHE A 354 ? 0.4637 0.6953 0.6809 -0.0228 0.0292  -0.0565 398 PHE A CG  
2637 C CD1 . PHE A 354 ? 0.4560 0.6542 0.6839 -0.0271 0.0292  -0.0496 398 PHE A CD1 
2638 C CD2 . PHE A 354 ? 0.4892 0.7344 0.6998 -0.0304 0.0285  -0.0796 398 PHE A CD2 
2639 C CE1 . PHE A 354 ? 0.4734 0.6460 0.7041 -0.0373 0.0306  -0.0633 398 PHE A CE1 
2640 C CE2 . PHE A 354 ? 0.5101 0.7300 0.7251 -0.0444 0.0299  -0.0959 398 PHE A CE2 
2641 C CZ  . PHE A 354 ? 0.5023 0.6830 0.7267 -0.0470 0.0320  -0.0863 398 PHE A CZ  
2642 N N   . ASP A 355 ? 0.6141 0.9008 0.7963 0.0055  0.0277  0.0027  399 ASP A N   
2643 C CA  . ASP A 355 ? 0.6336 0.9285 0.8018 0.0137  0.0335  0.0219  399 ASP A CA  
2644 C C   . ASP A 355 ? 0.6630 0.9402 0.8187 0.0196  0.0338  0.0440  399 ASP A C   
2645 O O   . ASP A 355 ? 0.6963 0.9857 0.8330 0.0312  0.0372  0.0582  399 ASP A O   
2646 C CB  . ASP A 355 ? 0.6485 0.9822 0.8016 0.0227  0.0354  0.0142  399 ASP A CB  
2647 C CG  . ASP A 355 ? 0.6637 1.0263 0.8085 0.0278  0.0269  0.0029  399 ASP A CG  
2648 O OD1 . ASP A 355 ? 0.6558 1.0113 0.8107 0.0238  0.0205  -0.0018 399 ASP A OD1 
2649 O OD2 . ASP A 355 ? 0.6834 1.0816 0.8116 0.0353  0.0267  -0.0016 399 ASP A OD2 
2650 N N   . GLN A 356 ? 0.4562 0.7056 0.6184 0.0145  0.0305  0.0453  400 GLN A N   
2651 C CA  . GLN A 356 ? 0.4965 0.7216 0.6439 0.0220  0.0327  0.0633  400 GLN A CA  
2652 C C   . GLN A 356 ? 0.5208 0.7737 0.6560 0.0415  0.0297  0.0658  400 GLN A C   
2653 O O   . GLN A 356 ? 0.5710 0.8135 0.6866 0.0565  0.0344  0.0853  400 GLN A O   
2654 C CB  . GLN A 356 ? 0.5322 0.7346 0.6660 0.0194  0.0416  0.0840  400 GLN A CB  
2655 C CG  . GLN A 356 ? 0.5784 0.7331 0.6984 0.0177  0.0460  0.0987  400 GLN A CG  
2656 C CD  . GLN A 356 ? 0.6117 0.7397 0.7186 0.0078  0.0562  0.1173  400 GLN A CD  
2657 O OE1 . GLN A 356 ? 0.6421 0.7761 0.7310 0.0178  0.0637  0.1327  400 GLN A OE1 
2658 N NE2 . GLN A 356 ? 0.6032 0.7033 0.7178 -0.0137 0.0565  0.1165  400 GLN A NE2 
2659 N N   . GLY A 357 ? 0.5017 0.7903 0.6484 0.0411  0.0223  0.0467  401 GLY A N   
2660 C CA  . GLY A 357 ? 0.5184 0.8421 0.6603 0.0574  0.0173  0.0475  401 GLY A CA  
2661 C C   . GLY A 357 ? 0.5421 0.9144 0.6706 0.0701  0.0140  0.0486  401 GLY A C   
2662 O O   . GLY A 357 ? 0.5573 0.9679 0.6801 0.0873  0.0087  0.0532  401 GLY A O   
2663 N N   . GLY A 358 ? 0.4122 0.7868 0.5352 0.0629  0.0173  0.0448  402 GLY A N   
2664 C CA  . GLY A 358 ? 0.4287 0.8484 0.5354 0.0722  0.0151  0.0431  402 GLY A CA  
2665 C C   . GLY A 358 ? 0.4096 0.8717 0.5274 0.0619  0.0053  0.0134  402 GLY A C   
2666 O O   . GLY A 358 ? 0.4250 0.9381 0.5301 0.0705  -0.0014 0.0087  402 GLY A O   
2667 N N   . ARG A 359 ? 0.7285 1.1707 0.8672 0.0425  0.0046  -0.0068 403 ARG A N   
2668 C CA  . ARG A 359 ? 0.7269 1.2038 0.8754 0.0293  -0.0034 -0.0346 403 ARG A CA  
2669 C C   . ARG A 359 ? 0.7092 1.1584 0.8803 0.0117  -0.0032 -0.0470 403 ARG A C   
2670 O O   . ARG A 359 ? 0.6856 1.0868 0.8640 0.0044  0.0032  -0.0444 403 ARG A O   
2671 C CB  . ARG A 359 ? 0.7338 1.2250 0.8720 0.0201  -0.0021 -0.0566 403 ARG A CB  
2672 C CG  . ARG A 359 ? 0.7374 1.2237 0.8876 -0.0032 -0.0035 -0.0886 403 ARG A CG  
2673 C CD  . ARG A 359 ? 0.7501 1.2372 0.8852 -0.0088 0.0015  -0.1095 403 ARG A CD  
2674 N NE  . ARG A 359 ? 0.7600 1.2310 0.8841 0.0065  0.0109  -0.0903 403 ARG A NE  
2675 C CZ  . ARG A 359 ? 0.7617 1.2656 0.8629 0.0205  0.0116  -0.0805 403 ARG A CZ  
2676 N NH1 . ARG A 359 ? 0.7515 1.3093 0.8368 0.0235  0.0014  -0.0882 403 ARG A NH1 
2677 N NH2 . ARG A 359 ? 0.7687 1.2557 0.8628 0.0308  0.0225  -0.0620 403 ARG A NH2 
2678 N N   . TRP A 360 ? 0.4615 0.9464 0.6435 0.0042  -0.0105 -0.0603 404 TRP A N   
2679 C CA  . TRP A 360 ? 0.4361 0.8988 0.6379 -0.0144 -0.0090 -0.0717 404 TRP A CA  
2680 C C   . TRP A 360 ? 0.4648 0.9442 0.6719 -0.0395 -0.0113 -0.1033 404 TRP A C   
2681 O O   . TRP A 360 ? 0.4832 1.0073 0.6811 -0.0420 -0.0174 -0.1178 404 TRP A O   
2682 C CB  . TRP A 360 ? 0.4042 0.8889 0.6165 -0.0049 -0.0117 -0.0594 404 TRP A CB  
2683 C CG  . TRP A 360 ? 0.3969 0.8516 0.6003 0.0174  -0.0069 -0.0311 404 TRP A CG  
2684 C CD1 . TRP A 360 ? 0.4186 0.8865 0.6049 0.0423  -0.0072 -0.0105 404 TRP A CD1 
2685 C CD2 . TRP A 360 ? 0.3878 0.7906 0.5953 0.0159  -0.0001 -0.0205 404 TRP A CD2 
2686 N NE1 . TRP A 360 ? 0.4238 0.8446 0.6032 0.0546  0.0002  0.0112  404 TRP A NE1 
2687 C CE2 . TRP A 360 ? 0.4063 0.7898 0.5985 0.0382  0.0038  0.0040  404 TRP A CE2 
2688 C CE3 . TRP A 360 ? 0.3735 0.7435 0.5930 -0.0024 0.0034  -0.0290 404 TRP A CE3 
2689 C CZ2 . TRP A 360 ? 0.4135 0.7465 0.6018 0.0403  0.0105  0.0165  404 TRP A CZ2 
2690 C CZ3 . TRP A 360 ? 0.3745 0.7000 0.5903 0.0017  0.0089  -0.0147 404 TRP A CZ3 
2691 C CH2 . TRP A 360 ? 0.3954 0.7030 0.5956 0.0218  0.0121  0.0061  404 TRP A CH2 
2692 N N   . THR A 361 ? 0.3910 0.8300 0.6097 -0.0587 -0.0058 -0.1139 405 THR A N   
2693 C CA  . THR A 361 ? 0.4215 0.8560 0.6411 -0.0847 -0.0041 -0.1438 405 THR A CA  
2694 C C   . THR A 361 ? 0.4185 0.8186 0.6534 -0.1038 0.0015  -0.1472 405 THR A C   
2695 O O   . THR A 361 ? 0.3900 0.7705 0.6326 -0.0947 0.0037  -0.1266 405 THR A O   
2696 C CB  . THR A 361 ? 0.4452 0.8418 0.6491 -0.0834 0.0029  -0.1539 405 THR A CB  
2697 O OG1 . THR A 361 ? 0.4890 0.8722 0.6885 -0.1080 0.0066  -0.1852 405 THR A OG1 
2698 C CG2 . THR A 361 ? 0.4236 0.7607 0.6309 -0.0731 0.0113  -0.1354 405 THR A CG2 
2699 N N   . HIS A 362 ? 0.7340 1.1233 0.9701 -0.1313 0.0050  -0.1731 406 HIS A N   
2700 C CA  . HIS A 362 ? 0.7341 1.0858 0.9811 -0.1512 0.0126  -0.1751 406 HIS A CA  
2701 C C   . HIS A 362 ? 0.7508 1.0258 0.9891 -0.1459 0.0226  -0.1686 406 HIS A C   
2702 O O   . HIS A 362 ? 0.7795 1.0336 1.0048 -0.1405 0.0257  -0.1781 406 HIS A O   
2703 C CB  . HIS A 362 ? 0.7779 1.1490 1.0291 -0.1866 0.0135  -0.2048 406 HIS A CB  
2704 C CG  . HIS A 362 ? 0.7326 1.1890 0.9989 -0.1939 0.0031  -0.2098 406 HIS A CG  
2705 N ND1 . HIS A 362 ? 0.7017 1.1834 0.9889 -0.2081 0.0049  -0.2059 406 HIS A ND1 
2706 C CD2 . HIS A 362 ? 0.7132 1.2410 0.9772 -0.1887 -0.0090 -0.2186 406 HIS A CD2 
2707 C CE1 . HIS A 362 ? 0.6641 1.2319 0.9644 -0.2097 -0.0058 -0.2115 406 HIS A CE1 
2708 N NE2 . HIS A 362 ? 0.6699 1.2672 0.9557 -0.1977 -0.0153 -0.2186 406 HIS A NE2 
2709 N N   . LEU A 363 ? 0.4720 0.7103 0.7165 -0.1448 0.0274  -0.1513 407 LEU A N   
2710 C CA  . LEU A 363 ? 0.4886 0.6598 0.7266 -0.1415 0.0361  -0.1443 407 LEU A CA  
2711 C C   . LEU A 363 ? 0.5524 0.6862 0.7824 -0.1632 0.0454  -0.1679 407 LEU A C   
2712 O O   . LEU A 363 ? 0.5874 0.7335 0.8215 -0.1900 0.0475  -0.1836 407 LEU A O   
2713 C CB  . LEU A 363 ? 0.4681 0.6136 0.7115 -0.1410 0.0387  -0.1237 407 LEU A CB  
2714 C CG  . LEU A 363 ? 0.4200 0.5812 0.6656 -0.1193 0.0322  -0.0999 407 LEU A CG  
2715 C CD1 . LEU A 363 ? 0.3963 0.6146 0.6492 -0.1170 0.0262  -0.0997 407 LEU A CD1 
2716 C CD2 . LEU A 363 ? 0.4137 0.5383 0.6579 -0.1192 0.0357  -0.0823 407 LEU A CD2 
2717 N N   . ARG A 364 ? 0.9761 1.0625 1.1948 -0.1523 0.0526  -0.1701 408 ARG A N   
2718 C CA  . ARG A 364 ? 1.0556 1.0933 1.2615 -0.1695 0.0644  -0.1928 408 ARG A CA  
2719 C C   . ARG A 364 ? 1.0991 1.0814 1.3045 -0.1819 0.0741  -0.1832 408 ARG A C   
2720 O O   . ARG A 364 ? 1.0640 1.0253 1.2727 -0.1649 0.0739  -0.1573 408 ARG A O   
2721 C CB  . ARG A 364 ? 1.0448 1.0525 1.2379 -0.1478 0.0707  -0.1977 408 ARG A CB  
2722 C CG  . ARG A 364 ? 1.0942 1.0258 1.2722 -0.1533 0.0869  -0.2096 408 ARG A CG  
2723 C CD  . ARG A 364 ? 1.0833 0.9979 1.2456 -0.1372 0.0947  -0.2271 408 ARG A CD  
2724 N NE  . ARG A 364 ? 1.0200 0.9928 1.1884 -0.1149 0.0852  -0.2190 408 ARG A NE  
2725 C CZ  . ARG A 364 ? 0.9482 0.9273 1.1269 -0.0854 0.0835  -0.1927 408 ARG A CZ  
2726 N NH1 . ARG A 364 ? 0.9307 0.8677 1.1156 -0.0728 0.0882  -0.1719 408 ARG A NH1 
2727 N NH2 . ARG A 364 ? 0.8928 0.9229 1.0754 -0.0695 0.0768  -0.1855 408 ARG A NH2 
2728 N N   . LYS A 365 ? 0.9499 0.9104 1.1493 -0.2140 0.0826  -0.2043 409 LYS A N   
2729 C CA  . LYS A 365 ? 0.9881 0.8925 1.1835 -0.2296 0.0944  -0.1952 409 LYS A CA  
2730 C C   . LYS A 365 ? 1.0228 0.8458 1.2004 -0.2113 0.1071  -0.1880 409 LYS A C   
2731 O O   . LYS A 365 ? 1.0141 0.8179 1.1804 -0.1991 0.1113  -0.2032 409 LYS A O   
2732 C CB  . LYS A 365 ? 1.0104 0.9154 1.2046 -0.2739 0.1015  -0.2208 409 LYS A CB  
2733 C CG  . LYS A 365 ? 1.0509 0.8977 1.2231 -0.2921 0.1147  -0.2504 409 LYS A CG  
2734 C CD  . LYS A 365 ? 1.0710 0.8913 1.2396 -0.3388 0.1269  -0.2663 409 LYS A CD  
2735 C CE  . LYS A 365 ? 1.1057 0.8703 1.2496 -0.3639 0.1400  -0.3023 409 LYS A CE  
2736 N NZ  . LYS A 365 ? 1.1517 0.8104 1.2697 -0.3425 0.1578  -0.2939 409 LYS A NZ  
2737 N N   . PRO A 366 ? 0.9390 0.7157 1.1127 -0.2074 0.1141  -0.1641 410 PRO A N   
2738 C CA  . PRO A 366 ? 0.9784 0.6798 1.1355 -0.1856 0.1260  -0.1523 410 PRO A CA  
2739 C C   . PRO A 366 ? 1.0288 0.6695 1.1651 -0.2005 0.1426  -0.1809 410 PRO A C   
2740 O O   . PRO A 366 ? 1.0484 0.6947 1.1821 -0.2382 0.1464  -0.2056 410 PRO A O   
2741 C CB  . PRO A 366 ? 0.9846 0.6528 1.1376 -0.1912 0.1312  -0.1261 410 PRO A CB  
2742 C CG  . PRO A 366 ? 0.9136 0.6532 1.0855 -0.1987 0.1172  -0.1167 410 PRO A CG  
2743 C CD  . PRO A 366 ? 0.9061 0.6997 1.0886 -0.2215 0.1121  -0.1463 410 PRO A CD  
2744 N N   . GLU A 367 ? 1.9105 1.4978 2.0325 -0.1719 0.1525  -0.1790 411 GLU A N   
2745 C CA  . GLU A 367 ? 1.9395 1.4622 2.0372 -0.1828 0.1703  -0.2092 411 GLU A CA  
2746 C C   . GLU A 367 ? 1.9955 1.4529 2.0760 -0.2224 0.1863  -0.2185 411 GLU A C   
2747 O O   . GLU A 367 ? 2.0198 1.4615 2.0879 -0.2584 0.1941  -0.2534 411 GLU A O   
2748 C CB  . GLU A 367 ? 1.9183 1.3859 2.0032 -0.1388 0.1816  -0.1983 411 GLU A CB  
2749 C CG  . GLU A 367 ? 1.9988 1.3560 2.0518 -0.1436 0.2072  -0.2090 411 GLU A CG  
2750 C CD  . GLU A 367 ? 1.9997 1.3055 2.0413 -0.0931 0.2196  -0.1961 411 GLU A CD  
2751 O OE1 . GLU A 367 ? 1.9232 1.2866 1.9843 -0.0570 0.2079  -0.1816 411 GLU A OE1 
2752 O OE2 . GLU A 367 ? 2.0746 1.2815 2.0878 -0.0892 0.2423  -0.1996 411 GLU A OE2 
2753 N N   . ASN A 368 ? 1.5513 0.9730 1.6299 -0.2176 0.1912  -0.1870 412 ASN A N   
2754 C CA  . ASN A 368 ? 1.5997 0.9511 1.6581 -0.2496 0.2088  -0.1876 412 ASN A CA  
2755 C C   . ASN A 368 ? 1.6016 1.0077 1.6739 -0.2860 0.2004  -0.1819 412 ASN A C   
2756 O O   . ASN A 368 ? 1.6306 1.0041 1.6868 -0.3077 0.2088  -0.1761 412 ASN A O   
2757 C CB  . ASN A 368 ? 1.6124 0.8893 1.6523 -0.2164 0.2199  -0.1519 412 ASN A CB  
2758 C CG  . ASN A 368 ? 1.6080 0.8237 1.6297 -0.1788 0.2318  -0.1565 412 ASN A CG  
2759 O OD1 . ASN A 368 ? 1.6252 0.8122 1.6283 -0.1893 0.2401  -0.1867 412 ASN A OD1 
2760 N ND2 . ASN A 368 ? 1.5748 0.7837 1.6016 -0.1312 0.2295  -0.1248 412 ASN A ND2 
2761 N N   . SER A 369 ? 1.3278 0.8203 1.4299 -0.2891 0.1840  -0.1814 413 SER A N   
2762 C CA  . SER A 369 ? 1.3122 0.8614 1.4294 -0.3206 0.1780  -0.1780 413 SER A CA  
2763 C C   . SER A 369 ? 1.3226 0.9021 1.4377 -0.3574 0.1769  -0.2099 413 SER A C   
2764 O O   . SER A 369 ? 1.3277 0.9159 1.4390 -0.3602 0.1743  -0.2387 413 SER A O   
2765 C CB  . SER A 369 ? 1.2556 0.8955 1.4012 -0.3043 0.1581  -0.1649 413 SER A CB  
2766 O OG  . SER A 369 ? 1.2350 0.8657 1.3797 -0.2855 0.1571  -0.1291 413 SER A OG  
2767 N N   . GLU A 370 ? 1.5543 1.1513 1.6713 -0.3856 0.1793  -0.2045 414 GLU A N   
2768 C CA  . GLU A 370 ? 1.5535 1.1918 1.6740 -0.4219 0.1771  -0.2322 414 GLU A CA  
2769 C C   . GLU A 370 ? 1.4966 1.2371 1.6488 -0.4340 0.1638  -0.2291 414 GLU A C   
2770 O O   . GLU A 370 ? 1.4650 1.2272 1.6305 -0.4199 0.1611  -0.2035 414 GLU A O   
2771 C CB  . GLU A 370 ? 1.6018 1.1733 1.6984 -0.4469 0.1936  -0.2323 414 GLU A CB  
2772 C CG  . GLU A 370 ? 1.6521 1.1170 1.7194 -0.4219 0.2086  -0.2131 414 GLU A CG  
2773 C CD  . GLU A 370 ? 1.7426 1.1290 1.7803 -0.4436 0.2261  -0.2220 414 GLU A CD  
2774 O OE1 . GLU A 370 ? 1.7722 1.1830 1.8137 -0.4827 0.2288  -0.2340 414 GLU A OE1 
2775 O OE2 . GLU A 370 ? 1.7817 1.0818 1.7926 -0.4202 0.2377  -0.2167 414 GLU A OE2 
2776 N N   . CYS A 371 ? 1.1158 0.9203 1.2787 -0.4575 0.1556  -0.2552 415 CYS A N   
2777 C CA  . CYS A 371 ? 1.0516 0.9630 1.2458 -0.4632 0.1414  -0.2550 415 CYS A CA  
2778 C C   . CYS A 371 ? 1.0352 0.9746 1.2412 -0.4850 0.1473  -0.2415 415 CYS A C   
2779 O O   . CYS A 371 ? 1.0777 0.9698 1.2686 -0.5105 0.1607  -0.2441 415 CYS A O   
2780 C CB  . CYS A 371 ? 1.0337 1.0075 1.2333 -0.4779 0.1298  -0.2868 415 CYS A CB  
2781 S SG  . CYS A 371 ? 1.0419 1.0008 1.2297 -0.4531 0.1222  -0.3050 415 CYS A SG  
2782 N N   . ASP A 372 ? 0.9690 0.9857 1.2019 -0.4740 0.1383  -0.2278 416 ASP A N   
2783 C CA  . ASP A 372 ? 0.9421 0.9930 1.1886 -0.4893 0.1447  -0.2137 416 ASP A CA  
2784 C C   . ASP A 372 ? 0.9072 1.0464 1.1747 -0.5135 0.1374  -0.2331 416 ASP A C   
2785 O O   . ASP A 372 ? 0.9111 1.0773 1.1778 -0.5205 0.1278  -0.2576 416 ASP A O   
2786 C CB  . ASP A 372 ? 0.8892 0.9690 1.1503 -0.4619 0.1423  -0.1867 416 ASP A CB  
2787 C CG  . ASP A 372 ? 0.8199 0.9846 1.1053 -0.4384 0.1250  -0.1904 416 ASP A CG  
2788 O OD1 . ASP A 372 ? 0.8040 1.0249 1.0994 -0.4441 0.1134  -0.2115 416 ASP A OD1 
2789 O OD2 . ASP A 372 ? 0.7804 0.9541 1.0727 -0.4132 0.1236  -0.1705 416 ASP A OD2 
2790 N N   . ALA A 373 ? 0.9446 1.1309 1.2301 -0.5256 0.1424  -0.2222 417 ALA A N   
2791 C CA  . ALA A 373 ? 0.9229 1.1926 1.2291 -0.5505 0.1374  -0.2390 417 ALA A CA  
2792 C C   . ALA A 373 ? 0.8599 1.2256 1.1886 -0.5289 0.1178  -0.2465 417 ALA A C   
2793 O O   . ALA A 373 ? 0.8460 1.2818 1.1878 -0.5452 0.1095  -0.2642 417 ALA A O   
2794 C CB  . ALA A 373 ? 0.9068 1.2056 1.2284 -0.5657 0.1490  -0.2239 417 ALA A CB  
2795 N N   . THR A 374 ? 0.8829 1.2519 1.2150 -0.4920 0.1105  -0.2320 418 THR A N   
2796 C CA  . THR A 374 ? 0.8256 1.2749 1.1748 -0.4658 0.0924  -0.2355 418 THR A CA  
2797 C C   . THR A 374 ? 0.8480 1.3013 1.1848 -0.4723 0.0812  -0.2613 418 THR A C   
2798 O O   . THR A 374 ? 0.8133 1.3472 1.1625 -0.4634 0.0662  -0.2703 418 THR A O   
2799 C CB  . THR A 374 ? 0.7955 1.2305 1.1463 -0.4272 0.0895  -0.2148 418 THR A CB  
2800 O OG1 . THR A 374 ? 0.8175 1.2577 1.1786 -0.4197 0.0998  -0.1922 418 THR A OG1 
2801 C CG2 . THR A 374 ? 0.7321 1.2417 1.0972 -0.3996 0.0722  -0.2168 418 THR A CG2 
2802 N N   . ALA A 375 ? 0.7447 1.1095 1.0546 -0.4855 0.0893  -0.2723 419 ALA A N   
2803 C CA  . ALA A 375 ? 0.7632 1.1190 1.0566 -0.4876 0.0812  -0.2967 419 ALA A CA  
2804 C C   . ALA A 375 ? 0.8216 1.2085 1.1113 -0.5237 0.0801  -0.3229 419 ALA A C   
2805 O O   . ALA A 375 ? 0.8817 1.2234 1.1621 -0.5548 0.0939  -0.3282 419 ALA A O   
2806 C CB  . ALA A 375 ? 0.7920 1.0382 1.0572 -0.4835 0.0921  -0.2984 419 ALA A CB  
2807 N N   . LYS A 376 ? 1.2488 1.7119 1.5438 -0.5197 0.0639  -0.3389 420 LYS A N   
2808 C CA  . LYS A 376 ? 1.2519 1.7522 1.5426 -0.5547 0.0613  -0.3656 420 LYS A CA  
2809 C C   . LYS A 376 ? 1.3140 1.7303 1.5707 -0.5768 0.0702  -0.3911 420 LYS A C   
2810 O O   . LYS A 376 ? 1.3338 1.7479 1.5810 -0.6139 0.0749  -0.4134 420 LYS A O   
2811 C CB  . LYS A 376 ? 1.1941 1.8056 1.4985 -0.5412 0.0408  -0.3726 420 LYS A CB  
2812 C CG  . LYS A 376 ? 1.1951 1.8084 1.4834 -0.5164 0.0292  -0.3813 420 LYS A CG  
2813 C CD  . LYS A 376 ? 1.1478 1.8689 1.4432 -0.5131 0.0108  -0.3920 420 LYS A CD  
2814 C CE  . LYS A 376 ? 1.1499 1.8812 1.4265 -0.4905 -0.0010 -0.4016 420 LYS A CE  
2815 N NZ  . LYS A 376 ? 1.1221 1.9491 1.3976 -0.4971 -0.0167 -0.4174 420 LYS A NZ  
2816 N N   . ASN A 377 ? 1.2012 1.5489 1.4396 -0.5535 0.0733  -0.3884 421 ASN A N   
2817 C CA  . ASN A 377 ? 1.2631 1.5145 1.4674 -0.5678 0.0858  -0.4086 421 ASN A CA  
2818 C C   . ASN A 377 ? 1.3105 1.4585 1.5036 -0.5546 0.1024  -0.3881 421 ASN A C   
2819 O O   . ASN A 377 ? 1.2956 1.4425 1.5004 -0.5228 0.0995  -0.3642 421 ASN A O   
2820 C CB  . ASN A 377 ? 1.2589 1.5196 1.4465 -0.5511 0.0758  -0.4280 421 ASN A CB  
2821 C CG  . ASN A 377 ? 1.3143 1.4763 1.4644 -0.5643 0.0901  -0.4517 421 ASN A CG  
2822 O OD1 . ASN A 377 ? 1.3648 1.4301 1.5003 -0.5682 0.1081  -0.4440 421 ASN A OD1 
2823 N ND2 . ASN A 377 ? 1.3018 1.4871 1.4339 -0.5684 0.0826  -0.4796 421 ASN A ND2 
2824 N N   . LYS A 378 ? 1.3066 1.3668 1.4752 -0.5783 0.1198  -0.3972 422 LYS A N   
2825 C CA  . LYS A 378 ? 1.3538 1.3182 1.5108 -0.5689 0.1369  -0.3742 422 LYS A CA  
2826 C C   . LYS A 378 ? 1.3854 1.2661 1.5201 -0.5372 0.1435  -0.3699 422 LYS A C   
2827 O O   . LYS A 378 ? 1.4050 1.2357 1.5394 -0.5156 0.1511  -0.3427 422 LYS A O   
2828 C CB  . LYS A 378 ? 1.4006 1.3062 1.5407 -0.6065 0.1540  -0.3815 422 LYS A CB  
2829 C CG  . LYS A 378 ? 1.3773 1.3162 1.5395 -0.6226 0.1581  -0.3602 422 LYS A CG  
2830 C CD  . LYS A 378 ? 1.3280 1.3723 1.5261 -0.6021 0.1414  -0.3444 422 LYS A CD  
2831 C CE  . LYS A 378 ? 1.2939 1.3689 1.5128 -0.6137 0.1473  -0.3228 422 LYS A CE  
2832 N NZ  . LYS A 378 ? 1.2338 1.4099 1.4856 -0.5909 0.1321  -0.3094 422 LYS A NZ  
2833 N N   . ASN A 379 ? 1.9693 1.8342 2.0843 -0.5337 0.1416  -0.3962 423 ASN A N   
2834 C CA  . ASN A 379 ? 1.9854 1.7821 2.0824 -0.4996 0.1476  -0.3933 423 ASN A CA  
2835 C C   . ASN A 379 ? 1.9431 1.8059 2.0610 -0.4680 0.1314  -0.3862 423 ASN A C   
2836 O O   . ASN A 379 ? 1.9508 1.7682 2.0631 -0.4369 0.1359  -0.3764 423 ASN A O   
2837 C CB  . ASN A 379 ? 2.0081 1.7494 2.0706 -0.5073 0.1561  -0.4259 423 ASN A CB  
2838 C CG  . ASN A 379 ? 2.0645 1.6978 2.0977 -0.5219 0.1779  -0.4271 423 ASN A CG  
2839 O OD1 . ASN A 379 ? 2.0860 1.7031 2.1246 -0.5413 0.1849  -0.4114 423 ASN A OD1 
2840 N ND2 . ASN A 379 ? 2.0870 1.6459 2.0872 -0.5118 0.1894  -0.4462 423 ASN A ND2 
2841 N N   . GLU A 380 ? 1.5111 1.4814 1.6528 -0.4750 0.1132  -0.3906 424 GLU A N   
2842 C CA  . GLU A 380 ? 1.4688 1.5103 1.6287 -0.4472 0.0965  -0.3858 424 GLU A CA  
2843 C C   . GLU A 380 ? 1.4219 1.5412 1.6165 -0.4367 0.0845  -0.3592 424 GLU A C   
2844 O O   . GLU A 380 ? 1.3863 1.5798 1.5967 -0.4523 0.0757  -0.3603 424 GLU A O   
2845 C CB  . GLU A 380 ? 1.4415 1.5496 1.5936 -0.4540 0.0830  -0.4149 424 GLU A CB  
2846 C CG  . GLU A 380 ? 1.4617 1.5091 1.5785 -0.4534 0.0917  -0.4432 424 GLU A CG  
2847 C CD  . GLU A 380 ? 1.5311 1.5011 1.6217 -0.4829 0.1086  -0.4599 424 GLU A CD  
2848 O OE1 . GLU A 380 ? 1.5661 1.5333 1.6665 -0.5072 0.1132  -0.4502 424 GLU A OE1 
2849 O OE2 . GLU A 380 ? 1.5476 1.4588 1.6063 -0.4814 0.1183  -0.4830 424 GLU A OE2 
2850 N N   . CYS A 381 ? 0.9076 1.0097 1.1135 -0.4085 0.0847  -0.3360 425 CYS A N   
2851 C CA  . CYS A 381 ? 0.8543 1.0199 1.0899 -0.3926 0.0751  -0.3098 425 CYS A CA  
2852 C C   . CYS A 381 ? 0.8524 0.9931 1.0872 -0.3487 0.0727  -0.2843 425 CYS A C   
2853 O O   . CYS A 381 ? 0.8912 0.9827 1.1061 -0.3301 0.0762  -0.2881 425 CYS A O   
2854 C CB  . CYS A 381 ? 0.8543 1.0017 1.0966 -0.4067 0.0850  -0.2908 425 CYS A CB  
2855 S SG  . CYS A 381 ? 0.9310 0.9486 1.1470 -0.4092 0.1068  -0.2811 425 CYS A SG  
2856 N N   . SER A 382 ? 0.7611 0.9347 1.0134 -0.3278 0.0672  -0.2550 426 SER A N   
2857 C CA  . SER A 382 ? 0.7611 0.9235 1.0110 -0.2844 0.0619  -0.2271 426 SER A CA  
2858 C C   . SER A 382 ? 0.7527 0.8723 1.0043 -0.2764 0.0697  -0.1997 426 SER A C   
2859 O O   . SER A 382 ? 0.7479 0.8475 1.0022 -0.3029 0.0802  -0.2004 426 SER A O   
2860 C CB  . SER A 382 ? 0.7303 0.9764 0.9945 -0.2630 0.0462  -0.2178 426 SER A CB  
2861 O OG  . SER A 382 ? 0.7258 1.0264 0.9892 -0.2743 0.0375  -0.2427 426 SER A OG  
2862 N N   . LEU A 383 ? 0.7158 0.8239 0.9646 -0.2412 0.0647  -0.1754 427 LEU A N   
2863 C CA  . LEU A 383 ? 0.6984 0.7885 0.9493 -0.2300 0.0673  -0.1484 427 LEU A CA  
2864 C C   . LEU A 383 ? 0.6642 0.8213 0.9297 -0.2162 0.0575  -0.1371 427 LEU A C   
2865 O O   . LEU A 383 ? 0.6619 0.8616 0.9309 -0.1994 0.0473  -0.1391 427 LEU A O   
2866 C CB  . LEU A 383 ? 0.7192 0.7553 0.9570 -0.2032 0.0679  -0.1298 427 LEU A CB  
2867 C CG  . LEU A 383 ? 0.7047 0.7188 0.9393 -0.1914 0.0690  -0.1025 427 LEU A CG  
2868 C CD1 . LEU A 383 ? 0.7115 0.6835 0.9390 -0.2136 0.0822  -0.0987 427 LEU A CD1 
2869 C CD2 . LEU A 383 ? 0.7192 0.7024 0.9454 -0.1633 0.0648  -0.0862 427 LEU A CD2 
2870 N N   . HIS A 384 ? 0.5295 0.6929 0.8010 -0.2222 0.0626  -0.1247 428 HIS A N   
2871 C CA  . HIS A 384 ? 0.5054 0.7224 0.7881 -0.2069 0.0573  -0.1131 428 HIS A CA  
2872 C C   . HIS A 384 ? 0.5075 0.6854 0.7791 -0.1940 0.0618  -0.0900 428 HIS A C   
2873 O O   . HIS A 384 ? 0.5171 0.6451 0.7783 -0.2060 0.0706  -0.0845 428 HIS A O   
2874 C CB  . HIS A 384 ? 0.4815 0.7612 0.7845 -0.2301 0.0602  -0.1259 428 HIS A CB  
2875 C CG  . HIS A 384 ? 0.4784 0.8008 0.7899 -0.2456 0.0535  -0.1505 428 HIS A CG  
2876 N ND1 . HIS A 384 ? 0.4685 0.8497 0.7859 -0.2258 0.0406  -0.1530 428 HIS A ND1 
2877 C CD2 . HIS A 384 ? 0.4946 0.8032 0.8045 -0.2785 0.0580  -0.1740 428 HIS A CD2 
2878 C CE1 . HIS A 384 ? 0.4693 0.8789 0.7892 -0.2462 0.0360  -0.1774 428 HIS A CE1 
2879 N NE2 . HIS A 384 ? 0.4891 0.8540 0.8044 -0.2797 0.0466  -0.1922 428 HIS A NE2 
2880 N N   . ILE A 385 ? 0.5261 0.7235 0.7964 -0.1694 0.0562  -0.0763 429 ILE A N   
2881 C CA  . ILE A 385 ? 0.5336 0.6905 0.7881 -0.1565 0.0580  -0.0572 429 ILE A CA  
2882 C C   . ILE A 385 ? 0.5320 0.7138 0.7879 -0.1530 0.0638  -0.0496 429 ILE A C   
2883 O O   . ILE A 385 ? 0.5313 0.7618 0.7979 -0.1409 0.0614  -0.0517 429 ILE A O   
2884 C CB  . ILE A 385 ? 0.5438 0.6876 0.7888 -0.1313 0.0480  -0.0474 429 ILE A CB  
2885 C CG1 . ILE A 385 ? 0.5513 0.6722 0.7948 -0.1314 0.0441  -0.0536 429 ILE A CG1 
2886 C CG2 . ILE A 385 ? 0.5486 0.6588 0.7770 -0.1218 0.0483  -0.0302 429 ILE A CG2 
2887 C CD1 . ILE A 385 ? 0.5574 0.6283 0.7928 -0.1426 0.0504  -0.0513 429 ILE A CD1 
2888 N N   . HIS A 386 ? 0.6532 0.8017 0.8964 -0.1608 0.0721  -0.0397 430 HIS A N   
2889 C CA  . HIS A 386 ? 0.6641 0.8259 0.9011 -0.1534 0.0790  -0.0311 430 HIS A CA  
2890 C C   . HIS A 386 ? 0.6859 0.8270 0.9046 -0.1289 0.0722  -0.0201 430 HIS A C   
2891 O O   . HIS A 386 ? 0.6888 0.7872 0.8915 -0.1263 0.0665  -0.0121 430 HIS A O   
2892 C CB  . HIS A 386 ? 0.6700 0.8025 0.8950 -0.1717 0.0910  -0.0240 430 HIS A CB  
2893 C CG  . HIS A 386 ? 0.6554 0.8069 0.8971 -0.2005 0.1012  -0.0345 430 HIS A CG  
2894 N ND1 . HIS A 386 ? 0.6423 0.8545 0.9051 -0.2094 0.1090  -0.0423 430 HIS A ND1 
2895 C CD2 . HIS A 386 ? 0.6554 0.7732 0.8959 -0.2235 0.1057  -0.0392 430 HIS A CD2 
2896 C CE1 . HIS A 386 ? 0.6301 0.8482 0.9052 -0.2412 0.1171  -0.0523 430 HIS A CE1 
2897 N NE2 . HIS A 386 ? 0.6426 0.7980 0.9020 -0.2505 0.1162  -0.0508 430 HIS A NE2 
2898 N N   . ALA A 387 ? 0.5142 0.6855 0.7347 -0.1113 0.0736  -0.0195 431 ALA A N   
2899 C CA  . ALA A 387 ? 0.5501 0.6970 0.7501 -0.0905 0.0697  -0.0110 431 ALA A CA  
2900 C C   . ALA A 387 ? 0.5864 0.7526 0.7804 -0.0773 0.0810  -0.0095 431 ALA A C   
2901 O O   . ALA A 387 ? 0.5770 0.7638 0.7775 -0.0881 0.0921  -0.0116 431 ALA A O   
2902 C CB  . ALA A 387 ? 0.5548 0.7083 0.7596 -0.0760 0.0593  -0.0115 431 ALA A CB  
2903 N N   . SER A 388 ? 0.6970 0.8498 0.8752 -0.0551 0.0806  -0.0052 432 SER A N   
2904 C CA  . SER A 388 ? 0.7401 0.8983 0.9058 -0.0385 0.0934  -0.0040 432 SER A CA  
2905 C C   . SER A 388 ? 0.7081 0.9289 0.8998 -0.0356 0.1039  -0.0085 432 SER A C   
2906 O O   . SER A 388 ? 0.7193 0.9491 0.9055 -0.0358 0.1178  -0.0087 432 SER A O   
2907 C CB  . SER A 388 ? 0.7815 0.9214 0.9318 -0.0125 0.0925  -0.0002 432 SER A CB  
2908 O OG  . SER A 388 ? 0.8143 0.8971 0.9373 -0.0186 0.0860  0.0030  432 SER A OG  
2909 N N   . TYR A 389 ? 0.8932 1.1623 1.1131 -0.0339 0.0973  -0.0124 433 TYR A N   
2910 C CA  . TYR A 389 ? 0.8554 1.1953 1.1036 -0.0320 0.1050  -0.0170 433 TYR A CA  
2911 C C   . TYR A 389 ? 0.8308 1.1844 1.0902 -0.0634 0.1141  -0.0221 433 TYR A C   
2912 O O   . TYR A 389 ? 0.8265 1.2158 1.0939 -0.0612 0.1286  -0.0221 433 TYR A O   
2913 C CB  . TYR A 389 ? 0.8129 1.2064 1.0876 -0.0284 0.0937  -0.0217 433 TYR A CB  
2914 C CG  . TYR A 389 ? 0.7743 1.2512 1.0794 -0.0236 0.1010  -0.0255 433 TYR A CG  
2915 C CD1 . TYR A 389 ? 0.7801 1.2874 1.0859 0.0128  0.1088  -0.0179 433 TYR A CD1 
2916 C CD2 . TYR A 389 ? 0.7319 1.2555 1.0642 -0.0562 0.1021  -0.0364 433 TYR A CD2 
2917 C CE1 . TYR A 389 ? 0.7400 1.3322 1.0769 0.0192  0.1159  -0.0201 433 TYR A CE1 
2918 C CE2 . TYR A 389 ? 0.6949 1.3025 1.0582 -0.0555 0.1088  -0.0402 433 TYR A CE2 
2919 C CZ  . TYR A 389 ? 0.6968 1.3432 1.0642 -0.0166 0.1152  -0.0315 433 TYR A CZ  
2920 O OH  . TYR A 389 ? 0.6537 1.3946 1.0562 -0.0135 0.1219  -0.0343 433 TYR A OH  
2921 N N   . SER A 390 ? 0.5783 0.9028 0.8372 -0.0914 0.1075  -0.0255 434 SER A N   
2922 C CA  . SER A 390 ? 0.5609 0.8825 0.8237 -0.1224 0.1176  -0.0275 434 SER A CA  
2923 C C   . SER A 390 ? 0.5976 0.8919 0.8355 -0.1191 0.1316  -0.0189 434 SER A C   
2924 O O   . SER A 390 ? 0.5898 0.9187 0.8373 -0.1293 0.1471  -0.0195 434 SER A O   
2925 C CB  . SER A 390 ? 0.5478 0.8203 0.8030 -0.1449 0.1097  -0.0288 434 SER A CB  
2926 O OG  . SER A 390 ? 0.5138 0.8182 0.7936 -0.1604 0.1033  -0.0412 434 SER A OG  
2927 N N   . ILE A 391 ? 0.5544 0.7896 0.7594 -0.1066 0.1264  -0.0117 435 ILE A N   
2928 C CA  . ILE A 391 ? 0.5970 0.7995 0.7700 -0.1035 0.1372  -0.0050 435 ILE A CA  
2929 C C   . ILE A 391 ? 0.6154 0.8598 0.7921 -0.0850 0.1536  -0.0071 435 ILE A C   
2930 O O   . ILE A 391 ? 0.6221 0.8746 0.7905 -0.0933 0.1695  -0.0050 435 ILE A O   
2931 C CB  . ILE A 391 ? 0.6384 0.7810 0.7775 -0.0915 0.1259  -0.0001 435 ILE A CB  
2932 C CG1 . ILE A 391 ? 0.6077 0.7125 0.7414 -0.1101 0.1138  0.0049  435 ILE A CG1 
2933 C CG2 . ILE A 391 ? 0.6919 0.8078 0.7950 -0.0842 0.1365  0.0027  435 ILE A CG2 
2934 C CD1 . ILE A 391 ? 0.6118 0.6835 0.7344 -0.1003 0.0973  0.0070  435 ILE A CD1 
2935 N N   . SER A 392 ? 0.7059 0.9790 0.8951 -0.0583 0.1510  -0.0101 436 SER A N   
2936 C CA  . SER A 392 ? 0.7149 1.0247 0.9063 -0.0328 0.1671  -0.0108 436 SER A CA  
2937 C C   . SER A 392 ? 0.6657 1.0525 0.8932 -0.0458 0.1801  -0.0139 436 SER A C   
2938 O O   . SER A 392 ? 0.6681 1.0895 0.8976 -0.0308 0.1983  -0.0136 436 SER A O   
2939 C CB  . SER A 392 ? 0.7154 1.0365 0.9118 0.0015  0.1610  -0.0102 436 SER A CB  
2940 O OG  . SER A 392 ? 0.6582 1.0510 0.8964 0.0018  0.1549  -0.0127 436 SER A OG  
2941 N N   . GLN A 393 ? 0.8651 1.2800 1.1212 -0.0750 0.1721  -0.0178 437 GLN A N   
2942 C CA  . GLN A 393 ? 0.8174 1.3088 1.1101 -0.0939 0.1837  -0.0223 437 GLN A CA  
2943 C C   . GLN A 393 ? 0.8250 1.2930 1.1052 -0.1265 0.1979  -0.0191 437 GLN A C   
2944 O O   . GLN A 393 ? 0.7883 1.3083 1.0964 -0.1534 0.2083  -0.0225 437 GLN A O   
2945 C CB  . GLN A 393 ? 0.7652 1.3046 1.0946 -0.1120 0.1697  -0.0312 437 GLN A CB  
2946 C CG  . GLN A 393 ? 0.7522 1.3306 1.0960 -0.0785 0.1571  -0.0322 437 GLN A CG  
2947 C CD  . GLN A 393 ? 0.7531 1.3796 1.1033 -0.0398 0.1700  -0.0269 437 GLN A CD  
2948 O OE1 . GLN A 393 ? 0.7096 1.4241 1.0954 -0.0401 0.1779  -0.0297 437 GLN A OE1 
2949 N NE2 . GLN A 393 ? 0.8016 1.3713 1.1171 -0.0062 0.1729  -0.0196 437 GLN A NE2 
2950 N N   . LYS A 394 ? 0.9586 1.3497 1.1962 -0.1259 0.1979  -0.0119 438 LYS A N   
2951 C CA  . LYS A 394 ? 0.9735 1.3343 1.1894 -0.1515 0.2117  -0.0047 438 LYS A CA  
2952 C C   . LYS A 394 ? 0.9385 1.2868 1.1681 -0.1909 0.2079  -0.0048 438 LYS A C   
2953 O O   . LYS A 394 ? 0.9365 1.2771 1.1596 -0.2177 0.2228  0.0012  438 LYS A O   
2954 C CB  . LYS A 394 ? 0.9751 1.3902 1.1986 -0.1496 0.2369  -0.0038 438 LYS A CB  
2955 C CG  . LYS A 394 ? 1.0110 1.4359 1.2181 -0.1080 0.2460  -0.0049 438 LYS A CG  
2956 C CD  . LYS A 394 ? 1.0729 1.4130 1.2278 -0.0921 0.2375  -0.0018 438 LYS A CD  
2957 C CE  . LYS A 394 ? 1.1058 1.4409 1.2451 -0.0495 0.2405  -0.0065 438 LYS A CE  
2958 N NZ  . LYS A 394 ? 1.1529 1.4103 1.2545 -0.0398 0.2232  -0.0066 438 LYS A NZ  
2959 N N   . LEU A 395 ? 0.7328 1.0716 0.9766 -0.1933 0.1891  -0.0112 439 LEU A N   
2960 C CA  . LEU A 395 ? 0.7145 1.0155 0.9592 -0.2245 0.1838  -0.0118 439 LEU A CA  
2961 C C   . LEU A 395 ? 0.7477 0.9683 0.9502 -0.2253 0.1827  0.0024  439 LEU A C   
2962 O O   . LEU A 395 ? 0.7814 0.9767 0.9556 -0.2014 0.1796  0.0092  439 LEU A O   
2963 C CB  . LEU A 395 ? 0.6914 0.9933 0.9528 -0.2204 0.1640  -0.0222 439 LEU A CB  
2964 C CG  . LEU A 395 ? 0.6524 1.0327 0.9548 -0.2258 0.1606  -0.0370 439 LEU A CG  
2965 C CD1 . LEU A 395 ? 0.6359 0.9968 0.9443 -0.2339 0.1441  -0.0470 439 LEU A CD1 
2966 C CD2 . LEU A 395 ? 0.6293 1.0601 0.9557 -0.2595 0.1782  -0.0419 439 LEU A CD2 
2967 N N   . ASN A 396 ? 1.0032 1.1821 1.1992 -0.2520 0.1850  0.0069  440 ASN A N   
2968 C CA  . ASN A 396 ? 1.0346 1.1448 1.1904 -0.2496 0.1845  0.0239  440 ASN A CA  
2969 C C   . ASN A 396 ? 1.0347 1.1036 1.1814 -0.2322 0.1631  0.0247  440 ASN A C   
2970 O O   . ASN A 396 ? 1.0283 1.0608 1.1757 -0.2429 0.1584  0.0259  440 ASN A O   
2971 C CB  . ASN A 396 ? 1.0390 1.1173 1.1874 -0.2826 0.1998  0.0327  440 ASN A CB  
2972 C CG  . ASN A 396 ? 1.0776 1.0999 1.1817 -0.2795 0.2051  0.0546  440 ASN A CG  
2973 O OD1 . ASN A 396 ? 1.0933 1.0757 1.1737 -0.2592 0.1898  0.0632  440 ASN A OD1 
2974 N ND2 . ASN A 396 ? 1.0930 1.1166 1.1856 -0.3004 0.2269  0.0647  440 ASN A ND2 
2975 N N   . VAL A 397 ? 0.6949 0.7649 0.8287 -0.2052 0.1525  0.0254  441 VAL A N   
2976 C CA  . VAL A 397 ? 0.6916 0.7357 0.8204 -0.1873 0.1326  0.0252  441 VAL A CA  
2977 C C   . VAL A 397 ? 0.7248 0.7411 0.8187 -0.1706 0.1261  0.0348  441 VAL A C   
2978 O O   . VAL A 397 ? 0.7461 0.7803 0.8344 -0.1551 0.1265  0.0293  441 VAL A O   
2979 C CB  . VAL A 397 ? 0.6724 0.7562 0.8285 -0.1737 0.1235  0.0110  441 VAL A CB  
2980 C CG1 . VAL A 397 ? 0.6669 0.7225 0.8196 -0.1606 0.1049  0.0118  441 VAL A CG1 
2981 C CG2 . VAL A 397 ? 0.6402 0.7662 0.8306 -0.1922 0.1296  -0.0015 441 VAL A CG2 
2982 N N   . PRO A 398 ? 0.8163 0.7896 0.8845 -0.1737 0.1214  0.0491  442 PRO A N   
2983 C CA  . PRO A 398 ? 0.8474 0.8021 0.8815 -0.1609 0.1135  0.0559  442 PRO A CA  
2984 C C   . PRO A 398 ? 0.8380 0.7920 0.8757 -0.1447 0.0955  0.0492  442 PRO A C   
2985 O O   . PRO A 398 ? 0.8668 0.8158 0.8806 -0.1363 0.0927  0.0472  442 PRO A O   
2986 C CB  . PRO A 398 ? 0.8619 0.7784 0.8711 -0.1674 0.1109  0.0748  442 PRO A CB  
2987 C CG  . PRO A 398 ? 0.8368 0.7406 0.8704 -0.1762 0.1116  0.0762  442 PRO A CG  
2988 C CD  . PRO A 398 ? 0.8116 0.7510 0.8781 -0.1871 0.1229  0.0597  442 PRO A CD  
2989 N N   . MET A 399 ? 0.7887 0.7456 0.8524 -0.1420 0.0853  0.0452  443 MET A N   
2990 C CA  . MET A 399 ? 0.7762 0.7328 0.8434 -0.1291 0.0699  0.0411  443 MET A CA  
2991 C C   . MET A 399 ? 0.7477 0.7273 0.8471 -0.1238 0.0666  0.0304  443 MET A C   
2992 O O   . MET A 399 ? 0.7267 0.7129 0.8470 -0.1313 0.0690  0.0273  443 MET A O   
2993 C CB  . MET A 399 ? 0.7670 0.6998 0.8242 -0.1276 0.0554  0.0528  443 MET A CB  
2994 C CG  . MET A 399 ? 0.7978 0.7158 0.8206 -0.1271 0.0488  0.0609  443 MET A CG  
2995 S SD  . MET A 399 ? 0.7907 0.6987 0.8115 -0.1226 0.0289  0.0749  443 MET A SD  
2996 C CE  . MET A 399 ? 0.7572 0.6813 0.7985 -0.1166 0.0181  0.0629  443 MET A CE  
2997 N N   . ALA A 400 ? 0.5795 0.5662 0.6788 -0.1117 0.0605  0.0251  444 ALA A N   
2998 C CA  . ALA A 400 ? 0.5609 0.5676 0.6847 -0.1040 0.0553  0.0180  444 ALA A CA  
2999 C C   . ALA A 400 ? 0.5246 0.5199 0.6578 -0.1052 0.0437  0.0220  444 ALA A C   
3000 O O   . ALA A 400 ? 0.5190 0.4922 0.6405 -0.1091 0.0385  0.0314  444 ALA A O   
3001 C CB  . ALA A 400 ? 0.5911 0.5998 0.7062 -0.0900 0.0542  0.0150  444 ALA A CB  
3002 N N   . PRO A 401 ? 0.5650 0.5786 0.7189 -0.0999 0.0401  0.0154  445 PRO A N   
3003 C CA  . PRO A 401 ? 0.5413 0.5440 0.7025 -0.0992 0.0314  0.0192  445 PRO A CA  
3004 C C   . PRO A 401 ? 0.5348 0.5249 0.6831 -0.0947 0.0213  0.0282  445 PRO A C   
3005 O O   . PRO A 401 ? 0.5468 0.5356 0.6822 -0.0921 0.0208  0.0276  445 PRO A O   
3006 C CB  . PRO A 401 ? 0.5365 0.5642 0.7181 -0.0941 0.0306  0.0093  445 PRO A CB  
3007 C CG  . PRO A 401 ? 0.5526 0.6060 0.7405 -0.0960 0.0385  0.0008  445 PRO A CG  
3008 C CD  . PRO A 401 ? 0.5750 0.6209 0.7452 -0.0929 0.0428  0.0061  445 PRO A CD  
3009 N N   . LEU A 402 ? 0.5193 0.5002 0.6700 -0.0942 0.0143  0.0362  446 LEU A N   
3010 C CA  . LEU A 402 ? 0.5175 0.4965 0.6594 -0.0932 0.0033  0.0447  446 LEU A CA  
3011 C C   . LEU A 402 ? 0.5069 0.4997 0.6683 -0.0865 -0.0033 0.0474  446 LEU A C   
3012 O O   . LEU A 402 ? 0.5141 0.5057 0.6886 -0.0807 -0.0012 0.0483  446 LEU A O   
3013 C CB  . LEU A 402 ? 0.5398 0.5040 0.6623 -0.0974 -0.0009 0.0559  446 LEU A CB  
3014 C CG  . LEU A 402 ? 0.5516 0.5234 0.6704 -0.0967 -0.0152 0.0668  446 LEU A CG  
3015 C CD1 . LEU A 402 ? 0.5524 0.5270 0.6553 -0.1059 -0.0215 0.0629  446 LEU A CD1 
3016 C CD2 . LEU A 402 ? 0.5884 0.5502 0.6929 -0.0951 -0.0188 0.0809  446 LEU A CD2 
3017 N N   . SER A 403 ? 0.6461 0.6497 0.8079 -0.0878 -0.0096 0.0485  447 SER A N   
3018 C CA  . SER A 403 ? 0.6418 0.6647 0.8219 -0.0829 -0.0156 0.0532  447 SER A CA  
3019 C C   . SER A 403 ? 0.6394 0.6711 0.8128 -0.0924 -0.0249 0.0586  447 SER A C   
3020 O O   . SER A 403 ? 0.6400 0.6579 0.7948 -0.1016 -0.0238 0.0545  447 SER A O   
3021 C CB  . SER A 403 ? 0.6351 0.6709 0.8308 -0.0764 -0.0093 0.0452  447 SER A CB  
3022 O OG  . SER A 403 ? 0.6330 0.6662 0.8185 -0.0797 -0.0061 0.0408  447 SER A OG  
3023 N N   . GLU A 404 ? 0.7421 0.7970 0.9303 -0.0907 -0.0332 0.0671  448 GLU A N   
3024 C CA  . GLU A 404 ? 0.7385 0.8101 0.9249 -0.1044 -0.0423 0.0710  448 GLU A CA  
3025 C C   . GLU A 404 ? 0.7265 0.8300 0.9394 -0.1012 -0.0420 0.0740  448 GLU A C   
3026 O O   . GLU A 404 ? 0.7348 0.8562 0.9684 -0.0856 -0.0402 0.0778  448 GLU A O   
3027 C CB  . GLU A 404 ? 0.7634 0.8463 0.9421 -0.1090 -0.0553 0.0803  448 GLU A CB  
3028 C CG  . GLU A 404 ? 0.7848 0.8389 0.9359 -0.1101 -0.0544 0.0797  448 GLU A CG  
3029 C CD  . GLU A 404 ? 0.7911 0.8270 0.9112 -0.1290 -0.0568 0.0722  448 GLU A CD  
3030 O OE1 . GLU A 404 ? 0.7821 0.8207 0.9008 -0.1427 -0.0584 0.0667  448 GLU A OE1 
3031 O OE2 . GLU A 404 ? 0.8128 0.8290 0.9071 -0.1308 -0.0560 0.0717  448 GLU A OE2 
3032 N N   . PRO A 405 ? 0.5778 0.6855 0.7877 -0.1163 -0.0418 0.0725  449 PRO A N   
3033 C CA  . PRO A 405 ? 0.5685 0.7101 0.8021 -0.1177 -0.0403 0.0771  449 PRO A CA  
3034 C C   . PRO A 405 ? 0.5694 0.7577 0.8283 -0.1139 -0.0501 0.0872  449 PRO A C   
3035 O O   . PRO A 405 ? 0.5662 0.7843 0.8501 -0.1015 -0.0450 0.0906  449 PRO A O   
3036 C CB  . PRO A 405 ? 0.5653 0.6940 0.7830 -0.1415 -0.0395 0.0753  449 PRO A CB  
3037 C CG  . PRO A 405 ? 0.5754 0.6585 0.7619 -0.1453 -0.0365 0.0677  449 PRO A CG  
3038 C CD  . PRO A 405 ? 0.5815 0.6580 0.7626 -0.1337 -0.0410 0.0666  449 PRO A CD  
3039 N N   . ASN A 406 ? 0.7929 0.9913 1.0454 -0.1219 -0.0634 0.0923  450 ASN A N   
3040 C CA  . ASN A 406 ? 0.7976 1.0475 1.0759 -0.1133 -0.0736 0.1045  450 ASN A CA  
3041 C C   . ASN A 406 ? 0.8196 1.0705 1.1121 -0.0816 -0.0685 0.1100  450 ASN A C   
3042 O O   . ASN A 406 ? 0.8196 1.1134 1.1386 -0.0661 -0.0716 0.1203  450 ASN A O   
3043 C CB  . ASN A 406 ? 0.8088 1.0725 1.0740 -0.1256 -0.0905 0.1100  450 ASN A CB  
3044 C CG  . ASN A 406 ? 0.8182 1.0536 1.0525 -0.1557 -0.0936 0.0996  450 ASN A CG  
3045 O OD1 . ASN A 406 ? 0.8237 1.0292 1.0285 -0.1589 -0.0976 0.0964  450 ASN A OD1 
3046 N ND2 . ASN A 406 ? 0.8259 1.0677 1.0639 -0.1788 -0.0905 0.0943  450 ASN A ND2 
3047 N N   . ALA A 407 ? 0.5607 0.7642 0.8348 -0.0719 -0.0604 0.1036  451 ALA A N   
3048 C CA  . ALA A 407 ? 0.5951 0.7900 0.8784 -0.0451 -0.0541 0.1077  451 ALA A CA  
3049 C C   . ALA A 407 ? 0.5914 0.7713 0.8814 -0.0369 -0.0389 0.0956  451 ALA A C   
3050 O O   . ALA A 407 ? 0.5961 0.7390 0.8707 -0.0381 -0.0310 0.0852  451 ALA A O   
3051 C CB  . ALA A 407 ? 0.6329 0.7889 0.8918 -0.0418 -0.0553 0.1105  451 ALA A CB  
3052 N N   . VAL A 408 ? 0.5414 0.7564 0.8559 -0.0261 -0.0348 0.0977  452 VAL A N   
3053 C CA  . VAL A 408 ? 0.5395 0.7513 0.8598 -0.0194 -0.0214 0.0864  452 VAL A CA  
3054 C C   . VAL A 408 ? 0.5786 0.7486 0.8876 -0.0062 -0.0113 0.0757  452 VAL A C   
3055 O O   . VAL A 408 ? 0.6122 0.7671 0.9218 0.0099  -0.0100 0.0807  452 VAL A O   
3056 C CB  . VAL A 408 ? 0.5299 0.7904 0.8788 -0.0058 -0.0175 0.0923  452 VAL A CB  
3057 C CG1 . VAL A 408 ? 0.5175 0.7736 0.8680 0.0038  -0.0025 0.0798  452 VAL A CG1 
3058 C CG2 . VAL A 408 ? 0.5131 0.8143 0.8725 -0.0268 -0.0255 0.1001  452 VAL A CG2 
3059 N N   . GLY A 409 ? 0.6524 0.8030 0.9492 -0.0143 -0.0043 0.0617  453 GLY A N   
3060 C CA  . GLY A 409 ? 0.6874 0.8064 0.9755 -0.0070 0.0056  0.0480  453 GLY A CA  
3061 C C   . GLY A 409 ? 0.6950 0.7751 0.9658 -0.0145 0.0049  0.0458  453 GLY A C   
3062 O O   . GLY A 409 ? 0.7121 0.7683 0.9748 -0.0167 0.0129  0.0321  453 GLY A O   
3063 N N   . ILE A 410 ? 0.6108 0.6870 0.8746 -0.0209 -0.0044 0.0584  454 ILE A N   
3064 C CA  . ILE A 410 ? 0.6203 0.6606 0.8673 -0.0254 -0.0029 0.0593  454 ILE A CA  
3065 C C   . ILE A 410 ? 0.5782 0.6065 0.8105 -0.0428 -0.0013 0.0498  454 ILE A C   
3066 O O   . ILE A 410 ? 0.5463 0.5872 0.7731 -0.0525 -0.0070 0.0514  454 ILE A O   
3067 C CB  . ILE A 410 ? 0.6380 0.6798 0.8793 -0.0227 -0.0130 0.0777  454 ILE A CB  
3068 C CG1 . ILE A 410 ? 0.6802 0.7287 0.9351 0.0006  -0.0123 0.0890  454 ILE A CG1 
3069 C CG2 . ILE A 410 ? 0.6335 0.6391 0.8516 -0.0317 -0.0108 0.0799  454 ILE A CG2 
3070 C CD1 . ILE A 410 ? 0.6945 0.7477 0.9424 0.0069  -0.0230 0.1093  454 ILE A CD1 
3071 N N   . VAL A 411 ? 0.5383 0.5420 0.7643 -0.0466 0.0078  0.0397  455 VAL A N   
3072 C CA  . VAL A 411 ? 0.5097 0.5080 0.7246 -0.0612 0.0104  0.0322  455 VAL A CA  
3073 C C   . VAL A 411 ? 0.5234 0.4906 0.7271 -0.0678 0.0171  0.0334  455 VAL A C   
3074 O O   . VAL A 411 ? 0.5516 0.4963 0.7571 -0.0654 0.0251  0.0288  455 VAL A O   
3075 C CB  . VAL A 411 ? 0.5043 0.5187 0.7256 -0.0647 0.0155  0.0155  455 VAL A CB  
3076 C CG1 . VAL A 411 ? 0.4826 0.5045 0.6956 -0.0737 0.0156  0.0131  455 VAL A CG1 
3077 C CG2 . VAL A 411 ? 0.5078 0.5478 0.7393 -0.0560 0.0126  0.0144  455 VAL A CG2 
3078 N N   . ILE A 412 ? 0.6141 0.5762 0.8034 -0.0766 0.0156  0.0395  456 ILE A N   
3079 C CA  . ILE A 412 ? 0.6300 0.5647 0.8062 -0.0855 0.0238  0.0426  456 ILE A CA  
3080 C C   . ILE A 412 ? 0.6141 0.5591 0.7865 -0.0990 0.0301  0.0330  456 ILE A C   
3081 O O   . ILE A 412 ? 0.5988 0.5611 0.7662 -0.0988 0.0257  0.0331  456 ILE A O   
3082 C CB  . ILE A 412 ? 0.6489 0.5695 0.8074 -0.0818 0.0180  0.0619  456 ILE A CB  
3083 C CG1 . ILE A 412 ? 0.6736 0.5962 0.8399 -0.0646 0.0102  0.0738  456 ILE A CG1 
3084 C CG2 . ILE A 412 ? 0.6728 0.5621 0.8142 -0.0913 0.0289  0.0679  456 ILE A CG2 
3085 C CD1 . ILE A 412 ? 0.7008 0.6209 0.8507 -0.0590 0.0009  0.0942  456 ILE A CD1 
3086 N N   . ALA A 413 ? 0.5706 0.5057 0.7456 -0.1109 0.0413  0.0243  457 ALA A N   
3087 C CA  . ALA A 413 ? 0.5619 0.5184 0.7390 -0.1236 0.0482  0.0147  457 ALA A CA  
3088 C C   . ALA A 413 ? 0.5756 0.5163 0.7511 -0.1423 0.0617  0.0109  457 ALA A C   
3089 O O   . ALA A 413 ? 0.5915 0.5047 0.7685 -0.1482 0.0673  0.0076  457 ALA A O   
3090 C CB  . ALA A 413 ? 0.5472 0.5409 0.7421 -0.1209 0.0455  -0.0007 457 ALA A CB  
3091 N N   . HIS A 414 ? 0.6685 0.6268 0.8411 -0.1523 0.0687  0.0102  458 HIS A N   
3092 C CA  . HIS A 414 ? 0.6729 0.6302 0.8504 -0.1749 0.0827  0.0032  458 HIS A CA  
3093 C C   . HIS A 414 ? 0.6562 0.6502 0.8575 -0.1826 0.0820  -0.0178 458 HIS A C   
3094 O O   . HIS A 414 ? 0.6429 0.6742 0.8548 -0.1692 0.0731  -0.0238 458 HIS A O   
3095 C CB  . HIS A 414 ? 0.6774 0.6511 0.8469 -0.1829 0.0921  0.0088  458 HIS A CB  
3096 C CG  . HIS A 414 ? 0.7017 0.6404 0.8427 -0.1784 0.0936  0.0286  458 HIS A CG  
3097 N ND1 . HIS A 414 ? 0.7082 0.6471 0.8333 -0.1611 0.0833  0.0372  458 HIS A ND1 
3098 C CD2 . HIS A 414 ? 0.7261 0.6286 0.8488 -0.1901 0.1042  0.0416  458 HIS A CD2 
3099 C CE1 . HIS A 414 ? 0.7346 0.6448 0.8332 -0.1620 0.0858  0.0536  458 HIS A CE1 
3100 N NE2 . HIS A 414 ? 0.7470 0.6341 0.8432 -0.1778 0.0987  0.0583  458 HIS A NE2 
3101 N N   . GLY A 415 ? 0.6722 0.6537 0.8793 -0.2046 0.0914  -0.0288 459 GLY A N   
3102 C CA  . GLY A 415 ? 0.6597 0.6795 0.8868 -0.2152 0.0895  -0.0508 459 GLY A CA  
3103 C C   . GLY A 415 ? 0.6647 0.6802 0.8976 -0.2492 0.1027  -0.0639 459 GLY A C   
3104 O O   . GLY A 415 ? 0.6794 0.6584 0.9003 -0.2647 0.1155  -0.0542 459 GLY A O   
3105 N N   . SER A 416 ? 0.6730 0.7274 0.9229 -0.2628 0.0999  -0.0863 460 SER A N   
3106 C CA  . SER A 416 ? 0.6817 0.7265 0.9357 -0.2998 0.1115  -0.1038 460 SER A CA  
3107 C C   . SER A 416 ? 0.6900 0.7443 0.9485 -0.3044 0.1043  -0.1282 460 SER A C   
3108 O O   . SER A 416 ? 0.6804 0.7704 0.9446 -0.2807 0.0905  -0.1308 460 SER A O   
3109 C CB  . SER A 416 ? 0.6550 0.7612 0.9289 -0.3240 0.1185  -0.1085 460 SER A CB  
3110 O OG  . SER A 416 ? 0.6265 0.8170 0.9237 -0.3142 0.1068  -0.1183 460 SER A OG  
3111 N N   . VAL A 417 ? 0.6198 0.6379 0.8721 -0.3363 0.1151  -0.1462 461 VAL A N   
3112 C CA  . VAL A 417 ? 0.6395 0.6537 0.8887 -0.3447 0.1113  -0.1730 461 VAL A CA  
3113 C C   . VAL A 417 ? 0.6608 0.7269 0.9210 -0.3797 0.1112  -0.1967 461 VAL A C   
3114 O O   . VAL A 417 ? 0.7128 0.7490 0.9621 -0.4034 0.1220  -0.1973 461 VAL A O   
3115 C CB  . VAL A 417 ? 0.6984 0.6132 0.9205 -0.3443 0.1233  -0.1744 461 VAL A CB  
3116 C CG1 . VAL A 417 ? 0.7259 0.6329 0.9407 -0.3526 0.1216  -0.2050 461 VAL A CG1 
3117 C CG2 . VAL A 417 ? 0.6805 0.5541 0.8904 -0.3029 0.1202  -0.1449 461 VAL A CG2 
3118 N N   . GLY A 418 ? 0.6536 0.7973 0.9303 -0.3756 0.0966  -0.2119 462 GLY A N   
3119 C CA  . GLY A 418 ? 0.6420 0.8500 0.9273 -0.3972 0.0910  -0.2294 462 GLY A CA  
3120 C C   . GLY A 418 ? 0.6102 0.9055 0.9121 -0.3803 0.0730  -0.2379 462 GLY A C   
3121 O O   . GLY A 418 ? 0.6171 0.9075 0.9173 -0.3591 0.0662  -0.2389 462 GLY A O   
3122 N N   . ASP A 419 ? 0.7949 1.1717 1.1127 -0.3884 0.0654  -0.2430 463 ASP A N   
3123 C CA  . ASP A 419 ? 0.7711 1.2329 1.1020 -0.3673 0.0479  -0.2464 463 ASP A CA  
3124 C C   . ASP A 419 ? 0.7377 1.2526 1.0902 -0.3365 0.0435  -0.2214 463 ASP A C   
3125 O O   . ASP A 419 ? 0.7208 1.2996 1.0823 -0.3114 0.0303  -0.2178 463 ASP A O   
3126 C CB  . ASP A 419 ? 0.7749 1.2987 1.1079 -0.3888 0.0406  -0.2667 463 ASP A CB  
3127 C CG  . ASP A 419 ? 0.8205 1.2967 1.1287 -0.4150 0.0435  -0.2947 463 ASP A CG  
3128 O OD1 . ASP A 419 ? 0.8456 1.2339 1.1359 -0.4163 0.0540  -0.2959 463 ASP A OD1 
3129 O OD2 . ASP A 419 ? 0.8383 1.3619 1.1433 -0.4331 0.0363  -0.3156 463 ASP A OD2 
3130 N N   . ALA A 420 ? 0.5659 1.0494 0.9229 -0.3363 0.0559  -0.2034 464 ALA A N   
3131 C CA  . ALA A 420 ? 0.5391 1.0640 0.9132 -0.3080 0.0554  -0.1813 464 ALA A CA  
3132 C C   . ALA A 420 ? 0.5492 1.0121 0.9176 -0.3095 0.0709  -0.1642 464 ALA A C   
3133 O O   . ALA A 420 ? 0.5735 0.9657 0.9255 -0.3328 0.0818  -0.1667 464 ALA A O   
3134 C CB  . ALA A 420 ? 0.5105 1.1207 0.9041 -0.3074 0.0523  -0.1799 464 ALA A CB  
3135 N N   . ILE A 421 ? 0.5250 1.0036 0.8954 -0.2766 0.0708  -0.1426 465 ILE A N   
3136 C CA  . ILE A 421 ? 0.5383 0.9643 0.8958 -0.2710 0.0834  -0.1234 465 ILE A CA  
3137 C C   . ILE A 421 ? 0.5258 0.9705 0.8973 -0.3074 0.0990  -0.1279 465 ILE A C   
3138 O O   . ILE A 421 ? 0.5033 1.0205 0.8951 -0.3118 0.0988  -0.1318 465 ILE A O   
3139 C CB  . ILE A 421 ? 0.5416 0.9833 0.8954 -0.2293 0.0806  -0.1032 465 ILE A CB  
3140 C CG1 . ILE A 421 ? 0.5602 0.9710 0.8969 -0.1995 0.0674  -0.0978 465 ILE A CG1 
3141 C CG2 . ILE A 421 ? 0.5574 0.9523 0.8956 -0.2268 0.0939  -0.0863 465 ILE A CG2 
3142 C CD1 . ILE A 421 ? 0.5768 0.9743 0.9003 -0.1621 0.0659  -0.0781 465 ILE A CD1 
3143 N N   . SER A 422 ? 0.8871 1.2548 1.2389 -0.3261 0.1108  -0.1229 466 SER A N   
3144 C CA  . SER A 422 ? 0.8918 1.2471 1.2409 -0.3549 0.1248  -0.1214 466 SER A CA  
3145 C C   . SER A 422 ? 0.8941 1.2479 1.2408 -0.3470 0.1388  -0.1012 466 SER A C   
3146 O O   . SER A 422 ? 0.9152 1.2220 1.2409 -0.3216 0.1377  -0.0854 466 SER A O   
3147 C CB  . SER A 422 ? 0.9255 1.1919 1.2489 -0.3762 0.1305  -0.1254 466 SER A CB  
3148 O OG  . SER A 422 ? 0.9590 1.1998 1.2738 -0.4005 0.1454  -0.1187 466 SER A OG  
3149 N N   . VAL A 423 ? 0.5469 0.9449 0.9057 -0.3598 0.1483  -0.0991 467 VAL A N   
3150 C CA  . VAL A 423 ? 0.5500 0.9482 0.9037 -0.3561 0.1651  -0.0814 467 VAL A CA  
3151 C C   . VAL A 423 ? 0.5956 0.9065 0.9184 -0.3748 0.1783  -0.0690 467 VAL A C   
3152 O O   . VAL A 423 ? 0.6034 0.9018 0.9134 -0.3717 0.1923  -0.0529 467 VAL A O   
3153 C CB  . VAL A 423 ? 0.5595 1.0372 0.9374 -0.3642 0.1736  -0.0823 467 VAL A CB  
3154 C CG1 . VAL A 423 ? 0.5238 1.0933 0.9318 -0.3419 0.1607  -0.0914 467 VAL A CG1 
3155 C CG2 . VAL A 423 ? 0.6131 1.0758 0.9901 -0.4021 0.1795  -0.0893 467 VAL A CG2 
3156 N N   . MET A 424 ? 1.0314 1.2810 1.3391 -0.3921 0.1752  -0.0754 468 MET A N   
3157 C CA  . MET A 424 ? 1.0728 1.2373 1.3489 -0.4042 0.1881  -0.0598 468 MET A CA  
3158 C C   . MET A 424 ? 1.0776 1.1837 1.3276 -0.3817 0.1892  -0.0410 468 MET A C   
3159 O O   . MET A 424 ? 1.0654 1.1826 1.3178 -0.3532 0.1755  -0.0418 468 MET A O   
3160 C CB  . MET A 424 ? 1.1052 1.2168 1.3704 -0.4243 0.1860  -0.0717 468 MET A CB  
3161 C CG  . MET A 424 ? 1.1213 1.2845 1.4069 -0.4521 0.1874  -0.0889 468 MET A CG  
3162 S SD  . MET A 424 ? 1.1883 1.2801 1.4548 -0.4792 0.1891  -0.1047 468 MET A SD  
3163 C CE  . MET A 424 ? 1.2289 1.2055 1.4545 -0.4685 0.2015  -0.0780 468 MET A CE  
3164 N N   . VAL A 425 ? 0.7992 0.8432 1.0197 -0.3882 0.2021  -0.0214 469 VAL A N   
3165 C CA  . VAL A 425 ? 0.8157 0.8035 1.0057 -0.3655 0.2014  -0.0006 469 VAL A CA  
3166 C C   . VAL A 425 ? 0.8261 0.7622 1.0066 -0.3467 0.1857  -0.0034 469 VAL A C   
3167 O O   . VAL A 425 ? 0.8484 0.7273 1.0188 -0.3619 0.1916  -0.0054 469 VAL A O   
3168 C CB  . VAL A 425 ? 0.8585 0.7924 1.0160 -0.3775 0.2191  0.0231  469 VAL A CB  
3169 C CG1 . VAL A 425 ? 0.8801 0.7670 1.0027 -0.3476 0.2127  0.0462  469 VAL A CG1 
3170 C CG2 . VAL A 425 ? 0.8576 0.8483 1.0244 -0.3910 0.2334  0.0258  469 VAL A CG2 
3171 N N   . PRO A 426 ? 0.8138 0.7681 0.9959 -0.3123 0.1668  -0.0030 470 PRO A N   
3172 C CA  . PRO A 426 ? 0.8150 0.7433 0.9983 -0.2968 0.1524  -0.0109 470 PRO A CA  
3173 C C   . PRO A 426 ? 0.8499 0.7037 1.0039 -0.2806 0.1509  0.0085  470 PRO A C   
3174 O O   . PRO A 426 ? 0.8682 0.7024 0.9993 -0.2698 0.1528  0.0302  470 PRO A O   
3175 C CB  . PRO A 426 ? 0.7894 0.7705 0.9858 -0.2688 0.1355  -0.0156 470 PRO A CB  
3176 C CG  . PRO A 426 ? 0.7955 0.7900 0.9784 -0.2581 0.1394  0.0001  470 PRO A CG  
3177 C CD  . PRO A 426 ? 0.8087 0.7950 0.9848 -0.2858 0.1598  0.0068  470 PRO A CD  
3178 N N   . ASP A 427 ? 0.8840 0.7000 1.0377 -0.2776 0.1477  0.0005  471 ASP A N   
3179 C CA  . ASP A 427 ? 0.9163 0.6746 1.0481 -0.2528 0.1430  0.0184  471 ASP A CA  
3180 C C   . ASP A 427 ? 0.8963 0.6879 1.0351 -0.2213 0.1228  0.0206  471 ASP A C   
3181 O O   . ASP A 427 ? 0.8627 0.7108 1.0194 -0.2196 0.1148  0.0087  471 ASP A O   
3182 C CB  . ASP A 427 ? 0.9462 0.6510 1.0747 -0.2582 0.1497  0.0079  471 ASP A CB  
3183 C CG  . ASP A 427 ? 0.9605 0.6391 1.0872 -0.2975 0.1695  -0.0038 471 ASP A CG  
3184 O OD1 . ASP A 427 ? 0.9723 0.6329 1.0846 -0.3127 0.1828  0.0127  471 ASP A OD1 
3185 O OD2 . ASP A 427 ? 0.9617 0.6393 1.1000 -0.3150 0.1721  -0.0299 471 ASP A OD2 
3186 N N   . VAL A 428 ? 0.7732 0.5309 0.8984 -0.1965 0.1152  0.0363  472 VAL A N   
3187 C CA  . VAL A 428 ? 0.7559 0.5441 0.8884 -0.1700 0.0967  0.0387  472 VAL A CA  
3188 C C   . VAL A 428 ? 0.7664 0.5404 0.9090 -0.1561 0.0924  0.0292  472 VAL A C   
3189 O O   . VAL A 428 ? 0.8048 0.5270 0.9365 -0.1512 0.1006  0.0352  472 VAL A O   
3190 C CB  . VAL A 428 ? 0.7735 0.5514 0.8850 -0.1521 0.0888  0.0643  472 VAL A CB  
3191 C CG1 . VAL A 428 ? 0.7574 0.5636 0.8777 -0.1292 0.0704  0.0658  472 VAL A CG1 
3192 C CG2 . VAL A 428 ? 0.7687 0.5649 0.8674 -0.1634 0.0928  0.0707  472 VAL A CG2 
3193 N N   . TYR A 429 ? 0.7298 0.5473 0.8911 -0.1489 0.0818  0.0147  473 TYR A N   
3194 C CA  . TYR A 429 ? 0.7422 0.5543 0.9130 -0.1372 0.0794  0.0030  473 TYR A CA  
3195 C C   . TYR A 429 ? 0.7319 0.5684 0.9085 -0.1115 0.0648  0.0132  473 TYR A C   
3196 O O   . TYR A 429 ? 0.7017 0.5725 0.8805 -0.1089 0.0552  0.0188  473 TYR A O   
3197 C CB  . TYR A 429 ? 0.7261 0.5698 0.9122 -0.1534 0.0812  -0.0241 473 TYR A CB  
3198 C CG  . TYR A 429 ? 0.7368 0.5609 0.9202 -0.1838 0.0955  -0.0376 473 TYR A CG  
3199 C CD1 . TYR A 429 ? 0.7130 0.5643 0.9002 -0.2042 0.0996  -0.0374 473 TYR A CD1 
3200 C CD2 . TYR A 429 ? 0.7737 0.5520 0.9501 -0.1934 0.1067  -0.0514 473 TYR A CD2 
3201 C CE1 . TYR A 429 ? 0.7209 0.5605 0.9085 -0.2365 0.1136  -0.0497 473 TYR A CE1 
3202 C CE2 . TYR A 429 ? 0.7842 0.5419 0.9570 -0.2269 0.1207  -0.0652 473 TYR A CE2 
3203 C CZ  . TYR A 429 ? 0.7551 0.5470 0.9352 -0.2496 0.1236  -0.0638 473 TYR A CZ  
3204 O OH  . TYR A 429 ? 0.7644 0.5413 0.9435 -0.2866 0.1383  -0.0774 473 TYR A OH  
3205 N N   . ILE A 430 ? 0.7058 0.5233 0.8843 -0.0931 0.0648  0.0151  474 ILE A N   
3206 C CA  . ILE A 430 ? 0.7007 0.5455 0.8884 -0.0704 0.0525  0.0247  474 ILE A CA  
3207 C C   . ILE A 430 ? 0.7144 0.5716 0.9151 -0.0599 0.0537  0.0093  474 ILE A C   
3208 O O   . ILE A 430 ? 0.7452 0.5716 0.9425 -0.0620 0.0652  -0.0047 474 ILE A O   
3209 C CB  . ILE A 430 ? 0.7302 0.5520 0.9088 -0.0506 0.0496  0.0496  474 ILE A CB  
3210 C CG1 . ILE A 430 ? 0.7163 0.5819 0.9062 -0.0351 0.0340  0.0609  474 ILE A CG1 
3211 C CG2 . ILE A 430 ? 0.7769 0.5529 0.9515 -0.0359 0.0616  0.0495  474 ILE A CG2 
3212 C CD1 . ILE A 430 ? 0.7425 0.6016 0.9256 -0.0170 0.0276  0.0856  474 ILE A CD1 
3213 N N   . SER A 431 ? 0.6799 0.5800 0.8929 -0.0500 0.0431  0.0116  475 SER A N   
3214 C CA  . SER A 431 ? 0.6972 0.6168 0.9217 -0.0379 0.0441  0.0005  475 SER A CA  
3215 C C   . SER A 431 ? 0.7018 0.6457 0.9369 -0.0180 0.0357  0.0180  475 SER A C   
3216 O O   . SER A 431 ? 0.6753 0.6419 0.9115 -0.0216 0.0248  0.0310  475 SER A O   
3217 C CB  . SER A 431 ? 0.6738 0.6311 0.9037 -0.0497 0.0408  -0.0152 475 SER A CB  
3218 O OG  . SER A 431 ? 0.6945 0.6761 0.9330 -0.0370 0.0409  -0.0217 475 SER A OG  
3219 N N   . ASP A 432 ? 0.7432 0.6835 0.9856 0.0025  0.0412  0.0182  476 ASP A N   
3220 C CA  . ASP A 432 ? 0.7386 0.7182 0.9973 0.0197  0.0331  0.0336  476 ASP A CA  
3221 C C   . ASP A 432 ? 0.7290 0.7502 1.0009 0.0219  0.0334  0.0240  476 ASP A C   
3222 O O   . ASP A 432 ? 0.7128 0.7724 0.9992 0.0289  0.0267  0.0361  476 ASP A O   
3223 C CB  . ASP A 432 ? 0.7628 0.7253 1.0253 0.0466  0.0379  0.0469  476 ASP A CB  
3224 C CG  . ASP A 432 ? 0.7926 0.7250 1.0521 0.0610  0.0545  0.0308  476 ASP A CG  
3225 O OD1 . ASP A 432 ? 0.7923 0.7357 1.0523 0.0530  0.0598  0.0098  476 ASP A OD1 
3226 O OD2 . ASP A 432 ? 0.8203 0.7150 1.0739 0.0817  0.0630  0.0393  476 ASP A OD2 
3227 N N   . ASP A 433 ? 0.5980 0.6143 0.8639 0.0145  0.0411  0.0028  477 ASP A N   
3228 C CA  . ASP A 433 ? 0.5906 0.6450 0.8638 0.0169  0.0425  -0.0054 477 ASP A CA  
3229 C C   . ASP A 433 ? 0.5695 0.6489 0.8389 -0.0006 0.0353  -0.0076 477 ASP A C   
3230 O O   . ASP A 433 ? 0.5712 0.6728 0.8391 -0.0008 0.0385  -0.0176 477 ASP A O   
3231 C CB  . ASP A 433 ? 0.6180 0.6584 0.8844 0.0247  0.0558  -0.0272 477 ASP A CB  
3232 C CG  . ASP A 433 ? 0.6393 0.6389 0.8888 0.0095  0.0613  -0.0458 477 ASP A CG  
3233 O OD1 . ASP A 433 ? 0.6246 0.6234 0.8694 -0.0102 0.0547  -0.0459 477 ASP A OD1 
3234 O OD2 . ASP A 433 ? 0.6694 0.6379 0.9100 0.0167  0.0738  -0.0619 477 ASP A OD2 
3235 N N   . GLY A 434 ? 0.5402 0.6126 0.8044 -0.0137 0.0273  0.0006  478 GLY A N   
3236 C CA  . GLY A 434 ? 0.5094 0.6015 0.7688 -0.0254 0.0224  0.0003  478 GLY A CA  
3237 C C   . GLY A 434 ? 0.5206 0.6080 0.7705 -0.0351 0.0256  -0.0167 478 GLY A C   
3238 O O   . GLY A 434 ? 0.5100 0.6182 0.7559 -0.0391 0.0232  -0.0185 478 GLY A O   
3239 N N   . GLY A 435 ? 0.5827 0.6436 0.8287 -0.0394 0.0313  -0.0285 479 GLY A N   
3240 C CA  . GLY A 435 ? 0.5783 0.6408 0.8183 -0.0535 0.0334  -0.0447 479 GLY A CA  
3241 C C   . GLY A 435 ? 0.6123 0.6803 0.8486 -0.0555 0.0396  -0.0673 479 GLY A C   
3242 O O   . GLY A 435 ? 0.6084 0.6899 0.8414 -0.0690 0.0393  -0.0820 479 GLY A O   
3243 N N   . TYR A 436 ? 0.4862 0.5471 0.7225 -0.0423 0.0454  -0.0714 480 TYR A N   
3244 C CA  . TYR A 436 ? 0.5105 0.5693 0.7378 -0.0448 0.0530  -0.0962 480 TYR A CA  
3245 C C   . TYR A 436 ? 0.5263 0.5351 0.7458 -0.0565 0.0619  -0.1098 480 TYR A C   
3246 O O   . TYR A 436 ? 0.5383 0.5421 0.7479 -0.0728 0.0663  -0.1345 480 TYR A O   
3247 C CB  . TYR A 436 ? 0.5246 0.5919 0.7525 -0.0246 0.0591  -0.0970 480 TYR A CB  
3248 C CG  . TYR A 436 ? 0.5107 0.6270 0.7410 -0.0175 0.0542  -0.0892 480 TYR A CG  
3249 C CD1 . TYR A 436 ? 0.4878 0.6215 0.7293 -0.0118 0.0477  -0.0645 480 TYR A CD1 
3250 C CD2 . TYR A 436 ? 0.5215 0.6648 0.7399 -0.0181 0.0565  -0.1064 480 TYR A CD2 
3251 C CE1 . TYR A 436 ? 0.4793 0.6503 0.7205 -0.0072 0.0457  -0.0555 480 TYR A CE1 
3252 C CE2 . TYR A 436 ? 0.5113 0.6965 0.7284 -0.0106 0.0535  -0.0957 480 TYR A CE2 
3253 C CZ  . TYR A 436 ? 0.4928 0.6885 0.7215 -0.0054 0.0491  -0.0695 480 TYR A CZ  
3254 O OH  . TYR A 436 ? 0.4841 0.7132 0.7094 -0.0001 0.0485  -0.0570 480 TYR A OH  
3255 N N   . SER A 437 ? 0.5416 0.5126 0.7632 -0.0496 0.0648  -0.0938 481 SER A N   
3256 C CA  . SER A 437 ? 0.5645 0.4783 0.7750 -0.0589 0.0759  -0.1029 481 SER A CA  
3257 C C   . SER A 437 ? 0.5521 0.4438 0.7640 -0.0637 0.0732  -0.0816 481 SER A C   
3258 O O   . SER A 437 ? 0.5243 0.4384 0.7449 -0.0531 0.0637  -0.0594 481 SER A O   
3259 C CB  . SER A 437 ? 0.6032 0.4786 0.8070 -0.0374 0.0883  -0.1071 481 SER A CB  
3260 O OG  . SER A 437 ? 0.5944 0.4784 0.8100 -0.0114 0.0847  -0.0812 481 SER A OG  
3261 N N   . TRP A 438 ? 0.6212 0.4690 0.8221 -0.0821 0.0823  -0.0891 482 TRP A N   
3262 C CA  . TRP A 438 ? 0.6047 0.4326 0.8028 -0.0906 0.0817  -0.0702 482 TRP A CA  
3263 C C   . TRP A 438 ? 0.6467 0.4044 0.8285 -0.0963 0.0965  -0.0689 482 TRP A C   
3264 O O   . TRP A 438 ? 0.6935 0.4142 0.8647 -0.1053 0.1089  -0.0900 482 TRP A O   
3265 C CB  . TRP A 438 ? 0.5672 0.4301 0.7704 -0.1161 0.0768  -0.0768 482 TRP A CB  
3266 C CG  . TRP A 438 ? 0.5328 0.4572 0.7482 -0.1105 0.0639  -0.0751 482 TRP A CG  
3267 C CD1 . TRP A 438 ? 0.5346 0.4988 0.7551 -0.1102 0.0598  -0.0917 482 TRP A CD1 
3268 C CD2 . TRP A 438 ? 0.4959 0.4456 0.7160 -0.1046 0.0545  -0.0554 482 TRP A CD2 
3269 N NE1 . TRP A 438 ? 0.5043 0.5143 0.7328 -0.1027 0.0491  -0.0807 482 TRP A NE1 
3270 C CE2 . TRP A 438 ? 0.4785 0.4779 0.7066 -0.1001 0.0462  -0.0601 482 TRP A CE2 
3271 C CE3 . TRP A 438 ? 0.4810 0.4138 0.6957 -0.1026 0.0528  -0.0348 482 TRP A CE3 
3272 C CZ2 . TRP A 438 ? 0.4473 0.4722 0.6777 -0.0939 0.0381  -0.0455 482 TRP A CZ2 
3273 C CZ3 . TRP A 438 ? 0.4469 0.4097 0.6637 -0.0984 0.0436  -0.0230 482 TRP A CZ3 
3274 C CH2 . TRP A 438 ? 0.4302 0.4351 0.6548 -0.0941 0.0371  -0.0287 482 TRP A CH2 
3275 N N   . THR A 439 ? 0.9067 0.6429 1.0830 -0.0918 0.0960  -0.0438 483 THR A N   
3276 C CA  . THR A 439 ? 0.9402 0.6075 1.0975 -0.1005 0.1112  -0.0382 483 THR A CA  
3277 C C   . THR A 439 ? 0.9149 0.5875 1.0680 -0.1149 0.1084  -0.0197 483 THR A C   
3278 O O   . THR A 439 ? 0.8787 0.5992 1.0412 -0.1079 0.0943  -0.0068 483 THR A O   
3279 C CB  . THR A 439 ? 0.9843 0.6020 1.1311 -0.0676 0.1180  -0.0207 483 THR A CB  
3280 O OG1 . THR A 439 ? 0.9633 0.6248 1.1230 -0.0404 0.1027  0.0019  483 THR A OG1 
3281 C CG2 . THR A 439 ? 1.0242 0.6162 1.1677 -0.0573 0.1287  -0.0431 483 THR A CG2 
3282 N N   . LYS A 440 ? 1.0188 0.6399 1.1557 -0.1362 0.1234  -0.0192 484 LYS A N   
3283 C CA  . LYS A 440 ? 1.0056 0.6242 1.1337 -0.1478 0.1245  0.0012  484 LYS A CA  
3284 C C   . LYS A 440 ? 1.0254 0.6267 1.1421 -0.1157 0.1185  0.0339  484 LYS A C   
3285 O O   . LYS A 440 ? 1.0702 0.6182 1.1735 -0.0957 0.1266  0.0452  484 LYS A O   
3286 C CB  . LYS A 440 ? 1.0308 0.5947 1.1428 -0.1800 0.1447  -0.0048 484 LYS A CB  
3287 C CG  . LYS A 440 ? 1.0090 0.5887 1.1166 -0.2023 0.1479  0.0081  484 LYS A CG  
3288 C CD  . LYS A 440 ? 1.0346 0.5629 1.1283 -0.2383 0.1699  0.0017  484 LYS A CD  
3289 C CE  . LYS A 440 ? 1.0215 0.5695 1.1309 -0.2700 0.1742  -0.0351 484 LYS A CE  
3290 N NZ  . LYS A 440 ? 1.0422 0.5593 1.1393 -0.3069 0.1902  -0.0424 484 LYS A NZ  
3291 N N   . MET A 441 ? 0.9851 0.6335 1.1062 -0.1099 0.1040  0.0484  485 MET A N   
3292 C CA  . MET A 441 ? 1.0022 0.6454 1.1116 -0.0848 0.0958  0.0784  485 MET A CA  
3293 C C   . MET A 441 ? 1.0322 0.6280 1.1141 -0.0933 0.1074  0.0995  485 MET A C   
3294 O O   . MET A 441 ? 1.0747 0.6248 1.1387 -0.0732 0.1125  0.1217  485 MET A O   
3295 C CB  . MET A 441 ? 0.9616 0.6686 1.0812 -0.0806 0.0769  0.0825  485 MET A CB  
3296 C CG  . MET A 441 ? 0.9731 0.6963 1.0910 -0.0525 0.0624  0.1050  485 MET A CG  
3297 S SD  . MET A 441 ? 0.9267 0.7149 1.0507 -0.0578 0.0430  0.1050  485 MET A SD  
3298 C CE  . MET A 441 ? 0.9413 0.7108 1.0346 -0.0726 0.0478  0.1207  485 MET A CE  
3299 N N   . LEU A 442 ? 1.0416 0.6502 1.1198 -0.1221 0.1129  0.0938  486 LEU A N   
3300 C CA  . LEU A 442 ? 1.0661 0.6401 1.1177 -0.1336 0.1245  0.1143  486 LEU A CA  
3301 C C   . LEU A 442 ? 1.0483 0.6237 1.1046 -0.1720 0.1397  0.0957  486 LEU A C   
3302 O O   . LEU A 442 ? 1.0050 0.6342 1.0842 -0.1852 0.1338  0.0737  486 LEU A O   
3303 C CB  . LEU A 442 ? 1.0589 0.6693 1.0986 -0.1235 0.1107  0.1343  486 LEU A CB  
3304 C CG  . LEU A 442 ? 1.0738 0.6989 1.1090 -0.0898 0.0923  0.1546  486 LEU A CG  
3305 C CD1 . LEU A 442 ? 1.0645 0.7293 1.0860 -0.0912 0.0799  0.1655  486 LEU A CD1 
3306 C CD2 . LEU A 442 ? 1.1260 0.6946 1.1411 -0.0661 0.0987  0.1806  486 LEU A CD2 
3307 N N   . GLU A 443 ? 1.3597 0.8789 1.3950 -0.1901 0.1596  0.1054  487 GLU A N   
3308 C CA  . GLU A 443 ? 1.3422 0.8706 1.3839 -0.2305 0.1747  0.0892  487 GLU A CA  
3309 C C   . GLU A 443 ? 1.3278 0.8922 1.3602 -0.2378 0.1747  0.1041  487 GLU A C   
3310 O O   . GLU A 443 ? 1.3575 0.8959 1.3616 -0.2242 0.1758  0.1326  487 GLU A O   
3311 C CB  . GLU A 443 ? 1.3871 0.8362 1.4102 -0.2526 0.1989  0.0905  487 GLU A CB  
3312 C CG  . GLU A 443 ? 1.4462 0.8205 1.4383 -0.2234 0.2039  0.1200  487 GLU A CG  
3313 C CD  . GLU A 443 ? 1.5160 0.8273 1.4873 -0.2357 0.2184  0.1194  487 GLU A CD  
3314 O OE1 . GLU A 443 ? 1.5733 0.8249 1.5165 -0.2106 0.2230  0.1460  487 GLU A OE1 
3315 O OE2 . GLU A 443 ? 1.5221 0.8452 1.5050 -0.2698 0.2250  0.0935  487 GLU A OE2 
3316 N N   . GLY A 444 ? 0.9225 0.5500 0.9776 -0.2565 0.1731  0.0849  488 GLY A N   
3317 C CA  . GLY A 444 ? 0.9074 0.5727 0.9547 -0.2624 0.1755  0.0948  488 GLY A CA  
3318 C C   . GLY A 444 ? 0.8687 0.5860 0.9233 -0.2368 0.1545  0.0929  488 GLY A C   
3319 O O   . GLY A 444 ? 0.8642 0.5819 0.9254 -0.2134 0.1382  0.0910  488 GLY A O   
3320 N N   . PRO A 445 ? 0.8647 0.6257 0.9177 -0.2414 0.1563  0.0927  489 PRO A N   
3321 C CA  . PRO A 445 ? 0.8452 0.6482 0.9025 -0.2191 0.1383  0.0882  489 PRO A CA  
3322 C C   . PRO A 445 ? 0.8759 0.6555 0.9024 -0.1974 0.1268  0.1104  489 PRO A C   
3323 O O   . PRO A 445 ? 0.9125 0.6565 0.9106 -0.2002 0.1353  0.1315  489 PRO A O   
3324 C CB  . PRO A 445 ? 0.8322 0.6824 0.8943 -0.2307 0.1483  0.0803  489 PRO A CB  
3325 C CG  . PRO A 445 ? 0.8411 0.6802 0.9041 -0.2612 0.1711  0.0820  489 PRO A CG  
3326 C CD  . PRO A 445 ? 0.8720 0.6428 0.9164 -0.2655 0.1761  0.0974  489 PRO A CD  
3327 N N   . HIS A 446 ? 0.8448 0.6464 0.8763 -0.1775 0.1076  0.1062  490 HIS A N   
3328 C CA  . HIS A 446 ? 0.8712 0.6611 0.8781 -0.1586 0.0930  0.1246  490 HIS A CA  
3329 C C   . HIS A 446 ? 0.8511 0.6778 0.8597 -0.1491 0.0781  0.1144  490 HIS A C   
3330 O O   . HIS A 446 ? 0.8178 0.6718 0.8506 -0.1503 0.0768  0.0952  490 HIS A O   
3331 C CB  . HIS A 446 ? 0.8846 0.6476 0.8980 -0.1427 0.0840  0.1339  490 HIS A CB  
3332 C CG  . HIS A 446 ? 0.9224 0.6332 0.9208 -0.1462 0.0983  0.1508  490 HIS A CG  
3333 N ND1 . HIS A 446 ? 0.9156 0.6009 0.9278 -0.1634 0.1150  0.1398  490 HIS A ND1 
3334 C CD2 . HIS A 446 ? 0.9682 0.6447 0.9363 -0.1350 0.0990  0.1787  490 HIS A CD2 
3335 C CE1 . HIS A 446 ? 0.9566 0.5865 0.9466 -0.1635 0.1273  0.1597  490 HIS A CE1 
3336 N NE2 . HIS A 446 ? 0.9881 0.6120 0.9512 -0.1440 0.1178  0.1853  490 HIS A NE2 
3337 N N   . TYR A 447 ? 0.8346 0.6605 0.8148 -0.1405 0.0673  0.1275  491 TYR A N   
3338 C CA  . TYR A 447 ? 0.8220 0.6727 0.8021 -0.1317 0.0499  0.1193  491 TYR A CA  
3339 C C   . TYR A 447 ? 0.8185 0.6681 0.8108 -0.1176 0.0332  0.1281  491 TYR A C   
3340 O O   . TYR A 447 ? 0.8478 0.6764 0.8302 -0.1099 0.0322  0.1474  491 TYR A O   
3341 C CB  . TYR A 447 ? 0.8578 0.7126 0.7991 -0.1336 0.0462  0.1247  491 TYR A CB  
3342 C CG  . TYR A 447 ? 0.8705 0.7296 0.7978 -0.1442 0.0644  0.1162  491 TYR A CG  
3343 C CD1 . TYR A 447 ? 0.8887 0.7331 0.8044 -0.1539 0.0827  0.1272  491 TYR A CD1 
3344 C CD2 . TYR A 447 ? 0.8714 0.7480 0.7958 -0.1438 0.0653  0.0982  491 TYR A CD2 
3345 C CE1 . TYR A 447 ? 0.9008 0.7566 0.8062 -0.1631 0.1005  0.1202  491 TYR A CE1 
3346 C CE2 . TYR A 447 ? 0.8923 0.7765 0.8047 -0.1491 0.0835  0.0910  491 TYR A CE2 
3347 C CZ  . TYR A 447 ? 0.9033 0.7815 0.8082 -0.1589 0.1008  0.1017  491 TYR A CZ  
3348 O OH  . TYR A 447 ? 0.9222 0.8156 0.8180 -0.1642 0.1208  0.0948  491 TYR A OH  
3349 N N   . TYR A 448 ? 0.8454 0.7176 0.8582 -0.1127 0.0216  0.1157  492 TYR A N   
3350 C CA  . TYR A 448 ? 0.8442 0.7245 0.8727 -0.0991 0.0069  0.1233  492 TYR A CA  
3351 C C   . TYR A 448 ? 0.8364 0.7459 0.8664 -0.0990 -0.0099 0.1170  492 TYR A C   
3352 O O   . TYR A 448 ? 0.8163 0.7339 0.8449 -0.1075 -0.0080 0.1013  492 TYR A O   
3353 C CB  . TYR A 448 ? 0.8184 0.6928 0.8793 -0.0942 0.0137  0.1150  492 TYR A CB  
3354 C CG  . TYR A 448 ? 0.7816 0.6646 0.8590 -0.1049 0.0244  0.0937  492 TYR A CG  
3355 C CD1 . TYR A 448 ? 0.7495 0.6583 0.8401 -0.1042 0.0179  0.0803  492 TYR A CD1 
3356 C CD2 . TYR A 448 ? 0.7854 0.6533 0.8647 -0.1161 0.0409  0.0885  492 TYR A CD2 
3357 C CE1 . TYR A 448 ? 0.7254 0.6468 0.8297 -0.1096 0.0262  0.0641  492 TYR A CE1 
3358 C CE2 . TYR A 448 ? 0.7594 0.6469 0.8561 -0.1250 0.0486  0.0697  492 TYR A CE2 
3359 C CZ  . TYR A 448 ? 0.7313 0.6467 0.8400 -0.1193 0.0406  0.0584  492 TYR A CZ  
3360 O OH  . TYR A 448 ? 0.7153 0.6546 0.8406 -0.1232 0.0467  0.0427  492 TYR A OH  
3361 N N   . THR A 449 ? 0.8663 0.7914 0.8974 -0.0899 -0.0256 0.1301  493 THR A N   
3362 C CA  . THR A 449 ? 0.8598 0.8158 0.9021 -0.0927 -0.0405 0.1232  493 THR A CA  
3363 C C   . THR A 449 ? 0.8669 0.8438 0.9371 -0.0773 -0.0495 0.1335  493 THR A C   
3364 O O   . THR A 449 ? 0.8835 0.8475 0.9583 -0.0615 -0.0457 0.1478  493 THR A O   
3365 C CB  . THR A 449 ? 0.9006 0.8714 0.9124 -0.1037 -0.0546 0.1253  493 THR A CB  
3366 O OG1 . THR A 449 ? 0.9358 0.9249 0.9418 -0.0935 -0.0687 0.1462  493 THR A OG1 
3367 C CG2 . THR A 449 ? 0.9153 0.8633 0.8914 -0.1145 -0.0445 0.1192  493 THR A CG2 
3368 N N   . ILE A 450 ? 0.6414 0.6488 0.7292 -0.0817 -0.0595 0.1261  494 ILE A N   
3369 C CA  . ILE A 450 ? 0.6580 0.6987 0.7743 -0.0683 -0.0692 0.1353  494 ILE A CA  
3370 C C   . ILE A 450 ? 0.6758 0.7585 0.7874 -0.0762 -0.0894 0.1424  494 ILE A C   
3371 O O   . ILE A 450 ? 0.6582 0.7494 0.7587 -0.0976 -0.0952 0.1303  494 ILE A O   
3372 C CB  . ILE A 450 ? 0.6092 0.6584 0.7553 -0.0680 -0.0623 0.1215  494 ILE A CB  
3373 C CG1 . ILE A 450 ? 0.5854 0.5999 0.7367 -0.0610 -0.0443 0.1134  494 ILE A CG1 
3374 C CG2 . ILE A 450 ? 0.6181 0.7095 0.7941 -0.0558 -0.0712 0.1301  494 ILE A CG2 
3375 C CD1 . ILE A 450 ? 0.5332 0.5501 0.6987 -0.0675 -0.0366 0.0957  494 ILE A CD1 
3376 N N   . LEU A 451 ? 0.7652 0.8747 0.8852 -0.0586 -0.0997 0.1622  495 LEU A N   
3377 C CA  . LEU A 451 ? 0.7562 0.9186 0.8765 -0.0649 -0.1212 0.1708  495 LEU A CA  
3378 C C   . LEU A 451 ? 0.7218 0.9326 0.8848 -0.0504 -0.1266 0.1777  495 LEU A C   
3379 O O   . LEU A 451 ? 0.7188 0.9146 0.9036 -0.0290 -0.1134 0.1799  495 LEU A O   
3380 C CB  . LEU A 451 ? 0.7849 0.9513 0.8777 -0.0539 -0.1313 0.1918  495 LEU A CB  
3381 C CG  . LEU A 451 ? 0.8170 0.9372 0.8655 -0.0660 -0.1235 0.1875  495 LEU A CG  
3382 C CD1 . LEU A 451 ? 0.8438 0.9625 0.8645 -0.0498 -0.1297 0.2131  495 LEU A CD1 
3383 C CD2 . LEU A 451 ? 0.8180 0.9453 0.8447 -0.0974 -0.1307 0.1674  495 LEU A CD2 
3384 N N   . ASP A 452 ? 0.7944 1.0637 0.9684 -0.0645 -0.1447 0.1789  496 ASP A N   
3385 C CA  . ASP A 452 ? 0.7571 1.0888 0.9735 -0.0524 -0.1519 0.1878  496 ASP A CA  
3386 C C   . ASP A 452 ? 0.7332 1.0541 0.9804 -0.0432 -0.1343 0.1784  496 ASP A C   
3387 O O   . ASP A 452 ? 0.7282 1.0663 1.0022 -0.0134 -0.1290 0.1897  496 ASP A O   
3388 C CB  . ASP A 452 ? 0.7695 1.1300 0.9940 -0.0176 -0.1599 0.2146  496 ASP A CB  
3389 C CG  . ASP A 452 ? 0.7272 1.1684 0.9963 -0.0041 -0.1703 0.2258  496 ASP A CG  
3390 O OD1 . ASP A 452 ? 0.6923 1.1880 0.9752 -0.0326 -0.1833 0.2176  496 ASP A OD1 
3391 O OD2 . ASP A 452 ? 0.7287 1.1777 1.0190 0.0345  -0.1636 0.2423  496 ASP A OD2 
3392 N N   . SER A 453 ? 0.6218 0.9129 0.8623 -0.0664 -0.1246 0.1582  497 SER A N   
3393 C CA  . SER A 453 ? 0.5973 0.8810 0.8620 -0.0606 -0.1089 0.1486  497 SER A CA  
3394 C C   . SER A 453 ? 0.6238 0.8791 0.8969 -0.0279 -0.0947 0.1537  497 SER A C   
3395 O O   . SER A 453 ? 0.6088 0.8858 0.9107 -0.0104 -0.0871 0.1549  497 SER A O   
3396 C CB  . SER A 453 ? 0.5542 0.9035 0.8545 -0.0661 -0.1148 0.1516  497 SER A CB  
3397 O OG  . SER A 453 ? 0.5317 0.9017 0.8233 -0.1017 -0.1260 0.1444  497 SER A OG  
3398 N N   . GLY A 454 ? 0.6518 0.8588 0.8983 -0.0208 -0.0900 0.1564  498 GLY A N   
3399 C CA  . GLY A 454 ? 0.6783 0.8459 0.9256 0.0047  -0.0752 0.1597  498 GLY A CA  
3400 C C   . GLY A 454 ? 0.6950 0.8712 0.9452 0.0349  -0.0793 0.1828  498 GLY A C   
3401 O O   . GLY A 454 ? 0.7163 0.8506 0.9629 0.0568  -0.0653 0.1867  498 GLY A O   
3402 N N   . GLY A 455 ? 0.8143 1.0438 1.0692 0.0363  -0.0981 0.1985  499 GLY A N   
3403 C CA  . GLY A 455 ? 0.8268 1.0728 1.0847 0.0691  -0.1039 0.2241  499 GLY A CA  
3404 C C   . GLY A 455 ? 0.8681 1.0515 1.0891 0.0776  -0.0972 0.2349  499 GLY A C   
3405 O O   . GLY A 455 ? 0.8885 1.0491 1.1068 0.1103  -0.0902 0.2535  499 GLY A O   
3406 N N   . ILE A 456 ? 0.9473 1.1009 1.1383 0.0485  -0.0977 0.2238  500 ILE A N   
3407 C CA  . ILE A 456 ? 0.9807 1.0777 1.1350 0.0500  -0.0897 0.2327  500 ILE A CA  
3408 C C   . ILE A 456 ? 0.9799 1.0308 1.1205 0.0238  -0.0753 0.2092  500 ILE A C   
3409 O O   . ILE A 456 ? 0.9625 1.0318 1.1078 0.0000  -0.0793 0.1906  500 ILE A O   
3410 C CB  . ILE A 456 ? 0.9955 1.1168 1.1202 0.0434  -0.1081 0.2490  500 ILE A CB  
3411 C CG1 . ILE A 456 ? 0.9886 1.1693 1.1290 0.0701  -0.1256 0.2740  500 ILE A CG1 
3412 C CG2 . ILE A 456 ? 1.0297 1.0919 1.1142 0.0450  -0.0972 0.2603  500 ILE A CG2 
3413 C CD1 . ILE A 456 ? 1.0077 1.2100 1.1149 0.0674  -0.1432 0.2921  500 ILE A CD1 
3414 N N   . ILE A 457 ? 0.8031 0.7947 0.9270 0.0283  -0.0577 0.2108  501 ILE A N   
3415 C CA  . ILE A 457 ? 0.7936 0.7496 0.9015 0.0030  -0.0454 0.1923  501 ILE A CA  
3416 C C   . ILE A 457 ? 0.8194 0.7404 0.8900 -0.0005 -0.0406 0.2070  501 ILE A C   
3417 O O   . ILE A 457 ? 0.8481 0.7420 0.9072 0.0192  -0.0355 0.2283  501 ILE A O   
3418 C CB  . ILE A 457 ? 0.7787 0.7009 0.9027 0.0027  -0.0266 0.1750  501 ILE A CB  
3419 C CG1 . ILE A 457 ? 0.7607 0.7183 0.9186 0.0098  -0.0303 0.1635  501 ILE A CG1 
3420 C CG2 . ILE A 457 ? 0.7528 0.6555 0.8655 -0.0238 -0.0167 0.1558  501 ILE A CG2 
3421 C CD1 . ILE A 457 ? 0.7450 0.6782 0.9155 0.0054  -0.0144 0.1425  501 ILE A CD1 
3422 N N   . VAL A 458 ? 0.8804 0.8000 0.9299 -0.0243 -0.0403 0.1966  502 VAL A N   
3423 C CA  . VAL A 458 ? 0.9086 0.8039 0.9198 -0.0293 -0.0364 0.2109  502 VAL A CA  
3424 C C   . VAL A 458 ? 0.8945 0.7547 0.8953 -0.0498 -0.0163 0.1955  502 VAL A C   
3425 O O   . VAL A 458 ? 0.8591 0.7300 0.8746 -0.0641 -0.0128 0.1723  502 VAL A O   
3426 C CB  . VAL A 458 ? 0.9234 0.8584 0.9124 -0.0369 -0.0565 0.2156  502 VAL A CB  
3427 C CG1 . VAL A 458 ? 0.9469 0.8608 0.8932 -0.0492 -0.0504 0.2213  502 VAL A CG1 
3428 C CG2 . VAL A 458 ? 0.9410 0.9102 0.9354 -0.0140 -0.0746 0.2391  502 VAL A CG2 
3429 N N   . ALA A 459 ? 0.8328 0.6533 0.8095 -0.0504 -0.0021 0.2097  503 ALA A N   
3430 C CA  . ALA A 459 ? 0.8203 0.6144 0.7926 -0.0710 0.0184  0.1959  503 ALA A CA  
3431 C C   . ALA A 459 ? 0.8570 0.6280 0.7891 -0.0795 0.0286  0.2125  503 ALA A C   
3432 O O   . ALA A 459 ? 0.8978 0.6495 0.8065 -0.0655 0.0269  0.2394  503 ALA A O   
3433 C CB  . ALA A 459 ? 0.8134 0.5744 0.8083 -0.0698 0.0339  0.1890  503 ALA A CB  
3434 N N   . ILE A 460 ? 1.0042 0.7800 0.9276 -0.1001 0.0398  0.1980  504 ILE A N   
3435 C CA  . ILE A 460 ? 1.0378 0.7954 0.9237 -0.1107 0.0532  0.2114  504 ILE A CA  
3436 C C   . ILE A 460 ? 1.0245 0.7616 0.9216 -0.1303 0.0782  0.2008  504 ILE A C   
3437 O O   . ILE A 460 ? 0.9855 0.7454 0.9086 -0.1411 0.0821  0.1760  504 ILE A O   
3438 C CB  . ILE A 460 ? 1.0439 0.8320 0.9037 -0.1179 0.0458  0.2038  504 ILE A CB  
3439 C CG1 . ILE A 460 ? 1.0607 0.8739 0.9069 -0.1044 0.0198  0.2126  504 ILE A CG1 
3440 C CG2 . ILE A 460 ? 1.0794 0.8507 0.8997 -0.1287 0.0628  0.2168  504 ILE A CG2 
3441 C CD1 . ILE A 460 ? 1.1080 0.9089 0.9177 -0.0927 0.0149  0.2445  504 ILE A CD1 
3442 N N   . GLU A 461 ? 1.5763 1.2723 1.4544 -0.1357 0.0952  0.2200  505 GLU A N   
3443 C CA  . GLU A 461 ? 1.5611 1.2415 1.4511 -0.1599 0.1195  0.2093  505 GLU A CA  
3444 C C   . GLU A 461 ? 1.5463 1.2636 1.4311 -0.1759 0.1276  0.1953  505 GLU A C   
3445 O O   . GLU A 461 ? 1.5724 1.3006 1.4237 -0.1723 0.1245  0.2052  505 GLU A O   
3446 C CB  . GLU A 461 ? 1.6005 1.2249 1.4652 -0.1666 0.1389  0.2343  505 GLU A CB  
3447 C CG  . GLU A 461 ? 1.5866 1.1988 1.4658 -0.1980 0.1645  0.2214  505 GLU A CG  
3448 C CD  . GLU A 461 ? 1.6277 1.1799 1.4769 -0.2103 0.1872  0.2469  505 GLU A CD  
3449 O OE1 . GLU A 461 ? 1.6699 1.1879 1.4850 -0.1898 0.1827  0.2771  505 GLU A OE1 
3450 O OE2 . GLU A 461 ? 1.6188 1.1600 1.4782 -0.2409 0.2098  0.2378  505 GLU A OE2 
3451 N N   . HIS A 462 ? 1.1499 0.8891 1.0668 -0.1919 0.1380  0.1717  506 HIS A N   
3452 C CA  . HIS A 462 ? 1.1403 0.9171 1.0560 -0.2034 0.1485  0.1590  506 HIS A CA  
3453 C C   . HIS A 462 ? 1.1549 0.9182 1.0606 -0.2271 0.1751  0.1681  506 HIS A C   
3454 O O   . HIS A 462 ? 1.1352 0.8945 1.0671 -0.2465 0.1885  0.1594  506 HIS A O   
3455 C CB  . HIS A 462 ? 1.0951 0.9129 1.0513 -0.2047 0.1450  0.1309  506 HIS A CB  
3456 C CG  . HIS A 462 ? 1.0909 0.9488 1.0503 -0.2135 0.1592  0.1187  506 HIS A CG  
3457 N ND1 . HIS A 462 ? 1.0750 0.9525 1.0560 -0.2351 0.1794  0.1113  506 HIS A ND1 
3458 C CD2 . HIS A 462 ? 1.1065 0.9892 1.0494 -0.2030 0.1573  0.1123  506 HIS A CD2 
3459 C CE1 . HIS A 462 ? 1.0781 0.9968 1.0594 -0.2343 0.1893  0.1023  506 HIS A CE1 
3460 N NE2 . HIS A 462 ? 1.1009 1.0188 1.0573 -0.2139 0.1770  0.1023  506 HIS A NE2 
3461 N N   . SER A 463 ? 1.1645 0.9231 1.0305 -0.2280 0.1834  0.1849  507 SER A N   
3462 C CA  . SER A 463 ? 1.1843 0.9232 1.0348 -0.2506 0.2096  0.1996  507 SER A CA  
3463 C C   . SER A 463 ? 1.1846 0.9682 1.0281 -0.2595 0.2248  0.1907  507 SER A C   
3464 O O   . SER A 463 ? 1.1920 1.0029 1.0222 -0.2434 0.2142  0.1820  507 SER A O   
3465 C CB  . SER A 463 ? 1.2336 0.9206 1.0377 -0.2429 0.2103  0.2336  507 SER A CB  
3466 O OG  . SER A 463 ? 1.2531 0.9089 1.0437 -0.2676 0.2382  0.2499  507 SER A OG  
3467 N N   . SER A 464 ? 1.4021 1.1933 1.2538 -0.2859 0.2512  0.1921  508 SER A N   
3468 C CA  . SER A 464 ? 1.4103 1.2437 1.2501 -0.2919 0.2689  0.1882  508 SER A CA  
3469 C C   . SER A 464 ? 1.4548 1.2696 1.2330 -0.2809 0.2710  0.2104  508 SER A C   
3470 O O   . SER A 464 ? 1.4655 1.3156 1.2285 -0.2820 0.2859  0.2050  508 SER A O   
3471 C CB  . SER A 464 ? 1.3982 1.2510 1.2619 -0.3260 0.2987  0.1866  508 SER A CB  
3472 O OG  . SER A 464 ? 1.4347 1.2319 1.2730 -0.3458 0.3141  0.2127  508 SER A OG  
3473 N N   . ARG A 465 ? 1.7058 1.4707 1.4476 -0.2696 0.2581  0.2352  509 ARG A N   
3474 C CA  . ARG A 465 ? 1.7520 1.5004 1.4300 -0.2592 0.2575  0.2597  509 ARG A CA  
3475 C C   . ARG A 465 ? 1.7868 1.4931 1.4433 -0.2386 0.2323  0.2812  509 ARG A C   
3476 O O   . ARG A 465 ? 1.7700 1.4574 1.4597 -0.2325 0.2192  0.2774  509 ARG A O   
3477 C CB  . ARG A 465 ? 1.7768 1.5105 1.4260 -0.2819 0.2903  0.2825  509 ARG A CB  
3478 C CG  . ARG A 465 ? 1.8181 1.5770 1.4242 -0.2929 0.3183  0.2913  509 ARG A CG  
3479 C CD  . ARG A 465 ? 1.9253 1.6419 1.4481 -0.3018 0.3431  0.3409  509 ARG A CD  
3480 N NE  . ARG A 465 ? 1.9755 1.6787 1.5103 -0.3198 0.3661  0.3624  509 ARG A NE  
3481 C CZ  . ARG A 465 ? 2.0023 1.7271 1.5572 -0.3420 0.3925  0.3649  509 ARG A CZ  
3482 N NH1 . ARG A 465 ? 1.9776 1.7450 1.5880 -0.3647 0.4092  0.3426  509 ARG A NH1 
3483 N NH2 . ARG A 465 ? 2.0703 1.7592 1.5915 -0.3426 0.3996  0.3989  509 ARG A NH2 
3484 N N   . PRO A 466 ? 1.3865 1.0781 0.9859 -0.2282 0.2285  0.3069  510 PRO A N   
3485 C CA  . PRO A 466 ? 1.4069 1.0946 0.9853 -0.2028 0.1970  0.3161  510 PRO A CA  
3486 C C   . PRO A 466 ? 1.4074 1.0576 1.0024 -0.1886 0.1829  0.3336  510 PRO A C   
3487 O O   . PRO A 466 ? 1.4172 1.0219 1.0136 -0.1955 0.1996  0.3535  510 PRO A O   
3488 C CB  . PRO A 466 ? 1.4613 1.1439 0.9719 -0.1993 0.2017  0.3427  510 PRO A CB  
3489 C CG  . PRO A 466 ? 1.4647 1.1620 0.9656 -0.2210 0.2335  0.3357  510 PRO A CG  
3490 C CD  . PRO A 466 ? 1.4319 1.1151 0.9801 -0.2389 0.2518  0.3300  510 PRO A CD  
3491 N N   . ILE A 467 ? 1.4433 1.1123 1.0482 -0.1682 0.1527  0.3261  511 ILE A N   
3492 C CA  . ILE A 467 ? 1.4412 1.0866 1.0666 -0.1496 0.1367  0.3385  511 ILE A CA  
3493 C C   . ILE A 467 ? 1.4750 1.1357 1.0655 -0.1255 0.1098  0.3589  511 ILE A C   
3494 O O   . ILE A 467 ? 1.4755 1.1775 1.0492 -0.1252 0.0938  0.3449  511 ILE A O   
3495 C CB  . ILE A 467 ? 1.3894 1.0546 1.0731 -0.1494 0.1260  0.3064  511 ILE A CB  
3496 C CG1 . ILE A 467 ? 1.3681 1.0839 1.0573 -0.1512 0.1116  0.2776  511 ILE A CG1 
3497 C CG2 . ILE A 467 ? 1.3592 1.0093 1.0773 -0.1718 0.1506  0.2906  511 ILE A CG2 
3498 C CD1 . ILE A 467 ? 1.3675 1.1076 1.0576 -0.1322 0.0799  0.2765  511 ILE A CD1 
3499 N N   . ASN A 468 ? 1.4937 1.1208 1.0680 -0.1060 0.1062  0.3932  512 ASN A N   
3500 C CA  . ASN A 468 ? 1.5201 1.1726 1.0720 -0.0795 0.0766  0.4125  512 ASN A CA  
3501 C C   . ASN A 468 ? 1.4956 1.1570 1.0921 -0.0576 0.0561  0.4088  512 ASN A C   
3502 O O   . ASN A 468 ? 1.5092 1.1951 1.0952 -0.0330 0.0319  0.4278  512 ASN A O   
3503 C CB  . ASN A 468 ? 1.5721 1.1935 1.0688 -0.0651 0.0828  0.4581  512 ASN A CB  
3504 C CG  . ASN A 468 ? 1.5813 1.1325 1.0834 -0.0589 0.1059  0.4829  512 ASN A CG  
3505 O OD1 . ASN A 468 ? 1.5537 1.0752 1.0908 -0.0777 0.1263  0.4639  512 ASN A OD1 
3506 N ND2 . ASN A 468 ? 1.6235 1.1466 1.0890 -0.0323 0.1028  0.5259  512 ASN A ND2 
3507 N N   . VAL A 469 ? 1.4158 1.0616 1.0615 -0.0660 0.0661  0.3854  513 VAL A N   
3508 C CA  . VAL A 469 ? 1.3981 1.0408 1.0826 -0.0438 0.0536  0.3858  513 VAL A CA  
3509 C C   . VAL A 469 ? 1.3460 1.0263 1.0818 -0.0502 0.0416  0.3484  513 VAL A C   
3510 O O   . VAL A 469 ? 1.3137 0.9960 1.0709 -0.0732 0.0541  0.3198  513 VAL A O   
3511 C CB  . VAL A 469 ? 1.4079 0.9796 1.0990 -0.0400 0.0785  0.4007  513 VAL A CB  
3512 C CG1 . VAL A 469 ? 1.3830 0.9494 1.1187 -0.0218 0.0712  0.3906  513 VAL A CG1 
3513 C CG2 . VAL A 469 ? 1.4573 0.9880 1.1000 -0.0207 0.0850  0.4460  513 VAL A CG2 
3514 N N   . ILE A 470 ? 1.2901 1.0035 1.0453 -0.0281 0.0175  0.3514  514 ILE A N   
3515 C CA  . ILE A 470 ? 1.2425 0.9885 1.0453 -0.0299 0.0062  0.3222  514 ILE A CA  
3516 C C   . ILE A 470 ? 1.2378 0.9597 1.0721 -0.0067 0.0090  0.3300  514 ILE A C   
3517 O O   . ILE A 470 ? 1.2682 0.9702 1.0878 0.0199  0.0073  0.3610  514 ILE A O   
3518 C CB  . ILE A 470 ? 1.2306 1.0411 1.0323 -0.0276 -0.0231 0.3157  514 ILE A CB  
3519 C CG1 . ILE A 470 ? 1.1837 1.0251 1.0305 -0.0347 -0.0315 0.2850  514 ILE A CG1 
3520 C CG2 . ILE A 470 ? 1.2553 1.0885 1.0452 0.0016  -0.0430 0.3476  514 ILE A CG2 
3521 C CD1 . ILE A 470 ? 1.1764 1.0722 1.0172 -0.0441 -0.0550 0.2726  514 ILE A CD1 
3522 N N   . LYS A 471 ? 1.1826 0.9041 1.0571 -0.0150 0.0148  0.3025  515 LYS A N   
3523 C CA  . LYS A 471 ? 1.1783 0.8783 1.0821 0.0056  0.0189  0.3039  515 LYS A CA  
3524 C C   . LYS A 471 ? 1.1448 0.9011 1.0850 0.0163  -0.0017 0.2898  515 LYS A C   
3525 O O   . LYS A 471 ? 1.1111 0.9066 1.0645 -0.0029 -0.0104 0.2660  515 LYS A O   
3526 C CB  . LYS A 471 ? 1.1643 0.8190 1.0844 -0.0128 0.0429  0.2828  515 LYS A CB  
3527 C CG  . LYS A 471 ? 1.1898 0.7959 1.0807 -0.0334 0.0656  0.2901  515 LYS A CG  
3528 C CD  . LYS A 471 ? 1.1599 0.7427 1.0740 -0.0590 0.0850  0.2616  515 LYS A CD  
3529 C CE  . LYS A 471 ? 1.1869 0.7142 1.0754 -0.0804 0.1112  0.2712  515 LYS A CE  
3530 N NZ  . LYS A 471 ? 1.1572 0.6623 1.0700 -0.1058 0.1293  0.2439  515 LYS A NZ  
3531 N N   . PHE A 472 ? 1.0428 0.8015 0.9992 0.0475  -0.0072 0.3048  516 PHE A N   
3532 C CA  . PHE A 472 ? 1.0118 0.8275 1.0058 0.0578  -0.0243 0.2930  516 PHE A CA  
3533 C C   . PHE A 472 ? 1.0136 0.8086 1.0347 0.0843  -0.0149 0.2940  516 PHE A C   
3534 O O   . PHE A 472 ? 1.0461 0.7858 1.0530 0.1045  0.0000  0.3122  516 PHE A O   
3535 C CB  . PHE A 472 ? 1.0136 0.8927 1.0010 0.0697  -0.0510 0.3113  516 PHE A CB  
3536 C CG  . PHE A 472 ? 1.0439 0.9182 1.0173 0.1067  -0.0555 0.3486  516 PHE A CG  
3537 C CD1 . PHE A 472 ? 1.0859 0.9097 1.0173 0.1127  -0.0446 0.3735  516 PHE A CD1 
3538 C CD2 . PHE A 472 ? 1.0285 0.9543 1.0296 0.1362  -0.0710 0.3608  516 PHE A CD2 
3539 C CE1 . PHE A 472 ? 1.1141 0.9317 1.0290 0.1509  -0.0487 0.4118  516 PHE A CE1 
3540 C CE2 . PHE A 472 ? 1.0519 0.9796 1.0407 0.1754  -0.0761 0.3979  516 PHE A CE2 
3541 C CZ  . PHE A 472 ? 1.0956 0.9663 1.0397 0.1842  -0.0650 0.4243  516 PHE A CZ  
3542 N N   . SER A 473 ? 0.9770 0.8126 1.0346 0.0831  -0.0216 0.2732  517 SER A N   
3543 C CA  . SER A 473 ? 0.9754 0.7985 1.0606 0.1057  -0.0117 0.2675  517 SER A CA  
3544 C C   . SER A 473 ? 0.9461 0.8445 1.0662 0.1184  -0.0297 0.2650  517 SER A C   
3545 O O   . SER A 473 ? 0.9161 0.8598 1.0487 0.0942  -0.0413 0.2474  517 SER A O   
3546 C CB  . SER A 473 ? 0.9631 0.7479 1.0568 0.0827  0.0069  0.2365  517 SER A CB  
3547 O OG  . SER A 473 ? 0.9533 0.7463 1.0763 0.0984  0.0119  0.2231  517 SER A OG  
3548 N N   . THR A 474 ? 1.0405 0.9523 1.1755 0.1564  -0.0309 0.2834  518 THR A N   
3549 C CA  . THR A 474 ? 1.0077 0.9974 1.1806 0.1686  -0.0457 0.2816  518 THR A CA  
3550 C C   . THR A 474 ? 0.9963 0.9807 1.1990 0.1789  -0.0310 0.2617  518 THR A C   
3551 O O   . THR A 474 ? 0.9667 1.0159 1.2023 0.1874  -0.0399 0.2590  518 THR A O   
3552 C CB  . THR A 474 ? 1.0109 1.0453 1.1890 0.2067  -0.0599 0.3155  518 THR A CB  
3553 O OG1 . THR A 474 ? 1.0502 1.0183 1.2088 0.2415  -0.0429 0.3366  518 THR A OG1 
3554 C CG2 . THR A 474 ? 1.0092 1.0850 1.1660 0.1910  -0.0828 0.3300  518 THR A CG2 
3555 N N   . ASP A 475 ? 1.0515 0.9614 1.2417 0.1777  -0.0081 0.2481  519 ASP A N   
3556 C CA  . ASP A 475 ? 1.0469 0.9450 1.2579 0.1851  0.0073  0.2259  519 ASP A CA  
3557 C C   . ASP A 475 ? 1.0279 0.9212 1.2421 0.1468  0.0120  0.1927  519 ASP A C   
3558 O O   . ASP A 475 ? 1.0362 0.8971 1.2541 0.1469  0.0285  0.1719  519 ASP A O   
3559 C CB  . ASP A 475 ? 1.0892 0.9092 1.2847 0.2132  0.0305  0.2307  519 ASP A CB  
3560 C CG  . ASP A 475 ? 1.1201 0.8594 1.2791 0.1928  0.0438  0.2297  519 ASP A CG  
3561 O OD1 . ASP A 475 ? 1.1025 0.8476 1.2527 0.1546  0.0382  0.2175  519 ASP A OD1 
3562 O OD2 . ASP A 475 ? 1.1614 0.8302 1.3002 0.2155  0.0616  0.2413  519 ASP A OD2 
3563 N N   . GLU A 476 ? 1.0120 0.9302 1.2196 0.1153  -0.0010 0.1880  520 GLU A N   
3564 C CA  . GLU A 476 ? 0.9904 0.9060 1.1988 0.0818  0.0027  0.1602  520 GLU A CA  
3565 C C   . GLU A 476 ? 1.0046 0.8537 1.1917 0.0654  0.0202  0.1466  520 GLU A C   
3566 O O   . GLU A 476 ? 0.9937 0.8338 1.1872 0.0513  0.0294  0.1223  520 GLU A O   
3567 C CB  . GLU A 476 ? 0.9712 0.9212 1.2074 0.0847  0.0052  0.1420  520 GLU A CB  
3568 C CG  . GLU A 476 ? 0.9440 0.9667 1.2041 0.0895  -0.0112 0.1509  520 GLU A CG  
3569 C CD  . GLU A 476 ? 0.9227 0.9787 1.2075 0.0898  -0.0066 0.1345  520 GLU A CD  
3570 O OE1 . GLU A 476 ? 0.9339 0.9572 1.2158 0.0895  0.0087  0.1158  520 GLU A OE1 
3571 O OE2 . GLU A 476 ? 0.8934 1.0104 1.1992 0.0885  -0.0181 0.1404  520 GLU A OE2 
3572 N N   . GLY A 477 ? 1.1367 0.9430 1.2980 0.0662  0.0248  0.1632  521 GLY A N   
3573 C CA  . GLY A 477 ? 1.1452 0.8959 1.2860 0.0435  0.0404  0.1525  521 GLY A CA  
3574 C C   . GLY A 477 ? 1.1821 0.8654 1.3140 0.0531  0.0618  0.1474  521 GLY A C   
3575 O O   . GLY A 477 ? 1.1884 0.8282 1.3066 0.0287  0.0759  0.1341  521 GLY A O   
3576 N N   . GLN A 478 ? 1.1973 0.8724 1.3372 0.0873  0.0652  0.1564  522 GLN A N   
3577 C CA  . GLN A 478 ? 1.2397 0.8396 1.3656 0.1000  0.0877  0.1520  522 GLN A CA  
3578 C C   . GLN A 478 ? 1.2791 0.8180 1.3744 0.1128  0.0966  0.1814  522 GLN A C   
3579 O O   . GLN A 478 ? 1.3154 0.7755 1.3890 0.1083  0.1180  0.1772  522 GLN A O   
3580 C CB  . GLN A 478 ? 1.2486 0.8607 1.3936 0.1351  0.0915  0.1482  522 GLN A CB  
3581 C CG  . GLN A 478 ? 1.2386 0.8546 1.3962 0.1205  0.1001  0.1113  522 GLN A CG  
3582 C CD  . GLN A 478 ? 1.2366 0.8876 1.4170 0.1541  0.1010  0.1077  522 GLN A CD  
3583 O OE1 . GLN A 478 ? 1.2603 0.8966 1.4409 0.1938  0.1066  0.1273  522 GLN A OE1 
3584 N NE2 . GLN A 478 ? 1.2067 0.9067 1.4060 0.1399  0.0963  0.0840  522 GLN A NE2 
3585 N N   . CYS A 479 ? 1.3718 0.9462 1.4630 0.1278  0.0803  0.2114  523 CYS A N   
3586 C CA  . CYS A 479 ? 1.4099 0.9340 1.4690 0.1435  0.0864  0.2445  523 CYS A CA  
3587 C C   . CYS A 479 ? 1.3951 0.9621 1.4420 0.1305  0.0681  0.2635  523 CYS A C   
3588 O O   . CYS A 479 ? 1.3614 1.0051 1.4274 0.1282  0.0463  0.2616  523 CYS A O   
3589 C CB  . CYS A 479 ? 1.4368 0.9513 1.4975 0.1959  0.0878  0.2707  523 CYS A CB  
3590 S SG  . CYS A 479 ? 1.4763 0.9081 1.5341 0.2166  0.1172  0.2537  523 CYS A SG  
3591 N N   . TRP A 480 ? 1.0503 0.5640 1.0619 0.1217  0.0786  0.2820  524 TRP A N   
3592 C CA  . TRP A 480 ? 1.0428 0.5894 1.0360 0.1047  0.0652  0.2962  524 TRP A CA  
3593 C C   . TRP A 480 ? 1.0853 0.6005 1.0428 0.1299  0.0662  0.3380  524 TRP A C   
3594 O O   . TRP A 480 ? 1.1545 0.5951 1.0925 0.1482  0.0859  0.3540  524 TRP A O   
3595 C CB  . TRP A 480 ? 1.0284 0.5552 1.0126 0.0587  0.0772  0.2737  524 TRP A CB  
3596 C CG  . TRP A 480 ? 0.9812 0.5575 0.9978 0.0376  0.0698  0.2387  524 TRP A CG  
3597 C CD1 . TRP A 480 ? 0.9685 0.5313 1.0068 0.0303  0.0800  0.2108  524 TRP A CD1 
3598 C CD2 . TRP A 480 ? 0.9421 0.5889 0.9709 0.0229  0.0504  0.2284  524 TRP A CD2 
3599 N NE1 . TRP A 480 ? 0.9216 0.5446 0.9852 0.0136  0.0679  0.1864  524 TRP A NE1 
3600 C CE2 . TRP A 480 ? 0.9044 0.5757 0.9626 0.0090  0.0506  0.1968  524 TRP A CE2 
3601 C CE3 . TRP A 480 ? 0.9383 0.6260 0.9522 0.0198  0.0338  0.2422  524 TRP A CE3 
3602 C CZ2 . TRP A 480 ? 0.8614 0.5912 0.9346 -0.0062 0.0362  0.1810  524 TRP A CZ2 
3603 C CZ3 . TRP A 480 ? 0.8980 0.6419 0.9266 0.0027  0.0198  0.2231  524 TRP A CZ3 
3604 C CH2 . TRP A 480 ? 0.8594 0.6211 0.9173 -0.0092 0.0218  0.1940  524 TRP A CH2 
3605 N N   . GLN A 481 ? 1.7281 1.2996 1.6747 0.1313  0.0450  0.3555  525 GLN A N   
3606 C CA  . GLN A 481 ? 1.7678 1.3201 1.6761 0.1526  0.0430  0.3961  525 GLN A CA  
3607 C C   . GLN A 481 ? 1.7645 1.3373 1.6454 0.1195  0.0371  0.3962  525 GLN A C   
3608 O O   . GLN A 481 ? 1.7298 1.3626 1.6264 0.0961  0.0219  0.3732  525 GLN A O   
3609 C CB  . GLN A 481 ? 1.7669 1.3789 1.6866 0.1961  0.0198  0.4219  525 GLN A CB  
3610 C CG  . GLN A 481 ? 1.7347 1.3644 1.6961 0.2251  0.0195  0.4115  525 GLN A CG  
3611 C CD  . GLN A 481 ? 1.6036 1.3197 1.6065 0.2070  -0.0004 0.3817  525 GLN A CD  
3612 O OE1 . GLN A 481 ? 1.5527 1.3263 1.5527 0.1844  -0.0199 0.3774  525 GLN A OE1 
3613 N NE2 . GLN A 481 ? 1.5656 1.2876 1.6038 0.2171  0.0060  0.3614  525 GLN A NE2 
3614 N N   . THR A 482 ? 1.4490 0.9668 1.2869 0.1177  0.0517  0.4220  526 THR A N   
3615 C CA  . THR A 482 ? 1.4526 0.9823 1.2589 0.0880  0.0512  0.4242  526 THR A CA  
3616 C C   . THR A 482 ? 1.4707 1.0457 1.2464 0.1093  0.0288  0.4570  526 THR A C   
3617 O O   . THR A 482 ? 1.5006 1.0544 1.2566 0.1461  0.0276  0.4938  526 THR A O   
3618 C CB  . THR A 482 ? 1.4831 0.9276 1.2580 0.0669  0.0835  0.4322  526 THR A CB  
3619 O OG1 . THR A 482 ? 1.4512 0.8853 1.2512 0.0293  0.0983  0.3937  526 THR A OG1 
3620 C CG2 . THR A 482 ? 1.5106 0.9574 1.2381 0.0552  0.0846  0.4555  526 THR A CG2 
3621 N N   . TYR A 483 ? 1.3905 1.0274 1.1602 0.0873  0.0111  0.4431  527 TYR A N   
3622 C CA  . TYR A 483 ? 1.4095 1.0927 1.1443 0.0995  -0.0106 0.4691  527 TYR A CA  
3623 C C   . TYR A 483 ? 1.4275 1.1086 1.1208 0.0676  -0.0040 0.4651  527 TYR A C   
3624 O O   . TYR A 483 ? 1.4045 1.0978 1.1107 0.0348  0.0012  0.4307  527 TYR A O   
3625 C CB  . TYR A 483 ? 1.3752 1.1473 1.1393 0.1064  -0.0433 0.4564  527 TYR A CB  
3626 C CG  . TYR A 483 ? 1.3878 1.2191 1.1164 0.1049  -0.0681 0.4703  527 TYR A CG  
3627 C CD1 . TYR A 483 ? 1.4217 1.2536 1.1123 0.1346  -0.0756 0.5134  527 TYR A CD1 
3628 C CD2 . TYR A 483 ? 1.3666 1.2514 1.0968 0.0744  -0.0839 0.4403  527 TYR A CD2 
3629 C CE1 . TYR A 483 ? 1.4332 1.3240 1.0883 0.1320  -0.0999 0.5250  527 TYR A CE1 
3630 C CE2 . TYR A 483 ? 1.3807 1.3176 1.0745 0.0699  -0.1065 0.4492  527 TYR A CE2 
3631 C CZ  . TYR A 483 ? 1.4135 1.3564 1.0697 0.0979  -0.1153 0.4911  527 TYR A CZ  
3632 O OH  . TYR A 483 ? 1.4281 1.4273 1.0448 0.0928  -0.1394 0.4997  527 TYR A OH  
3633 N N   . THR A 484 ? 1.4924 1.1593 1.1346 0.0801  -0.0033 0.5015  528 THR A N   
3634 C CA  . THR A 484 ? 1.5155 1.1846 1.1113 0.0540  0.0029  0.5020  528 THR A CA  
3635 C C   . THR A 484 ? 1.5117 1.2608 1.0906 0.0534  -0.0292 0.4978  528 THR A C   
3636 O O   . THR A 484 ? 1.5270 1.3074 1.0853 0.0809  -0.0498 0.5280  528 THR A O   
3637 C CB  . THR A 484 ? 1.5642 1.1729 1.1066 0.0653  0.0230  0.5451  528 THR A CB  
3638 O OG1 . THR A 484 ? 1.5685 1.1013 1.1175 0.0464  0.0582  0.5393  528 THR A OG1 
3639 C CG2 . THR A 484 ? 1.5919 1.2268 1.0786 0.0502  0.0192  0.5541  528 THR A CG2 
3640 N N   . PHE A 485 ? 1.4737 1.2561 1.0607 0.0222  -0.0336 0.4599  529 PHE A N   
3641 C CA  . PHE A 485 ? 1.4655 1.3201 1.0408 0.0162  -0.0639 0.4477  529 PHE A CA  
3642 C C   . PHE A 485 ? 1.5024 1.3679 1.0141 0.0026  -0.0650 0.4550  529 PHE A C   
3643 O O   . PHE A 485 ? 1.5040 1.4268 0.9950 -0.0019 -0.0911 0.4484  529 PHE A O   
3644 C CB  . PHE A 485 ? 1.4213 1.3030 1.0371 -0.0084 -0.0690 0.4017  529 PHE A CB  
3645 C CG  . PHE A 485 ? 1.4147 1.2614 1.0289 -0.0368 -0.0425 0.3747  529 PHE A CG  
3646 C CD1 . PHE A 485 ? 1.4303 1.2886 1.0041 -0.0583 -0.0399 0.3604  529 PHE A CD1 
3647 C CD2 . PHE A 485 ? 1.3908 1.1977 1.0445 -0.0413 -0.0206 0.3626  529 PHE A CD2 
3648 C CE1 . PHE A 485 ? 1.4203 1.2537 0.9961 -0.0802 -0.0150 0.3370  529 PHE A CE1 
3649 C CE2 . PHE A 485 ? 1.3777 1.1639 1.0340 -0.0658 0.0020  0.3390  529 PHE A CE2 
3650 C CZ  . PHE A 485 ? 1.3911 1.1920 1.0101 -0.0838 0.0053  0.3272  529 PHE A CZ  
3651 N N   . THR A 486 ? 1.6043 1.4163 1.0846 -0.0065 -0.0357 0.4664  530 THR A N   
3652 C CA  . THR A 486 ? 1.6439 1.4604 1.0600 -0.0188 -0.0308 0.4752  530 THR A CA  
3653 C C   . THR A 486 ? 1.6766 1.4287 1.0630 -0.0126 -0.0008 0.5100  530 THR A C   
3654 O O   . THR A 486 ? 1.6606 1.3616 1.0792 -0.0169 0.0235  0.5075  530 THR A O   
3655 C CB  . THR A 486 ? 1.6321 1.4599 1.0442 -0.0527 -0.0208 0.4322  530 THR A CB  
3656 O OG1 . THR A 486 ? 1.6729 1.5104 1.0183 -0.0620 -0.0177 0.4398  530 THR A OG1 
3657 C CG2 . THR A 486 ? 1.6093 1.3902 1.0536 -0.0690 0.0127  0.4158  530 THR A CG2 
3658 N N   . ARG A 487 ? 2.2110 1.9633 1.5349 -0.0035 -0.0018 0.5435  531 ARG A N   
3659 C CA  . ARG A 487 ? 2.2535 1.9388 1.5462 -0.0017 0.0306  0.5771  531 ARG A CA  
3660 C C   . ARG A 487 ? 2.2707 1.9473 1.5259 -0.0340 0.0563  0.5633  531 ARG A C   
3661 O O   . ARG A 487 ? 2.3203 1.9446 1.5504 -0.0418 0.0878  0.5859  531 ARG A O   
3662 C CB  . ARG A 487 ? 2.3266 2.0043 1.5772 0.0338  0.0184  0.6280  531 ARG A CB  
3663 C CG  . ARG A 487 ? 2.4140 2.0542 1.6032 0.0280  0.0356  0.6491  531 ARG A CG  
3664 C CD  . ARG A 487 ? 2.4817 2.1271 1.6439 0.0623  0.0123  0.6811  531 ARG A CD  
3665 N NE  . ARG A 487 ? 2.4633 2.1922 1.6166 0.0764  -0.0267 0.6740  531 ARG A NE  
3666 C CZ  . ARG A 487 ? 2.4762 2.2521 1.5811 0.0624  -0.0382 0.6634  531 ARG A CZ  
3667 N NH1 . ARG A 487 ? 2.5102 2.2572 1.5693 0.0379  -0.0117 0.6607  531 ARG A NH1 
3668 N NH2 . ARG A 487 ? 2.4585 2.3120 1.5619 0.0711  -0.0757 0.6530  531 ARG A NH2 
3669 N N   . ASP A 488 ? 1.9128 1.6386 1.1662 -0.0535 0.0454  0.5247  532 ASP A N   
3670 C CA  . ASP A 488 ? 1.9160 1.6350 1.1530 -0.0832 0.0733  0.5012  532 ASP A CA  
3671 C C   . ASP A 488 ? 1.8634 1.5879 1.1645 -0.1009 0.0796  0.4556  532 ASP A C   
3672 O O   . ASP A 488 ? 1.8397 1.6051 1.1568 -0.1048 0.0586  0.4231  532 ASP A O   
3673 C CB  . ASP A 488 ? 1.9446 1.7074 1.1217 -0.0909 0.0618  0.4911  532 ASP A CB  
3674 C CG  . ASP A 488 ? 2.0057 1.7687 1.1122 -0.0742 0.0558  0.5367  532 ASP A CG  
3675 O OD1 . ASP A 488 ? 2.0585 1.7812 1.1303 -0.0779 0.0857  0.5654  532 ASP A OD1 
3676 O OD2 . ASP A 488 ? 2.0213 1.8283 1.1057 -0.0586 0.0212  0.5445  532 ASP A OD2 
3677 N N   . PRO A 489 ? 1.5898 1.2735 0.9253 -0.1134 0.1093  0.4533  533 PRO A N   
3678 C CA  . PRO A 489 ? 1.5347 1.2225 0.9362 -0.1258 0.1141  0.4157  533 PRO A CA  
3679 C C   . PRO A 489 ? 1.5138 1.2401 0.9186 -0.1425 0.1156  0.3750  533 PRO A C   
3680 O O   . PRO A 489 ? 1.5434 1.2829 0.8991 -0.1502 0.1244  0.3746  533 PRO A O   
3681 C CB  . PRO A 489 ? 1.5274 1.1663 0.9470 -0.1405 0.1488  0.4264  533 PRO A CB  
3682 C CG  . PRO A 489 ? 1.5739 1.1703 0.9496 -0.1268 0.1552  0.4742  533 PRO A CG  
3683 C CD  . PRO A 489 ? 1.6156 1.2448 0.9290 -0.1162 0.1388  0.4892  533 PRO A CD  
3684 N N   . ILE A 490 ? 1.4083 1.1501 0.8673 -0.1461 0.1083  0.3419  534 ILE A N   
3685 C CA  . ILE A 490 ? 1.3908 1.1623 0.8558 -0.1579 0.1109  0.3035  534 ILE A CA  
3686 C C   . ILE A 490 ? 1.3474 1.1155 0.8654 -0.1704 0.1327  0.2807  534 ILE A C   
3687 O O   . ILE A 490 ? 1.3195 1.0686 0.8798 -0.1701 0.1359  0.2860  534 ILE A O   
3688 C CB  . ILE A 490 ? 1.3788 1.1797 0.8539 -0.1502 0.0785  0.2821  534 ILE A CB  
3689 C CG1 . ILE A 490 ? 1.3364 1.1342 0.8722 -0.1417 0.0651  0.2781  534 ILE A CG1 
3690 C CG2 . ILE A 490 ? 1.4179 1.2344 0.8429 -0.1406 0.0544  0.3016  534 ILE A CG2 
3691 C CD1 . ILE A 490 ? 1.3215 1.1495 0.8721 -0.1378 0.0363  0.2572  534 ILE A CD1 
3692 N N   . TYR A 491 ? 1.3935 1.1819 0.9075 -0.1802 0.1480  0.2552  535 TYR A N   
3693 C CA  . TYR A 491 ? 1.3520 1.1523 0.9187 -0.1879 0.1625  0.2292  535 TYR A CA  
3694 C C   . TYR A 491 ? 1.3257 1.1402 0.9237 -0.1783 0.1375  0.2046  535 TYR A C   
3695 O O   . TYR A 491 ? 1.3487 1.1758 0.9207 -0.1742 0.1248  0.1888  535 TYR A O   
3696 C CB  . TYR A 491 ? 1.3687 1.1893 0.9186 -0.1963 0.1885  0.2132  535 TYR A CB  
3697 C CG  . TYR A 491 ? 1.3745 1.1908 0.9175 -0.2117 0.2212  0.2305  535 TYR A CG  
3698 C CD1 . TYR A 491 ? 1.3344 1.1611 0.9289 -0.2247 0.2410  0.2227  535 TYR A CD1 
3699 C CD2 . TYR A 491 ? 1.4203 1.2266 0.9040 -0.2152 0.2331  0.2537  535 TYR A CD2 
3700 C CE1 . TYR A 491 ? 1.3381 1.1652 0.9286 -0.2434 0.2718  0.2369  535 TYR A CE1 
3701 C CE2 . TYR A 491 ? 1.4257 1.2284 0.9026 -0.2318 0.2652  0.2701  535 TYR A CE2 
3702 C CZ  . TYR A 491 ? 1.3845 1.1979 0.9160 -0.2472 0.2849  0.2613  535 TYR A CZ  
3703 O OH  . TYR A 491 ? 1.3911 1.2049 0.9155 -0.2681 0.3181  0.2773  535 TYR A OH  
3704 N N   . PHE A 492 ? 1.2109 1.0213 0.8616 -0.1764 0.1316  0.2006  536 PHE A N   
3705 C CA  . PHE A 492 ? 1.1878 1.0085 0.8640 -0.1667 0.1061  0.1849  536 PHE A CA  
3706 C C   . PHE A 492 ? 1.1711 1.0112 0.8715 -0.1677 0.1112  0.1533  536 PHE A C   
3707 O O   . PHE A 492 ? 1.1524 1.0010 0.8780 -0.1733 0.1318  0.1446  536 PHE A O   
3708 C CB  . PHE A 492 ? 1.1506 0.9577 0.8680 -0.1612 0.0970  0.1955  536 PHE A CB  
3709 C CG  . PHE A 492 ? 1.1190 0.9410 0.8689 -0.1530 0.0755  0.1788  536 PHE A CG  
3710 C CD1 . PHE A 492 ? 1.1328 0.9643 0.8673 -0.1442 0.0499  0.1840  536 PHE A CD1 
3711 C CD2 . PHE A 492 ? 1.0762 0.9076 0.8712 -0.1551 0.0808  0.1578  536 PHE A CD2 
3712 C CE1 . PHE A 492 ? 1.1044 0.9517 0.8692 -0.1397 0.0321  0.1691  536 PHE A CE1 
3713 C CE2 . PHE A 492 ? 1.0482 0.8923 0.8693 -0.1480 0.0629  0.1442  536 PHE A CE2 
3714 C CZ  . PHE A 492 ? 1.0621 0.9127 0.8690 -0.1413 0.0395  0.1498  536 PHE A CZ  
3715 N N   . THR A 493 ? 1.1435 0.9912 0.8364 -0.1624 0.0928  0.1369  537 THR A N   
3716 C CA  . THR A 493 ? 1.1345 0.9926 0.8491 -0.1598 0.0976  0.1093  537 THR A CA  
3717 C C   . THR A 493 ? 1.0974 0.9587 0.8497 -0.1546 0.0773  0.1007  537 THR A C   
3718 O O   . THR A 493 ? 1.0567 0.9256 0.8519 -0.1516 0.0830  0.0920  537 THR A O   
3719 C CB  . THR A 493 ? 1.1892 1.0452 0.8573 -0.1599 0.1009  0.0922  537 THR A CB  
3720 O OG1 . THR A 493 ? 1.2127 1.0637 0.8484 -0.1626 0.0766  0.0943  537 THR A OG1 
3721 C CG2 . THR A 493 ? 1.2226 1.0796 0.8547 -0.1638 0.1243  0.0990  537 THR A CG2 
3722 N N   . GLY A 494 ? 1.2086 1.0691 0.9453 -0.1543 0.0539  0.1026  538 GLY A N   
3723 C CA  . GLY A 494 ? 1.1726 1.0396 0.9455 -0.1508 0.0373  0.0956  538 GLY A CA  
3724 C C   . GLY A 494 ? 1.1697 1.0454 0.9426 -0.1494 0.0122  0.1099  538 GLY A C   
3725 O O   . GLY A 494 ? 1.2016 1.0795 0.9413 -0.1502 0.0041  0.1258  538 GLY A O   
3726 N N   . LEU A 495 ? 0.9473 0.8324 0.7590 -0.1457 0.0007  0.1056  539 LEU A N   
3727 C CA  . LEU A 495 ? 0.9484 0.8519 0.7660 -0.1447 -0.0237 0.1138  539 LEU A CA  
3728 C C   . LEU A 495 ? 0.9692 0.8787 0.7803 -0.1555 -0.0338 0.0930  539 LEU A C   
3729 O O   . LEU A 495 ? 0.9524 0.8516 0.7799 -0.1564 -0.0240 0.0760  539 LEU A O   
3730 C CB  . LEU A 495 ? 0.8966 0.8075 0.7613 -0.1333 -0.0277 0.1236  539 LEU A CB  
3731 C CG  . LEU A 495 ? 0.8804 0.7738 0.7543 -0.1246 -0.0137 0.1406  539 LEU A CG  
3732 C CD1 . LEU A 495 ? 0.8277 0.7194 0.7486 -0.1174 -0.0090 0.1365  539 LEU A CD1 
3733 C CD2 . LEU A 495 ? 0.9116 0.8060 0.7649 -0.1156 -0.0238 0.1675  539 LEU A CD2 
3734 N N   . ALA A 496 ? 0.8725 0.7982 0.6575 -0.1646 -0.0531 0.0947  540 ALA A N   
3735 C CA  . ALA A 496 ? 0.8863 0.8199 0.6702 -0.1793 -0.0660 0.0770  540 ALA A CA  
3736 C C   . ALA A 496 ? 0.8573 0.8297 0.6722 -0.1779 -0.0885 0.0904  540 ALA A C   
3737 O O   . ALA A 496 ? 0.8547 0.8506 0.6668 -0.1691 -0.1004 0.1118  540 ALA A O   
3738 C CB  . ALA A 496 ? 0.9401 0.8659 0.6681 -0.1965 -0.0706 0.0629  540 ALA A CB  
3739 N N   . SER A 497 ? 0.8402 0.8208 0.6854 -0.1842 -0.0929 0.0800  541 SER A N   
3740 C CA  . SER A 497 ? 0.8100 0.8350 0.6829 -0.1859 -0.1139 0.0903  541 SER A CA  
3741 C C   . SER A 497 ? 0.7825 0.8100 0.6696 -0.2043 -0.1171 0.0723  541 SER A C   
3742 O O   . SER A 497 ? 0.7704 0.7621 0.6574 -0.2065 -0.1006 0.0571  541 SER A O   
3743 C CB  . SER A 497 ? 0.7776 0.8168 0.6930 -0.1614 -0.1118 0.1105  541 SER A CB  
3744 O OG  . SER A 497 ? 0.7352 0.7672 0.6874 -0.1583 -0.1020 0.1016  541 SER A OG  
3745 N N   . GLU A 498 ? 0.9489 1.0210 0.8492 -0.2171 -0.1376 0.0755  542 GLU A N   
3746 C CA  . GLU A 498 ? 0.9231 0.9979 0.8328 -0.2410 -0.1407 0.0590  542 GLU A CA  
3747 C C   . GLU A 498 ? 0.8746 0.9336 0.8231 -0.2298 -0.1252 0.0576  542 GLU A C   
3748 O O   . GLU A 498 ? 0.8441 0.9281 0.8321 -0.2092 -0.1250 0.0730  542 GLU A O   
3749 C CB  . GLU A 498 ? 0.9049 1.0440 0.8303 -0.2568 -0.1658 0.0657  542 GLU A CB  
3750 C CG  . GLU A 498 ? 0.8996 1.0375 0.8122 -0.2947 -0.1717 0.0445  542 GLU A CG  
3751 C CD  . GLU A 498 ? 0.8616 1.0729 0.8112 -0.3092 -0.1923 0.0526  542 GLU A CD  
3752 O OE1 . GLU A 498 ? 0.8237 1.0655 0.8212 -0.2865 -0.1903 0.0694  542 GLU A OE1 
3753 O OE2 . GLU A 498 ? 0.8705 1.1110 0.8018 -0.3432 -0.2097 0.0415  542 GLU A OE2 
3754 N N   . PRO A 499 ? 0.7302 0.7449 0.6634 -0.2417 -0.1111 0.0392  543 PRO A N   
3755 C CA  . PRO A 499 ? 0.6838 0.6811 0.6445 -0.2353 -0.0970 0.0361  543 PRO A CA  
3756 C C   . PRO A 499 ? 0.6439 0.6883 0.6459 -0.2405 -0.1075 0.0451  543 PRO A C   
3757 O O   . PRO A 499 ? 0.6515 0.7318 0.6534 -0.2640 -0.1244 0.0443  543 PRO A O   
3758 C CB  . PRO A 499 ? 0.7084 0.6556 0.6335 -0.2553 -0.0868 0.0157  543 PRO A CB  
3759 C CG  . PRO A 499 ? 0.7669 0.6920 0.6447 -0.2616 -0.0876 0.0063  543 PRO A CG  
3760 C CD  . PRO A 499 ? 0.7793 0.7537 0.6602 -0.2605 -0.1070 0.0202  543 PRO A CD  
3761 N N   . GLY A 500 ? 0.7286 0.7783 0.7657 -0.2206 -0.0978 0.0527  544 GLY A N   
3762 C CA  . GLY A 500 ? 0.6945 0.7919 0.7723 -0.2214 -0.1049 0.0621  544 GLY A CA  
3763 C C   . GLY A 500 ? 0.6926 0.8315 0.7992 -0.1965 -0.1123 0.0797  544 GLY A C   
3764 O O   . GLY A 500 ? 0.6677 0.8498 0.8107 -0.1908 -0.1163 0.0886  544 GLY A O   
3765 N N   . ALA A 501 ? 0.6345 0.7589 0.7232 -0.1816 -0.1126 0.0853  545 ALA A N   
3766 C CA  . ALA A 501 ? 0.6372 0.7815 0.7470 -0.1540 -0.1142 0.1025  545 ALA A CA  
3767 C C   . ALA A 501 ? 0.6332 0.8413 0.7718 -0.1495 -0.1309 0.1173  545 ALA A C   
3768 O O   . ALA A 501 ? 0.6195 0.8481 0.7907 -0.1258 -0.1273 0.1283  545 ALA A O   
3769 C CB  . ALA A 501 ? 0.6061 0.7296 0.7379 -0.1351 -0.0972 0.1010  545 ALA A CB  
3770 N N   . ARG A 502 ? 0.7009 0.9425 0.8291 -0.1737 -0.1478 0.1151  546 ARG A N   
3771 C CA  . ARG A 502 ? 0.6874 1.0012 0.8434 -0.1717 -0.1658 0.1290  546 ARG A CA  
3772 C C   . ARG A 502 ? 0.7142 1.0601 0.8519 -0.1656 -0.1849 0.1435  546 ARG A C   
3773 O O   . ARG A 502 ? 0.6986 1.1141 0.8613 -0.1603 -0.2017 0.1577  546 ARG A O   
3774 C CB  . ARG A 502 ? 0.6615 1.0064 0.8275 -0.2066 -0.1728 0.1172  546 ARG A CB  
3775 C CG  . ARG A 502 ? 0.6267 0.9703 0.8256 -0.2033 -0.1578 0.1141  546 ARG A CG  
3776 C CD  . ARG A 502 ? 0.6016 0.9693 0.8102 -0.2392 -0.1606 0.1042  546 ARG A CD  
3777 N NE  . ARG A 502 ? 0.5725 0.9275 0.8058 -0.2305 -0.1423 0.1033  546 ARG A NE  
3778 C CZ  . ARG A 502 ? 0.5434 0.9533 0.8203 -0.2208 -0.1407 0.1133  546 ARG A CZ  
3779 N NH1 . ARG A 502 ? 0.5340 1.0220 0.8399 -0.2181 -0.1569 0.1260  546 ARG A NH1 
3780 N NH2 . ARG A 502 ? 0.5229 0.9136 0.8137 -0.2130 -0.1225 0.1111  546 ARG A NH2 
3781 N N   . SER A 503 ? 0.7587 1.0619 0.8529 -0.1665 -0.1832 0.1413  547 SER A N   
3782 C CA  . SER A 503 ? 0.7812 1.1211 0.8539 -0.1647 -0.2032 0.1550  547 SER A CA  
3783 C C   . SER A 503 ? 0.7974 1.1248 0.8719 -0.1254 -0.1976 0.1790  547 SER A C   
3784 O O   . SER A 503 ? 0.7953 1.0821 0.8851 -0.1059 -0.1781 0.1801  547 SER A O   
3785 C CB  . SER A 503 ? 0.8198 1.1291 0.8379 -0.1923 -0.2070 0.1389  547 SER A CB  
3786 O OG  . SER A 503 ? 0.8494 1.0961 0.8366 -0.1788 -0.1900 0.1390  547 SER A OG  
3787 N N   . MET A 504 ? 1.0378 1.4024 1.0974 -0.1139 -0.2151 0.1989  548 MET A N   
3788 C CA  . MET A 504 ? 1.0584 1.4033 1.1101 -0.0771 -0.2094 0.2248  548 MET A CA  
3789 C C   . MET A 504 ? 1.0996 1.4063 1.0955 -0.0836 -0.2084 0.2269  548 MET A C   
3790 O O   . MET A 504 ? 1.1212 1.4113 1.0997 -0.0578 -0.2054 0.2507  548 MET A O   
3791 C CB  . MET A 504 ? 1.0406 1.4567 1.1200 -0.0499 -0.2272 0.2517  548 MET A CB  
3792 C CG  . MET A 504 ? 0.9990 1.4557 1.1337 -0.0461 -0.2255 0.2468  548 MET A CG  
3793 S SD  . MET A 504 ? 0.9828 1.4918 1.1576 0.0056  -0.2300 0.2805  548 MET A SD  
3794 C CE  . MET A 504 ? 1.0265 1.4364 1.1759 0.0381  -0.2037 0.2924  548 MET A CE  
3795 N N   . ASN A 505 ? 0.8718 1.1656 0.8373 -0.1184 -0.2106 0.2026  549 ASN A N   
3796 C CA  . ASN A 505 ? 0.9134 1.1700 0.8229 -0.1279 -0.2068 0.1995  549 ASN A CA  
3797 C C   . ASN A 505 ? 0.9278 1.1090 0.8253 -0.1303 -0.1780 0.1843  549 ASN A C   
3798 O O   . ASN A 505 ? 0.9145 1.0751 0.8279 -0.1451 -0.1674 0.1616  549 ASN A O   
3799 C CB  . ASN A 505 ? 0.9266 1.2114 0.8034 -0.1638 -0.2249 0.1800  549 ASN A CB  
3800 C CG  . ASN A 505 ? 0.9122 1.2811 0.7954 -0.1644 -0.2559 0.1954  549 ASN A CG  
3801 O OD1 . ASN A 505 ? 0.9261 1.3180 0.7914 -0.1424 -0.2664 0.2217  549 ASN A OD1 
3802 N ND2 . ASN A 505 ? 0.8829 1.3001 0.7910 -0.1906 -0.2704 0.1799  549 ASN A ND2 
3803 N N   . ILE A 506 ? 0.8376 0.9819 0.7076 -0.1152 -0.1655 0.1989  550 ILE A N   
3804 C CA  . ILE A 506 ? 0.8490 0.9323 0.7042 -0.1189 -0.1392 0.1866  550 ILE A CA  
3805 C C   . ILE A 506 ? 0.8903 0.9541 0.6874 -0.1275 -0.1355 0.1882  550 ILE A C   
3806 O O   . ILE A 506 ? 0.9091 0.9904 0.6802 -0.1170 -0.1464 0.2114  550 ILE A O   
3807 C CB  . ILE A 506 ? 0.8302 0.8813 0.7125 -0.0947 -0.1205 0.2016  550 ILE A CB  
3808 C CG1 . ILE A 506 ? 0.8309 0.8304 0.7009 -0.1021 -0.0946 0.1884  550 ILE A CG1 
3809 C CG2 . ILE A 506 ? 0.8464 0.9009 0.7152 -0.0705 -0.1252 0.2349  550 ILE A CG2 
3810 C CD1 . ILE A 506 ? 0.8094 0.8007 0.7012 -0.1159 -0.0861 0.1605  550 ILE A CD1 
3811 N N   . SER A 507 ? 0.9501 0.9797 0.7260 -0.1442 -0.1193 0.1646  551 SER A N   
3812 C CA  . SER A 507 ? 0.9909 1.0003 0.7111 -0.1529 -0.1113 0.1616  551 SER A CA  
3813 C C   . SER A 507 ? 0.9903 0.9558 0.7075 -0.1455 -0.0822 0.1640  551 SER A C   
3814 O O   . SER A 507 ? 0.9747 0.9188 0.7117 -0.1502 -0.0658 0.1445  551 SER A O   
3815 C CB  . SER A 507 ? 1.0170 1.0224 0.7090 -0.1782 -0.1139 0.1304  551 SER A CB  
3816 O OG  . SER A 507 ? 1.0205 1.0685 0.7041 -0.1918 -0.1413 0.1276  551 SER A OG  
3817 N N   . ILE A 508 ? 1.0862 1.0410 0.7789 -0.1347 -0.0754 0.1886  552 ILE A N   
3818 C CA  . ILE A 508 ? 1.0858 1.0031 0.7738 -0.1327 -0.0468 0.1916  552 ILE A CA  
3819 C C   . ILE A 508 ? 1.1270 1.0332 0.7638 -0.1459 -0.0343 0.1794  552 ILE A C   
3820 O O   . ILE A 508 ? 1.1636 1.0796 0.7526 -0.1475 -0.0428 0.1913  552 ILE A O   
3821 C CB  . ILE A 508 ? 1.0889 0.9909 0.7741 -0.1163 -0.0408 0.2257  552 ILE A CB  
3822 C CG1 . ILE A 508 ? 1.0594 0.9698 0.7889 -0.0987 -0.0520 0.2394  552 ILE A CG1 
3823 C CG2 . ILE A 508 ? 1.0858 0.9505 0.7711 -0.1202 -0.0099 0.2270  552 ILE A CG2 
3824 C CD1 . ILE A 508 ? 1.0790 0.9680 0.7967 -0.0792 -0.0469 0.2754  552 ILE A CD1 
3825 N N   . TRP A 509 ? 1.0946 0.9831 0.7396 -0.1533 -0.0136 0.1566  553 TRP A N   
3826 C CA  . TRP A 509 ? 1.1371 1.0163 0.7347 -0.1629 0.0003  0.1421  553 TRP A CA  
3827 C C   . TRP A 509 ? 1.1398 1.0013 0.7305 -0.1613 0.0302  0.1511  553 TRP A C   
3828 O O   . TRP A 509 ? 1.1029 0.9561 0.7354 -0.1577 0.0441  0.1554  553 TRP A O   
3829 C CB  . TRP A 509 ? 1.1444 1.0181 0.7474 -0.1708 0.0036  0.1084  553 TRP A CB  
3830 C CG  . TRP A 509 ? 1.1615 1.0478 0.7510 -0.1812 -0.0213 0.0943  553 TRP A CG  
3831 C CD1 . TRP A 509 ? 1.1315 1.0347 0.7587 -0.1821 -0.0410 0.0941  553 TRP A CD1 
3832 C CD2 . TRP A 509 ? 1.2117 1.0952 0.7457 -0.1954 -0.0273 0.0760  553 TRP A CD2 
3833 N NE1 . TRP A 509 ? 1.1581 1.0718 0.7594 -0.1983 -0.0595 0.0779  553 TRP A NE1 
3834 C CE2 . TRP A 509 ? 1.2074 1.1067 0.7500 -0.2075 -0.0520 0.0653  553 TRP A CE2 
3835 C CE3 . TRP A 509 ? 1.2589 1.1282 0.7353 -0.2003 -0.0132 0.0664  553 TRP A CE3 
3836 C CZ2 . TRP A 509 ? 1.2470 1.1460 0.7424 -0.2273 -0.0639 0.0441  553 TRP A CZ2 
3837 C CZ3 . TRP A 509 ? 1.3005 1.1675 0.7272 -0.2168 -0.0248 0.0449  553 TRP A CZ3 
3838 C CH2 . TRP A 509 ? 1.2940 1.1745 0.7302 -0.2316 -0.0505 0.0331  553 TRP A CH2 
3839 N N   . GLY A 510 ? 1.2967 1.1550 0.8336 -0.1663 0.0404  0.1526  554 GLY A N   
3840 C CA  . GLY A 510 ? 1.3038 1.1508 0.8317 -0.1678 0.0708  0.1595  554 GLY A CA  
3841 C C   . GLY A 510 ? 1.3564 1.2035 0.8169 -0.1724 0.0789  0.1640  554 GLY A C   
3842 O O   . GLY A 510 ? 1.3882 1.2436 0.8073 -0.1755 0.0601  0.1567  554 GLY A O   
3843 N N   . PHE A 511 ? 1.5799 1.4203 1.0279 -0.1750 0.1073  0.1751  555 PHE A N   
3844 C CA  . PHE A 511 ? 1.6285 1.4698 1.0098 -0.1789 0.1188  0.1817  555 PHE A CA  
3845 C C   . PHE A 511 ? 1.6357 1.4668 1.0002 -0.1795 0.1319  0.2197  555 PHE A C   
3846 O O   . PHE A 511 ? 1.6037 1.4224 1.0109 -0.1796 0.1402  0.2360  555 PHE A O   
3847 C CB  . PHE A 511 ? 1.6456 1.4902 1.0142 -0.1818 0.1468  0.1545  555 PHE A CB  
3848 C CG  . PHE A 511 ? 1.6089 1.4581 1.0339 -0.1818 0.1724  0.1494  555 PHE A CG  
3849 C CD1 . PHE A 511 ? 1.5771 1.4305 1.0552 -0.1768 0.1677  0.1271  555 PHE A CD1 
3850 C CD2 . PHE A 511 ? 1.6075 1.4607 1.0310 -0.1883 0.2015  0.1667  555 PHE A CD2 
3851 C CE1 . PHE A 511 ? 1.5430 1.4096 1.0723 -0.1768 0.1894  0.1221  555 PHE A CE1 
3852 C CE2 . PHE A 511 ? 1.5717 1.4387 1.0490 -0.1917 0.2239  0.1604  555 PHE A CE2 
3853 C CZ  . PHE A 511 ? 1.5389 1.4151 1.0690 -0.1852 0.2167  0.1378  555 PHE A CZ  
3854 N N   . THR A 512 ? 1.4966 1.3297 0.7948 -0.1809 0.1340  0.2338  556 THR A N   
3855 C CA  . THR A 512 ? 1.5150 1.3342 0.7862 -0.1811 0.1479  0.2732  556 THR A CA  
3856 C C   . THR A 512 ? 1.5133 1.3287 0.7863 -0.1920 0.1889  0.2727  556 THR A C   
3857 O O   . THR A 512 ? 1.5006 1.3302 0.7918 -0.1958 0.2042  0.2415  556 THR A O   
3858 C CB  . THR A 512 ? 1.5665 1.3943 0.7628 -0.1773 0.1331  0.2900  556 THR A CB  
3859 O OG1 . THR A 512 ? 1.5996 1.4407 0.7495 -0.1844 0.1445  0.2624  556 THR A OG1 
3860 C CG2 . THR A 512 ? 1.5602 1.4032 0.7606 -0.1681 0.0913  0.2904  556 THR A CG2 
3861 N N   . GLU A 513 ? 2.1626 1.9605 1.4164 -0.1970 0.2082  0.3074  557 GLU A N   
3862 C CA  . GLU A 513 ? 2.1479 1.9486 1.4146 -0.2115 0.2478  0.3057  557 GLU A CA  
3863 C C   . GLU A 513 ? 2.1988 2.0142 1.3995 -0.2155 0.2693  0.3056  557 GLU A C   
3864 O O   . GLU A 513 ? 2.2363 2.0534 1.3744 -0.2082 0.2531  0.3128  557 GLU A O   
3865 C CB  . GLU A 513 ? 2.1295 1.8997 1.4187 -0.2211 0.2644  0.3395  557 GLU A CB  
3866 C CG  . GLU A 513 ? 2.1708 1.9079 1.4340 -0.2093 0.2440  0.3775  557 GLU A CG  
3867 C CD  . GLU A 513 ? 2.1557 1.8506 1.4429 -0.2192 0.2636  0.4070  557 GLU A CD  
3868 O OE1 . GLU A 513 ? 2.1392 1.8354 1.4580 -0.2403 0.2937  0.3984  557 GLU A OE1 
3869 O OE2 . GLU A 513 ? 2.1852 1.8458 1.4592 -0.2059 0.2494  0.4385  557 GLU A OE2 
3870 N N   . SER A 514 ? 2.0448 1.8741 1.2606 -0.2279 0.3064  0.2997  558 SER A N   
3871 C CA  . SER A 514 ? 2.0747 1.9284 1.2451 -0.2304 0.3335  0.2868  558 SER A CA  
3872 C C   . SER A 514 ? 2.0439 1.9181 1.2165 -0.2186 0.3254  0.2418  558 SER A C   
3873 O O   . SER A 514 ? 2.0442 1.9426 1.2462 -0.2183 0.3497  0.2180  558 SER A O   
3874 C CB  . SER A 514 ? 2.1769 2.0208 1.2611 -0.2292 0.3337  0.3140  558 SER A CB  
3875 O OG  . SER A 514 ? 2.2121 2.0390 1.3025 -0.2341 0.3453  0.3547  558 SER A OG  
3876 N N   . THR A 517 ? 2.3317 2.2200 1.2791 -0.1972 0.3286  0.1609  561 THR A N   
3877 C CA  . THR A 517 ? 2.3504 2.2295 1.2669 -0.2028 0.3018  0.1967  561 THR A CA  
3878 C C   . THR A 517 ? 2.3056 2.1737 1.2843 -0.2015 0.2673  0.2057  561 THR A C   
3879 O O   . THR A 517 ? 2.2677 2.1289 1.2843 -0.2044 0.2679  0.2382  561 THR A O   
3880 C CB  . THR A 517 ? 2.3517 2.2365 1.2588 -0.2077 0.3267  0.2382  561 THR A CB  
3881 O OG1 . THR A 517 ? 2.3592 2.2293 1.2605 -0.2079 0.3005  0.2771  561 THR A OG1 
3882 C CG2 . THR A 517 ? 2.2964 2.1906 1.2739 -0.2143 0.3597  0.2416  561 THR A CG2 
3883 N N   . SER A 518 ? 2.6365 2.5004 1.6226 -0.1979 0.2388  0.1759  562 SER A N   
3884 C CA  . SER A 518 ? 2.5906 2.4485 1.6391 -0.1958 0.2086  0.1782  562 SER A CA  
3885 C C   . SER A 518 ? 2.6031 2.4600 1.6346 -0.1966 0.1721  0.1535  562 SER A C   
3886 O O   . SER A 518 ? 2.6465 2.5027 1.6184 -0.2003 0.1712  0.1280  562 SER A O   
3887 C CB  . SER A 518 ? 2.5457 2.4033 1.6716 -0.1929 0.2246  0.1618  562 SER A CB  
3888 O OG  . SER A 518 ? 2.5104 2.3621 1.6746 -0.1901 0.1942  0.1454  562 SER A OG  
3889 N N   . GLN A 519 ? 2.1676 2.0248 1.2488 -0.1948 0.1429  0.1617  563 GLN A N   
3890 C CA  . GLN A 519 ? 2.1627 2.0203 1.2549 -0.1982 0.1129  0.1332  563 GLN A CA  
3891 C C   . GLN A 519 ? 2.1078 1.9643 1.2813 -0.1937 0.0974  0.1374  563 GLN A C   
3892 O O   . GLN A 519 ? 2.0767 1.9343 1.2863 -0.1880 0.0967  0.1687  563 GLN A O   
3893 C CB  . GLN A 519 ? 2.1913 2.0658 1.2275 -0.2048 0.0785  0.1386  563 GLN A CB  
3894 C CG  . GLN A 519 ? 2.2532 2.1369 1.2052 -0.2076 0.0847  0.1513  563 GLN A CG  
3895 C CD  . GLN A 519 ? 2.2441 2.1315 1.1931 -0.1986 0.0942  0.2005  563 GLN A CD  
3896 O OE1 . GLN A 519 ? 2.2032 2.0962 1.1869 -0.1909 0.0744  0.2306  563 GLN A OE1 
3897 N NE2 . GLN A 519 ? 2.2818 2.1634 1.1879 -0.1991 0.1266  0.2095  563 GLN A NE2 
3898 N N   . TRP A 520 ? 1.7480 1.5985 0.9461 -0.1966 0.0864  0.1056  564 TRP A N   
3899 C CA  . TRP A 520 ? 1.7018 1.5551 0.9675 -0.1938 0.0672  0.1079  564 TRP A CA  
3900 C C   . TRP A 520 ? 1.6973 1.5718 0.9583 -0.1958 0.0304  0.1273  564 TRP A C   
3901 O O   . TRP A 520 ? 1.7312 1.6189 0.9394 -0.2047 0.0119  0.1211  564 TRP A O   
3902 C CB  . TRP A 520 ? 1.6975 1.5370 0.9839 -0.1970 0.0664  0.0705  564 TRP A CB  
3903 C CG  . TRP A 520 ? 1.6928 1.5170 1.0010 -0.1887 0.0993  0.0529  564 TRP A CG  
3904 C CD1 . TRP A 520 ? 1.7316 1.5426 0.9974 -0.1868 0.1239  0.0307  564 TRP A CD1 
3905 C CD2 . TRP A 520 ? 1.6457 1.4710 1.0235 -0.1795 0.1105  0.0549  564 TRP A CD2 
3906 N NE1 . TRP A 520 ? 1.7110 1.5188 1.0186 -0.1746 0.1499  0.0210  564 TRP A NE1 
3907 C CE2 . TRP A 520 ? 1.6582 1.4764 1.0343 -0.1713 0.1411  0.0355  564 TRP A CE2 
3908 C CE3 . TRP A 520 ? 1.5938 1.4277 1.0335 -0.1766 0.0981  0.0708  564 TRP A CE3 
3909 C CZ2 . TRP A 520 ? 1.6202 1.4456 1.0554 -0.1610 0.1572  0.0327  564 TRP A CZ2 
3910 C CZ3 . TRP A 520 ? 1.5568 1.3928 1.0516 -0.1687 0.1146  0.0656  564 TRP A CZ3 
3911 C CH2 . TRP A 520 ? 1.5703 1.4050 1.0632 -0.1614 0.1427  0.0474  564 TRP A CH2 
3912 N N   . VAL A 521 ? 1.4883 1.3692 0.8050 -0.1872 0.0195  0.1492  565 VAL A N   
3913 C CA  . VAL A 521 ? 1.4800 1.3866 0.7984 -0.1837 -0.0136 0.1708  565 VAL A CA  
3914 C C   . VAL A 521 ? 1.4311 1.3440 0.8194 -0.1796 -0.0282 0.1667  565 VAL A C   
3915 O O   . VAL A 521 ? 1.4040 1.2983 0.8382 -0.1765 -0.0103 0.1573  565 VAL A O   
3916 C CB  . VAL A 521 ? 1.4875 1.3946 0.7893 -0.1708 -0.0096 0.2140  565 VAL A CB  
3917 C CG1 . VAL A 521 ? 1.4395 1.3206 0.7922 -0.1623 0.0147  0.2286  565 VAL A CG1 
3918 C CG2 . VAL A 521 ? 1.4944 1.4331 0.7926 -0.1615 -0.0436 0.2396  565 VAL A CG2 
3919 N N   . SER A 522 ? 1.5379 1.4820 0.9339 -0.1802 -0.0602 0.1724  566 SER A N   
3920 C CA  . SER A 522 ? 1.4899 1.4449 0.9512 -0.1743 -0.0730 0.1732  566 SER A CA  
3921 C C   . SER A 522 ? 1.4760 1.4656 0.9469 -0.1600 -0.0986 0.2058  566 SER A C   
3922 O O   . SER A 522 ? 1.4965 1.5205 0.9295 -0.1643 -0.1216 0.2123  566 SER A O   
3923 C CB  . SER A 522 ? 1.4790 1.4405 0.9526 -0.1918 -0.0845 0.1380  566 SER A CB  
3924 O OG  . SER A 522 ? 1.5151 1.5107 0.9536 -0.2063 -0.1123 0.1317  566 SER A OG  
3925 N N   . TYR A 523 ? 1.3098 1.2916 0.8298 -0.1417 -0.0941 0.2264  567 TYR A N   
3926 C CA  . TYR A 523 ? 1.2961 1.3097 0.8328 -0.1226 -0.1166 0.2568  567 TYR A CA  
3927 C C   . TYR A 523 ? 1.2521 1.2897 0.8481 -0.1221 -0.1309 0.2441  567 TYR A C   
3928 O O   . TYR A 523 ? 1.2217 1.2342 0.8632 -0.1167 -0.1154 0.2381  567 TYR A O   
3929 C CB  . TYR A 523 ? 1.2998 1.2816 0.8413 -0.0994 -0.0996 0.2924  567 TYR A CB  
3930 C CG  . TYR A 523 ? 1.3453 1.3082 0.8253 -0.0989 -0.0869 0.3123  567 TYR A CG  
3931 C CD1 . TYR A 523 ? 1.3594 1.2842 0.8211 -0.1120 -0.0565 0.3001  567 TYR A CD1 
3932 C CD2 . TYR A 523 ? 1.3738 1.3615 0.8142 -0.0840 -0.1045 0.3449  567 TYR A CD2 
3933 C CE1 . TYR A 523 ? 1.4016 1.3113 0.8064 -0.1127 -0.0424 0.3191  567 TYR A CE1 
3934 C CE2 . TYR A 523 ? 1.4184 1.3881 0.7983 -0.0833 -0.0916 0.3654  567 TYR A CE2 
3935 C CZ  . TYR A 523 ? 1.4326 1.3621 0.7945 -0.0988 -0.0596 0.3520  567 TYR A CZ  
3936 O OH  . TYR A 523 ? 1.4770 1.3908 0.7784 -0.0993 -0.0445 0.3728  567 TYR A OH  
3937 N N   . THR A 524 ? 1.1277 1.2173 0.7226 -0.1300 -0.1600 0.2390  568 THR A N   
3938 C CA  . THR A 524 ? 1.0866 1.2063 0.7375 -0.1306 -0.1736 0.2296  568 THR A CA  
3939 C C   . THR A 524 ? 1.0668 1.2285 0.7461 -0.1027 -0.1915 0.2634  568 THR A C   
3940 O O   . THR A 524 ? 1.0791 1.2881 0.7338 -0.0967 -0.2146 0.2821  568 THR A O   
3941 C CB  . THR A 524 ? 1.0870 1.2399 0.7285 -0.1615 -0.1925 0.1990  568 THR A CB  
3942 O OG1 . THR A 524 ? 1.1025 1.2085 0.7297 -0.1818 -0.1722 0.1663  568 THR A OG1 
3943 C CG2 . THR A 524 ? 1.0432 1.2380 0.7415 -0.1618 -0.2083 0.1963  568 THR A CG2 
3944 N N   . ILE A 525 ? 1.1796 1.3248 0.9099 -0.0840 -0.1802 0.2706  569 ILE A N   
3945 C CA  . ILE A 525 ? 1.1636 1.3381 0.9243 -0.0518 -0.1910 0.3017  569 ILE A CA  
3946 C C   . ILE A 525 ? 1.1229 1.3525 0.9350 -0.0543 -0.2083 0.2911  569 ILE A C   
3947 O O   . ILE A 525 ? 1.0989 1.3126 0.9439 -0.0677 -0.1977 0.2664  569 ILE A O   
3948 C CB  . ILE A 525 ? 1.1632 1.2780 0.9424 -0.0277 -0.1644 0.3175  569 ILE A CB  
3949 C CG1 . ILE A 525 ? 1.2014 1.2621 0.9316 -0.0296 -0.1444 0.3282  569 ILE A CG1 
3950 C CG2 . ILE A 525 ? 1.1552 1.2921 0.9612 0.0098  -0.1728 0.3497  569 ILE A CG2 
3951 C CD1 . ILE A 525 ? 1.2031 1.1997 0.9487 -0.0155 -0.1158 0.3384  569 ILE A CD1 
3952 N N   . ASP A 526 ? 1.1799 1.4788 0.9988 -0.0413 -0.2347 0.3110  570 ASP A N   
3953 C CA  . ASP A 526 ? 1.1366 1.4970 1.0093 -0.0396 -0.2501 0.3067  570 ASP A CA  
3954 C C   . ASP A 526 ? 1.1244 1.4817 1.0346 0.0046  -0.2421 0.3355  570 ASP A C   
3955 O O   . ASP A 526 ? 1.1444 1.5036 1.0368 0.0366  -0.2454 0.3692  570 ASP A O   
3956 C CB  . ASP A 526 ? 1.1261 1.5758 0.9900 -0.0537 -0.2844 0.3092  570 ASP A CB  
3957 C CG  . ASP A 526 ? 1.0773 1.5895 0.9929 -0.0716 -0.2979 0.2916  570 ASP A CG  
3958 O OD1 . ASP A 526 ? 1.0480 1.5492 1.0124 -0.0580 -0.2840 0.2898  570 ASP A OD1 
3959 O OD2 . ASP A 526 ? 1.0691 1.6426 0.9744 -0.1018 -0.3223 0.2789  570 ASP A OD2 
3960 N N   . PHE A 527 ? 1.0495 1.3981 1.0084 0.0075  -0.2299 0.3221  571 PHE A N   
3961 C CA  . PHE A 527 ? 1.0288 1.3706 1.0245 0.0484  -0.2196 0.3434  571 PHE A CA  
3962 C C   . PHE A 527 ? 1.0036 1.4389 1.0390 0.0656  -0.2427 0.3575  571 PHE A C   
3963 O O   . PHE A 527 ? 0.9862 1.4314 1.0615 0.0975  -0.2354 0.3694  571 PHE A O   
3964 C CB  . PHE A 527 ? 1.0156 1.3008 1.0393 0.0440  -0.1935 0.3215  571 PHE A CB  
3965 C CG  . PHE A 527 ? 1.0335 1.2308 1.0276 0.0455  -0.1681 0.3214  571 PHE A CG  
3966 C CD1 . PHE A 527 ? 1.0458 1.2057 1.0103 0.0126  -0.1591 0.2986  571 PHE A CD1 
3967 C CD2 . PHE A 527 ? 1.0388 1.1910 1.0320 0.0800  -0.1525 0.3453  571 PHE A CD2 
3968 C CE1 . PHE A 527 ? 1.0544 1.1427 0.9945 0.0122  -0.1354 0.2994  571 PHE A CE1 
3969 C CE2 . PHE A 527 ? 1.0530 1.1254 1.0184 0.0762  -0.1283 0.3452  571 PHE A CE2 
3970 C CZ  . PHE A 527 ? 1.0569 1.1025 0.9979 0.0415  -0.1203 0.3224  571 PHE A CZ  
3971 N N   . LYS A 528 ? 1.2973 1.8026 1.3205 0.0421  -0.2698 0.3538  572 LYS A N   
3972 C CA  . LYS A 528 ? 1.2630 1.8738 1.3240 0.0467  -0.2955 0.3624  572 LYS A CA  
3973 C C   . LYS A 528 ? 1.2411 1.8853 1.3320 0.1030  -0.2968 0.3995  572 LYS A C   
3974 O O   . LYS A 528 ? 1.2007 1.8979 1.3448 0.1167  -0.2985 0.4004  572 LYS A O   
3975 C CB  . LYS A 528 ? 1.2764 1.9477 1.3010 0.0204  -0.3252 0.3621  572 LYS A CB  
3976 C CG  . LYS A 528 ? 1.2537 2.0420 1.3075 0.0325  -0.3552 0.3806  572 LYS A CG  
3977 C CD  . LYS A 528 ? 1.2703 2.0975 1.2815 -0.0009 -0.3770 0.3670  572 LYS A CD  
3978 C CE  . LYS A 528 ? 1.2994 2.0625 1.2393 -0.0107 -0.3748 0.3709  572 LYS A CE  
3979 N NZ  . LYS A 528 ? 1.3127 2.1147 1.2103 -0.0431 -0.3950 0.3542  572 LYS A NZ  
3980 N N   . ASP A 529 ? 1.1910 1.8022 1.2467 0.1371  -0.2941 0.4309  573 ASP A N   
3981 C CA  . ASP A 529 ? 1.1787 1.8118 1.2568 0.1952  -0.2930 0.4681  573 ASP A CA  
3982 C C   . ASP A 529 ? 1.1945 1.7308 1.2792 0.2289  -0.2588 0.4758  573 ASP A C   
3983 O O   . ASP A 529 ? 1.1955 1.7350 1.3013 0.2757  -0.2512 0.4972  573 ASP A O   
3984 C CB  . ASP A 529 ? 1.2171 1.8629 1.2517 0.2132  -0.3051 0.4904  573 ASP A CB  
3985 C CG  . ASP A 529 ? 1.2185 1.9572 1.2482 0.1796  -0.3354 0.4750  573 ASP A CG  
3986 O OD1 . ASP A 529 ? 1.1872 2.0020 1.2646 0.1695  -0.3460 0.4598  573 ASP A OD1 
3987 O OD2 . ASP A 529 ? 1.2553 1.9894 1.2321 0.1621  -0.3471 0.4769  573 ASP A OD2 
3988 N N   . ILE A 530 ? 1.0567 1.5008 1.1220 0.2023  -0.2347 0.4508  574 ILE A N   
3989 C CA  . ILE A 530 ? 1.0664 1.4232 1.1419 0.2253  -0.2025 0.4499  574 ILE A CA  
3990 C C   . ILE A 530 ? 1.0328 1.4253 1.1676 0.2376  -0.1971 0.4368  574 ILE A C   
3991 O O   . ILE A 530 ? 1.0358 1.3991 1.1879 0.2788  -0.1805 0.4511  574 ILE A O   
3992 C CB  . ILE A 530 ? 1.0863 1.3509 1.1340 0.1888  -0.1796 0.4222  574 ILE A CB  
3993 C CG1 . ILE A 530 ? 1.1231 1.3235 1.1138 0.1930  -0.1708 0.4430  574 ILE A CG1 
3994 C CG2 . ILE A 530 ? 1.0785 1.2799 1.1523 0.1972  -0.1513 0.4061  574 ILE A CG2 
3995 C CD1 . ILE A 530 ? 1.1399 1.2616 1.1209 0.2317  -0.1459 0.4674  574 ILE A CD1 
3996 N N   . LEU A 531 ? 1.1401 1.5904 1.3032 0.2015  -0.2089 0.4091  575 LEU A N   
3997 C CA  . LEU A 531 ? 1.1014 1.6082 1.3211 0.2142  -0.2080 0.4024  575 LEU A CA  
3998 C C   . LEU A 531 ? 1.0689 1.6965 1.3125 0.2172  -0.2392 0.4174  575 LEU A C   
3999 O O   . LEU A 531 ? 1.0540 1.7349 1.3008 0.1732  -0.2573 0.3982  575 LEU A O   
4000 C CB  . LEU A 531 ? 1.0872 1.5779 1.3253 0.1727  -0.1975 0.3634  575 LEU A CB  
4001 C CG  . LEU A 531 ? 1.1133 1.4984 1.3270 0.1569  -0.1711 0.3422  575 LEU A CG  
4002 C CD1 . LEU A 531 ? 1.0951 1.4805 1.3305 0.1216  -0.1639 0.3080  575 LEU A CD1 
4003 C CD2 . LEU A 531 ? 1.1293 1.4508 1.3447 0.1988  -0.1474 0.3552  575 LEU A CD2 
4004 N N   . GLU A 532 ? 1.4457 2.1097 1.7047 0.2664  -0.2417 0.4459  576 GLU A N   
4005 C CA  . GLU A 532 ? 1.4319 2.1894 1.7015 0.2660  -0.2638 0.4497  576 GLU A CA  
4006 C C   . GLU A 532 ? 1.3938 2.2314 1.7191 0.2552  -0.2659 0.4317  576 GLU A C   
4007 O O   . GLU A 532 ? 1.3825 2.2982 1.7184 0.2215  -0.2862 0.4196  576 GLU A O   
4008 C CB  . GLU A 532 ? 1.4947 2.2405 1.7485 0.3185  -0.2601 0.4797  576 GLU A CB  
4009 C CG  . GLU A 532 ? 1.5035 2.2020 1.7791 0.3675  -0.2328 0.4884  576 GLU A CG  
4010 C CD  . GLU A 532 ? 1.5630 2.2916 1.8415 0.4149  -0.2345 0.5129  576 GLU A CD  
4011 O OE1 . GLU A 532 ? 1.5605 2.3830 1.8776 0.4183  -0.2458 0.5101  576 GLU A OE1 
4012 O OE2 . GLU A 532 ? 1.6214 2.2789 1.8631 0.4477  -0.2237 0.5356  576 GLU A OE2 
4013 N N   . ARG A 533 ? 0.9030 1.7173 1.2608 0.2822  -0.2430 0.4288  577 ARG A N   
4014 C CA  . ARG A 533 ? 0.8740 1.7614 1.2827 0.2780  -0.2408 0.4149  577 ARG A CA  
4015 C C   . ARG A 533 ? 0.8323 1.7118 1.2605 0.2373  -0.2337 0.3878  577 ARG A C   
4016 O O   . ARG A 533 ? 0.8525 1.6578 1.2675 0.2339  -0.2203 0.3827  577 ARG A O   
4017 C CB  . ARG A 533 ? 0.9006 1.7770 1.3326 0.3337  -0.2195 0.4270  577 ARG A CB  
4018 C CG  . ARG A 533 ? 0.8956 1.6746 1.3214 0.3572  -0.1909 0.4239  577 ARG A CG  
4019 C CD  . ARG A 533 ? 0.9233 1.7023 1.3762 0.4038  -0.1693 0.4272  577 ARG A CD  
4020 N NE  . ARG A 533 ? 0.9205 1.6074 1.3677 0.4185  -0.1410 0.4169  577 ARG A NE  
4021 C CZ  . ARG A 533 ? 0.8776 1.5681 1.3519 0.4015  -0.1281 0.3937  577 ARG A CZ  
4022 N NH1 . ARG A 533 ? 0.8463 1.6241 1.3542 0.3688  -0.1398 0.3797  577 ARG A NH1 
4023 N NH2 . ARG A 533 ? 0.8850 1.4893 1.3504 0.4149  -0.1024 0.3836  577 ARG A NH2 
4024 N N   . ASN A 534 ? 0.8587 1.8138 1.3171 0.2045  -0.2423 0.3709  578 ASN A N   
4025 C CA  . ASN A 534 ? 0.8371 1.7867 1.3136 0.1649  -0.2343 0.3455  578 ASN A CA  
4026 C C   . ASN A 534 ? 0.8216 1.7500 1.3287 0.1928  -0.2081 0.3412  578 ASN A C   
4027 O O   . ASN A 534 ? 0.8163 1.7630 1.3423 0.2359  -0.1974 0.3526  578 ASN A O   
4028 C CB  . ASN A 534 ? 0.8040 1.8311 1.2976 0.1179  -0.2488 0.3286  578 ASN A CB  
4029 C CG  . ASN A 534 ? 0.8228 1.8664 1.2819 0.0830  -0.2739 0.3264  578 ASN A CG  
4030 O OD1 . ASN A 534 ? 0.8539 1.8412 1.2741 0.0775  -0.2792 0.3295  578 ASN A OD1 
4031 N ND2 . ASN A 534 ? 0.8289 1.9495 1.3000 0.0579  -0.2889 0.3203  578 ASN A ND2 
4032 N N   . CYS A 535 ? 0.7541 1.6414 1.2637 0.1669  -0.1970 0.3235  579 CYS A N   
4033 C CA  . CYS A 535 ? 0.7351 1.6086 1.2732 0.1815  -0.1721 0.3128  579 CYS A CA  
4034 C C   . CYS A 535 ? 0.6910 1.6399 1.2631 0.1619  -0.1706 0.3007  579 CYS A C   
4035 O O   . CYS A 535 ? 0.6760 1.6731 1.2477 0.1203  -0.1878 0.2935  579 CYS A O   
4036 C CB  . CYS A 535 ? 0.7554 1.5418 1.2699 0.1542  -0.1576 0.2907  579 CYS A CB  
4037 S SG  . CYS A 535 ? 0.8265 1.4786 1.2847 0.1737  -0.1431 0.2905  579 CYS A SG  
4038 N N   . GLU A 536 ? 1.1410 2.0929 1.7385 0.1900  -0.1482 0.2973  580 GLU A N   
4039 C CA  . GLU A 536 ? 1.1062 2.1180 1.7359 0.1728  -0.1399 0.2852  580 GLU A CA  
4040 C C   . GLU A 536 ? 1.1050 2.0917 1.7522 0.2018  -0.1098 0.2768  580 GLU A C   
4041 O O   . GLU A 536 ? 1.1218 2.0372 1.7528 0.2140  -0.0977 0.2727  580 GLU A O   
4042 C CB  . GLU A 536 ? 1.1257 2.2217 1.7723 0.1761  -0.1552 0.2965  580 GLU A CB  
4043 C CG  . GLU A 536 ? 1.1290 2.2780 1.8103 0.1922  -0.1405 0.2951  580 GLU A CG  
4044 C CD  . GLU A 536 ? 1.1355 2.3735 1.8383 0.1618  -0.1543 0.2947  580 GLU A CD  
4045 O OE1 . GLU A 536 ? 1.1686 2.4690 1.8950 0.1917  -0.1550 0.3079  580 GLU A OE1 
4046 O OE2 . GLU A 536 ? 1.1113 2.3555 1.8077 0.1070  -0.1628 0.2804  580 GLU A OE2 
4047 N N   . GLU A 537 ? 1.2975 2.3356 1.9732 0.2046  -0.0973 0.2712  581 GLU A N   
4048 C CA  . GLU A 537 ? 1.2927 2.3041 1.9778 0.2219  -0.0694 0.2590  581 GLU A CA  
4049 C C   . GLU A 537 ? 1.3285 2.2671 1.9982 0.2741  -0.0518 0.2622  581 GLU A C   
4050 O O   . GLU A 537 ? 1.3411 2.2178 1.9970 0.2714  -0.0378 0.2498  581 GLU A O   
4051 C CB  . GLU A 537 ? 1.2993 2.3838 2.0166 0.2289  -0.0592 0.2584  581 GLU A CB  
4052 C CG  . GLU A 537 ? 1.2744 2.4129 2.0057 0.1741  -0.0654 0.2494  581 GLU A CG  
4053 C CD  . GLU A 537 ? 1.2739 2.4508 2.0014 0.1406  -0.0931 0.2558  581 GLU A CD  
4054 O OE1 . GLU A 537 ? 1.3059 2.5199 2.0399 0.1671  -0.1055 0.2713  581 GLU A OE1 
4055 O OE2 . GLU A 537 ? 1.2474 2.4138 1.9621 0.0899  -0.1022 0.2454  581 GLU A OE2 
4056 N N   . LYS A 538 ? 1.1337 2.0795 1.8065 0.3212  -0.0492 0.2769  582 LYS A N   
4057 C CA  . LYS A 538 ? 1.1708 2.0431 1.8164 0.3616  -0.0460 0.2889  582 LYS A CA  
4058 C C   . LYS A 538 ? 1.2101 1.9773 1.8281 0.3711  -0.0279 0.2779  582 LYS A C   
4059 O O   . LYS A 538 ? 1.2430 1.9693 1.8587 0.3964  -0.0027 0.2655  582 LYS A O   
4060 C CB  . LYS A 538 ? 1.1727 2.0623 1.8045 0.3509  -0.0741 0.3076  582 LYS A CB  
4061 C CG  . LYS A 538 ? 1.1313 1.9880 1.7421 0.3092  -0.0885 0.3028  582 LYS A CG  
4062 C CD  . LYS A 538 ? 1.1414 1.9879 1.7272 0.3033  -0.1107 0.3189  582 LYS A CD  
4063 C CE  . LYS A 538 ? 1.0875 1.8748 1.6558 0.2712  -0.1094 0.3068  582 LYS A CE  
4064 N NZ  . LYS A 538 ? 1.1052 1.8323 1.6324 0.2705  -0.1211 0.3189  582 LYS A NZ  
4065 N N   . ASP A 539 ? 0.7698 1.4927 1.3641 0.3550  -0.0412 0.2845  583 ASP A N   
4066 C CA  . ASP A 539 ? 0.8155 1.4375 1.3768 0.3552  -0.0309 0.2778  583 ASP A CA  
4067 C C   . ASP A 539 ? 0.8145 1.3949 1.3595 0.3077  -0.0233 0.2467  583 ASP A C   
4068 O O   . ASP A 539 ? 0.8562 1.3436 1.3640 0.2980  -0.0135 0.2319  583 ASP A O   
4069 C CB  . ASP A 539 ? 0.8359 1.4295 1.3666 0.3412  -0.0517 0.2924  583 ASP A CB  
4070 C CG  . ASP A 539 ? 0.8456 1.4739 1.3789 0.3824  -0.0631 0.3233  583 ASP A CG  
4071 O OD1 . ASP A 539 ? 0.8809 1.4961 1.4155 0.4254  -0.0476 0.3280  583 ASP A OD1 
4072 O OD2 . ASP A 539 ? 0.8280 1.4806 1.3486 0.3676  -0.0867 0.3384  583 ASP A OD2 
4073 N N   . TYR A 540 ? 0.6344 1.2845 1.2056 0.2760  -0.0291 0.2387  584 TYR A N   
4074 C CA  . TYR A 540 ? 0.6328 1.2441 1.1888 0.2401  -0.0186 0.2123  584 TYR A CA  
4075 C C   . TYR A 540 ? 0.6491 1.2380 1.2095 0.2690  0.0086  0.1987  584 TYR A C   
4076 O O   . TYR A 540 ? 0.6457 1.2734 1.2313 0.3108  0.0189  0.2091  584 TYR A O   
4077 C CB  . TYR A 540 ? 0.5786 1.2587 1.1547 0.1959  -0.0309 0.2092  584 TYR A CB  
4078 C CG  . TYR A 540 ? 0.5734 1.2668 1.1384 0.1651  -0.0569 0.2182  584 TYR A CG  
4079 C CD1 . TYR A 540 ? 0.5981 1.2206 1.1233 0.1319  -0.0621 0.2053  584 TYR A CD1 
4080 C CD2 . TYR A 540 ? 0.5471 1.3257 1.1398 0.1708  -0.0760 0.2391  584 TYR A CD2 
4081 C CE1 . TYR A 540 ? 0.6019 1.2325 1.1121 0.1050  -0.0838 0.2114  584 TYR A CE1 
4082 C CE2 . TYR A 540 ? 0.5495 1.3398 1.1272 0.1416  -0.1000 0.2450  584 TYR A CE2 
4083 C CZ  . TYR A 540 ? 0.5798 1.2925 1.1145 0.1088  -0.1029 0.2303  584 TYR A CZ  
4084 O OH  . TYR A 540 ? 0.5894 1.3101 1.1048 0.0802  -0.1248 0.2339  584 TYR A OH  
4085 N N   . THR A 541 ? 0.6019 1.1266 1.1349 0.2485  0.0206  0.1747  585 THR A N   
4086 C CA  . THR A 541 ? 0.6278 1.1241 1.1568 0.2725  0.0461  0.1580  585 THR A CA  
4087 C C   . THR A 541 ? 0.6087 1.1041 1.1291 0.2361  0.0513  0.1373  585 THR A C   
4088 O O   . THR A 541 ? 0.5900 1.0780 1.0983 0.1966  0.0375  0.1346  585 THR A O   
4089 C CB  . THR A 541 ? 0.6971 1.0936 1.1908 0.2959  0.0589  0.1495  585 THR A CB  
4090 O OG1 . THR A 541 ? 0.7262 1.1060 1.2206 0.3308  0.0844  0.1369  585 THR A OG1 
4091 C CG2 . THR A 541 ? 0.7237 1.0470 1.1798 0.2583  0.0563  0.1304  585 THR A CG2 
4092 N N   . ILE A 542 ? 0.6423 1.1493 1.1687 0.2518  0.0719  0.1244  586 ILE A N   
4093 C CA  . ILE A 542 ? 0.6222 1.1382 1.1411 0.2225  0.0783  0.1084  586 ILE A CA  
4094 C C   . ILE A 542 ? 0.6675 1.0966 1.1435 0.2075  0.0827  0.0856  586 ILE A C   
4095 O O   . ILE A 542 ? 0.7235 1.0970 1.1804 0.2306  0.0962  0.0724  586 ILE A O   
4096 C CB  . ILE A 542 ? 0.6153 1.1819 1.1547 0.2465  0.0999  0.1038  586 ILE A CB  
4097 C CG1 . ILE A 542 ? 0.5796 1.2290 1.1637 0.2720  0.0973  0.1269  586 ILE A CG1 
4098 C CG2 . ILE A 542 ? 0.5841 1.1833 1.1231 0.2142  0.1033  0.0971  586 ILE A CG2 
4099 C CD1 . ILE A 542 ? 0.5663 1.2827 1.1777 0.2958  0.1191  0.1258  586 ILE A CD1 
4100 N N   . TRP A 543 ? 0.4688 0.8862 0.9297 0.1688  0.0713  0.0812  587 TRP A N   
4101 C CA  . TRP A 543 ? 0.5008 0.8496 0.9253 0.1527  0.0735  0.0609  587 TRP A CA  
4102 C C   . TRP A 543 ? 0.4681 0.8301 0.8820 0.1274  0.0758  0.0507  587 TRP A C   
4103 O O   . TRP A 543 ? 0.4186 0.8016 0.8360 0.1008  0.0639  0.0606  587 TRP A O   
4104 C CB  . TRP A 543 ? 0.5066 0.8161 0.9165 0.1339  0.0568  0.0668  587 TRP A CB  
4105 C CG  . TRP A 543 ? 0.5443 0.7893 0.9209 0.1172  0.0587  0.0472  587 TRP A CG  
4106 C CD1 . TRP A 543 ? 0.6119 0.8027 0.9689 0.1295  0.0709  0.0301  587 TRP A CD1 
4107 C CD2 . TRP A 543 ? 0.5130 0.7452 0.8738 0.0856  0.0485  0.0432  587 TRP A CD2 
4108 N NE1 . TRP A 543 ? 0.6299 0.7837 0.9636 0.1053  0.0677  0.0158  587 TRP A NE1 
4109 C CE2 . TRP A 543 ? 0.5613 0.7407 0.8975 0.0809  0.0542  0.0244  587 TRP A CE2 
4110 C CE3 . TRP A 543 ? 0.4486 0.7076 0.8130 0.0613  0.0364  0.0532  587 TRP A CE3 
4111 C CZ2 . TRP A 543 ? 0.5279 0.6893 0.8468 0.0559  0.0475  0.0168  587 TRP A CZ2 
4112 C CZ3 . TRP A 543 ? 0.4261 0.6582 0.7698 0.0391  0.0314  0.0458  587 TRP A CZ3 
4113 C CH2 . TRP A 543 ? 0.4578 0.6452 0.7805 0.0380  0.0366  0.0283  587 TRP A CH2 
4114 N N   . LEU A 544 ? 0.4689 0.8147 0.8659 0.1352  0.0912  0.0310  588 LEU A N   
4115 C CA  . LEU A 544 ? 0.4431 0.7958 0.8231 0.1127  0.0923  0.0222  588 LEU A CA  
4116 C C   . LEU A 544 ? 0.4443 0.7478 0.7983 0.0904  0.0814  0.0132  588 LEU A C   
4117 O O   . LEU A 544 ? 0.4991 0.7550 0.8353 0.0952  0.0842  -0.0029 588 LEU A O   
4118 C CB  . LEU A 544 ? 0.4814 0.8392 0.8488 0.1286  0.1116  0.0035  588 LEU A CB  
4119 C CG  . LEU A 544 ? 0.4716 0.8334 0.8148 0.1101  0.1133  -0.0068 588 LEU A CG  
4120 C CD1 . LEU A 544 ? 0.4153 0.8227 0.7713 0.0914  0.1083  0.0142  588 LEU A CD1 
4121 C CD2 . LEU A 544 ? 0.5250 0.8927 0.8523 0.1275  0.1321  -0.0267 588 LEU A CD2 
4122 N N   . ALA A 545 ? 0.5143 0.8284 0.8661 0.0659  0.0701  0.0234  589 ALA A N   
4123 C CA  . ALA A 545 ? 0.5043 0.7801 0.8332 0.0475  0.0612  0.0159  589 ALA A CA  
4124 C C   . ALA A 545 ? 0.5217 0.7919 0.8285 0.0466  0.0690  -0.0025 589 ALA A C   
4125 O O   . ALA A 545 ? 0.5303 0.8302 0.8364 0.0543  0.0794  -0.0051 589 ALA A O   
4126 C CB  . ALA A 545 ? 0.4488 0.7338 0.7784 0.0256  0.0498  0.0313  589 ALA A CB  
4127 N N   . HIS A 546 ? 0.5573 0.7944 0.8459 0.0366  0.0637  -0.0148 590 HIS A N   
4128 C CA  . HIS A 546 ? 0.5672 0.8047 0.8343 0.0322  0.0668  -0.0324 590 HIS A CA  
4129 C C   . HIS A 546 ? 0.6352 0.8722 0.8932 0.0466  0.0803  -0.0533 590 HIS A C   
4130 O O   . HIS A 546 ? 0.6476 0.9025 0.8884 0.0455  0.0844  -0.0652 590 HIS A O   
4131 C CB  . HIS A 546 ? 0.5269 0.7957 0.7879 0.0250  0.0648  -0.0200 590 HIS A CB  
4132 C CG  . HIS A 546 ? 0.4816 0.7398 0.7407 0.0104  0.0534  -0.0062 590 HIS A CG  
4133 N ND1 . HIS A 546 ? 0.4723 0.7130 0.7182 0.0025  0.0464  -0.0146 590 HIS A ND1 
4134 C CD2 . HIS A 546 ? 0.4511 0.7140 0.7182 0.0019  0.0489  0.0140  590 HIS A CD2 
4135 C CE1 . HIS A 546 ? 0.4422 0.6753 0.6876 -0.0063 0.0394  0.0004  590 HIS A CE1 
4136 N NE2 . HIS A 546 ? 0.4331 0.6755 0.6891 -0.0082 0.0407  0.0169  590 HIS A NE2 
4137 N N   . SER A 547 ? 0.4462 0.6610 0.7124 0.0614  0.0880  -0.0584 591 SER A N   
4138 C CA  . SER A 547 ? 0.5266 0.7350 0.7802 0.0767  0.1036  -0.0804 591 SER A CA  
4139 C C   . SER A 547 ? 0.5814 0.7534 0.8088 0.0658  0.1056  -0.1099 591 SER A C   
4140 O O   . SER A 547 ? 0.5912 0.7206 0.8159 0.0570  0.1021  -0.1155 591 SER A O   
4141 C CB  . SER A 547 ? 0.5757 0.7700 0.8446 0.1014  0.1143  -0.0761 591 SER A CB  
4142 O OG  . SER A 547 ? 0.6406 0.8310 0.8953 0.1185  0.1321  -0.0976 591 SER A OG  
4143 N N   . THR A 548 ? 0.8807 1.0719 1.0875 0.0651  0.1119  -0.1290 592 THR A N   
4144 C CA  . THR A 548 ? 0.9138 1.0819 1.0939 0.0507  0.1127  -0.1603 592 THR A CA  
4145 C C   . THR A 548 ? 1.0098 1.1572 1.1703 0.0646  0.1311  -0.1876 592 THR A C   
4146 O O   . THR A 548 ? 1.0322 1.1266 1.1801 0.0609  0.1382  -0.2092 592 THR A O   
4147 C CB  . THR A 548 ? 0.8635 1.0740 1.0296 0.0356  0.1021  -0.1630 592 THR A CB  
4148 O OG1 . THR A 548 ? 0.7750 0.9959 0.9566 0.0247  0.0872  -0.1395 592 THR A OG1 
4149 C CG2 . THR A 548 ? 0.8865 1.0842 1.0271 0.0183  0.1010  -0.1967 592 THR A CG2 
4150 N N   . ASP A 549 ? 1.3903 1.5776 1.5451 0.0795  0.1401  -0.1872 593 ASP A N   
4151 C CA  . ASP A 549 ? 1.4429 1.6185 1.5761 0.0959  0.1598  -0.2133 593 ASP A CA  
4152 C C   . ASP A 549 ? 1.4197 1.6225 1.5740 0.1258  0.1736  -0.1935 593 ASP A C   
4153 O O   . ASP A 549 ? 1.3903 1.6473 1.5465 0.1302  0.1758  -0.1815 593 ASP A O   
4154 C CB  . ASP A 549 ? 1.4615 1.6694 1.5616 0.0832  0.1583  -0.2356 593 ASP A CB  
4155 C CG  . ASP A 549 ? 1.4953 1.7003 1.5682 0.1004  0.1795  -0.2627 593 ASP A CG  
4156 O OD1 . ASP A 549 ? 1.5088 1.6801 1.5871 0.1239  0.1975  -0.2675 593 ASP A OD1 
4157 O OD2 . ASP A 549 ? 1.5078 1.7458 1.5513 0.0920  0.1784  -0.2794 593 ASP A OD2 
4158 N N   . PRO A 550 ? 1.1265 1.2943 1.2974 0.1468  0.1834  -0.1883 594 PRO A N   
4159 C CA  . PRO A 550 ? 1.0921 1.2916 1.2919 0.1768  0.1946  -0.1660 594 PRO A CA  
4160 C C   . PRO A 550 ? 1.1029 1.3413 1.2921 0.1968  0.2146  -0.1765 594 PRO A C   
4161 O O   . PRO A 550 ? 1.0575 1.3507 1.2736 0.2108  0.2195  -0.1531 594 PRO A O   
4162 C CB  . PRO A 550 ? 1.1167 1.2568 1.3227 0.1979  0.2036  -0.1685 594 PRO A CB  
4163 C CG  . PRO A 550 ? 1.1381 1.2207 1.3280 0.1717  0.1916  -0.1800 594 PRO A CG  
4164 C CD  . PRO A 550 ? 1.1565 1.2508 1.3175 0.1433  0.1853  -0.2039 594 PRO A CD  
4165 N N   . GLU A 551 ? 1.4789 1.6920 1.6289 0.1962  0.2266  -0.2119 595 GLU A N   
4166 C CA  . GLU A 551 ? 1.4970 1.7438 1.6300 0.2156  0.2476  -0.2254 595 GLU A CA  
4167 C C   . GLU A 551 ? 1.4598 1.7792 1.5931 0.2027  0.2412  -0.2084 595 GLU A C   
4168 O O   . GLU A 551 ? 1.4617 1.8223 1.5861 0.2178  0.2584  -0.2109 595 GLU A O   
4169 C CB  . GLU A 551 ? 1.5653 1.7633 1.6489 0.2124  0.2599  -0.2713 595 GLU A CB  
4170 C CG  . GLU A 551 ? 1.6074 1.7228 1.6816 0.2287  0.2740  -0.2922 595 GLU A CG  
4171 C CD  . GLU A 551 ? 1.6293 1.7443 1.7138 0.2746  0.3016  -0.2902 595 GLU A CD  
4172 O OE1 . GLU A 551 ? 1.6053 1.7909 1.7073 0.2916  0.3098  -0.2734 595 GLU A OE1 
4173 O OE2 . GLU A 551 ? 1.6688 1.7125 1.7436 0.2946  0.3165  -0.3048 595 GLU A OE2 
4174 N N   . ASP A 552 ? 1.1224 1.4546 1.2641 0.1757  0.2181  -0.1900 596 ASP A N   
4175 C CA  . ASP A 552 ? 1.0988 1.4818 1.2278 0.1597  0.2106  -0.1783 596 ASP A CA  
4176 C C   . ASP A 552 ? 1.0255 1.4610 1.1877 0.1616  0.2103  -0.1396 596 ASP A C   
4177 O O   . ASP A 552 ? 0.9754 1.4071 1.1721 0.1579  0.2002  -0.1166 596 ASP A O   
4178 C CB  . ASP A 552 ? 1.1042 1.4706 1.2200 0.1311  0.1872  -0.1811 596 ASP A CB  
4179 C CG  . ASP A 552 ? 1.1197 1.5202 1.1997 0.1199  0.1833  -0.1899 596 ASP A CG  
4180 O OD1 . ASP A 552 ? 1.1308 1.5670 1.1943 0.1324  0.1987  -0.1914 596 ASP A OD1 
4181 O OD2 . ASP A 552 ? 1.1186 1.5145 1.1865 0.0998  0.1650  -0.1938 596 ASP A OD2 
4182 N N   . TYR A 553 ? 0.7967 1.2811 0.9456 0.1649  0.2218  -0.1331 597 TYR A N   
4183 C CA  . TYR A 553 ? 0.7330 1.2674 0.9069 0.1596  0.2230  -0.0972 597 TYR A CA  
4184 C C   . TYR A 553 ? 0.6796 1.2046 0.8658 0.1348  0.2001  -0.0733 597 TYR A C   
4185 O O   . TYR A 553 ? 0.6239 1.1658 0.8436 0.1284  0.1964  -0.0462 597 TYR A O   
4186 C CB  . TYR A 553 ? 0.7483 1.3272 0.8931 0.1611  0.2370  -0.0954 597 TYR A CB  
4187 C CG  . TYR A 553 ? 0.7000 1.3332 0.8698 0.1596  0.2483  -0.0623 597 TYR A CG  
4188 C CD1 . TYR A 553 ? 0.6708 1.3299 0.8835 0.1735  0.2603  -0.0511 597 TYR A CD1 
4189 C CD2 . TYR A 553 ? 0.6903 1.3519 0.8396 0.1450  0.2488  -0.0421 597 TYR A CD2 
4190 C CE1 . TYR A 553 ? 0.6295 1.3445 0.8669 0.1679  0.2713  -0.0224 597 TYR A CE1 
4191 C CE2 . TYR A 553 ? 0.6552 1.3629 0.8250 0.1394  0.2615  -0.0123 597 TYR A CE2 
4192 C CZ  . TYR A 553 ? 0.6232 1.3597 0.8384 0.1487  0.2726  -0.0036 597 TYR A CZ  
4193 O OH  . TYR A 553 ? 0.5889 1.3782 0.8270 0.1388  0.2860  0.0252  597 TYR A OH  
4194 N N   . GLU A 554 ? 0.9652 1.4655 1.1235 0.1206  0.1850  -0.0845 598 GLU A N   
4195 C CA  . GLU A 554 ? 0.9142 1.4078 1.0769 0.1005  0.1662  -0.0627 598 GLU A CA  
4196 C C   . GLU A 554 ? 0.8925 1.3428 1.0740 0.0925  0.1501  -0.0660 598 GLU A C   
4197 O O   . GLU A 554 ? 0.8515 1.2898 1.0344 0.0774  0.1347  -0.0530 598 GLU A O   
4198 C CB  . GLU A 554 ? 0.9363 1.4393 1.0598 0.0930  0.1594  -0.0680 598 GLU A CB  
4199 C CG  . GLU A 554 ? 0.9769 1.5235 1.0762 0.1014  0.1761  -0.0624 598 GLU A CG  
4200 C CD  . GLU A 554 ? 0.9945 1.5603 1.0791 0.0915  0.1712  -0.0320 598 GLU A CD  
4201 O OE1 . GLU A 554 ? 0.9785 1.5223 1.0734 0.0796  0.1555  -0.0160 598 GLU A OE1 
4202 O OE2 . GLU A 554 ? 1.0269 1.6268 1.0872 0.0970  0.1846  -0.0235 598 GLU A OE2 
4203 N N   . ASP A 555 ? 0.5675 0.9923 0.7611 0.1045  0.1555  -0.0827 599 ASP A N   
4204 C CA  . ASP A 555 ? 0.5578 0.9382 0.7645 0.0979  0.1426  -0.0867 599 ASP A CA  
4205 C C   . ASP A 555 ? 0.4811 0.8635 0.7163 0.0870  0.1301  -0.0576 599 ASP A C   
4206 O O   . ASP A 555 ? 0.4500 0.8592 0.7109 0.0923  0.1352  -0.0380 599 ASP A O   
4207 C CB  . ASP A 555 ? 0.6120 0.9621 0.8267 0.1167  0.1537  -0.1036 599 ASP A CB  
4208 C CG  . ASP A 555 ? 0.6213 0.9193 0.8424 0.1087  0.1420  -0.1082 599 ASP A CG  
4209 O OD1 . ASP A 555 ? 0.6376 0.9130 0.8395 0.0907  0.1316  -0.1223 599 ASP A OD1 
4210 O OD2 . ASP A 555 ? 0.6099 0.8936 0.8553 0.1199  0.1426  -0.0963 599 ASP A OD2 
4211 N N   . GLY A 556 ? 0.4665 0.8224 0.6969 0.0708  0.1141  -0.0564 600 GLY A N   
4212 C CA  . GLY A 556 ? 0.4070 0.7573 0.6579 0.0593  0.1022  -0.0332 600 GLY A CA  
4213 C C   . GLY A 556 ? 0.3919 0.7683 0.6402 0.0480  0.0999  -0.0107 600 GLY A C   
4214 O O   . GLY A 556 ? 0.3726 0.7448 0.6364 0.0371  0.0923  0.0078  600 GLY A O   
4215 N N   . CYS A 557 ? 0.7690 1.1687 0.9949 0.0498  0.1068  -0.0117 601 CYS A N   
4216 C CA  . CYS A 557 ? 0.7504 1.1616 0.9675 0.0388  0.1046  0.0114  601 CYS A CA  
4217 C C   . CYS A 557 ? 0.7323 1.1158 0.9361 0.0299  0.0897  0.0116  601 CYS A C   
4218 O O   . CYS A 557 ? 0.7482 1.1294 0.9328 0.0331  0.0850  -0.0048 601 CYS A O   
4219 C CB  . CYS A 557 ? 0.7866 1.2295 0.9793 0.0449  0.1164  0.0142  601 CYS A CB  
4220 S SG  . CYS A 557 ? 0.8101 1.2933 1.0148 0.0578  0.1377  0.0127  601 CYS A SG  
4221 N N   . ILE A 558 ? 0.5452 0.9110 0.7594 0.0182  0.0829  0.0297  602 ILE A N   
4222 C CA  . ILE A 558 ? 0.5347 0.8776 0.7355 0.0122  0.0725  0.0353  602 ILE A CA  
4223 C C   . ILE A 558 ? 0.5450 0.8841 0.7381 0.0041  0.0764  0.0614  602 ILE A C   
4224 O O   . ILE A 558 ? 0.5314 0.8647 0.7413 -0.0081 0.0781  0.0739  602 ILE A O   
4225 C CB  . ILE A 558 ? 0.5016 0.8139 0.7172 0.0052  0.0616  0.0297  602 ILE A CB  
4226 C CG1 . ILE A 558 ? 0.5054 0.8120 0.7215 0.0107  0.0585  0.0043  602 ILE A CG1 
4227 C CG2 . ILE A 558 ? 0.4953 0.7847 0.6989 -0.0012 0.0542  0.0415  602 ILE A CG2 
4228 C CD1 . ILE A 558 ? 0.5175 0.8334 0.7125 0.0134  0.0545  -0.0084 602 ILE A CD1 
4229 N N   . LEU A 559 ? 0.4935 0.8358 0.6599 0.0102  0.0779  0.0697  603 LEU A N   
4230 C CA  . LEU A 559 ? 0.5246 0.8532 0.6761 0.0045  0.0841  0.0958  603 LEU A CA  
4231 C C   . LEU A 559 ? 0.5388 0.8906 0.6976 -0.0025 0.0982  0.1072  603 LEU A C   
4232 O O   . LEU A 559 ? 0.5508 0.8895 0.7145 -0.0184 0.1039  0.1253  603 LEU A O   
4233 C CB  . LEU A 559 ? 0.5189 0.8053 0.6756 -0.0080 0.0775  0.1045  603 LEU A CB  
4234 C CG  . LEU A 559 ? 0.5361 0.7993 0.6714 0.0027  0.0707  0.1071  603 LEU A CG  
4235 C CD1 . LEU A 559 ? 0.5024 0.7843 0.6408 0.0144  0.0603  0.0850  603 LEU A CD1 
4236 C CD2 . LEU A 559 ? 0.5496 0.7670 0.6842 -0.0079 0.0677  0.1155  603 LEU A CD2 
4237 N N   . GLY A 560 ? 0.4876 0.8758 0.6458 0.0083  0.1051  0.0956  604 GLY A N   
4238 C CA  . GLY A 560 ? 0.5084 0.9265 0.6681 0.0052  0.1215  0.1081  604 GLY A CA  
4239 C C   . GLY A 560 ? 0.4773 0.9166 0.6736 -0.0024 0.1267  0.1048  604 GLY A C   
4240 O O   . GLY A 560 ? 0.4881 0.9608 0.6909 -0.0050 0.1417  0.1146  604 GLY A O   
4241 N N   . TYR A 561 ? 0.5520 0.9760 0.7720 -0.0045 0.1149  0.0927  605 TYR A N   
4242 C CA  . TYR A 561 ? 0.5249 0.9743 0.7802 -0.0069 0.1181  0.0911  605 TYR A CA  
4243 C C   . TYR A 561 ? 0.4992 0.9354 0.7736 0.0019  0.1070  0.0731  605 TYR A C   
4244 O O   . TYR A 561 ? 0.4924 0.8934 0.7563 0.0024  0.0948  0.0635  605 TYR A O   
4245 C CB  . TYR A 561 ? 0.5112 0.9622 0.7817 -0.0313 0.1189  0.1125  605 TYR A CB  
4246 C CG  . TYR A 561 ? 0.4980 0.9061 0.7673 -0.0480 0.1043  0.1169  605 TYR A CG  
4247 C CD1 . TYR A 561 ? 0.5291 0.8947 0.7674 -0.0536 0.1017  0.1249  605 TYR A CD1 
4248 C CD2 . TYR A 561 ? 0.4636 0.8761 0.7611 -0.0574 0.0945  0.1149  605 TYR A CD2 
4249 C CE1 . TYR A 561 ? 0.5280 0.8527 0.7631 -0.0683 0.0911  0.1278  605 TYR A CE1 
4250 C CE2 . TYR A 561 ? 0.4597 0.8349 0.7527 -0.0739 0.0822  0.1178  605 TYR A CE2 
4251 C CZ  . TYR A 561 ? 0.4928 0.8225 0.7544 -0.0798 0.0815  0.1232  605 TYR A CZ  
4252 O OH  . TYR A 561 ? 0.4981 0.7898 0.7541 -0.0956 0.0713  0.1243  605 TYR A OH  
4253 N N   . LYS A 562 ? 0.4608 0.9274 0.7633 0.0104  0.1127  0.0700  606 LYS A N   
4254 C CA  . LYS A 562 ? 0.4482 0.9015 0.7683 0.0220  0.1048  0.0570  606 LYS A CA  
4255 C C   . LYS A 562 ? 0.4131 0.8747 0.7614 0.0085  0.0952  0.0715  606 LYS A C   
4256 O O   . LYS A 562 ? 0.4007 0.8949 0.7637 -0.0069 0.0994  0.0882  606 LYS A O   
4257 C CB  . LYS A 562 ? 0.4752 0.9533 0.8054 0.0469  0.1181  0.0436  606 LYS A CB  
4258 C CG  . LYS A 562 ? 0.5148 1.0126 0.8226 0.0566  0.1338  0.0354  606 LYS A CG  
4259 C CD  . LYS A 562 ? 0.5449 1.0665 0.8642 0.0823  0.1494  0.0222  606 LYS A CD  
4260 C CE  . LYS A 562 ? 0.5969 1.1233 0.8833 0.0937  0.1629  0.0043  606 LYS A CE  
4261 N NZ  . LYS A 562 ? 0.6432 1.1523 0.9252 0.1181  0.1719  -0.0219 606 LYS A NZ  
4262 N N   . GLU A 563 ? 0.5319 0.9656 0.8860 0.0116  0.0826  0.0654  607 GLU A N   
4263 C CA  . GLU A 563 ? 0.5101 0.9606 0.8916 0.0052  0.0733  0.0767  607 GLU A CA  
4264 C C   . GLU A 563 ? 0.5268 0.9797 0.9248 0.0305  0.0731  0.0694  607 GLU A C   
4265 O O   . GLU A 563 ? 0.5534 0.9640 0.9356 0.0424  0.0712  0.0553  607 GLU A O   
4266 C CB  . GLU A 563 ? 0.4962 0.9110 0.8667 -0.0164 0.0578  0.0816  607 GLU A CB  
4267 C CG  . GLU A 563 ? 0.4924 0.9055 0.8512 -0.0422 0.0590  0.0934  607 GLU A CG  
4268 C CD  . GLU A 563 ? 0.4926 0.8618 0.8343 -0.0611 0.0462  0.0952  607 GLU A CD  
4269 O OE1 . GLU A 563 ? 0.4940 0.8264 0.8210 -0.0522 0.0396  0.0847  607 GLU A OE1 
4270 O OE2 . GLU A 563 ? 0.4986 0.8688 0.8402 -0.0859 0.0438  0.1061  607 GLU A OE2 
4271 N N   . GLN A 564 ? 0.5675 1.0721 0.9977 0.0389  0.0764  0.0803  608 GLN A N   
4272 C CA  . GLN A 564 ? 0.5850 1.0978 1.0354 0.0645  0.0744  0.0809  608 GLN A CA  
4273 C C   . GLN A 564 ? 0.5634 1.0952 1.0335 0.0518  0.0569  0.0966  608 GLN A C   
4274 O O   . GLN A 564 ? 0.5326 1.1109 1.0216 0.0308  0.0525  0.1096  608 GLN A O   
4275 C CB  . GLN A 564 ? 0.5935 1.1577 1.0676 0.0909  0.0914  0.0818  608 GLN A CB  
4276 C CG  . GLN A 564 ? 0.6393 1.1705 1.0903 0.1136  0.1073  0.0612  608 GLN A CG  
4277 C CD  . GLN A 564 ? 0.6608 1.2276 1.1325 0.1486  0.1241  0.0597  608 GLN A CD  
4278 O OE1 . GLN A 564 ? 0.6345 1.2562 1.1423 0.1585  0.1225  0.0765  608 GLN A OE1 
4279 N NE2 . GLN A 564 ? 0.7109 1.2497 1.1596 0.1685  0.1409  0.0388  608 GLN A NE2 
4280 N N   . PHE A 565 ? 0.4239 0.9184 0.8868 0.0638  0.0476  0.0946  609 PHE A N   
4281 C CA  . PHE A 565 ? 0.4176 0.9137 0.8862 0.0517  0.0287  0.1064  609 PHE A CA  
4282 C C   . PHE A 565 ? 0.4334 0.9632 0.9282 0.0821  0.0272  0.1173  609 PHE A C   
4283 O O   . PHE A 565 ? 0.4614 0.9863 0.9604 0.1150  0.0418  0.1117  609 PHE A O   
4284 C CB  . PHE A 565 ? 0.4426 0.8684 0.8790 0.0439  0.0207  0.0979  609 PHE A CB  
4285 C CG  . PHE A 565 ? 0.4191 0.8185 0.8325 0.0137  0.0175  0.0924  609 PHE A CG  
4286 C CD1 . PHE A 565 ? 0.4147 0.7954 0.8112 0.0125  0.0294  0.0804  609 PHE A CD1 
4287 C CD2 . PHE A 565 ? 0.4082 0.8013 0.8143 -0.0120 0.0030  0.0992  609 PHE A CD2 
4288 C CE1 . PHE A 565 ? 0.3963 0.7538 0.7714 -0.0102 0.0271  0.0783  609 PHE A CE1 
4289 C CE2 . PHE A 565 ? 0.3953 0.7583 0.7780 -0.0357 0.0026  0.0945  609 PHE A CE2 
4290 C CZ  . PHE A 565 ? 0.3878 0.7339 0.7563 -0.0331 0.0147  0.0856  609 PHE A CZ  
4291 N N   . LEU A 566 ? 0.4548 1.0218 0.9664 0.0725  0.0103  0.1328  610 LEU A N   
4292 C CA  . LEU A 566 ? 0.4746 1.0632 1.0038 0.1039  0.0047  0.1459  610 LEU A CA  
4293 C C   . LEU A 566 ? 0.5078 1.0368 1.0073 0.0952  -0.0091 0.1459  610 LEU A C   
4294 O O   . LEU A 566 ? 0.4964 1.0140 0.9808 0.0607  -0.0216 0.1445  610 LEU A O   
4295 C CB  . LEU A 566 ? 0.4363 1.1196 1.0064 0.1020  -0.0056 0.1642  610 LEU A CB  
4296 C CG  . LEU A 566 ? 0.4112 1.1659 1.0187 0.1236  0.0106  0.1684  610 LEU A CG  
4297 C CD1 . LEU A 566 ? 0.3850 1.2393 1.0344 0.1204  -0.0025 0.1872  610 LEU A CD1 
4298 C CD2 . LEU A 566 ? 0.4485 1.1779 1.0553 0.1741  0.0302  0.1636  610 LEU A CD2 
4299 N N   . ARG A 567 ? 0.5537 1.0410 1.0426 0.1269  -0.0044 0.1474  611 ARG A N   
4300 C CA  . ARG A 567 ? 0.5974 1.0150 1.0531 0.1214  -0.0104 0.1447  611 ARG A CA  
4301 C C   . ARG A 567 ? 0.6316 1.0444 1.0893 0.1539  -0.0150 0.1625  611 ARG A C   
4302 O O   . ARG A 567 ? 0.6444 1.0667 1.1170 0.1913  -0.0034 0.1681  611 ARG A O   
4303 C CB  . ARG A 567 ? 0.6290 0.9785 1.0593 0.1222  0.0061  0.1235  611 ARG A CB  
4304 C CG  . ARG A 567 ? 0.6418 0.9424 1.0425 0.0919  0.0003  0.1132  611 ARG A CG  
4305 C CD  . ARG A 567 ? 0.6801 0.9188 1.0584 0.0969  0.0150  0.0943  611 ARG A CD  
4306 N NE  . ARG A 567 ? 0.7075 0.9002 1.0598 0.0752  0.0085  0.0900  611 ARG A NE  
4307 C CZ  . ARG A 567 ? 0.7442 0.8852 1.0752 0.0694  0.0175  0.0736  611 ARG A CZ  
4308 N NH1 . ARG A 567 ? 0.7605 0.8859 1.0900 0.0817  0.0325  0.0579  611 ARG A NH1 
4309 N NH2 . ARG A 567 ? 0.7524 0.8614 1.0637 0.0501  0.0118  0.0718  611 ARG A NH2 
4310 N N   . LEU A 568 ? 0.5592 0.9544 0.9988 0.1417  -0.0307 0.1722  612 LEU A N   
4311 C CA  . LEU A 568 ? 0.5902 0.9848 1.0284 0.1718  -0.0373 0.1937  612 LEU A CA  
4312 C C   . LEU A 568 ? 0.6366 0.9542 1.0544 0.2026  -0.0187 0.1910  612 LEU A C   
4313 O O   . LEU A 568 ? 0.6549 0.9020 1.0427 0.1857  -0.0115 0.1763  612 LEU A O   
4314 C CB  . LEU A 568 ? 0.5968 0.9848 1.0127 0.1475  -0.0573 0.2026  612 LEU A CB  
4315 C CG  . LEU A 568 ? 0.6270 1.0190 1.0360 0.1753  -0.0674 0.2282  612 LEU A CG  
4316 C CD1 . LEU A 568 ? 0.6071 1.0927 1.0563 0.1990  -0.0769 0.2468  612 LEU A CD1 
4317 C CD2 . LEU A 568 ? 0.6354 1.0158 1.0157 0.1468  -0.0849 0.2324  612 LEU A CD2 
4318 N N   . ARG A 569 ? 0.8680 1.1111 1.3614 0.0826  0.0507  0.3897  613 ARG A N   
4319 C CA  . ARG A 569 ? 0.9120 1.0948 1.4204 0.0852  0.0664  0.4076  613 ARG A CA  
4320 C C   . ARG A 569 ? 0.9576 1.1207 1.4544 0.0832  0.0824  0.4426  613 ARG A C   
4321 O O   . ARG A 569 ? 0.9678 1.1599 1.4349 0.1013  0.0815  0.4666  613 ARG A O   
4322 C CB  . ARG A 569 ? 0.9104 1.0786 1.4242 0.1166  0.0640  0.4196  613 ARG A CB  
4323 C CG  . ARG A 569 ? 0.8889 1.0408 1.4268 0.1170  0.0602  0.3902  613 ARG A CG  
4324 C CD  . ARG A 569 ? 0.8802 1.0272 1.4223 0.1527  0.0569  0.4013  613 ARG A CD  
4325 N NE  . ARG A 569 ? 0.8256 1.0151 1.3770 0.1602  0.0453  0.3750  613 ARG A NE  
4326 C CZ  . ARG A 569 ? 0.8168 0.9917 1.3845 0.1552  0.0471  0.3470  613 ARG A CZ  
4327 N NH1 . ARG A 569 ? 0.8605 0.9786 1.4372 0.1425  0.0558  0.3366  613 ARG A NH1 
4328 N NH2 . ARG A 569 ? 0.7648 0.9842 1.3418 0.1636  0.0403  0.3289  613 ARG A NH2 
4329 N N   . LYS A 570 ? 0.8393 0.9556 1.3613 0.0622  0.0974  0.4450  614 LYS A N   
4330 C CA  . LYS A 570 ? 0.8757 0.9710 1.3966 0.0591  0.1175  0.4824  614 LYS A CA  
4331 C C   . LYS A 570 ? 0.9272 1.0102 1.4309 0.0943  0.1250  0.5244  614 LYS A C   
4332 O O   . LYS A 570 ? 0.9537 1.0557 1.4289 0.1085  0.1345  0.5581  614 LYS A O   
4333 C CB  . LYS A 570 ? 0.8963 0.9380 1.4617 0.0317  0.1314  0.4780  614 LYS A CB  
4334 C CG  . LYS A 570 ? 0.8745 0.9288 1.4560 0.0013  0.1218  0.4349  614 LYS A CG  
4335 C CD  . LYS A 570 ? 0.8855 0.9231 1.4960 -0.0274 0.1373  0.4425  614 LYS A CD  
4336 C CE  . LYS A 570 ? 0.8628 0.9102 1.4919 -0.0543 0.1258  0.3982  614 LYS A CE  
4337 N NZ  . LYS A 570 ? 0.8325 0.9315 1.4269 -0.0499 0.1091  0.3726  614 LYS A NZ  
4338 N N   . SER A 571 ? 1.0435 1.0988 1.5606 0.1126  0.1201  0.5217  615 SER A N   
4339 C CA  . SER A 571 ? 1.0640 1.0998 1.5689 0.1487  0.1281  0.5628  615 SER A CA  
4340 C C   . SER A 571 ? 1.0501 1.1480 1.5091 0.1806  0.1143  0.5760  615 SER A C   
4341 O O   . SER A 571 ? 1.0745 1.1715 1.5089 0.2107  0.1233  0.6180  615 SER A O   
4342 C CB  . SER A 571 ? 1.0583 1.0524 1.5889 0.1626  0.1238  0.5509  615 SER A CB  
4343 O OG  . SER A 571 ? 1.0295 1.0693 1.5430 0.1871  0.1033  0.5340  615 SER A OG  
4344 N N   . SER A 572 ? 0.9539 1.1068 1.4029 0.1746  0.0920  0.5396  616 SER A N   
4345 C CA  . SER A 572 ? 0.9514 1.1662 1.3655 0.2022  0.0736  0.5430  616 SER A CA  
4346 C C   . SER A 572 ? 0.9594 1.2064 1.3360 0.2040  0.0769  0.5597  616 SER A C   
4347 O O   . SER A 572 ? 0.9195 1.1824 1.2954 0.1761  0.0765  0.5390  616 SER A O   
4348 C CB  . SER A 572 ? 0.8906 1.1504 1.3172 0.1923  0.0499  0.4984  616 SER A CB  
4349 O OG  . SER A 572 ? 0.8926 1.1255 1.3488 0.1981  0.0495  0.4874  616 SER A OG  
4350 N N   . MET A 573 ? 1.2797 1.5400 1.6214 0.2413  0.0792  0.5968  617 MET A N   
4351 C CA  . MET A 573 ? 1.3103 1.6032 1.6084 0.2517  0.0833  0.6156  617 MET A CA  
4352 C C   . MET A 573 ? 1.2888 1.6530 1.5536 0.2767  0.0515  0.5950  617 MET A C   
4353 O O   . MET A 573 ? 1.2934 1.6777 1.5350 0.3170  0.0417  0.6148  617 MET A O   
4354 C CB  . MET A 573 ? 1.3604 1.6195 1.6386 0.2793  0.1108  0.6752  617 MET A CB  
4355 C CG  . MET A 573 ? 1.3959 1.6926 1.6192 0.3038  0.1172  0.7032  617 MET A CG  
4356 S SD  . MET A 573 ? 1.4466 1.7008 1.6507 0.3450  0.1500  0.7791  617 MET A SD  
4357 C CE  . MET A 573 ? 1.4477 1.6106 1.7257 0.3034  0.1802  0.7890  617 MET A CE  
4358 N N   . CYS A 574 ? 0.9711 1.3736 1.2345 0.2541  0.0349  0.5555  618 CYS A N   
4359 C CA  . CYS A 574 ? 0.9579 1.4269 1.2016 0.2718  0.0011  0.5272  618 CYS A CA  
4360 C C   . CYS A 574 ? 0.9102 1.4082 1.1520 0.2438  -0.0103 0.4891  618 CYS A C   
4361 O O   . CYS A 574 ? 0.8797 1.3478 1.1389 0.2100  0.0070  0.4822  618 CYS A O   
4362 C CB  . CYS A 574 ? 0.9317 1.4156 1.2129 0.2750  -0.0198 0.5036  618 CYS A CB  
4363 S SG  . CYS A 574 ? 0.8556 1.3179 1.1936 0.2259  -0.0178 0.4628  618 CYS A SG  
4364 N N   . GLN A 575 ? 0.9185 1.4746 1.1452 0.2577  -0.0418 0.4606  619 GLN A N   
4365 C CA  . GLN A 575 ? 0.9136 1.4987 1.1336 0.2379  -0.0553 0.4243  619 GLN A CA  
4366 C C   . GLN A 575 ? 0.8479 1.4460 1.1196 0.2059  -0.0735 0.3789  619 GLN A C   
4367 O O   . GLN A 575 ? 0.8037 1.4322 1.1011 0.2152  -0.0962 0.3624  619 GLN A O   
4368 C CB  . GLN A 575 ? 0.9417 1.5820 1.1112 0.2745  -0.0800 0.4182  619 GLN A CB  
4369 C CG  . GLN A 575 ? 0.9359 1.6105 1.1008 0.2593  -0.1018 0.3729  619 GLN A CG  
4370 C CD  . GLN A 575 ? 0.9685 1.6990 1.0814 0.3002  -0.1306 0.3615  619 GLN A CD  
4371 O OE1 . GLN A 575 ? 0.9941 1.7427 1.0720 0.3424  -0.1351 0.3889  619 GLN A OE1 
4372 N NE2 . GLN A 575 ? 0.9729 1.7304 1.0787 0.2903  -0.1508 0.3201  619 GLN A NE2 
4373 N N   . ASN A 576 ? 0.7648 1.3414 1.0533 0.1698  -0.0618 0.3616  620 ASN A N   
4374 C CA  . ASN A 576 ? 0.7088 1.2968 1.0411 0.1398  -0.0750 0.3219  620 ASN A CA  
4375 C C   . ASN A 576 ? 0.7072 1.3484 1.0371 0.1462  -0.1080 0.2871  620 ASN A C   
4376 O O   . ASN A 576 ? 0.6744 1.3365 1.0488 0.1318  -0.1247 0.2589  620 ASN A O   
4377 C CB  . ASN A 576 ? 0.7008 1.2555 1.0428 0.1054  -0.0550 0.3142  620 ASN A CB  
4378 C CG  . ASN A 576 ? 0.7034 1.2067 1.0642 0.0917  -0.0280 0.3359  620 ASN A CG  
4379 O OD1 . ASN A 576 ? 0.6746 1.1656 1.0628 0.0940  -0.0272 0.3389  620 ASN A OD1 
4380 N ND2 . ASN A 576 ? 0.7396 1.2142 1.0881 0.0781  -0.0064 0.3489  620 ASN A ND2 
4381 N N   . GLY A 577 ? 0.7458 1.4088 1.0261 0.1678  -0.1165 0.2882  621 GLY A N   
4382 C CA  . GLY A 577 ? 0.7552 1.4678 1.0292 0.1777  -0.1512 0.2511  621 GLY A CA  
4383 C C   . GLY A 577 ? 0.7261 1.4373 1.0098 0.1502  -0.1558 0.2166  621 GLY A C   
4384 O O   . GLY A 577 ? 0.6826 1.3613 0.9973 0.1173  -0.1373 0.2137  621 GLY A O   
4385 N N   . ARG A 578 ? 0.7546 1.5009 1.0103 0.1662  -0.1815 0.1889  622 ARG A N   
4386 C CA  . ARG A 578 ? 0.7359 1.4789 0.9978 0.1443  -0.1870 0.1547  622 ARG A CA  
4387 C C   . ARG A 578 ? 0.6829 1.4198 1.0171 0.1068  -0.1945 0.1259  622 ARG A C   
4388 O O   . ARG A 578 ? 0.6584 1.3759 1.0061 0.0822  -0.1876 0.1084  622 ARG A O   
4389 C CB  . ARG A 578 ? 0.7837 1.5683 1.0060 0.1722  -0.2195 0.1232  622 ARG A CB  
4390 C CG  . ARG A 578 ? 0.8427 1.6362 0.9850 0.2123  -0.2094 0.1503  622 ARG A CG  
4391 C CD  . ARG A 578 ? 0.8863 1.7129 0.9855 0.2354  -0.2369 0.1123  622 ARG A CD  
4392 N NE  . ARG A 578 ? 0.8596 1.6638 0.9717 0.2074  -0.2303 0.0857  622 ARG A NE  
4393 C CZ  . ARG A 578 ? 0.8640 1.6445 0.9392 0.2069  -0.1994 0.1054  622 ARG A CZ  
4394 N NH1 . ARG A 578 ? 0.8945 1.6702 0.9211 0.2304  -0.1706 0.1532  622 ARG A NH1 
4395 N NH2 . ARG A 578 ? 0.8402 1.6025 0.9309 0.1831  -0.1962 0.0790  622 ARG A NH2 
4396 N N   . ASP A 579 ? 0.9236 1.6781 1.3055 0.1041  -0.2065 0.1234  623 ASP A N   
4397 C CA  . ASP A 579 ? 0.8513 1.6055 1.3047 0.0711  -0.2113 0.0995  623 ASP A CA  
4398 C C   . ASP A 579 ? 0.8094 1.5251 1.2922 0.0481  -0.1782 0.1247  623 ASP A C   
4399 O O   . ASP A 579 ? 0.7486 1.4641 1.2886 0.0243  -0.1764 0.1128  623 ASP A O   
4400 C CB  . ASP A 579 ? 0.8090 1.6128 1.3082 0.0796  -0.2448 0.0772  623 ASP A CB  
4401 C CG  . ASP A 579 ? 0.8036 1.6221 1.3001 0.1038  -0.2429 0.1061  623 ASP A CG  
4402 O OD1 . ASP A 579 ? 0.8324 1.6182 1.2893 0.1146  -0.2157 0.1435  623 ASP A OD1 
4403 O OD2 . ASP A 579 ? 0.7702 1.6338 1.3083 0.1126  -0.2695 0.0906  623 ASP A OD2 
4404 N N   . TYR A 580 ? 0.5877 1.2717 1.0322 0.0566  -0.1522 0.1592  624 TYR A N   
4405 C CA  . TYR A 580 ? 0.5573 1.2038 1.0222 0.0402  -0.1234 0.1810  624 TYR A CA  
4406 C C   . TYR A 580 ? 0.5173 1.1406 1.0102 0.0080  -0.1100 0.1668  624 TYR A C   
4407 O O   . TYR A 580 ? 0.5287 1.1453 1.0049 -0.0012 -0.1102 0.1530  624 TYR A O   
4408 C CB  . TYR A 580 ? 0.6003 1.2148 1.0200 0.0532  -0.1004 0.2156  624 TYR A CB  
4409 C CG  . TYR A 580 ? 0.5826 1.1541 1.0188 0.0357  -0.0729 0.2323  624 TYR A CG  
4410 C CD1 . TYR A 580 ? 0.5600 1.1217 1.0192 0.0420  -0.0667 0.2461  624 TYR A CD1 
4411 C CD2 . TYR A 580 ? 0.5914 1.1333 1.0191 0.0155  -0.0546 0.2321  624 TYR A CD2 
4412 C CE1 . TYR A 580 ? 0.5513 1.0738 1.0227 0.0289  -0.0447 0.2561  624 TYR A CE1 
4413 C CE2 . TYR A 580 ? 0.5757 1.0820 1.0182 0.0015  -0.0338 0.2425  624 TYR A CE2 
4414 C CZ  . TYR A 580 ? 0.5593 1.0551 1.0223 0.0084  -0.0297 0.2532  624 TYR A CZ  
4415 O OH  . TYR A 580 ? 0.5523 1.0123 1.0275 -0.0031 -0.0118 0.2586  624 TYR A OH  
4416 N N   . VAL A 581 ? 0.6922 1.3049 1.2252 -0.0051 -0.0978 0.1714  625 VAL A N   
4417 C CA  . VAL A 581 ? 0.6523 1.2481 1.2154 -0.0310 -0.0849 0.1608  625 VAL A CA  
4418 C C   . VAL A 581 ? 0.6429 1.2050 1.2035 -0.0345 -0.0595 0.1809  625 VAL A C   
4419 O O   . VAL A 581 ? 0.6311 1.1955 1.2059 -0.0239 -0.0560 0.1927  625 VAL A O   
4420 C CB  . VAL A 581 ? 0.5974 1.2231 1.2213 -0.0416 -0.0968 0.1430  625 VAL A CB  
4421 C CG1 . VAL A 581 ? 0.5646 1.1710 1.2181 -0.0635 -0.0774 0.1415  625 VAL A CG1 
4422 C CG2 . VAL A 581 ? 0.5833 1.2391 1.2173 -0.0420 -0.1248 0.1158  625 VAL A CG2 
4423 N N   . VAL A 582 ? 0.5202 1.0523 1.0628 -0.0472 -0.0435 0.1827  626 VAL A N   
4424 C CA  . VAL A 582 ? 0.5117 1.0125 1.0531 -0.0507 -0.0230 0.1955  626 VAL A CA  
4425 C C   . VAL A 582 ? 0.4611 0.9699 1.0415 -0.0551 -0.0178 0.1908  626 VAL A C   
4426 O O   . VAL A 582 ? 0.4290 0.9490 1.0335 -0.0678 -0.0184 0.1785  626 VAL A O   
4427 C CB  . VAL A 582 ? 0.5171 0.9924 1.0388 -0.0644 -0.0103 0.1934  626 VAL A CB  
4428 C CG1 . VAL A 582 ? 0.5033 0.9508 1.0296 -0.0683 0.0062  0.1992  626 VAL A CG1 
4429 C CG2 . VAL A 582 ? 0.5723 1.0429 1.0585 -0.0583 -0.0108 0.2026  626 VAL A CG2 
4430 N N   . THR A 583 ? 0.4927 0.9954 1.0803 -0.0428 -0.0113 0.2020  627 THR A N   
4431 C CA  . THR A 583 ? 0.4843 0.9982 1.1062 -0.0420 -0.0033 0.2003  627 THR A CA  
4432 C C   . THR A 583 ? 0.4641 0.9466 1.0739 -0.0442 0.0150  0.2018  627 THR A C   
4433 O O   . THR A 583 ? 0.4660 0.9194 1.0525 -0.0380 0.0196  0.2078  627 THR A O   
4434 C CB  . THR A 583 ? 0.5151 1.0477 1.1547 -0.0223 -0.0082 0.2092  627 THR A CB  
4435 O OG1 . THR A 583 ? 0.5198 1.0888 1.1734 -0.0181 -0.0290 0.2047  627 THR A OG1 
4436 C CG2 . THR A 583 ? 0.5012 1.0473 1.1754 -0.0191 0.0045  0.2094  627 THR A CG2 
4437 N N   . LYS A 584 ? 0.5787 1.0666 1.2053 -0.0522 0.0253  0.1962  628 LYS A N   
4438 C CA  . LYS A 584 ? 0.5468 1.0102 1.1581 -0.0498 0.0404  0.1950  628 LYS A CA  
4439 C C   . LYS A 584 ? 0.5312 1.0119 1.1667 -0.0473 0.0538  0.1960  628 LYS A C   
4440 O O   . LYS A 584 ? 0.5339 1.0392 1.1998 -0.0564 0.0528  0.1966  628 LYS A O   
4441 C CB  . LYS A 584 ? 0.5200 0.9623 1.1059 -0.0632 0.0411  0.1885  628 LYS A CB  
4442 C CG  . LYS A 584 ? 0.5125 0.9695 1.1113 -0.0765 0.0409  0.1834  628 LYS A CG  
4443 C CD  . LYS A 584 ? 0.4918 0.9341 1.0671 -0.0876 0.0382  0.1773  628 LYS A CD  
4444 C CE  . LYS A 584 ? 0.4811 0.9327 1.0713 -0.0980 0.0403  0.1719  628 LYS A CE  
4445 N NZ  . LYS A 584 ? 0.4527 0.8883 1.0200 -0.1045 0.0439  0.1665  628 LYS A NZ  
4446 N N   . GLN A 585 ? 0.6148 1.0835 1.2390 -0.0340 0.0669  0.1962  629 GLN A N   
4447 C CA  . GLN A 585 ? 0.6017 1.0878 1.2428 -0.0297 0.0836  0.2008  629 GLN A CA  
4448 C C   . GLN A 585 ? 0.5792 1.0442 1.1876 -0.0227 0.0941  0.1950  629 GLN A C   
4449 O O   . GLN A 585 ? 0.5677 1.0090 1.1489 -0.0128 0.0907  0.1857  629 GLN A O   
4450 C CB  . GLN A 585 ? 0.6022 1.1139 1.2711 -0.0120 0.0924  0.2098  629 GLN A CB  
4451 C CG  . GLN A 585 ? 0.5959 1.0932 1.2482 0.0082  0.0893  0.2073  629 GLN A CG  
4452 C CD  . GLN A 585 ? 0.5984 1.1283 1.2863 0.0225  0.0911  0.2167  629 GLN A CD  
4453 O OE1 . GLN A 585 ? 0.6117 1.1778 1.3419 0.0131  0.0898  0.2236  629 GLN A OE1 
4454 N NE2 . GLN A 585 ? 0.5838 1.1014 1.2588 0.0457  0.0931  0.2154  629 GLN A NE2 
4455 N N   . PRO A 586 ? 0.3845 0.8579 0.9979 -0.0276 0.1056  0.1996  630 PRO A N   
4456 C CA  . PRO A 586 ? 0.3832 0.8436 0.9651 -0.0182 0.1154  0.1956  630 PRO A CA  
4457 C C   . PRO A 586 ? 0.4063 0.8757 0.9768 0.0102  0.1324  0.1995  630 PRO A C   
4458 O O   . PRO A 586 ? 0.4080 0.9031 1.0077 0.0180  0.1472  0.2148  630 PRO A O   
4459 C CB  . PRO A 586 ? 0.3808 0.8493 0.9784 -0.0318 0.1231  0.2045  630 PRO A CB  
4460 C CG  . PRO A 586 ? 0.3855 0.8802 1.0344 -0.0403 0.1264  0.2165  630 PRO A CG  
4461 C CD  . PRO A 586 ? 0.3930 0.8886 1.0464 -0.0428 0.1083  0.2088  630 PRO A CD  
4462 N N   . SER A 587 ? 0.5575 1.0094 1.0889 0.0262  0.1304  0.1851  631 SER A N   
4463 C CA  . SER A 587 ? 0.5840 1.0469 1.0952 0.0569  0.1472  0.1871  631 SER A CA  
4464 C C   . SER A 587 ? 0.6067 1.0682 1.0908 0.0616  0.1532  0.1870  631 SER A C   
4465 O O   . SER A 587 ? 0.6076 1.0508 1.0725 0.0516  0.1375  0.1709  631 SER A O   
4466 C CB  . SER A 587 ? 0.6056 1.0516 1.0910 0.0784  0.1384  0.1664  631 SER A CB  
4467 O OG  . SER A 587 ? 0.5817 1.0193 1.0881 0.0721  0.1283  0.1646  631 SER A OG  
4468 N N   . ILE A 588 ? 0.5192 1.0016 1.0039 0.0775  0.1768  0.2071  632 ILE A N   
4469 C CA  . ILE A 588 ? 0.5418 1.0236 1.0020 0.0836  0.1842  0.2123  632 ILE A CA  
4470 C C   . ILE A 588 ? 0.6005 1.0841 1.0085 0.1202  0.1862  0.1990  632 ILE A C   
4471 O O   . ILE A 588 ? 0.6324 1.1350 1.0284 0.1508  0.2061  0.2101  632 ILE A O   
4472 C CB  . ILE A 588 ? 0.5352 1.0358 1.0250 0.0819  0.2113  0.2455  632 ILE A CB  
4473 C CG1 . ILE A 588 ? 0.4980 0.9994 1.0440 0.0470  0.2060  0.2533  632 ILE A CG1 
4474 C CG2 . ILE A 588 ? 0.5579 1.0529 1.0212 0.0891  0.2181  0.2526  632 ILE A CG2 
4475 C CD1 . ILE A 588 ? 0.4863 0.9657 1.0300 0.0203  0.1838  0.2382  632 ILE A CD1 
4476 N N   . CYS A 589 ? 0.5256 0.9933 0.9039 0.1188  0.1655  0.1747  633 CYS A N   
4477 C CA  . CYS A 589 ? 0.5645 1.0325 0.8953 0.1514  0.1574  0.1511  633 CYS A CA  
4478 C C   . CYS A 589 ? 0.5939 1.0814 0.8907 0.1817  0.1759  0.1667  633 CYS A C   
4479 O O   . CYS A 589 ? 0.5808 1.0734 0.8916 0.1713  0.1908  0.1930  633 CYS A O   
4480 C CB  . CYS A 589 ? 0.5589 1.0064 0.8812 0.1362  0.1268  0.1180  633 CYS A CB  
4481 S SG  . CYS A 589 ? 0.5419 0.9636 0.8961 0.1109  0.1081  0.1009  633 CYS A SG  
4482 N N   . LEU A 590 ? 0.6575 1.1551 0.9087 0.2220  0.1755  0.1509  634 LEU A N   
4483 C CA  . LEU A 590 ? 0.7045 1.2223 0.9104 0.2592  0.1898  0.1621  634 LEU A CA  
4484 C C   . LEU A 590 ? 0.7115 1.2233 0.9003 0.2516  0.1690  0.1463  634 LEU A C   
4485 O O   . LEU A 590 ? 0.7256 1.2227 0.9161 0.2365  0.1378  0.1102  634 LEU A O   
4486 C CB  . LEU A 590 ? 0.7940 1.3255 0.9497 0.3078  0.1893  0.1418  634 LEU A CB  
4487 C CG  . LEU A 590 ? 0.7979 1.3559 0.9425 0.3425  0.2272  0.1754  634 LEU A CG  
4488 C CD1 . LEU A 590 ? 0.7425 1.2991 0.9397 0.3214  0.2404  0.1907  634 LEU A CD1 
4489 C CD2 . LEU A 590 ? 0.8958 1.4680 0.9755 0.3967  0.2214  0.1485  634 LEU A CD2 
4490 N N   . CYS A 591 ? 0.8385 1.3619 1.0146 0.2628  0.1875  0.1750  635 CYS A N   
4491 C CA  . CYS A 591 ? 0.8484 1.3716 1.0045 0.2632  0.1707  0.1636  635 CYS A CA  
4492 C C   . CYS A 591 ? 0.9298 1.4672 1.0317 0.3007  0.1474  0.1271  635 CYS A C   
4493 O O   . CYS A 591 ? 0.9853 1.5423 1.0415 0.3466  0.1590  0.1296  635 CYS A O   
4494 C CB  . CYS A 591 ? 0.8303 1.3611 0.9829 0.2733  0.1992  0.2062  635 CYS A CB  
4495 S SG  . CYS A 591 ? 0.7472 1.2566 0.9685 0.2221  0.2134  0.2364  635 CYS A SG  
4496 N N   . SER A 592 ? 0.7540 1.2837 0.8634 0.2817  0.1139  0.0920  636 SER A N   
4497 C CA  . SER A 592 ? 0.8245 1.3715 0.8910 0.3130  0.0871  0.0555  636 SER A CA  
4498 C C   . SER A 592 ? 0.7958 1.3515 0.8624 0.3065  0.0794  0.0614  636 SER A C   
4499 O O   . SER A 592 ? 0.7282 1.2716 0.8277 0.2769  0.0943  0.0905  636 SER A O   
4500 C CB  . SER A 592 ? 0.8579 1.3916 0.9411 0.2977  0.0520  0.0050  636 SER A CB  
4501 O OG  . SER A 592 ? 0.7873 1.3004 0.9249 0.2466  0.0389  -0.0003 636 SER A OG  
4502 N N   . LEU A 593 ? 0.7787 1.3566 0.8098 0.3353  0.0549  0.0319  637 LEU A N   
4503 C CA  . LEU A 593 ? 0.7708 1.3611 0.8015 0.3335  0.0470  0.0371  637 LEU A CA  
4504 C C   . LEU A 593 ? 0.7134 1.2858 0.8039 0.2791  0.0318  0.0265  637 LEU A C   
4505 O O   . LEU A 593 ? 0.6902 1.2627 0.7963 0.2647  0.0370  0.0445  637 LEU A O   
4506 C CB  . LEU A 593 ? 0.8206 1.4437 0.8066 0.3747  0.0174  0.0008  637 LEU A CB  
4507 C CG  . LEU A 593 ? 0.8890 1.5375 0.8031 0.4386  0.0297  0.0093  637 LEU A CG  
4508 C CD1 . LEU A 593 ? 0.9382 1.6196 0.8138 0.4754  -0.0101 -0.0406 637 LEU A CD1 
4509 C CD2 . LEU A 593 ? 0.9003 1.5542 0.7916 0.4598  0.0664  0.0656  637 LEU A CD2 
4510 N N   . GLU A 594 ? 1.0865 1.6419 1.2099 0.2508  0.0159  0.0000  638 GLU A N   
4511 C CA  . GLU A 594 ? 1.0156 1.5561 1.1930 0.2030  0.0021  -0.0107 638 GLU A CA  
4512 C C   . GLU A 594 ? 0.9371 1.4569 1.1455 0.1708  0.0275  0.0277  638 GLU A C   
4513 O O   . GLU A 594 ? 0.8698 1.3783 1.1183 0.1339  0.0208  0.0252  638 GLU A O   
4514 C CB  . GLU A 594 ? 1.0294 1.5552 1.2312 0.1868  -0.0192 -0.0463 638 GLU A CB  
4515 C CG  . GLU A 594 ? 1.1097 1.6562 1.2838 0.2192  -0.0484 -0.0903 638 GLU A CG  
4516 C CD  . GLU A 594 ? 1.0965 1.6313 1.3148 0.1924  -0.0793 -0.1330 638 GLU A CD  
4517 O OE1 . GLU A 594 ? 1.0570 1.5609 1.3114 0.1612  -0.0726 -0.1270 638 GLU A OE1 
4518 O OE2 . GLU A 594 ? 1.1173 1.6748 1.3379 0.2023  -0.1098 -0.1710 638 GLU A OE2 
4519 N N   . ASP A 595 ? 0.6673 1.1836 0.8586 0.1859  0.0568  0.0629  639 ASP A N   
4520 C CA  . ASP A 595 ? 0.6004 1.0998 0.8213 0.1595  0.0797  0.0978  639 ASP A CA  
4521 C C   . ASP A 595 ? 0.5919 1.0984 0.8020 0.1698  0.0902  0.1196  639 ASP A C   
4522 O O   . ASP A 595 ? 0.5601 1.0517 0.7935 0.1515  0.1081  0.1465  639 ASP A O   
4523 C CB  . ASP A 595 ? 0.6069 1.0989 0.8290 0.1662  0.1066  0.1250  639 ASP A CB  
4524 C CG  . ASP A 595 ? 0.6111 1.0937 0.8465 0.1565  0.0979  0.1062  639 ASP A CG  
4525 O OD1 . ASP A 595 ? 0.5538 1.0197 0.8272 0.1203  0.0895  0.1006  639 ASP A OD1 
4526 O OD2 . ASP A 595 ? 0.6742 1.1662 0.8798 0.1878  0.0996  0.0971  639 ASP A OD2 
4527 N N   . PHE A 596 ? 0.7537 1.2826 0.9295 0.2006  0.0777  0.1064  640 PHE A N   
4528 C CA  . PHE A 596 ? 0.7513 1.2865 0.9136 0.2159  0.0884  0.1290  640 PHE A CA  
4529 C C   . PHE A 596 ? 0.7305 1.2815 0.9011 0.2089  0.0618  0.1032  640 PHE A C   
4530 O O   . PHE A 596 ? 0.7510 1.3209 0.9185 0.2130  0.0337  0.0660  640 PHE A O   
4531 C CB  . PHE A 596 ? 0.8194 1.3726 0.9281 0.2683  0.1037  0.1473  640 PHE A CB  
4532 C CG  . PHE A 596 ? 0.8309 1.3726 0.9361 0.2775  0.1373  0.1820  640 PHE A CG  
4533 C CD1 . PHE A 596 ? 0.8558 1.4011 0.9526 0.2845  0.1368  0.1694  640 PHE A CD1 
4534 C CD2 . PHE A 596 ? 0.8184 1.3457 0.9342 0.2786  0.1701  0.2272  640 PHE A CD2 
4535 C CE1 . PHE A 596 ? 0.8579 1.3981 0.9572 0.2929  0.1692  0.2024  640 PHE A CE1 
4536 C CE2 . PHE A 596 ? 0.8248 1.3452 0.9483 0.2842  0.2025  0.2605  640 PHE A CE2 
4537 C CZ  . PHE A 596 ? 0.8399 1.3696 0.9549 0.2918  0.2024  0.2487  640 PHE A CZ  
4538 N N   . LEU A 597 ? 0.7599 1.3041 0.9450 0.1989  0.0702  0.1214  641 LEU A N   
4539 C CA  . LEU A 597 ? 0.7394 1.3042 0.9313 0.1983  0.0488  0.1017  641 LEU A CA  
4540 C C   . LEU A 597 ? 0.7850 1.3689 0.9359 0.2432  0.0539  0.1165  641 LEU A C   
4541 O O   . LEU A 597 ? 0.8089 1.3778 0.9394 0.2628  0.0819  0.1530  641 LEU A O   
4542 C CB  . LEU A 597 ? 0.6648 1.2126 0.8984 0.1609  0.0526  0.1082  641 LEU A CB  
4543 C CG  . LEU A 597 ? 0.6569 1.1797 0.8912 0.1627  0.0799  0.1450  641 LEU A CG  
4544 C CD1 . LEU A 597 ? 0.6508 1.1833 0.8803 0.1773  0.0780  0.1500  641 LEU A CD1 
4545 C CD2 . LEU A 597 ? 0.6079 1.1011 0.8798 0.1230  0.0899  0.1528  641 LEU A CD2 
4546 N N   . CYS A 598 ? 0.7485 1.3668 0.8904 0.2600  0.0272  0.0891  642 CYS A N   
4547 C CA  . CYS A 598 ? 0.7820 1.4242 0.8859 0.3045  0.0271  0.1002  642 CYS A CA  
4548 C C   . CYS A 598 ? 0.7528 1.3734 0.8654 0.3024  0.0507  0.1360  642 CYS A C   
4549 O O   . CYS A 598 ? 0.6935 1.3027 0.8461 0.2688  0.0488  0.1322  642 CYS A O   
4550 C CB  . CYS A 598 ? 0.7771 1.4634 0.8864 0.3135  -0.0103 0.0592  642 CYS A CB  
4551 S SG  . CYS A 598 ? 0.8366 1.5516 0.9233 0.3335  -0.0413 0.0143  642 CYS A SG  
4552 N N   . ASP A 599 ? 0.7595 1.3731 0.8337 0.3405  0.0744  0.1716  643 ASP A N   
4553 C CA  . ASP A 599 ? 0.7515 1.3380 0.8335 0.3428  0.0993  0.2080  643 ASP A CA  
4554 C C   . ASP A 599 ? 0.7559 1.3718 0.8273 0.3675  0.0815  0.1978  643 ASP A C   
4555 O O   . ASP A 599 ? 0.7599 1.4191 0.8248 0.3778  0.0493  0.1615  643 ASP A O   
4556 C CB  . ASP A 599 ? 0.8005 1.3672 0.8508 0.3745  0.1344  0.2538  643 ASP A CB  
4557 C CG  . ASP A 599 ? 0.7863 1.3066 0.8658 0.3585  0.1661  0.2928  643 ASP A CG  
4558 O OD1 . ASP A 599 ? 0.7612 1.2707 0.8642 0.3450  0.1604  0.2885  643 ASP A OD1 
4559 O OD2 . ASP A 599 ? 0.8070 1.3027 0.8879 0.3609  0.1971  0.3273  643 ASP A OD2 
4560 N N   . PHE A 600 ? 0.9120 1.5063 0.9852 0.3782  0.1007  0.2279  644 PHE A N   
4561 C CA  . PHE A 600 ? 0.9022 1.5268 0.9660 0.4042  0.0839  0.2186  644 PHE A CA  
4562 C C   . PHE A 600 ? 0.9563 1.6262 0.9654 0.4608  0.0695  0.2142  644 PHE A C   
4563 O O   . PHE A 600 ? 1.0121 1.6753 0.9778 0.4961  0.0894  0.2431  644 PHE A O   
4564 C CB  . PHE A 600 ? 0.8984 1.4876 0.9699 0.4117  0.1085  0.2532  644 PHE A CB  
4565 C CG  . PHE A 600 ? 0.9115 1.5325 0.9762 0.4393  0.0919  0.2440  644 PHE A CG  
4566 C CD1 . PHE A 600 ? 0.8720 1.5309 0.9676 0.4178  0.0613  0.2030  644 PHE A CD1 
4567 C CD2 . PHE A 600 ? 0.9681 1.5832 0.9984 0.4878  0.1080  0.2780  644 PHE A CD2 
4568 C CE1 . PHE A 600 ? 0.8853 1.5800 0.9803 0.4435  0.0457  0.1938  644 PHE A CE1 
4569 C CE2 . PHE A 600 ? 0.9834 1.6311 1.0083 0.5157  0.0916  0.2690  644 PHE A CE2 
4570 C CZ  . PHE A 600 ? 0.9402 1.6302 0.9986 0.4932  0.0596  0.2255  644 PHE A CZ  
4571 N N   . GLY A 601 ? 0.8605 1.5802 0.8731 0.4708  0.0347  0.1777  645 GLY A N   
4572 C CA  . GLY A 601 ? 0.9136 1.6827 0.8757 0.5265  0.0147  0.1671  645 GLY A CA  
4573 C C   . GLY A 601 ? 0.9300 1.7211 0.8643 0.5373  -0.0016 0.1415  645 GLY A C   
4574 O O   . GLY A 601 ? 0.9886 1.8103 0.8655 0.5920  -0.0084 0.1435  645 GLY A O   
4575 N N   . TYR A 602 ? 0.9046 1.6801 0.8768 0.4889  -0.0081 0.1174  646 TYR A N   
4576 C CA  . TYR A 602 ? 0.9400 1.7335 0.8956 0.4930  -0.0277 0.0847  646 TYR A CA  
4577 C C   . TYR A 602 ? 0.8926 1.6976 0.9076 0.4434  -0.0589 0.0360  646 TYR A C   
4578 O O   . TYR A 602 ? 0.8308 1.6195 0.8983 0.4000  -0.0549 0.0373  646 TYR A O   
4579 C CB  . TYR A 602 ? 0.9762 1.7288 0.9124 0.4895  0.0060  0.1156  646 TYR A CB  
4580 C CG  . TYR A 602 ? 1.0380 1.7922 0.9073 0.5485  0.0325  0.1564  646 TYR A CG  
4581 C CD1 . TYR A 602 ? 1.0383 1.7733 0.8959 0.5688  0.0622  0.2050  646 TYR A CD1 
4582 C CD2 . TYR A 602 ? 1.0968 1.8707 0.9148 0.5859  0.0293  0.1478  646 TYR A CD2 
4583 C CE1 . TYR A 602 ? 1.0928 1.8283 0.8915 0.6239  0.0900  0.2477  646 TYR A CE1 
4584 C CE2 . TYR A 602 ? 1.1499 1.9284 0.9044 0.6431  0.0568  0.1891  646 TYR A CE2 
4585 C CZ  . TYR A 602 ? 1.1465 1.9057 0.8926 0.6615  0.0883  0.2413  646 TYR A CZ  
4586 O OH  . TYR A 602 ? 1.1976 1.9602 0.8821 0.7198  0.1197  0.2881  646 TYR A OH  
4587 N N   . TYR A 603 ? 1.0227 1.8542 1.0301 0.4508  -0.0887 -0.0064 647 TYR A N   
4588 C CA  . TYR A 603 ? 0.9822 1.8244 1.0508 0.4056  -0.1188 -0.0526 647 TYR A CA  
4589 C C   . TYR A 603 ? 1.0294 1.8759 1.0861 0.4101  -0.1396 -0.0896 647 TYR A C   
4590 O O   . TYR A 603 ? 1.0941 1.9483 1.0889 0.4561  -0.1370 -0.0865 647 TYR A O   
4591 C CB  . TYR A 603 ? 0.9431 1.8368 1.0425 0.4098  -0.1521 -0.0834 647 TYR A CB  
4592 C CG  . TYR A 603 ? 0.9838 1.9323 1.0489 0.4579  -0.1904 -0.1228 647 TYR A CG  
4593 C CD1 . TYR A 603 ? 1.0348 1.9996 1.0234 0.5213  -0.1835 -0.1025 647 TYR A CD1 
4594 C CD2 . TYR A 603 ? 0.9680 1.9532 1.0792 0.4414  -0.2338 -0.1803 647 TYR A CD2 
4595 C CE1 . TYR A 603 ? 1.0671 2.0859 1.0182 0.5705  -0.2203 -0.1395 647 TYR A CE1 
4596 C CE2 . TYR A 603 ? 1.0003 2.0384 1.0813 0.4871  -0.2732 -0.2218 647 TYR A CE2 
4597 C CZ  . TYR A 603 ? 1.0491 2.1053 1.0460 0.5535  -0.2671 -0.2020 647 TYR A CZ  
4598 O OH  . TYR A 603 ? 1.0785 2.1911 1.0378 0.6050  -0.3080 -0.2441 647 TYR A OH  
4599 N N   . ARG A 604 ? 1.0144 1.8569 1.1299 0.3652  -0.1601 -0.1251 648 ARG A N   
4600 C CA  . ARG A 604 ? 1.0563 1.8958 1.1684 0.3655  -0.1808 -0.1636 648 ARG A CA  
4601 C C   . ARG A 604 ? 1.0447 1.9285 1.1930 0.3644  -0.2304 -0.2245 648 ARG A C   
4602 O O   . ARG A 604 ? 0.9953 1.8745 1.2154 0.3168  -0.2446 -0.2479 648 ARG A O   
4603 C CB  . ARG A 604 ? 1.0342 1.8241 1.1871 0.3147  -0.1626 -0.1546 648 ARG A CB  
4604 C CG  . ARG A 604 ? 1.0459 1.7947 1.1674 0.3163  -0.1190 -0.1034 648 ARG A CG  
4605 C CD  . ARG A 604 ? 1.0180 1.7243 1.1836 0.2668  -0.1056 -0.0977 648 ARG A CD  
4606 N NE  . ARG A 604 ? 1.0593 1.7364 1.1906 0.2787  -0.0787 -0.0724 648 ARG A NE  
4607 C CZ  . ARG A 604 ? 1.0286 1.6752 1.1630 0.2633  -0.0435 -0.0281 648 ARG A CZ  
4608 N NH1 . ARG A 604 ? 0.9605 1.5983 1.1252 0.2371  -0.0319 -0.0061 648 ARG A NH1 
4609 N NH2 . ARG A 604 ? 1.0627 1.6895 1.1723 0.2750  -0.0207 -0.0078 648 ARG A NH2 
4610 N N   . PRO A 605 ? 1.9073 2.8356 2.0073 0.4184  -0.2569 -0.2502 649 PRO A N   
4611 C CA  . PRO A 605 ? 1.8892 2.8697 2.0247 0.4231  -0.3078 -0.3095 649 PRO A CA  
4612 C C   . PRO A 605 ? 1.8884 2.8592 2.0793 0.3892  -0.3386 -0.3639 649 PRO A C   
4613 O O   . PRO A 605 ? 1.8350 2.8260 2.1046 0.3525  -0.3634 -0.3938 649 PRO A O   
4614 C CB  . PRO A 605 ? 1.9460 2.9684 1.9974 0.4976  -0.3251 -0.3215 649 PRO A CB  
4615 C CG  . PRO A 605 ? 2.0013 2.9846 1.9805 0.5246  -0.2874 -0.2827 649 PRO A CG  
4616 C CD  . PRO A 605 ? 1.9750 2.9073 1.9833 0.4800  -0.2406 -0.2263 649 PRO A CD  
4617 N N   . GLU A 606 ? 1.7756 2.7164 1.9305 0.4015  -0.3361 -0.3754 650 GLU A N   
4618 C CA  . GLU A 606 ? 1.7771 2.7021 1.9818 0.3731  -0.3648 -0.4273 650 GLU A CA  
4619 C C   . GLU A 606 ? 1.7595 2.6202 1.9935 0.3248  -0.3272 -0.3917 650 GLU A C   
4620 O O   . GLU A 606 ? 1.7368 2.5786 1.9639 0.3112  -0.2884 -0.3365 650 GLU A O   
4621 C CB  . GLU A 606 ? 1.8543 2.7990 1.9951 0.4294  -0.3955 -0.4739 650 GLU A CB  
4622 C CG  . GLU A 606 ? 1.9055 2.8149 2.0627 0.4163  -0.4105 -0.5141 650 GLU A CG  
4623 C CD  . GLU A 606 ? 1.9492 2.8131 2.0480 0.4299  -0.3682 -0.4725 650 GLU A CD  
4624 O OE1 . GLU A 606 ? 1.9704 2.8457 1.9963 0.4713  -0.3398 -0.4290 650 GLU A OE1 
4625 O OE2 . GLU A 606 ? 1.9622 2.7806 2.0902 0.4006  -0.3623 -0.4812 650 GLU A OE2 
4626 N N   . ASN A 607 ? 1.8024 2.6299 2.0755 0.2967  -0.3387 -0.4219 651 ASN A N   
4627 C CA  . ASN A 607 ? 1.7755 2.5459 2.0775 0.2527  -0.3037 -0.3858 651 ASN A CA  
4628 C C   . ASN A 607 ? 1.8255 2.5724 2.0518 0.2819  -0.2637 -0.3377 651 ASN A C   
4629 O O   . ASN A 607 ? 1.7847 2.5004 2.0228 0.2537  -0.2276 -0.2902 651 ASN A O   
4630 C CB  . ASN A 607 ? 1.7702 2.5070 2.1237 0.2238  -0.3238 -0.4271 651 ASN A CB  
4631 C CG  . ASN A 607 ? 1.7198 2.3972 2.0759 0.1981  -0.2885 -0.3920 651 ASN A CG  
4632 O OD1 . ASN A 607 ? 1.6835 2.3447 2.0132 0.1946  -0.2500 -0.3384 651 ASN A OD1 
4633 N ND2 . ASN A 607 ? 1.7127 2.3577 2.1083 0.1784  -0.3042 -0.4250 651 ASN A ND2 
4634 N N   . ASP A 608 ? 2.2035 2.9719 2.3537 0.3403  -0.2697 -0.3477 652 ASP A N   
4635 C CA  . ASP A 608 ? 2.2595 3.0098 2.3395 0.3734  -0.2324 -0.3057 652 ASP A CA  
4636 C C   . ASP A 608 ? 2.2230 2.9547 2.3072 0.3524  -0.1884 -0.2404 652 ASP A C   
4637 O O   . ASP A 608 ? 2.1768 2.9244 2.2846 0.3379  -0.1865 -0.2240 652 ASP A O   
4638 C CB  . ASP A 608 ? 2.3390 3.1304 2.3361 0.4434  -0.2412 -0.3137 652 ASP A CB  
4639 C CG  . ASP A 608 ? 2.3599 3.1871 2.3445 0.4590  -0.2386 -0.2898 652 ASP A CG  
4640 O OD1 . ASP A 608 ? 2.3417 3.1788 2.3901 0.4208  -0.2545 -0.3009 652 ASP A OD1 
4641 O OD2 . ASP A 608 ? 2.3900 3.2364 2.3043 0.5102  -0.2205 -0.2601 652 ASP A OD2 
4642 N N   . SER A 609 ? 1.6254 2.3228 1.6927 0.3489  -0.1541 -0.2055 653 SER A N   
4643 C CA  . SER A 609 ? 1.5972 2.2755 1.6710 0.3297  -0.1143 -0.1474 653 SER A CA  
4644 C C   . SER A 609 ? 1.6112 2.3141 1.6294 0.3739  -0.0960 -0.1135 653 SER A C   
4645 O O   . SER A 609 ? 1.5738 2.2665 1.6039 0.3590  -0.0707 -0.0721 653 SER A O   
4646 C CB  . SER A 609 ? 1.6096 2.2501 1.6847 0.3159  -0.0844 -0.1208 653 SER A CB  
4647 O OG  . SER A 609 ? 1.6687 2.3146 1.6951 0.3576  -0.0875 -0.1384 653 SER A OG  
4648 N N   . LYS A 610 ? 1.2987 2.0328 1.2553 0.4304  -0.1085 -0.1306 654 LYS A N   
4649 C CA  . LYS A 610 ? 1.3162 2.0705 1.2143 0.4779  -0.0856 -0.0910 654 LYS A CA  
4650 C C   . LYS A 610 ? 1.2742 2.0482 1.1876 0.4742  -0.0913 -0.0790 654 LYS A C   
4651 O O   . LYS A 610 ? 1.2545 2.0584 1.1892 0.4711  -0.1291 -0.1198 654 LYS A O   
4652 C CB  . LYS A 610 ? 1.3785 2.1674 1.2020 0.5446  -0.1009 -0.1149 654 LYS A CB  
4653 C CG  . LYS A 610 ? 1.4248 2.2347 1.1813 0.6005  -0.0735 -0.0693 654 LYS A CG  
4654 C CD  . LYS A 610 ? 1.4811 2.3330 1.1589 0.6715  -0.0946 -0.0991 654 LYS A CD  
4655 C CE  . LYS A 610 ? 1.4832 2.3578 1.1810 0.6661  -0.1531 -0.1782 654 LYS A CE  
4656 N NZ  . LYS A 610 ? 1.5679 2.4983 1.2041 0.7304  -0.1873 -0.2113 654 LYS A NZ  
4657 N N   . CYS A 611 ? 1.0386 1.7949 0.9458 0.4739  -0.0530 -0.0229 655 CYS A N   
4658 C CA  . CYS A 611 ? 0.9980 1.7639 0.9182 0.4716  -0.0503 -0.0031 655 CYS A CA  
4659 C C   . CYS A 611 ? 1.0453 1.8469 0.8965 0.5388  -0.0498 0.0105  655 CYS A C   
4660 O O   . CYS A 611 ? 1.0875 1.8811 0.8891 0.5753  -0.0171 0.0509  655 CYS A O   
4661 C CB  . CYS A 611 ? 0.9544 1.6774 0.9049 0.4379  -0.0098 0.0484  655 CYS A CB  
4662 S SG  . CYS A 611 ? 0.8717 1.5598 0.9074 0.3591  -0.0122 0.0382  655 CYS A SG  
4663 N N   . VAL A 612 ? 1.0407 1.8840 0.8908 0.5563  -0.0849 -0.0209 656 VAL A N   
4664 C CA  . VAL A 612 ? 1.0792 1.9621 0.8630 0.6236  -0.0892 -0.0106 656 VAL A CA  
4665 C C   . VAL A 612 ? 1.0586 1.9498 0.8584 0.6249  -0.0844 0.0139  656 VAL A C   
4666 O O   . VAL A 612 ? 1.0013 1.8842 0.8662 0.5762  -0.0932 0.0030  656 VAL A O   
4667 C CB  . VAL A 612 ? 1.1187 2.0553 0.8758 0.6590  -0.1407 -0.0739 656 VAL A CB  
4668 C CG1 . VAL A 612 ? 1.0824 2.0470 0.9049 0.6252  -0.1826 -0.1201 656 VAL A CG1 
4669 C CG2 . VAL A 612 ? 1.2031 2.1808 0.8716 0.7409  -0.1413 -0.0603 656 VAL A CG2 
4670 N N   . GLU A 613 ? 1.4310 2.3379 1.1696 0.6835  -0.0680 0.0496  657 GLU A N   
4671 C CA  . GLU A 613 ? 1.4015 2.3161 1.1450 0.6965  -0.0616 0.0761  657 GLU A CA  
4672 C C   . GLU A 613 ? 1.3603 2.3260 1.1373 0.6917  -0.1110 0.0244  657 GLU A C   
4673 O O   . GLU A 613 ? 1.3782 2.3924 1.1353 0.7184  -0.1516 -0.0242 657 GLU A O   
4674 C CB  . GLU A 613 ? 1.4502 2.3767 1.1132 0.7700  -0.0377 0.1214  657 GLU A CB  
4675 C CG  . GLU A 613 ? 1.4334 2.3363 1.0993 0.7798  -0.0061 0.1756  657 GLU A CG  
4676 C CD  . GLU A 613 ? 1.4969 2.4000 1.0850 0.8498  0.0278  0.2309  657 GLU A CD  
4677 O OE1 . GLU A 613 ? 1.5445 2.4581 1.0790 0.8816  0.0349  0.2297  657 GLU A OE1 
4678 O OE2 . GLU A 613 ? 1.5142 2.3975 1.0955 0.8645  0.0527  0.2701  657 GLU A OE2 
4679 N N   . GLN A 614 ? 1.3619 2.3193 1.1929 0.6582  -0.1083 0.0325  658 GLN A N   
4680 C CA  . GLN A 614 ? 1.3163 2.3261 1.1884 0.6516  -0.1514 -0.0127 658 GLN A CA  
4681 C C   . GLN A 614 ? 1.3560 2.4209 1.1762 0.7205  -0.1708 -0.0140 658 GLN A C   
4682 O O   . GLN A 614 ? 1.3970 2.4393 1.1646 0.7578  -0.1372 0.0353  658 GLN A O   
4683 C CB  . GLN A 614 ? 1.2486 2.2366 1.1931 0.5978  -0.1405 -0.0030 658 GLN A CB  
4684 C CG  . GLN A 614 ? 1.2031 2.1789 1.2153 0.5325  -0.1543 -0.0387 658 GLN A CG  
4685 C CD  . GLN A 614 ? 1.1430 2.0917 1.2217 0.4771  -0.1385 -0.0269 658 GLN A CD  
4686 O OE1 . GLN A 614 ? 1.1344 2.0419 1.2070 0.4725  -0.1034 0.0167  658 GLN A OE1 
4687 N NE2 . GLN A 614 ? 1.0988 2.0673 1.2432 0.4333  -0.1633 -0.0662 658 GLN A NE2 
4688 N N   . PRO A 615 ? 1.5003 2.6099 1.3339 0.7197  -0.2148 -0.0742 659 PRO A N   
4689 C CA  . PRO A 615 ? 1.5672 2.7106 1.3542 0.7653  -0.2309 -0.0927 659 PRO A CA  
4690 C C   . PRO A 615 ? 1.5742 2.7095 1.3549 0.7807  -0.2068 -0.0497 659 PRO A C   
4691 O O   . PRO A 615 ? 1.6469 2.7901 1.3629 0.8326  -0.1966 -0.0334 659 PRO A O   
4692 C CB  . PRO A 615 ? 1.5489 2.7349 1.3969 0.7350  -0.2810 -0.1635 659 PRO A CB  
4693 C CG  . PRO A 615 ? 1.5017 2.6730 1.3941 0.6915  -0.2916 -0.1870 659 PRO A CG  
4694 C CD  . PRO A 615 ? 1.4491 2.5781 1.3564 0.6693  -0.2512 -0.1300 659 PRO A CD  
4695 N N   . GLU A 616 ? 1.8293 2.9519 1.6791 0.7366  -0.1996 -0.0367 660 GLU A N   
4696 C CA  . GLU A 616 ? 1.8171 2.9001 1.6648 0.7403  -0.1590 0.0231  660 GLU A CA  
4697 C C   . GLU A 616 ? 1.7442 2.8283 1.6781 0.6892  -0.1624 0.0169  660 GLU A C   
4698 O O   . GLU A 616 ? 1.7086 2.8281 1.7011 0.6542  -0.1946 -0.0302 660 GLU A O   
4699 C CB  . GLU A 616 ? 1.8923 2.9777 1.6785 0.7945  -0.1448 0.0498  660 GLU A CB  
4700 C CG  . GLU A 616 ? 1.9172 2.9441 1.6618 0.8173  -0.0924 0.1205  660 GLU A CG  
4701 C CD  . GLU A 616 ? 1.9605 2.9674 1.6425 0.8455  -0.0706 0.1426  660 GLU A CD  
4702 O OE1 . GLU A 616 ? 1.9971 3.0396 1.6438 0.8667  -0.0952 0.1045  660 GLU A OE1 
4703 O OE2 . GLU A 616 ? 1.9576 2.9125 1.6314 0.8444  -0.0279 0.1967  660 GLU A OE2 
4704 N N   . LEU A 617 ? 1.0145 2.0573 0.9564 0.6858  -0.1264 0.0654  661 LEU A N   
4705 C CA  . LEU A 617 ? 0.9446 1.9696 0.9586 0.6347  -0.1167 0.0674  661 LEU A CA  
4706 C C   . LEU A 617 ? 0.9216 1.9927 0.9897 0.6221  -0.1393 0.0404  661 LEU A C   
4707 O O   . LEU A 617 ? 0.9671 2.0508 1.0101 0.6545  -0.1410 0.0468  661 LEU A O   
4708 C CB  . LEU A 617 ? 0.9522 1.9054 0.9478 0.6357  -0.0688 0.1238  661 LEU A CB  
4709 C CG  . LEU A 617 ? 0.9773 1.8824 0.9271 0.6426  -0.0415 0.1536  661 LEU A CG  
4710 C CD1 . LEU A 617 ? 1.0100 1.8547 0.9340 0.6622  0.0033  0.2130  661 LEU A CD1 
4711 C CD2 . LEU A 617 ? 0.9201 1.7948 0.9093 0.5800  -0.0385 0.1350  661 LEU A CD2 
4712 N N   . LYS A 618 ? 1.2500 2.3300 1.3891 0.5666  -0.1488 0.0139  662 LYS A N   
4713 C CA  . LYS A 618 ? 1.2205 2.3446 1.4237 0.5436  -0.1674 -0.0130 662 LYS A CA  
4714 C C   . LYS A 618 ? 1.1676 2.2509 1.4145 0.5001  -0.1378 0.0071  662 LYS A C   
4715 O O   . LYS A 618 ? 1.1606 2.1764 1.3888 0.4791  -0.1083 0.0328  662 LYS A O   
4716 C CB  . LYS A 618 ? 1.2061 2.3724 1.4544 0.5118  -0.2047 -0.0668 662 LYS A CB  
4717 C CG  . LYS A 618 ? 1.1793 2.3849 1.5033 0.4774  -0.2211 -0.0950 662 LYS A CG  
4718 C CD  . LYS A 618 ? 1.2038 2.4529 1.5547 0.4682  -0.2618 -0.1467 662 LYS A CD  
4719 C CE  . LYS A 618 ? 1.1580 2.4296 1.6046 0.4114  -0.2711 -0.1714 662 LYS A CE  
4720 N NZ  . LYS A 618 ? 1.0953 2.3329 1.5778 0.3657  -0.2482 -0.1567 662 LYS A NZ  
4721 N N   . GLY A 619 ? 0.8118 1.9324 1.1119 0.4884  -0.1437 -0.0036 663 GLY A N   
4722 C CA  . GLY A 619 ? 0.7503 1.8396 1.0952 0.4418  -0.1205 0.0050  663 GLY A CA  
4723 C C   . GLY A 619 ? 0.7724 1.7810 1.0825 0.4392  -0.0813 0.0451  663 GLY A C   
4724 O O   . GLY A 619 ? 0.8245 1.8115 1.0913 0.4811  -0.0672 0.0729  663 GLY A O   
4725 N N   . HIS A 620 ? 0.9834 1.9465 1.3137 0.3909  -0.0642 0.0481  664 HIS A N   
4726 C CA  . HIS A 620 ? 1.0101 1.8992 1.3171 0.3841  -0.0304 0.0804  664 HIS A CA  
4727 C C   . HIS A 620 ? 1.0661 1.9082 1.3205 0.4012  -0.0180 0.1034  664 HIS A C   
4728 O O   . HIS A 620 ? 1.1062 1.8875 1.3398 0.4032  0.0096  0.1332  664 HIS A O   
4729 C CB  . HIS A 620 ? 0.9621 1.8249 1.3079 0.3306  -0.0184 0.0745  664 HIS A CB  
4730 C CG  . HIS A 620 ? 0.9370 1.7894 1.2930 0.2940  -0.0252 0.0612  664 HIS A CG  
4731 N ND1 . HIS A 620 ? 0.9682 1.7631 1.2952 0.2834  -0.0092 0.0781  664 HIS A ND1 
4732 C CD2 . HIS A 620 ? 0.8856 1.7764 1.2822 0.2653  -0.0452 0.0331  664 HIS A CD2 
4733 C CE1 . HIS A 620 ? 0.9368 1.7360 1.2811 0.2529  -0.0198 0.0606  664 HIS A CE1 
4734 N NE2 . HIS A 620 ? 0.8899 1.7437 1.2762 0.2409  -0.0416 0.0333  664 HIS A NE2 
4735 N N   . ASP A 621 ? 0.8672 1.7390 1.1018 0.4156  -0.0380 0.0891  665 ASP A N   
4736 C CA  . ASP A 621 ? 0.9186 1.7565 1.0980 0.4425  -0.0247 0.1137  665 ASP A CA  
4737 C C   . ASP A 621 ? 0.9732 1.8082 1.1112 0.4982  -0.0134 0.1438  665 ASP A C   
4738 O O   . ASP A 621 ? 1.0169 1.8001 1.1198 0.5158  0.0148  0.1815  665 ASP A O   
4739 C CB  . ASP A 621 ? 0.9261 1.8006 1.0885 0.4515  -0.0504 0.0880  665 ASP A CB  
4740 C CG  . ASP A 621 ? 0.8917 1.7431 1.0782 0.4026  -0.0505 0.0723  665 ASP A CG  
4741 O OD1 . ASP A 621 ? 0.8960 1.6914 1.0663 0.3892  -0.0238 0.0981  665 ASP A OD1 
4742 O OD2 . ASP A 621 ? 0.8630 1.7524 1.0884 0.3779  -0.0772 0.0348  665 ASP A OD2 
4743 N N   . LEU A 622 ? 0.8036 1.6960 0.9502 0.5263  -0.0351 0.1282  666 LEU A N   
4744 C CA  . LEU A 622 ? 0.8588 1.7552 0.9681 0.5833  -0.0272 0.1554  666 LEU A CA  
4745 C C   . LEU A 622 ? 0.8585 1.7013 0.9814 0.5770  0.0025  0.1829  666 LEU A C   
4746 O O   . LEU A 622 ? 0.9077 1.7120 0.9957 0.6133  0.0253  0.2203  666 LEU A O   
4747 C CB  . LEU A 622 ? 0.8715 1.8520 0.9903 0.6154  -0.0628 0.1266  666 LEU A CB  
4748 C CG  . LEU A 622 ? 0.9426 1.9238 1.0115 0.6720  -0.0578 0.1495  666 LEU A CG  
4749 C CD1 . LEU A 622 ? 1.0039 1.9568 1.0009 0.7105  -0.0440 0.1784  666 LEU A CD1 
4750 C CD2 . LEU A 622 ? 0.9578 2.0053 1.0384 0.6790  -0.0932 0.1096  666 LEU A CD2 
4751 N N   . GLU A 623 ? 0.8405 1.6786 1.0136 0.5323  0.0032  0.1649  667 GLU A N   
4752 C CA  . GLU A 623 ? 0.8674 1.6537 1.0516 0.5274  0.0290  0.1852  667 GLU A CA  
4753 C C   . GLU A 623 ? 0.9243 1.6296 1.0876 0.5158  0.0593  0.2168  667 GLU A C   
4754 O O   . GLU A 623 ? 0.9971 1.6554 1.1404 0.5434  0.0822  0.2493  667 GLU A O   
4755 C CB  . GLU A 623 ? 0.8056 1.6028 1.0426 0.4826  0.0255  0.1598  667 GLU A CB  
4756 C CG  . GLU A 623 ? 0.7563 1.6276 1.0269 0.4922  0.0041  0.1349  667 GLU A CG  
4757 C CD  . GLU A 623 ? 0.6927 1.5741 1.0144 0.4449  0.0054  0.1141  667 GLU A CD  
4758 O OE1 . GLU A 623 ? 0.6661 1.5081 0.9952 0.4028  0.0148  0.1126  667 GLU A OE1 
4759 O OE2 . GLU A 623 ? 0.6847 1.6153 1.0384 0.4526  -0.0016 0.1013  667 GLU A OE2 
4760 N N   . PHE A 624 ? 1.2501 1.9397 1.4229 0.4749  0.0595  0.2073  668 PHE A N   
4761 C CA  . PHE A 624 ? 1.2972 1.9175 1.4591 0.4591  0.0864  0.2345  668 PHE A CA  
4762 C C   . PHE A 624 ? 1.3608 1.9611 1.4767 0.5072  0.1036  0.2730  668 PHE A C   
4763 O O   . PHE A 624 ? 1.4294 1.9702 1.5421 0.5150  0.1315  0.3058  668 PHE A O   
4764 C CB  . PHE A 624 ? 1.2472 1.8685 1.4204 0.4178  0.0799  0.2179  668 PHE A CB  
4765 C CG  . PHE A 624 ? 1.2898 1.8452 1.4629 0.3963  0.1068  0.2430  668 PHE A CG  
4766 C CD1 . PHE A 624 ? 1.3597 1.8562 1.5403 0.3982  0.1319  0.2688  668 PHE A CD1 
4767 C CD2 . PHE A 624 ? 1.2595 1.8123 1.4297 0.3744  0.1062  0.2393  668 PHE A CD2 
4768 C CE1 . PHE A 624 ? 1.3900 1.8296 1.5805 0.3764  0.1551  0.2901  668 PHE A CE1 
4769 C CE2 . PHE A 624 ? 1.2950 1.7932 1.4716 0.3545  0.1309  0.2625  668 PHE A CE2 
4770 C CZ  . PHE A 624 ? 1.3602 1.8035 1.5497 0.3544  0.1548  0.2876  668 PHE A CZ  
4771 N N   . CYS A 625 ? 1.0746 1.7244 1.1558 0.5415  0.0871  0.2693  669 CYS A N   
4772 C CA  . CYS A 625 ? 1.1309 1.7686 1.1610 0.5953  0.1045  0.3090  669 CYS A CA  
4773 C C   . CYS A 625 ? 1.1978 1.8137 1.2182 0.6354  0.1200  0.3381  669 CYS A C   
4774 O O   . CYS A 625 ? 1.2644 1.8299 1.2627 0.6607  0.1510  0.3831  669 CYS A O   
4775 C CB  . CYS A 625 ? 1.1118 1.8174 1.1021 0.6326  0.0777  0.2927  669 CYS A CB  
4776 S SG  . CYS A 625 ? 1.1683 1.8550 1.0885 0.6899  0.1046  0.3435  669 CYS A SG  
4777 N N   . LEU A 626 ? 1.2965 1.9490 1.3364 0.6424  0.1005  0.3148  670 LEU A N   
4778 C CA  . LEU A 626 ? 1.3650 1.9982 1.3928 0.6858  0.1144  0.3420  670 LEU A CA  
4779 C C   . LEU A 626 ? 1.4266 1.9719 1.4790 0.6627  0.1476  0.3668  670 LEU A C   
4780 O O   . LEU A 626 ? 1.4984 1.9914 1.5303 0.6923  0.1763  0.4108  670 LEU A O   
4781 C CB  . LEU A 626 ? 1.3261 2.0234 1.3735 0.6995  0.0862  0.3102  670 LEU A CB  
4782 C CG  . LEU A 626 ? 1.2895 2.0720 1.3127 0.7292  0.0516  0.2858  670 LEU A CG  
4783 C CD1 . LEU A 626 ? 1.2535 2.0913 1.3068 0.7253  0.0258  0.2503  670 LEU A CD1 
4784 C CD2 . LEU A 626 ? 1.3613 2.1298 1.3149 0.7778  0.0624  0.3160  670 LEU A CD2 
4785 N N   . TYR A 627 ? 1.7921 2.3212 1.8893 0.6112  0.1439  0.3389  671 TYR A N   
4786 C CA  . TYR A 627 ? 1.8210 2.2721 1.9450 0.5898  0.1687  0.3522  671 TYR A CA  
4787 C C   . TYR A 627 ? 1.8101 2.2085 1.9527 0.5436  0.1851  0.3589  671 TYR A C   
4788 O O   . TYR A 627 ? 1.8070 2.1430 1.9779 0.5201  0.2015  0.3633  671 TYR A O   
4789 C CB  . TYR A 627 ? 1.7740 2.2397 1.9317 0.5704  0.1554  0.3178  671 TYR A CB  
4790 C CG  . TYR A 627 ? 1.7551 2.2952 1.9045 0.6067  0.1329  0.3021  671 TYR A CG  
4791 C CD1 . TYR A 627 ? 1.8002 2.3332 1.9353 0.6569  0.1402  0.3211  671 TYR A CD1 
4792 C CD2 . TYR A 627 ? 1.6793 2.2976 1.8396 0.5915  0.1039  0.2684  671 TYR A CD2 
4793 C CE1 . TYR A 627 ? 1.7785 2.3861 1.9096 0.6919  0.1182  0.3062  671 TYR A CE1 
4794 C CE2 . TYR A 627 ? 1.6442 2.3360 1.8057 0.6233  0.0815  0.2524  671 TYR A CE2 
4795 C CZ  . TYR A 627 ? 1.6959 2.3850 1.8422 0.6742  0.0882  0.2712  671 TYR A CZ  
4796 O OH  . TYR A 627 ? 1.6604 2.4274 1.8111 0.7071  0.0648  0.2546  671 TYR A OH  
4797 N N   . GLY A 628 ? 1.5619 1.9872 1.6907 0.5315  0.1789  0.3567  672 GLY A N   
4798 C CA  . GLY A 628 ? 1.5420 1.9304 1.6918 0.4861  0.1903  0.3580  672 GLY A CA  
4799 C C   . GLY A 628 ? 1.5767 1.8923 1.7339 0.4864  0.2250  0.3997  672 GLY A C   
4800 O O   . GLY A 628 ? 1.6242 1.9188 1.7576 0.5291  0.2457  0.4394  672 GLY A O   
4801 N N   . ARG A 629 ? 2.1407 2.4190 2.3348 0.4382  0.2318  0.3913  673 ARG A N   
4802 C CA  . ARG A 629 ? 2.1530 2.3665 2.3677 0.4299  0.2633  0.4275  673 ARG A CA  
4803 C C   . ARG A 629 ? 2.1697 2.3988 2.3530 0.4533  0.2795  0.4619  673 ARG A C   
4804 O O   . ARG A 629 ? 2.1464 2.4257 2.3092 0.4481  0.2629  0.4441  673 ARG A O   
4805 C CB  . ARG A 629 ? 2.1054 2.2880 2.3673 0.3736  0.2618  0.4061  673 ARG A CB  
4806 C CG  . ARG A 629 ? 2.1135 2.2229 2.4122 0.3650  0.2912  0.4368  673 ARG A CG  
4807 C CD  . ARG A 629 ? 2.0474 2.1333 2.3923 0.3129  0.2901  0.4202  673 ARG A CD  
4808 N NE  . ARG A 629 ? 2.0115 2.0480 2.3964 0.2922  0.2871  0.4003  673 ARG A NE  
4809 C CZ  . ARG A 629 ? 1.9242 1.9649 2.3315 0.2550  0.2658  0.3585  673 ARG A CZ  
4810 N NH1 . ARG A 629 ? 1.8715 1.9596 2.2702 0.2312  0.2480  0.3358  673 ARG A NH1 
4811 N NH2 . ARG A 629 ? 1.8876 1.8823 2.3259 0.2436  0.2630  0.3400  673 ARG A NH2 
4812 N N   . GLU A 630 ? 1.9060 2.0921 2.0854 0.4814  0.3129  0.5118  674 GLU A N   
4813 C CA  . GLU A 630 ? 1.9312 2.1416 2.0660 0.5206  0.3295  0.5490  674 GLU A CA  
4814 C C   . GLU A 630 ? 1.8863 2.0943 2.0340 0.4947  0.3449  0.5615  674 GLU A C   
4815 O O   . GLU A 630 ? 1.8624 2.1110 1.9658 0.5229  0.3470  0.5740  674 GLU A O   
4816 C CB  . GLU A 630 ? 1.9894 2.1611 2.1072 0.5704  0.3627  0.6050  674 GLU A CB  
4817 C CG  . GLU A 630 ? 1.9912 2.0815 2.1629 0.5537  0.3869  0.6253  674 GLU A CG  
4818 C CD  . GLU A 630 ? 1.9747 2.0556 2.1587 0.5521  0.3645  0.5909  674 GLU A CD  
4819 O OE1 . GLU A 630 ? 1.9235 2.0530 2.1014 0.5345  0.3293  0.5409  674 GLU A OE1 
4820 O OE2 . GLU A 630 ? 2.0064 2.0311 2.2071 0.5704  0.3836  0.6155  674 GLU A OE2 
4821 N N   . GLU A 631 ? 2.8101 2.9756 3.0162 0.4443  0.3538  0.5559  675 GLU A N   
4822 C CA  . GLU A 631 ? 2.7728 2.9408 2.9944 0.4218  0.3691  0.5691  675 GLU A CA  
4823 C C   . GLU A 631 ? 2.7352 2.9675 2.9250 0.4143  0.3391  0.5309  675 GLU A C   
4824 O O   . GLU A 631 ? 2.7096 2.9641 2.8791 0.4246  0.3505  0.5469  675 GLU A O   
4825 C CB  . GLU A 631 ? 2.7184 2.8353 3.0143 0.3673  0.3786  0.5639  675 GLU A CB  
4826 C CG  . GLU A 631 ? 2.6501 2.7827 2.9689 0.3340  0.3819  0.5595  675 GLU A CG  
4827 C CD  . GLU A 631 ? 2.5411 2.7010 2.8712 0.2928  0.3448  0.5030  675 GLU A CD  
4828 O OE1 . GLU A 631 ? 2.4963 2.6295 2.8633 0.2623  0.3306  0.4756  675 GLU A OE1 
4829 O OE2 . GLU A 631 ? 2.5022 2.7088 2.8038 0.2928  0.3304  0.4862  675 GLU A OE2 
4830 N N   . HIS A 632 ? 2.1301 2.3921 2.3160 0.3993  0.3024  0.4820  676 HIS A N   
4831 C CA  . HIS A 632 ? 2.0701 2.3877 2.2354 0.3882  0.2727  0.4433  676 HIS A CA  
4832 C C   . HIS A 632 ? 2.0619 2.4340 2.1664 0.4373  0.2586  0.4406  676 HIS A C   
4833 O O   . HIS A 632 ? 2.0054 2.4223 2.0930 0.4322  0.2337  0.4084  676 HIS A O   
4834 C CB  . HIS A 632 ? 2.0454 2.3751 2.2367 0.3511  0.2410  0.3942  676 HIS A CB  
4835 C CG  . HIS A 632 ? 2.0690 2.3483 2.3121 0.3128  0.2482  0.3899  676 HIS A CG  
4836 N ND1 . HIS A 632 ? 2.0704 2.3393 2.3270 0.3079  0.2361  0.3701  676 HIS A ND1 
4837 C CD2 . HIS A 632 ? 2.0734 2.3136 2.3584 0.2793  0.2644  0.4001  676 HIS A CD2 
4838 C CE1 . HIS A 632 ? 2.0727 2.2948 2.3737 0.2743  0.2436  0.3663  676 HIS A CE1 
4839 N NE2 . HIS A 632 ? 2.0731 2.2784 2.3941 0.2555  0.2592  0.3834  676 HIS A NE2 
4840 N N   . LEU A 633 ? 1.9742 2.3427 2.0473 0.4859  0.2721  0.4718  677 LEU A N   
4841 C CA  . LEU A 633 ? 1.9598 2.3850 1.9758 0.5357  0.2521  0.4629  677 LEU A CA  
4842 C C   . LEU A 633 ? 1.9353 2.3919 1.9059 0.5640  0.2579  0.4748  677 LEU A C   
4843 O O   . LEU A 633 ? 1.9006 2.4127 1.8387 0.5798  0.2270  0.4407  677 LEU A O   
4844 C CB  . LEU A 633 ? 2.0065 2.4193 1.9996 0.5838  0.2652  0.4951  677 LEU A CB  
4845 C CG  . LEU A 633 ? 2.0020 2.4007 2.0315 0.5625  0.2494  0.4698  677 LEU A CG  
4846 C CD1 . LEU A 633 ? 2.0872 2.4759 2.0939 0.6130  0.2597  0.4984  677 LEU A CD1 
4847 C CD2 . LEU A 633 ? 1.9014 2.3574 1.9375 0.5410  0.2065  0.4120  677 LEU A CD2 
4848 N N   . THR A 634 ? 1.9573 2.3798 1.9285 0.5709  0.2974  0.5219  678 THR A N   
4849 C CA  . THR A 634 ? 1.9295 2.3803 1.8612 0.5941  0.3064  0.5330  678 THR A CA  
4850 C C   . THR A 634 ? 1.8752 2.3366 1.8378 0.5433  0.2865  0.4911  678 THR A C   
4851 O O   . THR A 634 ? 1.8656 2.2895 1.8862 0.4919  0.2943  0.4880  678 THR A O   
4852 C CB  . THR A 634 ? 1.9526 2.3668 1.8843 0.6129  0.3586  0.5985  678 THR A CB  
4853 O OG1 . THR A 634 ? 1.9357 2.3059 1.9368 0.5552  0.3762  0.6035  678 THR A OG1 
4854 C CG2 . THR A 634 ? 2.0157 2.4005 1.9345 0.6533  0.3848  0.6467  678 THR A CG2 
4855 N N   . THR A 635 ? 1.3692 1.8812 1.2935 0.5593  0.2593  0.4573  679 THR A N   
4856 C CA  . THR A 635 ? 1.3210 1.8417 1.2724 0.5150  0.2403  0.4183  679 THR A CA  
4857 C C   . THR A 635 ? 1.3039 1.8450 1.2190 0.5385  0.2515  0.4268  679 THR A C   
4858 O O   . THR A 635 ? 1.3275 1.8917 1.1838 0.5956  0.2638  0.4510  679 THR A O   
4859 C CB  . THR A 635 ? 1.2993 1.8581 1.2537 0.5005  0.1926  0.3593  679 THR A CB  
4860 O OG1 . THR A 635 ? 1.3133 1.9236 1.2084 0.5517  0.1715  0.3430  679 THR A OG1 
4861 C CG2 . THR A 635 ? 1.3122 1.8591 1.2967 0.4854  0.1824  0.3518  679 THR A CG2 
4862 N N   . ASN A 636 ? 1.6012 2.1349 1.5499 0.4964  0.2473  0.4064  680 ASN A N   
4863 C CA  . ASN A 636 ? 1.5816 2.1340 1.5027 0.5130  0.2558  0.4080  680 ASN A CA  
4864 C C   . ASN A 636 ? 1.5765 2.1715 1.4704 0.5195  0.2110  0.3497  680 ASN A C   
4865 O O   . ASN A 636 ? 1.5669 2.1808 1.4360 0.5326  0.2076  0.3357  680 ASN A O   
4866 C CB  . ASN A 636 ? 1.5464 2.0661 1.5240 0.4654  0.2773  0.4205  680 ASN A CB  
4867 C CG  . ASN A 636 ? 1.5564 2.0290 1.5865 0.4383  0.3050  0.4571  680 ASN A CG  
4868 O OD1 . ASN A 636 ? 1.5610 2.0133 1.6328 0.3991  0.2880  0.4358  680 ASN A OD1 
4869 N ND2 . ASN A 636 ? 1.5652 2.0204 1.5936 0.4617  0.3482  0.5126  680 ASN A ND2 
4870 N N   . GLY A 637 ? 1.0819 1.6909 0.9865 0.5085  0.1769  0.3147  681 GLY A N   
4871 C CA  . GLY A 637 ? 1.0805 1.7275 0.9775 0.5057  0.1315  0.2562  681 GLY A CA  
4872 C C   . GLY A 637 ? 1.0415 1.6718 0.9912 0.4475  0.1185  0.2256  681 GLY A C   
4873 O O   . GLY A 637 ? 1.0368 1.6869 1.0037 0.4280  0.0826  0.1785  681 GLY A O   
4874 N N   . TYR A 638 ? 0.6669 1.3164 0.9256 0.3180  0.2031  0.2539  682 TYR A N   
4875 C CA  . TYR A 638 ? 0.6539 1.2812 0.9209 0.2986  0.1943  0.2374  682 TYR A CA  
4876 C C   . TYR A 638 ? 0.6231 1.2287 0.9601 0.2524  0.1973  0.2707  682 TYR A C   
4877 O O   . TYR A 638 ? 0.6241 1.2618 1.0117 0.2555  0.2162  0.3305  682 TYR A O   
4878 C CB  . TYR A 638 ? 0.6856 1.3615 0.9252 0.3489  0.2097  0.2538  682 TYR A CB  
4879 C CG  . TYR A 638 ? 0.7260 1.4101 0.8880 0.3984  0.1958  0.2090  682 TYR A CG  
4880 C CD1 . TYR A 638 ? 0.7254 1.3674 0.8581 0.3868  0.1653  0.1511  682 TYR A CD1 
4881 C CD2 . TYR A 638 ? 0.7711 1.5060 0.8902 0.4618  0.2109  0.2274  682 TYR A CD2 
4882 C CE1 . TYR A 638 ? 0.7704 1.4143 0.8357 0.4346  0.1440  0.1093  682 TYR A CE1 
4883 C CE2 . TYR A 638 ? 0.8195 1.5568 0.8622 0.5144  0.1917  0.1840  682 TYR A CE2 
4884 C CZ  . TYR A 638 ? 0.8201 1.5090 0.8374 0.4998  0.1553  0.1236  682 TYR A CZ  
4885 O OH  . TYR A 638 ? 0.8761 1.5612 0.8202 0.5544  0.1277  0.0790  682 TYR A OH  
4886 N N   . ARG A 639 ? 0.7127 1.2652 1.0550 0.2127  0.1764  0.2339  683 ARG A N   
4887 C CA  . ARG A 639 ? 0.7077 1.2303 1.1068 0.1723  0.1720  0.2548  683 ARG A CA  
4888 C C   . ARG A 639 ? 0.7062 1.2054 1.0957 0.1584  0.1611  0.2247  683 ARG A C   
4889 O O   . ARG A 639 ? 0.7143 1.1880 1.0634 0.1548  0.1448  0.1732  683 ARG A O   
4890 C CB  . ARG A 639 ? 0.7282 1.1978 1.1481 0.1335  0.1548  0.2433  683 ARG A CB  
4891 C CG  . ARG A 639 ? 0.7341 1.2184 1.1947 0.1342  0.1626  0.2904  683 ARG A CG  
4892 C CD  . ARG A 639 ? 0.7738 1.1968 1.2561 0.0970  0.1404  0.2788  683 ARG A CD  
4893 N NE  . ARG A 639 ? 0.7958 1.1916 1.3385 0.0708  0.1281  0.3086  683 ARG A NE  
4894 C CZ  . ARG A 639 ? 0.8015 1.2085 1.4063 0.0673  0.1275  0.3624  683 ARG A CZ  
4895 N NH1 . ARG A 639 ? 0.7883 1.2375 1.3995 0.0895  0.1432  0.3932  683 ARG A NH1 
4896 N NH2 . ARG A 639 ? 0.8158 1.1913 1.4802 0.0421  0.1085  0.3870  683 ARG A NH2 
4897 N N   . LYS A 640 ? 0.6974 1.2060 1.1315 0.1496  0.1686  0.2606  684 LYS A N   
4898 C CA  . LYS A 640 ? 0.6949 1.1761 1.1302 0.1298  0.1577  0.2372  684 LYS A CA  
4899 C C   . LYS A 640 ? 0.7120 1.1259 1.1436 0.0883  0.1327  0.1935  684 LYS A C   
4900 O O   . LYS A 640 ? 0.7322 1.1118 1.1944 0.0621  0.1229  0.2039  684 LYS A O   
4901 C CB  . LYS A 640 ? 0.6788 1.1753 1.1765 0.1203  0.1670  0.2894  684 LYS A CB  
4902 C CG  . LYS A 640 ? 0.6627 1.1813 1.1462 0.1369  0.1745  0.2857  684 LYS A CG  
4903 C CD  . LYS A 640 ? 0.6354 1.1896 1.1863 0.1387  0.1905  0.3525  684 LYS A CD  
4904 C CE  . LYS A 640 ? 0.6151 1.2114 1.1433 0.1724  0.2068  0.3587  684 LYS A CE  
4905 N NZ  . LYS A 640 ? 0.6125 1.2396 1.2194 0.1667  0.2203  0.4276  684 LYS A NZ  
4906 N N   . ILE A 641 ? 0.5246 0.9214 0.9186 0.0867  0.1212  0.1466  685 ILE A N   
4907 C CA  . ILE A 641 ? 0.5070 0.8493 0.8977 0.0531  0.1013  0.1094  685 ILE A CA  
4908 C C   . ILE A 641 ? 0.4973 0.8046 0.9332 0.0223  0.0951  0.1305  685 ILE A C   
4909 O O   . ILE A 641 ? 0.4974 0.8189 0.9623 0.0219  0.1012  0.1571  685 ILE A O   
4910 C CB  . ILE A 641 ? 0.5035 0.8398 0.8638 0.0557  0.0903  0.0677  685 ILE A CB  
4911 C CG1 . ILE A 641 ? 0.5188 0.8749 0.8377 0.0832  0.0840  0.0403  685 ILE A CG1 
4912 C CG2 . ILE A 641 ? 0.4845 0.7707 0.8533 0.0210  0.0745  0.0420  685 ILE A CG2 
4913 C CD1 . ILE A 641 ? 0.5274 0.8855 0.8190 0.0966  0.0686  0.0047  685 ILE A CD1 
4914 N N   . PRO A 642 ? 0.5386 0.7994 0.9808 -0.0001 0.0810  0.1205  686 PRO A N   
4915 C CA  . PRO A 642 ? 0.5636 0.7818 1.0447 -0.0250 0.0669  0.1365  686 PRO A CA  
4916 C C   . PRO A 642 ? 0.5524 0.7502 1.0351 -0.0399 0.0596  0.1185  686 PRO A C   
4917 O O   . PRO A 642 ? 0.5370 0.7248 0.9864 -0.0423 0.0563  0.0805  686 PRO A O   
4918 C CB  . PRO A 642 ? 0.5978 0.7684 1.0644 -0.0353 0.0513  0.1178  686 PRO A CB  
4919 C CG  . PRO A 642 ? 0.5727 0.7620 0.9943 -0.0218 0.0591  0.0869  686 PRO A CG  
4920 C CD  . PRO A 642 ? 0.5453 0.7917 0.9601 0.0016  0.0761  0.0983  686 PRO A CD  
4921 N N   . GLY A 643 ? 0.5524 0.7468 1.0800 -0.0500 0.0561  0.1494  687 GLY A N   
4922 C CA  . GLY A 643 ? 0.5419 0.7166 1.0767 -0.0649 0.0488  0.1372  687 GLY A CA  
4923 C C   . GLY A 643 ? 0.5029 0.7291 1.0264 -0.0466 0.0677  0.1394  687 GLY A C   
4924 O O   . GLY A 643 ? 0.4873 0.7048 1.0097 -0.0552 0.0645  0.1254  687 GLY A O   
4925 N N   . ASP A 644 ? 0.6159 0.8943 1.1256 -0.0174 0.0863  0.1549  688 ASP A N   
4926 C CA  . ASP A 644 ? 0.5893 0.9161 1.0782 0.0106  0.1022  0.1560  688 ASP A CA  
4927 C C   . ASP A 644 ? 0.5678 0.9328 1.1073 0.0198  0.1176  0.2138  688 ASP A C   
4928 O O   . ASP A 644 ? 0.5666 0.9558 1.1441 0.0267  0.1268  0.2603  688 ASP A O   
4929 C CB  . ASP A 644 ? 0.5976 0.9609 1.0407 0.0455  0.1117  0.1430  688 ASP A CB  
4930 C CG  . ASP A 644 ? 0.5956 0.9980 1.0015 0.0814  0.1198  0.1316  688 ASP A CG  
4931 O OD1 . ASP A 644 ? 0.5831 1.0212 1.0074 0.0989  0.1358  0.1668  688 ASP A OD1 
4932 O OD2 . ASP A 644 ? 0.6117 1.0077 0.9716 0.0939  0.1075  0.0878  688 ASP A OD2 
4933 N N   . LYS A 645 ? 0.7906 1.1602 1.3374 0.0178  0.1193  0.2140  689 LYS A N   
4934 C CA  . LYS A 645 ? 0.7616 1.1665 1.3651 0.0233  0.1328  0.2719  689 LYS A CA  
4935 C C   . LYS A 645 ? 0.7499 1.2273 1.3324 0.0722  0.1610  0.2970  689 LYS A C   
4936 O O   . LYS A 645 ? 0.7205 1.2338 1.3480 0.0809  0.1755  0.3463  689 LYS A O   
4937 C CB  . LYS A 645 ? 0.7429 1.1039 1.3771 -0.0115 0.1153  0.2636  689 LYS A CB  
4938 C CG  . LYS A 645 ? 0.7595 1.0525 1.4214 -0.0505 0.0870  0.2531  689 LYS A CG  
4939 C CD  . LYS A 645 ? 0.7379 0.9853 1.4277 -0.0806 0.0671  0.2449  689 LYS A CD  
4940 C CE  . LYS A 645 ? 0.7659 0.9391 1.4713 -0.1108 0.0343  0.2293  689 LYS A CE  
4941 N NZ  . LYS A 645 ? 0.7633 0.8819 1.4503 -0.1326 0.0147  0.1885  689 LYS A NZ  
4942 N N   . CYS A 646 ? 0.5235 1.0208 1.0368 0.1073  0.1664  0.2629  690 CYS A N   
4943 C CA  . CYS A 646 ? 0.5528 1.1121 1.0282 0.1636  0.1883  0.2768  690 CYS A CA  
4944 C C   . CYS A 646 ? 0.5695 1.1984 1.0901 0.1956  0.2196  0.3563  690 CYS A C   
4945 O O   . CYS A 646 ? 0.5639 1.1985 1.1303 0.1830  0.2236  0.3934  690 CYS A O   
4946 C CB  . CYS A 646 ? 0.5759 1.1376 0.9724 0.1980  0.1809  0.2277  690 CYS A CB  
4947 S SG  . CYS A 646 ? 0.5870 1.1712 0.9823 0.2144  0.1909  0.2503  690 CYS A SG  
4948 N N   . GLN A 647 ? 1.0289 1.7136 1.5403 0.2392  0.2423  0.3870  691 GLN A N   
4949 C CA  . GLN A 647 ? 0.9911 1.7513 1.5507 0.2742  0.2758  0.4710  691 GLN A CA  
4950 C C   . GLN A 647 ? 1.0093 1.8320 1.4998 0.3507  0.3007  0.4840  691 GLN A C   
4951 O O   . GLN A 647 ? 1.0357 1.8622 1.4682 0.3809  0.2981  0.4451  691 GLN A O   
4952 C CB  . GLN A 647 ? 0.9436 1.7095 1.6012 0.2409  0.2798  0.5332  691 GLN A CB  
4953 C CG  . GLN A 647 ? 0.9148 1.6290 1.6512 0.1781  0.2557  0.5447  691 GLN A CG  
4954 C CD  . GLN A 647 ? 0.9343 1.6631 1.7253 0.1797  0.2603  0.6191  691 GLN A CD  
4955 O OE1 . GLN A 647 ? 0.9442 1.7220 1.7082 0.2275  0.2841  0.6644  691 GLN A OE1 
4956 N NE2 . GLN A 647 ? 0.9491 1.6280 1.8121 0.1293  0.2326  0.6308  691 GLN A NE2 
4957 N N   . GLY A 648 ? 0.8559 1.7072 1.3370 0.3787  0.3165  0.5339  692 GLY A N   
4958 C CA  . GLY A 648 ? 0.9060 1.7963 1.3015 0.4492  0.3331  0.5478  692 GLY A CA  
4959 C C   . GLY A 648 ? 0.9362 1.8190 1.2425 0.4858  0.3205  0.4780  692 GLY A C   
4960 O O   . GLY A 648 ? 0.9223 1.7831 1.2439 0.4598  0.3077  0.4448  692 GLY A O   
4961 N N   . GLY A 649 ? 0.8560 1.7534 1.0682 0.5475  0.3203  0.4560  693 GLY A N   
4962 C CA  . GLY A 649 ? 0.8897 1.7735 1.0095 0.5900  0.3000  0.3895  693 GLY A CA  
4963 C C   . GLY A 649 ? 0.9088 1.8029 1.0124 0.6039  0.3043  0.4028  693 GLY A C   
4964 O O   . GLY A 649 ? 0.9403 1.8680 1.0576 0.6181  0.3280  0.4713  693 GLY A O   
4965 N N   . VAL A 650 ? 0.9165 1.7812 0.9948 0.5992  0.2797  0.3383  694 VAL A N   
4966 C CA  . VAL A 650 ? 0.9291 1.7977 0.9833 0.6139  0.2783  0.3368  694 VAL A CA  
4967 C C   . VAL A 650 ? 0.8773 1.7501 1.0259 0.5587  0.2938  0.3822  694 VAL A C   
4968 O O   . VAL A 650 ? 0.8516 1.7043 1.0767 0.5015  0.2899  0.3789  694 VAL A O   
4969 C CB  . VAL A 650 ? 0.9670 1.7980 0.9707 0.6238  0.2416  0.2514  694 VAL A CB  
4970 C CG1 . VAL A 650 ? 0.9717 1.8037 0.9587 0.6327  0.2384  0.2475  694 VAL A CG1 
4971 C CG2 . VAL A 650 ? 1.0225 1.8414 0.9286 0.6828  0.2169  0.2056  694 VAL A CG2 
4972 N N   . ASN A 651 ? 1.3734 2.2702 1.5157 0.5771  0.3089  0.4258  695 ASN A N   
4973 C CA  . ASN A 651 ? 1.3322 2.2260 1.5564 0.5285  0.3163  0.4604  695 ASN A CA  
4974 C C   . ASN A 651 ? 1.3507 2.2465 1.5342 0.5499  0.3123  0.4448  695 ASN A C   
4975 O O   . ASN A 651 ? 1.3704 2.2961 1.5419 0.5774  0.3296  0.4960  695 ASN A O   
4976 C CB  . ASN A 651 ? 1.3204 2.2419 1.6108 0.5166  0.3398  0.5499  695 ASN A CB  
4977 C CG  . ASN A 651 ? 1.2868 2.1971 1.6659 0.4658  0.3394  0.5844  695 ASN A CG  
4978 O OD1 . ASN A 651 ? 1.2507 2.1299 1.7025 0.4095  0.3266  0.5758  695 ASN A OD1 
4979 N ND2 . ASN A 651 ? 1.3079 2.2409 1.6793 0.4872  0.3510  0.6233  695 ASN A ND2 
4980 N N   . PRO A 652 ? 1.1135 1.9784 1.2762 0.5393  0.2886  0.3757  696 PRO A N   
4981 C CA  . PRO A 652 ? 1.1339 1.9946 1.2582 0.5569  0.2796  0.3508  696 PRO A CA  
4982 C C   . PRO A 652 ? 1.1000 1.9631 1.2963 0.5156  0.2911  0.3903  696 PRO A C   
4983 O O   . PRO A 652 ? 1.1119 1.9803 1.2789 0.5341  0.2904  0.3871  696 PRO A O   
4984 C CB  . PRO A 652 ? 1.1704 1.9765 1.2627 0.5380  0.2413  0.2669  696 PRO A CB  
4985 C CG  . PRO A 652 ? 1.1542 1.9188 1.3025 0.4729  0.2322  0.2611  696 PRO A CG  
4986 C CD  . PRO A 652 ? 1.1228 1.9387 1.3020 0.4951  0.2630  0.3195  696 PRO A CD  
4987 N N   . VAL A 653 ? 1.2349 2.0891 1.5218 0.4612  0.2968  0.4231  697 VAL A N   
4988 C CA  . VAL A 653 ? 1.2137 2.0599 1.5710 0.4199  0.2995  0.4566  697 VAL A CA  
4989 C C   . VAL A 653 ? 1.2104 2.0921 1.5544 0.4539  0.3187  0.5145  697 VAL A C   
4990 O O   . VAL A 653 ? 1.2293 2.1411 1.5563 0.4865  0.3348  0.5599  697 VAL A O   
4991 C CB  . VAL A 653 ? 1.1925 2.0076 1.6401 0.3580  0.2924  0.4859  697 VAL A CB  
4992 C CG1 . VAL A 653 ? 1.1682 2.0188 1.6494 0.3723  0.3111  0.5486  697 VAL A CG1 
4993 C CG2 . VAL A 653 ? 1.1887 1.9810 1.6989 0.3176  0.2848  0.5122  697 VAL A CG2 
4994 N N   . ARG A 654 ? 1.5053 2.3841 1.8532 0.4488  0.3169  0.5134  698 ARG A N   
4995 C CA  . ARG A 654 ? 1.5295 2.4394 1.8321 0.4936  0.3308  0.5450  698 ARG A CA  
4996 C C   . ARG A 654 ? 1.5170 2.4379 1.8927 0.4705  0.3413  0.6124  698 ARG A C   
4997 O O   . ARG A 654 ? 1.4853 2.3812 1.9432 0.4177  0.3314  0.6227  698 ARG A O   
4998 C CB  . ARG A 654 ? 1.5503 2.4497 1.7780 0.5202  0.3172  0.4825  698 ARG A CB  
4999 C CG  . ARG A 654 ? 1.5961 2.5032 1.7213 0.5805  0.3096  0.4433  698 ARG A CG  
5000 C CD  . ARG A 654 ? 1.6441 2.5894 1.7191 0.6347  0.3272  0.4916  698 ARG A CD  
5001 N NE  . ARG A 654 ? 1.6366 2.5891 1.7376 0.6241  0.3343  0.5179  698 ARG A NE  
5002 C CZ  . ARG A 654 ? 1.6734 2.6613 1.7720 0.6512  0.3548  0.5824  698 ARG A CZ  
5003 N NH1 . ARG A 654 ? 1.7224 2.7444 1.7923 0.6930  0.3717  0.6305  698 ARG A NH1 
5004 N NH2 . ARG A 654 ? 1.6627 2.6532 1.7879 0.6382  0.3585  0.6011  698 ARG A NH2 
5005 N N   . GLU A 655 ? 1.7220 2.6794 2.0663 0.5136  0.3588  0.6598  699 GLU A N   
5006 C CA  . GLU A 655 ? 1.7246 2.6963 2.1282 0.5016  0.3680  0.7242  699 GLU A CA  
5007 C C   . GLU A 655 ? 1.6897 2.6359 2.1006 0.4765  0.3545  0.6845  699 GLU A C   
5008 O O   . GLU A 655 ? 1.6983 2.6421 2.0331 0.5043  0.3497  0.6326  699 GLU A O   
5009 C CB  . GLU A 655 ? 1.7866 2.8060 2.1388 0.5620  0.3902  0.7779  699 GLU A CB  
5010 C CG  . GLU A 655 ? 1.8270 2.8779 2.1732 0.5925  0.4067  0.8301  699 GLU A CG  
5011 C CD  . GLU A 655 ? 1.8459 2.8929 2.1058 0.6255  0.4017  0.7726  699 GLU A CD  
5012 O OE1 . GLU A 655 ? 1.8199 2.8338 2.0418 0.6146  0.3818  0.6913  699 GLU A OE1 
5013 O OE2 . GLU A 655 ? 1.8938 2.9711 2.1256 0.6642  0.4163  0.8116  699 GLU A OE2 
5014 N N   . VAL A 656 ? 1.2073 2.1325 1.7109 0.4258  0.3452  0.7103  700 VAL A N   
5015 C CA  . VAL A 656 ? 1.1922 2.0863 1.7130 0.3942  0.3290  0.6691  700 VAL A CA  
5016 C C   . VAL A 656 ? 1.2145 2.1247 1.6798 0.4261  0.3359  0.6604  700 VAL A C   
5017 O O   . VAL A 656 ? 1.2471 2.1914 1.6982 0.4593  0.3526  0.7111  700 VAL A O   
5018 C CB  . VAL A 656 ? 1.1896 2.0585 1.8224 0.3404  0.3142  0.7088  700 VAL A CB  
5019 C CG1 . VAL A 656 ? 1.1792 2.0296 1.8662 0.3106  0.3040  0.7191  700 VAL A CG1 
5020 C CG2 . VAL A 656 ? 1.1887 2.0824 1.8693 0.3484  0.3239  0.7870  700 VAL A CG2 
5021 N N   . LYS A 657 ? 1.5444 2.4306 1.9773 0.4179  0.3227  0.5969  701 LYS A N   
5022 C CA  . LYS A 657 ? 1.5582 2.4540 1.9294 0.4487  0.3248  0.5752  701 LYS A CA  
5023 C C   . LYS A 657 ? 1.5643 2.4306 1.9612 0.4152  0.3103  0.5417  701 LYS A C   
5024 O O   . LYS A 657 ? 1.5863 2.3947 1.9661 0.3807  0.2856  0.4852  701 LYS A O   
5025 C CB  . LYS A 657 ? 1.5812 2.4825 1.8523 0.4952  0.3209  0.5217  701 LYS A CB  
5026 C CG  . LYS A 657 ? 1.6245 2.5278 1.8291 0.5267  0.3150  0.4880  701 LYS A CG  
5027 C CD  . LYS A 657 ? 1.6574 2.5622 1.7670 0.5769  0.3034  0.4383  701 LYS A CD  
5028 C CE  . LYS A 657 ? 1.7101 2.6144 1.7561 0.6103  0.2925  0.4066  701 LYS A CE  
5029 N NZ  . LYS A 657 ? 1.7592 2.6590 1.7124 0.6633  0.2725  0.3567  701 LYS A NZ  
5030 N N   . ASP A 658 ? 1.5825 2.4576 1.9939 0.4170  0.3149  0.5690  702 ASP A N   
5031 C CA  . ASP A 658 ? 1.5985 2.4272 2.0353 0.3761  0.2955  0.5467  702 ASP A CA  
5032 C C   . ASP A 658 ? 1.6192 2.4179 1.9791 0.3826  0.2808  0.4790  702 ASP A C   
5033 O O   . ASP A 658 ? 1.6145 2.4479 1.9338 0.4221  0.2921  0.4791  702 ASP A O   
5034 C CB  . ASP A 658 ? 1.5834 2.4400 2.0856 0.3746  0.3064  0.6113  702 ASP A CB  
5035 C CG  . ASP A 658 ? 1.6211 2.4163 2.1355 0.3338  0.2807  0.5858  702 ASP A CG  
5036 O OD1 . ASP A 658 ? 1.6292 2.3588 2.1196 0.3002  0.2553  0.5298  702 ASP A OD1 
5037 O OD2 . ASP A 658 ? 1.6425 2.4570 2.1891 0.3387  0.2867  0.6236  702 ASP A OD2 
5038 N N   . LEU A 659 ? 0.8181 1.5516 1.1652 0.3426  0.2544  0.4255  703 LEU A N   
5039 C CA  . LEU A 659 ? 0.8315 1.5345 1.1190 0.3430  0.2371  0.3641  703 LEU A CA  
5040 C C   . LEU A 659 ? 0.8426 1.5122 1.1431 0.3169  0.2266  0.3579  703 LEU A C   
5041 O O   . LEU A 659 ? 0.8508 1.4953 1.1131 0.3131  0.2125  0.3136  703 LEU A O   
5042 C CB  . LEU A 659 ? 0.8425 1.5016 1.1102 0.3194  0.2165  0.3135  703 LEU A CB  
5043 C CG  . LEU A 659 ? 0.8438 1.5269 1.0773 0.3497  0.2190  0.2989  703 LEU A CG  
5044 C CD1 . LEU A 659 ? 0.8582 1.4960 1.0637 0.3297  0.1927  0.2393  703 LEU A CD1 
5045 C CD2 . LEU A 659 ? 0.8464 1.5824 1.0312 0.4104  0.2316  0.3051  703 LEU A CD2 
5046 N N   . LYS A 660 ? 1.7653 2.4342 2.1233 0.3001  0.2311  0.4043  704 LYS A N   
5047 C CA  . LYS A 660 ? 1.7856 2.4231 2.1559 0.2803  0.2203  0.4025  704 LYS A CA  
5048 C C   . LYS A 660 ? 1.7705 2.4366 2.0974 0.3107  0.2292  0.3918  704 LYS A C   
5049 O O   . LYS A 660 ? 1.7792 2.4141 2.0774 0.3003  0.2160  0.3546  704 LYS A O   
5050 C CB  . LYS A 660 ? 1.8016 2.4412 2.2461 0.2655  0.2207  0.4612  704 LYS A CB  
5051 C CG  . LYS A 660 ? 1.8233 2.4496 2.2793 0.2603  0.2147  0.4716  704 LYS A CG  
5052 C CD  . LYS A 660 ? 1.8173 2.4773 2.3479 0.2641  0.2229  0.5437  704 LYS A CD  
5053 C CE  . LYS A 660 ? 1.7650 2.5098 2.2919 0.3094  0.2576  0.5854  704 LYS A CE  
5054 N NZ  . LYS A 660 ? 1.7546 2.5251 2.2156 0.3420  0.2703  0.5602  704 LYS A NZ  
5055 N N   . LYS A 661 ? 1.3691 2.0975 1.6914 0.3517  0.2521  0.4271  705 LYS A N   
5056 C CA  . LYS A 661 ? 1.3605 2.1210 1.6438 0.3867  0.2615  0.4245  705 LYS A CA  
5057 C C   . LYS A 661 ? 1.3730 2.1185 1.5874 0.4018  0.2464  0.3623  705 LYS A C   
5058 O O   . LYS A 661 ? 1.3797 2.1306 1.5628 0.4184  0.2433  0.3464  705 LYS A O   
5059 C CB  . LYS A 661 ? 1.3367 2.1717 1.6252 0.4360  0.2911  0.4787  705 LYS A CB  
5060 C CG  . LYS A 661 ? 1.3362 2.2041 1.5664 0.4829  0.2981  0.4594  705 LYS A CG  
5061 C CD  . LYS A 661 ? 1.3370 2.2436 1.5335 0.5270  0.3150  0.5035  705 LYS A CD  
5062 C CE  . LYS A 661 ? 1.3252 2.2513 1.5885 0.5137  0.3316  0.5770  705 LYS A CE  
5063 N NZ  . LYS A 661 ? 1.3643 2.3290 1.5995 0.5558  0.3493  0.6291  705 LYS A NZ  
5064 N N   . LYS A 662 ? 1.1891 1.9153 1.3837 0.3962  0.2339  0.3280  706 LYS A N   
5065 C CA  . LYS A 662 ? 1.2133 1.9294 1.3507 0.4153  0.2147  0.2743  706 LYS A CA  
5066 C C   . LYS A 662 ? 1.2185 1.8824 1.3568 0.3771  0.1906  0.2328  706 LYS A C   
5067 O O   . LYS A 662 ? 1.2364 1.8927 1.3410 0.3897  0.1719  0.1956  706 LYS A O   
5068 C CB  . LYS A 662 ? 1.2353 1.9583 1.3478 0.4346  0.2090  0.2558  706 LYS A CB  
5069 C CG  . LYS A 662 ? 1.2789 2.0440 1.3325 0.4999  0.2114  0.2497  706 LYS A CG  
5070 C CD  . LYS A 662 ? 1.3188 2.1027 1.3472 0.5316  0.2131  0.2466  706 LYS A CD  
5071 C CE  . LYS A 662 ? 1.3642 2.2130 1.3591 0.6005  0.2388  0.2840  706 LYS A CE  
5072 N NZ  . LYS A 662 ? 1.4230 2.2764 1.3628 0.6428  0.2269  0.2589  706 LYS A NZ  
5073 N N   . CYS A 663 ? 1.7690 2.3977 1.9471 0.3343  0.1894  0.2416  707 CYS A N   
5074 C CA  . CYS A 663 ? 1.7710 2.3603 1.9497 0.3071  0.1740  0.2151  707 CYS A CA  
5075 C C   . CYS A 663 ? 1.7702 2.3735 1.9437 0.3193  0.1805  0.2288  707 CYS A C   
5076 O O   . CYS A 663 ? 1.7760 2.3774 1.9261 0.3274  0.1697  0.2038  707 CYS A O   
5077 C CB  . CYS A 663 ? 1.7724 2.3187 1.9851 0.2678  0.1699  0.2210  707 CYS A CB  
5078 S SG  . CYS A 663 ? 1.7730 2.2930 1.9910 0.2472  0.1590  0.1981  707 CYS A SG  
5079 N N   . THR A 664 ? 0.7647 1.3832 0.9667 0.3204  0.1967  0.2720  708 THR A N   
5080 C CA  . THR A 664 ? 0.7653 1.3901 0.9741 0.3241  0.2027  0.2913  708 THR A CA  
5081 C C   . THR A 664 ? 0.7637 1.4348 0.9402 0.3658  0.2126  0.2958  708 THR A C   
5082 O O   . THR A 664 ? 0.7626 1.4411 0.9388 0.3717  0.2171  0.3073  708 THR A O   
5083 C CB  . THR A 664 ? 0.7739 1.3991 1.0337 0.3115  0.2118  0.3401  708 THR A CB  
5084 O OG1 . THR A 664 ? 0.7633 1.4354 1.0388 0.3347  0.2294  0.3766  708 THR A OG1 
5085 C CG2 . THR A 664 ? 0.7976 1.3684 1.0855 0.2737  0.1956  0.3328  708 THR A CG2 
5086 N N   . SER A 665 ? 0.7431 1.4439 0.8888 0.3986  0.2148  0.2865  709 SER A N   
5087 C CA  . SER A 665 ? 0.7741 1.5168 0.8792 0.4475  0.2211  0.2881  709 SER A CA  
5088 C C   . SER A 665 ? 0.7822 1.5041 0.8571 0.4483  0.1993  0.2464  709 SER A C   
5089 O O   . SER A 665 ? 0.8029 1.5496 0.8515 0.4804  0.2019  0.2490  709 SER A O   
5090 C CB  . SER A 665 ? 0.8040 1.5777 0.8734 0.4902  0.2235  0.2828  709 SER A CB  
5091 O OG  . SER A 665 ? 0.7992 1.5387 0.8525 0.4765  0.1981  0.2364  709 SER A OG  
5092 N N   . ASN A 666 ? 0.7590 1.4380 0.8419 0.4142  0.1779  0.2116  710 ASN A N   
5093 C CA  . ASN A 666 ? 0.7597 1.4194 0.8300 0.4091  0.1561  0.1788  710 ASN A CA  
5094 C C   . ASN A 666 ? 0.7437 1.3932 0.8339 0.3891  0.1645  0.1948  710 ASN A C   
5095 O O   . ASN A 666 ? 0.7539 1.4080 0.8298 0.4007  0.1560  0.1836  710 ASN A O   
5096 C CB  . ASN A 666 ? 0.7431 1.3675 0.8241 0.3815  0.1322  0.1445  710 ASN A CB  
5097 C CG  . ASN A 666 ? 0.7627 1.3920 0.8221 0.4021  0.1173  0.1228  710 ASN A CG  
5098 O OD1 . ASN A 666 ? 0.8001 1.4540 0.8218 0.4462  0.1114  0.1158  710 ASN A OD1 
5099 N ND2 . ASN A 666 ? 0.7466 1.3516 0.8258 0.3743  0.1101  0.1113  710 ASN A ND2 
5100 N N   . PHE A 667 ? 0.7177 1.3500 0.8403 0.3609  0.1773  0.2194  711 PHE A N   
5101 C CA  . PHE A 667 ? 0.7075 1.3223 0.8479 0.3428  0.1822  0.2342  711 PHE A CA  
5102 C C   . PHE A 667 ? 0.7224 1.3700 0.8639 0.3652  0.1990  0.2681  711 PHE A C   
5103 O O   . PHE A 667 ? 0.7347 1.4165 0.8799 0.3866  0.2134  0.2954  711 PHE A O   
5104 C CB  . PHE A 667 ? 0.7004 1.2788 0.8718 0.3108  0.1827  0.2465  711 PHE A CB  
5105 C CG  . PHE A 667 ? 0.7022 1.2498 0.8740 0.2899  0.1696  0.2185  711 PHE A CG  
5106 C CD1 . PHE A 667 ? 0.7085 1.2611 0.8812 0.2899  0.1676  0.2117  711 PHE A CD1 
5107 C CD2 . PHE A 667 ? 0.6966 1.2124 0.8686 0.2725  0.1608  0.2024  711 PHE A CD2 
5108 C CE1 . PHE A 667 ? 0.7093 1.2343 0.8851 0.2702  0.1555  0.1874  711 PHE A CE1 
5109 C CE2 . PHE A 667 ? 0.6945 1.1863 0.8699 0.2557  0.1509  0.1818  711 PHE A CE2 
5110 C CZ  . PHE A 667 ? 0.7012 1.1970 0.8795 0.2530  0.1475  0.1733  711 PHE A CZ  
5111 N N   . LEU A 668 ? 0.7223 1.3631 0.8625 0.3624  0.1984  0.2693  712 LEU A N   
5112 C CA  . LEU A 668 ? 0.7322 1.3957 0.8839 0.3751  0.2133  0.3055  712 LEU A CA  
5113 C C   . LEU A 668 ? 0.7235 1.3610 0.9180 0.3493  0.2151  0.3350  712 LEU A C   
5114 O O   . LEU A 668 ? 0.7136 1.3060 0.9148 0.3236  0.2022  0.3190  712 LEU A O   
5115 C CB  . LEU A 668 ? 0.7360 1.3972 0.8713 0.3801  0.2094  0.2944  712 LEU A CB  
5116 C CG  . LEU A 668 ? 0.7477 1.4345 0.8912 0.3959  0.2237  0.3287  712 LEU A CG  
5117 C CD1 . LEU A 668 ? 0.7697 1.5093 0.8932 0.4366  0.2370  0.3438  712 LEU A CD1 
5118 C CD2 . LEU A 668 ? 0.7476 1.4218 0.8781 0.3934  0.2176  0.3148  712 LEU A CD2 
5119 N N   . SER A 669 ? 0.8912 1.5562 1.1170 0.3587  0.2284  0.3802  713 SER A N   
5120 C CA  . SER A 669 ? 0.9246 1.5604 1.2009 0.3335  0.2214  0.4094  713 SER A CA  
5121 C C   . SER A 669 ? 0.9453 1.5780 1.2477 0.3325  0.2206  0.4393  713 SER A C   
5122 O O   . SER A 669 ? 0.9207 1.5943 1.2138 0.3564  0.2352  0.4558  713 SER A O   
5123 C CB  . SER A 669 ? 0.9194 1.5856 1.2319 0.3390  0.2320  0.4464  713 SER A CB  
5124 O OG  . SER A 669 ? 0.8986 1.5731 1.1803 0.3464  0.2339  0.4179  713 SER A OG  
5125 N N   . PRO A 670 ? 0.7692 1.3505 1.1029 0.3073  0.2004  0.4454  714 PRO A N   
5126 C CA  . PRO A 670 ? 0.7991 1.3723 1.1639 0.3062  0.1937  0.4757  714 PRO A CA  
5127 C C   . PRO A 670 ? 0.8030 1.4097 1.2387 0.3087  0.1990  0.5397  714 PRO A C   
5128 O O   . PRO A 670 ? 0.7850 1.4190 1.2481 0.3103  0.2080  0.5626  714 PRO A O   
5129 C CB  . PRO A 670 ? 0.8497 1.3475 1.2141 0.2837  0.1633  0.4521  714 PRO A CB  
5130 C CG  . PRO A 670 ? 0.8551 1.3300 1.2213 0.2693  0.1552  0.4355  714 PRO A CG  
5131 C CD  . PRO A 670 ? 0.8053 1.3284 1.1381 0.2829  0.1790  0.4185  714 PRO A CD  
5132 N N   . GLU A 671 ? 1.3719 1.9762 1.8422 0.3087  0.1919  0.5711  715 GLU A N   
5133 C CA  . GLU A 671 ? 1.3526 1.9886 1.9049 0.3092  0.1933  0.6400  715 GLU A CA  
5134 C C   . GLU A 671 ? 1.3037 2.0270 1.8643 0.3395  0.2314  0.6799  715 GLU A C   
5135 O O   . GLU A 671 ? 1.2856 2.0316 1.8579 0.3425  0.2412  0.6908  715 GLU A O   
5136 C CB  . GLU A 671 ? 1.3623 1.9506 1.9777 0.2809  0.1620  0.6572  715 GLU A CB  
5137 C CG  . GLU A 671 ? 1.3256 1.9487 2.0437 0.2781  0.1596  0.7361  715 GLU A CG  
5138 C CD  . GLU A 671 ? 1.2954 1.9627 2.0488 0.2813  0.1773  0.7682  715 GLU A CD  
5139 O OE1 . GLU A 671 ? 1.3129 1.9587 2.0203 0.2755  0.1773  0.7240  715 GLU A OE1 
5140 O OE2 . GLU A 671 ? 1.2504 1.9773 2.0799 0.2914  0.1922  0.8408  715 GLU A OE2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   45  ?   ?   ?   A . n 
A 1 2   ALA 2   46  ?   ?   ?   A . n 
A 1 3   PRO 3   47  ?   ?   ?   A . n 
A 1 4   GLY 4   48  ?   ?   ?   A . n 
A 1 5   GLU 5   49  ?   ?   ?   A . n 
A 1 6   ASP 6   50  ?   ?   ?   A . n 
A 1 7   GLU 7   51  ?   ?   ?   A . n 
A 1 8   GLU 8   52  ?   ?   ?   A . n 
A 1 9   CYS 9   53  ?   ?   ?   A . n 
A 1 10  GLY 10  54  54  GLY GLY A . n 
A 1 11  ARG 11  55  55  ARG ARG A . n 
A 1 12  VAL 12  56  56  VAL VAL A . n 
A 1 13  ARG 13  57  57  ARG ARG A . n 
A 1 14  ASP 14  58  58  ASP ASP A . n 
A 1 15  PHE 15  59  59  PHE PHE A . n 
A 1 16  VAL 16  60  60  VAL VAL A . n 
A 1 17  ALA 17  61  61  ALA ALA A . n 
A 1 18  LYS 18  62  62  LYS LYS A . n 
A 1 19  LEU 19  63  63  LEU LEU A . n 
A 1 20  ALA 20  64  64  ALA ALA A . n 
A 1 21  ASN 21  65  65  ASN ASN A . n 
A 1 22  ASN 22  66  66  ASN ASN A . n 
A 1 23  THR 23  67  67  THR THR A . n 
A 1 24  HIS 24  68  68  HIS HIS A . n 
A 1 25  GLN 25  69  69  GLN GLN A . n 
A 1 26  HIS 26  70  70  HIS HIS A . n 
A 1 27  VAL 27  71  71  VAL VAL A . n 
A 1 28  PHE 28  72  72  PHE PHE A . n 
A 1 29  ASP 29  73  73  ASP ASP A . n 
A 1 30  ASP 30  74  74  ASP ASP A . n 
A 1 31  LEU 31  75  75  LEU LEU A . n 
A 1 32  ARG 32  76  76  ARG ARG A . n 
A 1 33  GLY 33  77  77  GLY GLY A . n 
A 1 34  SER 34  78  78  SER SER A . n 
A 1 35  VAL 35  79  79  VAL VAL A . n 
A 1 36  SER 36  80  80  SER SER A . n 
A 1 37  LEU 37  81  81  LEU LEU A . n 
A 1 38  SER 38  82  82  SER SER A . n 
A 1 39  TRP 39  83  83  TRP TRP A . n 
A 1 40  VAL 40  84  84  VAL VAL A . n 
A 1 41  GLY 41  85  85  GLY GLY A . n 
A 1 42  ASP 42  86  86  ASP ASP A . n 
A 1 43  SER 43  87  87  SER SER A . n 
A 1 44  THR 44  88  88  THR THR A . n 
A 1 45  GLY 45  89  89  GLY GLY A . n 
A 1 46  VAL 46  90  90  VAL VAL A . n 
A 1 47  ILE 47  91  91  ILE ILE A . n 
A 1 48  LEU 48  92  92  LEU LEU A . n 
A 1 49  VAL 49  93  93  VAL VAL A . n 
A 1 50  LEU 50  94  94  LEU LEU A . n 
A 1 51  THR 51  95  95  THR THR A . n 
A 1 52  THR 52  96  96  THR THR A . n 
A 1 53  PHE 53  97  97  PHE PHE A . n 
A 1 54  HIS 54  98  98  HIS HIS A . n 
A 1 55  VAL 55  99  99  VAL VAL A . n 
A 1 56  PRO 56  100 100 PRO PRO A . n 
A 1 57  LEU 57  101 ?   ?   ?   A . n 
A 1 58  VAL 58  102 ?   ?   ?   A . n 
A 1 59  ILE 59  103 ?   ?   ?   A . n 
A 1 60  MET 60  104 ?   ?   ?   A . n 
A 1 61  THR 61  105 ?   ?   ?   A . n 
A 1 62  PHE 62  106 ?   ?   ?   A . n 
A 1 63  GLY 63  107 ?   ?   ?   A . n 
A 1 64  GLN 64  108 108 GLN GLN A . n 
A 1 65  SER 65  109 109 SER SER A . n 
A 1 66  LYS 66  110 110 LYS LYS A . n 
A 1 67  LEU 67  111 111 LEU LEU A . n 
A 1 68  TYR 68  112 112 TYR TYR A . n 
A 1 69  ARG 69  113 113 ARG ARG A . n 
A 1 70  SER 70  114 114 SER SER A . n 
A 1 71  GLU 71  115 115 GLU GLU A . n 
A 1 72  ASP 72  116 116 ASP ASP A . n 
A 1 73  TYR 73  117 117 TYR TYR A . n 
A 1 74  GLY 74  118 118 GLY GLY A . n 
A 1 75  LYS 75  119 119 LYS LYS A . n 
A 1 76  ASN 76  120 120 ASN ASN A . n 
A 1 77  PHE 77  121 121 PHE PHE A . n 
A 1 78  LYS 78  122 122 LYS LYS A . n 
A 1 79  ASP 79  123 123 ASP ASP A . n 
A 1 80  ILE 80  124 124 ILE ILE A . n 
A 1 81  THR 81  125 125 THR THR A . n 
A 1 82  ASP 82  126 126 ASP ASP A . n 
A 1 83  LEU 83  127 127 LEU LEU A . n 
A 1 84  ILE 84  128 128 ILE ILE A . n 
A 1 85  ASN 85  129 129 ASN ASN A . n 
A 1 86  ASN 86  130 130 ASN ASN A . n 
A 1 87  THR 87  131 131 THR THR A . n 
A 1 88  PHE 88  132 132 PHE PHE A . n 
A 1 89  ILE 89  133 133 ILE ILE A . n 
A 1 90  ARG 90  134 134 ARG ARG A . n 
A 1 91  THR 91  135 135 THR THR A . n 
A 1 92  GLU 92  136 136 GLU GLU A . n 
A 1 93  PHE 93  137 137 PHE PHE A . n 
A 1 94  GLY 94  138 138 GLY GLY A . n 
A 1 95  MET 95  139 139 MET MET A . n 
A 1 96  ALA 96  140 140 ALA ALA A . n 
A 1 97  ILE 97  141 141 ILE ILE A . n 
A 1 98  GLY 98  142 142 GLY GLY A . n 
A 1 99  PRO 99  143 143 PRO PRO A . n 
A 1 100 GLU 100 144 144 GLU GLU A . n 
A 1 101 ASN 101 145 145 ASN ASN A . n 
A 1 102 SER 102 146 146 SER SER A . n 
A 1 103 GLY 103 147 147 GLY GLY A . n 
A 1 104 LYS 104 148 148 LYS LYS A . n 
A 1 105 VAL 105 149 149 VAL VAL A . n 
A 1 106 VAL 106 150 150 VAL VAL A . n 
A 1 107 LEU 107 151 151 LEU LEU A . n 
A 1 108 THR 108 152 152 THR THR A . n 
A 1 109 ALA 109 153 153 ALA ALA A . n 
A 1 110 GLU 110 154 154 GLU GLU A . n 
A 1 111 VAL 111 155 155 VAL VAL A . n 
A 1 112 SER 112 156 156 SER SER A . n 
A 1 113 GLY 113 157 157 GLY GLY A . n 
A 1 114 GLY 114 158 158 GLY GLY A . n 
A 1 115 SER 115 159 159 SER SER A . n 
A 1 116 ARG 116 160 160 ARG ARG A . n 
A 1 117 GLY 117 161 161 GLY GLY A . n 
A 1 118 GLY 118 162 162 GLY GLY A . n 
A 1 119 ARG 119 163 163 ARG ARG A . n 
A 1 120 ILE 120 164 164 ILE ILE A . n 
A 1 121 PHE 121 165 165 PHE PHE A . n 
A 1 122 ARG 122 166 166 ARG ARG A . n 
A 1 123 SER 123 167 167 SER SER A . n 
A 1 124 SER 124 168 168 SER SER A . n 
A 1 125 ASP 125 169 169 ASP ASP A . n 
A 1 126 PHE 126 170 170 PHE PHE A . n 
A 1 127 ALA 127 171 171 ALA ALA A . n 
A 1 128 LYS 128 172 172 LYS LYS A . n 
A 1 129 ASN 129 173 173 ASN ASN A . n 
A 1 130 PHE 130 174 174 PHE PHE A . n 
A 1 131 VAL 131 175 175 VAL VAL A . n 
A 1 132 GLN 132 176 176 GLN GLN A . n 
A 1 133 THR 133 177 177 THR THR A . n 
A 1 134 ASP 134 178 178 ASP ASP A . n 
A 1 135 LEU 135 179 179 LEU LEU A . n 
A 1 136 PRO 136 180 180 PRO PRO A . n 
A 1 137 PHE 137 181 181 PHE PHE A . n 
A 1 138 HIS 138 182 182 HIS HIS A . n 
A 1 139 PRO 139 183 183 PRO PRO A . n 
A 1 140 LEU 140 184 184 LEU LEU A . n 
A 1 141 THR 141 185 185 THR THR A . n 
A 1 142 GLN 142 186 186 GLN GLN A . n 
A 1 143 MET 143 187 187 MET MET A . n 
A 1 144 MET 144 188 188 MET MET A . n 
A 1 145 TYR 145 189 189 TYR TYR A . n 
A 1 146 SER 146 190 190 SER SER A . n 
A 1 147 PRO 147 191 191 PRO PRO A . n 
A 1 148 GLN 148 192 192 GLN GLN A . n 
A 1 149 ASN 149 193 193 ASN ASN A . n 
A 1 150 SER 150 194 194 SER SER A . n 
A 1 151 ASP 151 195 195 ASP ASP A . n 
A 1 152 TYR 152 196 196 TYR TYR A . n 
A 1 153 LEU 153 197 197 LEU LEU A . n 
A 1 154 LEU 154 198 198 LEU LEU A . n 
A 1 155 ALA 155 199 199 ALA ALA A . n 
A 1 156 LEU 156 200 200 LEU LEU A . n 
A 1 157 SER 157 201 201 SER SER A . n 
A 1 158 THR 158 202 202 THR THR A . n 
A 1 159 GLU 159 203 203 GLU GLU A . n 
A 1 160 ASN 160 204 204 ASN ASN A . n 
A 1 161 GLY 161 205 205 GLY GLY A . n 
A 1 162 LEU 162 206 206 LEU LEU A . n 
A 1 163 TRP 163 207 207 TRP TRP A . n 
A 1 164 VAL 164 208 208 VAL VAL A . n 
A 1 165 SER 165 209 209 SER SER A . n 
A 1 166 LYS 166 210 210 LYS LYS A . n 
A 1 167 ASN 167 211 211 ASN ASN A . n 
A 1 168 PHE 168 212 212 PHE PHE A . n 
A 1 169 GLY 169 213 213 GLY GLY A . n 
A 1 170 GLY 170 214 214 GLY GLY A . n 
A 1 171 LYS 171 215 215 LYS LYS A . n 
A 1 172 TRP 172 216 216 TRP TRP A . n 
A 1 173 GLU 173 217 217 GLU GLU A . n 
A 1 174 GLU 174 218 218 GLU GLU A . n 
A 1 175 ILE 175 219 219 ILE ILE A . n 
A 1 176 HIS 176 220 220 HIS HIS A . n 
A 1 177 LYS 177 221 221 LYS LYS A . n 
A 1 178 ALA 178 222 222 ALA ALA A . n 
A 1 179 VAL 179 223 223 VAL VAL A . n 
A 1 180 CYS 180 224 224 CYS CYS A . n 
A 1 181 LEU 181 225 225 LEU LEU A . n 
A 1 182 ALA 182 226 226 ALA ALA A . n 
A 1 183 LYS 183 227 227 LYS LYS A . n 
A 1 184 TRP 184 228 228 TRP TRP A . n 
A 1 185 GLY 185 229 229 GLY GLY A . n 
A 1 186 SER 186 230 230 SER SER A . n 
A 1 187 ASP 187 231 231 ASP ASP A . n 
A 1 188 ASN 188 232 232 ASN ASN A . n 
A 1 189 THR 189 233 233 THR THR A . n 
A 1 190 ILE 190 234 234 ILE ILE A . n 
A 1 191 PHE 191 235 235 PHE PHE A . n 
A 1 192 PHE 192 236 236 PHE PHE A . n 
A 1 193 THR 193 237 237 THR THR A . n 
A 1 194 THR 194 238 238 THR THR A . n 
A 1 195 TYR 195 239 239 TYR TYR A . n 
A 1 196 ALA 196 240 240 ALA ALA A . n 
A 1 197 ASN 197 241 241 ASN ASN A . n 
A 1 198 GLY 198 242 242 GLY GLY A . n 
A 1 199 SER 199 243 243 SER SER A . n 
A 1 200 CYS 200 244 244 CYS CYS A . n 
A 1 201 LYS 201 245 245 LYS LYS A . n 
A 1 202 ALA 202 246 246 ALA ALA A . n 
A 1 203 ASP 203 247 247 ASP ASP A . n 
A 1 204 LEU 204 248 248 LEU LEU A . n 
A 1 205 GLY 205 249 249 GLY GLY A . n 
A 1 206 ALA 206 250 250 ALA ALA A . n 
A 1 207 LEU 207 251 251 LEU LEU A . n 
A 1 208 GLU 208 252 252 GLU GLU A . n 
A 1 209 LEU 209 253 253 LEU LEU A . n 
A 1 210 TRP 210 254 254 TRP TRP A . n 
A 1 211 ARG 211 255 255 ARG ARG A . n 
A 1 212 THR 212 256 256 THR THR A . n 
A 1 213 SER 213 257 257 SER SER A . n 
A 1 214 ASP 214 258 258 ASP ASP A . n 
A 1 215 LEU 215 259 259 LEU LEU A . n 
A 1 216 GLY 216 260 260 GLY GLY A . n 
A 1 217 LYS 217 261 261 LYS LYS A . n 
A 1 218 SER 218 262 262 SER SER A . n 
A 1 219 PHE 219 263 263 PHE PHE A . n 
A 1 220 LYS 220 264 264 LYS LYS A . n 
A 1 221 THR 221 265 265 THR THR A . n 
A 1 222 ILE 222 266 266 ILE ILE A . n 
A 1 223 GLY 223 267 267 GLY GLY A . n 
A 1 224 VAL 224 268 268 VAL VAL A . n 
A 1 225 LYS 225 269 269 LYS LYS A . n 
A 1 226 ILE 226 270 270 ILE ILE A . n 
A 1 227 TYR 227 271 271 TYR TYR A . n 
A 1 228 SER 228 272 272 SER SER A . n 
A 1 229 PHE 229 273 273 PHE PHE A . n 
A 1 230 GLY 230 274 274 GLY GLY A . n 
A 1 231 LEU 231 275 275 LEU LEU A . n 
A 1 232 GLY 232 276 276 GLY GLY A . n 
A 1 233 GLY 233 277 277 GLY GLY A . n 
A 1 234 ARG 234 278 278 ARG ARG A . n 
A 1 235 PHE 235 279 279 PHE PHE A . n 
A 1 236 LEU 236 280 280 LEU LEU A . n 
A 1 237 PHE 237 281 281 PHE PHE A . n 
A 1 238 ALA 238 282 282 ALA ALA A . n 
A 1 239 SER 239 283 283 SER SER A . n 
A 1 240 VAL 240 284 284 VAL VAL A . n 
A 1 241 MET 241 285 285 MET MET A . n 
A 1 242 ALA 242 286 286 ALA ALA A . n 
A 1 243 ASP 243 287 287 ASP ASP A . n 
A 1 244 LYS 244 288 288 LYS LYS A . n 
A 1 245 ASP 245 289 289 ASP ASP A . n 
A 1 246 THR 246 290 290 THR THR A . n 
A 1 247 THR 247 291 291 THR THR A . n 
A 1 248 ARG 248 292 292 ARG ARG A . n 
A 1 249 ARG 249 293 293 ARG ARG A . n 
A 1 250 ILE 250 294 294 ILE ILE A . n 
A 1 251 HIS 251 295 295 HIS HIS A . n 
A 1 252 VAL 252 296 296 VAL VAL A . n 
A 1 253 SER 253 297 297 SER SER A . n 
A 1 254 THR 254 298 298 THR THR A . n 
A 1 255 ASP 255 299 299 ASP ASP A . n 
A 1 256 GLN 256 300 300 GLN GLN A . n 
A 1 257 GLY 257 301 301 GLY GLY A . n 
A 1 258 ASP 258 302 302 ASP ASP A . n 
A 1 259 THR 259 303 303 THR THR A . n 
A 1 260 TRP 260 304 304 TRP TRP A . n 
A 1 261 SER 261 305 305 SER SER A . n 
A 1 262 MET 262 306 306 MET MET A . n 
A 1 263 ALA 263 307 307 ALA ALA A . n 
A 1 264 GLN 264 308 308 GLN GLN A . n 
A 1 265 LEU 265 309 309 LEU LEU A . n 
A 1 266 PRO 266 310 310 PRO PRO A . n 
A 1 267 SER 267 311 311 SER SER A . n 
A 1 268 VAL 268 312 312 VAL VAL A . n 
A 1 269 GLY 269 313 313 GLY GLY A . n 
A 1 270 GLN 270 314 314 GLN GLN A . n 
A 1 271 GLU 271 315 315 GLU GLU A . n 
A 1 272 GLN 272 316 316 GLN GLN A . n 
A 1 273 PHE 273 317 317 PHE PHE A . n 
A 1 274 TYR 274 318 318 TYR TYR A . n 
A 1 275 SER 275 319 319 SER SER A . n 
A 1 276 ILE 276 320 320 ILE ILE A . n 
A 1 277 LEU 277 321 321 LEU LEU A . n 
A 1 278 ALA 278 322 322 ALA ALA A . n 
A 1 279 ALA 279 323 323 ALA ALA A . n 
A 1 280 ASN 280 324 324 ASN ASN A . n 
A 1 281 ASP 281 325 325 ASP ASP A . n 
A 1 282 ASP 282 326 326 ASP ASP A . n 
A 1 283 MET 283 327 327 MET MET A . n 
A 1 284 VAL 284 328 328 VAL VAL A . n 
A 1 285 PHE 285 329 329 PHE PHE A . n 
A 1 286 MET 286 330 330 MET MET A . n 
A 1 287 HIS 287 331 331 HIS HIS A . n 
A 1 288 VAL 288 332 332 VAL VAL A . n 
A 1 289 ASP 289 333 333 ASP ASP A . n 
A 1 290 GLU 290 334 334 GLU GLU A . n 
A 1 291 PRO 291 335 335 PRO PRO A . n 
A 1 292 GLY 292 336 336 GLY GLY A . n 
A 1 293 ASP 293 337 337 ASP ASP A . n 
A 1 294 THR 294 338 338 THR THR A . n 
A 1 295 GLY 295 339 339 GLY GLY A . n 
A 1 296 PHE 296 340 340 PHE PHE A . n 
A 1 297 GLY 297 341 341 GLY GLY A . n 
A 1 298 THR 298 342 342 THR THR A . n 
A 1 299 ILE 299 343 343 ILE ILE A . n 
A 1 300 PHE 300 344 344 PHE PHE A . n 
A 1 301 THR 301 345 345 THR THR A . n 
A 1 302 SER 302 346 346 SER SER A . n 
A 1 303 ASP 303 347 347 ASP ASP A . n 
A 1 304 ASP 304 348 348 ASP ASP A . n 
A 1 305 ARG 305 349 349 ARG ARG A . n 
A 1 306 GLY 306 350 350 GLY GLY A . n 
A 1 307 ILE 307 351 351 ILE ILE A . n 
A 1 308 VAL 308 352 352 VAL VAL A . n 
A 1 309 TYR 309 353 353 TYR TYR A . n 
A 1 310 SER 310 354 354 SER SER A . n 
A 1 311 LYS 311 355 355 LYS LYS A . n 
A 1 312 SER 312 356 356 SER SER A . n 
A 1 313 LEU 313 357 357 LEU LEU A . n 
A 1 314 ASP 314 358 358 ASP ASP A . n 
A 1 315 ARG 315 359 359 ARG ARG A . n 
A 1 316 HIS 316 360 360 HIS HIS A . n 
A 1 317 LEU 317 361 361 LEU LEU A . n 
A 1 318 TYR 318 362 362 TYR TYR A . n 
A 1 319 THR 319 363 363 THR THR A . n 
A 1 320 THR 320 364 364 THR THR A . n 
A 1 321 THR 321 365 365 THR THR A . n 
A 1 322 GLY 322 366 366 GLY GLY A . n 
A 1 323 GLY 323 367 367 GLY GLY A . n 
A 1 324 GLU 324 368 368 GLU GLU A . n 
A 1 325 THR 325 369 369 THR THR A . n 
A 1 326 ASP 326 370 370 ASP ASP A . n 
A 1 327 PHE 327 371 371 PHE PHE A . n 
A 1 328 THR 328 372 372 THR THR A . n 
A 1 329 ASN 329 373 373 ASN ASN A . n 
A 1 330 VAL 330 374 374 VAL VAL A . n 
A 1 331 THR 331 375 375 THR THR A . n 
A 1 332 SER 332 376 376 SER SER A . n 
A 1 333 LEU 333 377 377 LEU LEU A . n 
A 1 334 ARG 334 378 378 ARG ARG A . n 
A 1 335 GLY 335 379 379 GLY GLY A . n 
A 1 336 VAL 336 380 380 VAL VAL A . n 
A 1 337 TYR 337 381 381 TYR TYR A . n 
A 1 338 ILE 338 382 382 ILE ILE A . n 
A 1 339 THR 339 383 383 THR THR A . n 
A 1 340 SER 340 384 384 SER SER A . n 
A 1 341 VAL 341 385 385 VAL VAL A . n 
A 1 342 LEU 342 386 386 LEU LEU A . n 
A 1 343 SER 343 387 387 SER SER A . n 
A 1 344 GLU 344 388 388 GLU GLU A . n 
A 1 345 ASP 345 389 389 ASP ASP A . n 
A 1 346 ASN 346 390 390 ASN ASN A . n 
A 1 347 SER 347 391 391 SER SER A . n 
A 1 348 ILE 348 392 392 ILE ILE A . n 
A 1 349 GLN 349 393 393 GLN GLN A . n 
A 1 350 THR 350 394 394 THR THR A . n 
A 1 351 MET 351 395 395 MET MET A . n 
A 1 352 ILE 352 396 396 ILE ILE A . n 
A 1 353 THR 353 397 397 THR THR A . n 
A 1 354 PHE 354 398 398 PHE PHE A . n 
A 1 355 ASP 355 399 399 ASP ASP A . n 
A 1 356 GLN 356 400 400 GLN GLN A . n 
A 1 357 GLY 357 401 401 GLY GLY A . n 
A 1 358 GLY 358 402 402 GLY GLY A . n 
A 1 359 ARG 359 403 403 ARG ARG A . n 
A 1 360 TRP 360 404 404 TRP TRP A . n 
A 1 361 THR 361 405 405 THR THR A . n 
A 1 362 HIS 362 406 406 HIS HIS A . n 
A 1 363 LEU 363 407 407 LEU LEU A . n 
A 1 364 ARG 364 408 408 ARG ARG A . n 
A 1 365 LYS 365 409 409 LYS LYS A . n 
A 1 366 PRO 366 410 410 PRO PRO A . n 
A 1 367 GLU 367 411 411 GLU GLU A . n 
A 1 368 ASN 368 412 412 ASN ASN A . n 
A 1 369 SER 369 413 413 SER SER A . n 
A 1 370 GLU 370 414 414 GLU GLU A . n 
A 1 371 CYS 371 415 415 CYS CYS A . n 
A 1 372 ASP 372 416 416 ASP ASP A . n 
A 1 373 ALA 373 417 417 ALA ALA A . n 
A 1 374 THR 374 418 418 THR THR A . n 
A 1 375 ALA 375 419 419 ALA ALA A . n 
A 1 376 LYS 376 420 420 LYS LYS A . n 
A 1 377 ASN 377 421 421 ASN ASN A . n 
A 1 378 LYS 378 422 422 LYS LYS A . n 
A 1 379 ASN 379 423 423 ASN ASN A . n 
A 1 380 GLU 380 424 424 GLU GLU A . n 
A 1 381 CYS 381 425 425 CYS CYS A . n 
A 1 382 SER 382 426 426 SER SER A . n 
A 1 383 LEU 383 427 427 LEU LEU A . n 
A 1 384 HIS 384 428 428 HIS HIS A . n 
A 1 385 ILE 385 429 429 ILE ILE A . n 
A 1 386 HIS 386 430 430 HIS HIS A . n 
A 1 387 ALA 387 431 431 ALA ALA A . n 
A 1 388 SER 388 432 432 SER SER A . n 
A 1 389 TYR 389 433 433 TYR TYR A . n 
A 1 390 SER 390 434 434 SER SER A . n 
A 1 391 ILE 391 435 435 ILE ILE A . n 
A 1 392 SER 392 436 436 SER SER A . n 
A 1 393 GLN 393 437 437 GLN GLN A . n 
A 1 394 LYS 394 438 438 LYS LYS A . n 
A 1 395 LEU 395 439 439 LEU LEU A . n 
A 1 396 ASN 396 440 440 ASN ASN A . n 
A 1 397 VAL 397 441 441 VAL VAL A . n 
A 1 398 PRO 398 442 442 PRO PRO A . n 
A 1 399 MET 399 443 443 MET MET A . n 
A 1 400 ALA 400 444 444 ALA ALA A . n 
A 1 401 PRO 401 445 445 PRO PRO A . n 
A 1 402 LEU 402 446 446 LEU LEU A . n 
A 1 403 SER 403 447 447 SER SER A . n 
A 1 404 GLU 404 448 448 GLU GLU A . n 
A 1 405 PRO 405 449 449 PRO PRO A . n 
A 1 406 ASN 406 450 450 ASN ASN A . n 
A 1 407 ALA 407 451 451 ALA ALA A . n 
A 1 408 VAL 408 452 452 VAL VAL A . n 
A 1 409 GLY 409 453 453 GLY GLY A . n 
A 1 410 ILE 410 454 454 ILE ILE A . n 
A 1 411 VAL 411 455 455 VAL VAL A . n 
A 1 412 ILE 412 456 456 ILE ILE A . n 
A 1 413 ALA 413 457 457 ALA ALA A . n 
A 1 414 HIS 414 458 458 HIS HIS A . n 
A 1 415 GLY 415 459 459 GLY GLY A . n 
A 1 416 SER 416 460 460 SER SER A . n 
A 1 417 VAL 417 461 461 VAL VAL A . n 
A 1 418 GLY 418 462 462 GLY GLY A . n 
A 1 419 ASP 419 463 463 ASP ASP A . n 
A 1 420 ALA 420 464 464 ALA ALA A . n 
A 1 421 ILE 421 465 465 ILE ILE A . n 
A 1 422 SER 422 466 466 SER SER A . n 
A 1 423 VAL 423 467 467 VAL VAL A . n 
A 1 424 MET 424 468 468 MET MET A . n 
A 1 425 VAL 425 469 469 VAL VAL A . n 
A 1 426 PRO 426 470 470 PRO PRO A . n 
A 1 427 ASP 427 471 471 ASP ASP A . n 
A 1 428 VAL 428 472 472 VAL VAL A . n 
A 1 429 TYR 429 473 473 TYR TYR A . n 
A 1 430 ILE 430 474 474 ILE ILE A . n 
A 1 431 SER 431 475 475 SER SER A . n 
A 1 432 ASP 432 476 476 ASP ASP A . n 
A 1 433 ASP 433 477 477 ASP ASP A . n 
A 1 434 GLY 434 478 478 GLY GLY A . n 
A 1 435 GLY 435 479 479 GLY GLY A . n 
A 1 436 TYR 436 480 480 TYR TYR A . n 
A 1 437 SER 437 481 481 SER SER A . n 
A 1 438 TRP 438 482 482 TRP TRP A . n 
A 1 439 THR 439 483 483 THR THR A . n 
A 1 440 LYS 440 484 484 LYS LYS A . n 
A 1 441 MET 441 485 485 MET MET A . n 
A 1 442 LEU 442 486 486 LEU LEU A . n 
A 1 443 GLU 443 487 487 GLU GLU A . n 
A 1 444 GLY 444 488 488 GLY GLY A . n 
A 1 445 PRO 445 489 489 PRO PRO A . n 
A 1 446 HIS 446 490 490 HIS HIS A . n 
A 1 447 TYR 447 491 491 TYR TYR A . n 
A 1 448 TYR 448 492 492 TYR TYR A . n 
A 1 449 THR 449 493 493 THR THR A . n 
A 1 450 ILE 450 494 494 ILE ILE A . n 
A 1 451 LEU 451 495 495 LEU LEU A . n 
A 1 452 ASP 452 496 496 ASP ASP A . n 
A 1 453 SER 453 497 497 SER SER A . n 
A 1 454 GLY 454 498 498 GLY GLY A . n 
A 1 455 GLY 455 499 499 GLY GLY A . n 
A 1 456 ILE 456 500 500 ILE ILE A . n 
A 1 457 ILE 457 501 501 ILE ILE A . n 
A 1 458 VAL 458 502 502 VAL VAL A . n 
A 1 459 ALA 459 503 503 ALA ALA A . n 
A 1 460 ILE 460 504 504 ILE ILE A . n 
A 1 461 GLU 461 505 505 GLU GLU A . n 
A 1 462 HIS 462 506 506 HIS HIS A . n 
A 1 463 SER 463 507 507 SER SER A . n 
A 1 464 SER 464 508 508 SER SER A . n 
A 1 465 ARG 465 509 509 ARG ARG A . n 
A 1 466 PRO 466 510 510 PRO PRO A . n 
A 1 467 ILE 467 511 511 ILE ILE A . n 
A 1 468 ASN 468 512 512 ASN ASN A . n 
A 1 469 VAL 469 513 513 VAL VAL A . n 
A 1 470 ILE 470 514 514 ILE ILE A . n 
A 1 471 LYS 471 515 515 LYS LYS A . n 
A 1 472 PHE 472 516 516 PHE PHE A . n 
A 1 473 SER 473 517 517 SER SER A . n 
A 1 474 THR 474 518 518 THR THR A . n 
A 1 475 ASP 475 519 519 ASP ASP A . n 
A 1 476 GLU 476 520 520 GLU GLU A . n 
A 1 477 GLY 477 521 521 GLY GLY A . n 
A 1 478 GLN 478 522 522 GLN GLN A . n 
A 1 479 CYS 479 523 523 CYS CYS A . n 
A 1 480 TRP 480 524 524 TRP TRP A . n 
A 1 481 GLN 481 525 525 GLN GLN A . n 
A 1 482 THR 482 526 526 THR THR A . n 
A 1 483 TYR 483 527 527 TYR TYR A . n 
A 1 484 THR 484 528 528 THR THR A . n 
A 1 485 PHE 485 529 529 PHE PHE A . n 
A 1 486 THR 486 530 530 THR THR A . n 
A 1 487 ARG 487 531 531 ARG ARG A . n 
A 1 488 ASP 488 532 532 ASP ASP A . n 
A 1 489 PRO 489 533 533 PRO PRO A . n 
A 1 490 ILE 490 534 534 ILE ILE A . n 
A 1 491 TYR 491 535 535 TYR TYR A . n 
A 1 492 PHE 492 536 536 PHE PHE A . n 
A 1 493 THR 493 537 537 THR THR A . n 
A 1 494 GLY 494 538 538 GLY GLY A . n 
A 1 495 LEU 495 539 539 LEU LEU A . n 
A 1 496 ALA 496 540 540 ALA ALA A . n 
A 1 497 SER 497 541 541 SER SER A . n 
A 1 498 GLU 498 542 542 GLU GLU A . n 
A 1 499 PRO 499 543 543 PRO PRO A . n 
A 1 500 GLY 500 544 544 GLY GLY A . n 
A 1 501 ALA 501 545 545 ALA ALA A . n 
A 1 502 ARG 502 546 546 ARG ARG A . n 
A 1 503 SER 503 547 547 SER SER A . n 
A 1 504 MET 504 548 548 MET MET A . n 
A 1 505 ASN 505 549 549 ASN ASN A . n 
A 1 506 ILE 506 550 550 ILE ILE A . n 
A 1 507 SER 507 551 551 SER SER A . n 
A 1 508 ILE 508 552 552 ILE ILE A . n 
A 1 509 TRP 509 553 553 TRP TRP A . n 
A 1 510 GLY 510 554 554 GLY GLY A . n 
A 1 511 PHE 511 555 555 PHE PHE A . n 
A 1 512 THR 512 556 556 THR THR A . n 
A 1 513 GLU 513 557 557 GLU GLU A . n 
A 1 514 SER 514 558 558 SER SER A . n 
A 1 515 PHE 515 559 ?   ?   ?   A . n 
A 1 516 LEU 516 560 ?   ?   ?   A . n 
A 1 517 THR 517 561 561 THR THR A . n 
A 1 518 SER 518 562 562 SER SER A . n 
A 1 519 GLN 519 563 563 GLN GLN A . n 
A 1 520 TRP 520 564 564 TRP TRP A . n 
A 1 521 VAL 521 565 565 VAL VAL A . n 
A 1 522 SER 522 566 566 SER SER A . n 
A 1 523 TYR 523 567 567 TYR TYR A . n 
A 1 524 THR 524 568 568 THR THR A . n 
A 1 525 ILE 525 569 569 ILE ILE A . n 
A 1 526 ASP 526 570 570 ASP ASP A . n 
A 1 527 PHE 527 571 571 PHE PHE A . n 
A 1 528 LYS 528 572 572 LYS LYS A . n 
A 1 529 ASP 529 573 573 ASP ASP A . n 
A 1 530 ILE 530 574 574 ILE ILE A . n 
A 1 531 LEU 531 575 575 LEU LEU A . n 
A 1 532 GLU 532 576 576 GLU GLU A . n 
A 1 533 ARG 533 577 577 ARG ARG A . n 
A 1 534 ASN 534 578 578 ASN ASN A . n 
A 1 535 CYS 535 579 579 CYS CYS A . n 
A 1 536 GLU 536 580 580 GLU GLU A . n 
A 1 537 GLU 537 581 581 GLU GLU A . n 
A 1 538 LYS 538 582 582 LYS LYS A . n 
A 1 539 ASP 539 583 583 ASP ASP A . n 
A 1 540 TYR 540 584 584 TYR TYR A . n 
A 1 541 THR 541 585 585 THR THR A . n 
A 1 542 ILE 542 586 586 ILE ILE A . n 
A 1 543 TRP 543 587 587 TRP TRP A . n 
A 1 544 LEU 544 588 588 LEU LEU A . n 
A 1 545 ALA 545 589 589 ALA ALA A . n 
A 1 546 HIS 546 590 590 HIS HIS A . n 
A 1 547 SER 547 591 591 SER SER A . n 
A 1 548 THR 548 592 592 THR THR A . n 
A 1 549 ASP 549 593 593 ASP ASP A . n 
A 1 550 PRO 550 594 594 PRO PRO A . n 
A 1 551 GLU 551 595 595 GLU GLU A . n 
A 1 552 ASP 552 596 596 ASP ASP A . n 
A 1 553 TYR 553 597 597 TYR TYR A . n 
A 1 554 GLU 554 598 598 GLU GLU A . n 
A 1 555 ASP 555 599 599 ASP ASP A . n 
A 1 556 GLY 556 600 600 GLY GLY A . n 
A 1 557 CYS 557 601 601 CYS CYS A . n 
A 1 558 ILE 558 602 602 ILE ILE A . n 
A 1 559 LEU 559 603 603 LEU LEU A . n 
A 1 560 GLY 560 604 604 GLY GLY A . n 
A 1 561 TYR 561 605 605 TYR TYR A . n 
A 1 562 LYS 562 606 606 LYS LYS A . n 
A 1 563 GLU 563 607 607 GLU GLU A . n 
A 1 564 GLN 564 608 608 GLN GLN A . n 
A 1 565 PHE 565 609 609 PHE PHE A . n 
A 1 566 LEU 566 610 610 LEU LEU A . n 
A 1 567 ARG 567 611 611 ARG ARG A . n 
A 1 568 LEU 568 612 612 LEU LEU A . n 
A 1 569 ARG 569 613 613 ARG ARG A . n 
A 1 570 LYS 570 614 614 LYS LYS A . n 
A 1 571 SER 571 615 615 SER SER A . n 
A 1 572 SER 572 616 616 SER SER A . n 
A 1 573 MET 573 617 617 MET MET A . n 
A 1 574 CYS 574 618 618 CYS CYS A . n 
A 1 575 GLN 575 619 619 GLN GLN A . n 
A 1 576 ASN 576 620 620 ASN ASN A . n 
A 1 577 GLY 577 621 621 GLY GLY A . n 
A 1 578 ARG 578 622 622 ARG ARG A . n 
A 1 579 ASP 579 623 623 ASP ASP A . n 
A 1 580 TYR 580 624 624 TYR TYR A . n 
A 1 581 VAL 581 625 625 VAL VAL A . n 
A 1 582 VAL 582 626 626 VAL VAL A . n 
A 1 583 THR 583 627 627 THR THR A . n 
A 1 584 LYS 584 628 628 LYS LYS A . n 
A 1 585 GLN 585 629 629 GLN GLN A . n 
A 1 586 PRO 586 630 630 PRO PRO A . n 
A 1 587 SER 587 631 631 SER SER A . n 
A 1 588 ILE 588 632 632 ILE ILE A . n 
A 1 589 CYS 589 633 633 CYS CYS A . n 
A 1 590 LEU 590 634 634 LEU LEU A . n 
A 1 591 CYS 591 635 635 CYS CYS A . n 
A 1 592 SER 592 636 636 SER SER A . n 
A 1 593 LEU 593 637 637 LEU LEU A . n 
A 1 594 GLU 594 638 638 GLU GLU A . n 
A 1 595 ASP 595 639 639 ASP ASP A . n 
A 1 596 PHE 596 640 640 PHE PHE A . n 
A 1 597 LEU 597 641 641 LEU LEU A . n 
A 1 598 CYS 598 642 642 CYS CYS A . n 
A 1 599 ASP 599 643 643 ASP ASP A . n 
A 1 600 PHE 600 644 644 PHE PHE A . n 
A 1 601 GLY 601 645 645 GLY GLY A . n 
A 1 602 TYR 602 646 646 TYR TYR A . n 
A 1 603 TYR 603 647 647 TYR TYR A . n 
A 1 604 ARG 604 648 648 ARG ARG A . n 
A 1 605 PRO 605 649 649 PRO PRO A . n 
A 1 606 GLU 606 650 650 GLU GLU A . n 
A 1 607 ASN 607 651 651 ASN ASN A . n 
A 1 608 ASP 608 652 652 ASP ASP A . n 
A 1 609 SER 609 653 653 SER SER A . n 
A 1 610 LYS 610 654 654 LYS LYS A . n 
A 1 611 CYS 611 655 655 CYS CYS A . n 
A 1 612 VAL 612 656 656 VAL VAL A . n 
A 1 613 GLU 613 657 657 GLU GLU A . n 
A 1 614 GLN 614 658 658 GLN GLN A . n 
A 1 615 PRO 615 659 659 PRO PRO A . n 
A 1 616 GLU 616 660 660 GLU GLU A . n 
A 1 617 LEU 617 661 661 LEU LEU A . n 
A 1 618 LYS 618 662 662 LYS LYS A . n 
A 1 619 GLY 619 663 663 GLY GLY A . n 
A 1 620 HIS 620 664 664 HIS HIS A . n 
A 1 621 ASP 621 665 665 ASP ASP A . n 
A 1 622 LEU 622 666 666 LEU LEU A . n 
A 1 623 GLU 623 667 667 GLU GLU A . n 
A 1 624 PHE 624 668 668 PHE PHE A . n 
A 1 625 CYS 625 669 669 CYS CYS A . n 
A 1 626 LEU 626 670 670 LEU LEU A . n 
A 1 627 TYR 627 671 671 TYR TYR A . n 
A 1 628 GLY 628 672 672 GLY GLY A . n 
A 1 629 ARG 629 673 673 ARG ARG A . n 
A 1 630 GLU 630 674 674 GLU GLU A . n 
A 1 631 GLU 631 675 675 GLU GLU A . n 
A 1 632 HIS 632 676 676 HIS HIS A . n 
A 1 633 LEU 633 677 677 LEU LEU A . n 
A 1 634 THR 634 678 678 THR THR A . n 
A 1 635 THR 635 679 679 THR THR A . n 
A 1 636 ASN 636 680 680 ASN ASN A . n 
A 1 637 GLY 637 681 681 GLY GLY A . n 
A 1 638 TYR 638 682 682 TYR TYR A . n 
A 1 639 ARG 639 683 683 ARG ARG A . n 
A 1 640 LYS 640 684 684 LYS LYS A . n 
A 1 641 ILE 641 685 685 ILE ILE A . n 
A 1 642 PRO 642 686 686 PRO PRO A . n 
A 1 643 GLY 643 687 687 GLY GLY A . n 
A 1 644 ASP 644 688 688 ASP ASP A . n 
A 1 645 LYS 645 689 689 LYS LYS A . n 
A 1 646 CYS 646 690 690 CYS CYS A . n 
A 1 647 GLN 647 691 691 GLN GLN A . n 
A 1 648 GLY 648 692 692 GLY GLY A . n 
A 1 649 GLY 649 693 693 GLY GLY A . n 
A 1 650 VAL 650 694 694 VAL VAL A . n 
A 1 651 ASN 651 695 695 ASN ASN A . n 
A 1 652 PRO 652 696 696 PRO PRO A . n 
A 1 653 VAL 653 697 697 VAL VAL A . n 
A 1 654 ARG 654 698 698 ARG ARG A . n 
A 1 655 GLU 655 699 699 GLU GLU A . n 
A 1 656 VAL 656 700 700 VAL VAL A . n 
A 1 657 LYS 657 701 701 LYS LYS A . n 
A 1 658 ASP 658 702 702 ASP ASP A . n 
A 1 659 LEU 659 703 703 LEU LEU A . n 
A 1 660 LYS 660 704 704 LYS LYS A . n 
A 1 661 LYS 661 705 705 LYS LYS A . n 
A 1 662 LYS 662 706 706 LYS LYS A . n 
A 1 663 CYS 663 707 707 CYS CYS A . n 
A 1 664 THR 664 708 708 THR THR A . n 
A 1 665 SER 665 709 709 SER SER A . n 
A 1 666 ASN 666 710 710 ASN ASN A . n 
A 1 667 PHE 667 711 711 PHE PHE A . n 
A 1 668 LEU 668 712 712 LEU LEU A . n 
A 1 669 SER 669 713 713 SER SER A . n 
A 1 670 PRO 670 714 714 PRO PRO A . n 
A 1 671 GLU 671 715 715 GLU GLU A . n 
A 1 672 LYS 672 716 ?   ?   ?   A . n 
A 1 673 GLN 673 717 ?   ?   ?   A . n 
A 1 674 ASN 674 718 ?   ?   ?   A . n 
A 1 675 SER 675 719 ?   ?   ?   A . n 
A 1 676 LYS 676 720 ?   ?   ?   A . n 
A 1 677 SER 677 721 ?   ?   ?   A . n 
A 1 678 ASN 678 722 ?   ?   ?   A . n 
A 1 679 SER 679 723 ?   ?   ?   A . n 
A 1 680 GLY 680 724 ?   ?   ?   A . n 
A 1 681 SER 681 725 ?   ?   ?   A . n 
A 1 682 ALA 682 726 ?   ?   ?   A . n 
A 1 683 MET 683 727 ?   ?   ?   A . n 
A 1 684 ILE 684 728 ?   ?   ?   A . n 
A 1 685 GLU 685 729 ?   ?   ?   A . n 
A 1 686 GLY 686 730 ?   ?   ?   A . n 
A 1 687 ARG 687 731 ?   ?   ?   A . n 
A 1 688 GLY 688 732 ?   ?   ?   A . n 
A 1 689 VAL 689 733 ?   ?   ?   A . n 
A 1 690 GLY 690 734 ?   ?   ?   A . n 
A 1 691 HIS 691 735 ?   ?   ?   A . n 
A 1 692 HIS 692 736 ?   ?   ?   A . n 
A 1 693 HIS 693 737 ?   ?   ?   A . n 
A 1 694 HIS 694 738 ?   ?   ?   A . n 
A 1 695 HIS 695 739 ?   ?   ?   A . n 
A 1 696 HIS 696 740 ?   ?   ?   A . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 329 A ASN 373 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 505 A ASN 549 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2014-01-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -17.4940 36.6506 39.4273  0.8964 0.7899 0.5767 -0.2521 -0.0754 -0.1032 3.0910 5.1885 2.9809 
-2.1932 -0.6000 -0.4584 0.1720  -0.8384 0.2306  0.7959  0.0649  -0.1650 -0.6142 0.3990  -0.1669 
'X-RAY DIFFRACTION' 2 ? refined -28.2968 39.6610 11.1504  0.6850 0.5901 0.4514 0.1333  0.1220  0.0836  2.3265 7.2940 3.9781 
-1.0199 -0.1582 1.2941  0.3741  0.4138  0.3582  -0.0911 -0.2932 0.3290  -1.0896 -0.5930 -0.0551 
'X-RAY DIFFRACTION' 3 ? refined -18.9286 11.3280 21.9023  0.4805 0.3795 0.6396 -0.0807 0.0252  0.0626  3.3568 2.2603 5.5782 
-0.0639 -1.2946 -0.2676 -0.0910 -0.1460 -0.6396 0.4182  -0.1950 -0.0792 0.6809  0.1121  0.2214  
'X-RAY DIFFRACTION' 4 ? refined -18.3975 28.9515 -1.8760  0.4665 0.9513 0.7826 0.0671  0.0677  0.1152  5.2342 3.5579 3.0275 
-2.8021 -0.2462 -0.0239 0.6901  0.9690  -0.0068 -0.6824 -0.7077 -0.0208 -0.1422 -0.4026 0.1242  
'X-RAY DIFFRACTION' 5 ? refined -21.9835 39.0975 -12.3725 0.6608 1.3408 1.0029 0.3042  0.2310  0.3571  4.1353 3.9631 1.8414 
-4.0261 2.7568  -2.7115 0.8433  1.8647  0.9171  -0.6105 -1.3497 -0.8697 0.1359  0.5700  0.3847  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 54:228)'  
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 229:386)' 
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 387:612)' 
'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 613:681)' 
'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 682:715)' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DNA    'data collection' .                             ? 1 
PHASER phasing           .                             ? 2 
PHENIX refinement        '(phenix.refine: 1.8.3_1479)' ? 3 
XDS    'data reduction'  .                             ? 4 
SCALA  'data scaling'    .                             ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 55  ? ? 83.75   5.03    
2 1 TYR A 117 ? ? 85.10   10.20   
3 1 ASN A 129 ? ? 81.50   7.20    
4 1 GLU A 144 ? ? 49.77   -134.02 
5 1 PHE A 170 ? ? 39.39   38.61   
6 1 GLN A 300 ? ? 70.23   38.00   
7 1 ALA A 431 ? ? -143.52 -158.90 
8 1 GLU A 520 ? ? 70.67   40.23   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 45  ? A SER 1   
2  1 Y 1 A ALA 46  ? A ALA 2   
3  1 Y 1 A PRO 47  ? A PRO 3   
4  1 Y 1 A GLY 48  ? A GLY 4   
5  1 Y 1 A GLU 49  ? A GLU 5   
6  1 Y 1 A ASP 50  ? A ASP 6   
7  1 Y 1 A GLU 51  ? A GLU 7   
8  1 Y 1 A GLU 52  ? A GLU 8   
9  1 Y 1 A CYS 53  ? A CYS 9   
10 1 Y 1 A LEU 101 ? A LEU 57  
11 1 Y 1 A VAL 102 ? A VAL 58  
12 1 Y 1 A ILE 103 ? A ILE 59  
13 1 Y 1 A MET 104 ? A MET 60  
14 1 Y 1 A THR 105 ? A THR 61  
15 1 Y 1 A PHE 106 ? A PHE 62  
16 1 Y 1 A GLY 107 ? A GLY 63  
17 1 Y 1 A PHE 559 ? A PHE 515 
18 1 Y 1 A LEU 560 ? A LEU 516 
19 1 Y 1 A LYS 716 ? A LYS 672 
20 1 Y 1 A GLN 717 ? A GLN 673 
21 1 Y 1 A ASN 718 ? A ASN 674 
22 1 Y 1 A SER 719 ? A SER 675 
23 1 Y 1 A LYS 720 ? A LYS 676 
24 1 Y 1 A SER 721 ? A SER 677 
25 1 Y 1 A ASN 722 ? A ASN 678 
26 1 Y 1 A SER 723 ? A SER 679 
27 1 Y 1 A GLY 724 ? A GLY 680 
28 1 Y 1 A SER 725 ? A SER 681 
29 1 Y 1 A ALA 726 ? A ALA 682 
30 1 Y 1 A MET 727 ? A MET 683 
31 1 Y 1 A ILE 728 ? A ILE 684 
32 1 Y 1 A GLU 729 ? A GLU 685 
33 1 Y 1 A GLY 730 ? A GLY 686 
34 1 Y 1 A ARG 731 ? A ARG 687 
35 1 Y 1 A GLY 732 ? A GLY 688 
36 1 Y 1 A VAL 733 ? A VAL 689 
37 1 Y 1 A GLY 734 ? A GLY 690 
38 1 Y 1 A HIS 735 ? A HIS 691 
39 1 Y 1 A HIS 736 ? A HIS 692 
40 1 Y 1 A HIS 737 ? A HIS 693 
41 1 Y 1 A HIS 738 ? A HIS 694 
42 1 Y 1 A HIS 739 ? A HIS 695 
43 1 Y 1 A HIS 740 ? A HIS 696 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 N-ACETYL-D-GLUCOSAMINE                                                NAG 
3 BETA-D-MANNOSE                                                        BMA 
4 'TRIETHYLENE GLYCOL'                                                  PGE 
5 '2-[(6-methylpyridin-2-yl)carbamoyl]-5-(trifluoromethyl)benzoic acid' 2JQ 
6 water                                                                 HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NAG 1  801  800  NAG NAG A . 
C 2 NAG 2  802  801  NAG NAG A . 
D 3 BMA 3  803  804  BMA BMA A . 
E 2 NAG 1  804  802  NAG NAG A . 
F 2 NAG 2  805  803  NAG NAG A . 
G 4 PGE 1  806  805  PGE PGE A . 
H 5 2JQ 1  807  900  2JQ LIG A . 
I 6 HOH 1  1000 1000 HOH HOH A . 
I 6 HOH 2  1001 1001 HOH HOH A . 
I 6 HOH 3  1002 1002 HOH HOH A . 
I 6 HOH 4  1003 1003 HOH HOH A . 
I 6 HOH 5  1004 1004 HOH HOH A . 
I 6 HOH 6  1005 1005 HOH HOH A . 
I 6 HOH 7  1006 1006 HOH HOH A . 
I 6 HOH 8  1007 1007 HOH HOH A . 
I 6 HOH 9  1008 1008 HOH HOH A . 
I 6 HOH 10 1009 1009 HOH HOH A . 
I 6 HOH 11 1010 1010 HOH HOH A . 
I 6 HOH 12 1011 1011 HOH HOH A . 
I 6 HOH 13 1012 1012 HOH HOH A . 
I 6 HOH 14 1013 1013 HOH HOH A . 
I 6 HOH 15 1014 1014 HOH HOH A . 
I 6 HOH 16 1015 1015 HOH HOH A . 
I 6 HOH 17 1016 1016 HOH HOH A . 
I 6 HOH 18 1017 1017 HOH HOH A . 
I 6 HOH 19 1018 1018 HOH HOH A . 
I 6 HOH 20 1019 1019 HOH HOH A . 
I 6 HOH 21 1020 1020 HOH HOH A . 
I 6 HOH 22 1021 1021 HOH HOH A . 
I 6 HOH 23 1022 1022 HOH HOH A . 
I 6 HOH 24 1023 1023 HOH HOH A . 
I 6 HOH 25 1024 1024 HOH HOH A . 
I 6 HOH 26 1025 1025 HOH HOH A . 
I 6 HOH 27 1026 1026 HOH HOH A . 
I 6 HOH 28 1027 1027 HOH HOH A . 
I 6 HOH 29 1028 1028 HOH HOH A . 
I 6 HOH 30 1029 1029 HOH HOH A . 
I 6 HOH 31 1030 1030 HOH HOH A . 
I 6 HOH 32 1031 1031 HOH HOH A . 
I 6 HOH 33 1032 1032 HOH HOH A . 
I 6 HOH 34 1033 1033 HOH HOH A . 
I 6 HOH 35 1034 1034 HOH HOH A . 
I 6 HOH 36 1035 1035 HOH HOH A . 
I 6 HOH 37 1036 1036 HOH HOH A . 
I 6 HOH 38 1037 1037 HOH HOH A . 
I 6 HOH 39 1038 1038 HOH HOH A . 
I 6 HOH 40 1039 1039 HOH HOH A . 
I 6 HOH 41 1040 1040 HOH HOH A . 
I 6 HOH 42 1041 1041 HOH HOH A . 
I 6 HOH 43 1042 1042 HOH HOH A . 
I 6 HOH 44 1043 1043 HOH HOH A . 
I 6 HOH 45 1044 1044 HOH HOH A . 
I 6 HOH 46 1045 1045 HOH HOH A . 
I 6 HOH 47 1046 1046 HOH HOH A . 
I 6 HOH 48 1047 1047 HOH HOH A . 
I 6 HOH 49 1048 1048 HOH HOH A . 
I 6 HOH 50 1049 1049 HOH HOH A . 
I 6 HOH 51 1050 1050 HOH HOH A . 
#