data_4NDH
# 
_entry.id   4NDH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4NDH         
NDB   NA2748       
RCSB  RCSB083064   
WWPDB D_1000083064 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3SZQ . unspecified 
PDB 4NDF . unspecified 
PDB 4NDG . unspecified 
PDB 4NDI . unspecified 
# 
_pdbx_database_status.entry_id                        4NDH 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-10-26 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Schellenberg, M.J.' 1 
'Tumbale, P.S.'      2 
'Williams, R.S.'     3 
# 
_citation.id                        primary 
_citation.title                     'Aprataxin resolves adenylated RNA-DNA junctions to maintain genome integrity.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            506 
_citation.page_first                111 
_citation.page_last                 115 
_citation.year                      2013 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24362567 
_citation.pdbx_database_id_DOI      10.1038/nature12824 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tumbale, P.'        1 
primary 'Williams, J.S.'     2 
primary 'Schellenberg, M.J.' 3 
primary 'Kunkel, T.A.'       4 
primary 'Williams, R.S.'     5 
# 
_cell.entry_id           4NDH 
_cell.length_a           40.397 
_cell.length_b           117.082 
_cell.length_c           118.202 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4NDH 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Aprataxin                                 21259.756 2   ? ? ? ? 
2 polymer     syn "5'-D(P*GP*TP*TP*CP*TP*AP*GP*AP*AP*C)-3'" 3044.017  4   ? ? ? ? 
3 non-polymer syn 'ADENOSINE MONOPHOSPHATE'                 347.221   2   ? ? ? ? 
4 non-polymer syn 'ZINC ION'                                65.409    2   ? ? ? ? 
5 water       nat water                                     18.015    501 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Forkhead-associated domain histidine triad-like protein, FHA-HIT' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GSHMGHWSQGLKISMQDPKMQVYKDEQVVVIKDKYPKARYHWLVLPWTSISSLKAVAREHLELLKHMHTVGEKVIVDFAG
SSKLRFRLGYHAIPSMSHVHLHVISQDFDSPCLKNKKHWNSFNTEYFLESQAVIEMVQEAGRVTVRDGMPELLKLPLRCH
ECQQLLPSIPQLKEHLRKHWTQ
;
;GSHMGHWSQGLKISMQDPKMQVYKDEQVVVIKDKYPKARYHWLVLPWTSISSLKAVAREHLELLKHMHTVGEKVIVDFAG
SSKLRFRLGYHAIPSMSHVHLHVISQDFDSPCLKNKKHWNSFNTEYFLESQAVIEMVQEAGRVTVRDGMPELLKLPLRCH
ECQQLLPSIPQLKEHLRKHWTQ
;
A,B     ? 
2 polydeoxyribonucleotide no no '(DG)(DT)(DT)(DC)(DT)(DA)(DG)(DA)(DA)(DC)' GTTCTAGAAC D,E,G,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   GLY n 
1 6   HIS n 
1 7   TRP n 
1 8   SER n 
1 9   GLN n 
1 10  GLY n 
1 11  LEU n 
1 12  LYS n 
1 13  ILE n 
1 14  SER n 
1 15  MET n 
1 16  GLN n 
1 17  ASP n 
1 18  PRO n 
1 19  LYS n 
1 20  MET n 
1 21  GLN n 
1 22  VAL n 
1 23  TYR n 
1 24  LYS n 
1 25  ASP n 
1 26  GLU n 
1 27  GLN n 
1 28  VAL n 
1 29  VAL n 
1 30  VAL n 
1 31  ILE n 
1 32  LYS n 
1 33  ASP n 
1 34  LYS n 
1 35  TYR n 
1 36  PRO n 
1 37  LYS n 
1 38  ALA n 
1 39  ARG n 
1 40  TYR n 
1 41  HIS n 
1 42  TRP n 
1 43  LEU n 
1 44  VAL n 
1 45  LEU n 
1 46  PRO n 
1 47  TRP n 
1 48  THR n 
1 49  SER n 
1 50  ILE n 
1 51  SER n 
1 52  SER n 
1 53  LEU n 
1 54  LYS n 
1 55  ALA n 
1 56  VAL n 
1 57  ALA n 
1 58  ARG n 
1 59  GLU n 
1 60  HIS n 
1 61  LEU n 
1 62  GLU n 
1 63  LEU n 
1 64  LEU n 
1 65  LYS n 
1 66  HIS n 
1 67  MET n 
1 68  HIS n 
1 69  THR n 
1 70  VAL n 
1 71  GLY n 
1 72  GLU n 
1 73  LYS n 
1 74  VAL n 
1 75  ILE n 
1 76  VAL n 
1 77  ASP n 
1 78  PHE n 
1 79  ALA n 
1 80  GLY n 
1 81  SER n 
1 82  SER n 
1 83  LYS n 
1 84  LEU n 
1 85  ARG n 
1 86  PHE n 
1 87  ARG n 
1 88  LEU n 
1 89  GLY n 
1 90  TYR n 
1 91  HIS n 
1 92  ALA n 
1 93  ILE n 
1 94  PRO n 
1 95  SER n 
1 96  MET n 
1 97  SER n 
1 98  HIS n 
1 99  VAL n 
1 100 HIS n 
1 101 LEU n 
1 102 HIS n 
1 103 VAL n 
1 104 ILE n 
1 105 SER n 
1 106 GLN n 
1 107 ASP n 
1 108 PHE n 
1 109 ASP n 
1 110 SER n 
1 111 PRO n 
1 112 CYS n 
1 113 LEU n 
1 114 LYS n 
1 115 ASN n 
1 116 LYS n 
1 117 LYS n 
1 118 HIS n 
1 119 TRP n 
1 120 ASN n 
1 121 SER n 
1 122 PHE n 
1 123 ASN n 
1 124 THR n 
1 125 GLU n 
1 126 TYR n 
1 127 PHE n 
1 128 LEU n 
1 129 GLU n 
1 130 SER n 
1 131 GLN n 
1 132 ALA n 
1 133 VAL n 
1 134 ILE n 
1 135 GLU n 
1 136 MET n 
1 137 VAL n 
1 138 GLN n 
1 139 GLU n 
1 140 ALA n 
1 141 GLY n 
1 142 ARG n 
1 143 VAL n 
1 144 THR n 
1 145 VAL n 
1 146 ARG n 
1 147 ASP n 
1 148 GLY n 
1 149 MET n 
1 150 PRO n 
1 151 GLU n 
1 152 LEU n 
1 153 LEU n 
1 154 LYS n 
1 155 LEU n 
1 156 PRO n 
1 157 LEU n 
1 158 ARG n 
1 159 CYS n 
1 160 HIS n 
1 161 GLU n 
1 162 CYS n 
1 163 GLN n 
1 164 GLN n 
1 165 LEU n 
1 166 LEU n 
1 167 PRO n 
1 168 SER n 
1 169 ILE n 
1 170 PRO n 
1 171 GLN n 
1 172 LEU n 
1 173 LYS n 
1 174 GLU n 
1 175 HIS n 
1 176 LEU n 
1 177 ARG n 
1 178 LYS n 
1 179 HIS n 
1 180 TRP n 
1 181 THR n 
1 182 GLN n 
2 1   DG  n 
2 2   DT  n 
2 3   DT  n 
2 4   DC  n 
2 5   DT  n 
2 6   DA  n 
2 7   DG  n 
2 8   DA  n 
2 9   DA  n 
2 10  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'APTX, AXA1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET15b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP APTX_HUMAN Q7Z2E3 1 
;GHWSQGLKISMQDPKMQVYKDEQVVVIKDKYPKARYHWLVLPWTSISSLKAVAREHLELLKHMHTVGEKVIVDFAGSSKL
RFRLGYHAIPSMSHVHLHVISQDFDSPCLKNKKHWNSFNTEYFLESQAVIEMVQEAGRVTVRDGMPELLKLPLRCHECQQ
LLPSIPQLKEHLRKHWTQ
;
179 ? 
2 PDB 4NDH       4NDH   2 GTTCTAGAAC 1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4NDH A 5 ? 182 ? Q7Z2E3 179 ? 356 ? 165 342 
2 1 4NDH B 5 ? 182 ? Q7Z2E3 179 ? 356 ? 165 342 
3 2 4NDH D 1 ? 10  ? 4NDH   1   ? 10  ? 1   10  
4 2 4NDH E 1 ? 10  ? 4NDH   1   ? 10  ? 1   10  
5 2 4NDH G 1 ? 10  ? 4NDH   1   ? 10  ? 1   10  
6 2 4NDH H 1 ? 10  ? 4NDH   1   ? 10  ? 1   10  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4NDH GLY A 1 ? UNP Q7Z2E3 ? ? 'EXPRESSION TAG' 161 1 
1 4NDH SER A 2 ? UNP Q7Z2E3 ? ? 'EXPRESSION TAG' 162 2 
1 4NDH HIS A 3 ? UNP Q7Z2E3 ? ? 'EXPRESSION TAG' 163 3 
1 4NDH MET A 4 ? UNP Q7Z2E3 ? ? 'EXPRESSION TAG' 164 4 
2 4NDH GLY B 1 ? UNP Q7Z2E3 ? ? 'EXPRESSION TAG' 161 5 
2 4NDH SER B 2 ? UNP Q7Z2E3 ? ? 'EXPRESSION TAG' 162 6 
2 4NDH HIS B 3 ? UNP Q7Z2E3 ? ? 'EXPRESSION TAG' 163 7 
2 4NDH MET B 4 ? UNP Q7Z2E3 ? ? 'EXPRESSION TAG' 164 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
AMP non-polymer         . 'ADENOSINE MONOPHOSPHATE'            ? 'C10 H14 N5 O7 P' 347.221 
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.entry_id          4NDH 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.58 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   52.27 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    '100 mM Tris, 20% w/v PEG10000, pH 8.5, VAPOR DIFFUSION, temperature 277K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2012-11-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Rosenbaum-Rock double-crystal Si(111)' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
# 
_reflns.entry_id                     4NDH 
_reflns.d_resolution_high            1.848 
_reflns.d_resolution_low             50.0 
_reflns.number_obs                   48759 
_reflns.pdbx_Rmerge_I_obs            0.063 
_reflns.pdbx_netI_over_sigmaI        10.2 
_reflns.pdbx_chi_squared             1.003 
_reflns.pdbx_redundancy              3.8 
_reflns.percent_possible_obs         99.4 
_reflns.B_iso_Wilson_estimate        25.07 
_reflns.observed_criterion_sigma_F   1 
_reflns.observed_criterion_sigma_I   1 
_reflns.number_all                   49053 
_reflns.pdbx_Rsym_value              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.848 1.920  ? ? ? 0.436 ? ? 1.003 3.3 ? 4747 98.5 1  1 
1.920 1.990  ? ? ? 0.326 ? ? 1.004 3.9 ? 4805 99.9 2  1 
1.990 2.080  ? ? ? 0.231 ? ? 1.013 3.9 ? 4838 99.9 3  1 
2.080 2.190  ? ? ? 0.163 ? ? 1.010 3.9 ? 4832 99.9 4  1 
2.190 2.330  ? ? ? 0.124 ? ? 1.010 3.9 ? 4835 99.8 5  1 
2.330 2.510  ? ? ? 0.105 ? ? 0.990 3.9 ? 4875 99.7 6  1 
2.510 2.760  ? ? ? 0.082 ? ? 0.998 3.9 ? 4866 99.5 7  1 
2.760 3.160  ? ? ? 0.055 ? ? 1.003 3.9 ? 4888 99.3 8  1 
3.160 3.990  ? ? ? 0.049 ? ? 0.998 3.7 ? 4942 99.2 9  1 
3.990 50.000 ? ? ? 0.034 ? ? 1.002 3.6 ? 5131 98.4 10 1 
# 
_refine.entry_id                                 4NDH 
_refine.ls_d_res_high                            1.848 
_refine.ls_d_res_low                             32.687 
_refine.pdbx_ls_sigma_F                          1.350 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.3700 
_refine.ls_number_reflns_obs                     48675 
_refine.ls_number_reflns_all                     49053 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1642 
_refine.ls_R_factor_R_work                       0.1625 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.1964 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.05 
_refine.ls_number_reflns_R_free                  2457 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               29.3702 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.1500 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3SZQ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8748 
_refine.B_iso_max                                88.290 
_refine.B_iso_min                                5.820 
_refine.pdbx_overall_phase_error                 19.2300 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2944 
_refine_hist.pdbx_number_atoms_nucleic_acid   824 
_refine_hist.pdbx_number_atoms_ligand         48 
_refine_hist.number_atoms_solvent             501 
_refine_hist.number_atoms_total               4317 
_refine_hist.d_res_high                       1.848 
_refine_hist.d_res_low                        32.687 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           4247 0.005  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          5977 1.099  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     646  0.066  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      591  0.004  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 1682 19.889 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
1.848  1.8840  18 97.0  2475 . 0.2194 0.2597 . 120 . 2595 . . 'X-RAY DIFFRACTION' 
1.8840 1.9224  18 100.0 2590 . 0.2066 0.2381 . 131 . 2721 . . 'X-RAY DIFFRACTION' 
1.9224 1.9642  18 100.0 2484 . 0.1994 0.2444 . 133 . 2617 . . 'X-RAY DIFFRACTION' 
1.9642 2.0099  18 100.0 2542 . 0.1843 0.2365 . 145 . 2687 . . 'X-RAY DIFFRACTION' 
2.0099 2.0602  18 100.0 2526 . 0.1782 0.2195 . 152 . 2678 . . 'X-RAY DIFFRACTION' 
2.0602 2.1159  18 100.0 2540 . 0.1701 0.2192 . 141 . 2681 . . 'X-RAY DIFFRACTION' 
2.1159 2.1781  18 100.0 2556 . 0.1685 0.1944 . 120 . 2676 . . 'X-RAY DIFFRACTION' 
2.1781 2.2484  18 100.0 2590 . 0.1685 0.2247 . 138 . 2728 . . 'X-RAY DIFFRACTION' 
2.2484 2.3287  18 100.0 2510 . 0.1688 0.2134 . 130 . 2640 . . 'X-RAY DIFFRACTION' 
2.3287 2.4220  18 100.0 2578 . 0.1747 0.2605 . 124 . 2702 . . 'X-RAY DIFFRACTION' 
2.4220 2.5321  18 100.0 2568 . 0.1732 0.2142 . 153 . 2721 . . 'X-RAY DIFFRACTION' 
2.5321 2.6656  18 100.0 2548 . 0.1789 0.2220 . 142 . 2690 . . 'X-RAY DIFFRACTION' 
2.6656 2.8325  18 99.0  2547 . 0.1779 0.2271 . 138 . 2685 . . 'X-RAY DIFFRACTION' 
2.8325 3.0511  18 99.0  2579 . 0.1803 0.2162 . 139 . 2718 . . 'X-RAY DIFFRACTION' 
3.0511 3.3578  18 99.0  2623 . 0.1519 0.1650 . 117 . 2740 . . 'X-RAY DIFFRACTION' 
3.3578 3.8431  18 99.0  2584 . 0.1384 0.1799 . 132 . 2716 . . 'X-RAY DIFFRACTION' 
3.8431 4.8393  18 99.0  2617 . 0.1277 0.1532 . 161 . 2778 . . 'X-RAY DIFFRACTION' 
4.8393 32.6919 18 98.0  2761 . 0.1673 0.1771 . 141 . 2902 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4NDH 
_struct.title                     'Human Aprataxin (Aptx) bound to DNA, AMP, and Zn - product complex' 
_struct.pdbx_descriptor           Aprataxin 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4NDH 
_struct_keywords.text            
;protein-DNA complex, DNA repair, 5'-DNA end processing, Histidine Triad domain, HIT domain, Zinc finger, 5'-DNA end recognition, DNA BINDING PROTEIN-DNA complex
;
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 3 ? 
J N N 4 ? 
K N N 5 ? 
L N N 5 ? 
M N N 5 ? 
N N N 5 ? 
O N N 5 ? 
P N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  HIS A 6   ? SER A 8   ? HIS A 166 SER A 168 5 ? 3  
HELX_P HELX_P2  2  GLN A 9   ? MET A 15  ? GLN A 169 MET A 175 1 ? 7  
HELX_P HELX_P3  3  SER A 52  ? VAL A 56  ? SER A 212 VAL A 216 5 ? 5  
HELX_P HELX_P4  4  ALA A 57  ? GLU A 59  ? ALA A 217 GLU A 219 5 ? 3  
HELX_P HELX_P5  5  HIS A 60  ? GLY A 80  ? HIS A 220 GLY A 240 1 ? 21 
HELX_P HELX_P6  6  SER A 81  ? LYS A 83  ? SER A 241 LYS A 243 5 ? 3  
HELX_P HELX_P7  7  ASN A 115 ? THR A 124 ? ASN A 275 THR A 284 1 ? 10 
HELX_P HELX_P8  8  SER A 130 ? GLY A 141 ? SER A 290 GLY A 301 1 ? 12 
HELX_P HELX_P9  9  GLY A 148 ? LEU A 153 ? GLY A 308 LEU A 313 1 ? 6  
HELX_P HELX_P10 10 SER A 168 ? ARG A 177 ? SER A 328 ARG A 337 1 ? 10 
HELX_P HELX_P11 11 LYS A 178 ? TRP A 180 ? LYS A 338 TRP A 340 5 ? 3  
HELX_P HELX_P12 12 GLY B 5   ? SER B 8   ? GLY B 165 SER B 168 5 ? 4  
HELX_P HELX_P13 13 GLN B 9   ? GLN B 16  ? GLN B 169 GLN B 176 1 ? 8  
HELX_P HELX_P14 14 SER B 52  ? VAL B 56  ? SER B 212 VAL B 216 5 ? 5  
HELX_P HELX_P15 15 ALA B 57  ? GLU B 59  ? ALA B 217 GLU B 219 5 ? 3  
HELX_P HELX_P16 16 HIS B 60  ? ALA B 79  ? HIS B 220 ALA B 239 1 ? 20 
HELX_P HELX_P17 17 ASN B 115 ? THR B 124 ? ASN B 275 THR B 284 1 ? 10 
HELX_P HELX_P18 18 SER B 130 ? GLY B 141 ? SER B 290 GLY B 301 1 ? 12 
HELX_P HELX_P19 19 GLY B 148 ? LEU B 153 ? GLY B 308 LEU B 313 1 ? 6  
HELX_P HELX_P20 20 SER B 168 ? ARG B 177 ? SER B 328 ARG B 337 1 ? 10 
HELX_P HELX_P21 21 LYS B 178 ? TRP B 180 ? LYS B 338 TRP B 340 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B HIS 179 NE2 ? ? ? 1_555 J ZN . ZN ? ? B HIS 339 B ZN 402 1_555 ? ? ? ? ? ? ?            1.989 ? 
metalc2  metalc ? ? A HIS 179 NE2 ? ? ? 1_555 H ZN . ZN ? ? A HIS 339 A ZN 402 1_555 ? ? ? ? ? ? ?            2.012 ? 
metalc3  metalc ? ? A HIS 175 NE2 ? ? ? 1_555 H ZN . ZN ? ? A HIS 335 A ZN 402 1_555 ? ? ? ? ? ? ?            2.023 ? 
metalc4  metalc ? ? B HIS 175 NE2 ? ? ? 1_555 J ZN . ZN ? ? B HIS 335 B ZN 402 1_555 ? ? ? ? ? ? ?            2.030 ? 
metalc5  metalc ? ? A CYS 162 SG  ? ? ? 1_555 H ZN . ZN ? ? A CYS 322 A ZN 402 1_555 ? ? ? ? ? ? ?            2.275 ? 
metalc6  metalc ? ? B CYS 162 SG  ? ? ? 1_555 J ZN . ZN ? ? B CYS 322 B ZN 402 1_555 ? ? ? ? ? ? ?            2.306 ? 
metalc7  metalc ? ? A CYS 159 SG  ? ? ? 1_555 H ZN . ZN ? ? A CYS 319 A ZN 402 1_555 ? ? ? ? ? ? ?            2.334 ? 
metalc8  metalc ? ? B CYS 159 SG  ? ? ? 1_555 J ZN . ZN ? ? B CYS 319 B ZN 402 1_555 ? ? ? ? ? ? ?            2.341 ? 
hydrog1  hydrog ? ? C DT  2   N3  A ? ? 1_555 D DA 9 N1 ? ? D DT  2   E DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? C DT  2   O4  A ? ? 1_555 D DA 9 N6 ? ? D DT  2   E DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? C DT  3   N3  A ? ? 1_555 D DA 8 N1 ? ? D DT  3   E DA 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? C DT  3   O4  A ? ? 1_555 D DA 8 N6 ? ? D DT  3   E DA 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? C DC  4   N3  ? ? ? 1_555 D DG 7 N1 A ? D DC  4   E DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? C DC  4   N4  ? ? ? 1_555 D DG 7 O6 A ? D DC  4   E DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? C DC  4   O2  ? ? ? 1_555 D DG 7 N2 A ? D DC  4   E DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? C DT  5   N3  ? ? ? 1_555 D DA 6 N1 A ? D DT  5   E DA 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? C DT  5   O4  ? ? ? 1_555 D DA 6 N6 A ? D DT  5   E DA 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? C DA  6   N1  ? ? ? 1_555 D DT 5 N3 ? ? D DA  6   E DT 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? C DA  6   N6  ? ? ? 1_555 D DT 5 O4 ? ? D DA  6   E DT 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? C DG  7   N1  ? ? ? 1_555 D DC 4 N3 ? ? D DG  7   E DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? C DG  7   N2  ? ? ? 1_555 D DC 4 O2 ? ? D DG  7   E DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? C DG  7   O6  ? ? ? 1_555 D DC 4 N4 ? ? D DG  7   E DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? C DA  8   N1  ? ? ? 1_555 D DT 3 N3 ? ? D DA  8   E DT 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? C DA  8   N6  ? ? ? 1_555 D DT 3 O4 ? ? D DA  8   E DT 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? C DA  9   N1  ? ? ? 1_555 D DT 2 N3 ? ? D DA  9   E DT 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? C DA  9   N6  ? ? ? 1_555 D DT 2 O4 ? ? D DA  9   E DT 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? C DC  10  N3  ? ? ? 1_555 D DG 1 N1 ? ? D DC  10  E DG 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? C DC  10  N4  ? ? ? 1_555 D DG 1 O6 ? ? D DC  10  E DG 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? C DC  10  O2  ? ? ? 1_555 D DG 1 N2 ? ? D DC  10  E DG 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? E DT  2   N3  ? ? ? 1_555 F DA 9 N1 ? ? G DT  2   H DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? E DT  2   O4  ? ? ? 1_555 F DA 9 N6 ? ? G DT  2   H DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? E DT  3   N3  ? ? ? 1_555 F DA 8 N1 ? ? G DT  3   H DA 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? E DT  3   O4  ? ? ? 1_555 F DA 8 N6 ? ? G DT  3   H DA 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? E DC  4   N3  ? ? ? 1_555 F DG 7 N1 ? ? G DC  4   H DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? E DC  4   N4  ? ? ? 1_555 F DG 7 O6 ? ? G DC  4   H DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? E DC  4   O2  ? ? ? 1_555 F DG 7 N2 ? ? G DC  4   H DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? E DT  5   N3  ? ? ? 1_555 F DA 6 N1 ? ? G DT  5   H DA 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? E DT  5   O4  ? ? ? 1_555 F DA 6 N6 ? ? G DT  5   H DA 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? E DA  6   N1  ? ? ? 1_555 F DT 5 N3 ? ? G DA  6   H DT 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? E DA  6   N6  ? ? ? 1_555 F DT 5 O4 ? ? G DA  6   H DT 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? E DG  7   N1  ? ? ? 1_555 F DC 4 N3 ? ? G DG  7   H DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? E DG  7   N2  ? ? ? 1_555 F DC 4 O2 ? ? G DG  7   H DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? E DG  7   O6  ? ? ? 1_555 F DC 4 N4 ? ? G DG  7   H DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? E DA  8   N1  ? ? ? 1_555 F DT 3 N3 ? ? G DA  8   H DT 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? E DA  8   N6  ? ? ? 1_555 F DT 3 O4 ? ? G DA  8   H DT 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? E DA  9   N1  ? ? ? 1_555 F DT 2 N3 ? ? G DA  9   H DT 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? E DA  9   N6  ? ? ? 1_555 F DT 2 O4 ? ? G DA  9   H DT 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? E DC  10  N3  ? ? ? 1_555 F DG 1 N1 ? ? G DC  10  H DG 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? E DC  10  N4  ? ? ? 1_555 F DG 1 O6 ? ? G DC  10  H DG 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? E DC  10  O2  ? ? ? 1_555 F DG 1 N2 ? ? G DC  10  H DG 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 6 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 21  ? LYS A 24  ? GLN A 181 LYS A 184 
A 2 VAL A 28  ? LYS A 32  ? VAL A 188 LYS A 192 
A 3 HIS A 41  ? PRO A 46  ? HIS A 201 PRO A 206 
A 4 LEU A 101 ? SER A 105 ? LEU A 261 SER A 265 
A 5 PHE A 86  ? HIS A 91  ? PHE A 246 HIS A 251 
A 6 PHE A 127 ? GLU A 129 ? PHE A 287 GLU A 289 
B 1 LEU A 157 ? ARG A 158 ? LEU A 317 ARG A 318 
B 2 LEU A 165 ? LEU A 166 ? LEU A 325 LEU A 326 
C 1 GLN B 21  ? LYS B 24  ? GLN B 181 LYS B 184 
C 2 VAL B 28  ? LYS B 32  ? VAL B 188 LYS B 192 
C 3 HIS B 41  ? PRO B 46  ? HIS B 201 PRO B 206 
C 4 LEU B 101 ? SER B 105 ? LEU B 261 SER B 265 
C 5 PHE B 86  ? HIS B 91  ? PHE B 246 HIS B 251 
C 6 PHE B 127 ? GLU B 129 ? PHE B 287 GLU B 289 
D 1 LEU B 157 ? ARG B 158 ? LEU B 317 ARG B 318 
D 2 LEU B 165 ? LEU B 166 ? LEU B 325 LEU B 326 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 22  ? N VAL A 182 O VAL A 30  ? O VAL A 190 
A 2 3 N VAL A 29  ? N VAL A 189 O LEU A 45  ? O LEU A 205 
A 3 4 N TRP A 42  ? N TRP A 202 O VAL A 103 ? O VAL A 263 
A 4 5 O HIS A 102 ? O HIS A 262 N GLY A 89  ? N GLY A 249 
A 5 6 N TYR A 90  ? N TYR A 250 O LEU A 128 ? O LEU A 288 
B 1 2 N LEU A 157 ? N LEU A 317 O LEU A 166 ? O LEU A 326 
C 1 2 N TYR B 23  ? N TYR B 183 O VAL B 30  ? O VAL B 190 
C 2 3 N VAL B 29  ? N VAL B 189 O LEU B 45  ? O LEU B 205 
C 3 4 N TRP B 42  ? N TRP B 202 O VAL B 103 ? O VAL B 263 
C 4 5 O HIS B 102 ? O HIS B 262 N GLY B 89  ? N GLY B 249 
C 5 6 N TYR B 90  ? N TYR B 250 O LEU B 128 ? O LEU B 288 
D 1 2 N LEU B 157 ? N LEU B 317 O LEU B 166 ? O LEU B 326 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE AMP A 401' 
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 402'  
AC3 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE AMP B 401' 
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 402'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 18 LEU A 11  ? LEU A 171 . ? 1_555 ? 
2  AC1 18 SER A 14  ? SER A 174 . ? 1_555 ? 
3  AC1 18 ASP A 33  ? ASP A 193 . ? 1_555 ? 
4  AC1 18 LYS A 34  ? LYS A 194 . ? 1_555 ? 
5  AC1 18 TYR A 35  ? TYR A 195 . ? 1_555 ? 
6  AC1 18 LYS A 37  ? LYS A 197 . ? 1_555 ? 
7  AC1 18 HIS A 41  ? HIS A 201 . ? 1_555 ? 
8  AC1 18 LEU A 43  ? LEU A 203 . ? 1_555 ? 
9  AC1 18 HIS A 91  ? HIS A 251 . ? 1_555 ? 
10 AC1 18 PRO A 94  ? PRO A 254 . ? 1_555 ? 
11 AC1 18 SER A 95  ? SER A 255 . ? 1_555 ? 
12 AC1 18 MET A 96  ? MET A 256 . ? 1_555 ? 
13 AC1 18 HIS A 100 ? HIS A 260 . ? 1_555 ? 
14 AC1 18 HIS A 102 ? HIS A 262 . ? 1_555 ? 
15 AC1 18 HOH K .   ? HOH A 513 . ? 1_555 ? 
16 AC1 18 HOH K .   ? HOH A 586 . ? 1_555 ? 
17 AC1 18 HOH K .   ? HOH A 593 . ? 1_555 ? 
18 AC1 18 HOH K .   ? HOH A 602 . ? 1_555 ? 
19 AC2 4  CYS A 159 ? CYS A 319 . ? 1_555 ? 
20 AC2 4  CYS A 162 ? CYS A 322 . ? 1_555 ? 
21 AC2 4  HIS A 175 ? HIS A 335 . ? 1_555 ? 
22 AC2 4  HIS A 179 ? HIS A 339 . ? 1_555 ? 
23 AC3 23 GLY B 10  ? GLY B 170 . ? 1_555 ? 
24 AC3 23 LEU B 11  ? LEU B 171 . ? 1_555 ? 
25 AC3 23 SER B 14  ? SER B 174 . ? 1_555 ? 
26 AC3 23 ILE B 31  ? ILE B 191 . ? 1_555 ? 
27 AC3 23 LYS B 32  ? LYS B 192 . ? 1_555 ? 
28 AC3 23 ASP B 33  ? ASP B 193 . ? 1_555 ? 
29 AC3 23 LYS B 34  ? LYS B 194 . ? 1_555 ? 
30 AC3 23 TYR B 35  ? TYR B 195 . ? 1_555 ? 
31 AC3 23 LEU B 43  ? LEU B 203 . ? 1_555 ? 
32 AC3 23 HIS B 91  ? HIS B 251 . ? 1_555 ? 
33 AC3 23 SER B 95  ? SER B 255 . ? 1_555 ? 
34 AC3 23 MET B 96  ? MET B 256 . ? 1_555 ? 
35 AC3 23 HIS B 100 ? HIS B 260 . ? 1_555 ? 
36 AC3 23 HIS B 102 ? HIS B 262 . ? 1_555 ? 
37 AC3 23 HOH L .   ? HOH B 511 . ? 1_555 ? 
38 AC3 23 HOH L .   ? HOH B 524 . ? 1_555 ? 
39 AC3 23 HOH L .   ? HOH B 539 . ? 1_555 ? 
40 AC3 23 HOH L .   ? HOH B 546 . ? 1_555 ? 
41 AC3 23 HOH L .   ? HOH B 577 . ? 1_555 ? 
42 AC3 23 HOH L .   ? HOH B 607 . ? 1_555 ? 
43 AC3 23 HOH L .   ? HOH B 615 . ? 1_555 ? 
44 AC3 23 HOH L .   ? HOH B 640 . ? 1_555 ? 
45 AC3 23 DG  E 1   ? DG  G 1   . ? 1_555 ? 
46 AC4 4  CYS B 159 ? CYS B 319 . ? 1_555 ? 
47 AC4 4  CYS B 162 ? CYS B 322 . ? 1_555 ? 
48 AC4 4  HIS B 175 ? HIS B 335 . ? 1_555 ? 
49 AC4 4  HIS B 179 ? HIS B 339 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4NDH 
_atom_sites.fract_transf_matrix[1][1]   0.024754 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008541 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008460 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 22.924  13.716 -10.115 1.00 36.57 ? 161 GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 23.101  15.148 -9.941  1.00 37.36 ? 161 GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 22.454  15.646 -8.664  1.00 32.99 ? 161 GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 21.956  14.854 -7.865  1.00 32.60 ? 161 GLY A O     1 
ATOM   5    N  N     . SER A 1 2   ? 22.454  16.963 -8.474  1.00 26.75 ? 162 SER A N     1 
ATOM   6    C  CA    . SER A 1 2   ? 21.927  17.563 -7.253  1.00 23.47 ? 162 SER A CA    1 
ATOM   7    C  C     . SER A 1 2   ? 20.401  17.591 -7.240  1.00 21.27 ? 162 SER A C     1 
ATOM   8    O  O     . SER A 1 2   ? 19.750  17.469 -8.284  1.00 20.70 ? 162 SER A O     1 
ATOM   9    C  CB    . SER A 1 2   ? 22.443  18.994 -7.107  1.00 24.73 ? 162 SER A CB    1 
ATOM   10   O  OG    . SER A 1 2   ? 21.839  19.827 -8.079  1.00 23.52 ? 162 SER A OG    1 
ATOM   11   N  N     . HIS A 1 3   ? 19.825  17.765 -6.057  1.00 19.63 ? 163 HIS A N     1 
ATOM   12   C  CA    A HIS A 1 3   ? 18.379  17.911 -5.953  0.55 22.41 ? 163 HIS A CA    1 
ATOM   13   C  CA    B HIS A 1 3   ? 18.376  17.925 -5.939  0.45 22.40 ? 163 HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 17.920  19.250 -6.536  1.00 20.70 ? 163 HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 16.985  19.297 -7.330  1.00 18.72 ? 163 HIS A O     1 
ATOM   16   C  CB    A HIS A 1 3   ? 17.928  17.757 -4.498  0.55 25.48 ? 163 HIS A CB    1 
ATOM   17   C  CB    B HIS A 1 3   ? 17.927  17.858 -4.478  0.45 24.72 ? 163 HIS A CB    1 
ATOM   18   C  CG    A HIS A 1 3   ? 18.219  16.406 -3.918  0.55 29.36 ? 163 HIS A CG    1 
ATOM   19   C  CG    B HIS A 1 3   ? 16.528  18.348 -4.260  0.45 25.88 ? 163 HIS A CG    1 
ATOM   20   N  ND1   A HIS A 1 3   ? 17.605  15.257 -4.367  0.55 32.47 ? 163 HIS A ND1   1 
ATOM   21   N  ND1   B HIS A 1 3   ? 15.417  17.597 -4.580  0.45 29.05 ? 163 HIS A ND1   1 
ATOM   22   C  CD2   A HIS A 1 3   ? 19.060  16.021 -2.929  0.55 33.21 ? 163 HIS A CD2   1 
ATOM   23   C  CD2   B HIS A 1 3   ? 16.059  19.522 -3.773  0.45 28.36 ? 163 HIS A CD2   1 
ATOM   24   C  CE1   A HIS A 1 3   ? 18.054  14.222 -3.679  0.55 33.51 ? 163 HIS A CE1   1 
ATOM   25   C  CE1   B HIS A 1 3   ? 14.325  18.281 -4.288  0.45 27.84 ? 163 HIS A CE1   1 
ATOM   26   N  NE2   A HIS A 1 3   ? 18.938  14.658 -2.800  0.55 34.99 ? 163 HIS A NE2   1 
ATOM   27   N  NE2   B HIS A 1 3   ? 14.687  19.454 -3.799  0.45 27.38 ? 163 HIS A NE2   1 
ATOM   28   N  N     . MET A 1 4   ? 18.586  20.339 -6.153  1.00 19.34 ? 164 MET A N     1 
ATOM   29   C  CA    . MET A 1 4   ? 18.166  21.661 -6.624  1.00 18.79 ? 164 MET A CA    1 
ATOM   30   C  C     . MET A 1 4   ? 18.297  21.820 -8.143  1.00 20.94 ? 164 MET A C     1 
ATOM   31   O  O     . MET A 1 4   ? 17.526  22.551 -8.771  1.00 21.47 ? 164 MET A O     1 
ATOM   32   C  CB    . MET A 1 4   ? 18.938  22.769 -5.896  1.00 21.96 ? 164 MET A CB    1 
ATOM   33   C  CG    . MET A 1 4   ? 20.448  22.692 -6.080  1.00 22.54 ? 164 MET A CG    1 
ATOM   34   S  SD    . MET A 1 4   ? 21.278  24.007 -5.175  1.00 41.58 ? 164 MET A SD    1 
ATOM   35   C  CE    . MET A 1 4   ? 20.968  23.518 -3.487  1.00 51.03 ? 164 MET A CE    1 
ATOM   36   N  N     . GLY A 1 5   ? 19.254  21.112 -8.735  1.00 19.37 ? 165 GLY A N     1 
ATOM   37   C  CA    . GLY A 1 5   ? 19.510  21.220 -10.162 1.00 20.75 ? 165 GLY A CA    1 
ATOM   38   C  C     . GLY A 1 5   ? 18.770  20.202 -11.009 1.00 19.50 ? 165 GLY A C     1 
ATOM   39   O  O     . GLY A 1 5   ? 18.895  20.198 -12.239 1.00 18.58 ? 165 GLY A O     1 
ATOM   40   N  N     . HIS A 1 6   ? 17.986  19.342 -10.365 1.00 14.33 ? 166 HIS A N     1 
ATOM   41   C  CA    . HIS A 1 6   ? 17.253  18.320 -11.096 1.00 14.72 ? 166 HIS A CA    1 
ATOM   42   C  C     . HIS A 1 6   ? 16.173  18.939 -11.983 1.00 13.36 ? 166 HIS A C     1 
ATOM   43   O  O     . HIS A 1 6   ? 15.554  19.936 -11.609 1.00 15.90 ? 166 HIS A O     1 
ATOM   44   C  CB    . HIS A 1 6   ? 16.624  17.314 -10.130 1.00 16.03 ? 166 HIS A CB    1 
ATOM   45   C  CG    . HIS A 1 6   ? 16.020  16.128 -10.810 1.00 16.96 ? 166 HIS A CG    1 
ATOM   46   N  ND1   . HIS A 1 6   ? 14.661  15.983 -10.987 1.00 14.87 ? 166 HIS A ND1   1 
ATOM   47   C  CD2   . HIS A 1 6   ? 16.590  15.030 -11.361 1.00 18.38 ? 166 HIS A CD2   1 
ATOM   48   C  CE1   . HIS A 1 6   ? 14.417  14.843 -11.614 1.00 16.39 ? 166 HIS A CE1   1 
ATOM   49   N  NE2   . HIS A 1 6   ? 15.573  14.249 -11.857 1.00 17.08 ? 166 HIS A NE2   1 
ATOM   50   N  N     . TRP A 1 7   ? 15.944  18.342 -13.151 1.00 13.87 ? 167 TRP A N     1 
ATOM   51   C  CA    . TRP A 1 7   ? 14.974  18.900 -14.103 1.00 14.25 ? 167 TRP A CA    1 
ATOM   52   C  C     . TRP A 1 7   ? 13.600  19.141 -13.495 1.00 15.17 ? 167 TRP A C     1 
ATOM   53   O  O     . TRP A 1 7   ? 12.915  20.091 -13.878 1.00 14.90 ? 167 TRP A O     1 
ATOM   54   C  CB    . TRP A 1 7   ? 14.859  18.041 -15.385 1.00 13.77 ? 167 TRP A CB    1 
ATOM   55   C  CG    . TRP A 1 7   ? 14.350  16.630 -15.155 1.00 12.70 ? 167 TRP A CG    1 
ATOM   56   C  CD1   . TRP A 1 7   ? 15.107  15.489 -15.095 1.00 13.77 ? 167 TRP A CD1   1 
ATOM   57   C  CD2   . TRP A 1 7   ? 12.994  16.222 -14.957 1.00 11.72 ? 167 TRP A CD2   1 
ATOM   58   N  NE1   . TRP A 1 7   ? 14.300  14.401 -14.871 1.00 13.67 ? 167 TRP A NE1   1 
ATOM   59   C  CE2   . TRP A 1 7   ? 12.999  14.821 -14.783 1.00 14.07 ? 167 TRP A CE2   1 
ATOM   60   C  CE3   . TRP A 1 7   ? 11.769  16.900 -14.927 1.00 11.51 ? 167 TRP A CE3   1 
ATOM   61   C  CZ2   . TRP A 1 7   ? 11.834  14.090 -14.566 1.00 14.28 ? 167 TRP A CZ2   1 
ATOM   62   C  CZ3   . TRP A 1 7   ? 10.612  16.172 -14.686 1.00 13.48 ? 167 TRP A CZ3   1 
ATOM   63   C  CH2   . TRP A 1 7   ? 10.651  14.781 -14.525 1.00 16.01 ? 167 TRP A CH2   1 
ATOM   64   N  N     . SER A 1 8   ? 13.202  18.300 -12.536 1.00 12.77 ? 168 SER A N     1 
ATOM   65   C  CA    . SER A 1 8   ? 11.871  18.403 -11.934 1.00 14.97 ? 168 SER A CA    1 
ATOM   66   C  C     . SER A 1 8   ? 11.715  19.652 -11.078 1.00 15.28 ? 168 SER A C     1 
ATOM   67   O  O     . SER A 1 8   ? 10.596  20.037 -10.742 1.00 15.01 ? 168 SER A O     1 
ATOM   68   C  CB    . SER A 1 8   ? 11.537  17.155 -11.090 1.00 13.24 ? 168 SER A CB    1 
ATOM   69   O  OG    . SER A 1 8   ? 12.430  17.043 -9.981  1.00 14.67 ? 168 SER A OG    1 
ATOM   70   N  N     . GLN A 1 9   ? 12.831  20.293 -10.737 1.00 12.83 ? 169 GLN A N     1 
ATOM   71   C  CA    . GLN A 1 9   ? 12.799  21.443 -9.851  1.00 13.74 ? 169 GLN A CA    1 
ATOM   72   C  C     . GLN A 1 9   ? 12.863  22.752 -10.625 1.00 15.23 ? 169 GLN A C     1 
ATOM   73   O  O     . GLN A 1 9   ? 12.994  23.825 -10.028 1.00 14.99 ? 169 GLN A O     1 
ATOM   74   C  CB    . GLN A 1 9   ? 13.966  21.367 -8.861  1.00 16.79 ? 169 GLN A CB    1 
ATOM   75   C  CG    . GLN A 1 9   ? 13.952  20.088 -8.038  1.00 19.77 ? 169 GLN A CG    1 
ATOM   76   C  CD    . GLN A 1 9   ? 12.627  19.877 -7.330  1.00 23.04 ? 169 GLN A CD    1 
ATOM   77   O  OE1   . GLN A 1 9   ? 12.220  20.691 -6.500  1.00 24.82 ? 169 GLN A OE1   1 
ATOM   78   N  NE2   . GLN A 1 9   ? 11.941  18.793 -7.665  1.00 22.95 ? 169 GLN A NE2   1 
ATOM   79   N  N     . GLY A 1 10  ? 12.749  22.653 -11.948 1.00 13.04 ? 170 GLY A N     1 
ATOM   80   C  CA    . GLY A 1 10  ? 12.965  23.784 -12.847 1.00 14.37 ? 170 GLY A CA    1 
ATOM   81   C  C     . GLY A 1 10  ? 12.027  24.969 -12.666 1.00 13.81 ? 170 GLY A C     1 
ATOM   82   O  O     . GLY A 1 10  ? 12.422  26.113 -12.895 1.00 14.69 ? 170 GLY A O     1 
ATOM   83   N  N     . LEU A 1 11  ? 10.787  24.713 -12.263 1.00 13.64 ? 171 LEU A N     1 
ATOM   84   C  CA    . LEU A 1 11  ? 9.840   25.806 -12.067 1.00 13.13 ? 171 LEU A CA    1 
ATOM   85   C  C     . LEU A 1 11  ? 10.250  26.699 -10.914 1.00 17.07 ? 171 LEU A C     1 
ATOM   86   O  O     . LEU A 1 11  ? 9.955   27.891 -10.915 1.00 15.00 ? 171 LEU A O     1 
ATOM   87   C  CB    . LEU A 1 11  ? 8.413   25.294 -11.836 1.00 13.10 ? 171 LEU A CB    1 
ATOM   88   C  CG    . LEU A 1 11  ? 7.785   24.454 -12.944 1.00 13.96 ? 171 LEU A CG    1 
ATOM   89   C  CD1   . LEU A 1 11  ? 6.320   24.188 -12.615 1.00 15.49 ? 171 LEU A CD1   1 
ATOM   90   C  CD2   . LEU A 1 11  ? 7.910   25.155 -14.280 1.00 14.62 ? 171 LEU A CD2   1 
ATOM   91   N  N     . LYS A 1 12  ? 10.933  26.131 -9.926  1.00 14.82 ? 172 LYS A N     1 
ATOM   92   C  CA    . LYS A 1 12  ? 11.361  26.927 -8.779  1.00 16.56 ? 172 LYS A CA    1 
ATOM   93   C  C     . LYS A 1 12  ? 12.362  27.990 -9.209  1.00 18.34 ? 172 LYS A C     1 
ATOM   94   O  O     . LYS A 1 12  ? 12.477  29.048 -8.585  1.00 19.35 ? 172 LYS A O     1 
ATOM   95   C  CB    . LYS A 1 12  ? 11.914  26.025 -7.673  1.00 19.55 ? 172 LYS A CB    1 
ATOM   96   C  CG    . LYS A 1 12  ? 10.823  25.111 -7.125  1.00 25.00 ? 172 LYS A CG    1 
ATOM   97   C  CD    . LYS A 1 12  ? 11.299  24.233 -5.989  1.00 29.65 ? 172 LYS A CD    1 
ATOM   98   C  CE    . LYS A 1 12  ? 10.134  23.425 -5.445  1.00 27.65 ? 172 LYS A CE    1 
ATOM   99   N  NZ    . LYS A 1 12  ? 9.103   24.287 -4.779  1.00 25.94 ? 172 LYS A NZ    1 
ATOM   100  N  N     . ILE A 1 13  ? 13.077  27.709 -10.290 1.00 16.23 ? 173 ILE A N     1 
ATOM   101  C  CA    A ILE A 1 13  ? 14.010  28.676 -10.857 0.55 17.31 ? 173 ILE A CA    1 
ATOM   102  C  CA    B ILE A 1 13  ? 14.008  28.679 -10.857 0.45 16.84 ? 173 ILE A CA    1 
ATOM   103  C  C     . ILE A 1 13  ? 13.272  29.689 -11.736 1.00 16.72 ? 173 ILE A C     1 
ATOM   104  O  O     . ILE A 1 13  ? 13.407  30.901 -11.558 1.00 16.41 ? 173 ILE A O     1 
ATOM   105  C  CB    A ILE A 1 13  ? 15.115  27.965 -11.673 0.55 20.75 ? 173 ILE A CB    1 
ATOM   106  C  CB    B ILE A 1 13  ? 15.115  27.982 -11.678 0.45 20.32 ? 173 ILE A CB    1 
ATOM   107  C  CG1   A ILE A 1 13  ? 15.969  27.085 -10.750 0.55 22.80 ? 173 ILE A CG1   1 
ATOM   108  C  CG1   B ILE A 1 13  ? 16.006  27.145 -10.756 0.45 21.91 ? 173 ILE A CG1   1 
ATOM   109  C  CG2   A ILE A 1 13  ? 15.987  28.980 -12.399 0.55 22.70 ? 173 ILE A CG2   1 
ATOM   110  C  CG2   B ILE A 1 13  ? 15.951  29.007 -12.431 0.45 22.63 ? 173 ILE A CG2   1 
ATOM   111  C  CD1   A ILE A 1 13  ? 16.931  26.166 -11.480 0.55 21.17 ? 173 ILE A CD1   1 
ATOM   112  C  CD1   B ILE A 1 13  ? 16.616  27.937 -9.627  0.45 19.22 ? 173 ILE A CD1   1 
ATOM   113  N  N     . SER A 1 14  ? 12.478  29.194 -12.680 1.00 17.73 ? 174 SER A N     1 
ATOM   114  C  CA    . SER A 1 14  ? 11.766  30.085 -13.604 1.00 16.26 ? 174 SER A CA    1 
ATOM   115  C  C     . SER A 1 14  ? 10.813  31.069 -12.925 1.00 17.21 ? 174 SER A C     1 
ATOM   116  O  O     . SER A 1 14  ? 10.665  32.214 -13.371 1.00 18.19 ? 174 SER A O     1 
ATOM   117  C  CB    . SER A 1 14  ? 11.006  29.271 -14.651 1.00 14.58 ? 174 SER A CB    1 
ATOM   118  O  OG    . SER A 1 14  ? 11.901  28.506 -15.433 1.00 19.21 ? 174 SER A OG    1 
ATOM   119  N  N     . MET A 1 15  ? 10.155  30.634 -11.855 1.00 14.86 ? 175 MET A N     1 
ATOM   120  C  CA    . MET A 1 15  ? 9.178   31.495 -11.205 1.00 17.27 ? 175 MET A CA    1 
ATOM   121  C  C     . MET A 1 15  ? 9.839   32.728 -10.574 1.00 14.17 ? 175 MET A C     1 
ATOM   122  O  O     . MET A 1 15  ? 9.169   33.703 -10.275 1.00 16.05 ? 175 MET A O     1 
ATOM   123  C  CB    . MET A 1 15  ? 8.336   30.720 -10.183 1.00 18.28 ? 175 MET A CB    1 
ATOM   124  C  CG    . MET A 1 15  ? 9.080   30.258 -8.961  1.00 17.82 ? 175 MET A CG    1 
ATOM   125  S  SD    . MET A 1 15  ? 8.010   29.195 -7.944  1.00 19.75 ? 175 MET A SD    1 
ATOM   126  C  CE    . MET A 1 15  ? 7.051   30.430 -7.078  1.00 20.34 ? 175 MET A CE    1 
ATOM   127  N  N     . GLN A 1 16  ? 11.159  32.679 -10.390 1.00 15.29 ? 176 GLN A N     1 
ATOM   128  C  CA    . GLN A 1 16  ? 11.892  33.818 -9.828  1.00 16.85 ? 176 GLN A CA    1 
ATOM   129  C  C     . GLN A 1 16  ? 12.660  34.618 -10.878 1.00 21.62 ? 176 GLN A C     1 
ATOM   130  O  O     . GLN A 1 16  ? 13.354  35.571 -10.539 1.00 20.38 ? 176 GLN A O     1 
ATOM   131  C  CB    . GLN A 1 16  ? 12.873  33.358 -8.740  1.00 18.60 ? 176 GLN A CB    1 
ATOM   132  C  CG    . GLN A 1 16  ? 12.258  32.440 -7.693  1.00 18.05 ? 176 GLN A CG    1 
ATOM   133  C  CD    . GLN A 1 16  ? 11.280  33.163 -6.781  1.00 17.49 ? 176 GLN A CD    1 
ATOM   134  O  OE1   . GLN A 1 16  ? 11.222  34.391 -6.763  1.00 18.89 ? 176 GLN A OE1   1 
ATOM   135  N  NE2   . GLN A 1 16  ? 10.508  32.396 -6.011  1.00 15.58 ? 176 GLN A NE2   1 
ATOM   136  N  N     . ASP A 1 17  ? 12.533  34.234 -12.144 1.00 19.09 ? 177 ASP A N     1 
ATOM   137  C  CA    . ASP A 1 17  ? 13.270  34.896 -13.225 1.00 21.59 ? 177 ASP A CA    1 
ATOM   138  C  C     . ASP A 1 17  ? 12.423  36.031 -13.799 1.00 20.84 ? 177 ASP A C     1 
ATOM   139  O  O     . ASP A 1 17  ? 11.401  35.780 -14.426 1.00 19.61 ? 177 ASP A O     1 
ATOM   140  C  CB    . ASP A 1 17  ? 13.580  33.871 -14.321 1.00 22.66 ? 177 ASP A CB    1 
ATOM   141  C  CG    . ASP A 1 17  ? 14.403  34.442 -15.468 1.00 28.44 ? 177 ASP A CG    1 
ATOM   142  O  OD1   . ASP A 1 17  ? 14.552  35.680 -15.581 1.00 26.71 ? 177 ASP A OD1   1 
ATOM   143  O  OD2   . ASP A 1 17  ? 14.900  33.625 -16.273 1.00 30.83 ? 177 ASP A OD2   1 
ATOM   144  N  N     . PRO A 1 18  ? 12.863  37.285 -13.610 1.00 20.93 ? 178 PRO A N     1 
ATOM   145  C  CA    . PRO A 1 18  ? 12.063  38.443 -14.030 1.00 23.18 ? 178 PRO A CA    1 
ATOM   146  C  C     . PRO A 1 18  ? 11.709  38.413 -15.518 1.00 26.86 ? 178 PRO A C     1 
ATOM   147  O  O     . PRO A 1 18  ? 10.637  38.883 -15.896 1.00 27.52 ? 178 PRO A O     1 
ATOM   148  C  CB    . PRO A 1 18  ? 12.980  39.629 -13.730 1.00 26.13 ? 178 PRO A CB    1 
ATOM   149  C  CG    . PRO A 1 18  ? 13.913  39.130 -12.693 1.00 26.95 ? 178 PRO A CG    1 
ATOM   150  C  CD    . PRO A 1 18  ? 14.143  37.691 -13.012 1.00 24.34 ? 178 PRO A CD    1 
ATOM   151  N  N     . LYS A 1 19  ? 12.582  37.838 -16.342 1.00 23.44 ? 179 LYS A N     1 
ATOM   152  C  CA    . LYS A 1 19  ? 12.329  37.790 -17.781 1.00 23.77 ? 179 LYS A CA    1 
ATOM   153  C  C     . LYS A 1 19  ? 11.234  36.805 -18.156 1.00 22.34 ? 179 LYS A C     1 
ATOM   154  O  O     . LYS A 1 19  ? 10.739  36.822 -19.281 1.00 22.90 ? 179 LYS A O     1 
ATOM   155  C  CB    . LYS A 1 19  ? 13.608  37.455 -18.546 1.00 25.48 ? 179 LYS A CB    1 
ATOM   156  C  CG    . LYS A 1 19  ? 14.699  38.506 -18.411 1.00 27.24 ? 179 LYS A CG    1 
ATOM   157  C  CD    . LYS A 1 19  ? 15.930  38.078 -19.179 1.00 34.64 ? 179 LYS A CD    1 
ATOM   158  C  CE    . LYS A 1 19  ? 17.046  39.089 -19.054 1.00 38.07 ? 179 LYS A CE    1 
ATOM   159  N  NZ    . LYS A 1 19  ? 18.281  38.592 -19.716 1.00 40.64 ? 179 LYS A NZ    1 
ATOM   160  N  N     . MET A 1 20  ? 10.862  35.931 -17.227 1.00 19.22 ? 180 MET A N     1 
ATOM   161  C  CA    . MET A 1 20  ? 9.801   34.977 -17.495 1.00 18.14 ? 180 MET A CA    1 
ATOM   162  C  C     . MET A 1 20  ? 8.490   35.363 -16.824 1.00 18.84 ? 180 MET A C     1 
ATOM   163  O  O     . MET A 1 20  ? 7.445   34.818 -17.153 1.00 16.51 ? 180 MET A O     1 
ATOM   164  C  CB    . MET A 1 20  ? 10.217  33.574 -17.053 1.00 19.93 ? 180 MET A CB    1 
ATOM   165  C  CG    . MET A 1 20  ? 11.454  33.055 -17.770 1.00 24.41 ? 180 MET A CG    1 
ATOM   166  S  SD    . MET A 1 20  ? 11.835  31.369 -17.266 1.00 30.02 ? 180 MET A SD    1 
ATOM   167  C  CE    . MET A 1 20  ? 13.252  31.014 -18.305 1.00 30.70 ? 180 MET A CE    1 
ATOM   168  N  N     . GLN A 1 21  ? 8.552   36.307 -15.889 1.00 17.56 ? 181 GLN A N     1 
ATOM   169  C  CA    . GLN A 1 21  ? 7.367   36.727 -15.144 1.00 17.28 ? 181 GLN A CA    1 
ATOM   170  C  C     . GLN A 1 21  ? 6.531   37.718 -15.947 1.00 17.75 ? 181 GLN A C     1 
ATOM   171  O  O     . GLN A 1 21  ? 7.069   38.657 -16.534 1.00 20.09 ? 181 GLN A O     1 
ATOM   172  C  CB    . GLN A 1 21  ? 7.784   37.370 -13.821 1.00 17.20 ? 181 GLN A CB    1 
ATOM   173  C  CG    . GLN A 1 21  ? 8.558   36.431 -12.891 1.00 17.33 ? 181 GLN A CG    1 
ATOM   174  C  CD    . GLN A 1 21  ? 9.136   37.163 -11.696 1.00 18.72 ? 181 GLN A CD    1 
ATOM   175  O  OE1   . GLN A 1 21  ? 9.359   38.381 -11.743 1.00 18.41 ? 181 GLN A OE1   1 
ATOM   176  N  NE2   . GLN A 1 21  ? 9.377   36.432 -10.617 1.00 14.25 ? 181 GLN A NE2   1 
ATOM   177  N  N     . VAL A 1 22  ? 5.217   37.515 -15.966 1.00 13.58 ? 182 VAL A N     1 
ATOM   178  C  CA    . VAL A 1 22  ? 4.330   38.466 -16.643 1.00 17.36 ? 182 VAL A CA    1 
ATOM   179  C  C     . VAL A 1 22  ? 3.383   39.174 -15.672 1.00 20.62 ? 182 VAL A C     1 
ATOM   180  O  O     . VAL A 1 22  ? 2.778   40.198 -16.007 1.00 19.56 ? 182 VAL A O     1 
ATOM   181  C  CB    . VAL A 1 22  ? 3.521   37.797 -17.773 1.00 20.71 ? 182 VAL A CB    1 
ATOM   182  C  CG1   . VAL A 1 22  ? 4.456   37.117 -18.757 1.00 23.82 ? 182 VAL A CG1   1 
ATOM   183  C  CG2   . VAL A 1 22  ? 2.527   36.808 -17.212 1.00 20.92 ? 182 VAL A CG2   1 
ATOM   184  N  N     . TYR A 1 23  ? 3.262   38.627 -14.467 1.00 17.75 ? 183 TYR A N     1 
ATOM   185  C  CA    . TYR A 1 23  ? 2.392   39.192 -13.439 1.00 19.46 ? 183 TYR A CA    1 
ATOM   186  C  C     . TYR A 1 23  ? 2.877   38.700 -12.084 1.00 18.48 ? 183 TYR A C     1 
ATOM   187  O  O     . TYR A 1 23  ? 3.306   37.549 -11.950 1.00 18.39 ? 183 TYR A O     1 
ATOM   188  C  CB    . TYR A 1 23  ? 0.931   38.771 -13.674 1.00 20.97 ? 183 TYR A CB    1 
ATOM   189  C  CG    . TYR A 1 23  ? -0.027  39.109 -12.535 1.00 23.28 ? 183 TYR A CG    1 
ATOM   190  C  CD1   . TYR A 1 23  ? -0.156  38.267 -11.437 1.00 24.42 ? 183 TYR A CD1   1 
ATOM   191  C  CD2   . TYR A 1 23  ? -0.806  40.255 -12.571 1.00 32.72 ? 183 TYR A CD2   1 
ATOM   192  C  CE1   . TYR A 1 23  ? -1.017  38.562 -10.396 1.00 25.99 ? 183 TYR A CE1   1 
ATOM   193  C  CE2   . TYR A 1 23  ? -1.678  40.558 -11.532 1.00 35.63 ? 183 TYR A CE2   1 
ATOM   194  C  CZ    . TYR A 1 23  ? -1.781  39.698 -10.450 1.00 30.52 ? 183 TYR A CZ    1 
ATOM   195  O  OH    . TYR A 1 23  ? -2.642  39.983 -9.405  1.00 30.89 ? 183 TYR A OH    1 
ATOM   196  N  N     . LYS A 1 24  ? 2.810   39.572 -11.085 1.00 16.38 ? 184 LYS A N     1 
ATOM   197  C  CA    . LYS A 1 24  ? 3.174   39.222 -9.714  1.00 17.66 ? 184 LYS A CA    1 
ATOM   198  C  C     . LYS A 1 24  ? 2.216   39.924 -8.757  1.00 15.49 ? 184 LYS A C     1 
ATOM   199  O  O     . LYS A 1 24  ? 1.910   41.095 -8.941  1.00 17.26 ? 184 LYS A O     1 
ATOM   200  C  CB    . LYS A 1 24  ? 4.578   39.739 -9.374  1.00 23.86 ? 184 LYS A CB    1 
ATOM   201  C  CG    . LYS A 1 24  ? 5.736   39.015 -10.009 1.00 26.10 ? 184 LYS A CG    1 
ATOM   202  C  CD    . LYS A 1 24  ? 7.040   39.387 -9.301  1.00 28.41 ? 184 LYS A CD    1 
ATOM   203  C  CE    . LYS A 1 24  ? 7.416   40.831 -9.509  1.00 37.32 ? 184 LYS A CE    1 
ATOM   204  N  NZ    . LYS A 1 24  ? 8.666   41.162 -8.767  1.00 42.27 ? 184 LYS A NZ    1 
ATOM   205  N  N     . ASP A 1 25  ? 1.750   39.225 -7.732  1.00 14.19 ? 185 ASP A N     1 
ATOM   206  C  CA    . ASP A 1 25  ? 1.104   39.922 -6.620  1.00 19.47 ? 185 ASP A CA    1 
ATOM   207  C  C     . ASP A 1 25  ? 1.608   39.359 -5.298  1.00 19.14 ? 185 ASP A C     1 
ATOM   208  O  O     . ASP A 1 25  ? 2.675   38.740 -5.262  1.00 17.89 ? 185 ASP A O     1 
ATOM   209  C  CB    . ASP A 1 25  ? -0.438  39.994 -6.736  1.00 21.39 ? 185 ASP A CB    1 
ATOM   210  C  CG    . ASP A 1 25  ? -1.127  38.630 -6.667  1.00 22.30 ? 185 ASP A CG    1 
ATOM   211  O  OD1   . ASP A 1 25  ? -0.570  37.669 -6.089  1.00 18.71 ? 185 ASP A OD1   1 
ATOM   212  O  OD2   . ASP A 1 25  ? -2.266  38.530 -7.190  1.00 19.47 ? 185 ASP A OD2   1 
ATOM   213  N  N     . GLU A 1 26  ? 0.869   39.581 -4.217  1.00 16.48 ? 186 GLU A N     1 
ATOM   214  C  CA    A GLU A 1 26  ? 1.316   39.149 -2.898  0.59 18.67 ? 186 GLU A CA    1 
ATOM   215  C  CA    B GLU A 1 26  ? 1.324   39.154 -2.901  0.41 18.87 ? 186 GLU A CA    1 
ATOM   216  C  C     . GLU A 1 26  ? 1.209   37.642 -2.705  1.00 18.24 ? 186 GLU A C     1 
ATOM   217  O  O     . GLU A 1 26  ? 1.775   37.092 -1.762  1.00 16.81 ? 186 GLU A O     1 
ATOM   218  C  CB    A GLU A 1 26  ? 0.531   39.867 -1.797  0.59 22.19 ? 186 GLU A CB    1 
ATOM   219  C  CB    B GLU A 1 26  ? 0.551   39.892 -1.802  0.41 22.19 ? 186 GLU A CB    1 
ATOM   220  C  CG    A GLU A 1 26  ? 0.756   41.361 -1.757  0.59 24.83 ? 186 GLU A CG    1 
ATOM   221  C  CG    B GLU A 1 26  ? -0.836  39.336 -1.526  0.41 24.96 ? 186 GLU A CG    1 
ATOM   222  C  CD    A GLU A 1 26  ? 0.244   41.982 -0.473  0.59 33.29 ? 186 GLU A CD    1 
ATOM   223  C  CD    B GLU A 1 26  ? -1.883  39.772 -2.539  0.41 30.33 ? 186 GLU A CD    1 
ATOM   224  O  OE1   A GLU A 1 26  ? -0.346  41.245 0.347   0.59 35.95 ? 186 GLU A OE1   1 
ATOM   225  O  OE1   B GLU A 1 26  ? -1.519  40.375 -3.573  0.41 31.92 ? 186 GLU A OE1   1 
ATOM   226  O  OE2   A GLU A 1 26  ? 0.435   43.201 -0.281  0.59 35.43 ? 186 GLU A OE2   1 
ATOM   227  O  OE2   B GLU A 1 26  ? -3.082  39.515 -2.290  0.41 31.68 ? 186 GLU A OE2   1 
ATOM   228  N  N     . GLN A 1 27  ? 0.480   36.974 -3.596  1.00 15.11 ? 187 GLN A N     1 
ATOM   229  C  CA    . GLN A 1 27  ? 0.238   35.544 -3.425  1.00 15.48 ? 187 GLN A CA    1 
ATOM   230  C  C     . GLN A 1 27  ? 0.794   34.663 -4.523  1.00 13.00 ? 187 GLN A C     1 
ATOM   231  O  O     . GLN A 1 27  ? 1.168   33.516 -4.267  1.00 12.58 ? 187 GLN A O     1 
ATOM   232  C  CB    . GLN A 1 27  ? -1.261  35.270 -3.307  1.00 20.39 ? 187 GLN A CB    1 
ATOM   233  C  CG    . GLN A 1 27  ? -1.897  35.903 -2.087  1.00 26.66 ? 187 GLN A CG    1 
ATOM   234  C  CD    . GLN A 1 27  ? -3.309  35.410 -1.870  1.00 35.38 ? 187 GLN A CD    1 
ATOM   235  O  OE1   . GLN A 1 27  ? -3.521  34.269 -1.458  1.00 37.93 ? 187 GLN A OE1   1 
ATOM   236  N  NE2   . GLN A 1 27  ? -4.283  36.260 -2.164  1.00 39.44 ? 187 GLN A NE2   1 
ATOM   237  N  N     . VAL A 1 28  ? 0.791   35.167 -5.755  1.00 11.53 ? 188 VAL A N     1 
ATOM   238  C  CA    . VAL A 1 28  ? 1.137   34.327 -6.898  1.00 12.76 ? 188 VAL A CA    1 
ATOM   239  C  C     . VAL A 1 28  ? 2.029   35.033 -7.913  1.00 14.53 ? 188 VAL A C     1 
ATOM   240  O  O     . VAL A 1 28  ? 2.181   36.257 -7.900  1.00 14.91 ? 188 VAL A O     1 
ATOM   241  C  CB    . VAL A 1 28  ? -0.129  33.822 -7.657  1.00 12.82 ? 188 VAL A CB    1 
ATOM   242  C  CG1   . VAL A 1 28  ? -1.021  33.014 -6.731  1.00 14.28 ? 188 VAL A CG1   1 
ATOM   243  C  CG2   . VAL A 1 28  ? -0.907  34.990 -8.270  1.00 13.83 ? 188 VAL A CG2   1 
ATOM   244  N  N     . VAL A 1 29  ? 2.616   34.236 -8.791  1.00 12.33 ? 189 VAL A N     1 
ATOM   245  C  CA    . VAL A 1 29  ? 3.366   34.758 -9.917  1.00 12.45 ? 189 VAL A CA    1 
ATOM   246  C  C     . VAL A 1 29  ? 2.860   34.026 -11.157 1.00 13.94 ? 189 VAL A C     1 
ATOM   247  O  O     . VAL A 1 29  ? 2.428   32.873 -11.077 1.00 15.52 ? 189 VAL A O     1 
ATOM   248  C  CB    . VAL A 1 29  ? 4.882   34.561 -9.714  1.00 10.30 ? 189 VAL A CB    1 
ATOM   249  C  CG1   . VAL A 1 29  ? 5.216   33.069 -9.554  1.00 13.26 ? 189 VAL A CG1   1 
ATOM   250  C  CG2   . VAL A 1 29  ? 5.686   35.223 -10.849 1.00 12.76 ? 189 VAL A CG2   1 
ATOM   251  N  N     . VAL A 1 30  ? 2.853   34.714 -12.289 1.00 12.58 ? 190 VAL A N     1 
ATOM   252  C  CA    . VAL A 1 30  ? 2.496   34.080 -13.550 1.00 13.53 ? 190 VAL A CA    1 
ATOM   253  C  C     . VAL A 1 30  ? 3.717   34.148 -14.431 1.00 13.36 ? 190 VAL A C     1 
ATOM   254  O  O     . VAL A 1 30  ? 4.298   35.223 -14.586 1.00 13.71 ? 190 VAL A O     1 
ATOM   255  C  CB    . VAL A 1 30  ? 1.349   34.819 -14.250 1.00 14.73 ? 190 VAL A CB    1 
ATOM   256  C  CG1   . VAL A 1 30  ? 0.947   34.065 -15.520 1.00 13.51 ? 190 VAL A CG1   1 
ATOM   257  C  CG2   . VAL A 1 30  ? 0.171   34.951 -13.309 1.00 15.46 ? 190 VAL A CG2   1 
ATOM   258  N  N     . ILE A 1 31  ? 4.133   33.004 -14.972 1.00 12.05 ? 191 ILE A N     1 
ATOM   259  C  CA    . ILE A 1 31  ? 5.240   32.976 -15.916 1.00 11.80 ? 191 ILE A CA    1 
ATOM   260  C  C     . ILE A 1 31  ? 4.801   32.402 -17.261 1.00 12.62 ? 191 ILE A C     1 
ATOM   261  O  O     . ILE A 1 31  ? 3.788   31.713 -17.356 1.00 12.97 ? 191 ILE A O     1 
ATOM   262  C  CB    . ILE A 1 31  ? 6.436   32.155 -15.390 1.00 12.67 ? 191 ILE A CB    1 
ATOM   263  C  CG1   . ILE A 1 31  ? 6.035   30.692 -15.195 1.00 14.82 ? 191 ILE A CG1   1 
ATOM   264  C  CG2   . ILE A 1 31  ? 6.951   32.751 -14.079 1.00 14.07 ? 191 ILE A CG2   1 
ATOM   265  C  CD1   . ILE A 1 31  ? 7.223   29.762 -14.846 1.00 16.69 ? 191 ILE A CD1   1 
ATOM   266  N  N     . LYS A 1 32  ? 5.557   32.728 -18.297 1.00 12.69 ? 192 LYS A N     1 
ATOM   267  C  CA    . LYS A 1 32  ? 5.388   32.067 -19.585 1.00 15.27 ? 192 LYS A CA    1 
ATOM   268  C  C     . LYS A 1 32  ? 5.898   30.648 -19.430 1.00 16.62 ? 192 LYS A C     1 
ATOM   269  O  O     . LYS A 1 32  ? 6.956   30.428 -18.839 1.00 16.40 ? 192 LYS A O     1 
ATOM   270  C  CB    . LYS A 1 32  ? 6.214   32.788 -20.655 1.00 19.88 ? 192 LYS A CB    1 
ATOM   271  C  CG    . LYS A 1 32  ? 5.757   34.213 -20.915 1.00 23.35 ? 192 LYS A CG    1 
ATOM   272  C  CD    . LYS A 1 32  ? 6.530   34.860 -22.062 1.00 33.64 ? 192 LYS A CD    1 
ATOM   273  C  CE    . LYS A 1 32  ? 7.986   35.094 -21.716 1.00 38.33 ? 192 LYS A CE    1 
ATOM   274  N  NZ    . LYS A 1 32  ? 8.696   35.833 -22.815 1.00 40.09 ? 192 LYS A NZ    1 
ATOM   275  N  N     . ASP A 1 33  ? 5.144   29.682 -19.939 1.00 13.04 ? 193 ASP A N     1 
ATOM   276  C  CA    . ASP A 1 33  ? 5.639   28.311 -19.994 1.00 12.78 ? 193 ASP A CA    1 
ATOM   277  C  C     . ASP A 1 33  ? 6.884   28.310 -20.869 1.00 15.87 ? 193 ASP A C     1 
ATOM   278  O  O     . ASP A 1 33  ? 6.908   28.950 -21.922 1.00 14.89 ? 193 ASP A O     1 
ATOM   279  C  CB    . ASP A 1 33  ? 4.579   27.402 -20.611 1.00 15.97 ? 193 ASP A CB    1 
ATOM   280  C  CG    . ASP A 1 33  ? 4.880   25.935 -20.390 1.00 16.09 ? 193 ASP A CG    1 
ATOM   281  O  OD1   . ASP A 1 33  ? 5.835   25.428 -21.011 1.00 18.21 ? 193 ASP A OD1   1 
ATOM   282  O  OD2   . ASP A 1 33  ? 4.166   25.289 -19.596 1.00 17.38 ? 193 ASP A OD2   1 
ATOM   283  N  N     . LYS A 1 34  ? 7.921   27.593 -20.443 1.00 11.84 ? 194 LYS A N     1 
ATOM   284  C  CA    . LYS A 1 34  ? 9.176   27.591 -21.178 1.00 13.89 ? 194 LYS A CA    1 
ATOM   285  C  C     . LYS A 1 34  ? 9.074   26.830 -22.502 1.00 15.35 ? 194 LYS A C     1 
ATOM   286  O  O     . LYS A 1 34  ? 9.840   27.073 -23.445 1.00 15.27 ? 194 LYS A O     1 
ATOM   287  C  CB    . LYS A 1 34  ? 10.286  27.005 -20.312 1.00 14.34 ? 194 LYS A CB    1 
ATOM   288  C  CG    . LYS A 1 34  ? 11.678  27.126 -20.921 1.00 17.45 ? 194 LYS A CG    1 
ATOM   289  C  CD    . LYS A 1 34  ? 12.754  26.821 -19.889 1.00 24.00 ? 194 LYS A CD    1 
ATOM   290  C  CE    . LYS A 1 34  ? 14.132  26.826 -20.514 1.00 33.39 ? 194 LYS A CE    1 
ATOM   291  N  NZ    . LYS A 1 34  ? 15.180  26.476 -19.516 1.00 38.06 ? 194 LYS A NZ    1 
ATOM   292  N  N     . TYR A 1 35  ? 8.130   25.898 -22.557 1.00 13.35 ? 195 TYR A N     1 
ATOM   293  C  CA    . TYR A 1 35  ? 7.907   25.082 -23.741 1.00 13.28 ? 195 TYR A CA    1 
ATOM   294  C  C     . TYR A 1 35  ? 6.430   25.099 -24.069 1.00 13.95 ? 195 TYR A C     1 
ATOM   295  O  O     . TYR A 1 35  ? 5.746   24.076 -23.929 1.00 15.47 ? 195 TYR A O     1 
ATOM   296  C  CB    . TYR A 1 35  ? 8.361   23.646 -23.480 1.00 13.91 ? 195 TYR A CB    1 
ATOM   297  C  CG    . TYR A 1 35  ? 9.785   23.578 -22.986 1.00 15.71 ? 195 TYR A CG    1 
ATOM   298  C  CD1   . TYR A 1 35  ? 10.845  23.590 -23.875 1.00 16.64 ? 195 TYR A CD1   1 
ATOM   299  C  CD2   . TYR A 1 35  ? 10.066  23.506 -21.627 1.00 18.54 ? 195 TYR A CD2   1 
ATOM   300  C  CE1   . TYR A 1 35  ? 12.155  23.528 -23.433 1.00 20.44 ? 195 TYR A CE1   1 
ATOM   301  C  CE2   . TYR A 1 35  ? 11.377  23.452 -21.173 1.00 19.02 ? 195 TYR A CE2   1 
ATOM   302  C  CZ    . TYR A 1 35  ? 12.412  23.466 -22.080 1.00 22.29 ? 195 TYR A CZ    1 
ATOM   303  O  OH    . TYR A 1 35  ? 13.717  23.401 -21.640 1.00 25.41 ? 195 TYR A OH    1 
ATOM   304  N  N     . PRO A 1 36  ? 5.931   26.268 -24.504 1.00 13.27 ? 196 PRO A N     1 
ATOM   305  C  CA    . PRO A 1 36  ? 4.484   26.490 -24.633 1.00 13.51 ? 196 PRO A CA    1 
ATOM   306  C  C     . PRO A 1 36  ? 3.872   25.531 -25.627 1.00 14.48 ? 196 PRO A C     1 
ATOM   307  O  O     . PRO A 1 36  ? 4.442   25.290 -26.696 1.00 16.63 ? 196 PRO A O     1 
ATOM   308  C  CB    . PRO A 1 36  ? 4.382   27.941 -25.133 1.00 13.03 ? 196 PRO A CB    1 
ATOM   309  C  CG    . PRO A 1 36  ? 5.722   28.248 -25.744 1.00 15.20 ? 196 PRO A CG    1 
ATOM   310  C  CD    . PRO A 1 36  ? 6.720   27.433 -24.948 1.00 13.97 ? 196 PRO A CD    1 
ATOM   311  N  N     . LYS A 1 37  ? 2.717   24.981 -25.276 1.00 16.41 ? 197 LYS A N     1 
ATOM   312  C  CA    . LYS A 1 37  ? 2.076   23.983 -26.119 1.00 15.64 ? 197 LYS A CA    1 
ATOM   313  C  C     . LYS A 1 37  ? 0.951   24.590 -26.955 1.00 14.73 ? 197 LYS A C     1 
ATOM   314  O  O     . LYS A 1 37  ? 0.214   23.871 -27.632 1.00 13.83 ? 197 LYS A O     1 
ATOM   315  C  CB    . LYS A 1 37  ? 1.562   22.815 -25.268 1.00 16.47 ? 197 LYS A CB    1 
ATOM   316  C  CG    . LYS A 1 37  ? 2.656   22.126 -24.450 1.00 15.06 ? 197 LYS A CG    1 
ATOM   317  C  CD    . LYS A 1 37  ? 3.820   21.681 -25.342 1.00 16.36 ? 197 LYS A CD    1 
ATOM   318  C  CE    . LYS A 1 37  ? 4.813   20.781 -24.586 1.00 17.17 ? 197 LYS A CE    1 
ATOM   319  N  NZ    . LYS A 1 37  ? 5.358   21.443 -23.357 1.00 15.66 ? 197 LYS A NZ    1 
ATOM   320  N  N     . ALA A 1 38  ? 0.847   25.920 -26.920 1.00 14.95 ? 198 ALA A N     1 
ATOM   321  C  CA    . ALA A 1 38  ? -0.095  26.651 -27.766 1.00 14.34 ? 198 ALA A CA    1 
ATOM   322  C  C     . ALA A 1 38  ? 0.407   28.079 -27.933 1.00 16.50 ? 198 ALA A C     1 
ATOM   323  O  O     . ALA A 1 38  ? 1.472   28.431 -27.425 1.00 15.85 ? 198 ALA A O     1 
ATOM   324  C  CB    . ALA A 1 38  ? -1.486  26.648 -27.148 1.00 13.75 ? 198 ALA A CB    1 
ATOM   325  N  N     . ARG A 1 39  ? -0.358  28.910 -28.633 1.00 15.40 ? 199 ARG A N     1 
ATOM   326  C  CA    . ARG A 1 39  ? 0.083   30.286 -28.876 1.00 15.30 ? 199 ARG A CA    1 
ATOM   327  C  C     . ARG A 1 39  ? 0.222   31.090 -27.598 1.00 16.92 ? 199 ARG A C     1 
ATOM   328  O  O     . ARG A 1 39  ? 1.117   31.938 -27.484 1.00 17.75 ? 199 ARG A O     1 
ATOM   329  C  CB    . ARG A 1 39  ? -0.851  30.990 -29.853 1.00 17.00 ? 199 ARG A CB    1 
ATOM   330  C  CG    . ARG A 1 39  ? -0.753  30.416 -31.246 1.00 22.15 ? 199 ARG A CG    1 
ATOM   331  C  CD    . ARG A 1 39  ? -1.712  31.092 -32.179 1.00 22.56 ? 199 ARG A CD    1 
ATOM   332  N  NE    . ARG A 1 39  ? -1.610  30.563 -33.530 1.00 22.19 ? 199 ARG A NE    1 
ATOM   333  C  CZ    . ARG A 1 39  ? -2.387  30.957 -34.528 1.00 25.10 ? 199 ARG A CZ    1 
ATOM   334  N  NH1   . ARG A 1 39  ? -3.316  31.880 -34.310 1.00 27.18 ? 199 ARG A NH1   1 
ATOM   335  N  NH2   . ARG A 1 39  ? -2.233  30.441 -35.738 1.00 26.44 ? 199 ARG A NH2   1 
ATOM   336  N  N     . TYR A 1 40  ? -0.666  30.830 -26.642 1.00 14.48 ? 200 TYR A N     1 
ATOM   337  C  CA    . TYR A 1 40  ? -0.556  31.420 -25.311 1.00 13.01 ? 200 TYR A CA    1 
ATOM   338  C  C     . TYR A 1 40  ? -0.545  30.306 -24.293 1.00 15.79 ? 200 TYR A C     1 
ATOM   339  O  O     . TYR A 1 40  ? -1.456  29.481 -24.261 1.00 15.98 ? 200 TYR A O     1 
ATOM   340  C  CB    . TYR A 1 40  ? -1.738  32.348 -25.028 1.00 13.40 ? 200 TYR A CB    1 
ATOM   341  C  CG    . TYR A 1 40  ? -1.819  33.506 -25.991 1.00 15.01 ? 200 TYR A CG    1 
ATOM   342  C  CD1   . TYR A 1 40  ? -1.152  34.696 -25.731 1.00 16.46 ? 200 TYR A CD1   1 
ATOM   343  C  CD2   . TYR A 1 40  ? -2.540  33.401 -27.164 1.00 18.74 ? 200 TYR A CD2   1 
ATOM   344  C  CE1   . TYR A 1 40  ? -1.222  35.758 -26.620 1.00 21.42 ? 200 TYR A CE1   1 
ATOM   345  C  CE2   . TYR A 1 40  ? -2.614  34.450 -28.060 1.00 24.06 ? 200 TYR A CE2   1 
ATOM   346  C  CZ    . TYR A 1 40  ? -1.957  35.625 -27.778 1.00 24.96 ? 200 TYR A CZ    1 
ATOM   347  O  OH    . TYR A 1 40  ? -2.027  36.668 -28.668 1.00 28.91 ? 200 TYR A OH    1 
ATOM   348  N  N     . HIS A 1 41  ? 0.487   30.270 -23.459 1.00 12.65 ? 201 HIS A N     1 
ATOM   349  C  CA    . HIS A 1 41  ? 0.581   29.218 -22.456 1.00 11.22 ? 201 HIS A CA    1 
ATOM   350  C  C     . HIS A 1 41  ? 1.345   29.766 -21.263 1.00 13.33 ? 201 HIS A C     1 
ATOM   351  O  O     . HIS A 1 41  ? 2.549   30.001 -21.340 1.00 13.80 ? 201 HIS A O     1 
ATOM   352  C  CB    . HIS A 1 41  ? 1.277   27.977 -23.046 1.00 10.85 ? 201 HIS A CB    1 
ATOM   353  C  CG    . HIS A 1 41  ? 1.229   26.771 -22.162 1.00 11.11 ? 201 HIS A CG    1 
ATOM   354  N  ND1   . HIS A 1 41  ? 1.769   25.557 -22.534 1.00 13.03 ? 201 HIS A ND1   1 
ATOM   355  C  CD2   . HIS A 1 41  ? 0.735   26.594 -20.912 1.00 9.49  ? 201 HIS A CD2   1 
ATOM   356  C  CE1   . HIS A 1 41  ? 1.596   24.680 -21.558 1.00 14.21 ? 201 HIS A CE1   1 
ATOM   357  N  NE2   . HIS A 1 41  ? 0.973   25.285 -20.561 1.00 12.29 ? 201 HIS A NE2   1 
ATOM   358  N  N     . TRP A 1 42  ? 0.619   30.018 -20.181 1.00 10.94 ? 202 TRP A N     1 
ATOM   359  C  CA    . TRP A 1 42  ? 1.231   30.519 -18.961 1.00 10.62 ? 202 TRP A CA    1 
ATOM   360  C  C     . TRP A 1 42  ? 1.025   29.522 -17.842 1.00 10.91 ? 202 TRP A C     1 
ATOM   361  O  O     . TRP A 1 42  ? 0.123   28.678 -17.904 1.00 13.31 ? 202 TRP A O     1 
ATOM   362  C  CB    . TRP A 1 42  ? 0.582   31.827 -18.529 1.00 11.67 ? 202 TRP A CB    1 
ATOM   363  C  CG    . TRP A 1 42  ? 0.682   32.967 -19.510 1.00 14.71 ? 202 TRP A CG    1 
ATOM   364  C  CD1   . TRP A 1 42  ? 1.769   33.754 -19.750 1.00 14.60 ? 202 TRP A CD1   1 
ATOM   365  C  CD2   . TRP A 1 42  ? -0.374  33.472 -20.333 1.00 14.28 ? 202 TRP A CD2   1 
ATOM   366  N  NE1   . TRP A 1 42  ? 1.454   34.724 -20.693 1.00 16.35 ? 202 TRP A NE1   1 
ATOM   367  C  CE2   . TRP A 1 42  ? 0.142   34.565 -21.061 1.00 15.49 ? 202 TRP A CE2   1 
ATOM   368  C  CE3   . TRP A 1 42  ? -1.711  33.105 -20.523 1.00 15.63 ? 202 TRP A CE3   1 
ATOM   369  C  CZ2   . TRP A 1 42  ? -0.629  35.285 -21.975 1.00 17.09 ? 202 TRP A CZ2   1 
ATOM   370  C  CZ3   . TRP A 1 42  ? -2.480  33.832 -21.427 1.00 17.65 ? 202 TRP A CZ3   1 
ATOM   371  C  CH2   . TRP A 1 42  ? -1.932  34.903 -22.145 1.00 19.08 ? 202 TRP A CH2   1 
ATOM   372  N  N     . LEU A 1 43  ? 1.835   29.673 -16.800 1.00 10.31 ? 203 LEU A N     1 
ATOM   373  C  CA    . LEU A 1 43  ? 1.679   28.913 -15.567 1.00 10.04 ? 203 LEU A CA    1 
ATOM   374  C  C     . LEU A 1 43  ? 1.477   29.894 -14.427 1.00 12.99 ? 203 LEU A C     1 
ATOM   375  O  O     . LEU A 1 43  ? 2.207   30.887 -14.312 1.00 12.06 ? 203 LEU A O     1 
ATOM   376  C  CB    . LEU A 1 43  ? 2.933   28.081 -15.311 1.00 9.99  ? 203 LEU A CB    1 
ATOM   377  C  CG    . LEU A 1 43  ? 3.351   27.115 -16.422 1.00 12.02 ? 203 LEU A CG    1 
ATOM   378  C  CD1   . LEU A 1 43  ? 4.658   26.440 -16.026 1.00 13.84 ? 203 LEU A CD1   1 
ATOM   379  C  CD2   . LEU A 1 43  ? 2.267   26.071 -16.661 1.00 14.08 ? 203 LEU A CD2   1 
ATOM   380  N  N     . VAL A 1 44  ? 0.484   29.630 -13.587 1.00 10.91 ? 204 VAL A N     1 
ATOM   381  C  CA    . VAL A 1 44  ? 0.272   30.460 -12.399 1.00 11.97 ? 204 VAL A CA    1 
ATOM   382  C  C     . VAL A 1 44  ? 0.758   29.658 -11.205 1.00 13.55 ? 204 VAL A C     1 
ATOM   383  O  O     . VAL A 1 44  ? 0.327   28.523 -11.007 1.00 13.15 ? 204 VAL A O     1 
ATOM   384  C  CB    . VAL A 1 44  ? -1.208  30.797 -12.193 1.00 13.84 ? 204 VAL A CB    1 
ATOM   385  C  CG1   . VAL A 1 44  ? -1.373  31.764 -11.021 1.00 15.46 ? 204 VAL A CG1   1 
ATOM   386  C  CG2   . VAL A 1 44  ? -1.832  31.390 -13.475 1.00 16.59 ? 204 VAL A CG2   1 
ATOM   387  N  N     . LEU A 1 45  ? 1.653   30.239 -10.411 1.00 11.92 ? 205 LEU A N     1 
ATOM   388  C  CA    . LEU A 1 45  ? 2.232   29.525 -9.273  1.00 11.17 ? 205 LEU A CA    1 
ATOM   389  C  C     . LEU A 1 45  ? 2.148   30.355 -8.007  1.00 15.02 ? 205 LEU A C     1 
ATOM   390  O  O     . LEU A 1 45  ? 2.402   31.554 -8.030  1.00 15.84 ? 205 LEU A O     1 
ATOM   391  C  CB    . LEU A 1 45  ? 3.695   29.164 -9.530  1.00 13.97 ? 205 LEU A CB    1 
ATOM   392  C  CG    . LEU A 1 45  ? 4.047   28.443 -10.839 1.00 12.44 ? 205 LEU A CG    1 
ATOM   393  C  CD1   . LEU A 1 45  ? 4.426   29.445 -11.918 1.00 17.34 ? 205 LEU A CD1   1 
ATOM   394  C  CD2   . LEU A 1 45  ? 5.173   27.456 -10.590 1.00 16.65 ? 205 LEU A CD2   1 
ATOM   395  N  N     . PRO A 1 46  ? 1.807   29.711 -6.887  1.00 13.44 ? 206 PRO A N     1 
ATOM   396  C  CA    . PRO A 1 46  ? 1.863   30.441 -5.615  1.00 13.66 ? 206 PRO A CA    1 
ATOM   397  C  C     . PRO A 1 46  ? 3.304   30.640 -5.188  1.00 13.99 ? 206 PRO A C     1 
ATOM   398  O  O     . PRO A 1 46  ? 4.173   29.817 -5.504  1.00 14.91 ? 206 PRO A O     1 
ATOM   399  C  CB    . PRO A 1 46  ? 1.135   29.510 -4.638  1.00 16.70 ? 206 PRO A CB    1 
ATOM   400  C  CG    . PRO A 1 46  ? 1.262   28.146 -5.244  1.00 19.01 ? 206 PRO A CG    1 
ATOM   401  C  CD    . PRO A 1 46  ? 1.313   28.332 -6.736  1.00 16.05 ? 206 PRO A CD    1 
ATOM   402  N  N     . TRP A 1 47  ? 3.568   31.746 -4.503  1.00 12.02 ? 207 TRP A N     1 
ATOM   403  C  CA    . TRP A 1 47  ? 4.876   31.953 -3.922  1.00 10.51 ? 207 TRP A CA    1 
ATOM   404  C  C     . TRP A 1 47  ? 5.182   30.846 -2.917  1.00 15.48 ? 207 TRP A C     1 
ATOM   405  O  O     . TRP A 1 47  ? 6.305   30.344 -2.863  1.00 17.03 ? 207 TRP A O     1 
ATOM   406  C  CB    . TRP A 1 47  ? 4.942   33.295 -3.218  1.00 14.47 ? 207 TRP A CB    1 
ATOM   407  C  CG    . TRP A 1 47  ? 4.879   34.490 -4.121  1.00 13.57 ? 207 TRP A CG    1 
ATOM   408  C  CD1   . TRP A 1 47  ? 3.993   35.531 -4.032  1.00 14.62 ? 207 TRP A CD1   1 
ATOM   409  C  CD2   . TRP A 1 47  ? 5.745   34.793 -5.227  1.00 16.67 ? 207 TRP A CD2   1 
ATOM   410  N  NE1   . TRP A 1 47  ? 4.259   36.462 -5.004  1.00 15.97 ? 207 TRP A NE1   1 
ATOM   411  C  CE2   . TRP A 1 47  ? 5.327   36.036 -5.753  1.00 15.65 ? 207 TRP A CE2   1 
ATOM   412  C  CE3   . TRP A 1 47  ? 6.847   34.150 -5.807  1.00 15.86 ? 207 TRP A CE3   1 
ATOM   413  C  CZ2   . TRP A 1 47  ? 5.969   36.645 -6.841  1.00 16.74 ? 207 TRP A CZ2   1 
ATOM   414  C  CZ3   . TRP A 1 47  ? 7.484   34.757 -6.883  1.00 16.34 ? 207 TRP A CZ3   1 
ATOM   415  C  CH2   . TRP A 1 47  ? 7.036   35.986 -7.396  1.00 16.81 ? 207 TRP A CH2   1 
ATOM   416  N  N     . THR A 1 48  ? 4.180   30.476 -2.127  1.00 15.92 ? 208 THR A N     1 
ATOM   417  C  CA    . THR A 1 48  ? 4.374   29.471 -1.085  1.00 17.01 ? 208 THR A CA    1 
ATOM   418  C  C     . THR A 1 48  ? 4.569   28.096 -1.734  1.00 18.87 ? 208 THR A C     1 
ATOM   419  O  O     . THR A 1 48  ? 3.967   27.792 -2.763  1.00 18.35 ? 208 THR A O     1 
ATOM   420  C  CB    . THR A 1 48  ? 3.220   29.484 -0.051  1.00 16.96 ? 208 THR A CB    1 
ATOM   421  O  OG1   . THR A 1 48  ? 3.593   28.710 1.099   1.00 22.01 ? 208 THR A OG1   1 
ATOM   422  C  CG2   . THR A 1 48  ? 1.909   28.937 -0.654  1.00 14.79 ? 208 THR A CG2   1 
ATOM   423  N  N     . SER A 1 49  ? 5.434   27.270 -1.156  1.00 19.51 ? 209 SER A N     1 
ATOM   424  C  CA    A SER A 1 49  ? 5.773   25.999 -1.783  0.49 19.42 ? 209 SER A CA    1 
ATOM   425  C  CA    B SER A 1 49  ? 5.767   26.001 -1.788  0.51 19.39 ? 209 SER A CA    1 
ATOM   426  C  C     . SER A 1 49  ? 4.800   24.890 -1.414  1.00 19.10 ? 209 SER A C     1 
ATOM   427  O  O     . SER A 1 49  ? 4.688   24.513 -0.255  1.00 20.73 ? 209 SER A O     1 
ATOM   428  C  CB    A SER A 1 49  ? 7.194   25.571 -1.423  0.49 21.79 ? 209 SER A CB    1 
ATOM   429  C  CB    B SER A 1 49  ? 7.201   25.587 -1.461  0.51 21.84 ? 209 SER A CB    1 
ATOM   430  O  OG    A SER A 1 49  ? 7.548   24.387 -2.114  0.49 22.88 ? 209 SER A OG    1 
ATOM   431  O  OG    B SER A 1 49  ? 8.125   26.353 -2.215  0.51 21.98 ? 209 SER A OG    1 
ATOM   432  N  N     . ILE A 1 50  ? 4.113   24.369 -2.421  1.00 16.74 ? 210 ILE A N     1 
ATOM   433  C  CA    . ILE A 1 50  ? 3.224   23.227 -2.269  1.00 17.20 ? 210 ILE A CA    1 
ATOM   434  C  C     . ILE A 1 50  ? 3.666   22.299 -3.386  1.00 18.01 ? 210 ILE A C     1 
ATOM   435  O  O     . ILE A 1 50  ? 3.660   22.704 -4.547  1.00 17.70 ? 210 ILE A O     1 
ATOM   436  C  CB    . ILE A 1 50  ? 1.759   23.627 -2.505  1.00 19.17 ? 210 ILE A CB    1 
ATOM   437  C  CG1   . ILE A 1 50  ? 1.377   24.808 -1.612  1.00 21.58 ? 210 ILE A CG1   1 
ATOM   438  C  CG2   . ILE A 1 50  ? 0.841   22.441 -2.246  1.00 19.11 ? 210 ILE A CG2   1 
ATOM   439  C  CD1   . ILE A 1 50  ? 0.011   25.392 -1.918  1.00 23.70 ? 210 ILE A CD1   1 
ATOM   440  N  N     . SER A 1 51  ? 4.079   21.082 -3.044  1.00 17.69 ? 211 SER A N     1 
ATOM   441  C  CA    . SER A 1 51  ? 4.768   20.219 -4.006  1.00 19.61 ? 211 SER A CA    1 
ATOM   442  C  C     . SER A 1 51  ? 3.883   19.871 -5.205  1.00 20.77 ? 211 SER A C     1 
ATOM   443  O  O     . SER A 1 51  ? 4.328   19.918 -6.354  1.00 18.83 ? 211 SER A O     1 
ATOM   444  C  CB    . SER A 1 51  ? 5.281   18.942 -3.329  1.00 24.45 ? 211 SER A CB    1 
ATOM   445  O  OG    . SER A 1 51  ? 4.208   18.213 -2.762  1.00 28.82 ? 211 SER A OG    1 
ATOM   446  N  N     . SER A 1 52  ? 2.629   19.532 -4.928  1.00 20.70 ? 212 SER A N     1 
ATOM   447  C  CA    . SER A 1 52  ? 1.679   19.190 -5.979  1.00 17.41 ? 212 SER A CA    1 
ATOM   448  C  C     . SER A 1 52  ? 0.276   19.251 -5.402  1.00 17.79 ? 212 SER A C     1 
ATOM   449  O  O     . SER A 1 52  ? 0.101   19.585 -4.235  1.00 18.41 ? 212 SER A O     1 
ATOM   450  C  CB    . SER A 1 52  ? 1.941   17.783 -6.517  1.00 19.12 ? 212 SER A CB    1 
ATOM   451  O  OG    . SER A 1 52  ? 1.492   16.794 -5.600  1.00 25.55 ? 212 SER A OG    1 
ATOM   452  N  N     . LEU A 1 53  ? -0.724  18.911 -6.211  1.00 17.36 ? 213 LEU A N     1 
ATOM   453  C  CA    . LEU A 1 53  ? -2.101  18.872 -5.716  1.00 16.10 ? 213 LEU A CA    1 
ATOM   454  C  C     . LEU A 1 53  ? -2.293  17.840 -4.608  1.00 18.35 ? 213 LEU A C     1 
ATOM   455  O  O     . LEU A 1 53  ? -3.261  17.922 -3.850  1.00 18.13 ? 213 LEU A O     1 
ATOM   456  C  CB    . LEU A 1 53  ? -3.095  18.618 -6.853  1.00 18.95 ? 213 LEU A CB    1 
ATOM   457  C  CG    . LEU A 1 53  ? -3.314  19.769 -7.843  1.00 21.23 ? 213 LEU A CG    1 
ATOM   458  C  CD1   . LEU A 1 53  ? -4.446  19.431 -8.811  1.00 22.29 ? 213 LEU A CD1   1 
ATOM   459  C  CD2   . LEU A 1 53  ? -3.608  21.069 -7.117  1.00 23.77 ? 213 LEU A CD2   1 
ATOM   460  N  N     . LYS A 1 54  ? -1.376  16.875 -4.512  1.00 17.98 ? 214 LYS A N     1 
ATOM   461  C  CA    . LYS A 1 54  ? -1.433  15.882 -3.440  1.00 22.48 ? 214 LYS A CA    1 
ATOM   462  C  C     . LYS A 1 54  ? -1.334  16.510 -2.059  1.00 21.66 ? 214 LYS A C     1 
ATOM   463  O  O     . LYS A 1 54  ? -1.823  15.949 -1.080  1.00 21.52 ? 214 LYS A O     1 
ATOM   464  C  CB    . LYS A 1 54  ? -0.309  14.850 -3.581  1.00 30.18 ? 214 LYS A CB    1 
ATOM   465  C  CG    . LYS A 1 54  ? -0.469  13.876 -4.721  1.00 33.61 ? 214 LYS A CG    1 
ATOM   466  C  CD    . LYS A 1 54  ? 0.609   12.797 -4.634  1.00 40.56 ? 214 LYS A CD    1 
ATOM   467  C  CE    . LYS A 1 54  ? 0.380   11.681 -5.634  1.00 45.36 ? 214 LYS A CE    1 
ATOM   468  N  NZ    . LYS A 1 54  ? 1.338   10.559 -5.407  1.00 50.23 ? 214 LYS A NZ    1 
ATOM   469  N  N     . ALA A 1 55  ? -0.681  17.664 -1.982  1.00 18.08 ? 215 ALA A N     1 
ATOM   470  C  CA    . ALA A 1 55  ? -0.453  18.333 -0.708  1.00 21.41 ? 215 ALA A CA    1 
ATOM   471  C  C     . ALA A 1 55  ? -1.451  19.464 -0.452  1.00 18.79 ? 215 ALA A C     1 
ATOM   472  O  O     . ALA A 1 55  ? -1.376  20.134 0.572   1.00 23.65 ? 215 ALA A O     1 
ATOM   473  C  CB    . ALA A 1 55  ? 0.971   18.862 -0.649  1.00 24.98 ? 215 ALA A CB    1 
ATOM   474  N  N     . VAL A 1 56  ? -2.376  19.675 -1.383  1.00 15.75 ? 216 VAL A N     1 
ATOM   475  C  CA    . VAL A 1 56  ? -3.379  20.731 -1.228  1.00 18.62 ? 216 VAL A CA    1 
ATOM   476  C  C     . VAL A 1 56  ? -4.473  20.364 -0.208  1.00 19.43 ? 216 VAL A C     1 
ATOM   477  O  O     . VAL A 1 56  ? -4.958  19.235 -0.189  1.00 21.88 ? 216 VAL A O     1 
ATOM   478  C  CB    . VAL A 1 56  ? -3.997  21.102 -2.602  1.00 20.48 ? 216 VAL A CB    1 
ATOM   479  C  CG1   . VAL A 1 56  ? -5.250  21.936 -2.433  1.00 23.08 ? 216 VAL A CG1   1 
ATOM   480  C  CG2   . VAL A 1 56  ? -2.970  21.849 -3.448  1.00 17.48 ? 216 VAL A CG2   1 
ATOM   481  N  N     . ALA A 1 57  ? -4.837  21.324 0.643   1.00 20.02 ? 217 ALA A N     1 
ATOM   482  C  CA    . ALA A 1 57  ? -5.908  21.154 1.628   1.00 16.57 ? 217 ALA A CA    1 
ATOM   483  C  C     . ALA A 1 57  ? -6.814  22.388 1.638   1.00 14.76 ? 217 ALA A C     1 
ATOM   484  O  O     . ALA A 1 57  ? -6.588  23.335 0.883   1.00 13.25 ? 217 ALA A O     1 
ATOM   485  C  CB    . ALA A 1 57  ? -5.326  20.922 3.014   1.00 17.45 ? 217 ALA A CB    1 
ATOM   486  N  N     . ARG A 1 58  ? -7.830  22.387 2.496   1.00 17.62 ? 218 ARG A N     1 
ATOM   487  C  CA    . ARG A 1 58  ? -8.784  23.498 2.513   1.00 15.71 ? 218 ARG A CA    1 
ATOM   488  C  C     . ARG A 1 58  ? -8.158  24.826 2.902   1.00 16.58 ? 218 ARG A C     1 
ATOM   489  O  O     . ARG A 1 58  ? -8.685  25.890 2.551   1.00 15.45 ? 218 ARG A O     1 
ATOM   490  C  CB    . ARG A 1 58  ? -9.989  23.197 3.404   1.00 13.40 ? 218 ARG A CB    1 
ATOM   491  C  CG    . ARG A 1 58  ? -10.909 22.124 2.823   1.00 13.53 ? 218 ARG A CG    1 
ATOM   492  C  CD    . ARG A 1 58  ? -12.157 22.052 3.659   1.00 16.56 ? 218 ARG A CD    1 
ATOM   493  N  NE    . ARG A 1 58  ? -13.234 21.244 3.086   1.00 17.00 ? 218 ARG A NE    1 
ATOM   494  C  CZ    . ARG A 1 58  ? -13.608 20.064 3.564   1.00 19.46 ? 218 ARG A CZ    1 
ATOM   495  N  NH1   . ARG A 1 58  ? -12.967 19.529 4.597   1.00 18.28 ? 218 ARG A NH1   1 
ATOM   496  N  NH2   . ARG A 1 58  ? -14.622 19.416 3.005   1.00 17.79 ? 218 ARG A NH2   1 
ATOM   497  N  N     . GLU A 1 59  ? -7.036  24.779 3.622   1.00 13.99 ? 219 GLU A N     1 
ATOM   498  C  CA    . GLU A 1 59  ? -6.297  25.999 3.918   1.00 16.02 ? 219 GLU A CA    1 
ATOM   499  C  C     . GLU A 1 59  ? -5.836  26.681 2.631   1.00 15.24 ? 219 GLU A C     1 
ATOM   500  O  O     . GLU A 1 59  ? -5.534  27.882 2.626   1.00 17.45 ? 219 GLU A O     1 
ATOM   501  C  CB    . GLU A 1 59  ? -5.096  25.723 4.832   1.00 20.88 ? 219 GLU A CB    1 
ATOM   502  C  CG    . GLU A 1 59  ? -4.031  24.838 4.199   1.00 24.00 ? 219 GLU A CG    1 
ATOM   503  C  CD    . GLU A 1 59  ? -2.775  24.742 5.043   1.00 37.56 ? 219 GLU A CD    1 
ATOM   504  O  OE1   . GLU A 1 59  ? -2.369  23.609 5.375   1.00 41.60 ? 219 GLU A OE1   1 
ATOM   505  O  OE2   . GLU A 1 59  ? -2.188  25.799 5.364   1.00 43.38 ? 219 GLU A OE2   1 
ATOM   506  N  N     . HIS A 1 60  ? -5.799  25.928 1.534   1.00 15.19 ? 220 HIS A N     1 
ATOM   507  C  CA    . HIS A 1 60  ? -5.328  26.464 0.257   1.00 15.14 ? 220 HIS A CA    1 
ATOM   508  C  C     . HIS A 1 60  ? -6.462  26.838 -0.686  1.00 14.88 ? 220 HIS A C     1 
ATOM   509  O  O     . HIS A 1 60  ? -6.219  27.220 -1.834  1.00 15.05 ? 220 HIS A O     1 
ATOM   510  C  CB    . HIS A 1 60  ? -4.417  25.453 -0.451  1.00 15.33 ? 220 HIS A CB    1 
ATOM   511  C  CG    . HIS A 1 60  ? -3.232  25.037 0.358   1.00 18.42 ? 220 HIS A CG    1 
ATOM   512  N  ND1   . HIS A 1 60  ? -3.052  23.743 0.796   1.00 21.10 ? 220 HIS A ND1   1 
ATOM   513  C  CD2   . HIS A 1 60  ? -2.171  25.742 0.819   1.00 17.50 ? 220 HIS A CD2   1 
ATOM   514  C  CE1   . HIS A 1 60  ? -1.928  23.666 1.487   1.00 22.28 ? 220 HIS A CE1   1 
ATOM   515  N  NE2   . HIS A 1 60  ? -1.374  24.866 1.515   1.00 19.87 ? 220 HIS A NE2   1 
ATOM   516  N  N     . LEU A 1 61  ? -7.698  26.727 -0.214  1.00 13.82 ? 221 LEU A N     1 
ATOM   517  C  CA    . LEU A 1 61  ? -8.850  26.931 -1.089  1.00 17.02 ? 221 LEU A CA    1 
ATOM   518  C  C     . LEU A 1 61  ? -8.899  28.345 -1.668  1.00 14.60 ? 221 LEU A C     1 
ATOM   519  O  O     . LEU A 1 61  ? -9.100  28.523 -2.875  1.00 16.70 ? 221 LEU A O     1 
ATOM   520  C  CB    . LEU A 1 61  ? -10.152 26.588 -0.364  1.00 16.77 ? 221 LEU A CB    1 
ATOM   521  C  CG    . LEU A 1 61  ? -11.432 26.696 -1.195  1.00 15.96 ? 221 LEU A CG    1 
ATOM   522  C  CD1   . LEU A 1 61  ? -11.416 25.725 -2.370  1.00 15.76 ? 221 LEU A CD1   1 
ATOM   523  C  CD2   . LEU A 1 61  ? -12.655 26.462 -0.319  1.00 18.03 ? 221 LEU A CD2   1 
ATOM   524  N  N     . GLU A 1 62  ? -8.702  29.341 -0.815  1.00 15.63 ? 222 GLU A N     1 
ATOM   525  C  CA    . GLU A 1 62  ? -8.665  30.734 -1.248  1.00 17.23 ? 222 GLU A CA    1 
ATOM   526  C  C     . GLU A 1 62  ? -7.567  30.946 -2.292  1.00 19.41 ? 222 GLU A C     1 
ATOM   527  O  O     . GLU A 1 62  ? -7.751  31.656 -3.286  1.00 14.67 ? 222 GLU A O     1 
ATOM   528  C  CB    . GLU A 1 62  ? -8.435  31.651 -0.048  1.00 22.75 ? 222 GLU A CB    1 
ATOM   529  C  CG    . GLU A 1 62  ? -9.621  32.521 0.293   1.00 34.27 ? 222 GLU A CG    1 
ATOM   530  C  CD    . GLU A 1 62  ? -9.409  33.370 1.550   1.00 42.66 ? 222 GLU A CD    1 
ATOM   531  O  OE1   . GLU A 1 62  ? -9.227  32.798 2.654   1.00 40.15 ? 222 GLU A OE1   1 
ATOM   532  O  OE2   . GLU A 1 62  ? -9.439  34.613 1.433   1.00 47.54 ? 222 GLU A OE2   1 
ATOM   533  N  N     . LEU A 1 63  ? -6.426  30.311 -2.062  1.00 15.34 ? 223 LEU A N     1 
ATOM   534  C  CA    . LEU A 1 63  ? -5.285  30.456 -2.954  1.00 14.55 ? 223 LEU A CA    1 
ATOM   535  C  C     . LEU A 1 63  ? -5.568  29.855 -4.335  1.00 14.22 ? 223 LEU A C     1 
ATOM   536  O  O     . LEU A 1 63  ? -5.263  30.475 -5.350  1.00 14.52 ? 223 LEU A O     1 
ATOM   537  C  CB    . LEU A 1 63  ? -4.055  29.812 -2.326  1.00 15.42 ? 223 LEU A CB    1 
ATOM   538  C  CG    . LEU A 1 63  ? -2.773  29.786 -3.155  1.00 19.36 ? 223 LEU A CG    1 
ATOM   539  C  CD1   . LEU A 1 63  ? -2.296  31.201 -3.503  1.00 19.23 ? 223 LEU A CD1   1 
ATOM   540  C  CD2   . LEU A 1 63  ? -1.698  29.025 -2.384  1.00 22.08 ? 223 LEU A CD2   1 
ATOM   541  N  N     . LEU A 1 64  ? -6.151  28.654 -4.376  1.00 12.49 ? 224 LEU A N     1 
ATOM   542  C  CA    . LEU A 1 64  ? -6.525  28.033 -5.645  1.00 15.94 ? 224 LEU A CA    1 
ATOM   543  C  C     . LEU A 1 64  ? -7.498  28.892 -6.447  1.00 13.19 ? 224 LEU A C     1 
ATOM   544  O  O     . LEU A 1 64  ? -7.394  28.995 -7.678  1.00 14.13 ? 224 LEU A O     1 
ATOM   545  C  CB    . LEU A 1 64  ? -7.175  26.662 -5.411  1.00 15.42 ? 224 LEU A CB    1 
ATOM   546  C  CG    . LEU A 1 64  ? -6.248  25.555 -4.926  1.00 18.93 ? 224 LEU A CG    1 
ATOM   547  C  CD1   . LEU A 1 64  ? -7.075  24.295 -4.661  1.00 20.75 ? 224 LEU A CD1   1 
ATOM   548  C  CD2   . LEU A 1 64  ? -5.174  25.288 -5.950  1.00 18.92 ? 224 LEU A CD2   1 
ATOM   549  N  N     . LYS A 1 65  ? -8.453  29.487 -5.748  1.00 10.80 ? 225 LYS A N     1 
ATOM   550  C  CA    . LYS A 1 65  ? -9.413  30.370 -6.399  1.00 11.87 ? 225 LYS A CA    1 
ATOM   551  C  C     . LYS A 1 65  ? -8.737  31.637 -6.904  1.00 15.55 ? 225 LYS A C     1 
ATOM   552  O  O     . LYS A 1 65  ? -9.062  32.143 -7.983  1.00 15.11 ? 225 LYS A O     1 
ATOM   553  C  CB    . LYS A 1 65  ? -10.558 30.712 -5.455  1.00 14.63 ? 225 LYS A CB    1 
ATOM   554  C  CG    . LYS A 1 65  ? -11.498 29.538 -5.226  1.00 13.32 ? 225 LYS A CG    1 
ATOM   555  C  CD    . LYS A 1 65  ? -12.524 29.898 -4.160  1.00 16.38 ? 225 LYS A CD    1 
ATOM   556  C  CE    . LYS A 1 65  ? -13.413 28.694 -3.831  1.00 16.45 ? 225 LYS A CE    1 
ATOM   557  N  NZ    . LYS A 1 65  ? -14.474 29.108 -2.882  1.00 17.46 ? 225 LYS A NZ    1 
ATOM   558  N  N     . HIS A 1 66  ? -7.790  32.143 -6.124  1.00 14.07 ? 226 HIS A N     1 
ATOM   559  C  CA    . HIS A 1 66  ? -7.061  33.336 -6.528  1.00 16.90 ? 226 HIS A CA    1 
ATOM   560  C  C     . HIS A 1 66  ? -6.211  33.047 -7.777  1.00 15.92 ? 226 HIS A C     1 
ATOM   561  O  O     . HIS A 1 66  ? -6.138  33.877 -8.683  1.00 12.89 ? 226 HIS A O     1 
ATOM   562  C  CB    . HIS A 1 66  ? -6.185  33.849 -5.377  1.00 18.22 ? 226 HIS A CB    1 
ATOM   563  C  CG    . HIS A 1 66  ? -5.459  35.116 -5.696  1.00 19.86 ? 226 HIS A CG    1 
ATOM   564  N  ND1   . HIS A 1 66  ? -6.084  36.344 -5.717  1.00 23.65 ? 226 HIS A ND1   1 
ATOM   565  C  CD2   . HIS A 1 66  ? -4.162  35.350 -6.014  1.00 20.96 ? 226 HIS A CD2   1 
ATOM   566  C  CE1   . HIS A 1 66  ? -5.204  37.280 -6.030  1.00 24.59 ? 226 HIS A CE1   1 
ATOM   567  N  NE2   . HIS A 1 66  ? -4.030  36.703 -6.215  1.00 22.42 ? 226 HIS A NE2   1 
ATOM   568  N  N     . MET A 1 67  ? -5.551  31.886 -7.805  1.00 12.91 ? 227 MET A N     1 
ATOM   569  C  CA    . MET A 1 67  ? -4.781  31.475 -8.986  1.00 14.02 ? 227 MET A CA    1 
ATOM   570  C  C     . MET A 1 67  ? -5.654  31.495 -10.237 1.00 15.47 ? 227 MET A C     1 
ATOM   571  O  O     . MET A 1 67  ? -5.246  31.997 -11.288 1.00 12.42 ? 227 MET A O     1 
ATOM   572  C  CB    . MET A 1 67  ? -4.178  30.082 -8.781  1.00 13.34 ? 227 MET A CB    1 
ATOM   573  C  CG    . MET A 1 67  ? -3.077  30.081 -7.724  1.00 13.60 ? 227 MET A CG    1 
ATOM   574  S  SD    . MET A 1 67  ? -2.629  28.444 -7.110  1.00 19.13 ? 227 MET A SD    1 
ATOM   575  C  CE    . MET A 1 67  ? -2.027  27.650 -8.609  1.00 15.98 ? 227 MET A CE    1 
ATOM   576  N  N     . HIS A 1 68  ? -6.860  30.950 -10.107 1.00 13.20 ? 228 HIS A N     1 
ATOM   577  C  CA    . HIS A 1 68  ? -7.822  30.942 -11.200 1.00 17.36 ? 228 HIS A CA    1 
ATOM   578  C  C     . HIS A 1 68  ? -8.206  32.355 -11.660 1.00 14.59 ? 228 HIS A C     1 
ATOM   579  O  O     . HIS A 1 68  ? -8.203  32.645 -12.860 1.00 16.31 ? 228 HIS A O     1 
ATOM   580  C  CB    . HIS A 1 68  ? -9.074  30.166 -10.794 1.00 17.51 ? 228 HIS A CB    1 
ATOM   581  C  CG    . HIS A 1 68  ? -10.046 29.974 -11.913 1.00 20.32 ? 228 HIS A CG    1 
ATOM   582  N  ND1   . HIS A 1 68  ? -10.128 28.799 -12.627 1.00 21.21 ? 228 HIS A ND1   1 
ATOM   583  C  CD2   . HIS A 1 68  ? -10.961 30.811 -12.456 1.00 22.97 ? 228 HIS A CD2   1 
ATOM   584  C  CE1   . HIS A 1 68  ? -11.054 28.918 -13.561 1.00 24.23 ? 228 HIS A CE1   1 
ATOM   585  N  NE2   . HIS A 1 68  ? -11.578 30.129 -13.477 1.00 25.60 ? 228 HIS A NE2   1 
ATOM   586  N  N     . THR A 1 69  ? -8.518  33.238 -10.715 1.00 13.86 ? 229 THR A N     1 
ATOM   587  C  CA    A THR A 1 69  ? -8.898  34.611 -11.026 0.66 16.23 ? 229 THR A CA    1 
ATOM   588  C  CA    B THR A 1 69  ? -8.918  34.589 -11.088 0.34 16.06 ? 229 THR A CA    1 
ATOM   589  C  C     . THR A 1 69  ? -7.755  35.347 -11.723 1.00 16.67 ? 229 THR A C     1 
ATOM   590  O  O     . THR A 1 69  ? -7.967  36.141 -12.646 1.00 15.40 ? 229 THR A O     1 
ATOM   591  C  CB    A THR A 1 69  ? -9.286  35.380 -9.742  0.66 19.35 ? 229 THR A CB    1 
ATOM   592  C  CB    B THR A 1 69  ? -9.506  35.396 -9.909  0.34 19.33 ? 229 THR A CB    1 
ATOM   593  O  OG1   A THR A 1 69  ? -10.407 34.738 -9.123  0.66 20.55 ? 229 THR A OG1   1 
ATOM   594  O  OG1   B THR A 1 69  ? -8.501  35.610 -8.914  0.34 18.71 ? 229 THR A OG1   1 
ATOM   595  C  CG2   A THR A 1 69  ? -9.651  36.817 -10.055 0.66 22.19 ? 229 THR A CG2   1 
ATOM   596  C  CG2   B THR A 1 69  ? -10.683 34.661 -9.293  0.34 20.25 ? 229 THR A CG2   1 
ATOM   597  N  N     . VAL A 1 70  ? -6.538  35.081 -11.259 1.00 13.97 ? 230 VAL A N     1 
ATOM   598  C  CA    . VAL A 1 70  ? -5.365  35.719 -11.844 1.00 14.26 ? 230 VAL A CA    1 
ATOM   599  C  C     . VAL A 1 70  ? -5.136  35.199 -13.270 1.00 14.82 ? 230 VAL A C     1 
ATOM   600  O  O     . VAL A 1 70  ? -4.790  35.963 -14.177 1.00 15.62 ? 230 VAL A O     1 
ATOM   601  C  CB    . VAL A 1 70  ? -4.112  35.507 -10.970 1.00 14.06 ? 230 VAL A CB    1 
ATOM   602  C  CG1   . VAL A 1 70  ? -2.862  35.804 -11.770 1.00 15.08 ? 230 VAL A CG1   1 
ATOM   603  C  CG2   . VAL A 1 70  ? -4.181  36.397 -9.719  1.00 15.39 ? 230 VAL A CG2   1 
ATOM   604  N  N     . GLY A 1 71  ? -5.346  33.902 -13.466 1.00 14.23 ? 231 GLY A N     1 
ATOM   605  C  CA    . GLY A 1 71  ? -5.262  33.318 -14.797 1.00 13.76 ? 231 GLY A CA    1 
ATOM   606  C  C     . GLY A 1 71  ? -6.220  33.996 -15.765 1.00 15.37 ? 231 GLY A C     1 
ATOM   607  O  O     . GLY A 1 71  ? -5.871  34.303 -16.905 1.00 14.54 ? 231 GLY A O     1 
ATOM   608  N  N     . GLU A 1 72  ? -7.438  34.238 -15.302 1.00 13.76 ? 232 GLU A N     1 
ATOM   609  C  CA    . GLU A 1 72  ? -8.432  34.902 -16.133 1.00 18.89 ? 232 GLU A CA    1 
ATOM   610  C  C     . GLU A 1 72  ? -8.035  36.337 -16.455 1.00 18.20 ? 232 GLU A C     1 
ATOM   611  O  O     . GLU A 1 72  ? -8.262  36.809 -17.564 1.00 17.79 ? 232 GLU A O     1 
ATOM   612  C  CB    . GLU A 1 72  ? -9.809  34.838 -15.478 1.00 23.98 ? 232 GLU A CB    1 
ATOM   613  C  CG    . GLU A 1 72  ? -10.424 33.449 -15.549 1.00 29.93 ? 232 GLU A CG    1 
ATOM   614  C  CD    . GLU A 1 72  ? -11.806 33.388 -14.947 1.00 45.11 ? 232 GLU A CD    1 
ATOM   615  O  OE1   . GLU A 1 72  ? -12.003 33.969 -13.855 1.00 49.04 ? 232 GLU A OE1   1 
ATOM   616  O  OE2   . GLU A 1 72  ? -12.694 32.763 -15.569 1.00 52.19 ? 232 GLU A OE2   1 
ATOM   617  N  N     . LYS A 1 73  ? -7.431  37.022 -15.490 1.00 16.44 ? 233 LYS A N     1 
ATOM   618  C  CA    . LYS A 1 73  ? -7.003  38.401 -15.693 1.00 18.28 ? 233 LYS A CA    1 
ATOM   619  C  C     . LYS A 1 73  ? -5.863  38.475 -16.704 1.00 19.43 ? 233 LYS A C     1 
ATOM   620  O  O     . LYS A 1 73  ? -5.825  39.384 -17.531 1.00 20.41 ? 233 LYS A O     1 
ATOM   621  C  CB    . LYS A 1 73  ? -6.578  39.040 -14.370 1.00 21.96 ? 233 LYS A CB    1 
ATOM   622  C  CG    . LYS A 1 73  ? -6.032  40.455 -14.513 1.00 29.20 ? 233 LYS A CG    1 
ATOM   623  C  CD    . LYS A 1 73  ? -5.769  41.091 -13.151 1.00 35.71 ? 233 LYS A CD    1 
ATOM   624  C  CE    . LYS A 1 73  ? -4.814  42.283 -13.265 1.00 39.75 ? 233 LYS A CE    1 
ATOM   625  N  NZ    . LYS A 1 73  ? -5.213  43.237 -14.343 1.00 41.31 ? 233 LYS A NZ    1 
ATOM   626  N  N     . VAL A 1 74  ? -4.940  37.517 -16.642 1.00 16.06 ? 234 VAL A N     1 
ATOM   627  C  CA    . VAL A 1 74  ? -3.841  37.469 -17.610 1.00 17.18 ? 234 VAL A CA    1 
ATOM   628  C  C     . VAL A 1 74  ? -4.370  37.283 -19.032 1.00 16.54 ? 234 VAL A C     1 
ATOM   629  O  O     . VAL A 1 74  ? -3.916  37.935 -19.977 1.00 18.94 ? 234 VAL A O     1 
ATOM   630  C  CB    . VAL A 1 74  ? -2.837  36.352 -17.261 1.00 18.36 ? 234 VAL A CB    1 
ATOM   631  C  CG1   . VAL A 1 74  ? -1.881  36.108 -18.425 1.00 18.50 ? 234 VAL A CG1   1 
ATOM   632  C  CG2   . VAL A 1 74  ? -2.066  36.731 -16.007 1.00 21.91 ? 234 VAL A CG2   1 
ATOM   633  N  N     . ILE A 1 75  ? -5.360  36.412 -19.177 1.00 16.03 ? 235 ILE A N     1 
ATOM   634  C  CA    . ILE A 1 75  ? -5.999  36.211 -20.469 1.00 16.85 ? 235 ILE A CA    1 
ATOM   635  C  C     . ILE A 1 75  ? -6.549  37.527 -21.014 1.00 21.03 ? 235 ILE A C     1 
ATOM   636  O  O     . ILE A 1 75  ? -6.325  37.878 -22.176 1.00 19.57 ? 235 ILE A O     1 
ATOM   637  C  CB    . ILE A 1 75  ? -7.144  35.184 -20.366 1.00 19.13 ? 235 ILE A CB    1 
ATOM   638  C  CG1   . ILE A 1 75  ? -6.568  33.794 -20.072 1.00 16.88 ? 235 ILE A CG1   1 
ATOM   639  C  CG2   . ILE A 1 75  ? -7.951  35.156 -21.646 1.00 20.39 ? 235 ILE A CG2   1 
ATOM   640  C  CD1   . ILE A 1 75  ? -7.631  32.743 -19.766 1.00 17.42 ? 235 ILE A CD1   1 
ATOM   641  N  N     . VAL A 1 76  ? -7.268  38.257 -20.171 1.00 18.49 ? 236 VAL A N     1 
ATOM   642  C  CA    . VAL A 1 76  ? -7.861  39.524 -20.595 1.00 20.28 ? 236 VAL A CA    1 
ATOM   643  C  C     . VAL A 1 76  ? -6.786  40.540 -20.987 1.00 23.19 ? 236 VAL A C     1 
ATOM   644  O  O     . VAL A 1 76  ? -6.885  41.187 -22.028 1.00 22.43 ? 236 VAL A O     1 
ATOM   645  C  CB    . VAL A 1 76  ? -8.760  40.122 -19.493 1.00 22.48 ? 236 VAL A CB    1 
ATOM   646  C  CG1   . VAL A 1 76  ? -9.121  41.570 -19.811 1.00 30.01 ? 236 VAL A CG1   1 
ATOM   647  C  CG2   . VAL A 1 76  ? -10.013 39.276 -19.314 1.00 22.70 ? 236 VAL A CG2   1 
ATOM   648  N  N     . ASP A 1 77  ? -5.756  40.666 -20.159 1.00 20.34 ? 237 ASP A N     1 
ATOM   649  C  CA    . ASP A 1 77  ? -4.749  41.707 -20.346 1.00 23.50 ? 237 ASP A CA    1 
ATOM   650  C  C     . ASP A 1 77  ? -3.787  41.430 -21.499 1.00 23.32 ? 237 ASP A C     1 
ATOM   651  O  O     . ASP A 1 77  ? -3.298  42.358 -22.130 1.00 23.98 ? 237 ASP A O     1 
ATOM   652  C  CB    . ASP A 1 77  ? -3.951  41.924 -19.056 1.00 29.41 ? 237 ASP A CB    1 
ATOM   653  C  CG    . ASP A 1 77  ? -4.799  42.488 -17.934 1.00 38.00 ? 237 ASP A CG    1 
ATOM   654  O  OD1   . ASP A 1 77  ? -5.890  43.029 -18.222 1.00 41.34 ? 237 ASP A OD1   1 
ATOM   655  O  OD2   . ASP A 1 77  ? -4.373  42.398 -16.764 1.00 41.27 ? 237 ASP A OD2   1 
ATOM   656  N  N     . PHE A 1 78  ? -3.508  40.157 -21.770 1.00 21.04 ? 238 PHE A N     1 
ATOM   657  C  CA    . PHE A 1 78  ? -2.494  39.818 -22.766 1.00 20.89 ? 238 PHE A CA    1 
ATOM   658  C  C     . PHE A 1 78  ? -3.053  39.274 -24.075 1.00 22.66 ? 238 PHE A C     1 
ATOM   659  O  O     . PHE A 1 78  ? -2.366  39.288 -25.100 1.00 25.34 ? 238 PHE A O     1 
ATOM   660  C  CB    . PHE A 1 78  ? -1.475  38.834 -22.179 1.00 22.51 ? 238 PHE A CB    1 
ATOM   661  C  CG    . PHE A 1 78  ? -0.559  39.449 -21.155 1.00 24.39 ? 238 PHE A CG    1 
ATOM   662  C  CD1   . PHE A 1 78  ? -0.925  39.504 -19.823 1.00 28.12 ? 238 PHE A CD1   1 
ATOM   663  C  CD2   . PHE A 1 78  ? 0.670   39.974 -21.530 1.00 29.88 ? 238 PHE A CD2   1 
ATOM   664  C  CE1   . PHE A 1 78  ? -0.087  40.075 -18.878 1.00 30.79 ? 238 PHE A CE1   1 
ATOM   665  C  CE2   . PHE A 1 78  ? 1.512   40.541 -20.589 1.00 32.32 ? 238 PHE A CE2   1 
ATOM   666  C  CZ    . PHE A 1 78  ? 1.130   40.592 -19.263 1.00 31.80 ? 238 PHE A CZ    1 
ATOM   667  N  N     . ALA A 1 79  ? -4.290  38.796 -24.047 1.00 21.96 ? 239 ALA A N     1 
ATOM   668  C  CA    . ALA A 1 79  ? -4.876  38.161 -25.223 1.00 26.21 ? 239 ALA A CA    1 
ATOM   669  C  C     . ALA A 1 79  ? -6.350  38.507 -25.412 1.00 27.09 ? 239 ALA A C     1 
ATOM   670  O  O     . ALA A 1 79  ? -7.057  37.829 -26.154 1.00 30.94 ? 239 ALA A O     1 
ATOM   671  C  CB    . ALA A 1 79  ? -4.709  36.650 -25.130 1.00 26.89 ? 239 ALA A CB    1 
ATOM   672  N  N     . GLY A 1 80  ? -6.810  39.555 -24.736 1.00 25.83 ? 240 GLY A N     1 
ATOM   673  C  CA    . GLY A 1 80  ? -8.221  39.900 -24.739 1.00 27.92 ? 240 GLY A CA    1 
ATOM   674  C  C     . GLY A 1 80  ? -8.820  40.136 -26.114 1.00 30.99 ? 240 GLY A C     1 
ATOM   675  O  O     . GLY A 1 80  ? -9.928  39.682 -26.407 1.00 33.79 ? 240 GLY A O     1 
ATOM   676  N  N     . SER A 1 81  ? -8.096  40.843 -26.971 1.00 34.57 ? 241 SER A N     1 
ATOM   677  C  CA    . SER A 1 81  ? -8.641  41.181 -28.283 1.00 39.89 ? 241 SER A CA    1 
ATOM   678  C  C     . SER A 1 81  ? -8.580  39.996 -29.245 1.00 43.05 ? 241 SER A C     1 
ATOM   679  O  O     . SER A 1 81  ? -9.154  40.041 -30.333 1.00 49.08 ? 241 SER A O     1 
ATOM   680  C  CB    . SER A 1 81  ? -7.931  42.404 -28.879 1.00 41.59 ? 241 SER A CB    1 
ATOM   681  O  OG    . SER A 1 81  ? -6.585  42.106 -29.210 1.00 39.98 ? 241 SER A OG    1 
ATOM   682  N  N     . SER A 1 82  ? -7.890  38.935 -28.842 1.00 41.94 ? 242 SER A N     1 
ATOM   683  C  CA    . SER A 1 82  ? -7.744  37.765 -29.699 1.00 44.69 ? 242 SER A CA    1 
ATOM   684  C  C     . SER A 1 82  ? -9.023  36.938 -29.706 1.00 44.19 ? 242 SER A C     1 
ATOM   685  O  O     . SER A 1 82  ? -9.284  36.202 -30.655 1.00 40.76 ? 242 SER A O     1 
ATOM   686  C  CB    . SER A 1 82  ? -6.575  36.892 -29.237 1.00 46.90 ? 242 SER A CB    1 
ATOM   687  O  OG    . SER A 1 82  ? -7.015  35.865 -28.358 1.00 47.79 ? 242 SER A OG    1 
ATOM   688  N  N     . LYS A 1 83  ? -9.808  37.066 -28.638 1.00 40.32 ? 243 LYS A N     1 
ATOM   689  C  CA    . LYS A 1 83  ? -11.026 36.279 -28.459 1.00 46.28 ? 243 LYS A CA    1 
ATOM   690  C  C     . LYS A 1 83  ? -10.793 34.783 -28.682 1.00 45.44 ? 243 LYS A C     1 
ATOM   691  O  O     . LYS A 1 83  ? -11.633 34.098 -29.269 1.00 46.78 ? 243 LYS A O     1 
ATOM   692  C  CB    . LYS A 1 83  ? -12.149 36.780 -29.378 1.00 52.75 ? 243 LYS A CB    1 
ATOM   693  C  CG    . LYS A 1 83  ? -13.121 37.749 -28.722 1.00 57.73 ? 243 LYS A CG    1 
ATOM   694  C  CD    . LYS A 1 83  ? -12.624 39.182 -28.770 1.00 61.54 ? 243 LYS A CD    1 
ATOM   695  C  CE    . LYS A 1 83  ? -13.711 40.145 -28.309 1.00 66.40 ? 243 LYS A CE    1 
ATOM   696  N  NZ    . LYS A 1 83  ? -13.340 41.571 -28.531 1.00 70.05 ? 243 LYS A NZ    1 
ATOM   697  N  N     . LEU A 1 84  ? -9.644  34.286 -28.234 1.00 41.93 ? 244 LEU A N     1 
ATOM   698  C  CA    . LEU A 1 84  ? -9.343  32.862 -28.333 1.00 38.71 ? 244 LEU A CA    1 
ATOM   699  C  C     . LEU A 1 84  ? -10.004 32.123 -27.188 1.00 31.07 ? 244 LEU A C     1 
ATOM   700  O  O     . LEU A 1 84  ? -10.375 32.726 -26.179 1.00 30.68 ? 244 LEU A O     1 
ATOM   701  C  CB    . LEU A 1 84  ? -7.831  32.611 -28.288 1.00 43.52 ? 244 LEU A CB    1 
ATOM   702  C  CG    . LEU A 1 84  ? -7.002  32.878 -29.548 1.00 50.83 ? 244 LEU A CG    1 
ATOM   703  C  CD1   . LEU A 1 84  ? -5.538  32.544 -29.301 1.00 49.06 ? 244 LEU A CD1   1 
ATOM   704  C  CD2   . LEU A 1 84  ? -7.541  32.086 -30.728 1.00 54.88 ? 244 LEU A CD2   1 
ATOM   705  N  N     . ARG A 1 85  ? -10.160 30.816 -27.347 1.00 25.03 ? 245 ARG A N     1 
ATOM   706  C  CA    . ARG A 1 85  ? -10.665 29.989 -26.268 1.00 23.37 ? 245 ARG A CA    1 
ATOM   707  C  C     . ARG A 1 85  ? -9.496  29.538 -25.405 1.00 19.64 ? 245 ARG A C     1 
ATOM   708  O  O     . ARG A 1 85  ? -8.408  29.247 -25.913 1.00 18.18 ? 245 ARG A O     1 
ATOM   709  C  CB    . ARG A 1 85  ? -11.435 28.786 -26.823 1.00 31.07 ? 245 ARG A CB    1 
ATOM   710  C  CG    . ARG A 1 85  ? -12.297 28.078 -25.793 1.00 39.37 ? 245 ARG A CG    1 
ATOM   711  C  CD    . ARG A 1 85  ? -13.258 27.078 -26.447 1.00 46.44 ? 245 ARG A CD    1 
ATOM   712  N  NE    . ARG A 1 85  ? -12.567 25.898 -26.966 1.00 48.27 ? 245 ARG A NE    1 
ATOM   713  C  CZ    . ARG A 1 85  ? -12.291 24.818 -26.242 1.00 49.77 ? 245 ARG A CZ    1 
ATOM   714  N  NH1   . ARG A 1 85  ? -12.640 24.765 -24.961 1.00 48.24 ? 245 ARG A NH1   1 
ATOM   715  N  NH2   . ARG A 1 85  ? -11.660 23.790 -26.796 1.00 50.25 ? 245 ARG A NH2   1 
ATOM   716  N  N     . PHE A 1 86  ? -9.711  29.523 -24.095 1.00 14.67 ? 246 PHE A N     1 
ATOM   717  C  CA    . PHE A 1 86  ? -8.687  29.106 -23.152 1.00 16.61 ? 246 PHE A CA    1 
ATOM   718  C  C     . PHE A 1 86  ? -9.254  28.055 -22.223 1.00 13.81 ? 246 PHE A C     1 
ATOM   719  O  O     . PHE A 1 86  ? -10.467 28.011 -21.968 1.00 16.48 ? 246 PHE A O     1 
ATOM   720  C  CB    . PHE A 1 86  ? -8.225  30.285 -22.289 1.00 16.79 ? 246 PHE A CB    1 
ATOM   721  C  CG    . PHE A 1 86  ? -7.200  31.163 -22.940 1.00 17.87 ? 246 PHE A CG    1 
ATOM   722  C  CD1   . PHE A 1 86  ? -7.581  32.190 -23.790 1.00 18.80 ? 246 PHE A CD1   1 
ATOM   723  C  CD2   . PHE A 1 86  ? -5.854  30.978 -22.667 1.00 17.23 ? 246 PHE A CD2   1 
ATOM   724  C  CE1   . PHE A 1 86  ? -6.624  33.014 -24.375 1.00 20.12 ? 246 PHE A CE1   1 
ATOM   725  C  CE2   . PHE A 1 86  ? -4.898  31.781 -23.246 1.00 17.44 ? 246 PHE A CE2   1 
ATOM   726  C  CZ    . PHE A 1 86  ? -5.279  32.809 -24.091 1.00 16.46 ? 246 PHE A CZ    1 
ATOM   727  N  N     . ARG A 1 87  ? -8.378  27.192 -21.732 1.00 13.16 ? 247 ARG A N     1 
ATOM   728  C  CA    . ARG A 1 87  ? -8.720  26.343 -20.610 1.00 15.79 ? 247 ARG A CA    1 
ATOM   729  C  C     . ARG A 1 87  ? -7.738  26.605 -19.487 1.00 15.71 ? 247 ARG A C     1 
ATOM   730  O  O     . ARG A 1 87  ? -6.583  26.950 -19.725 1.00 16.65 ? 247 ARG A O     1 
ATOM   731  C  CB    . ARG A 1 87  ? -8.733  24.860 -20.999 1.00 15.76 ? 247 ARG A CB    1 
ATOM   732  C  CG    . ARG A 1 87  ? -9.849  24.532 -21.982 1.00 17.55 ? 247 ARG A CG    1 
ATOM   733  C  CD    . ARG A 1 87  ? -9.886  23.052 -22.299 1.00 19.84 ? 247 ARG A CD    1 
ATOM   734  N  NE    . ARG A 1 87  ? -10.398 22.267 -21.180 1.00 21.07 ? 247 ARG A NE    1 
ATOM   735  C  CZ    . ARG A 1 87  ? -10.209 20.958 -21.048 1.00 25.32 ? 247 ARG A CZ    1 
ATOM   736  N  NH1   . ARG A 1 87  ? -9.502  20.299 -21.958 1.00 23.50 ? 247 ARG A NH1   1 
ATOM   737  N  NH2   . ARG A 1 87  ? -10.713 20.310 -20.005 1.00 26.86 ? 247 ARG A NH2   1 
ATOM   738  N  N     . LEU A 1 88  ? -8.216  26.451 -18.260 1.00 12.71 ? 248 LEU A N     1 
ATOM   739  C  CA    . LEU A 1 88  ? -7.367  26.608 -17.089 1.00 12.01 ? 248 LEU A CA    1 
ATOM   740  C  C     . LEU A 1 88  ? -7.466  25.323 -16.295 1.00 12.72 ? 248 LEU A C     1 
ATOM   741  O  O     . LEU A 1 88  ? -8.565  24.857 -15.988 1.00 13.86 ? 248 LEU A O     1 
ATOM   742  C  CB    . LEU A 1 88  ? -7.858  27.781 -16.240 1.00 13.55 ? 248 LEU A CB    1 
ATOM   743  C  CG    . LEU A 1 88  ? -7.739  29.205 -16.799 1.00 15.88 ? 248 LEU A CG    1 
ATOM   744  C  CD1   . LEU A 1 88  ? -8.829  29.515 -17.815 1.00 19.76 ? 248 LEU A CD1   1 
ATOM   745  C  CD2   . LEU A 1 88  ? -7.797  30.201 -15.648 1.00 20.54 ? 248 LEU A CD2   1 
ATOM   746  N  N     . GLY A 1 89  ? -6.333  24.733 -15.956 1.00 11.61 ? 249 GLY A N     1 
ATOM   747  C  CA    . GLY A 1 89  ? -6.398  23.473 -15.249 1.00 11.82 ? 249 GLY A CA    1 
ATOM   748  C  C     . GLY A 1 89  ? -5.069  22.881 -14.860 1.00 10.91 ? 249 GLY A C     1 
ATOM   749  O  O     . GLY A 1 89  ? -4.008  23.509 -15.025 1.00 11.52 ? 249 GLY A O     1 
ATOM   750  N  N     . TYR A 1 90  ? -5.141  21.649 -14.365 1.00 11.48 ? 250 TYR A N     1 
ATOM   751  C  CA    . TYR A 1 90  ? -3.995  20.956 -13.783 1.00 11.40 ? 250 TYR A CA    1 
ATOM   752  C  C     . TYR A 1 90  ? -3.833  19.575 -14.400 1.00 11.97 ? 250 TYR A C     1 
ATOM   753  O  O     . TYR A 1 90  ? -4.818  18.894 -14.669 1.00 14.72 ? 250 TYR A O     1 
ATOM   754  C  CB    . TYR A 1 90  ? -4.222  20.779 -12.273 1.00 11.70 ? 250 TYR A CB    1 
ATOM   755  C  CG    . TYR A 1 90  ? -4.385  22.072 -11.507 1.00 13.63 ? 250 TYR A CG    1 
ATOM   756  C  CD1   . TYR A 1 90  ? -3.280  22.740 -11.007 1.00 14.61 ? 250 TYR A CD1   1 
ATOM   757  C  CD2   . TYR A 1 90  ? -5.644  22.616 -11.271 1.00 13.42 ? 250 TYR A CD2   1 
ATOM   758  C  CE1   . TYR A 1 90  ? -3.413  23.915 -10.302 1.00 15.49 ? 250 TYR A CE1   1 
ATOM   759  C  CE2   . TYR A 1 90  ? -5.790  23.809 -10.560 1.00 16.99 ? 250 TYR A CE2   1 
ATOM   760  C  CZ    . TYR A 1 90  ? -4.666  24.446 -10.081 1.00 16.78 ? 250 TYR A CZ    1 
ATOM   761  O  OH    . TYR A 1 90  ? -4.783  25.617 -9.376  1.00 15.69 ? 250 TYR A OH    1 
ATOM   762  N  N     . HIS A 1 91  ? -2.590  19.148 -14.608 1.00 13.58 ? 251 HIS A N     1 
ATOM   763  C  CA    . HIS A 1 91  ? -2.358  17.776 -15.040 1.00 14.91 ? 251 HIS A CA    1 
ATOM   764  C  C     . HIS A 1 91  ? -2.593  16.848 -13.849 1.00 15.05 ? 251 HIS A C     1 
ATOM   765  O  O     . HIS A 1 91  ? -2.180  17.158 -12.735 1.00 15.79 ? 251 HIS A O     1 
ATOM   766  C  CB    . HIS A 1 91  ? -0.941  17.628 -15.594 1.00 14.12 ? 251 HIS A CB    1 
ATOM   767  C  CG    . HIS A 1 91  ? -0.784  18.169 -16.979 1.00 16.95 ? 251 HIS A CG    1 
ATOM   768  N  ND1   . HIS A 1 91  ? 0.441   18.483 -17.528 1.00 19.95 ? 251 HIS A ND1   1 
ATOM   769  C  CD2   . HIS A 1 91  ? -1.702  18.423 -17.943 1.00 22.19 ? 251 HIS A CD2   1 
ATOM   770  C  CE1   . HIS A 1 91  ? 0.269   18.926 -18.761 1.00 19.59 ? 251 HIS A CE1   1 
ATOM   771  N  NE2   . HIS A 1 91  ? -1.022  18.897 -19.038 1.00 22.00 ? 251 HIS A NE2   1 
ATOM   772  N  N     . ALA A 1 92  ? -3.271  15.727 -14.086 1.00 18.58 ? 252 ALA A N     1 
ATOM   773  C  CA    . ALA A 1 92  ? -3.648  14.798 -13.019 1.00 18.89 ? 252 ALA A CA    1 
ATOM   774  C  C     . ALA A 1 92  ? -2.427  14.237 -12.293 1.00 23.63 ? 252 ALA A C     1 
ATOM   775  O  O     . ALA A 1 92  ? -2.480  13.938 -11.093 1.00 24.48 ? 252 ALA A O     1 
ATOM   776  C  CB    . ALA A 1 92  ? -4.500  13.655 -13.586 1.00 19.73 ? 252 ALA A CB    1 
ATOM   777  N  N     . ILE A 1 93  ? -1.345  14.062 -13.046 1.00 18.70 ? 253 ILE A N     1 
ATOM   778  C  CA    . ILE A 1 93  ? -0.062  13.628 -12.512 1.00 17.93 ? 253 ILE A CA    1 
ATOM   779  C  C     . ILE A 1 93  ? 1.000   14.538 -13.132 1.00 22.01 ? 253 ILE A C     1 
ATOM   780  O  O     . ILE A 1 93  ? 1.387   14.361 -14.285 1.00 28.43 ? 253 ILE A O     1 
ATOM   781  C  CB    . ILE A 1 93  ? 0.265   12.170 -12.889 1.00 20.80 ? 253 ILE A CB    1 
ATOM   782  C  CG1   . ILE A 1 93  ? -0.894  11.233 -12.534 1.00 22.76 ? 253 ILE A CG1   1 
ATOM   783  C  CG2   . ILE A 1 93  ? 1.540   11.713 -12.188 1.00 25.61 ? 253 ILE A CG2   1 
ATOM   784  C  CD1   . ILE A 1 93  ? -0.688  9.804  -12.999 1.00 27.90 ? 253 ILE A CD1   1 
ATOM   785  N  N     . PRO A 1 94  ? 1.475   15.521 -12.374 1.00 21.46 ? 254 PRO A N     1 
ATOM   786  C  CA    . PRO A 1 94  ? 2.420   16.469 -12.970 1.00 21.90 ? 254 PRO A CA    1 
ATOM   787  C  C     . PRO A 1 94  ? 3.831   15.903 -13.002 1.00 19.32 ? 254 PRO A C     1 
ATOM   788  O  O     . PRO A 1 94  ? 4.117   14.918 -12.320 1.00 21.77 ? 254 PRO A O     1 
ATOM   789  C  CB    . PRO A 1 94  ? 2.350   17.657 -12.016 1.00 24.37 ? 254 PRO A CB    1 
ATOM   790  C  CG    . PRO A 1 94  ? 2.073   17.026 -10.690 1.00 26.23 ? 254 PRO A CG    1 
ATOM   791  C  CD    . PRO A 1 94  ? 1.214   15.811 -10.953 1.00 25.95 ? 254 PRO A CD    1 
ATOM   792  N  N     . SER A 1 95  ? 4.696   16.507 -13.808 1.00 17.83 ? 255 SER A N     1 
ATOM   793  C  CA    . SER A 1 95  ? 6.097   16.108 -13.880 1.00 17.15 ? 255 SER A CA    1 
ATOM   794  C  C     . SER A 1 95  ? 6.951   17.047 -13.039 1.00 17.98 ? 255 SER A C     1 
ATOM   795  O  O     . SER A 1 95  ? 7.908   16.629 -12.384 1.00 16.29 ? 255 SER A O     1 
ATOM   796  C  CB    . SER A 1 95  ? 6.593   16.139 -15.333 1.00 19.24 ? 255 SER A CB    1 
ATOM   797  O  OG    . SER A 1 95  ? 6.041   15.075 -16.099 1.00 22.77 ? 255 SER A OG    1 
ATOM   798  N  N     . MET A 1 96  ? 6.601   18.326 -13.071 1.00 16.24 ? 256 MET A N     1 
ATOM   799  C  CA    . MET A 1 96  ? 7.391   19.350 -12.418 1.00 14.20 ? 256 MET A CA    1 
ATOM   800  C  C     . MET A 1 96  ? 6.865   19.620 -11.016 1.00 14.69 ? 256 MET A C     1 
ATOM   801  O  O     . MET A 1 96  ? 5.648   19.714 -10.804 1.00 16.95 ? 256 MET A O     1 
ATOM   802  C  CB    . MET A 1 96  ? 7.346   20.641 -13.247 1.00 14.93 ? 256 MET A CB    1 
ATOM   803  C  CG    . MET A 1 96  ? 7.790   20.455 -14.708 1.00 14.75 ? 256 MET A CG    1 
ATOM   804  S  SD    . MET A 1 96  ? 9.557   20.184 -14.894 1.00 18.89 ? 256 MET A SD    1 
ATOM   805  C  CE    . MET A 1 96  ? 10.170  21.783 -14.354 1.00 12.57 ? 256 MET A CE    1 
ATOM   806  N  N     . SER A 1 97  ? 7.781   19.776 -10.065 1.00 12.84 ? 257 SER A N     1 
ATOM   807  C  CA    . SER A 1 97  ? 7.403   20.129 -8.695  1.00 15.13 ? 257 SER A CA    1 
ATOM   808  C  C     . SER A 1 97  ? 6.934   21.575 -8.595  1.00 16.68 ? 257 SER A C     1 
ATOM   809  O  O     . SER A 1 97  ? 7.272   22.398 -9.452  1.00 16.82 ? 257 SER A O     1 
ATOM   810  C  CB    . SER A 1 97  ? 8.573   19.920 -7.736  1.00 20.02 ? 257 SER A CB    1 
ATOM   811  O  OG    . SER A 1 97  ? 8.956   18.556 -7.702  1.00 25.26 ? 257 SER A OG    1 
ATOM   812  N  N     . HIS A 1 98  ? 6.184   21.847 -7.525  1.00 14.66 ? 258 HIS A N     1 
ATOM   813  C  CA    . HIS A 1 98  ? 5.585   23.148 -7.188  1.00 15.06 ? 258 HIS A CA    1 
ATOM   814  C  C     . HIS A 1 98  ? 4.276   23.312 -7.932  1.00 15.08 ? 258 HIS A C     1 
ATOM   815  O  O     . HIS A 1 98  ? 4.261   23.385 -9.169  1.00 17.19 ? 258 HIS A O     1 
ATOM   816  C  CB    . HIS A 1 98  ? 6.521   24.327 -7.479  1.00 15.12 ? 258 HIS A CB    1 
ATOM   817  C  CG    . HIS A 1 98  ? 6.148   25.584 -6.755  1.00 16.76 ? 258 HIS A CG    1 
ATOM   818  N  ND1   . HIS A 1 98  ? 6.894   26.086 -5.710  1.00 21.27 ? 258 HIS A ND1   1 
ATOM   819  C  CD2   . HIS A 1 98  ? 5.108   26.438 -6.921  1.00 16.97 ? 258 HIS A CD2   1 
ATOM   820  C  CE1   . HIS A 1 98  ? 6.332   27.197 -5.265  1.00 21.22 ? 258 HIS A CE1   1 
ATOM   821  N  NE2   . HIS A 1 98  ? 5.242   27.427 -5.974  1.00 17.53 ? 258 HIS A NE2   1 
ATOM   822  N  N     . VAL A 1 99  ? 3.176   23.359 -7.181  1.00 13.17 ? 259 VAL A N     1 
ATOM   823  C  CA    A VAL A 1 99  ? 1.831   23.481 -7.753  0.53 13.43 ? 259 VAL A CA    1 
ATOM   824  C  CA    B VAL A 1 99  ? 1.856   23.425 -7.803  0.47 12.92 ? 259 VAL A CA    1 
ATOM   825  C  C     . VAL A 1 99  ? 1.764   24.592 -8.788  1.00 15.28 ? 259 VAL A C     1 
ATOM   826  O  O     . VAL A 1 99  ? 2.224   25.709 -8.522  1.00 15.78 ? 259 VAL A O     1 
ATOM   827  C  CB    A VAL A 1 99  ? 0.789   23.775 -6.655  0.53 16.78 ? 259 VAL A CB    1 
ATOM   828  C  CB    B VAL A 1 99  ? 0.709   23.463 -6.761  0.47 16.37 ? 259 VAL A CB    1 
ATOM   829  C  CG1   A VAL A 1 99  ? -0.504  24.299 -7.259  0.53 16.20 ? 259 VAL A CG1   1 
ATOM   830  C  CG1   B VAL A 1 99  ? 0.798   24.709 -5.904  0.47 15.90 ? 259 VAL A CG1   1 
ATOM   831  C  CG2   A VAL A 1 99  ? 0.524   22.534 -5.840  0.53 16.12 ? 259 VAL A CG2   1 
ATOM   832  C  CG2   B VAL A 1 99  ? -0.646  23.376 -7.452  0.47 15.79 ? 259 VAL A CG2   1 
ATOM   833  N  N     . HIS A 1 100 ? 1.200   24.299 -9.954  1.00 16.22 ? 260 HIS A N     1 
ATOM   834  C  CA    . HIS A 1 100 ? 1.098   25.296 -11.013 1.00 15.17 ? 260 HIS A CA    1 
ATOM   835  C  C     . HIS A 1 100 ? -0.166  25.058 -11.814 1.00 14.95 ? 260 HIS A C     1 
ATOM   836  O  O     . HIS A 1 100 ? -0.491  23.922 -12.162 1.00 15.52 ? 260 HIS A O     1 
ATOM   837  C  CB    . HIS A 1 100 ? 2.319   25.237 -11.938 1.00 13.97 ? 260 HIS A CB    1 
ATOM   838  C  CG    . HIS A 1 100 ? 2.655   23.853 -12.406 1.00 15.29 ? 260 HIS A CG    1 
ATOM   839  N  ND1   . HIS A 1 100 ? 3.345   22.952 -11.623 1.00 18.55 ? 260 HIS A ND1   1 
ATOM   840  C  CD2   . HIS A 1 100 ? 2.399   23.217 -13.576 1.00 19.67 ? 260 HIS A CD2   1 
ATOM   841  C  CE1   . HIS A 1 100 ? 3.498   21.818 -12.288 1.00 18.12 ? 260 HIS A CE1   1 
ATOM   842  N  NE2   . HIS A 1 100 ? 2.930   21.952 -13.474 1.00 19.42 ? 260 HIS A NE2   1 
ATOM   843  N  N     . LEU A 1 101 ? -0.875  26.145 -12.084 1.00 12.15 ? 261 LEU A N     1 
ATOM   844  C  CA    . LEU A 1 101 ? -2.062  26.126 -12.915 1.00 10.26 ? 261 LEU A CA    1 
ATOM   845  C  C     . LEU A 1 101 ? -1.688  26.450 -14.356 1.00 11.98 ? 261 LEU A C     1 
ATOM   846  O  O     . LEU A 1 101 ? -1.032  27.469 -14.618 1.00 12.70 ? 261 LEU A O     1 
ATOM   847  C  CB    . LEU A 1 101 ? -3.038  27.183 -12.400 1.00 11.34 ? 261 LEU A CB    1 
ATOM   848  C  CG    . LEU A 1 101 ? -4.313  27.458 -13.192 1.00 13.14 ? 261 LEU A CG    1 
ATOM   849  C  CD1   . LEU A 1 101 ? -5.255  26.246 -13.145 1.00 13.13 ? 261 LEU A CD1   1 
ATOM   850  C  CD2   . LEU A 1 101 ? -5.007  28.703 -12.638 1.00 16.12 ? 261 LEU A CD2   1 
ATOM   851  N  N     . HIS A 1 102 ? -2.096  25.585 -15.279 1.00 12.35 ? 262 HIS A N     1 
ATOM   852  C  CA    . HIS A 1 102 ? -1.935  25.843 -16.708 1.00 11.89 ? 262 HIS A CA    1 
ATOM   853  C  C     . HIS A 1 102 ? -3.024  26.778 -17.208 1.00 13.22 ? 262 HIS A C     1 
ATOM   854  O  O     . HIS A 1 102 ? -4.210  26.566 -16.948 1.00 12.91 ? 262 HIS A O     1 
ATOM   855  C  CB    . HIS A 1 102 ? -2.031  24.536 -17.509 1.00 11.05 ? 262 HIS A CB    1 
ATOM   856  C  CG    . HIS A 1 102 ? -0.842  23.643 -17.352 1.00 13.68 ? 262 HIS A CG    1 
ATOM   857  N  ND1   . HIS A 1 102 ? 0.245   23.697 -18.198 1.00 12.56 ? 262 HIS A ND1   1 
ATOM   858  C  CD2   . HIS A 1 102 ? -0.574  22.663 -16.455 1.00 15.51 ? 262 HIS A CD2   1 
ATOM   859  C  CE1   . HIS A 1 102 ? 1.138   22.794 -17.824 1.00 14.01 ? 262 HIS A CE1   1 
ATOM   860  N  NE2   . HIS A 1 102 ? 0.666   22.156 -16.765 1.00 14.38 ? 262 HIS A NE2   1 
ATOM   861  N  N     . VAL A 1 103 ? -2.617  27.793 -17.958 1.00 11.27 ? 263 VAL A N     1 
ATOM   862  C  CA    . VAL A 1 103 ? -3.553  28.693 -18.622 1.00 11.91 ? 263 VAL A CA    1 
ATOM   863  C  C     . VAL A 1 103 ? -3.184  28.644 -20.099 1.00 14.14 ? 263 VAL A C     1 
ATOM   864  O  O     . VAL A 1 103 ? -2.157  29.175 -20.500 1.00 16.04 ? 263 VAL A O     1 
ATOM   865  C  CB    . VAL A 1 103 ? -3.406  30.126 -18.104 1.00 14.32 ? 263 VAL A CB    1 
ATOM   866  C  CG1   . VAL A 1 103 ? -4.405  31.051 -18.801 1.00 17.12 ? 263 VAL A CG1   1 
ATOM   867  C  CG2   . VAL A 1 103 ? -3.604  30.163 -16.582 1.00 16.84 ? 263 VAL A CG2   1 
ATOM   868  N  N     . ILE A 1 104 ? -4.006  27.986 -20.905 1.00 13.08 ? 264 ILE A N     1 
ATOM   869  C  CA    . ILE A 1 104 ? -3.553  27.616 -22.244 1.00 14.40 ? 264 ILE A CA    1 
ATOM   870  C  C     . ILE A 1 104 ? -4.603  27.806 -23.328 1.00 14.61 ? 264 ILE A C     1 
ATOM   871  O  O     . ILE A 1 104 ? -5.754  27.388 -23.171 1.00 16.29 ? 264 ILE A O     1 
ATOM   872  C  CB    . ILE A 1 104 ? -2.991  26.169 -22.258 1.00 14.76 ? 264 ILE A CB    1 
ATOM   873  C  CG1   . ILE A 1 104 ? -2.341  25.854 -23.609 1.00 15.47 ? 264 ILE A CG1   1 
ATOM   874  C  CG2   . ILE A 1 104 ? -4.069  25.134 -21.860 1.00 12.89 ? 264 ILE A CG2   1 
ATOM   875  C  CD1   . ILE A 1 104 ? -1.646  24.494 -23.653 1.00 13.95 ? 264 ILE A CD1   1 
ATOM   876  N  N     . SER A 1 105 ? -4.205  28.468 -24.416 1.00 14.74 ? 265 SER A N     1 
ATOM   877  C  CA    . SER A 1 105 ? -5.108  28.700 -25.543 1.00 14.44 ? 265 SER A CA    1 
ATOM   878  C  C     . SER A 1 105 ? -5.335  27.410 -26.318 1.00 14.29 ? 265 SER A C     1 
ATOM   879  O  O     . SER A 1 105 ? -4.490  26.515 -26.332 1.00 14.87 ? 265 SER A O     1 
ATOM   880  C  CB    . SER A 1 105 ? -4.591  29.823 -26.462 1.00 15.57 ? 265 SER A CB    1 
ATOM   881  O  OG    . SER A 1 105 ? -3.305  29.506 -26.969 1.00 15.37 ? 265 SER A OG    1 
ATOM   882  N  N     . GLN A 1 106 ? -6.490  27.311 -26.961 1.00 15.41 ? 266 GLN A N     1 
ATOM   883  C  CA    . GLN A 1 106 ? -6.952  26.024 -27.473 1.00 18.31 ? 266 GLN A CA    1 
ATOM   884  C  C     . GLN A 1 106 ? -6.684  25.823 -28.968 1.00 21.57 ? 266 GLN A C     1 
ATOM   885  O  O     . GLN A 1 106 ? -7.247  24.926 -29.601 1.00 19.89 ? 266 GLN A O     1 
ATOM   886  C  CB    . GLN A 1 106 ? -8.426  25.838 -27.118 1.00 18.87 ? 266 GLN A CB    1 
ATOM   887  C  CG    . GLN A 1 106 ? -8.631  25.799 -25.603 1.00 17.92 ? 266 GLN A CG    1 
ATOM   888  C  CD    . GLN A 1 106 ? -8.070  24.530 -24.984 1.00 17.22 ? 266 GLN A CD    1 
ATOM   889  O  OE1   . GLN A 1 106 ? -8.541  23.428 -25.278 1.00 19.39 ? 266 GLN A OE1   1 
ATOM   890  N  NE2   . GLN A 1 106 ? -7.041  24.675 -24.151 1.00 15.10 ? 266 GLN A NE2   1 
ATOM   891  N  N     . ASP A 1 107 ? -5.804  26.654 -29.517 1.00 16.32 ? 267 ASP A N     1 
ATOM   892  C  CA    . ASP A 1 107 ? -5.306  26.453 -30.869 1.00 18.03 ? 267 ASP A CA    1 
ATOM   893  C  C     . ASP A 1 107 ? -4.335  25.282 -30.895 1.00 16.31 ? 267 ASP A C     1 
ATOM   894  O  O     . ASP A 1 107 ? -4.263  24.551 -31.880 1.00 18.35 ? 267 ASP A O     1 
ATOM   895  C  CB    . ASP A 1 107 ? -4.567  27.708 -31.331 1.00 21.88 ? 267 ASP A CB    1 
ATOM   896  C  CG    . ASP A 1 107 ? -3.563  28.196 -30.298 1.00 20.17 ? 267 ASP A CG    1 
ATOM   897  O  OD1   . ASP A 1 107 ? -3.976  28.907 -29.362 1.00 18.52 ? 267 ASP A OD1   1 
ATOM   898  O  OD2   . ASP A 1 107 ? -2.360  27.865 -30.412 1.00 20.73 ? 267 ASP A OD2   1 
ATOM   899  N  N     . PHE A 1 108 ? -3.586  25.124 -29.805 1.00 16.48 ? 268 PHE A N     1 
ATOM   900  C  CA    . PHE A 1 108 ? -2.464  24.180 -29.732 1.00 18.34 ? 268 PHE A CA    1 
ATOM   901  C  C     . PHE A 1 108 ? -1.515  24.293 -30.924 1.00 20.13 ? 268 PHE A C     1 
ATOM   902  O  O     . PHE A 1 108 ? -0.999  23.289 -31.422 1.00 20.55 ? 268 PHE A O     1 
ATOM   903  C  CB    . PHE A 1 108 ? -2.955  22.741 -29.547 1.00 17.57 ? 268 PHE A CB    1 
ATOM   904  C  CG    . PHE A 1 108 ? -3.684  22.519 -28.248 1.00 18.42 ? 268 PHE A CG    1 
ATOM   905  C  CD1   . PHE A 1 108 ? -2.984  22.447 -27.052 1.00 14.72 ? 268 PHE A CD1   1 
ATOM   906  C  CD2   . PHE A 1 108 ? -5.067  22.379 -28.231 1.00 17.27 ? 268 PHE A CD2   1 
ATOM   907  C  CE1   . PHE A 1 108 ? -3.638  22.254 -25.850 1.00 17.29 ? 268 PHE A CE1   1 
ATOM   908  C  CE2   . PHE A 1 108 ? -5.732  22.187 -27.038 1.00 17.95 ? 268 PHE A CE2   1 
ATOM   909  C  CZ    . PHE A 1 108 ? -5.018  22.128 -25.843 1.00 13.90 ? 268 PHE A CZ    1 
ATOM   910  N  N     . ASP A 1 109 ? -1.295  25.528 -31.373 1.00 17.32 ? 269 ASP A N     1 
ATOM   911  C  CA    . ASP A 1 109 ? -0.382  25.799 -32.475 1.00 17.91 ? 269 ASP A CA    1 
ATOM   912  C  C     . ASP A 1 109 ? 0.999   26.116 -31.907 1.00 20.27 ? 269 ASP A C     1 
ATOM   913  O  O     . ASP A 1 109 ? 1.279   27.259 -31.557 1.00 22.21 ? 269 ASP A O     1 
ATOM   914  C  CB    . ASP A 1 109 ? -0.904  26.984 -33.300 1.00 19.57 ? 269 ASP A CB    1 
ATOM   915  C  CG    . ASP A 1 109 ? 0.086   27.459 -34.347 1.00 25.61 ? 269 ASP A CG    1 
ATOM   916  O  OD1   . ASP A 1 109 ? 0.891   26.638 -34.840 1.00 24.36 ? 269 ASP A OD1   1 
ATOM   917  O  OD2   . ASP A 1 109 ? 0.057   28.665 -34.676 1.00 27.47 ? 269 ASP A OD2   1 
ATOM   918  N  N     . SER A 1 110 ? 1.857   25.103 -31.814 1.00 17.62 ? 270 SER A N     1 
ATOM   919  C  CA    . SER A 1 110 ? 3.191   25.289 -31.242 1.00 17.75 ? 270 SER A CA    1 
ATOM   920  C  C     . SER A 1 110 ? 4.145   24.181 -31.662 1.00 17.53 ? 270 SER A C     1 
ATOM   921  O  O     . SER A 1 110 ? 3.768   23.016 -31.694 1.00 20.18 ? 270 SER A O     1 
ATOM   922  C  CB    . SER A 1 110 ? 3.113   25.315 -29.715 1.00 21.14 ? 270 SER A CB    1 
ATOM   923  O  OG    . SER A 1 110 ? 4.409   25.414 -29.144 1.00 24.07 ? 270 SER A OG    1 
ATOM   924  N  N     . PRO A 1 111 ? 5.391   24.542 -31.979 1.00 20.04 ? 271 PRO A N     1 
ATOM   925  C  CA    . PRO A 1 111 ? 6.365   23.497 -32.309 1.00 24.42 ? 271 PRO A CA    1 
ATOM   926  C  C     . PRO A 1 111 ? 6.739   22.660 -31.086 1.00 21.77 ? 271 PRO A C     1 
ATOM   927  O  O     . PRO A 1 111 ? 7.252   21.556 -31.258 1.00 24.23 ? 271 PRO A O     1 
ATOM   928  C  CB    . PRO A 1 111 ? 7.579   24.290 -32.819 1.00 27.69 ? 271 PRO A CB    1 
ATOM   929  C  CG    . PRO A 1 111 ? 7.421   25.660 -32.243 1.00 30.84 ? 271 PRO A CG    1 
ATOM   930  C  CD    . PRO A 1 111 ? 5.938   25.898 -32.151 1.00 27.02 ? 271 PRO A CD    1 
ATOM   931  N  N     . CYS A 1 112 ? 6.489   23.168 -29.880 1.00 19.00 ? 272 CYS A N     1 
ATOM   932  C  CA    . CYS A 1 112 ? 6.818   22.422 -28.662 1.00 20.24 ? 272 CYS A CA    1 
ATOM   933  C  C     . CYS A 1 112 ? 5.860   21.257 -28.432 1.00 19.32 ? 272 CYS A C     1 
ATOM   934  O  O     . CYS A 1 112 ? 6.162   20.351 -27.664 1.00 19.45 ? 272 CYS A O     1 
ATOM   935  C  CB    . CYS A 1 112 ? 6.838   23.334 -27.432 1.00 18.08 ? 272 CYS A CB    1 
ATOM   936  S  SG    . CYS A 1 112 ? 7.955   24.738 -27.582 1.00 28.80 ? 272 CYS A SG    1 
ATOM   937  N  N     . LEU A 1 113 ? 4.702   21.288 -29.084 1.00 18.45 ? 273 LEU A N     1 
ATOM   938  C  CA    . LEU A 1 113 ? 3.788   20.152 -29.047 1.00 18.31 ? 273 LEU A CA    1 
ATOM   939  C  C     . LEU A 1 113 ? 4.296   19.097 -30.032 1.00 22.05 ? 273 LEU A C     1 
ATOM   940  O  O     . LEU A 1 113 ? 4.185   19.263 -31.254 1.00 20.60 ? 273 LEU A O     1 
ATOM   941  C  CB    . LEU A 1 113 ? 2.372   20.598 -29.410 1.00 20.25 ? 273 LEU A CB    1 
ATOM   942  C  CG    . LEU A 1 113 ? 1.211   19.809 -28.806 1.00 27.28 ? 273 LEU A CG    1 
ATOM   943  C  CD1   . LEU A 1 113 ? -0.091  20.568 -28.996 1.00 28.39 ? 273 LEU A CD1   1 
ATOM   944  C  CD2   . LEU A 1 113 ? 1.111   18.414 -29.411 1.00 27.16 ? 273 LEU A CD2   1 
ATOM   945  N  N     . LYS A 1 114 ? 4.857   18.018 -29.498 1.00 18.08 ? 274 LYS A N     1 
ATOM   946  C  CA    . LYS A 1 114 ? 5.653   17.098 -30.307 1.00 19.75 ? 274 LYS A CA    1 
ATOM   947  C  C     . LYS A 1 114 ? 5.237   15.634 -30.207 1.00 21.52 ? 274 LYS A C     1 
ATOM   948  O  O     . LYS A 1 114 ? 5.607   14.837 -31.058 1.00 20.28 ? 274 LYS A O     1 
ATOM   949  C  CB    . LYS A 1 114 ? 7.131   17.198 -29.922 1.00 20.63 ? 274 LYS A CB    1 
ATOM   950  C  CG    . LYS A 1 114 ? 7.817   18.475 -30.368 1.00 29.32 ? 274 LYS A CG    1 
ATOM   951  C  CD    . LYS A 1 114 ? 9.314   18.374 -30.160 1.00 30.76 ? 274 LYS A CD    1 
ATOM   952  C  CE    . LYS A 1 114 ? 9.970   19.741 -30.177 1.00 32.31 ? 274 LYS A CE    1 
ATOM   953  N  NZ    . LYS A 1 114 ? 11.443  19.640 -30.015 1.00 33.92 ? 274 LYS A NZ    1 
ATOM   954  N  N     . ASN A 1 115 ? 4.503   15.265 -29.163 1.00 17.60 ? 275 ASN A N     1 
ATOM   955  C  CA    . ASN A 1 115 ? 4.182   13.851 -28.981 1.00 18.54 ? 275 ASN A CA    1 
ATOM   956  C  C     . ASN A 1 115 ? 2.795   13.598 -28.402 1.00 17.89 ? 275 ASN A C     1 
ATOM   957  O  O     . ASN A 1 115 ? 2.108   14.531 -27.961 1.00 17.48 ? 275 ASN A O     1 
ATOM   958  C  CB    . ASN A 1 115 ? 5.271   13.155 -28.152 1.00 21.71 ? 275 ASN A CB    1 
ATOM   959  C  CG    . ASN A 1 115 ? 5.485   13.811 -26.804 1.00 22.20 ? 275 ASN A CG    1 
ATOM   960  O  OD1   . ASN A 1 115 ? 4.544   13.997 -26.041 1.00 19.11 ? 275 ASN A OD1   1 
ATOM   961  N  ND2   . ASN A 1 115 ? 6.730   14.174 -26.510 1.00 20.92 ? 275 ASN A ND2   1 
ATOM   962  N  N     . LYS A 1 116 ? 2.405   12.330 -28.397 1.00 15.75 ? 276 LYS A N     1 
ATOM   963  C  CA    . LYS A 1 116 ? 1.075   11.920 -27.968 1.00 15.73 ? 276 LYS A CA    1 
ATOM   964  C  C     . LYS A 1 116 ? 0.832   12.292 -26.509 1.00 17.43 ? 276 LYS A C     1 
ATOM   965  O  O     . LYS A 1 116 ? -0.289  12.647 -26.127 1.00 17.58 ? 276 LYS A O     1 
ATOM   966  C  CB    . LYS A 1 116 ? 0.890   10.413 -28.184 1.00 17.78 ? 276 LYS A CB    1 
ATOM   967  C  CG    . LYS A 1 116 ? -0.418  9.851  -27.632 1.00 22.40 ? 276 LYS A CG    1 
ATOM   968  C  CD    . LYS A 1 116 ? -0.663  8.418  -28.089 1.00 22.43 ? 276 LYS A CD    1 
ATOM   969  C  CE    . LYS A 1 116 ? -1.198  8.379  -29.512 1.00 26.36 ? 276 LYS A CE    1 
ATOM   970  N  NZ    . LYS A 1 116 ? -1.464  6.987  -29.974 1.00 31.58 ? 276 LYS A NZ    1 
ATOM   971  N  N     . LYS A 1 117 ? 1.875   12.210 -25.687 1.00 18.61 ? 277 LYS A N     1 
ATOM   972  C  CA    . LYS A 1 117 ? 1.704   12.546 -24.281 1.00 18.98 ? 277 LYS A CA    1 
ATOM   973  C  C     . LYS A 1 117 ? 1.315   14.008 -24.135 1.00 18.51 ? 277 LYS A C     1 
ATOM   974  O  O     . LYS A 1 117 ? 0.416   14.330 -23.358 1.00 18.78 ? 277 LYS A O     1 
ATOM   975  C  CB    . LYS A 1 117 ? 2.937   12.218 -23.435 1.00 20.96 ? 277 LYS A CB    1 
ATOM   976  C  CG    . LYS A 1 117 ? 2.771   12.655 -21.979 1.00 24.45 ? 277 LYS A CG    1 
ATOM   977  C  CD    . LYS A 1 117 ? 3.818   12.062 -21.049 1.00 30.24 ? 277 LYS A CD    1 
ATOM   978  C  CE    . LYS A 1 117 ? 3.582   12.537 -19.609 1.00 33.48 ? 277 LYS A CE    1 
ATOM   979  N  NZ    . LYS A 1 117 ? 4.638   12.069 -18.668 1.00 37.25 ? 277 LYS A NZ    1 
ATOM   980  N  N     . HIS A 1 118 ? 1.984   14.886 -24.884 1.00 15.59 ? 278 HIS A N     1 
ATOM   981  C  CA    . HIS A 1 118 ? 1.632   16.304 -24.883 1.00 16.30 ? 278 HIS A CA    1 
ATOM   982  C  C     . HIS A 1 118 ? 0.155   16.478 -25.200 1.00 16.64 ? 278 HIS A C     1 
ATOM   983  O  O     . HIS A 1 118 ? -0.581  17.139 -24.460 1.00 16.28 ? 278 HIS A O     1 
ATOM   984  C  CB    . HIS A 1 118 ? 2.449   17.064 -25.929 1.00 15.60 ? 278 HIS A CB    1 
ATOM   985  C  CG    . HIS A 1 118 ? 3.900   17.190 -25.589 1.00 16.04 ? 278 HIS A CG    1 
ATOM   986  N  ND1   . HIS A 1 118 ? 4.875   17.380 -26.546 1.00 17.87 ? 278 HIS A ND1   1 
ATOM   987  C  CD2   . HIS A 1 118 ? 4.540   17.183 -24.394 1.00 17.16 ? 278 HIS A CD2   1 
ATOM   988  C  CE1   . HIS A 1 118 ? 6.054   17.465 -25.956 1.00 18.57 ? 278 HIS A CE1   1 
ATOM   989  N  NE2   . HIS A 1 118 ? 5.877   17.359 -24.650 1.00 17.61 ? 278 HIS A NE2   1 
ATOM   990  N  N     . TRP A 1 119 ? -0.277  15.865 -26.297 1.00 13.57 ? 279 TRP A N     1 
ATOM   991  C  CA    . TRP A 1 119 ? -1.648  16.030 -26.748 1.00 12.53 ? 279 TRP A CA    1 
ATOM   992  C  C     . TRP A 1 119 ? -2.663  15.539 -25.717 1.00 15.98 ? 279 TRP A C     1 
ATOM   993  O  O     . TRP A 1 119 ? -3.596  16.258 -25.355 1.00 16.80 ? 279 TRP A O     1 
ATOM   994  C  CB    . TRP A 1 119 ? -1.894  15.319 -28.083 1.00 13.88 ? 279 TRP A CB    1 
ATOM   995  C  CG    . TRP A 1 119 ? -3.294  15.517 -28.514 1.00 16.05 ? 279 TRP A CG    1 
ATOM   996  C  CD1   . TRP A 1 119 ? -4.295  14.591 -28.517 1.00 15.90 ? 279 TRP A CD1   1 
ATOM   997  C  CD2   . TRP A 1 119 ? -3.876  16.747 -28.957 1.00 18.35 ? 279 TRP A CD2   1 
ATOM   998  N  NE1   . TRP A 1 119 ? -5.471  15.170 -28.955 1.00 19.78 ? 279 TRP A NE1   1 
ATOM   999  C  CE2   . TRP A 1 119 ? -5.233  16.493 -29.235 1.00 18.41 ? 279 TRP A CE2   1 
ATOM   1000 C  CE3   . TRP A 1 119 ? -3.375  18.041 -29.157 1.00 18.52 ? 279 TRP A CE3   1 
ATOM   1001 C  CZ2   . TRP A 1 119 ? -6.098  17.483 -29.697 1.00 18.69 ? 279 TRP A CZ2   1 
ATOM   1002 C  CZ3   . TRP A 1 119 ? -4.235  19.019 -29.619 1.00 20.35 ? 279 TRP A CZ3   1 
ATOM   1003 C  CH2   . TRP A 1 119 ? -5.580  18.734 -29.887 1.00 22.41 ? 279 TRP A CH2   1 
ATOM   1004 N  N     . ASN A 1 120 ? -2.477  14.313 -25.247 1.00 15.64 ? 280 ASN A N     1 
ATOM   1005 C  CA    . ASN A 1 120 ? -3.441  13.701 -24.340 1.00 15.60 ? 280 ASN A CA    1 
ATOM   1006 C  C     . ASN A 1 120 ? -3.407  14.293 -22.928 1.00 16.60 ? 280 ASN A C     1 
ATOM   1007 O  O     . ASN A 1 120 ? -4.387  14.207 -22.192 1.00 17.54 ? 280 ASN A O     1 
ATOM   1008 C  CB    . ASN A 1 120 ? -3.245  12.188 -24.295 1.00 14.99 ? 280 ASN A CB    1 
ATOM   1009 C  CG    . ASN A 1 120 ? -3.754  11.503 -25.544 1.00 20.37 ? 280 ASN A CG    1 
ATOM   1010 O  OD1   . ASN A 1 120 ? -4.694  11.975 -26.194 1.00 21.33 ? 280 ASN A OD1   1 
ATOM   1011 N  ND2   . ASN A 1 120 ? -3.135  10.389 -25.893 1.00 19.76 ? 280 ASN A ND2   1 
ATOM   1012 N  N     . SER A 1 121 ? -2.291  14.917 -22.558 1.00 14.70 ? 281 SER A N     1 
ATOM   1013 C  CA    . SER A 1 121 ? -2.209  15.547 -21.242 1.00 16.22 ? 281 SER A CA    1 
ATOM   1014 C  C     . SER A 1 121 ? -3.099  16.783 -21.168 1.00 17.43 ? 281 SER A C     1 
ATOM   1015 O  O     . SER A 1 121 ? -3.489  17.192 -20.081 1.00 19.28 ? 281 SER A O     1 
ATOM   1016 C  CB    . SER A 1 121 ? -0.767  15.922 -20.874 1.00 16.26 ? 281 SER A CB    1 
ATOM   1017 O  OG    . SER A 1 121 ? -0.316  17.013 -21.645 1.00 19.17 ? 281 SER A OG    1 
ATOM   1018 N  N     . PHE A 1 122 ? -3.418  17.371 -22.320 1.00 14.10 ? 282 PHE A N     1 
ATOM   1019 C  CA    . PHE A 1 122 ? -4.278  18.554 -22.356 1.00 13.84 ? 282 PHE A CA    1 
ATOM   1020 C  C     . PHE A 1 122 ? -5.675  18.268 -22.890 1.00 17.01 ? 282 PHE A C     1 
ATOM   1021 O  O     . PHE A 1 122 ? -6.562  19.128 -22.821 1.00 18.91 ? 282 PHE A O     1 
ATOM   1022 C  CB    . PHE A 1 122 ? -3.632  19.655 -23.202 1.00 15.67 ? 282 PHE A CB    1 
ATOM   1023 C  CG    . PHE A 1 122 ? -2.457  20.293 -22.535 1.00 16.79 ? 282 PHE A CG    1 
ATOM   1024 C  CD1   . PHE A 1 122 ? -2.645  21.241 -21.545 1.00 17.00 ? 282 PHE A CD1   1 
ATOM   1025 C  CD2   . PHE A 1 122 ? -1.163  19.921 -22.872 1.00 19.40 ? 282 PHE A CD2   1 
ATOM   1026 C  CE1   . PHE A 1 122 ? -1.561  21.832 -20.912 1.00 16.29 ? 282 PHE A CE1   1 
ATOM   1027 C  CE2   . PHE A 1 122 ? -0.076  20.501 -22.240 1.00 12.96 ? 282 PHE A CE2   1 
ATOM   1028 C  CZ    . PHE A 1 122 ? -0.275  21.452 -21.259 1.00 16.19 ? 282 PHE A CZ    1 
ATOM   1029 N  N     . ASN A 1 123 ? -5.879  17.068 -23.418 1.00 13.89 ? 283 ASN A N     1 
ATOM   1030 C  CA    . ASN A 1 123 ? -7.117  16.793 -24.149 1.00 15.72 ? 283 ASN A CA    1 
ATOM   1031 C  C     . ASN A 1 123 ? -7.839  15.504 -23.783 1.00 22.46 ? 283 ASN A C     1 
ATOM   1032 O  O     . ASN A 1 123 ? -8.586  14.954 -24.590 1.00 24.91 ? 283 ASN A O     1 
ATOM   1033 C  CB    . ASN A 1 123 ? -6.864  16.848 -25.656 1.00 17.70 ? 283 ASN A CB    1 
ATOM   1034 C  CG    . ASN A 1 123 ? -6.557  18.252 -26.124 1.00 19.61 ? 283 ASN A CG    1 
ATOM   1035 O  OD1   . ASN A 1 123 ? -7.453  19.082 -26.231 1.00 19.18 ? 283 ASN A OD1   1 
ATOM   1036 N  ND2   . ASN A 1 123 ? -5.283  18.537 -26.359 1.00 17.63 ? 283 ASN A ND2   1 
ATOM   1037 N  N     . THR A 1 124 ? -7.608  15.028 -22.568 1.00 21.09 ? 284 THR A N     1 
ATOM   1038 C  CA    . THR A 1 124 ? -8.375  13.928 -22.011 1.00 20.57 ? 284 THR A CA    1 
ATOM   1039 C  C     . THR A 1 124 ? -8.689  14.305 -20.581 1.00 22.95 ? 284 THR A C     1 
ATOM   1040 O  O     . THR A 1 124 ? -8.387  15.423 -20.145 1.00 20.84 ? 284 THR A O     1 
ATOM   1041 C  CB    . THR A 1 124 ? -7.560  12.624 -21.996 1.00 21.85 ? 284 THR A CB    1 
ATOM   1042 O  OG1   . THR A 1 124 ? -6.424  12.796 -21.136 1.00 18.89 ? 284 THR A OG1   1 
ATOM   1043 C  CG2   . THR A 1 124 ? -7.088  12.255 -23.404 1.00 21.55 ? 284 THR A CG2   1 
ATOM   1044 N  N     . GLU A 1 125 ? -9.268  13.377 -19.827 1.00 22.64 ? 285 GLU A N     1 
ATOM   1045 C  CA    A GLU A 1 125 ? -9.566  13.600 -18.415 0.62 24.85 ? 285 GLU A CA    1 
ATOM   1046 C  CA    B GLU A 1 125 ? -9.574  13.656 -18.426 0.38 24.37 ? 285 GLU A CA    1 
ATOM   1047 C  C     . GLU A 1 125 ? -8.290  13.821 -17.596 1.00 23.25 ? 285 GLU A C     1 
ATOM   1048 O  O     . GLU A 1 125 ? -8.333  14.245 -16.449 1.00 25.48 ? 285 GLU A O     1 
ATOM   1049 C  CB    A GLU A 1 125 ? -10.381 12.432 -17.849 0.62 29.96 ? 285 GLU A CB    1 
ATOM   1050 C  CB    B GLU A 1 125 ? -10.559 12.613 -17.862 0.38 29.25 ? 285 GLU A CB    1 
ATOM   1051 C  CG    A GLU A 1 125 ? -11.758 12.239 -18.494 0.62 32.39 ? 285 GLU A CG    1 
ATOM   1052 C  CG    B GLU A 1 125 ? -10.246 12.025 -16.490 0.38 33.82 ? 285 GLU A CG    1 
ATOM   1053 C  CD    A GLU A 1 125 ? -11.718 11.411 -19.775 0.62 35.63 ? 285 GLU A CD    1 
ATOM   1054 C  CD    B GLU A 1 125 ? -10.549 12.966 -15.333 0.38 38.15 ? 285 GLU A CD    1 
ATOM   1055 O  OE1   A GLU A 1 125 ? -10.608 11.100 -20.258 0.62 34.17 ? 285 GLU A OE1   1 
ATOM   1056 O  OE1   B GLU A 1 125 ? -10.157 12.640 -14.193 0.38 38.07 ? 285 GLU A OE1   1 
ATOM   1057 O  OE2   A GLU A 1 125 ? -12.802 11.063 -20.296 0.62 35.71 ? 285 GLU A OE2   1 
ATOM   1058 O  OE2   B GLU A 1 125 ? -11.160 14.032 -15.560 0.38 43.37 ? 285 GLU A OE2   1 
ATOM   1059 N  N     . TYR A 1 126 ? -7.136  13.539 -18.202 1.00 18.30 ? 286 TYR A N     1 
ATOM   1060 C  CA    . TYR A 1 126 ? -5.845  13.830 -17.569 1.00 14.93 ? 286 TYR A CA    1 
ATOM   1061 C  C     . TYR A 1 126 ? -5.735  15.320 -17.228 1.00 18.02 ? 286 TYR A C     1 
ATOM   1062 O  O     . TYR A 1 126 ? -5.019  15.722 -16.307 1.00 18.02 ? 286 TYR A O     1 
ATOM   1063 C  CB    . TYR A 1 126 ? -4.707  13.460 -18.531 1.00 17.69 ? 286 TYR A CB    1 
ATOM   1064 C  CG    . TYR A 1 126 ? -3.362  13.214 -17.884 1.00 17.45 ? 286 TYR A CG    1 
ATOM   1065 C  CD1   . TYR A 1 126 ? -3.005  11.948 -17.452 1.00 23.42 ? 286 TYR A CD1   1 
ATOM   1066 C  CD2   . TYR A 1 126 ? -2.433  14.247 -17.735 1.00 20.54 ? 286 TYR A CD2   1 
ATOM   1067 C  CE1   . TYR A 1 126 ? -1.774  11.704 -16.876 1.00 25.67 ? 286 TYR A CE1   1 
ATOM   1068 C  CE2   . TYR A 1 126 ? -1.191  14.010 -17.148 1.00 22.48 ? 286 TYR A CE2   1 
ATOM   1069 C  CZ    . TYR A 1 126 ? -0.873  12.737 -16.726 1.00 26.65 ? 286 TYR A CZ    1 
ATOM   1070 O  OH    . TYR A 1 126 ? 0.351   12.474 -16.150 1.00 32.92 ? 286 TYR A OH    1 
ATOM   1071 N  N     . PHE A 1 127 ? -6.428  16.149 -17.993 1.00 16.08 ? 287 PHE A N     1 
ATOM   1072 C  CA    . PHE A 1 127 ? -6.419  17.580 -17.724 1.00 14.50 ? 287 PHE A CA    1 
ATOM   1073 C  C     . PHE A 1 127 ? -7.591  17.903 -16.807 1.00 15.30 ? 287 PHE A C     1 
ATOM   1074 O  O     . PHE A 1 127 ? -8.746  17.859 -17.227 1.00 18.39 ? 287 PHE A O     1 
ATOM   1075 C  CB    . PHE A 1 127 ? -6.509  18.360 -19.031 1.00 14.26 ? 287 PHE A CB    1 
ATOM   1076 C  CG    . PHE A 1 127 ? -6.318  19.846 -18.875 1.00 15.99 ? 287 PHE A CG    1 
ATOM   1077 C  CD1   . PHE A 1 127 ? -5.046  20.387 -18.770 1.00 18.20 ? 287 PHE A CD1   1 
ATOM   1078 C  CD2   . PHE A 1 127 ? -7.410  20.700 -18.853 1.00 17.93 ? 287 PHE A CD2   1 
ATOM   1079 C  CE1   . PHE A 1 127 ? -4.868  21.768 -18.633 1.00 19.64 ? 287 PHE A CE1   1 
ATOM   1080 C  CE2   . PHE A 1 127 ? -7.241  22.082 -18.722 1.00 20.03 ? 287 PHE A CE2   1 
ATOM   1081 C  CZ    . PHE A 1 127 ? -5.966  22.609 -18.610 1.00 20.13 ? 287 PHE A CZ    1 
ATOM   1082 N  N     . LEU A 1 128 ? -7.285  18.193 -15.546 1.00 15.79 ? 288 LEU A N     1 
ATOM   1083 C  CA    . LEU A 1 128 ? -8.314  18.483 -14.551 1.00 18.09 ? 288 LEU A CA    1 
ATOM   1084 C  C     . LEU A 1 128 ? -8.675  19.962 -14.576 1.00 14.11 ? 288 LEU A C     1 
ATOM   1085 O  O     . LEU A 1 128 ? -7.813  20.818 -14.366 1.00 15.89 ? 288 LEU A O     1 
ATOM   1086 C  CB    . LEU A 1 128 ? -7.820  18.121 -13.151 1.00 18.58 ? 288 LEU A CB    1 
ATOM   1087 C  CG    . LEU A 1 128 ? -7.244  16.729 -12.868 1.00 22.19 ? 288 LEU A CG    1 
ATOM   1088 C  CD1   . LEU A 1 128 ? -6.808  16.662 -11.412 1.00 23.21 ? 288 LEU A CD1   1 
ATOM   1089 C  CD2   . LEU A 1 128 ? -8.249  15.624 -13.178 1.00 22.82 ? 288 LEU A CD2   1 
ATOM   1090 N  N     . GLU A 1 129 ? -9.946  20.268 -14.813 1.00 13.68 ? 289 GLU A N     1 
ATOM   1091 C  CA    . GLU A 1 129 ? -10.377 21.663 -14.857 1.00 15.00 ? 289 GLU A CA    1 
ATOM   1092 C  C     . GLU A 1 129 ? -10.115 22.341 -13.518 1.00 12.91 ? 289 GLU A C     1 
ATOM   1093 O  O     . GLU A 1 129 ? -10.314 21.741 -12.466 1.00 13.85 ? 289 GLU A O     1 
ATOM   1094 C  CB    . GLU A 1 129 ? -11.867 21.767 -15.206 1.00 22.84 ? 289 GLU A CB    1 
ATOM   1095 C  CG    . GLU A 1 129 ? -12.197 21.485 -16.658 1.00 31.59 ? 289 GLU A CG    1 
ATOM   1096 C  CD    . GLU A 1 129 ? -11.996 22.701 -17.542 1.00 41.68 ? 289 GLU A CD    1 
ATOM   1097 O  OE1   . GLU A 1 129 ? -11.749 23.798 -16.991 1.00 44.88 ? 289 GLU A OE1   1 
ATOM   1098 O  OE2   . GLU A 1 129 ? -12.093 22.568 -18.783 1.00 43.07 ? 289 GLU A OE2   1 
ATOM   1099 N  N     . SER A 1 130 ? -9.658  23.591 -13.560 1.00 12.63 ? 290 SER A N     1 
ATOM   1100 C  CA    . SER A 1 130 ? -9.397  24.341 -12.335 1.00 12.60 ? 290 SER A CA    1 
ATOM   1101 C  C     . SER A 1 130 ? -10.648 24.387 -11.451 1.00 16.31 ? 290 SER A C     1 
ATOM   1102 O  O     . SER A 1 130 ? -10.579 24.145 -10.248 1.00 14.69 ? 290 SER A O     1 
ATOM   1103 C  CB    . SER A 1 130 ? -8.927  25.758 -12.674 1.00 15.65 ? 290 SER A CB    1 
ATOM   1104 O  OG    . SER A 1 130 ? -8.858  26.568 -11.509 1.00 19.77 ? 290 SER A OG    1 
ATOM   1105 N  N     . GLN A 1 131 ? -11.796 24.669 -12.056 1.00 16.34 ? 291 GLN A N     1 
ATOM   1106 C  CA    . GLN A 1 131 ? -13.039 24.732 -11.294 1.00 18.15 ? 291 GLN A CA    1 
ATOM   1107 C  C     . GLN A 1 131 ? -13.343 23.397 -10.601 1.00 15.49 ? 291 GLN A C     1 
ATOM   1108 O  O     . GLN A 1 131 ? -13.830 23.380 -9.475  1.00 17.18 ? 291 GLN A O     1 
ATOM   1109 C  CB    . GLN A 1 131 ? -14.206 25.130 -12.197 1.00 25.85 ? 291 GLN A CB    1 
ATOM   1110 C  CG    . GLN A 1 131 ? -15.228 25.992 -11.499 1.00 38.40 ? 291 GLN A CG    1 
ATOM   1111 C  CD    . GLN A 1 131 ? -14.637 27.314 -11.031 1.00 46.59 ? 291 GLN A CD    1 
ATOM   1112 O  OE1   . GLN A 1 131 ? -14.438 27.527 -9.836  1.00 47.31 ? 291 GLN A OE1   1 
ATOM   1113 N  NE2   . GLN A 1 131 ? -14.350 28.208 -11.976 1.00 51.68 ? 291 GLN A NE2   1 
ATOM   1114 N  N     . ALA A 1 132 ? -13.049 22.288 -11.273 1.00 14.36 ? 292 ALA A N     1 
ATOM   1115 C  CA    . ALA A 1 132 ? -13.267 20.956 -10.694 1.00 14.38 ? 292 ALA A CA    1 
ATOM   1116 C  C     . ALA A 1 132 ? -12.374 20.684 -9.488  1.00 17.43 ? 292 ALA A C     1 
ATOM   1117 O  O     . ALA A 1 132 ? -12.814 20.098 -8.499  1.00 17.60 ? 292 ALA A O     1 
ATOM   1118 C  CB    . ALA A 1 132 ? -13.058 19.869 -11.744 1.00 17.94 ? 292 ALA A CB    1 
ATOM   1119 N  N     . VAL A 1 133 ? -11.108 21.071 -9.593  1.00 15.09 ? 293 VAL A N     1 
ATOM   1120 C  CA    . VAL A 1 133 ? -10.162 20.910 -8.490  1.00 14.64 ? 293 VAL A CA    1 
ATOM   1121 C  C     . VAL A 1 133 ? -10.604 21.757 -7.299  1.00 15.10 ? 293 VAL A C     1 
ATOM   1122 O  O     . VAL A 1 133 ? -10.604 21.293 -6.167  1.00 14.89 ? 293 VAL A O     1 
ATOM   1123 C  CB    . VAL A 1 133 ? -8.730  21.304 -8.914  1.00 17.03 ? 293 VAL A CB    1 
ATOM   1124 C  CG1   . VAL A 1 133 ? -7.816  21.433 -7.698  1.00 18.13 ? 293 VAL A CG1   1 
ATOM   1125 C  CG2   . VAL A 1 133 ? -8.160  20.277 -9.910  1.00 17.60 ? 293 VAL A CG2   1 
ATOM   1126 N  N     . ILE A 1 134 ? -10.990 23.001 -7.568  1.00 12.97 ? 294 ILE A N     1 
ATOM   1127 C  CA    . ILE A 1 134 ? -11.446 23.903 -6.522  1.00 14.07 ? 294 ILE A CA    1 
ATOM   1128 C  C     . ILE A 1 134 ? -12.655 23.316 -5.791  1.00 15.18 ? 294 ILE A C     1 
ATOM   1129 O  O     . ILE A 1 134 ? -12.707 23.294 -4.558  1.00 15.64 ? 294 ILE A O     1 
ATOM   1130 C  CB    . ILE A 1 134 ? -11.797 25.282 -7.110  1.00 13.47 ? 294 ILE A CB    1 
ATOM   1131 C  CG1   . ILE A 1 134 ? -10.519 26.041 -7.488  1.00 13.86 ? 294 ILE A CG1   1 
ATOM   1132 C  CG2   . ILE A 1 134 ? -12.614 26.105 -6.127  1.00 15.63 ? 294 ILE A CG2   1 
ATOM   1133 C  CD1   . ILE A 1 134 ? -10.768 27.234 -8.389  1.00 15.95 ? 294 ILE A CD1   1 
ATOM   1134 N  N     . GLU A 1 135 ? -13.622 22.835 -6.558  1.00 12.22 ? 295 GLU A N     1 
ATOM   1135 C  CA    . GLU A 1 135 ? -14.817 22.262 -5.964  1.00 15.70 ? 295 GLU A CA    1 
ATOM   1136 C  C     . GLU A 1 135 ? -14.508 20.993 -5.185  1.00 16.52 ? 295 GLU A C     1 
ATOM   1137 O  O     . GLU A 1 135 ? -15.118 20.741 -4.143  1.00 18.58 ? 295 GLU A O     1 
ATOM   1138 C  CB    . GLU A 1 135 ? -15.883 22.027 -7.028  1.00 17.02 ? 295 GLU A CB    1 
ATOM   1139 C  CG    . GLU A 1 135 ? -16.474 23.348 -7.527  1.00 20.30 ? 295 GLU A CG    1 
ATOM   1140 C  CD    . GLU A 1 135 ? -17.292 23.203 -8.797  1.00 30.18 ? 295 GLU A CD    1 
ATOM   1141 O  OE1   . GLU A 1 135 ? -17.428 22.068 -9.300  1.00 32.04 ? 295 GLU A OE1   1 
ATOM   1142 O  OE2   . GLU A 1 135 ? -17.796 24.233 -9.297  1.00 34.37 ? 295 GLU A OE2   1 
ATOM   1143 N  N     . MET A 1 136 ? -13.566 20.201 -5.687  1.00 15.87 ? 296 MET A N     1 
ATOM   1144 C  CA    . MET A 1 136 ? -13.157 18.978 -4.997  1.00 17.29 ? 296 MET A CA    1 
ATOM   1145 C  C     . MET A 1 136 ? -12.515 19.310 -3.646  1.00 15.31 ? 296 MET A C     1 
ATOM   1146 O  O     . MET A 1 136 ? -12.811 18.677 -2.633  1.00 16.47 ? 296 MET A O     1 
ATOM   1147 C  CB    . MET A 1 136 ? -12.196 18.154 -5.859  1.00 19.04 ? 296 MET A CB    1 
ATOM   1148 C  CG    . MET A 1 136 ? -11.746 16.861 -5.203  1.00 26.28 ? 296 MET A CG    1 
ATOM   1149 S  SD    . MET A 1 136 ? -10.775 15.807 -6.308  1.00 27.18 ? 296 MET A SD    1 
ATOM   1150 C  CE    . MET A 1 136 ? -11.968 15.474 -7.605  1.00 47.17 ? 296 MET A CE    1 
ATOM   1151 N  N     . VAL A 1 137 ? -11.625 20.297 -3.629  1.00 13.05 ? 297 VAL A N     1 
ATOM   1152 C  CA    . VAL A 1 137 ? -11.019 20.716 -2.368  1.00 12.35 ? 297 VAL A CA    1 
ATOM   1153 C  C     . VAL A 1 137 ? -12.067 21.258 -1.402  1.00 13.72 ? 297 VAL A C     1 
ATOM   1154 O  O     . VAL A 1 137 ? -12.048 20.962 -0.206  1.00 14.77 ? 297 VAL A O     1 
ATOM   1155 C  CB    . VAL A 1 137 ? -9.881  21.749 -2.584  1.00 14.20 ? 297 VAL A CB    1 
ATOM   1156 C  CG1   . VAL A 1 137 ? -9.379  22.284 -1.252  1.00 14.69 ? 297 VAL A CG1   1 
ATOM   1157 C  CG2   . VAL A 1 137 ? -8.735  21.100 -3.343  1.00 17.41 ? 297 VAL A CG2   1 
ATOM   1158 N  N     . GLN A 1 138 ? -12.999 22.051 -1.917  1.00 12.23 ? 298 GLN A N     1 
ATOM   1159 C  CA    . GLN A 1 138 ? -14.015 22.627 -1.053  1.00 15.03 ? 298 GLN A CA    1 
ATOM   1160 C  C     . GLN A 1 138 ? -14.886 21.543 -0.407  1.00 17.76 ? 298 GLN A C     1 
ATOM   1161 O  O     . GLN A 1 138 ? -15.143 21.577 0.794   1.00 17.81 ? 298 GLN A O     1 
ATOM   1162 C  CB    . GLN A 1 138 ? -14.874 23.627 -1.835  1.00 16.59 ? 298 GLN A CB    1 
ATOM   1163 C  CG    . GLN A 1 138 ? -15.848 24.414 -0.982  1.00 20.93 ? 298 GLN A CG    1 
ATOM   1164 C  CD    . GLN A 1 138 ? -16.369 25.639 -1.707  1.00 25.38 ? 298 GLN A CD    1 
ATOM   1165 O  OE1   . GLN A 1 138 ? -15.595 26.451 -2.224  1.00 25.49 ? 298 GLN A OE1   1 
ATOM   1166 N  NE2   . GLN A 1 138 ? -17.681 25.768 -1.768  1.00 24.77 ? 298 GLN A NE2   1 
ATOM   1167 N  N     . GLU A 1 139 ? -15.321 20.571 -1.204  1.00 13.90 ? 299 GLU A N     1 
ATOM   1168 C  CA    . GLU A 1 139 ? -16.292 19.581 -0.734  1.00 14.40 ? 299 GLU A CA    1 
ATOM   1169 C  C     . GLU A 1 139 ? -15.662 18.391 -0.006  1.00 20.37 ? 299 GLU A C     1 
ATOM   1170 O  O     . GLU A 1 139 ? -16.235 17.871 0.961   1.00 19.76 ? 299 GLU A O     1 
ATOM   1171 C  CB    . GLU A 1 139 ? -17.151 19.068 -1.897  1.00 17.53 ? 299 GLU A CB    1 
ATOM   1172 C  CG    . GLU A 1 139 ? -18.140 20.106 -2.423  1.00 21.22 ? 299 GLU A CG    1 
ATOM   1173 C  CD    . GLU A 1 139 ? -19.079 19.558 -3.481  1.00 28.46 ? 299 GLU A CD    1 
ATOM   1174 O  OE1   . GLU A 1 139 ? -19.972 20.320 -3.915  1.00 23.84 ? 299 GLU A OE1   1 
ATOM   1175 O  OE2   . GLU A 1 139 ? -18.935 18.370 -3.868  1.00 30.93 ? 299 GLU A OE2   1 
ATOM   1176 N  N     . ALA A 1 140 ? -14.502 17.951 -0.481  1.00 19.57 ? 300 ALA A N     1 
ATOM   1177 C  CA    . ALA A 1 140 ? -13.875 16.742 0.054   1.00 19.71 ? 300 ALA A CA    1 
ATOM   1178 C  C     . ALA A 1 140 ? -12.615 17.028 0.870   1.00 19.93 ? 300 ALA A C     1 
ATOM   1179 O  O     . ALA A 1 140 ? -12.124 16.155 1.592   1.00 23.53 ? 300 ALA A O     1 
ATOM   1180 C  CB    . ALA A 1 140 ? -13.576 15.749 -1.076  1.00 21.67 ? 300 ALA A CB    1 
ATOM   1181 N  N     . GLY A 1 141 ? -12.088 18.242 0.745   1.00 20.84 ? 301 GLY A N     1 
ATOM   1182 C  CA    . GLY A 1 141 ? -10.948 18.659 1.545   1.00 20.37 ? 301 GLY A CA    1 
ATOM   1183 C  C     . GLY A 1 141 ? -9.594  18.235 1.007   1.00 20.22 ? 301 GLY A C     1 
ATOM   1184 O  O     . GLY A 1 141 ? -8.557  18.532 1.609   1.00 20.10 ? 301 GLY A O     1 
ATOM   1185 N  N     . ARG A 1 142 ? -9.594  17.545 -0.126  1.00 20.38 ? 302 ARG A N     1 
ATOM   1186 C  CA    . ARG A 1 142 ? -8.354  17.063 -0.724  1.00 20.39 ? 302 ARG A CA    1 
ATOM   1187 C  C     . ARG A 1 142 ? -8.586  16.669 -2.178  1.00 19.95 ? 302 ARG A C     1 
ATOM   1188 O  O     . ARG A 1 142 ? -9.724  16.415 -2.589  1.00 22.86 ? 302 ARG A O     1 
ATOM   1189 C  CB    . ARG A 1 142 ? -7.824  15.857 0.051   1.00 32.76 ? 302 ARG A CB    1 
ATOM   1190 C  CG    . ARG A 1 142 ? -8.678  14.612 -0.094  1.00 40.11 ? 302 ARG A CG    1 
ATOM   1191 C  CD    . ARG A 1 142 ? -8.150  13.477 0.768   1.00 50.06 ? 302 ARG A CD    1 
ATOM   1192 N  NE    . ARG A 1 142 ? -6.692  13.410 0.737   1.00 56.18 ? 302 ARG A NE    1 
ATOM   1193 C  CZ    . ARG A 1 142 ? -5.993  12.297 0.534   1.00 64.56 ? 302 ARG A CZ    1 
ATOM   1194 N  NH1   . ARG A 1 142 ? -6.617  11.141 0.339   1.00 66.22 ? 302 ARG A NH1   1 
ATOM   1195 N  NH2   . ARG A 1 142 ? -4.667  12.339 0.527   1.00 67.82 ? 302 ARG A NH2   1 
ATOM   1196 N  N     . VAL A 1 143 ? -7.501  16.602 -2.944  1.00 19.32 ? 303 VAL A N     1 
ATOM   1197 C  CA    . VAL A 1 143 ? -7.575  16.219 -4.345  1.00 19.57 ? 303 VAL A CA    1 
ATOM   1198 C  C     . VAL A 1 143 ? -7.223  14.747 -4.516  1.00 22.38 ? 303 VAL A C     1 
ATOM   1199 O  O     . VAL A 1 143 ? -6.133  14.322 -4.158  1.00 22.98 ? 303 VAL A O     1 
ATOM   1200 C  CB    . VAL A 1 143 ? -6.599  17.029 -5.220  1.00 20.11 ? 303 VAL A CB    1 
ATOM   1201 C  CG1   . VAL A 1 143 ? -6.680  16.547 -6.674  1.00 22.26 ? 303 VAL A CG1   1 
ATOM   1202 C  CG2   . VAL A 1 143 ? -6.908  18.511 -5.128  1.00 20.72 ? 303 VAL A CG2   1 
ATOM   1203 N  N     . THR A 1 144 ? -8.154  13.978 -5.064  1.00 21.82 ? 304 THR A N     1 
ATOM   1204 C  CA    . THR A 1 144 ? -7.877  12.582 -5.380  1.00 26.26 ? 304 THR A CA    1 
ATOM   1205 C  C     . THR A 1 144 ? -8.060  12.371 -6.874  1.00 26.89 ? 304 THR A C     1 
ATOM   1206 O  O     . THR A 1 144 ? -8.914  13.005 -7.495  1.00 29.50 ? 304 THR A O     1 
ATOM   1207 C  CB    . THR A 1 144 ? -8.813  11.647 -4.612  1.00 33.46 ? 304 THR A CB    1 
ATOM   1208 O  OG1   . THR A 1 144 ? -10.172 12.031 -4.863  1.00 34.05 ? 304 THR A OG1   1 
ATOM   1209 C  CG2   . THR A 1 144 ? -8.539  11.731 -3.109  1.00 33.32 ? 304 THR A CG2   1 
ATOM   1210 N  N     . VAL A 1 145 ? -7.254  11.493 -7.460  1.00 26.13 ? 305 VAL A N     1 
ATOM   1211 C  CA    . VAL A 1 145 ? -7.403  11.192 -8.879  1.00 26.32 ? 305 VAL A CA    1 
ATOM   1212 C  C     . VAL A 1 145 ? -7.668  9.707  -9.065  1.00 27.96 ? 305 VAL A C     1 
ATOM   1213 O  O     . VAL A 1 145 ? -7.194  8.883  -8.285  1.00 28.97 ? 305 VAL A O     1 
ATOM   1214 C  CB    . VAL A 1 145 ? -6.177  11.661 -9.719  1.00 36.52 ? 305 VAL A CB    1 
ATOM   1215 C  CG1   . VAL A 1 145 ? -5.857  13.138 -9.424  1.00 33.71 ? 305 VAL A CG1   1 
ATOM   1216 C  CG2   . VAL A 1 145 ? -4.964  10.794 -9.456  1.00 36.81 ? 305 VAL A CG2   1 
ATOM   1217 N  N     . ARG A 1 146 ? -8.452  9.364  -10.079 1.00 30.15 ? 306 ARG A N     1 
ATOM   1218 C  CA    . ARG A 1 146 ? -8.823  7.974  -10.291 1.00 38.23 ? 306 ARG A CA    1 
ATOM   1219 C  C     . ARG A 1 146 ? -7.649  7.191  -10.859 1.00 34.54 ? 306 ARG A C     1 
ATOM   1220 O  O     . ARG A 1 146 ? -6.689  7.781  -11.359 1.00 30.97 ? 306 ARG A O     1 
ATOM   1221 C  CB    . ARG A 1 146 ? -10.017 7.872  -11.236 1.00 49.82 ? 306 ARG A CB    1 
ATOM   1222 C  CG    . ARG A 1 146 ? -11.339 8.353  -10.657 1.00 59.06 ? 306 ARG A CG    1 
ATOM   1223 C  CD    . ARG A 1 146 ? -12.460 8.029  -11.637 1.00 66.05 ? 306 ARG A CD    1 
ATOM   1224 N  NE    . ARG A 1 146 ? -13.752 8.630  -11.306 1.00 69.24 ? 306 ARG A NE    1 
ATOM   1225 C  CZ    . ARG A 1 146 ? -14.023 9.931  -11.375 1.00 70.29 ? 306 ARG A CZ    1 
ATOM   1226 N  NH1   . ARG A 1 146 ? -13.085 10.798 -11.737 1.00 69.35 ? 306 ARG A NH1   1 
ATOM   1227 N  NH2   . ARG A 1 146 ? -15.236 10.369 -11.063 1.00 71.82 ? 306 ARG A NH2   1 
ATOM   1228 N  N     . ASP A 1 147 ? -7.726  5.865  -10.774 1.00 31.70 ? 307 ASP A N     1 
ATOM   1229 C  CA    . ASP A 1 147 ? -6.750  5.004  -11.430 1.00 39.20 ? 307 ASP A CA    1 
ATOM   1230 C  C     . ASP A 1 147 ? -6.877  5.182  -12.930 1.00 36.21 ? 307 ASP A C     1 
ATOM   1231 O  O     . ASP A 1 147 ? -7.885  5.694  -13.417 1.00 39.51 ? 307 ASP A O     1 
ATOM   1232 C  CB    . ASP A 1 147 ? -6.994  3.529  -11.092 1.00 46.66 ? 307 ASP A CB    1 
ATOM   1233 C  CG    . ASP A 1 147 ? -6.756  3.216  -9.635  1.00 55.55 ? 307 ASP A CG    1 
ATOM   1234 O  OD1   . ASP A 1 147 ? -6.150  4.059  -8.934  1.00 55.01 ? 307 ASP A OD1   1 
ATOM   1235 O  OD2   . ASP A 1 147 ? -7.169  2.119  -9.193  1.00 61.44 ? 307 ASP A OD2   1 
ATOM   1236 N  N     . GLY A 1 148 ? -5.853  4.760  -13.663 1.00 32.66 ? 308 GLY A N     1 
ATOM   1237 C  CA    . GLY A 1 148 ? -5.921  4.749  -15.109 1.00 31.70 ? 308 GLY A CA    1 
ATOM   1238 C  C     . GLY A 1 148 ? -5.462  6.019  -15.798 1.00 28.68 ? 308 GLY A C     1 
ATOM   1239 O  O     . GLY A 1 148 ? -5.560  6.120  -17.021 1.00 29.39 ? 308 GLY A O     1 
ATOM   1240 N  N     . MET A 1 149 ? -4.967  6.988  -15.033 1.00 25.69 ? 309 MET A N     1 
ATOM   1241 C  CA    . MET A 1 149 ? -4.468  8.220  -15.644 1.00 26.26 ? 309 MET A CA    1 
ATOM   1242 C  C     . MET A 1 149 ? -3.337  7.973  -16.650 1.00 24.66 ? 309 MET A C     1 
ATOM   1243 O  O     . MET A 1 149 ? -3.373  8.528  -17.746 1.00 23.25 ? 309 MET A O     1 
ATOM   1244 C  CB    . MET A 1 149 ? -4.056  9.269  -14.599 1.00 25.57 ? 309 MET A CB    1 
ATOM   1245 C  CG    . MET A 1 149 ? -5.203  9.895  -13.824 1.00 28.69 ? 309 MET A CG    1 
ATOM   1246 S  SD    . MET A 1 149 ? -6.453  10.707 -14.851 1.00 34.54 ? 309 MET A SD    1 
ATOM   1247 C  CE    . MET A 1 149 ? -7.749  9.471  -14.819 1.00 38.72 ? 309 MET A CE    1 
ATOM   1248 N  N     . PRO A 1 150 ? -2.334  7.143  -16.297 1.00 26.47 ? 310 PRO A N     1 
ATOM   1249 C  CA    . PRO A 1 150 ? -1.273  6.949  -17.293 1.00 27.40 ? 310 PRO A CA    1 
ATOM   1250 C  C     . PRO A 1 150 ? -1.763  6.343  -18.608 1.00 30.31 ? 310 PRO A C     1 
ATOM   1251 O  O     . PRO A 1 150 ? -1.247  6.711  -19.666 1.00 31.13 ? 310 PRO A O     1 
ATOM   1252 C  CB    . PRO A 1 150 ? -0.308  5.994  -16.586 1.00 31.90 ? 310 PRO A CB    1 
ATOM   1253 C  CG    . PRO A 1 150 ? -0.497  6.310  -15.138 1.00 32.07 ? 310 PRO A CG    1 
ATOM   1254 C  CD    . PRO A 1 150 ? -1.974  6.522  -15.006 1.00 30.13 ? 310 PRO A CD    1 
ATOM   1255 N  N     . GLU A 1 151 ? -2.746  5.449  -18.549 1.00 27.25 ? 311 GLU A N     1 
ATOM   1256 C  CA    . GLU A 1 151 ? -3.277  4.834  -19.762 1.00 26.09 ? 311 GLU A CA    1 
ATOM   1257 C  C     . GLU A 1 151 ? -3.938  5.859  -20.685 1.00 24.23 ? 311 GLU A C     1 
ATOM   1258 O  O     . GLU A 1 151 ? -3.939  5.685  -21.905 1.00 25.26 ? 311 GLU A O     1 
ATOM   1259 C  CB    . GLU A 1 151 ? -4.263  3.710  -19.432 1.00 37.51 ? 311 GLU A CB    1 
ATOM   1260 C  CG    . GLU A 1 151 ? -3.612  2.439  -18.891 1.00 42.40 ? 311 GLU A CG    1 
ATOM   1261 C  CD    . GLU A 1 151 ? -2.962  2.639  -17.528 1.00 48.81 ? 311 GLU A CD    1 
ATOM   1262 O  OE1   . GLU A 1 151 ? -1.916  2.007  -17.270 1.00 55.87 ? 311 GLU A OE1   1 
ATOM   1263 O  OE2   . GLU A 1 151 ? -3.494  3.429  -16.715 1.00 45.65 ? 311 GLU A OE2   1 
ATOM   1264 N  N     . LEU A 1 152 ? -4.512  6.909  -20.103 1.00 23.10 ? 312 LEU A N     1 
ATOM   1265 C  CA    . LEU A 1 152 ? -5.143  7.971  -20.883 1.00 22.25 ? 312 LEU A CA    1 
ATOM   1266 C  C     . LEU A 1 152 ? -4.150  8.635  -21.832 1.00 20.59 ? 312 LEU A C     1 
ATOM   1267 O  O     . LEU A 1 152 ? -4.518  9.082  -22.912 1.00 21.08 ? 312 LEU A O     1 
ATOM   1268 C  CB    . LEU A 1 152 ? -5.752  9.039  -19.970 1.00 21.70 ? 312 LEU A CB    1 
ATOM   1269 C  CG    . LEU A 1 152 ? -7.029  8.668  -19.225 1.00 23.84 ? 312 LEU A CG    1 
ATOM   1270 C  CD1   . LEU A 1 152 ? -7.537  9.863  -18.434 1.00 24.56 ? 312 LEU A CD1   1 
ATOM   1271 C  CD2   . LEU A 1 152 ? -8.091  8.163  -20.186 1.00 27.00 ? 312 LEU A CD2   1 
ATOM   1272 N  N     . LEU A 1 153 ? -2.888  8.687  -21.421 1.00 19.49 ? 313 LEU A N     1 
ATOM   1273 C  CA    . LEU A 1 153 ? -1.856  9.319  -22.232 1.00 22.61 ? 313 LEU A CA    1 
ATOM   1274 C  C     . LEU A 1 153 ? -1.554  8.535  -23.506 1.00 24.26 ? 313 LEU A C     1 
ATOM   1275 O  O     . LEU A 1 153 ? -0.907  9.054  -24.410 1.00 26.47 ? 313 LEU A O     1 
ATOM   1276 C  CB    . LEU A 1 153 ? -0.580  9.518  -21.406 1.00 20.00 ? 313 LEU A CB    1 
ATOM   1277 C  CG    . LEU A 1 153 ? -0.736  10.435 -20.195 1.00 21.27 ? 313 LEU A CG    1 
ATOM   1278 C  CD1   . LEU A 1 153 ? 0.552   10.455 -19.373 1.00 23.28 ? 313 LEU A CD1   1 
ATOM   1279 C  CD2   . LEU A 1 153 ? -1.132  11.842 -20.647 1.00 21.63 ? 313 LEU A CD2   1 
ATOM   1280 N  N     . LYS A 1 154 ? -2.044  7.297  -23.579 1.00 21.03 ? 314 LYS A N     1 
ATOM   1281 C  CA    A LYS A 1 154 ? -1.765  6.420  -24.710 0.49 22.94 ? 314 LYS A CA    1 
ATOM   1282 C  CA    B LYS A 1 154 ? -1.760  6.427  -24.711 0.51 22.92 ? 314 LYS A CA    1 
ATOM   1283 C  C     . LYS A 1 154 ? -2.953  6.324  -25.659 1.00 23.02 ? 314 LYS A C     1 
ATOM   1284 O  O     . LYS A 1 154 ? -2.921  5.567  -26.626 1.00 26.87 ? 314 LYS A O     1 
ATOM   1285 C  CB    A LYS A 1 154 ? -1.395  5.017  -24.219 0.49 26.09 ? 314 LYS A CB    1 
ATOM   1286 C  CB    B LYS A 1 154 ? -1.355  5.036  -24.214 0.51 26.70 ? 314 LYS A CB    1 
ATOM   1287 C  CG    A LYS A 1 154 ? -0.246  4.974  -23.230 0.49 30.49 ? 314 LYS A CG    1 
ATOM   1288 C  CG    B LYS A 1 154 ? -0.324  5.053  -23.093 0.51 30.59 ? 314 LYS A CG    1 
ATOM   1289 C  CD    A LYS A 1 154 ? 1.036   4.489  -23.885 0.49 34.76 ? 314 LYS A CD    1 
ATOM   1290 C  CD    B LYS A 1 154 ? 1.097   5.047  -23.630 0.51 32.76 ? 314 LYS A CD    1 
ATOM   1291 C  CE    A LYS A 1 154 ? 2.071   4.102  -22.842 0.49 38.18 ? 314 LYS A CE    1 
ATOM   1292 C  CE    B LYS A 1 154 ? 1.820   3.750  -23.284 0.51 37.72 ? 314 LYS A CE    1 
ATOM   1293 N  NZ    A LYS A 1 154 ? 1.660   2.898  -22.060 0.49 41.42 ? 314 LYS A NZ    1 
ATOM   1294 N  NZ    B LYS A 1 154 ? 2.561   3.836  -21.985 0.51 39.93 ? 314 LYS A NZ    1 
ATOM   1295 N  N     . LEU A 1 155 ? -4.010  7.084  -25.378 1.00 22.43 ? 315 LEU A N     1 
ATOM   1296 C  CA    . LEU A 1 155 ? -5.209  7.058  -26.223 1.00 22.87 ? 315 LEU A CA    1 
ATOM   1297 C  C     . LEU A 1 155 ? -4.925  7.511  -27.656 1.00 22.06 ? 315 LEU A C     1 
ATOM   1298 O  O     . LEU A 1 155 ? -4.019  8.312  -27.891 1.00 20.69 ? 315 LEU A O     1 
ATOM   1299 C  CB    . LEU A 1 155 ? -6.320  7.927  -25.623 1.00 23.78 ? 315 LEU A CB    1 
ATOM   1300 C  CG    . LEU A 1 155 ? -7.079  7.382  -24.416 1.00 26.89 ? 315 LEU A CG    1 
ATOM   1301 C  CD1   . LEU A 1 155 ? -7.917  8.493  -23.812 1.00 28.85 ? 315 LEU A CD1   1 
ATOM   1302 C  CD2   . LEU A 1 155 ? -7.966  6.216  -24.806 1.00 27.86 ? 315 LEU A CD2   1 
ATOM   1303 N  N     . PRO A 1 156 ? -5.695  6.985  -28.623 1.00 24.50 ? 316 PRO A N     1 
ATOM   1304 C  CA    . PRO A 1 156 ? -5.586  7.425  -30.018 1.00 25.25 ? 316 PRO A CA    1 
ATOM   1305 C  C     . PRO A 1 156 ? -5.801  8.927  -30.132 1.00 25.76 ? 316 PRO A C     1 
ATOM   1306 O  O     . PRO A 1 156 ? -6.556  9.495  -29.345 1.00 23.91 ? 316 PRO A O     1 
ATOM   1307 C  CB    . PRO A 1 156 ? -6.719  6.667  -30.703 1.00 30.42 ? 316 PRO A CB    1 
ATOM   1308 C  CG    . PRO A 1 156 ? -6.847  5.413  -29.897 1.00 32.48 ? 316 PRO A CG    1 
ATOM   1309 C  CD    . PRO A 1 156 ? -6.611  5.837  -28.480 1.00 29.46 ? 316 PRO A CD    1 
ATOM   1310 N  N     . LEU A 1 157 ? -5.128  9.556  -31.087 1.00 22.50 ? 317 LEU A N     1 
ATOM   1311 C  CA    . LEU A 1 157 ? -5.177  11.005 -31.229 1.00 26.93 ? 317 LEU A CA    1 
ATOM   1312 C  C     . LEU A 1 157 ? -6.503  11.460 -31.818 1.00 26.47 ? 317 LEU A C     1 
ATOM   1313 O  O     . LEU A 1 157 ? -6.887  11.025 -32.903 1.00 27.01 ? 317 LEU A O     1 
ATOM   1314 C  CB    . LEU A 1 157 ? -4.037  11.480 -32.124 1.00 27.55 ? 317 LEU A CB    1 
ATOM   1315 C  CG    . LEU A 1 157 ? -2.618  11.175 -31.644 1.00 23.61 ? 317 LEU A CG    1 
ATOM   1316 C  CD1   . LEU A 1 157 ? -1.635  11.574 -32.728 1.00 22.27 ? 317 LEU A CD1   1 
ATOM   1317 C  CD2   . LEU A 1 157 ? -2.301  11.879 -30.329 1.00 22.73 ? 317 LEU A CD2   1 
ATOM   1318 N  N     . ARG A 1 158 ? -7.190  12.344 -31.102 1.00 24.13 ? 318 ARG A N     1 
ATOM   1319 C  CA    A ARG A 1 158 ? -8.473  12.857 -31.564 0.50 25.17 ? 318 ARG A CA    1 
ATOM   1320 C  CA    B ARG A 1 158 ? -8.495  12.843 -31.517 0.50 25.22 ? 318 ARG A CA    1 
ATOM   1321 C  C     . ARG A 1 158 ? -8.545  14.367 -31.423 1.00 24.15 ? 318 ARG A C     1 
ATOM   1322 O  O     . ARG A 1 158 ? -8.141  14.935 -30.411 1.00 23.57 ? 318 ARG A O     1 
ATOM   1323 C  CB    A ARG A 1 158 ? -9.636  12.199 -30.819 0.50 27.19 ? 318 ARG A CB    1 
ATOM   1324 C  CB    B ARG A 1 158 ? -9.576  12.230 -30.624 0.50 25.56 ? 318 ARG A CB    1 
ATOM   1325 C  CG    A ARG A 1 158 ? -9.914  10.769 -31.251 0.50 30.60 ? 318 ARG A CG    1 
ATOM   1326 C  CG    B ARG A 1 158 ? -10.992 12.654 -30.948 0.50 28.16 ? 318 ARG A CG    1 
ATOM   1327 C  CD    A ARG A 1 158 ? -11.254 10.285 -30.729 0.50 38.32 ? 318 ARG A CD    1 
ATOM   1328 C  CD    B ARG A 1 158 ? -11.990 11.826 -30.156 0.50 33.82 ? 318 ARG A CD    1 
ATOM   1329 N  NE    A ARG A 1 158 ? -11.509 8.894  -31.095 0.50 42.37 ? 318 ARG A NE    1 
ATOM   1330 N  NE    B ARG A 1 158 ? -11.699 10.400 -30.275 0.50 38.20 ? 318 ARG A NE    1 
ATOM   1331 C  CZ    A ARG A 1 158 ? -12.055 8.509  -32.245 0.50 44.44 ? 318 ARG A CZ    1 
ATOM   1332 C  CZ    B ARG A 1 158 ? -12.172 9.616  -31.239 0.50 42.80 ? 318 ARG A CZ    1 
ATOM   1333 N  NH1   A ARG A 1 158 ? -12.406 9.410  -33.153 0.50 45.16 ? 318 ARG A NH1   1 
ATOM   1334 N  NH1   B ARG A 1 158 ? -12.971 10.117 -32.171 0.50 45.67 ? 318 ARG A NH1   1 
ATOM   1335 N  NH2   A ARG A 1 158 ? -12.250 7.220  -32.490 0.50 46.15 ? 318 ARG A NH2   1 
ATOM   1336 N  NH2   B ARG A 1 158 ? -11.847 8.330  -31.270 0.50 43.71 ? 318 ARG A NH2   1 
ATOM   1337 N  N     . CYS A 1 159 ? -9.052  15.017 -32.465 1.00 25.07 ? 319 CYS A N     1 
ATOM   1338 C  CA    . CYS A 1 159 ? -9.194  16.468 -32.460 1.00 25.46 ? 319 CYS A CA    1 
ATOM   1339 C  C     . CYS A 1 159 ? -10.123 16.889 -31.328 1.00 26.36 ? 319 CYS A C     1 
ATOM   1340 O  O     . CYS A 1 159 ? -11.126 16.234 -31.060 1.00 27.47 ? 319 CYS A O     1 
ATOM   1341 C  CB    . CYS A 1 159 ? -9.734  16.974 -33.802 1.00 26.73 ? 319 CYS A CB    1 
ATOM   1342 S  SG    . CYS A 1 159 ? -9.904  18.769 -33.858 1.00 27.66 ? 319 CYS A SG    1 
ATOM   1343 N  N     . HIS A 1 160 ? -9.775  17.970 -30.647 1.00 26.28 ? 320 HIS A N     1 
ATOM   1344 C  CA    . HIS A 1 160 ? -10.562 18.433 -29.510 1.00 27.47 ? 320 HIS A CA    1 
ATOM   1345 C  C     . HIS A 1 160 ? -11.739 19.280 -29.973 1.00 29.40 ? 320 HIS A C     1 
ATOM   1346 O  O     . HIS A 1 160 ? -12.663 19.545 -29.206 1.00 30.99 ? 320 HIS A O     1 
ATOM   1347 C  CB    . HIS A 1 160 ? -9.689  19.249 -28.556 1.00 29.02 ? 320 HIS A CB    1 
ATOM   1348 C  CG    . HIS A 1 160 ? -9.176  20.520 -29.153 1.00 28.80 ? 320 HIS A CG    1 
ATOM   1349 N  ND1   . HIS A 1 160 ? -8.549  20.564 -30.380 1.00 26.79 ? 320 HIS A ND1   1 
ATOM   1350 C  CD2   . HIS A 1 160 ? -9.198  21.795 -28.695 1.00 30.76 ? 320 HIS A CD2   1 
ATOM   1351 C  CE1   . HIS A 1 160 ? -8.202  21.811 -30.650 1.00 27.72 ? 320 HIS A CE1   1 
ATOM   1352 N  NE2   . HIS A 1 160 ? -8.586  22.578 -29.645 1.00 29.97 ? 320 HIS A NE2   1 
ATOM   1353 N  N     . GLU A 1 161 ? -11.700 19.713 -31.227 1.00 29.58 ? 321 GLU A N     1 
ATOM   1354 C  CA    . GLU A 1 161 ? -12.765 20.556 -31.756 1.00 33.61 ? 321 GLU A CA    1 
ATOM   1355 C  C     . GLU A 1 161 ? -13.865 19.766 -32.470 1.00 35.48 ? 321 GLU A C     1 
ATOM   1356 O  O     . GLU A 1 161 ? -15.053 20.032 -32.271 1.00 36.71 ? 321 GLU A O     1 
ATOM   1357 C  CB    . GLU A 1 161 ? -12.194 21.644 -32.673 1.00 34.47 ? 321 GLU A CB    1 
ATOM   1358 C  CG    . GLU A 1 161 ? -11.210 22.597 -31.983 1.00 39.05 ? 321 GLU A CG    1 
ATOM   1359 C  CD    . GLU A 1 161 ? -11.871 23.551 -30.990 1.00 46.96 ? 321 GLU A CD    1 
ATOM   1360 O  OE1   . GLU A 1 161 ? -13.104 23.480 -30.799 1.00 51.73 ? 321 GLU A OE1   1 
ATOM   1361 O  OE2   . GLU A 1 161 ? -11.149 24.387 -30.400 1.00 50.35 ? 321 GLU A OE2   1 
ATOM   1362 N  N     . CYS A 1 162 ? -13.477 18.797 -33.295 1.00 31.97 ? 322 CYS A N     1 
ATOM   1363 C  CA    . CYS A 1 162 ? -14.455 18.052 -34.088 1.00 33.55 ? 322 CYS A CA    1 
ATOM   1364 C  C     . CYS A 1 162 ? -14.390 16.545 -33.851 1.00 33.18 ? 322 CYS A C     1 
ATOM   1365 O  O     . CYS A 1 162 ? -15.112 15.784 -34.493 1.00 34.76 ? 322 CYS A O     1 
ATOM   1366 C  CB    . CYS A 1 162 ? -14.269 18.340 -35.580 1.00 34.01 ? 322 CYS A CB    1 
ATOM   1367 S  SG    . CYS A 1 162 ? -12.783 17.586 -36.277 1.00 33.15 ? 322 CYS A SG    1 
ATOM   1368 N  N     . GLN A 1 163 ? -13.503 16.125 -32.952 1.00 31.41 ? 323 GLN A N     1 
ATOM   1369 C  CA    . GLN A 1 163 ? -13.375 14.719 -32.548 1.00 36.76 ? 323 GLN A CA    1 
ATOM   1370 C  C     . GLN A 1 163 ? -12.887 13.751 -33.633 1.00 35.67 ? 323 GLN A C     1 
ATOM   1371 O  O     . GLN A 1 163 ? -12.991 12.536 -33.475 1.00 33.09 ? 323 GLN A O     1 
ATOM   1372 C  CB    . GLN A 1 163 ? -14.671 14.198 -31.905 1.00 41.50 ? 323 GLN A CB    1 
ATOM   1373 C  CG    . GLN A 1 163 ? -14.957 14.774 -30.520 1.00 44.86 ? 323 GLN A CG    1 
ATOM   1374 C  CD    . GLN A 1 163 ? -15.485 16.197 -30.571 1.00 49.49 ? 323 GLN A CD    1 
ATOM   1375 O  OE1   . GLN A 1 163 ? -16.451 16.486 -31.277 1.00 52.89 ? 323 GLN A OE1   1 
ATOM   1376 N  NE2   . GLN A 1 163 ? -14.846 17.097 -29.827 1.00 50.07 ? 323 GLN A NE2   1 
ATOM   1377 N  N     . GLN A 1 164 ? -12.343 14.278 -34.724 1.00 30.50 ? 324 GLN A N     1 
ATOM   1378 C  CA    . GLN A 1 164 ? -11.812 13.414 -35.776 1.00 30.61 ? 324 GLN A CA    1 
ATOM   1379 C  C     . GLN A 1 164 ? -10.570 12.647 -35.315 1.00 28.80 ? 324 GLN A C     1 
ATOM   1380 O  O     . GLN A 1 164 ? -9.706  13.198 -34.635 1.00 27.07 ? 324 GLN A O     1 
ATOM   1381 C  CB    . GLN A 1 164 ? -11.492 14.226 -37.034 1.00 39.96 ? 324 GLN A CB    1 
ATOM   1382 C  CG    . GLN A 1 164 ? -10.865 13.406 -38.152 1.00 43.19 ? 324 GLN A CG    1 
ATOM   1383 C  CD    . GLN A 1 164 ? -10.721 14.182 -39.444 1.00 48.41 ? 324 GLN A CD    1 
ATOM   1384 O  OE1   . GLN A 1 164 ? -11.487 15.108 -39.720 1.00 48.54 ? 324 GLN A OE1   1 
ATOM   1385 N  NE2   . GLN A 1 164 ? -9.729  13.808 -40.246 1.00 51.78 ? 324 GLN A NE2   1 
ATOM   1386 N  N     . LEU A 1 165 ? -10.488 11.375 -35.692 1.00 29.53 ? 325 LEU A N     1 
ATOM   1387 C  CA    . LEU A 1 165 ? -9.327  10.552 -35.372 1.00 31.86 ? 325 LEU A CA    1 
ATOM   1388 C  C     . LEU A 1 165 ? -8.199  10.801 -36.367 1.00 32.07 ? 325 LEU A C     1 
ATOM   1389 O  O     . LEU A 1 165 ? -8.416  10.764 -37.575 1.00 33.18 ? 325 LEU A O     1 
ATOM   1390 C  CB    . LEU A 1 165 ? -9.708  9.071  -35.383 1.00 35.56 ? 325 LEU A CB    1 
ATOM   1391 C  CG    . LEU A 1 165 ? -8.549  8.074  -35.289 1.00 39.21 ? 325 LEU A CG    1 
ATOM   1392 C  CD1   . LEU A 1 165 ? -7.890  8.127  -33.921 1.00 37.78 ? 325 LEU A CD1   1 
ATOM   1393 C  CD2   . LEU A 1 165 ? -9.019  6.661  -35.602 1.00 44.95 ? 325 LEU A CD2   1 
ATOM   1394 N  N     . LEU A 1 166 ? -7.001  11.060 -35.850 1.00 28.88 ? 326 LEU A N     1 
ATOM   1395 C  CA    . LEU A 1 166 ? -5.812  11.274 -36.678 1.00 29.27 ? 326 LEU A CA    1 
ATOM   1396 C  C     . LEU A 1 166 ? -4.741  10.246 -36.324 1.00 27.48 ? 326 LEU A C     1 
ATOM   1397 O  O     . LEU A 1 166 ? -4.554  9.923  -35.148 1.00 29.01 ? 326 LEU A O     1 
ATOM   1398 C  CB    . LEU A 1 166 ? -5.264  12.688 -36.480 1.00 30.13 ? 326 LEU A CB    1 
ATOM   1399 C  CG    . LEU A 1 166 ? -5.933  13.833 -37.248 1.00 33.71 ? 326 LEU A CG    1 
ATOM   1400 C  CD1   . LEU A 1 166 ? -6.022  13.511 -38.729 1.00 36.69 ? 326 LEU A CD1   1 
ATOM   1401 C  CD2   . LEU A 1 166 ? -7.308  14.165 -36.678 1.00 33.36 ? 326 LEU A CD2   1 
ATOM   1402 N  N     . PRO A 1 167 ? -4.026  9.731  -37.337 1.00 30.52 ? 327 PRO A N     1 
ATOM   1403 C  CA    . PRO A 1 167 ? -3.101  8.613  -37.117 1.00 29.80 ? 327 PRO A CA    1 
ATOM   1404 C  C     . PRO A 1 167 ? -1.728  9.016  -36.569 1.00 29.31 ? 327 PRO A C     1 
ATOM   1405 O  O     . PRO A 1 167 ? -0.968  8.140  -36.150 1.00 31.41 ? 327 PRO A O     1 
ATOM   1406 C  CB    . PRO A 1 167 ? -2.948  8.021  -38.517 1.00 33.30 ? 327 PRO A CB    1 
ATOM   1407 C  CG    . PRO A 1 167 ? -3.118  9.177  -39.415 1.00 36.49 ? 327 PRO A CG    1 
ATOM   1408 C  CD    . PRO A 1 167 ? -4.134  10.079 -38.764 1.00 34.91 ? 327 PRO A CD    1 
ATOM   1409 N  N     . SER A 1 168 ? -1.408  10.307 -36.573 1.00 23.85 ? 328 SER A N     1 
ATOM   1410 C  CA    . SER A 1 168 ? -0.081  10.737 -36.152 1.00 22.94 ? 328 SER A CA    1 
ATOM   1411 C  C     . SER A 1 168 ? -0.072  12.181 -35.690 1.00 28.73 ? 328 SER A C     1 
ATOM   1412 O  O     . SER A 1 168 ? -0.968  12.963 -36.024 1.00 22.79 ? 328 SER A O     1 
ATOM   1413 C  CB    . SER A 1 168 ? 0.940   10.567 -37.285 1.00 24.44 ? 328 SER A CB    1 
ATOM   1414 O  OG    . SER A 1 168 ? 0.802   11.585 -38.258 1.00 25.69 ? 328 SER A OG    1 
ATOM   1415 N  N     . ILE A 1 169 ? 0.953   12.524 -34.919 1.00 21.95 ? 329 ILE A N     1 
ATOM   1416 C  CA    . ILE A 1 169 ? 1.141   13.898 -34.459 1.00 23.44 ? 329 ILE A CA    1 
ATOM   1417 C  C     . ILE A 1 169 ? 1.260   14.906 -35.620 1.00 22.80 ? 329 ILE A C     1 
ATOM   1418 O  O     . ILE A 1 169 ? 0.564   15.922 -35.610 1.00 23.22 ? 329 ILE A O     1 
ATOM   1419 C  CB    . ILE A 1 169 ? 2.326   14.019 -33.457 1.00 24.63 ? 329 ILE A CB    1 
ATOM   1420 C  CG1   . ILE A 1 169 ? 1.953   13.388 -32.113 1.00 23.30 ? 329 ILE A CG1   1 
ATOM   1421 C  CG2   . ILE A 1 169 ? 2.734   15.474 -33.259 1.00 26.05 ? 329 ILE A CG2   1 
ATOM   1422 C  CD1   . ILE A 1 169 ? 0.894   14.158 -31.344 1.00 22.22 ? 329 ILE A CD1   1 
ATOM   1423 N  N     . PRO A 1 170 ? 2.119   14.630 -36.625 1.00 26.08 ? 330 PRO A N     1 
ATOM   1424 C  CA    . PRO A 1 170 ? 2.165   15.562 -37.761 1.00 24.99 ? 330 PRO A CA    1 
ATOM   1425 C  C     . PRO A 1 170 ? 0.813   15.743 -38.458 1.00 25.29 ? 330 PRO A C     1 
ATOM   1426 O  O     . PRO A 1 170 ? 0.470   16.862 -38.836 1.00 26.75 ? 330 PRO A O     1 
ATOM   1427 C  CB    . PRO A 1 170 ? 3.158   14.895 -38.714 1.00 28.39 ? 330 PRO A CB    1 
ATOM   1428 C  CG    . PRO A 1 170 ? 4.075   14.157 -37.805 1.00 27.86 ? 330 PRO A CG    1 
ATOM   1429 C  CD    . PRO A 1 170 ? 3.171   13.602 -36.737 1.00 22.58 ? 330 PRO A CD    1 
ATOM   1430 N  N     . GLN A 1 171 ? 0.056   14.666 -38.623 1.00 23.14 ? 331 GLN A N     1 
ATOM   1431 C  CA    . GLN A 1 171 ? -1.258  14.780 -39.253 1.00 25.37 ? 331 GLN A CA    1 
ATOM   1432 C  C     . GLN A 1 171 ? -2.250  15.521 -38.363 1.00 23.95 ? 331 GLN A C     1 
ATOM   1433 O  O     . GLN A 1 171 ? -3.089  16.282 -38.850 1.00 22.79 ? 331 GLN A O     1 
ATOM   1434 C  CB    . GLN A 1 171 ? -1.799  13.414 -39.661 1.00 25.64 ? 331 GLN A CB    1 
ATOM   1435 C  CG    . GLN A 1 171 ? -1.146  12.875 -40.920 1.00 28.29 ? 331 GLN A CG    1 
ATOM   1436 C  CD    . GLN A 1 171 ? -1.856  11.654 -41.475 1.00 35.35 ? 331 GLN A CD    1 
ATOM   1437 O  OE1   . GLN A 1 171 ? -3.072  11.665 -41.677 1.00 37.81 ? 331 GLN A OE1   1 
ATOM   1438 N  NE2   . GLN A 1 171 ? -1.096  10.591 -41.721 1.00 33.80 ? 331 GLN A NE2   1 
ATOM   1439 N  N     . LEU A 1 172 ? -2.140  15.313 -37.057 1.00 21.88 ? 332 LEU A N     1 
ATOM   1440 C  CA    . LEU A 1 172 ? -2.972  16.055 -36.114 1.00 22.30 ? 332 LEU A CA    1 
ATOM   1441 C  C     . LEU A 1 172 ? -2.659  17.544 -36.177 1.00 22.17 ? 332 LEU A C     1 
ATOM   1442 O  O     . LEU A 1 172 ? -3.566  18.379 -36.221 1.00 23.52 ? 332 LEU A O     1 
ATOM   1443 C  CB    . LEU A 1 172 ? -2.765  15.545 -34.690 1.00 21.48 ? 332 LEU A CB    1 
ATOM   1444 C  CG    . LEU A 1 172 ? -3.545  16.289 -33.599 1.00 26.25 ? 332 LEU A CG    1 
ATOM   1445 C  CD1   . LEU A 1 172 ? -5.041  16.153 -33.827 1.00 31.20 ? 332 LEU A CD1   1 
ATOM   1446 C  CD2   . LEU A 1 172 ? -3.158  15.777 -32.215 1.00 25.86 ? 332 LEU A CD2   1 
ATOM   1447 N  N     . LYS A 1 173 ? -1.372  17.877 -36.168 1.00 20.13 ? 333 LYS A N     1 
ATOM   1448 C  CA    . LYS A 1 173 ? -0.957  19.275 -36.182 1.00 27.93 ? 333 LYS A CA    1 
ATOM   1449 C  C     . LYS A 1 173 ? -1.454  19.970 -37.448 1.00 28.44 ? 333 LYS A C     1 
ATOM   1450 O  O     . LYS A 1 173 ? -1.854  21.131 -37.412 1.00 26.23 ? 333 LYS A O     1 
ATOM   1451 C  CB    . LYS A 1 173 ? 0.565   19.403 -36.034 1.00 28.03 ? 333 LYS A CB    1 
ATOM   1452 C  CG    . LYS A 1 173 ? 1.067   18.970 -34.662 1.00 29.60 ? 333 LYS A CG    1 
ATOM   1453 C  CD    . LYS A 1 173 ? 2.588   18.891 -34.594 1.00 30.08 ? 333 LYS A CD    1 
ATOM   1454 C  CE    . LYS A 1 173 ? 3.234   20.263 -34.627 1.00 31.78 ? 333 LYS A CE    1 
ATOM   1455 N  NZ    . LYS A 1 173 ? 3.015   21.050 -33.368 1.00 29.51 ? 333 LYS A NZ    1 
ATOM   1456 N  N     . GLU A 1 174 ? -1.450  19.246 -38.562 1.00 27.68 ? 334 GLU A N     1 
ATOM   1457 C  CA    . GLU A 1 174 ? -1.931  19.817 -39.812 1.00 32.75 ? 334 GLU A CA    1 
ATOM   1458 C  C     . GLU A 1 174 ? -3.447  20.003 -39.776 1.00 35.13 ? 334 GLU A C     1 
ATOM   1459 O  O     . GLU A 1 174 ? -3.968  21.021 -40.242 1.00 30.93 ? 334 GLU A O     1 
ATOM   1460 C  CB    . GLU A 1 174 ? -1.513  18.954 -41.004 1.00 38.63 ? 334 GLU A CB    1 
ATOM   1461 C  CG    . GLU A 1 174 ? -1.365  19.744 -42.292 1.00 50.48 ? 334 GLU A CG    1 
ATOM   1462 C  CD    . GLU A 1 174 ? -0.377  20.897 -42.157 1.00 59.84 ? 334 GLU A CD    1 
ATOM   1463 O  OE1   . GLU A 1 174 ? 0.642   20.735 -41.448 1.00 61.73 ? 334 GLU A OE1   1 
ATOM   1464 O  OE2   . GLU A 1 174 ? -0.622  21.968 -42.755 1.00 65.41 ? 334 GLU A OE2   1 
ATOM   1465 N  N     . HIS A 1 175 ? -4.153  19.024 -39.215 1.00 26.38 ? 335 HIS A N     1 
ATOM   1466 C  CA    . HIS A 1 175 ? -5.607  19.112 -39.085 1.00 27.12 ? 335 HIS A CA    1 
ATOM   1467 C  C     . HIS A 1 175 ? -6.035  20.310 -38.231 1.00 27.36 ? 335 HIS A C     1 
ATOM   1468 O  O     . HIS A 1 175 ? -6.990  21.001 -38.567 1.00 29.51 ? 335 HIS A O     1 
ATOM   1469 C  CB    . HIS A 1 175 ? -6.192  17.820 -38.497 1.00 25.40 ? 335 HIS A CB    1 
ATOM   1470 C  CG    . HIS A 1 175 ? -7.657  17.912 -38.189 1.00 29.45 ? 335 HIS A CG    1 
ATOM   1471 N  ND1   . HIS A 1 175 ? -8.635  17.551 -39.092 1.00 32.18 ? 335 HIS A ND1   1 
ATOM   1472 C  CD2   . HIS A 1 175 ? -8.310  18.341 -37.082 1.00 29.82 ? 335 HIS A CD2   1 
ATOM   1473 C  CE1   . HIS A 1 175 ? -9.826  17.748 -38.553 1.00 32.14 ? 335 HIS A CE1   1 
ATOM   1474 N  NE2   . HIS A 1 175 ? -9.657  18.226 -37.333 1.00 28.29 ? 335 HIS A NE2   1 
ATOM   1475 N  N     . LEU A 1 176 ? -5.322  20.550 -37.135 1.00 25.60 ? 336 LEU A N     1 
ATOM   1476 C  CA    . LEU A 1 176 ? -5.682  21.621 -36.196 1.00 26.05 ? 336 LEU A CA    1 
ATOM   1477 C  C     . LEU A 1 176 ? -5.730  23.008 -36.836 1.00 28.99 ? 336 LEU A C     1 
ATOM   1478 O  O     . LEU A 1 176 ? -6.456  23.886 -36.370 1.00 30.17 ? 336 LEU A O     1 
ATOM   1479 C  CB    . LEU A 1 176 ? -4.719  21.641 -35.007 1.00 28.63 ? 336 LEU A CB    1 
ATOM   1480 C  CG    . LEU A 1 176 ? -4.814  20.470 -34.029 1.00 28.81 ? 336 LEU A CG    1 
ATOM   1481 C  CD1   . LEU A 1 176 ? -3.657  20.524 -33.045 1.00 29.69 ? 336 LEU A CD1   1 
ATOM   1482 C  CD2   . LEU A 1 176 ? -6.147  20.491 -33.297 1.00 30.56 ? 336 LEU A CD2   1 
ATOM   1483 N  N     . ARG A 1 177 ? -4.950  23.201 -37.896 1.00 30.57 ? 337 ARG A N     1 
ATOM   1484 C  CA    . ARG A 1 177 ? -4.943  24.462 -38.628 1.00 34.09 ? 337 ARG A CA    1 
ATOM   1485 C  C     . ARG A 1 177 ? -6.323  24.808 -39.176 1.00 44.14 ? 337 ARG A C     1 
ATOM   1486 O  O     . ARG A 1 177 ? -6.668  25.984 -39.317 1.00 38.86 ? 337 ARG A O     1 
ATOM   1487 C  CB    . ARG A 1 177 ? -3.943  24.403 -39.781 1.00 47.14 ? 337 ARG A CB    1 
ATOM   1488 C  CG    . ARG A 1 177 ? -2.486  24.419 -39.358 1.00 46.57 ? 337 ARG A CG    1 
ATOM   1489 C  CD    . ARG A 1 177 ? -1.584  24.449 -40.584 1.00 52.58 ? 337 ARG A CD    1 
ATOM   1490 N  NE    . ARG A 1 177 ? -0.441  25.341 -40.407 1.00 55.38 ? 337 ARG A NE    1 
ATOM   1491 C  CZ    . ARG A 1 177 ? -0.334  26.545 -40.962 1.00 62.42 ? 337 ARG A CZ    1 
ATOM   1492 N  NH1   . ARG A 1 177 ? -1.302  27.013 -41.741 1.00 63.93 ? 337 ARG A NH1   1 
ATOM   1493 N  NH2   . ARG A 1 177 ? 0.748   27.280 -40.743 1.00 66.82 ? 337 ARG A NH2   1 
ATOM   1494 N  N     . LYS A 1 178 ? -7.111  23.781 -39.485 1.00 35.31 ? 338 LYS A N     1 
ATOM   1495 C  CA    . LYS A 1 178 ? -8.452  23.984 -40.024 1.00 42.54 ? 338 LYS A CA    1 
ATOM   1496 C  C     . LYS A 1 178 ? -9.381  24.678 -39.032 1.00 41.37 ? 338 LYS A C     1 
ATOM   1497 O  O     . LYS A 1 178 ? -10.387 25.259 -39.432 1.00 44.06 ? 338 LYS A O     1 
ATOM   1498 C  CB    . LYS A 1 178 ? -9.062  22.652 -40.464 1.00 44.74 ? 338 LYS A CB    1 
ATOM   1499 C  CG    . LYS A 1 178 ? -8.325  21.997 -41.619 1.00 50.97 ? 338 LYS A CG    1 
ATOM   1500 C  CD    . LYS A 1 178 ? -9.020  20.727 -42.080 1.00 55.73 ? 338 LYS A CD    1 
ATOM   1501 C  CE    . LYS A 1 178 ? -8.341  20.150 -43.312 1.00 60.07 ? 338 LYS A CE    1 
ATOM   1502 N  NZ    . LYS A 1 178 ? -9.039  18.938 -43.822 1.00 63.27 ? 338 LYS A NZ    1 
ATOM   1503 N  N     . HIS A 1 179 ? -9.041  24.624 -37.746 1.00 35.19 ? 339 HIS A N     1 
ATOM   1504 C  CA    . HIS A 1 179 ? -9.903  25.185 -36.709 1.00 38.44 ? 339 HIS A CA    1 
ATOM   1505 C  C     . HIS A 1 179 ? -9.461  26.559 -36.210 1.00 44.36 ? 339 HIS A C     1 
ATOM   1506 O  O     . HIS A 1 179 ? -9.865  26.988 -35.127 1.00 47.53 ? 339 HIS A O     1 
ATOM   1507 C  CB    . HIS A 1 179 ? -10.023 24.225 -35.528 1.00 32.59 ? 339 HIS A CB    1 
ATOM   1508 C  CG    . HIS A 1 179 ? -10.696 22.935 -35.869 1.00 33.68 ? 339 HIS A CG    1 
ATOM   1509 N  ND1   . HIS A 1 179 ? -12.018 22.865 -36.247 1.00 37.07 ? 339 HIS A ND1   1 
ATOM   1510 C  CD2   . HIS A 1 179 ? -10.230 21.663 -35.888 1.00 32.17 ? 339 HIS A CD2   1 
ATOM   1511 C  CE1   . HIS A 1 179 ? -12.339 21.607 -36.486 1.00 34.14 ? 339 HIS A CE1   1 
ATOM   1512 N  NE2   . HIS A 1 179 ? -11.272 20.857 -36.278 1.00 31.36 ? 339 HIS A NE2   1 
ATOM   1513 N  N     . TRP A 1 180 ? -8.635  27.245 -36.992 1.00 44.04 ? 340 TRP A N     1 
ATOM   1514 C  CA    . TRP A 1 180 ? -8.239  28.604 -36.641 1.00 45.81 ? 340 TRP A CA    1 
ATOM   1515 C  C     . TRP A 1 180 ? -9.359  29.583 -36.983 1.00 51.01 ? 340 TRP A C     1 
ATOM   1516 O  O     . TRP A 1 180 ? -9.924  29.536 -38.079 1.00 54.29 ? 340 TRP A O     1 
ATOM   1517 C  CB    . TRP A 1 180 ? -6.960  29.007 -37.371 1.00 47.17 ? 340 TRP A CB    1 
ATOM   1518 C  CG    . TRP A 1 180 ? -5.727  28.259 -36.948 1.00 43.60 ? 340 TRP A CG    1 
ATOM   1519 C  CD1   . TRP A 1 180 ? -5.626  27.303 -35.973 1.00 42.50 ? 340 TRP A CD1   1 
ATOM   1520 C  CD2   . TRP A 1 180 ? -4.412  28.414 -37.496 1.00 43.77 ? 340 TRP A CD2   1 
ATOM   1521 N  NE1   . TRP A 1 180 ? -4.327  26.856 -35.882 1.00 35.28 ? 340 TRP A NE1   1 
ATOM   1522 C  CE2   . TRP A 1 180 ? -3.563  27.522 -36.808 1.00 38.27 ? 340 TRP A CE2   1 
ATOM   1523 C  CE3   . TRP A 1 180 ? -3.869  29.225 -38.501 1.00 45.23 ? 340 TRP A CE3   1 
ATOM   1524 C  CZ2   . TRP A 1 180 ? -2.203  27.413 -37.098 1.00 39.07 ? 340 TRP A CZ2   1 
ATOM   1525 C  CZ3   . TRP A 1 180 ? -2.516  29.117 -38.785 1.00 46.19 ? 340 TRP A CZ3   1 
ATOM   1526 C  CH2   . TRP A 1 180 ? -1.699  28.218 -38.086 1.00 43.07 ? 340 TRP A CH2   1 
ATOM   1527 N  N     . HIS B 1 3   ? 20.701  63.761 -32.080 1.00 64.59 ? 163 HIS B N     1 
ATOM   1528 C  CA    A HIS B 1 3   ? 20.449  62.513 -32.795 0.52 61.35 ? 163 HIS B CA    1 
ATOM   1529 C  CA    B HIS B 1 3   ? 20.483  62.522 -32.825 0.48 61.30 ? 163 HIS B CA    1 
ATOM   1530 C  C     . HIS B 1 3   ? 19.617  62.739 -34.066 1.00 54.85 ? 163 HIS B C     1 
ATOM   1531 O  O     . HIS B 1 3   ? 19.647  63.818 -34.663 1.00 53.21 ? 163 HIS B O     1 
ATOM   1532 C  CB    A HIS B 1 3   ? 19.764  61.504 -31.865 0.52 61.42 ? 163 HIS B CB    1 
ATOM   1533 C  CB    B HIS B 1 3   ? 19.911  61.414 -31.928 0.48 61.54 ? 163 HIS B CB    1 
ATOM   1534 C  CG    A HIS B 1 3   ? 19.944  60.074 -32.277 0.52 62.44 ? 163 HIS B CG    1 
ATOM   1535 C  CG    B HIS B 1 3   ? 18.748  61.841 -31.085 0.48 60.69 ? 163 HIS B CG    1 
ATOM   1536 N  ND1   A HIS B 1 3   ? 21.167  59.550 -32.637 0.52 65.32 ? 163 HIS B ND1   1 
ATOM   1537 N  ND1   B HIS B 1 3   ? 18.091  63.040 -31.263 0.48 59.46 ? 163 HIS B ND1   1 
ATOM   1538 C  CD2   A HIS B 1 3   ? 19.053  59.060 -32.388 0.52 61.81 ? 163 HIS B CD2   1 
ATOM   1539 C  CD2   B HIS B 1 3   ? 18.126  61.222 -30.053 0.48 61.25 ? 163 HIS B CD2   1 
ATOM   1540 C  CE1   A HIS B 1 3   ? 21.022  58.275 -32.952 0.52 65.11 ? 163 HIS B CE1   1 
ATOM   1541 C  CE1   B HIS B 1 3   ? 17.117  63.142 -30.377 0.48 59.61 ? 163 HIS B CE1   1 
ATOM   1542 N  NE2   A HIS B 1 3   ? 19.749  57.953 -32.809 0.52 62.96 ? 163 HIS B NE2   1 
ATOM   1543 N  NE2   B HIS B 1 3   ? 17.116  62.052 -29.631 0.48 60.26 ? 163 HIS B NE2   1 
ATOM   1544 N  N     . MET B 1 4   ? 18.862  61.716 -34.461 1.00 49.21 ? 164 MET B N     1 
ATOM   1545 C  CA    . MET B 1 4   ? 18.094  61.726 -35.710 1.00 40.57 ? 164 MET B CA    1 
ATOM   1546 C  C     . MET B 1 4   ? 16.963  62.750 -35.760 1.00 34.01 ? 164 MET B C     1 
ATOM   1547 O  O     . MET B 1 4   ? 16.360  63.083 -34.741 1.00 34.54 ? 164 MET B O     1 
ATOM   1548 C  CB    . MET B 1 4   ? 17.539  60.332 -35.994 1.00 40.67 ? 164 MET B CB    1 
ATOM   1549 C  CG    . MET B 1 4   ? 18.557  59.222 -35.787 1.00 45.49 ? 164 MET B CG    1 
ATOM   1550 S  SD    . MET B 1 4   ? 19.965  59.366 -36.903 1.00 66.92 ? 164 MET B SD    1 
ATOM   1551 C  CE    . MET B 1 4   ? 19.195  58.945 -38.465 1.00 69.24 ? 164 MET B CE    1 
ATOM   1552 N  N     . GLY B 1 5   ? 16.670  63.224 -36.967 1.00 24.77 ? 165 GLY B N     1 
ATOM   1553 C  CA    . GLY B 1 5   ? 15.719  64.302 -37.157 1.00 22.97 ? 165 GLY B CA    1 
ATOM   1554 C  C     . GLY B 1 5   ? 14.268  63.885 -37.017 1.00 23.63 ? 165 GLY B C     1 
ATOM   1555 O  O     . GLY B 1 5   ? 13.958  62.702 -36.866 1.00 20.57 ? 165 GLY B O     1 
ATOM   1556 N  N     . HIS B 1 6   ? 13.379  64.874 -37.080 1.00 21.80 ? 166 HIS B N     1 
ATOM   1557 C  CA    . HIS B 1 6   ? 11.939  64.639 -36.945 1.00 21.07 ? 166 HIS B CA    1 
ATOM   1558 C  C     . HIS B 1 6   ? 11.398  63.642 -37.964 1.00 19.70 ? 166 HIS B C     1 
ATOM   1559 O  O     . HIS B 1 6   ? 10.474  62.882 -37.666 1.00 20.99 ? 166 HIS B O     1 
ATOM   1560 C  CB    . HIS B 1 6   ? 11.179  65.962 -37.065 1.00 22.33 ? 166 HIS B CB    1 
ATOM   1561 C  CG    . HIS B 1 6   ? 11.394  66.886 -35.909 1.00 25.99 ? 166 HIS B CG    1 
ATOM   1562 N  ND1   . HIS B 1 6   ? 11.083  68.229 -35.961 1.00 31.43 ? 166 HIS B ND1   1 
ATOM   1563 C  CD2   . HIS B 1 6   ? 11.885  66.660 -34.668 1.00 24.83 ? 166 HIS B CD2   1 
ATOM   1564 C  CE1   . HIS B 1 6   ? 11.379  68.792 -34.803 1.00 34.66 ? 166 HIS B CE1   1 
ATOM   1565 N  NE2   . HIS B 1 6   ? 11.869  67.863 -34.001 1.00 33.89 ? 166 HIS B NE2   1 
ATOM   1566 N  N     . TRP B 1 7   ? 11.973  63.647 -39.165 1.00 19.67 ? 167 TRP B N     1 
ATOM   1567 C  CA    . TRP B 1 7   ? 11.556  62.730 -40.222 1.00 19.63 ? 167 TRP B CA    1 
ATOM   1568 C  C     . TRP B 1 7   ? 11.549  61.293 -39.725 1.00 22.17 ? 167 TRP B C     1 
ATOM   1569 O  O     . TRP B 1 7   ? 10.734  60.483 -40.163 1.00 20.22 ? 167 TRP B O     1 
ATOM   1570 C  CB    . TRP B 1 7   ? 12.487  62.834 -41.440 1.00 23.94 ? 167 TRP B CB    1 
ATOM   1571 C  CG    . TRP B 1 7   ? 13.852  62.269 -41.174 1.00 20.09 ? 167 TRP B CG    1 
ATOM   1572 C  CD1   . TRP B 1 7   ? 14.964  62.961 -40.766 1.00 21.05 ? 167 TRP B CD1   1 
ATOM   1573 C  CD2   . TRP B 1 7   ? 14.254  60.895 -41.291 1.00 19.59 ? 167 TRP B CD2   1 
ATOM   1574 N  NE1   . TRP B 1 7   ? 16.024  62.098 -40.615 1.00 21.34 ? 167 TRP B NE1   1 
ATOM   1575 C  CE2   . TRP B 1 7   ? 15.617  60.827 -40.932 1.00 20.62 ? 167 TRP B CE2   1 
ATOM   1576 C  CE3   . TRP B 1 7   ? 13.590  59.713 -41.654 1.00 19.07 ? 167 TRP B CE3   1 
ATOM   1577 C  CZ2   . TRP B 1 7   ? 16.332  59.623 -40.928 1.00 21.26 ? 167 TRP B CZ2   1 
ATOM   1578 C  CZ3   . TRP B 1 7   ? 14.301  58.516 -41.645 1.00 19.60 ? 167 TRP B CZ3   1 
ATOM   1579 C  CH2   . TRP B 1 7   ? 15.661  58.485 -41.288 1.00 21.24 ? 167 TRP B CH2   1 
ATOM   1580 N  N     . SER B 1 8   ? 12.462  60.986 -38.803 1.00 18.34 ? 168 SER B N     1 
ATOM   1581 C  CA    . SER B 1 8   ? 12.660  59.618 -38.337 1.00 18.19 ? 168 SER B CA    1 
ATOM   1582 C  C     . SER B 1 8   ? 11.549  59.158 -37.403 1.00 19.18 ? 168 SER B C     1 
ATOM   1583 O  O     . SER B 1 8   ? 11.453  57.971 -37.092 1.00 20.01 ? 168 SER B O     1 
ATOM   1584 C  CB    . SER B 1 8   ? 14.011  59.473 -37.632 1.00 19.96 ? 168 SER B CB    1 
ATOM   1585 O  OG    . SER B 1 8   ? 14.014  60.150 -36.388 1.00 22.03 ? 168 SER B OG    1 
ATOM   1586 N  N     . GLN B 1 9   ? 10.711  60.092 -36.957 1.00 19.66 ? 169 GLN B N     1 
ATOM   1587 C  CA    A GLN B 1 9   ? 9.638   59.758 -36.022 0.49 22.12 ? 169 GLN B CA    1 
ATOM   1588 C  CA    B GLN B 1 9   ? 9.634   59.770 -36.023 0.51 22.11 ? 169 GLN B CA    1 
ATOM   1589 C  C     . GLN B 1 9   ? 8.342   59.407 -36.749 1.00 24.25 ? 169 GLN B C     1 
ATOM   1590 O  O     . GLN B 1 9   ? 7.351   59.027 -36.121 1.00 21.41 ? 169 GLN B O     1 
ATOM   1591 C  CB    A GLN B 1 9   ? 9.414   60.900 -35.021 0.49 24.65 ? 169 GLN B CB    1 
ATOM   1592 C  CB    B GLN B 1 9   ? 9.391   60.939 -35.063 0.51 24.36 ? 169 GLN B CB    1 
ATOM   1593 C  CG    A GLN B 1 9   ? 10.644  61.209 -34.170 0.49 26.84 ? 169 GLN B CG    1 
ATOM   1594 C  CG    B GLN B 1 9   ? 10.619  61.322 -34.245 0.51 26.48 ? 169 GLN B CG    1 
ATOM   1595 C  CD    A GLN B 1 9   ? 10.424  62.333 -33.178 0.49 28.65 ? 169 GLN B CD    1 
ATOM   1596 C  CD    B GLN B 1 9   ? 11.117  60.179 -33.378 0.51 28.38 ? 169 GLN B CD    1 
ATOM   1597 O  OE1   A GLN B 1 9   ? 11.190  63.295 -33.140 0.49 32.32 ? 169 GLN B OE1   1 
ATOM   1598 O  OE1   B GLN B 1 9   ? 10.523  59.870 -32.349 0.51 33.20 ? 169 GLN B OE1   1 
ATOM   1599 N  NE2   A GLN B 1 9   ? 9.388   62.211 -32.356 0.49 30.08 ? 169 GLN B NE2   1 
ATOM   1600 N  NE2   B GLN B 1 9   ? 12.208  59.541 -33.794 0.51 27.66 ? 169 GLN B NE2   1 
ATOM   1601 N  N     . GLY B 1 10  ? 8.364   59.518 -38.075 1.00 22.31 ? 170 GLY B N     1 
ATOM   1602 C  CA    . GLY B 1 10  ? 7.194   59.252 -38.897 1.00 23.70 ? 170 GLY B CA    1 
ATOM   1603 C  C     . GLY B 1 10  ? 6.592   57.862 -38.742 1.00 21.88 ? 170 GLY B C     1 
ATOM   1604 O  O     . GLY B 1 10  ? 5.376   57.719 -38.636 1.00 22.32 ? 170 GLY B O     1 
ATOM   1605 N  N     . LEU B 1 11  ? 7.437   56.837 -38.725 1.00 20.15 ? 171 LEU B N     1 
ATOM   1606 C  CA    . LEU B 1 11  ? 6.958   55.462 -38.594 1.00 23.00 ? 171 LEU B CA    1 
ATOM   1607 C  C     . LEU B 1 11  ? 6.218   55.240 -37.274 1.00 25.16 ? 171 LEU B C     1 
ATOM   1608 O  O     . LEU B 1 11  ? 5.152   54.631 -37.252 1.00 26.24 ? 171 LEU B O     1 
ATOM   1609 C  CB    . LEU B 1 11  ? 8.120   54.472 -38.728 1.00 24.80 ? 171 LEU B CB    1 
ATOM   1610 C  CG    . LEU B 1 11  ? 7.790   52.981 -38.674 1.00 27.62 ? 171 LEU B CG    1 
ATOM   1611 C  CD1   . LEU B 1 11  ? 6.757   52.608 -39.734 1.00 25.29 ? 171 LEU B CD1   1 
ATOM   1612 C  CD2   . LEU B 1 11  ? 9.063   52.157 -38.846 1.00 26.86 ? 171 LEU B CD2   1 
ATOM   1613 N  N     . LYS B 1 12  ? 6.781   55.753 -36.184 1.00 24.50 ? 172 LYS B N     1 
ATOM   1614 C  CA    A LYS B 1 12  ? 6.162   55.625 -34.871 0.50 26.03 ? 172 LYS B CA    1 
ATOM   1615 C  CA    B LYS B 1 12  ? 6.171   55.646 -34.863 0.50 26.02 ? 172 LYS B CA    1 
ATOM   1616 C  C     . LYS B 1 12  ? 4.806   56.323 -34.836 1.00 25.28 ? 172 LYS B C     1 
ATOM   1617 O  O     . LYS B 1 12  ? 3.855   55.811 -34.256 1.00 21.98 ? 172 LYS B O     1 
ATOM   1618 C  CB    A LYS B 1 12  ? 7.078   56.186 -33.780 0.50 29.10 ? 172 LYS B CB    1 
ATOM   1619 C  CB    B LYS B 1 12  ? 7.077   56.286 -33.811 0.50 28.24 ? 172 LYS B CB    1 
ATOM   1620 C  CG    A LYS B 1 12  ? 6.598   55.909 -32.362 0.50 34.62 ? 172 LYS B CG    1 
ATOM   1621 C  CG    B LYS B 1 12  ? 6.539   56.214 -32.390 0.50 32.62 ? 172 LYS B CG    1 
ATOM   1622 C  CD    A LYS B 1 12  ? 6.479   54.411 -32.108 0.50 38.83 ? 172 LYS B CD    1 
ATOM   1623 C  CD    B LYS B 1 12  ? 7.119   57.320 -31.524 0.50 35.13 ? 172 LYS B CD    1 
ATOM   1624 C  CE    A LYS B 1 12  ? 6.067   54.113 -30.675 0.50 43.90 ? 172 LYS B CE    1 
ATOM   1625 C  CE    B LYS B 1 12  ? 8.614   57.491 -31.758 0.50 36.52 ? 172 LYS B CE    1 
ATOM   1626 N  NZ    A LYS B 1 12  ? 7.110   54.530 -29.697 0.50 46.83 ? 172 LYS B NZ    1 
ATOM   1627 N  NZ    B LYS B 1 12  ? 9.420   56.324 -31.298 0.50 38.47 ? 172 LYS B NZ    1 
ATOM   1628 N  N     . ILE B 1 13  ? 4.725   57.491 -35.463 1.00 21.78 ? 173 ILE B N     1 
ATOM   1629 C  CA    . ILE B 1 13  ? 3.472   58.225 -35.545 1.00 21.42 ? 173 ILE B CA    1 
ATOM   1630 C  C     . ILE B 1 13  ? 2.443   57.448 -36.371 1.00 21.34 ? 173 ILE B C     1 
ATOM   1631 O  O     . ILE B 1 13  ? 1.277   57.342 -35.987 1.00 22.86 ? 173 ILE B O     1 
ATOM   1632 C  CB    . ILE B 1 13  ? 3.711   59.641 -36.121 1.00 25.20 ? 173 ILE B CB    1 
ATOM   1633 C  CG1   . ILE B 1 13  ? 4.442   60.501 -35.082 1.00 28.70 ? 173 ILE B CG1   1 
ATOM   1634 C  CG2   . ILE B 1 13  ? 2.396   60.285 -36.534 1.00 26.17 ? 173 ILE B CG2   1 
ATOM   1635 C  CD1   . ILE B 1 13  ? 5.224   61.689 -35.655 1.00 30.59 ? 173 ILE B CD1   1 
ATOM   1636 N  N     . SER B 1 14  ? 2.886   56.882 -37.492 1.00 21.47 ? 174 SER B N     1 
ATOM   1637 C  CA    . SER B 1 14  ? 2.002   56.109 -38.358 1.00 22.47 ? 174 SER B CA    1 
ATOM   1638 C  C     . SER B 1 14  ? 1.461   54.854 -37.680 1.00 23.73 ? 174 SER B C     1 
ATOM   1639 O  O     . SER B 1 14  ? 0.308   54.505 -37.891 1.00 25.06 ? 174 SER B O     1 
ATOM   1640 C  CB    . SER B 1 14  ? 2.683   55.762 -39.684 1.00 25.22 ? 174 SER B CB    1 
ATOM   1641 O  OG    . SER B 1 14  ? 3.053   56.946 -40.379 1.00 28.06 ? 174 SER B OG    1 
ATOM   1642 N  N     . MET B 1 15  ? 2.285   54.196 -36.860 1.00 22.22 ? 175 MET B N     1 
ATOM   1643 C  CA    . MET B 1 15  ? 1.839   53.035 -36.070 1.00 27.02 ? 175 MET B CA    1 
ATOM   1644 C  C     . MET B 1 15  ? 0.627   53.356 -35.218 1.00 26.56 ? 175 MET B C     1 
ATOM   1645 O  O     . MET B 1 15  ? -0.198  52.486 -34.942 1.00 27.90 ? 175 MET B O     1 
ATOM   1646 C  CB    . MET B 1 15  ? 2.912   52.593 -35.078 1.00 28.97 ? 175 MET B CB    1 
ATOM   1647 C  CG    . MET B 1 15  ? 4.180   52.047 -35.642 1.00 33.53 ? 175 MET B CG    1 
ATOM   1648 S  SD    . MET B 1 15  ? 5.263   51.705 -34.241 1.00 38.83 ? 175 MET B SD    1 
ATOM   1649 C  CE    . MET B 1 15  ? 4.331   50.475 -33.351 1.00 27.88 ? 175 MET B CE    1 
ATOM   1650 N  N     . GLN B 1 16  ? 0.547   54.608 -34.778 1.00 28.85 ? 176 GLN B N     1 
ATOM   1651 C  CA    A GLN B 1 16  ? -0.484  55.041 -33.840 0.40 32.74 ? 176 GLN B CA    1 
ATOM   1652 C  CA    B GLN B 1 16  ? -0.486  55.026 -33.841 0.60 32.80 ? 176 GLN B CA    1 
ATOM   1653 C  C     . GLN B 1 16  ? -1.708  55.627 -34.536 1.00 33.52 ? 176 GLN B C     1 
ATOM   1654 O  O     . GLN B 1 16  ? -2.684  55.989 -33.884 1.00 37.05 ? 176 GLN B O     1 
ATOM   1655 C  CB    A GLN B 1 16  ? 0.092   56.073 -32.864 0.40 33.34 ? 176 GLN B CB    1 
ATOM   1656 C  CB    B GLN B 1 16  ? 0.104   56.007 -32.823 0.60 33.77 ? 176 GLN B CB    1 
ATOM   1657 C  CG    A GLN B 1 16  ? 1.190   55.542 -31.955 0.40 34.65 ? 176 GLN B CG    1 
ATOM   1658 C  CG    B GLN B 1 16  ? 1.223   55.402 -31.980 0.60 35.11 ? 176 GLN B CG    1 
ATOM   1659 C  CD    A GLN B 1 16  ? 0.650   54.774 -30.760 0.40 37.83 ? 176 GLN B CD    1 
ATOM   1660 C  CD    B GLN B 1 16  ? 1.925   56.417 -31.095 0.60 36.03 ? 176 GLN B CD    1 
ATOM   1661 O  OE1   A GLN B 1 16  ? -0.562  54.650 -30.580 0.40 41.20 ? 176 GLN B OE1   1 
ATOM   1662 O  OE1   B GLN B 1 16  ? 2.255   57.517 -31.532 0.60 37.17 ? 176 GLN B OE1   1 
ATOM   1663 N  NE2   A GLN B 1 16  ? 1.552   54.260 -29.932 0.40 38.73 ? 176 GLN B NE2   1 
ATOM   1664 N  NE2   B GLN B 1 16  ? 2.155   56.047 -29.840 0.60 38.97 ? 176 GLN B NE2   1 
ATOM   1665 N  N     . ASP B 1 17  ? -1.652  55.723 -35.860 1.00 27.60 ? 177 ASP B N     1 
ATOM   1666 C  CA    . ASP B 1 17  ? -2.753  56.292 -36.638 1.00 31.50 ? 177 ASP B CA    1 
ATOM   1667 C  C     . ASP B 1 17  ? -3.790  55.216 -36.943 1.00 30.22 ? 177 ASP B C     1 
ATOM   1668 O  O     . ASP B 1 17  ? -3.502  54.276 -37.671 1.00 29.22 ? 177 ASP B O     1 
ATOM   1669 C  CB    . ASP B 1 17  ? -2.215  56.883 -37.948 1.00 30.12 ? 177 ASP B CB    1 
ATOM   1670 C  CG    . ASP B 1 17  ? -3.267  57.671 -38.721 1.00 36.17 ? 177 ASP B CG    1 
ATOM   1671 O  OD1   . ASP B 1 17  ? -4.465  57.572 -38.396 1.00 39.31 ? 177 ASP B OD1   1 
ATOM   1672 O  OD2   . ASP B 1 17  ? -2.887  58.390 -39.670 1.00 39.25 ? 177 ASP B OD2   1 
ATOM   1673 N  N     . PRO B 1 18  ? -5.011  55.366 -36.407 1.00 34.87 ? 178 PRO B N     1 
ATOM   1674 C  CA    . PRO B 1 18  ? -6.051  54.344 -36.596 1.00 34.75 ? 178 PRO B CA    1 
ATOM   1675 C  C     . PRO B 1 18  ? -6.345  54.079 -38.069 1.00 33.77 ? 178 PRO B C     1 
ATOM   1676 O  O     . PRO B 1 18  ? -6.614  52.936 -38.440 1.00 37.24 ? 178 PRO B O     1 
ATOM   1677 C  CB    . PRO B 1 18  ? -7.279  54.959 -35.917 1.00 36.53 ? 178 PRO B CB    1 
ATOM   1678 C  CG    . PRO B 1 18  ? -6.726  55.944 -34.947 1.00 37.77 ? 178 PRO B CG    1 
ATOM   1679 C  CD    . PRO B 1 18  ? -5.488  56.495 -35.588 1.00 35.34 ? 178 PRO B CD    1 
ATOM   1680 N  N     . LYS B 1 19  ? -6.271  55.117 -38.895 1.00 31.42 ? 179 LYS B N     1 
ATOM   1681 C  CA    . LYS B 1 19  ? -6.504  54.967 -40.328 1.00 34.06 ? 179 LYS B CA    1 
ATOM   1682 C  C     . LYS B 1 19  ? -5.421  54.136 -41.019 1.00 32.60 ? 179 LYS B C     1 
ATOM   1683 O  O     . LYS B 1 19  ? -5.660  53.572 -42.087 1.00 33.79 ? 179 LYS B O     1 
ATOM   1684 C  CB    . LYS B 1 19  ? -6.638  56.336 -40.999 1.00 38.49 ? 179 LYS B CB    1 
ATOM   1685 C  CG    . LYS B 1 19  ? -7.828  57.132 -40.491 1.00 43.27 ? 179 LYS B CG    1 
ATOM   1686 C  CD    . LYS B 1 19  ? -8.073  58.371 -41.323 1.00 48.35 ? 179 LYS B CD    1 
ATOM   1687 C  CE    . LYS B 1 19  ? -9.325  59.098 -40.856 1.00 51.68 ? 179 LYS B CE    1 
ATOM   1688 N  NZ    . LYS B 1 19  ? -9.616  60.286 -41.705 1.00 53.40 ? 179 LYS B NZ    1 
ATOM   1689 N  N     . MET B 1 20  ? -4.238  54.056 -40.412 1.00 27.11 ? 180 MET B N     1 
ATOM   1690 C  CA    . MET B 1 20  ? -3.152  53.264 -40.985 1.00 22.72 ? 180 MET B CA    1 
ATOM   1691 C  C     . MET B 1 20  ? -3.106  51.832 -40.456 1.00 23.56 ? 180 MET B C     1 
ATOM   1692 O  O     . MET B 1 20  ? -2.445  50.981 -41.044 1.00 22.60 ? 180 MET B O     1 
ATOM   1693 C  CB    . MET B 1 20  ? -1.786  53.924 -40.744 1.00 23.64 ? 180 MET B CB    1 
ATOM   1694 C  CG    . MET B 1 20  ? -1.598  55.281 -41.411 1.00 30.48 ? 180 MET B CG    1 
ATOM   1695 S  SD    . MET B 1 20  ? -1.749  55.190 -43.204 1.00 40.56 ? 180 MET B SD    1 
ATOM   1696 C  CE    . MET B 1 20  ? -3.354  55.952 -43.437 1.00 46.80 ? 180 MET B CE    1 
ATOM   1697 N  N     . GLN B 1 21  ? -3.793  51.570 -39.349 1.00 22.70 ? 181 GLN B N     1 
ATOM   1698 C  CA    . GLN B 1 21  ? -3.678  50.277 -38.680 1.00 22.30 ? 181 GLN B CA    1 
ATOM   1699 C  C     . GLN B 1 21  ? -4.503  49.188 -39.372 1.00 27.50 ? 181 GLN B C     1 
ATOM   1700 O  O     . GLN B 1 21  ? -5.726  49.158 -39.264 1.00 32.36 ? 181 GLN B O     1 
ATOM   1701 C  CB    . GLN B 1 21  ? -4.082  50.404 -37.209 1.00 27.62 ? 181 GLN B CB    1 
ATOM   1702 C  CG    . GLN B 1 21  ? -3.191  51.340 -36.410 1.00 26.99 ? 181 GLN B CG    1 
ATOM   1703 C  CD    . GLN B 1 21  ? -3.721  51.605 -35.020 1.00 29.27 ? 181 GLN B CD    1 
ATOM   1704 O  OE1   . GLN B 1 21  ? -4.909  51.421 -34.747 1.00 28.41 ? 181 GLN B OE1   1 
ATOM   1705 N  NE2   . GLN B 1 21  ? -2.842  52.041 -34.130 1.00 30.80 ? 181 GLN B NE2   1 
ATOM   1706 N  N     . VAL B 1 22  ? -3.819  48.295 -40.076 1.00 23.87 ? 182 VAL B N     1 
ATOM   1707 C  CA    . VAL B 1 22  ? -4.476  47.197 -40.772 1.00 23.56 ? 182 VAL B CA    1 
ATOM   1708 C  C     . VAL B 1 22  ? -4.962  46.159 -39.771 1.00 23.41 ? 182 VAL B C     1 
ATOM   1709 O  O     . VAL B 1 22  ? -6.020  45.547 -39.940 1.00 24.18 ? 182 VAL B O     1 
ATOM   1710 C  CB    . VAL B 1 22  ? -3.502  46.549 -41.783 1.00 23.49 ? 182 VAL B CB    1 
ATOM   1711 C  CG1   . VAL B 1 22  ? -4.110  45.315 -42.420 1.00 25.00 ? 182 VAL B CG1   1 
ATOM   1712 C  CG2   . VAL B 1 22  ? -3.116  47.565 -42.856 1.00 22.33 ? 182 VAL B CG2   1 
ATOM   1713 N  N     . TYR B 1 23  ? -4.179  45.977 -38.715 1.00 20.09 ? 183 TYR B N     1 
ATOM   1714 C  CA    . TYR B 1 23  ? -4.499  45.029 -37.662 1.00 24.21 ? 183 TYR B CA    1 
ATOM   1715 C  C     . TYR B 1 23  ? -3.767  45.497 -36.418 1.00 19.49 ? 183 TYR B C     1 
ATOM   1716 O  O     . TYR B 1 23  ? -2.672  46.026 -36.513 1.00 21.86 ? 183 TYR B O     1 
ATOM   1717 C  CB    . TYR B 1 23  ? -4.007  43.627 -38.053 1.00 25.33 ? 183 TYR B CB    1 
ATOM   1718 C  CG    . TYR B 1 23  ? -3.969  42.629 -36.907 1.00 26.75 ? 183 TYR B CG    1 
ATOM   1719 C  CD1   . TYR B 1 23  ? -2.851  42.533 -36.081 1.00 25.67 ? 183 TYR B CD1   1 
ATOM   1720 C  CD2   . TYR B 1 23  ? -5.037  41.779 -36.663 1.00 34.03 ? 183 TYR B CD2   1 
ATOM   1721 C  CE1   . TYR B 1 23  ? -2.805  41.630 -35.033 1.00 27.38 ? 183 TYR B CE1   1 
ATOM   1722 C  CE2   . TYR B 1 23  ? -5.000  40.867 -35.619 1.00 35.35 ? 183 TYR B CE2   1 
ATOM   1723 C  CZ    . TYR B 1 23  ? -3.879  40.798 -34.810 1.00 32.23 ? 183 TYR B CZ    1 
ATOM   1724 O  OH    . TYR B 1 23  ? -3.830  39.898 -33.765 1.00 33.59 ? 183 TYR B OH    1 
ATOM   1725 N  N     . LYS B 1 24  ? -4.363  45.304 -35.251 1.00 21.25 ? 184 LYS B N     1 
ATOM   1726 C  CA    . LYS B 1 24  ? -3.621  45.556 -34.025 1.00 26.49 ? 184 LYS B CA    1 
ATOM   1727 C  C     . LYS B 1 24  ? -4.104  44.685 -32.886 1.00 22.84 ? 184 LYS B C     1 
ATOM   1728 O  O     . LYS B 1 24  ? -5.280  44.319 -32.813 1.00 23.96 ? 184 LYS B O     1 
ATOM   1729 C  CB    . LYS B 1 24  ? -3.659  47.038 -33.629 1.00 30.90 ? 184 LYS B CB    1 
ATOM   1730 C  CG    . LYS B 1 24  ? -4.947  47.498 -32.991 1.00 38.42 ? 184 LYS B CG    1 
ATOM   1731 C  CD    . LYS B 1 24  ? -4.772  48.881 -32.378 1.00 43.03 ? 184 LYS B CD    1 
ATOM   1732 C  CE    . LYS B 1 24  ? -6.023  49.321 -31.634 1.00 49.81 ? 184 LYS B CE    1 
ATOM   1733 N  NZ    . LYS B 1 24  ? -5.823  50.634 -30.951 1.00 54.56 ? 184 LYS B NZ    1 
ATOM   1734 N  N     . ASP B 1 25  ? -3.178  44.335 -32.007 1.00 24.12 ? 185 ASP B N     1 
ATOM   1735 C  CA    . ASP B 1 25  ? -3.530  43.660 -30.770 1.00 26.49 ? 185 ASP B CA    1 
ATOM   1736 C  C     . ASP B 1 25  ? -2.645  44.156 -29.633 1.00 24.67 ? 185 ASP B C     1 
ATOM   1737 O  O     . ASP B 1 25  ? -1.976  45.178 -29.764 1.00 24.69 ? 185 ASP B O     1 
ATOM   1738 C  CB    . ASP B 1 25  ? -3.488  42.130 -30.920 1.00 31.05 ? 185 ASP B CB    1 
ATOM   1739 C  CG    . ASP B 1 25  ? -2.115  41.596 -31.336 1.00 31.84 ? 185 ASP B CG    1 
ATOM   1740 O  OD1   . ASP B 1 25  ? -1.074  42.202 -30.995 1.00 27.00 ? 185 ASP B OD1   1 
ATOM   1741 O  OD2   . ASP B 1 25  ? -2.088  40.536 -32.003 1.00 32.12 ? 185 ASP B OD2   1 
ATOM   1742 N  N     . GLU B 1 26  ? -2.636  43.422 -28.527 1.00 23.14 ? 186 GLU B N     1 
ATOM   1743 C  CA    . GLU B 1 26  ? -1.877  43.827 -27.354 1.00 26.59 ? 186 GLU B CA    1 
ATOM   1744 C  C     . GLU B 1 26  ? -0.375  43.868 -27.613 1.00 24.69 ? 186 GLU B C     1 
ATOM   1745 O  O     . GLU B 1 26  ? 0.356   44.561 -26.914 1.00 30.31 ? 186 GLU B O     1 
ATOM   1746 C  CB    . GLU B 1 26  ? -2.183  42.897 -26.174 1.00 29.34 ? 186 GLU B CB    1 
ATOM   1747 C  CG    . GLU B 1 26  ? -3.615  42.984 -25.647 1.00 36.95 ? 186 GLU B CG    1 
ATOM   1748 C  CD    . GLU B 1 26  ? -4.613  42.157 -26.449 1.00 43.11 ? 186 GLU B CD    1 
ATOM   1749 O  OE1   . GLU B 1 26  ? -4.218  41.538 -27.464 1.00 44.18 ? 186 GLU B OE1   1 
ATOM   1750 O  OE2   . GLU B 1 26  ? -5.800  42.120 -26.054 1.00 47.33 ? 186 GLU B OE2   1 
ATOM   1751 N  N     . GLN B 1 27  ? 0.087   43.135 -28.621 1.00 21.02 ? 187 GLN B N     1 
ATOM   1752 C  CA    . GLN B 1 27  ? 1.527   42.985 -28.836 1.00 23.14 ? 187 GLN B CA    1 
ATOM   1753 C  C     . GLN B 1 27  ? 2.061   43.692 -30.072 1.00 22.65 ? 187 GLN B C     1 
ATOM   1754 O  O     . GLN B 1 27  ? 3.203   44.168 -30.076 1.00 22.62 ? 187 GLN B O     1 
ATOM   1755 C  CB    . GLN B 1 27  ? 1.898   41.510 -28.942 1.00 25.76 ? 187 GLN B CB    1 
ATOM   1756 C  CG    . GLN B 1 27  ? 1.532   40.688 -27.738 1.00 29.59 ? 187 GLN B CG    1 
ATOM   1757 C  CD    . GLN B 1 27  ? 1.792   39.222 -27.977 1.00 35.97 ? 187 GLN B CD    1 
ATOM   1758 O  OE1   . GLN B 1 27  ? 2.942   38.799 -28.111 1.00 39.29 ? 187 GLN B OE1   1 
ATOM   1759 N  NE2   . GLN B 1 27  ? 0.725   38.439 -28.062 1.00 37.74 ? 187 GLN B NE2   1 
ATOM   1760 N  N     . VAL B 1 28  ? 1.265   43.719 -31.139 1.00 17.50 ? 188 VAL B N     1 
ATOM   1761 C  CA    . VAL B 1 28  ? 1.757   44.231 -32.408 1.00 17.37 ? 188 VAL B CA    1 
ATOM   1762 C  C     . VAL B 1 28  ? 0.743   45.096 -33.143 1.00 17.46 ? 188 VAL B C     1 
ATOM   1763 O  O     . VAL B 1 28  ? -0.452  45.061 -32.857 1.00 17.52 ? 188 VAL B O     1 
ATOM   1764 C  CB    . VAL B 1 28  ? 2.191   43.097 -33.374 1.00 19.49 ? 188 VAL B CB    1 
ATOM   1765 C  CG1   . VAL B 1 28  ? 3.264   42.219 -32.745 1.00 21.46 ? 188 VAL B CG1   1 
ATOM   1766 C  CG2   . VAL B 1 28  ? 0.987   42.269 -33.799 1.00 19.94 ? 188 VAL B CG2   1 
ATOM   1767 N  N     . VAL B 1 29  ? 1.243   45.876 -34.094 1.00 17.79 ? 189 VAL B N     1 
ATOM   1768 C  CA    . VAL B 1 29  ? 0.378   46.569 -35.032 1.00 18.66 ? 189 VAL B CA    1 
ATOM   1769 C  C     . VAL B 1 29  ? 0.881   46.263 -36.439 1.00 17.46 ? 189 VAL B C     1 
ATOM   1770 O  O     . VAL B 1 29  ? 2.073   46.046 -36.643 1.00 18.02 ? 189 VAL B O     1 
ATOM   1771 C  CB    . VAL B 1 29  ? 0.345   48.090 -34.765 1.00 19.23 ? 189 VAL B CB    1 
ATOM   1772 C  CG1   . VAL B 1 29  ? 1.728   48.672 -34.876 1.00 21.93 ? 189 VAL B CG1   1 
ATOM   1773 C  CG2   . VAL B 1 29  ? -0.616  48.791 -35.723 1.00 23.92 ? 189 VAL B CG2   1 
ATOM   1774 N  N     . VAL B 1 30  ? -0.037  46.183 -37.395 1.00 17.81 ? 190 VAL B N     1 
ATOM   1775 C  CA    . VAL B 1 30  ? 0.340   45.968 -38.782 1.00 17.04 ? 190 VAL B CA    1 
ATOM   1776 C  C     . VAL B 1 30  ? -0.045  47.188 -39.606 1.00 17.89 ? 190 VAL B C     1 
ATOM   1777 O  O     . VAL B 1 30  ? -1.168  47.682 -39.500 1.00 15.82 ? 190 VAL B O     1 
ATOM   1778 C  CB    . VAL B 1 30  ? -0.354  44.731 -39.381 1.00 18.21 ? 190 VAL B CB    1 
ATOM   1779 C  CG1   . VAL B 1 30  ? 0.072   44.535 -40.835 1.00 18.59 ? 190 VAL B CG1   1 
ATOM   1780 C  CG2   . VAL B 1 30  ? -0.032  43.503 -38.557 1.00 16.82 ? 190 VAL B CG2   1 
ATOM   1781 N  N     . ILE B 1 31  ? 0.885   47.677 -40.422 1.00 15.88 ? 191 ILE B N     1 
ATOM   1782 C  CA    . ILE B 1 31  ? 0.576   48.775 -41.330 1.00 16.58 ? 191 ILE B CA    1 
ATOM   1783 C  C     . ILE B 1 31  ? 1.115   48.460 -42.719 1.00 17.98 ? 191 ILE B C     1 
ATOM   1784 O  O     . ILE B 1 31  ? 2.010   47.628 -42.860 1.00 15.71 ? 191 ILE B O     1 
ATOM   1785 C  CB    . ILE B 1 31  ? 1.159   50.130 -40.846 1.00 19.41 ? 191 ILE B CB    1 
ATOM   1786 C  CG1   . ILE B 1 31  ? 2.689   50.139 -40.930 1.00 19.98 ? 191 ILE B CG1   1 
ATOM   1787 C  CG2   . ILE B 1 31  ? 0.694   50.456 -39.428 1.00 18.03 ? 191 ILE B CG2   1 
ATOM   1788 C  CD1   . ILE B 1 31  ? 3.313   51.449 -40.444 1.00 23.90 ? 191 ILE B CD1   1 
ATOM   1789 N  N     . LYS B 1 32  ? 0.556   49.091 -43.747 1.00 18.24 ? 192 LYS B N     1 
ATOM   1790 C  CA    A LYS B 1 32  ? 1.136   48.985 -45.081 0.44 19.40 ? 192 LYS B CA    1 
ATOM   1791 C  CA    B LYS B 1 32  ? 1.138   48.980 -45.079 0.56 19.41 ? 192 LYS B CA    1 
ATOM   1792 C  C     . LYS B 1 32  ? 2.455   49.744 -45.089 1.00 18.32 ? 192 LYS B C     1 
ATOM   1793 O  O     . LYS B 1 32  ? 2.550   50.828 -44.512 1.00 15.74 ? 192 LYS B O     1 
ATOM   1794 C  CB    A LYS B 1 32  ? 0.202   49.582 -46.137 0.44 21.43 ? 192 LYS B CB    1 
ATOM   1795 C  CB    B LYS B 1 32  ? 0.202   49.557 -46.143 0.56 21.33 ? 192 LYS B CB    1 
ATOM   1796 C  CG    A LYS B 1 32  ? -1.154  48.907 -46.250 0.44 24.56 ? 192 LYS B CG    1 
ATOM   1797 C  CG    B LYS B 1 32  ? -1.097  48.791 -46.345 0.56 24.47 ? 192 LYS B CG    1 
ATOM   1798 C  CD    A LYS B 1 32  ? -1.979  49.532 -47.373 0.44 28.31 ? 192 LYS B CD    1 
ATOM   1799 C  CD    B LYS B 1 32  ? -1.849  49.335 -47.557 0.56 27.58 ? 192 LYS B CD    1 
ATOM   1800 C  CE    A LYS B 1 32  ? -2.032  51.052 -47.246 0.44 31.35 ? 192 LYS B CE    1 
ATOM   1801 C  CE    B LYS B 1 32  ? -3.231  48.721 -47.704 0.56 30.67 ? 192 LYS B CE    1 
ATOM   1802 N  NZ    A LYS B 1 32  ? -2.930  51.686 -48.257 0.44 36.87 ? 192 LYS B NZ    1 
ATOM   1803 N  NZ    B LYS B 1 32  ? -4.140  49.099 -46.586 0.56 34.70 ? 192 LYS B NZ    1 
ATOM   1804 N  N     . ASP B 1 33  ? 3.480   49.182 -45.729 1.00 15.64 ? 193 ASP B N     1 
ATOM   1805 C  CA    . ASP B 1 33  ? 4.711   49.942 -45.900 1.00 16.22 ? 193 ASP B CA    1 
ATOM   1806 C  C     . ASP B 1 33  ? 4.378   51.166 -46.743 1.00 15.64 ? 193 ASP B C     1 
ATOM   1807 O  O     . ASP B 1 33  ? 3.632   51.065 -47.717 1.00 16.73 ? 193 ASP B O     1 
ATOM   1808 C  CB    . ASP B 1 33  ? 5.782   49.113 -46.609 1.00 16.64 ? 193 ASP B CB    1 
ATOM   1809 C  CG    . ASP B 1 33  ? 7.181   49.673 -46.408 1.00 20.44 ? 193 ASP B CG    1 
ATOM   1810 O  OD1   . ASP B 1 33  ? 7.502   50.729 -46.993 1.00 21.90 ? 193 ASP B OD1   1 
ATOM   1811 O  OD2   . ASP B 1 33  ? 7.968   49.049 -45.663 1.00 20.48 ? 193 ASP B OD2   1 
ATOM   1812 N  N     . LYS B 1 34  ? 4.921   52.317 -46.358 1.00 17.15 ? 194 LYS B N     1 
ATOM   1813 C  CA    . LYS B 1 34  ? 4.652   53.584 -47.025 1.00 18.90 ? 194 LYS B CA    1 
ATOM   1814 C  C     . LYS B 1 34  ? 5.325   53.628 -48.388 1.00 16.28 ? 194 LYS B C     1 
ATOM   1815 O  O     . LYS B 1 34  ? 4.917   54.383 -49.279 1.00 18.16 ? 194 LYS B O     1 
ATOM   1816 C  CB    . LYS B 1 34  ? 5.160   54.739 -46.156 1.00 20.69 ? 194 LYS B CB    1 
ATOM   1817 C  CG    . LYS B 1 34  ? 4.831   56.135 -46.660 1.00 25.03 ? 194 LYS B CG    1 
ATOM   1818 C  CD    . LYS B 1 34  ? 5.285   57.180 -45.638 1.00 31.17 ? 194 LYS B CD    1 
ATOM   1819 C  CE    . LYS B 1 34  ? 5.087   58.606 -46.143 1.00 39.45 ? 194 LYS B CE    1 
ATOM   1820 N  NZ    . LYS B 1 34  ? 3.645   58.986 -46.178 1.00 45.70 ? 194 LYS B NZ    1 
ATOM   1821 N  N     . TYR B 1 35  ? 6.365   52.818 -48.550 1.00 14.81 ? 195 TYR B N     1 
ATOM   1822 C  CA    . TYR B 1 35  ? 7.091   52.772 -49.814 1.00 16.01 ? 195 TYR B CA    1 
ATOM   1823 C  C     . TYR B 1 35  ? 7.195   51.333 -50.263 1.00 18.48 ? 195 TYR B C     1 
ATOM   1824 O  O     . TYR B 1 35  ? 8.280   50.762 -50.262 1.00 18.36 ? 195 TYR B O     1 
ATOM   1825 C  CB    . TYR B 1 35  ? 8.481   53.385 -49.652 1.00 14.78 ? 195 TYR B CB    1 
ATOM   1826 C  CG    . TYR B 1 35  ? 8.413   54.790 -49.109 1.00 19.86 ? 195 TYR B CG    1 
ATOM   1827 C  CD1   . TYR B 1 35  ? 8.039   55.847 -49.926 1.00 19.78 ? 195 TYR B CD1   1 
ATOM   1828 C  CD2   . TYR B 1 35  ? 8.691   55.055 -47.773 1.00 22.04 ? 195 TYR B CD2   1 
ATOM   1829 C  CE1   . TYR B 1 35  ? 7.961   57.144 -49.435 1.00 24.76 ? 195 TYR B CE1   1 
ATOM   1830 C  CE2   . TYR B 1 35  ? 8.620   56.355 -47.273 1.00 24.98 ? 195 TYR B CE2   1 
ATOM   1831 C  CZ    . TYR B 1 35  ? 8.251   57.386 -48.110 1.00 25.91 ? 195 TYR B CZ    1 
ATOM   1832 O  OH    . TYR B 1 35  ? 8.168   58.674 -47.626 1.00 31.10 ? 195 TYR B OH    1 
ATOM   1833 N  N     . PRO B 1 36  ? 6.054   50.740 -50.639 1.00 18.32 ? 196 PRO B N     1 
ATOM   1834 C  CA    . PRO B 1 36  ? 5.983   49.295 -50.875 1.00 16.44 ? 196 PRO B CA    1 
ATOM   1835 C  C     . PRO B 1 36  ? 6.920   48.860 -51.987 1.00 16.25 ? 196 PRO B C     1 
ATOM   1836 O  O     . PRO B 1 36  ? 7.030   49.531 -53.006 1.00 18.94 ? 196 PRO B O     1 
ATOM   1837 C  CB    . PRO B 1 36  ? 4.520   49.077 -51.280 1.00 16.70 ? 196 PRO B CB    1 
ATOM   1838 C  CG    . PRO B 1 36  ? 4.060   50.400 -51.787 1.00 19.49 ? 196 PRO B CG    1 
ATOM   1839 C  CD    . PRO B 1 36  ? 4.785   51.418 -50.958 1.00 16.85 ? 196 PRO B CD    1 
ATOM   1840 N  N     . LYS B 1 37  ? 7.597   47.738 -51.780 1.00 15.34 ? 197 LYS B N     1 
ATOM   1841 C  CA    . LYS B 1 37  ? 8.552   47.259 -52.768 1.00 18.53 ? 197 LYS B CA    1 
ATOM   1842 C  C     . LYS B 1 37  ? 7.954   46.117 -53.593 1.00 18.75 ? 197 LYS B C     1 
ATOM   1843 O  O     . LYS B 1 37  ? 8.644   45.475 -54.382 1.00 21.40 ? 197 LYS B O     1 
ATOM   1844 C  CB    . LYS B 1 37  ? 9.852   46.835 -52.085 1.00 15.03 ? 197 LYS B CB    1 
ATOM   1845 C  CG    . LYS B 1 37  ? 10.567  47.995 -51.387 1.00 15.41 ? 197 LYS B CG    1 
ATOM   1846 C  CD    . LYS B 1 37  ? 10.686  49.198 -52.326 1.00 19.00 ? 197 LYS B CD    1 
ATOM   1847 C  CE    . LYS B 1 37  ? 11.596  50.283 -51.741 1.00 18.96 ? 197 LYS B CE    1 
ATOM   1848 N  NZ    . LYS B 1 37  ? 11.112  50.772 -50.413 1.00 17.39 ? 197 LYS B NZ    1 
ATOM   1849 N  N     . ALA B 1 38  ? 6.660   45.886 -53.401 1.00 17.46 ? 198 ALA B N     1 
ATOM   1850 C  CA    . ALA B 1 38  ? 5.911   44.907 -54.190 1.00 16.95 ? 198 ALA B CA    1 
ATOM   1851 C  C     . ALA B 1 38  ? 4.432   45.268 -54.132 1.00 19.26 ? 198 ALA B C     1 
ATOM   1852 O  O     . ALA B 1 38  ? 4.057   46.240 -53.481 1.00 19.04 ? 198 ALA B O     1 
ATOM   1853 C  CB    . ALA B 1 38  ? 6.130   43.495 -53.649 1.00 15.55 ? 198 ALA B CB    1 
ATOM   1854 N  N     . ARG B 1 39  ? 3.598   44.483 -54.807 1.00 20.21 ? 199 ARG B N     1 
ATOM   1855 C  CA    . ARG B 1 39  ? 2.150   44.714 -54.807 1.00 22.89 ? 199 ARG B CA    1 
ATOM   1856 C  C     . ARG B 1 39  ? 1.544   44.675 -53.413 1.00 21.41 ? 199 ARG B C     1 
ATOM   1857 O  O     . ARG B 1 39  ? 0.643   45.456 -53.097 1.00 20.77 ? 199 ARG B O     1 
ATOM   1858 C  CB    . ARG B 1 39  ? 1.443   43.708 -55.714 1.00 23.54 ? 199 ARG B CB    1 
ATOM   1859 C  CG    . ARG B 1 39  ? 1.717   43.951 -57.174 1.00 29.24 ? 199 ARG B CG    1 
ATOM   1860 C  CD    . ARG B 1 39  ? 1.073   42.894 -58.052 1.00 31.75 ? 199 ARG B CD    1 
ATOM   1861 N  NE    . ARG B 1 39  ? 1.618   42.945 -59.403 1.00 36.49 ? 199 ARG B NE    1 
ATOM   1862 C  CZ    . ARG B 1 39  ? 1.397   42.023 -60.333 1.00 42.01 ? 199 ARG B CZ    1 
ATOM   1863 N  NH1   . ARG B 1 39  ? 0.631   40.975 -60.057 1.00 42.04 ? 199 ARG B NH1   1 
ATOM   1864 N  NH2   . ARG B 1 39  ? 1.943   42.150 -61.537 1.00 42.98 ? 199 ARG B NH2   1 
ATOM   1865 N  N     . TYR B 1 40  ? 2.038   43.764 -52.582 1.00 16.24 ? 200 TYR B N     1 
ATOM   1866 C  CA    . TYR B 1 40  ? 1.648   43.708 -51.179 1.00 17.91 ? 200 TYR B CA    1 
ATOM   1867 C  C     . TYR B 1 40  ? 2.889   43.793 -50.319 1.00 19.00 ? 200 TYR B C     1 
ATOM   1868 O  O     . TYR B 1 40  ? 3.831   43.026 -50.495 1.00 19.76 ? 200 TYR B O     1 
ATOM   1869 C  CB    . TYR B 1 40  ? 0.895   42.421 -50.862 1.00 20.06 ? 200 TYR B CB    1 
ATOM   1870 C  CG    . TYR B 1 40  ? -0.386  42.285 -51.646 1.00 24.31 ? 200 TYR B CG    1 
ATOM   1871 C  CD1   . TYR B 1 40  ? -1.562  42.863 -51.191 1.00 26.30 ? 200 TYR B CD1   1 
ATOM   1872 C  CD2   . TYR B 1 40  ? -0.413  41.598 -52.854 1.00 29.28 ? 200 TYR B CD2   1 
ATOM   1873 C  CE1   . TYR B 1 40  ? -2.735  42.748 -51.911 1.00 31.55 ? 200 TYR B CE1   1 
ATOM   1874 C  CE2   . TYR B 1 40  ? -1.583  41.479 -53.581 1.00 33.20 ? 200 TYR B CE2   1 
ATOM   1875 C  CZ    . TYR B 1 40  ? -2.738  42.056 -53.104 1.00 34.24 ? 200 TYR B CZ    1 
ATOM   1876 O  OH    . TYR B 1 40  ? -3.901  41.943 -53.821 1.00 37.93 ? 200 TYR B OH    1 
ATOM   1877 N  N     . HIS B 1 41  ? 2.887   44.735 -49.388 1.00 15.48 ? 201 HIS B N     1 
ATOM   1878 C  CA    . HIS B 1 41  ? 4.042   44.928 -48.531 1.00 13.72 ? 201 HIS B CA    1 
ATOM   1879 C  C     . HIS B 1 41  ? 3.562   45.507 -47.208 1.00 18.25 ? 201 HIS B C     1 
ATOM   1880 O  O     . HIS B 1 41  ? 3.214   46.689 -47.136 1.00 16.95 ? 201 HIS B O     1 
ATOM   1881 C  CB    . HIS B 1 41  ? 5.047   45.869 -49.204 1.00 12.90 ? 201 HIS B CB    1 
ATOM   1882 C  CG    . HIS B 1 41  ? 6.365   45.951 -48.495 1.00 14.65 ? 201 HIS B CG    1 
ATOM   1883 N  ND1   . HIS B 1 41  ? 7.417   46.708 -48.962 1.00 16.08 ? 201 HIS B ND1   1 
ATOM   1884 C  CD2   . HIS B 1 41  ? 6.798   45.375 -47.348 1.00 15.82 ? 201 HIS B CD2   1 
ATOM   1885 C  CE1   . HIS B 1 41  ? 8.442   46.596 -48.136 1.00 16.51 ? 201 HIS B CE1   1 
ATOM   1886 N  NE2   . HIS B 1 41  ? 8.096   45.787 -47.151 1.00 13.43 ? 201 HIS B NE2   1 
ATOM   1887 N  N     . TRP B 1 42  ? 3.511   44.663 -46.179 1.00 13.63 ? 202 TRP B N     1 
ATOM   1888 C  CA    . TRP B 1 42  ? 3.116   45.115 -44.849 1.00 16.05 ? 202 TRP B CA    1 
ATOM   1889 C  C     . TRP B 1 42  ? 4.278   45.031 -43.883 1.00 15.91 ? 202 TRP B C     1 
ATOM   1890 O  O     . TRP B 1 42  ? 5.245   44.297 -44.114 1.00 16.18 ? 202 TRP B O     1 
ATOM   1891 C  CB    . TRP B 1 42  ? 1.979   44.262 -44.288 1.00 16.72 ? 202 TRP B CB    1 
ATOM   1892 C  CG    . TRP B 1 42  ? 0.697   44.336 -45.030 1.00 17.63 ? 202 TRP B CG    1 
ATOM   1893 C  CD1   . TRP B 1 42  ? -0.232  45.336 -44.981 1.00 19.99 ? 202 TRP B CD1   1 
ATOM   1894 C  CD2   . TRP B 1 42  ? 0.169   43.335 -45.903 1.00 19.78 ? 202 TRP B CD2   1 
ATOM   1895 N  NE1   . TRP B 1 42  ? -1.309  45.021 -45.788 1.00 19.71 ? 202 TRP B NE1   1 
ATOM   1896 C  CE2   . TRP B 1 42  ? -1.081  43.797 -46.366 1.00 20.73 ? 202 TRP B CE2   1 
ATOM   1897 C  CE3   . TRP B 1 42  ? 0.636   42.090 -46.345 1.00 19.82 ? 202 TRP B CE3   1 
ATOM   1898 C  CZ2   . TRP B 1 42  ? -1.871  43.056 -47.246 1.00 24.65 ? 202 TRP B CZ2   1 
ATOM   1899 C  CZ3   . TRP B 1 42  ? -0.155  41.355 -47.226 1.00 21.73 ? 202 TRP B CZ3   1 
ATOM   1900 C  CH2   . TRP B 1 42  ? -1.391  41.843 -47.665 1.00 23.17 ? 202 TRP B CH2   1 
ATOM   1901 N  N     . LEU B 1 43  ? 4.173   45.794 -42.802 1.00 14.16 ? 203 LEU B N     1 
ATOM   1902 C  CA    . LEU B 1 43  ? 5.129   45.743 -41.708 1.00 14.38 ? 203 LEU B CA    1 
ATOM   1903 C  C     . LEU B 1 43  ? 4.399   45.312 -40.450 1.00 14.78 ? 203 LEU B C     1 
ATOM   1904 O  O     . LEU B 1 43  ? 3.316   45.823 -40.155 1.00 17.24 ? 203 LEU B O     1 
ATOM   1905 C  CB    . LEU B 1 43  ? 5.714   47.127 -41.448 1.00 16.23 ? 203 LEU B CB    1 
ATOM   1906 C  CG    . LEU B 1 43  ? 6.387   47.865 -42.592 1.00 18.28 ? 203 LEU B CG    1 
ATOM   1907 C  CD1   . LEU B 1 43  ? 6.797   49.234 -42.093 1.00 20.59 ? 203 LEU B CD1   1 
ATOM   1908 C  CD2   . LEU B 1 43  ? 7.595   47.078 -43.070 1.00 19.67 ? 203 LEU B CD2   1 
ATOM   1909 N  N     . VAL B 1 44  ? 4.991   44.381 -39.707 1.00 15.15 ? 204 VAL B N     1 
ATOM   1910 C  CA    . VAL B 1 44  ? 4.467   44.007 -38.395 1.00 16.19 ? 204 VAL B CA    1 
ATOM   1911 C  C     . VAL B 1 44  ? 5.407   44.603 -37.356 1.00 15.27 ? 204 VAL B C     1 
ATOM   1912 O  O     . VAL B 1 44  ? 6.598   44.307 -37.345 1.00 18.05 ? 204 VAL B O     1 
ATOM   1913 C  CB    . VAL B 1 44  ? 4.381   42.470 -38.220 1.00 17.30 ? 204 VAL B CB    1 
ATOM   1914 C  CG1   . VAL B 1 44  ? 3.703   42.120 -36.895 1.00 18.01 ? 204 VAL B CG1   1 
ATOM   1915 C  CG2   . VAL B 1 44  ? 3.628   41.841 -39.384 1.00 17.60 ? 204 VAL B CG2   1 
ATOM   1916 N  N     . LEU B 1 45  ? 4.869   45.471 -36.507 1.00 13.31 ? 205 LEU B N     1 
ATOM   1917 C  CA    . LEU B 1 45  ? 5.675   46.251 -35.581 1.00 17.19 ? 205 LEU B CA    1 
ATOM   1918 C  C     . LEU B 1 45  ? 5.229   45.954 -34.160 1.00 19.03 ? 205 LEU B C     1 
ATOM   1919 O  O     . LEU B 1 45  ? 4.043   46.046 -33.855 1.00 18.86 ? 205 LEU B O     1 
ATOM   1920 C  CB    . LEU B 1 45  ? 5.456   47.739 -35.869 1.00 19.64 ? 205 LEU B CB    1 
ATOM   1921 C  CG    . LEU B 1 45  ? 5.437   48.052 -37.369 1.00 24.92 ? 205 LEU B CG    1 
ATOM   1922 C  CD1   . LEU B 1 45  ? 4.472   49.167 -37.704 1.00 32.46 ? 205 LEU B CD1   1 
ATOM   1923 C  CD2   . LEU B 1 45  ? 6.825   48.404 -37.848 1.00 26.19 ? 205 LEU B CD2   1 
ATOM   1924 N  N     . PRO B 1 46  ? 6.173   45.594 -33.277 1.00 19.87 ? 206 PRO B N     1 
ATOM   1925 C  CA    . PRO B 1 46  ? 5.751   45.361 -31.891 1.00 19.42 ? 206 PRO B CA    1 
ATOM   1926 C  C     . PRO B 1 46  ? 5.607   46.671 -31.132 1.00 20.97 ? 206 PRO B C     1 
ATOM   1927 O  O     . PRO B 1 46  ? 6.348   47.616 -31.407 1.00 22.54 ? 206 PRO B O     1 
ATOM   1928 C  CB    . PRO B 1 46  ? 6.902   44.539 -31.303 1.00 22.88 ? 206 PRO B CB    1 
ATOM   1929 C  CG    . PRO B 1 46  ? 8.082   44.892 -32.113 1.00 24.99 ? 206 PRO B CG    1 
ATOM   1930 C  CD    . PRO B 1 46  ? 7.585   45.239 -33.503 1.00 22.33 ? 206 PRO B CD    1 
ATOM   1931 N  N     . TRP B 1 47  ? 4.663   46.726 -30.196 1.00 20.39 ? 207 TRP B N     1 
ATOM   1932 C  CA    . TRP B 1 47  ? 4.486   47.910 -29.367 1.00 23.21 ? 207 TRP B CA    1 
ATOM   1933 C  C     . TRP B 1 47  ? 5.710   48.138 -28.482 1.00 27.28 ? 207 TRP B C     1 
ATOM   1934 O  O     . TRP B 1 47  ? 6.142   49.271 -28.292 1.00 31.29 ? 207 TRP B O     1 
ATOM   1935 C  CB    . TRP B 1 47  ? 3.224   47.786 -28.506 1.00 23.87 ? 207 TRP B CB    1 
ATOM   1936 C  CG    . TRP B 1 47  ? 1.954   47.843 -29.307 1.00 29.48 ? 207 TRP B CG    1 
ATOM   1937 C  CD1   . TRP B 1 47  ? 1.026   46.848 -29.450 1.00 28.87 ? 207 TRP B CD1   1 
ATOM   1938 C  CD2   . TRP B 1 47  ? 1.478   48.949 -30.087 1.00 30.71 ? 207 TRP B CD2   1 
ATOM   1939 N  NE1   . TRP B 1 47  ? 0.000   47.270 -30.261 1.00 29.72 ? 207 TRP B NE1   1 
ATOM   1940 C  CE2   . TRP B 1 47  ? 0.253   48.555 -30.666 1.00 32.80 ? 207 TRP B CE2   1 
ATOM   1941 C  CE3   . TRP B 1 47  ? 1.964   50.235 -30.347 1.00 33.72 ? 207 TRP B CE3   1 
ATOM   1942 C  CZ2   . TRP B 1 47  ? -0.490  49.400 -31.489 1.00 36.12 ? 207 TRP B CZ2   1 
ATOM   1943 C  CZ3   . TRP B 1 47  ? 1.223   51.074 -31.163 1.00 37.18 ? 207 TRP B CZ3   1 
ATOM   1944 C  CH2   . TRP B 1 47  ? 0.012   50.652 -31.727 1.00 36.66 ? 207 TRP B CH2   1 
ATOM   1945 N  N     . THR B 1 48  ? 6.257   47.056 -27.935 1.00 27.42 ? 208 THR B N     1 
ATOM   1946 C  CA    . THR B 1 48  ? 7.504   47.137 -27.181 1.00 31.74 ? 208 THR B CA    1 
ATOM   1947 C  C     . THR B 1 48  ? 8.656   46.797 -28.112 1.00 31.77 ? 208 THR B C     1 
ATOM   1948 O  O     . THR B 1 48  ? 8.854   45.634 -28.471 1.00 29.74 ? 208 THR B O     1 
ATOM   1949 C  CB    . THR B 1 48  ? 7.523   46.177 -25.985 1.00 35.35 ? 208 THR B CB    1 
ATOM   1950 O  OG1   . THR B 1 48  ? 6.403   46.448 -25.131 1.00 38.61 ? 208 THR B OG1   1 
ATOM   1951 C  CG2   . THR B 1 48  ? 8.813   46.353 -25.194 1.00 36.74 ? 208 THR B CG2   1 
ATOM   1952 N  N     . SER B 1 49  ? 9.415   47.817 -28.500 1.00 29.32 ? 209 SER B N     1 
ATOM   1953 C  CA    . SER B 1 49  ? 10.407  47.656 -29.555 1.00 28.09 ? 209 SER B CA    1 
ATOM   1954 C  C     . SER B 1 49  ? 11.604  46.813 -29.126 1.00 26.95 ? 209 SER B C     1 
ATOM   1955 O  O     . SER B 1 49  ? 11.915  46.700 -27.941 1.00 25.63 ? 209 SER B O     1 
ATOM   1956 C  CB    . SER B 1 49  ? 10.886  49.020 -30.060 1.00 29.58 ? 209 SER B CB    1 
ATOM   1957 O  OG    . SER B 1 49  ? 11.604  49.697 -29.044 1.00 36.60 ? 209 SER B OG    1 
ATOM   1958 N  N     . ILE B 1 50  ? 12.256  46.214 -30.114 1.00 26.05 ? 210 ILE B N     1 
ATOM   1959 C  CA    . ILE B 1 50  ? 13.536  45.540 -29.924 1.00 28.41 ? 210 ILE B CA    1 
ATOM   1960 C  C     . ILE B 1 50  ? 14.558  46.339 -30.717 1.00 27.97 ? 210 ILE B C     1 
ATOM   1961 O  O     . ILE B 1 50  ? 14.291  46.711 -31.853 1.00 26.48 ? 210 ILE B O     1 
ATOM   1962 C  CB    . ILE B 1 50  ? 13.494  44.116 -30.473 1.00 30.74 ? 210 ILE B CB    1 
ATOM   1963 C  CG1   . ILE B 1 50  ? 12.239  43.394 -29.975 1.00 34.39 ? 210 ILE B CG1   1 
ATOM   1964 C  CG2   . ILE B 1 50  ? 14.761  43.354 -30.092 1.00 32.39 ? 210 ILE B CG2   1 
ATOM   1965 C  CD1   . ILE B 1 50  ? 11.967  42.087 -30.694 1.00 35.46 ? 210 ILE B CD1   1 
ATOM   1966 N  N     . SER B 1 51  ? 15.719  46.611 -30.127 1.00 33.93 ? 211 SER B N     1 
ATOM   1967 C  CA    . SER B 1 51  ? 16.671  47.550 -30.731 1.00 36.11 ? 211 SER B CA    1 
ATOM   1968 C  C     . SER B 1 51  ? 17.216  47.083 -32.080 1.00 33.48 ? 211 SER B C     1 
ATOM   1969 O  O     . SER B 1 51  ? 17.270  47.855 -33.038 1.00 35.75 ? 211 SER B O     1 
ATOM   1970 C  CB    . SER B 1 51  ? 17.821  47.848 -29.769 1.00 41.34 ? 211 SER B CB    1 
ATOM   1971 O  OG    . SER B 1 51  ? 18.586  46.684 -29.531 1.00 44.66 ? 211 SER B OG    1 
ATOM   1972 N  N     . SER B 1 52  ? 17.621  45.820 -32.151 1.00 29.80 ? 212 SER B N     1 
ATOM   1973 C  CA    . SER B 1 52  ? 18.090  45.240 -33.403 1.00 31.48 ? 212 SER B CA    1 
ATOM   1974 C  C     . SER B 1 52  ? 18.084  43.730 -33.267 1.00 29.69 ? 212 SER B C     1 
ATOM   1975 O  O     . SER B 1 52  ? 17.882  43.210 -32.174 1.00 29.92 ? 212 SER B O     1 
ATOM   1976 C  CB    . SER B 1 52  ? 19.500  45.729 -33.750 1.00 35.06 ? 212 SER B CB    1 
ATOM   1977 O  OG    . SER B 1 52  ? 20.483  45.061 -32.976 1.00 36.33 ? 212 SER B OG    1 
ATOM   1978 N  N     . LEU B 1 53  ? 18.292  43.029 -34.377 1.00 28.24 ? 213 LEU B N     1 
ATOM   1979 C  CA    . LEU B 1 53  ? 18.331  41.570 -34.350 1.00 30.14 ? 213 LEU B CA    1 
ATOM   1980 C  C     . LEU B 1 53  ? 19.394  41.071 -33.386 1.00 32.01 ? 213 LEU B C     1 
ATOM   1981 O  O     . LEU B 1 53  ? 19.248  40.012 -32.778 1.00 32.40 ? 213 LEU B O     1 
ATOM   1982 C  CB    . LEU B 1 53  ? 18.581  41.002 -35.746 1.00 28.23 ? 213 LEU B CB    1 
ATOM   1983 C  CG    . LEU B 1 53  ? 17.395  41.078 -36.706 1.00 28.23 ? 213 LEU B CG    1 
ATOM   1984 C  CD1   . LEU B 1 53  ? 17.763  40.464 -38.057 1.00 29.23 ? 213 LEU B CD1   1 
ATOM   1985 C  CD2   . LEU B 1 53  ? 16.181  40.386 -36.101 1.00 27.11 ? 213 LEU B CD2   1 
ATOM   1986 N  N     . LYS B 1 54  ? 20.457  41.849 -33.233 1.00 32.71 ? 214 LYS B N     1 
ATOM   1987 C  CA    . LYS B 1 54  ? 21.547  41.457 -32.359 1.00 35.68 ? 214 LYS B CA    1 
ATOM   1988 C  C     . LYS B 1 54  ? 21.140  41.455 -30.885 1.00 33.47 ? 214 LYS B C     1 
ATOM   1989 O  O     . LYS B 1 54  ? 21.780  40.801 -30.067 1.00 33.15 ? 214 LYS B O     1 
ATOM   1990 C  CB    . LYS B 1 54  ? 22.770  42.346 -32.589 1.00 39.72 ? 214 LYS B CB    1 
ATOM   1991 C  CG    . LYS B 1 54  ? 23.392  42.177 -33.967 1.00 41.32 ? 214 LYS B CG    1 
ATOM   1992 C  CD    . LYS B 1 54  ? 24.834  42.679 -33.989 1.00 47.40 ? 214 LYS B CD    1 
ATOM   1993 C  CE    . LYS B 1 54  ? 25.494  42.407 -35.333 1.00 49.79 ? 214 LYS B CE    1 
ATOM   1994 N  NZ    . LYS B 1 54  ? 26.924  42.827 -35.348 1.00 53.11 ? 214 LYS B NZ    1 
ATOM   1995 N  N     . ALA B 1 55  ? 20.068  42.169 -30.550 1.00 34.32 ? 215 ALA B N     1 
ATOM   1996 C  CA    . ALA B 1 55  ? 19.615  42.244 -29.160 1.00 34.92 ? 215 ALA B CA    1 
ATOM   1997 C  C     . ALA B 1 55  ? 18.551  41.198 -28.837 1.00 33.68 ? 215 ALA B C     1 
ATOM   1998 O  O     . ALA B 1 55  ? 18.172  41.023 -27.681 1.00 36.79 ? 215 ALA B O     1 
ATOM   1999 C  CB    . ALA B 1 55  ? 19.093  43.634 -28.843 1.00 33.94 ? 215 ALA B CB    1 
ATOM   2000 N  N     . VAL B 1 56  ? 18.079  40.501 -29.863 1.00 27.56 ? 216 VAL B N     1 
ATOM   2001 C  CA    . VAL B 1 56  ? 17.061  39.471 -29.680 1.00 27.89 ? 216 VAL B CA    1 
ATOM   2002 C  C     . VAL B 1 56  ? 17.560  38.348 -28.770 1.00 29.44 ? 216 VAL B C     1 
ATOM   2003 O  O     . VAL B 1 56  ? 18.693  37.873 -28.908 1.00 30.71 ? 216 VAL B O     1 
ATOM   2004 C  CB    . VAL B 1 56  ? 16.602  38.909 -31.041 1.00 24.22 ? 216 VAL B CB    1 
ATOM   2005 C  CG1   . VAL B 1 56  ? 15.799  37.635 -30.860 1.00 25.78 ? 216 VAL B CG1   1 
ATOM   2006 C  CG2   . VAL B 1 56  ? 15.797  39.956 -31.799 1.00 25.12 ? 216 VAL B CG2   1 
ATOM   2007 N  N     . ALA B 1 57  ? 16.728  37.948 -27.811 1.00 31.23 ? 217 ALA B N     1 
ATOM   2008 C  CA    . ALA B 1 57  ? 17.056  36.834 -26.925 1.00 28.59 ? 217 ALA B CA    1 
ATOM   2009 C  C     . ALA B 1 57  ? 15.836  35.943 -26.721 1.00 28.03 ? 217 ALA B C     1 
ATOM   2010 O  O     . ALA B 1 57  ? 14.790  36.183 -27.317 1.00 25.84 ? 217 ALA B O     1 
ATOM   2011 C  CB    . ALA B 1 57  ? 17.582  37.341 -25.590 1.00 32.71 ? 217 ALA B CB    1 
ATOM   2012 N  N     . ARG B 1 58  ? 15.969  34.921 -25.879 1.00 27.46 ? 218 ARG B N     1 
ATOM   2013 C  CA    . ARG B 1 58  ? 14.870  33.976 -25.657 1.00 28.76 ? 218 ARG B CA    1 
ATOM   2014 C  C     . ARG B 1 58  ? 13.586  34.638 -25.177 1.00 28.46 ? 218 ARG B C     1 
ATOM   2015 O  O     . ARG B 1 58  ? 12.491  34.193 -25.519 1.00 29.93 ? 218 ARG B O     1 
ATOM   2016 C  CB    . ARG B 1 58  ? 15.278  32.863 -24.694 1.00 35.73 ? 218 ARG B CB    1 
ATOM   2017 C  CG    . ARG B 1 58  ? 16.194  31.848 -25.330 1.00 41.79 ? 218 ARG B CG    1 
ATOM   2018 C  CD    . ARG B 1 58  ? 16.335  30.602 -24.486 1.00 43.27 ? 218 ARG B CD    1 
ATOM   2019 N  NE    . ARG B 1 58  ? 17.361  29.722 -25.035 1.00 45.67 ? 218 ARG B NE    1 
ATOM   2020 C  CZ    . ARG B 1 58  ? 17.134  28.820 -25.984 1.00 48.64 ? 218 ARG B CZ    1 
ATOM   2021 N  NH1   . ARG B 1 58  ? 15.912  28.676 -26.486 1.00 47.78 ? 218 ARG B NH1   1 
ATOM   2022 N  NH2   . ARG B 1 58  ? 18.126  28.061 -26.430 1.00 51.19 ? 218 ARG B NH2   1 
ATOM   2023 N  N     . GLU B 1 59  ? 13.727  35.708 -24.402 1.00 28.09 ? 219 GLU B N     1 
ATOM   2024 C  CA    . GLU B 1 59  ? 12.583  36.450 -23.885 1.00 30.30 ? 219 GLU B CA    1 
ATOM   2025 C  C     . GLU B 1 59  ? 11.726  37.044 -25.002 1.00 27.77 ? 219 GLU B C     1 
ATOM   2026 O  O     . GLU B 1 59  ? 10.569  37.397 -24.779 1.00 28.16 ? 219 GLU B O     1 
ATOM   2027 C  CB    . GLU B 1 59  ? 13.062  37.570 -22.963 1.00 37.13 ? 219 GLU B CB    1 
ATOM   2028 C  CG    . GLU B 1 59  ? 13.817  38.666 -23.696 1.00 43.86 ? 219 GLU B CG    1 
ATOM   2029 C  CD    . GLU B 1 59  ? 14.730  39.459 -22.787 1.00 53.10 ? 219 GLU B CD    1 
ATOM   2030 O  OE1   . GLU B 1 59  ? 14.324  40.561 -22.355 1.00 57.28 ? 219 GLU B OE1   1 
ATOM   2031 O  OE2   . GLU B 1 59  ? 15.855  38.983 -22.511 1.00 56.02 ? 219 GLU B OE2   1 
ATOM   2032 N  N     . HIS B 1 60  ? 12.296  37.166 -26.198 1.00 21.69 ? 220 HIS B N     1 
ATOM   2033 C  CA    . HIS B 1 60  ? 11.574  37.741 -27.328 1.00 19.63 ? 220 HIS B CA    1 
ATOM   2034 C  C     . HIS B 1 60  ? 10.968  36.676 -28.227 1.00 18.01 ? 220 HIS B C     1 
ATOM   2035 O  O     . HIS B 1 60  ? 10.324  37.010 -29.213 1.00 21.99 ? 220 HIS B O     1 
ATOM   2036 C  CB    . HIS B 1 60  ? 12.498  38.607 -28.190 1.00 19.99 ? 220 HIS B CB    1 
ATOM   2037 C  CG    . HIS B 1 60  ? 13.099  39.767 -27.462 1.00 25.15 ? 220 HIS B CG    1 
ATOM   2038 N  ND1   . HIS B 1 60  ? 14.413  39.785 -27.051 1.00 28.80 ? 220 HIS B ND1   1 
ATOM   2039 C  CD2   . HIS B 1 60  ? 12.566  40.950 -27.076 1.00 28.09 ? 220 HIS B CD2   1 
ATOM   2040 C  CE1   . HIS B 1 60  ? 14.665  40.928 -26.438 1.00 28.23 ? 220 HIS B CE1   1 
ATOM   2041 N  NE2   . HIS B 1 60  ? 13.561  41.653 -26.439 1.00 30.08 ? 220 HIS B NE2   1 
ATOM   2042 N  N     . LEU B 1 61  ? 11.203  35.408 -27.910 1.00 18.71 ? 221 LEU B N     1 
ATOM   2043 C  CA    . LEU B 1 61  ? 10.784  34.315 -28.789 1.00 24.07 ? 221 LEU B CA    1 
ATOM   2044 C  C     . LEU B 1 61  ? 9.272   34.281 -29.019 1.00 23.51 ? 221 LEU B C     1 
ATOM   2045 O  O     . LEU B 1 61  ? 8.816   34.080 -30.145 1.00 23.11 ? 221 LEU B O     1 
ATOM   2046 C  CB    . LEU B 1 61  ? 11.275  32.973 -28.254 1.00 24.86 ? 221 LEU B CB    1 
ATOM   2047 C  CG    . LEU B 1 61  ? 10.986  31.733 -29.104 1.00 28.87 ? 221 LEU B CG    1 
ATOM   2048 C  CD1   . LEU B 1 61  ? 11.566  31.883 -30.504 1.00 29.71 ? 221 LEU B CD1   1 
ATOM   2049 C  CD2   . LEU B 1 61  ? 11.528  30.481 -28.426 1.00 30.63 ? 221 LEU B CD2   1 
ATOM   2050 N  N     A GLU B 1 62  ? 8.488   34.473 -27.965 0.49 23.14 ? 222 GLU B N     1 
ATOM   2051 N  N     B GLU B 1 62  ? 8.510   34.485 -27.949 0.51 23.06 ? 222 GLU B N     1 
ATOM   2052 C  CA    A GLU B 1 62  ? 7.038   34.436 -28.128 0.49 23.00 ? 222 GLU B CA    1 
ATOM   2053 C  CA    B GLU B 1 62  ? 7.054   34.485 -28.028 0.51 23.90 ? 222 GLU B CA    1 
ATOM   2054 C  C     A GLU B 1 62  ? 6.547   35.589 -29.003 0.49 19.61 ? 222 GLU B C     1 
ATOM   2055 C  C     B GLU B 1 62  ? 6.578   35.573 -28.986 0.51 20.09 ? 222 GLU B C     1 
ATOM   2056 O  O     A GLU B 1 62  ? 5.642   35.412 -29.808 0.49 18.80 ? 222 GLU B O     1 
ATOM   2057 O  O     B GLU B 1 62  ? 5.722   35.336 -29.830 0.51 18.52 ? 222 GLU B O     1 
ATOM   2058 C  CB    A GLU B 1 62  ? 6.313   34.409 -26.781 0.49 28.71 ? 222 GLU B CB    1 
ATOM   2059 C  CB    B GLU B 1 62  ? 6.445   34.691 -26.638 0.51 28.94 ? 222 GLU B CB    1 
ATOM   2060 C  CG    A GLU B 1 62  ? 6.401   33.069 -26.071 0.49 34.40 ? 222 GLU B CG    1 
ATOM   2061 C  CG    B GLU B 1 62  ? 4.932   34.537 -26.581 0.51 33.83 ? 222 GLU B CG    1 
ATOM   2062 C  CD    A GLU B 1 62  ? 6.159   31.894 -27.006 0.49 37.54 ? 222 GLU B CD    1 
ATOM   2063 C  CD    B GLU B 1 62  ? 4.371   34.797 -25.194 0.51 46.84 ? 222 GLU B CD    1 
ATOM   2064 O  OE1   A GLU B 1 62  ? 5.054   31.798 -27.586 0.49 31.56 ? 222 GLU B OE1   1 
ATOM   2065 O  OE1   B GLU B 1 62  ? 4.780   35.796 -24.564 0.51 49.26 ? 222 GLU B OE1   1 
ATOM   2066 O  OE2   A GLU B 1 62  ? 7.082   31.068 -27.167 0.49 44.68 ? 222 GLU B OE2   1 
ATOM   2067 O  OE2   B GLU B 1 62  ? 3.524   34.000 -24.732 0.51 51.50 ? 222 GLU B OE2   1 
ATOM   2068 N  N     . LEU B 1 63  ? 7.163   36.760 -28.855 1.00 19.22 ? 223 LEU B N     1 
ATOM   2069 C  CA    . LEU B 1 63  ? 6.811   37.905 -29.684 1.00 17.76 ? 223 LEU B CA    1 
ATOM   2070 C  C     . LEU B 1 63  ? 7.156   37.640 -31.142 1.00 18.53 ? 223 LEU B C     1 
ATOM   2071 O  O     . LEU B 1 63  ? 6.373   37.944 -32.041 1.00 20.04 ? 223 LEU B O     1 
ATOM   2072 C  CB    . LEU B 1 63  ? 7.539   39.156 -29.192 1.00 20.29 ? 223 LEU B CB    1 
ATOM   2073 C  CG    . LEU B 1 63  ? 7.336   40.450 -29.985 1.00 19.31 ? 223 LEU B CG    1 
ATOM   2074 C  CD1   . LEU B 1 63  ? 5.863   40.825 -30.108 1.00 21.99 ? 223 LEU B CD1   1 
ATOM   2075 C  CD2   . LEU B 1 63  ? 8.110   41.582 -29.307 1.00 22.44 ? 223 LEU B CD2   1 
ATOM   2076 N  N     . LEU B 1 64  ? 8.331   37.064 -31.376 1.00 19.97 ? 224 LEU B N     1 
ATOM   2077 C  CA    . LEU B 1 64  ? 8.744   36.745 -32.739 1.00 20.81 ? 224 LEU B CA    1 
ATOM   2078 C  C     . LEU B 1 64  ? 7.781   35.763 -33.387 1.00 19.78 ? 224 LEU B C     1 
ATOM   2079 O  O     . LEU B 1 64  ? 7.408   35.935 -34.548 1.00 18.29 ? 224 LEU B O     1 
ATOM   2080 C  CB    . LEU B 1 64  ? 10.169  36.197 -32.769 1.00 22.31 ? 224 LEU B CB    1 
ATOM   2081 C  CG    . LEU B 1 64  ? 11.229  37.252 -32.437 1.00 25.06 ? 224 LEU B CG    1 
ATOM   2082 C  CD1   . LEU B 1 64  ? 12.607  36.619 -32.322 1.00 28.61 ? 224 LEU B CD1   1 
ATOM   2083 C  CD2   . LEU B 1 64  ? 11.224  38.351 -33.482 1.00 24.76 ? 224 LEU B CD2   1 
ATOM   2084 N  N     . LYS B 1 65  ? 7.369   34.748 -32.631 1.00 18.45 ? 225 LYS B N     1 
ATOM   2085 C  CA    . LYS B 1 65  ? 6.419   33.766 -33.137 1.00 17.05 ? 225 LYS B CA    1 
ATOM   2086 C  C     . LYS B 1 65  ? 5.080   34.428 -33.410 1.00 20.98 ? 225 LYS B C     1 
ATOM   2087 O  O     . LYS B 1 65  ? 4.426   34.132 -34.409 1.00 19.27 ? 225 LYS B O     1 
ATOM   2088 C  CB    . LYS B 1 65  ? 6.230   32.623 -32.138 1.00 20.66 ? 225 LYS B CB    1 
ATOM   2089 C  CG    . LYS B 1 65  ? 7.459   31.757 -31.931 1.00 21.48 ? 225 LYS B CG    1 
ATOM   2090 C  CD    . LYS B 1 65  ? 7.165   30.657 -30.919 1.00 26.43 ? 225 LYS B CD    1 
ATOM   2091 C  CE    . LYS B 1 65  ? 8.327   29.689 -30.789 1.00 33.23 ? 225 LYS B CE    1 
ATOM   2092 N  NZ    . LYS B 1 65  ? 8.097   28.681 -29.704 1.00 39.01 ? 225 LYS B NZ    1 
ATOM   2093 N  N     . HIS B 1 66  ? 4.675   35.324 -32.516 1.00 18.67 ? 226 HIS B N     1 
ATOM   2094 C  CA    . HIS B 1 66  ? 3.408   36.028 -32.679 1.00 20.50 ? 226 HIS B CA    1 
ATOM   2095 C  C     . HIS B 1 66  ? 3.415   36.932 -33.909 1.00 19.87 ? 226 HIS B C     1 
ATOM   2096 O  O     . HIS B 1 66  ? 2.415   37.022 -34.617 1.00 19.25 ? 226 HIS B O     1 
ATOM   2097 C  CB    . HIS B 1 66  ? 3.066   36.849 -31.430 1.00 19.60 ? 226 HIS B CB    1 
ATOM   2098 C  CG    . HIS B 1 66  ? 1.747   37.547 -31.520 1.00 21.82 ? 226 HIS B CG    1 
ATOM   2099 N  ND1   . HIS B 1 66  ? 0.545   36.874 -31.459 1.00 26.70 ? 226 HIS B ND1   1 
ATOM   2100 C  CD2   . HIS B 1 66  ? 1.437   38.857 -31.673 1.00 22.61 ? 226 HIS B CD2   1 
ATOM   2101 C  CE1   . HIS B 1 66  ? -0.448  37.740 -31.563 1.00 28.38 ? 226 HIS B CE1   1 
ATOM   2102 N  NE2   . HIS B 1 66  ? 0.066   38.950 -31.699 1.00 24.94 ? 226 HIS B NE2   1 
ATOM   2103 N  N     . MET B 1 67  ? 4.539   37.603 -34.162 1.00 16.57 ? 227 MET B N     1 
ATOM   2104 C  CA    . MET B 1 67  ? 4.654   38.469 -35.334 1.00 17.43 ? 227 MET B CA    1 
ATOM   2105 C  C     . MET B 1 67  ? 4.518   37.650 -36.611 1.00 17.00 ? 227 MET B C     1 
ATOM   2106 O  O     . MET B 1 67  ? 3.874   38.075 -37.569 1.00 14.55 ? 227 MET B O     1 
ATOM   2107 C  CB    . MET B 1 67  ? 5.972   39.255 -35.316 1.00 18.47 ? 227 MET B CB    1 
ATOM   2108 C  CG    . MET B 1 67  ? 6.002   40.337 -34.244 1.00 18.68 ? 227 MET B CG    1 
ATOM   2109 S  SD    . MET B 1 67  ? 7.662   40.925 -33.843 1.00 27.11 ? 227 MET B SD    1 
ATOM   2110 C  CE    . MET B 1 67  ? 8.098   41.707 -35.393 1.00 19.82 ? 227 MET B CE    1 
ATOM   2111 N  N     . HIS B 1 68  ? 5.101   36.459 -36.598 1.00 15.93 ? 228 HIS B N     1 
ATOM   2112 C  CA    . HIS B 1 68  ? 4.996   35.553 -37.729 1.00 18.34 ? 228 HIS B CA    1 
ATOM   2113 C  C     . HIS B 1 68  ? 3.543   35.142 -37.969 1.00 16.90 ? 228 HIS B C     1 
ATOM   2114 O  O     . HIS B 1 68  ? 3.044   35.207 -39.097 1.00 20.39 ? 228 HIS B O     1 
ATOM   2115 C  CB    . HIS B 1 68  ? 5.860   34.305 -37.505 1.00 17.95 ? 228 HIS B CB    1 
ATOM   2116 C  CG    . HIS B 1 68  ? 5.942   33.421 -38.707 1.00 24.91 ? 228 HIS B CG    1 
ATOM   2117 N  ND1   . HIS B 1 68  ? 6.936   33.546 -39.653 1.00 27.84 ? 228 HIS B ND1   1 
ATOM   2118 C  CD2   . HIS B 1 68  ? 5.131   32.426 -39.140 1.00 31.00 ? 228 HIS B CD2   1 
ATOM   2119 C  CE1   . HIS B 1 68  ? 6.742   32.657 -40.611 1.00 32.71 ? 228 HIS B CE1   1 
ATOM   2120 N  NE2   . HIS B 1 68  ? 5.654   31.964 -40.324 1.00 34.52 ? 228 HIS B NE2   1 
ATOM   2121 N  N     . THR B 1 69  ? 2.861   34.722 -36.909 1.00 17.82 ? 229 THR B N     1 
ATOM   2122 C  CA    A THR B 1 69  ? 1.475   34.280 -37.003 0.57 18.93 ? 229 THR B CA    1 
ATOM   2123 C  CA    B THR B 1 69  ? 1.479   34.266 -37.063 0.43 18.88 ? 229 THR B CA    1 
ATOM   2124 C  C     . THR B 1 69  ? 0.584   35.400 -37.535 1.00 20.58 ? 229 THR B C     1 
ATOM   2125 O  O     . THR B 1 69  ? -0.302  35.184 -38.363 1.00 19.45 ? 229 THR B O     1 
ATOM   2126 C  CB    A THR B 1 69  ? 0.974   33.828 -35.620 0.57 21.89 ? 229 THR B CB    1 
ATOM   2127 C  CB    B THR B 1 69  ? 0.890   33.621 -35.785 0.43 21.68 ? 229 THR B CB    1 
ATOM   2128 O  OG1   A THR B 1 69  ? 1.743   32.699 -35.181 0.57 22.00 ? 229 THR B OG1   1 
ATOM   2129 O  OG1   B THR B 1 69  ? 0.618   34.625 -34.798 0.43 21.33 ? 229 THR B OG1   1 
ATOM   2130 C  CG2   A THR B 1 69  ? -0.489  33.448 -35.671 0.57 22.29 ? 229 THR B CG2   1 
ATOM   2131 C  CG2   B THR B 1 69  ? 1.834   32.573 -35.224 0.43 21.88 ? 229 THR B CG2   1 
ATOM   2132 N  N     . VAL B 1 70  ? 0.825   36.604 -37.030 1.00 15.24 ? 230 VAL B N     1 
ATOM   2133 C  CA    . VAL B 1 70  ? 0.054   37.768 -37.443 1.00 17.17 ? 230 VAL B CA    1 
ATOM   2134 C  C     . VAL B 1 70  ? 0.327   38.077 -38.918 1.00 16.62 ? 230 VAL B C     1 
ATOM   2135 O  O     . VAL B 1 70  ? -0.596  38.364 -39.681 1.00 19.53 ? 230 VAL B O     1 
ATOM   2136 C  CB    . VAL B 1 70  ? 0.372   38.985 -36.548 1.00 18.38 ? 230 VAL B CB    1 
ATOM   2137 C  CG1   . VAL B 1 70  ? -0.100  40.277 -37.204 1.00 18.21 ? 230 VAL B CG1   1 
ATOM   2138 C  CG2   . VAL B 1 70  ? -0.274  38.806 -35.181 1.00 19.39 ? 230 VAL B CG2   1 
ATOM   2139 N  N     . GLY B 1 71  ? 1.593   37.987 -39.319 1.00 16.88 ? 231 GLY B N     1 
ATOM   2140 C  CA    . GLY B 1 71  ? 1.972   38.194 -40.707 1.00 18.48 ? 231 GLY B CA    1 
ATOM   2141 C  C     . GLY B 1 71  ? 1.263   37.240 -41.654 1.00 20.24 ? 231 GLY B C     1 
ATOM   2142 O  O     . GLY B 1 71  ? 0.721   37.649 -42.683 1.00 21.57 ? 231 GLY B O     1 
ATOM   2143 N  N     . GLU B 1 72  ? 1.248   35.957 -41.302 1.00 18.14 ? 232 GLU B N     1 
ATOM   2144 C  CA    . GLU B 1 72  ? 0.571   34.965 -42.128 1.00 19.14 ? 232 GLU B CA    1 
ATOM   2145 C  C     . GLU B 1 72  ? -0.944  35.215 -42.195 1.00 21.48 ? 232 GLU B C     1 
ATOM   2146 O  O     . GLU B 1 72  ? -1.567  35.032 -43.241 1.00 22.18 ? 232 GLU B O     1 
ATOM   2147 C  CB    . GLU B 1 72  ? 0.909   33.546 -41.643 1.00 26.93 ? 232 GLU B CB    1 
ATOM   2148 C  CG    . GLU B 1 72  ? 2.420   33.304 -41.596 1.00 33.36 ? 232 GLU B CG    1 
ATOM   2149 C  CD    . GLU B 1 72  ? 2.822   31.855 -41.780 1.00 48.86 ? 232 GLU B CD    1 
ATOM   2150 O  OE1   . GLU B 1 72  ? 2.294   30.987 -41.050 1.00 56.10 ? 232 GLU B OE1   1 
ATOM   2151 O  OE2   . GLU B 1 72  ? 3.684   31.589 -42.651 1.00 51.84 ? 232 GLU B OE2   1 
ATOM   2152 N  N     . LYS B 1 73  ? -1.522  35.664 -41.084 1.00 20.84 ? 233 LYS B N     1 
ATOM   2153 C  CA    . LYS B 1 73  ? -2.954  35.963 -41.005 1.00 21.83 ? 233 LYS B CA    1 
ATOM   2154 C  C     . LYS B 1 73  ? -3.333  37.144 -41.909 1.00 22.51 ? 233 LYS B C     1 
ATOM   2155 O  O     . LYS B 1 73  ? -4.392  37.140 -42.548 1.00 22.35 ? 233 LYS B O     1 
ATOM   2156 C  CB    . LYS B 1 73  ? -3.327  36.270 -39.552 1.00 25.91 ? 233 LYS B CB    1 
ATOM   2157 C  CG    . LYS B 1 73  ? -4.790  36.610 -39.309 1.00 35.63 ? 233 LYS B CG    1 
ATOM   2158 C  CD    . LYS B 1 73  ? -4.968  37.221 -37.919 1.00 41.72 ? 233 LYS B CD    1 
ATOM   2159 C  CE    . LYS B 1 73  ? -6.416  37.152 -37.446 1.00 47.64 ? 233 LYS B CE    1 
ATOM   2160 N  NZ    . LYS B 1 73  ? -7.348  37.838 -38.382 1.00 49.05 ? 233 LYS B NZ    1 
ATOM   2161 N  N     . VAL B 1 74  ? -2.471  38.156 -41.953 1.00 20.95 ? 234 VAL B N     1 
ATOM   2162 C  CA    . VAL B 1 74  ? -2.704  39.326 -42.802 1.00 21.34 ? 234 VAL B CA    1 
ATOM   2163 C  C     . VAL B 1 74  ? -2.751  38.940 -44.280 1.00 21.00 ? 234 VAL B C     1 
ATOM   2164 O  O     . VAL B 1 74  ? -3.579  39.449 -45.040 1.00 22.29 ? 234 VAL B O     1 
ATOM   2165 C  CB    . VAL B 1 74  ? -1.644  40.431 -42.575 1.00 21.47 ? 234 VAL B CB    1 
ATOM   2166 C  CG1   . VAL B 1 74  ? -1.807  41.545 -43.605 1.00 22.67 ? 234 VAL B CG1   1 
ATOM   2167 C  CG2   . VAL B 1 74  ? -1.781  40.998 -41.174 1.00 26.38 ? 234 VAL B CG2   1 
ATOM   2168 N  N     . ILE B 1 75  ? -1.874  38.022 -44.676 1.00 18.37 ? 235 ILE B N     1 
ATOM   2169 C  CA    . ILE B 1 75  ? -1.890  37.500 -46.040 1.00 19.60 ? 235 ILE B CA    1 
ATOM   2170 C  C     . ILE B 1 75  ? -3.239  36.854 -46.341 1.00 23.76 ? 235 ILE B C     1 
ATOM   2171 O  O     . ILE B 1 75  ? -3.850  37.118 -47.378 1.00 23.27 ? 235 ILE B O     1 
ATOM   2172 C  CB    . ILE B 1 75  ? -0.764  36.475 -46.265 1.00 20.35 ? 235 ILE B CB    1 
ATOM   2173 C  CG1   . ILE B 1 75  ? 0.597   37.163 -46.183 1.00 19.57 ? 235 ILE B CG1   1 
ATOM   2174 C  CG2   . ILE B 1 75  ? -0.916  35.786 -47.615 1.00 25.51 ? 235 ILE B CG2   1 
ATOM   2175 C  CD1   . ILE B 1 75  ? 1.762   36.187 -46.057 1.00 21.16 ? 235 ILE B CD1   1 
ATOM   2176 N  N     . VAL B 1 76  ? -3.706  36.013 -45.424 1.00 24.30 ? 236 VAL B N     1 
ATOM   2177 C  CA    . VAL B 1 76  ? -4.985  35.334 -45.618 1.00 24.80 ? 236 VAL B CA    1 
ATOM   2178 C  C     . VAL B 1 76  ? -6.136  36.333 -45.714 1.00 26.57 ? 236 VAL B C     1 
ATOM   2179 O  O     . VAL B 1 76  ? -7.000  36.225 -46.588 1.00 26.21 ? 236 VAL B O     1 
ATOM   2180 C  CB    . VAL B 1 76  ? -5.272  34.327 -44.477 1.00 26.23 ? 236 VAL B CB    1 
ATOM   2181 C  CG1   . VAL B 1 76  ? -6.664  33.725 -44.626 1.00 32.48 ? 236 VAL B CG1   1 
ATOM   2182 C  CG2   . VAL B 1 76  ? -4.225  33.229 -44.462 1.00 24.33 ? 236 VAL B CG2   1 
ATOM   2183 N  N     . ASP B 1 77  ? -6.141  37.313 -44.820 1.00 22.54 ? 237 ASP B N     1 
ATOM   2184 C  CA    . ASP B 1 77  ? -7.275  38.222 -44.716 1.00 28.80 ? 237 ASP B CA    1 
ATOM   2185 C  C     . ASP B 1 77  ? -7.284  39.355 -45.747 1.00 28.13 ? 237 ASP B C     1 
ATOM   2186 O  O     . ASP B 1 77  ? -8.350  39.839 -46.117 1.00 30.04 ? 237 ASP B O     1 
ATOM   2187 C  CB    . ASP B 1 77  ? -7.365  38.794 -43.300 1.00 34.03 ? 237 ASP B CB    1 
ATOM   2188 C  CG    . ASP B 1 77  ? -7.742  37.744 -42.276 1.00 39.99 ? 237 ASP B CG    1 
ATOM   2189 O  OD1   . ASP B 1 77  ? -8.266  36.685 -42.680 1.00 44.74 ? 237 ASP B OD1   1 
ATOM   2190 O  OD2   . ASP B 1 77  ? -7.524  37.978 -41.069 1.00 40.97 ? 237 ASP B OD2   1 
ATOM   2191 N  N     . PHE B 1 78  ? -6.111  39.774 -46.213 1.00 26.35 ? 238 PHE B N     1 
ATOM   2192 C  CA    . PHE B 1 78  ? -6.028  40.957 -47.072 1.00 28.47 ? 238 PHE B CA    1 
ATOM   2193 C  C     . PHE B 1 78  ? -5.458  40.688 -48.466 1.00 35.69 ? 238 PHE B C     1 
ATOM   2194 O  O     . PHE B 1 78  ? -5.487  41.569 -49.328 1.00 42.13 ? 238 PHE B O     1 
ATOM   2195 C  CB    . PHE B 1 78  ? -5.244  42.078 -46.375 1.00 27.64 ? 238 PHE B CB    1 
ATOM   2196 C  CG    . PHE B 1 78  ? -5.905  42.588 -45.119 1.00 29.00 ? 238 PHE B CG    1 
ATOM   2197 C  CD1   . PHE B 1 78  ? -5.632  42.011 -43.891 1.00 27.57 ? 238 PHE B CD1   1 
ATOM   2198 C  CD2   . PHE B 1 78  ? -6.811  43.636 -45.174 1.00 31.70 ? 238 PHE B CD2   1 
ATOM   2199 C  CE1   . PHE B 1 78  ? -6.251  42.466 -42.735 1.00 28.72 ? 238 PHE B CE1   1 
ATOM   2200 C  CE2   . PHE B 1 78  ? -7.430  44.099 -44.021 1.00 32.54 ? 238 PHE B CE2   1 
ATOM   2201 C  CZ    . PHE B 1 78  ? -7.150  43.512 -42.801 1.00 30.64 ? 238 PHE B CZ    1 
ATOM   2202 N  N     . ALA B 1 79  ? -4.935  39.485 -48.682 1.00 34.55 ? 239 ALA B N     1 
ATOM   2203 C  CA    . ALA B 1 79  ? -4.456  39.073 -49.999 1.00 39.03 ? 239 ALA B CA    1 
ATOM   2204 C  C     . ALA B 1 79  ? -4.805  37.609 -50.228 1.00 51.97 ? 239 ALA B C     1 
ATOM   2205 O  O     . ALA B 1 79  ? -4.006  36.844 -50.768 1.00 54.78 ? 239 ALA B O     1 
ATOM   2206 C  CB    . ALA B 1 79  ? -2.958  39.278 -50.116 1.00 34.60 ? 239 ALA B CB    1 
ATOM   2207 N  N     . GLY B 1 80  ? -6.006  37.227 -49.806 1.00 59.13 ? 240 GLY B N     1 
ATOM   2208 C  CA    . GLY B 1 80  ? -6.413  35.835 -49.808 1.00 62.91 ? 240 GLY B CA    1 
ATOM   2209 C  C     . GLY B 1 80  ? -6.521  35.184 -51.173 1.00 64.81 ? 240 GLY B C     1 
ATOM   2210 O  O     . GLY B 1 80  ? -6.075  34.051 -51.365 1.00 68.08 ? 240 GLY B O     1 
ATOM   2211 N  N     A SER B 1 81  ? -7.176  35.894 -52.086 0.60 63.80 ? 241 SER B N     1 
ATOM   2212 N  N     B SER B 1 81  ? -7.055  35.898 -52.158 0.40 63.44 ? 241 SER B N     1 
ATOM   2213 C  CA    A SER B 1 81  ? -7.497  35.377 -53.408 0.60 63.95 ? 241 SER B CA    1 
ATOM   2214 C  CA    B SER B 1 81  ? -7.172  35.321 -53.500 0.40 62.34 ? 241 SER B CA    1 
ATOM   2215 C  C     A SER B 1 81  ? -6.332  35.593 -54.358 0.60 57.43 ? 241 SER B C     1 
ATOM   2216 C  C     B SER B 1 81  ? -6.163  35.896 -54.501 0.40 56.25 ? 241 SER B C     1 
ATOM   2217 O  O     A SER B 1 81  ? -6.327  35.086 -55.480 0.60 57.66 ? 241 SER B O     1 
ATOM   2218 O  O     B SER B 1 81  ? -6.459  36.011 -55.690 0.40 57.04 ? 241 SER B O     1 
ATOM   2219 C  CB    A SER B 1 81  ? -8.759  36.055 -53.945 0.60 68.07 ? 241 SER B CB    1 
ATOM   2220 C  CB    B SER B 1 81  ? -8.599  35.480 -54.036 0.40 67.24 ? 241 SER B CB    1 
ATOM   2221 O  OG    A SER B 1 81  ? -8.736  37.450 -53.685 0.60 68.18 ? 241 SER B OG    1 
ATOM   2222 O  OG    B SER B 1 81  ? -8.648  36.422 -55.094 0.40 67.54 ? 241 SER B OG    1 
ATOM   2223 N  N     A SER B 1 82  ? -5.347  36.357 -53.900 0.60 52.11 ? 242 SER B N     1 
ATOM   2224 N  N     B SER B 1 82  ? -4.967  36.230 -54.022 0.40 50.51 ? 242 SER B N     1 
ATOM   2225 C  CA    A SER B 1 82  ? -4.117  36.531 -54.649 0.60 45.43 ? 242 SER B CA    1 
ATOM   2226 C  CA    B SER B 1 82  ? -3.971  36.911 -54.850 0.40 44.21 ? 242 SER B CA    1 
ATOM   2227 C  C     A SER B 1 82  ? -3.410  35.190 -54.783 0.60 41.45 ? 242 SER B C     1 
ATOM   2228 C  C     B SER B 1 82  ? -3.148  35.983 -55.747 0.40 40.83 ? 242 SER B C     1 
ATOM   2229 O  O     A SER B 1 82  ? -3.418  34.373 -53.861 0.60 41.84 ? 242 SER B O     1 
ATOM   2230 O  O     B SER B 1 82  ? -2.737  36.391 -56.836 0.40 39.67 ? 242 SER B O     1 
ATOM   2231 C  CB    A SER B 1 82  ? -3.196  37.527 -53.947 0.60 42.22 ? 242 SER B CB    1 
ATOM   2232 C  CB    B SER B 1 82  ? -3.019  37.730 -53.976 0.40 41.44 ? 242 SER B CB    1 
ATOM   2233 O  OG    A SER B 1 82  ? -1.892  37.471 -54.496 0.60 39.31 ? 242 SER B OG    1 
ATOM   2234 O  OG    B SER B 1 82  ? -1.942  36.928 -53.522 0.40 39.78 ? 242 SER B OG    1 
ATOM   2235 N  N     A LYS B 1 83  ? -2.809  34.961 -55.942 0.60 39.64 ? 243 LYS B N     1 
ATOM   2236 N  N     B LYS B 1 83  ? -2.890  34.763 -55.266 0.40 39.82 ? 243 LYS B N     1 
ATOM   2237 C  CA    A LYS B 1 83  ? -2.003  33.768 -56.138 0.60 39.26 ? 243 LYS B CA    1 
ATOM   2238 C  CA    B LYS B 1 83  ? -2.086  33.749 -55.971 0.40 39.65 ? 243 LYS B CA    1 
ATOM   2239 C  C     A LYS B 1 83  ? -0.525  34.122 -56.100 0.60 36.16 ? 243 LYS B C     1 
ATOM   2240 C  C     B LYS B 1 83  ? -0.563  33.997 -55.864 0.40 36.47 ? 243 LYS B C     1 
ATOM   2241 O  O     A LYS B 1 83  ? 0.295   33.472 -56.747 0.60 38.20 ? 243 LYS B O     1 
ATOM   2242 O  O     B LYS B 1 83  ? 0.251   33.139 -56.208 0.40 37.77 ? 243 LYS B O     1 
ATOM   2243 C  CB    A LYS B 1 83  ? -2.362  33.074 -57.451 0.60 40.62 ? 243 LYS B CB    1 
ATOM   2244 C  CB    B LYS B 1 83  ? -2.568  33.568 -57.427 0.40 40.76 ? 243 LYS B CB    1 
ATOM   2245 C  CG    A LYS B 1 83  ? -3.728  32.411 -57.436 0.60 43.29 ? 243 LYS B CG    1 
ATOM   2246 C  CG    B LYS B 1 83  ? -1.808  32.559 -58.269 0.40 42.46 ? 243 LYS B CG    1 
ATOM   2247 C  CD    A LYS B 1 83  ? -3.820  31.340 -58.503 0.60 45.22 ? 243 LYS B CD    1 
ATOM   2248 C  CD    B LYS B 1 83  ? -1.786  31.193 -57.615 0.40 45.65 ? 243 LYS B CD    1 
ATOM   2249 C  CE    A LYS B 1 83  ? -4.984  30.398 -58.238 0.60 48.98 ? 243 LYS B CE    1 
ATOM   2250 C  CE    B LYS B 1 83  ? -0.626  30.372 -58.138 0.40 45.27 ? 243 LYS B CE    1 
ATOM   2251 N  NZ    A LYS B 1 83  ? -4.964  29.239 -59.161 0.60 52.36 ? 243 LYS B NZ    1 
ATOM   2252 N  NZ    B LYS B 1 83  ? -0.334  29.244 -57.226 0.40 46.71 ? 243 LYS B NZ    1 
ATOM   2253 N  N     . LEU B 1 84  ? -0.189  35.159 -55.340 1.00 31.45 ? 244 LEU B N     1 
ATOM   2254 C  CA    . LEU B 1 84  ? 1.212   35.543 -55.188 1.00 32.88 ? 244 LEU B CA    1 
ATOM   2255 C  C     . LEU B 1 84  ? 1.917   34.772 -54.074 1.00 32.36 ? 244 LEU B C     1 
ATOM   2256 O  O     . LEU B 1 84  ? 1.304   34.403 -53.074 1.00 35.03 ? 244 LEU B O     1 
ATOM   2257 C  CB    . LEU B 1 84  ? 1.328   37.050 -54.919 1.00 28.72 ? 244 LEU B CB    1 
ATOM   2258 C  CG    . LEU B 1 84  ? 0.875   37.953 -56.066 1.00 31.26 ? 244 LEU B CG    1 
ATOM   2259 C  CD1   . LEU B 1 84  ? 0.833   39.408 -55.624 1.00 30.70 ? 244 LEU B CD1   1 
ATOM   2260 C  CD2   . LEU B 1 84  ? 1.794   37.777 -57.265 1.00 34.42 ? 244 LEU B CD2   1 
ATOM   2261 N  N     . ARG B 1 85  ? 3.211   34.535 -54.261 1.00 30.24 ? 245 ARG B N     1 
ATOM   2262 C  CA    . ARG B 1 85  ? 4.050   33.978 -53.212 1.00 27.17 ? 245 ARG B CA    1 
ATOM   2263 C  C     . ARG B 1 85  ? 4.439   35.110 -52.264 1.00 23.38 ? 245 ARG B C     1 
ATOM   2264 O  O     . ARG B 1 85  ? 4.613   36.248 -52.693 1.00 22.49 ? 245 ARG B O     1 
ATOM   2265 C  CB    . ARG B 1 85  ? 5.302   33.343 -53.828 1.00 28.38 ? 245 ARG B CB    1 
ATOM   2266 C  CG    . ARG B 1 85  ? 6.165   32.557 -52.859 1.00 35.11 ? 245 ARG B CG    1 
ATOM   2267 C  CD    . ARG B 1 85  ? 7.238   31.746 -53.592 1.00 38.01 ? 245 ARG B CD    1 
ATOM   2268 N  NE    . ARG B 1 85  ? 8.161   32.595 -54.344 1.00 36.09 ? 245 ARG B NE    1 
ATOM   2269 C  CZ    . ARG B 1 85  ? 9.340   33.006 -53.887 1.00 39.39 ? 245 ARG B CZ    1 
ATOM   2270 N  NH1   . ARG B 1 85  ? 9.748   32.645 -52.678 1.00 38.68 ? 245 ARG B NH1   1 
ATOM   2271 N  NH2   . ARG B 1 85  ? 10.113  33.781 -54.639 1.00 40.07 ? 245 ARG B NH2   1 
ATOM   2272 N  N     . PHE B 1 86  ? 4.551   34.808 -50.975 1.00 21.72 ? 246 PHE B N     1 
ATOM   2273 C  CA    . PHE B 1 86  ? 5.008   35.805 -50.008 1.00 21.04 ? 246 PHE B CA    1 
ATOM   2274 C  C     . PHE B 1 86  ? 6.268   35.335 -49.302 1.00 22.54 ? 246 PHE B C     1 
ATOM   2275 O  O     . PHE B 1 86  ? 6.493   34.136 -49.162 1.00 23.88 ? 246 PHE B O     1 
ATOM   2276 C  CB    . PHE B 1 86  ? 3.938   36.067 -48.950 1.00 21.80 ? 246 PHE B CB    1 
ATOM   2277 C  CG    . PHE B 1 86  ? 2.867   37.025 -49.386 1.00 20.40 ? 246 PHE B CG    1 
ATOM   2278 C  CD1   . PHE B 1 86  ? 1.784   36.581 -50.116 1.00 23.85 ? 246 PHE B CD1   1 
ATOM   2279 C  CD2   . PHE B 1 86  ? 2.946   38.367 -49.052 1.00 20.09 ? 246 PHE B CD2   1 
ATOM   2280 C  CE1   . PHE B 1 86  ? 0.799   37.465 -50.520 1.00 26.43 ? 246 PHE B CE1   1 
ATOM   2281 C  CE2   . PHE B 1 86  ? 1.957   39.252 -49.445 1.00 22.14 ? 246 PHE B CE2   1 
ATOM   2282 C  CZ    . PHE B 1 86  ? 0.887   38.798 -50.181 1.00 21.59 ? 246 PHE B CZ    1 
ATOM   2283 N  N     . ARG B 1 87  ? 7.077   36.285 -48.849 1.00 17.99 ? 247 ARG B N     1 
ATOM   2284 C  CA    . ARG B 1 87  ? 8.108   35.979 -47.866 1.00 20.93 ? 247 ARG B CA    1 
ATOM   2285 C  C     . ARG B 1 87  ? 7.878   36.851 -46.643 1.00 18.68 ? 247 ARG B C     1 
ATOM   2286 O  O     . ARG B 1 87  ? 7.381   37.972 -46.747 1.00 16.83 ? 247 ARG B O     1 
ATOM   2287 C  CB    . ARG B 1 87  ? 9.507   36.220 -48.426 1.00 19.79 ? 247 ARG B CB    1 
ATOM   2288 C  CG    . ARG B 1 87  ? 9.918   35.234 -49.510 1.00 22.38 ? 247 ARG B CG    1 
ATOM   2289 C  CD    . ARG B 1 87  ? 11.343  35.506 -49.978 1.00 25.29 ? 247 ARG B CD    1 
ATOM   2290 N  NE    . ARG B 1 87  ? 12.338  35.020 -49.026 1.00 25.34 ? 247 ARG B NE    1 
ATOM   2291 C  CZ    . ARG B 1 87  ? 13.612  35.405 -49.015 1.00 29.10 ? 247 ARG B CZ    1 
ATOM   2292 N  NH1   . ARG B 1 87  ? 14.044  36.297 -49.895 1.00 28.70 ? 247 ARG B NH1   1 
ATOM   2293 N  NH2   . ARG B 1 87  ? 14.453  34.901 -48.121 1.00 32.55 ? 247 ARG B NH2   1 
ATOM   2294 N  N     . LEU B 1 88  ? 8.237   36.317 -45.485 1.00 17.09 ? 248 LEU B N     1 
ATOM   2295 C  CA    . LEU B 1 88  ? 8.149   37.059 -44.237 1.00 15.67 ? 248 LEU B CA    1 
ATOM   2296 C  C     . LEU B 1 88  ? 9.553   37.071 -43.676 1.00 19.21 ? 248 LEU B C     1 
ATOM   2297 O  O     . LEU B 1 88  ? 10.176  36.021 -43.543 1.00 18.48 ? 248 LEU B O     1 
ATOM   2298 C  CB    . LEU B 1 88  ? 7.209   36.358 -43.248 1.00 17.63 ? 248 LEU B CB    1 
ATOM   2299 C  CG    . LEU B 1 88  ? 5.695   36.395 -43.507 1.00 24.21 ? 248 LEU B CG    1 
ATOM   2300 C  CD1   . LEU B 1 88  ? 5.296   35.440 -44.609 1.00 27.96 ? 248 LEU B CD1   1 
ATOM   2301 C  CD2   . LEU B 1 88  ? 4.935   36.079 -42.230 1.00 25.94 ? 248 LEU B CD2   1 
ATOM   2302 N  N     . GLY B 1 89  ? 10.075  38.248 -43.364 1.00 17.55 ? 249 GLY B N     1 
ATOM   2303 C  CA    . GLY B 1 89  ? 11.425  38.283 -42.846 1.00 18.41 ? 249 GLY B CA    1 
ATOM   2304 C  C     . GLY B 1 89  ? 11.902  39.636 -42.382 1.00 15.45 ? 249 GLY B C     1 
ATOM   2305 O  O     . GLY B 1 89  ? 11.155  40.611 -42.408 1.00 16.34 ? 249 GLY B O     1 
ATOM   2306 N  N     . TYR B 1 90  ? 13.164  39.667 -41.968 1.00 18.79 ? 250 TYR B N     1 
ATOM   2307 C  CA    . TYR B 1 90  ? 13.780  40.818 -41.331 1.00 17.94 ? 250 TYR B CA    1 
ATOM   2308 C  C     . TYR B 1 90  ? 15.019  41.243 -42.103 1.00 19.55 ? 250 TYR B C     1 
ATOM   2309 O  O     . TYR B 1 90  ? 15.771  40.404 -42.589 1.00 19.97 ? 250 TYR B O     1 
ATOM   2310 C  CB    . TYR B 1 90  ? 14.212  40.444 -39.908 1.00 16.79 ? 250 TYR B CB    1 
ATOM   2311 C  CG    . TYR B 1 90  ? 13.066  40.044 -39.009 1.00 18.26 ? 250 TYR B CG    1 
ATOM   2312 C  CD1   . TYR B 1 90  ? 12.318  41.009 -38.337 1.00 18.42 ? 250 TYR B CD1   1 
ATOM   2313 C  CD2   . TYR B 1 90  ? 12.730  38.710 -38.831 1.00 22.18 ? 250 TYR B CD2   1 
ATOM   2314 C  CE1   . TYR B 1 90  ? 11.266  40.653 -37.509 1.00 18.07 ? 250 TYR B CE1   1 
ATOM   2315 C  CE2   . TYR B 1 90  ? 11.677  38.342 -38.008 1.00 24.66 ? 250 TYR B CE2   1 
ATOM   2316 C  CZ    . TYR B 1 90  ? 10.950  39.323 -37.348 1.00 19.65 ? 250 TYR B CZ    1 
ATOM   2317 O  OH    . TYR B 1 90  ? 9.900   38.976 -36.530 1.00 21.73 ? 250 TYR B OH    1 
ATOM   2318 N  N     . HIS B 1 91  ? 15.231  42.549 -42.208 1.00 17.12 ? 251 HIS B N     1 
ATOM   2319 C  CA    . HIS B 1 91  ? 16.506  43.045 -42.697 1.00 17.79 ? 251 HIS B CA    1 
ATOM   2320 C  C     . HIS B 1 91  ? 17.544  42.875 -41.605 1.00 20.49 ? 251 HIS B C     1 
ATOM   2321 O  O     . HIS B 1 91  ? 17.258  43.105 -40.429 1.00 22.69 ? 251 HIS B O     1 
ATOM   2322 C  CB    . HIS B 1 91  ? 16.392  44.513 -43.080 1.00 18.97 ? 251 HIS B CB    1 
ATOM   2323 C  CG    . HIS B 1 91  ? 15.567  44.746 -44.304 1.00 22.18 ? 251 HIS B CG    1 
ATOM   2324 N  ND1   . HIS B 1 91  ? 14.703  45.813 -44.435 1.00 25.07 ? 251 HIS B ND1   1 
ATOM   2325 C  CD2   . HIS B 1 91  ? 15.476  44.044 -45.458 1.00 21.46 ? 251 HIS B CD2   1 
ATOM   2326 C  CE1   . HIS B 1 91  ? 14.117  45.759 -45.618 1.00 24.67 ? 251 HIS B CE1   1 
ATOM   2327 N  NE2   . HIS B 1 91  ? 14.567  44.694 -46.258 1.00 24.99 ? 251 HIS B NE2   1 
ATOM   2328 N  N     . ALA B 1 92  ? 18.744  42.470 -42.001 1.00 17.85 ? 252 ALA B N     1 
ATOM   2329 C  CA    . ALA B 1 92  ? 19.811  42.192 -41.047 1.00 21.48 ? 252 ALA B CA    1 
ATOM   2330 C  C     . ALA B 1 92  ? 20.101  43.410 -40.179 1.00 24.05 ? 252 ALA B C     1 
ATOM   2331 O  O     . ALA B 1 92  ? 20.383  43.288 -38.987 1.00 26.16 ? 252 ALA B O     1 
ATOM   2332 C  CB    . ALA B 1 92  ? 21.073  41.756 -41.789 1.00 21.45 ? 252 ALA B CB    1 
ATOM   2333 N  N     . ILE B 1 93  ? 20.026  44.583 -40.799 1.00 22.78 ? 253 ILE B N     1 
ATOM   2334 C  CA    . ILE B 1 93  ? 20.255  45.850 -40.119 1.00 25.96 ? 253 ILE B CA    1 
ATOM   2335 C  C     . ILE B 1 93  ? 19.047  46.737 -40.407 1.00 25.45 ? 253 ILE B C     1 
ATOM   2336 O  O     . ILE B 1 93  ? 18.645  46.863 -41.554 1.00 28.03 ? 253 ILE B O     1 
ATOM   2337 C  CB    . ILE B 1 93  ? 21.527  46.537 -40.668 1.00 30.28 ? 253 ILE B CB    1 
ATOM   2338 C  CG1   . ILE B 1 93  ? 22.721  45.580 -40.596 1.00 33.15 ? 253 ILE B CG1   1 
ATOM   2339 C  CG2   . ILE B 1 93  ? 21.831  47.823 -39.906 1.00 34.79 ? 253 ILE B CG2   1 
ATOM   2340 C  CD1   . ILE B 1 93  ? 23.998  46.145 -41.168 1.00 35.86 ? 253 ILE B CD1   1 
ATOM   2341 N  N     . PRO B 1 94  ? 18.451  47.338 -39.368 1.00 26.56 ? 254 PRO B N     1 
ATOM   2342 C  CA    . PRO B 1 94  ? 17.312  48.234 -39.614 1.00 25.83 ? 254 PRO B CA    1 
ATOM   2343 C  C     . PRO B 1 94  ? 17.774  49.447 -40.429 1.00 25.26 ? 254 PRO B C     1 
ATOM   2344 O  O     . PRO B 1 94  ? 18.923  49.849 -40.273 1.00 24.14 ? 254 PRO B O     1 
ATOM   2345 C  CB    . PRO B 1 94  ? 16.916  48.690 -38.205 1.00 28.39 ? 254 PRO B CB    1 
ATOM   2346 C  CG    . PRO B 1 94  ? 17.570  47.708 -37.259 1.00 32.49 ? 254 PRO B CG    1 
ATOM   2347 C  CD    . PRO B 1 94  ? 18.825  47.286 -37.947 1.00 30.47 ? 254 PRO B CD    1 
ATOM   2348 N  N     . SER B 1 95  ? 16.916  50.022 -41.267 1.00 25.32 ? 255 SER B N     1 
ATOM   2349 C  CA    . SER B 1 95  ? 17.311  51.220 -42.017 1.00 29.16 ? 255 SER B CA    1 
ATOM   2350 C  C     . SER B 1 95  ? 17.222  52.444 -41.128 1.00 31.01 ? 255 SER B C     1 
ATOM   2351 O  O     . SER B 1 95  ? 17.938  53.429 -41.318 1.00 32.93 ? 255 SER B O     1 
ATOM   2352 C  CB    . SER B 1 95  ? 16.434  51.426 -43.254 1.00 31.38 ? 255 SER B CB    1 
ATOM   2353 O  OG    . SER B 1 95  ? 15.109  51.772 -42.878 1.00 28.82 ? 255 SER B OG    1 
ATOM   2354 N  N     . MET B 1 96  ? 16.329  52.383 -40.152 1.00 30.85 ? 256 MET B N     1 
ATOM   2355 C  CA    . MET B 1 96  ? 16.175  53.479 -39.212 1.00 34.45 ? 256 MET B CA    1 
ATOM   2356 C  C     . MET B 1 96  ? 16.544  52.996 -37.811 1.00 39.89 ? 256 MET B C     1 
ATOM   2357 O  O     . MET B 1 96  ? 17.699  53.104 -37.397 1.00 45.26 ? 256 MET B O     1 
ATOM   2358 C  CB    . MET B 1 96  ? 14.754  54.047 -39.297 1.00 34.81 ? 256 MET B CB    1 
ATOM   2359 C  CG    . MET B 1 96  ? 14.514  54.820 -40.606 1.00 37.61 ? 256 MET B CG    1 
ATOM   2360 S  SD    . MET B 1 96  ? 12.799  55.000 -41.166 1.00 37.90 ? 256 MET B SD    1 
ATOM   2361 C  CE    . MET B 1 96  ? 12.357  53.294 -41.450 1.00 38.41 ? 256 MET B CE    1 
ATOM   2362 N  N     . SER B 1 97  ? 15.580  52.448 -37.086 1.00 34.33 ? 257 SER B N     1 
ATOM   2363 C  CA    . SER B 1 97  ? 15.884  51.761 -35.842 1.00 35.27 ? 257 SER B CA    1 
ATOM   2364 C  C     . SER B 1 97  ? 14.835  50.685 -35.616 1.00 31.72 ? 257 SER B C     1 
ATOM   2365 O  O     . SER B 1 97  ? 13.826  50.654 -36.314 1.00 32.51 ? 257 SER B O     1 
ATOM   2366 C  CB    . SER B 1 97  ? 15.906  52.739 -34.670 1.00 44.53 ? 257 SER B CB    1 
ATOM   2367 O  OG    . SER B 1 97  ? 14.672  53.422 -34.556 1.00 50.11 ? 257 SER B OG    1 
ATOM   2368 N  N     . HIS B 1 98  ? 15.098  49.801 -34.658 1.00 30.44 ? 258 HIS B N     1 
ATOM   2369 C  CA    . HIS B 1 98  ? 14.132  48.798 -34.210 1.00 26.92 ? 258 HIS B CA    1 
ATOM   2370 C  C     . HIS B 1 98  ? 13.869  47.665 -35.202 1.00 26.66 ? 258 HIS B C     1 
ATOM   2371 O  O     . HIS B 1 98  ? 14.064  47.808 -36.410 1.00 31.06 ? 258 HIS B O     1 
ATOM   2372 C  CB    . HIS B 1 98  ? 12.807  49.450 -33.799 1.00 26.63 ? 258 HIS B CB    1 
ATOM   2373 C  CG    . HIS B 1 98  ? 12.956  50.521 -32.767 1.00 33.33 ? 258 HIS B CG    1 
ATOM   2374 N  ND1   . HIS B 1 98  ? 14.010  50.558 -31.878 1.00 38.97 ? 258 HIS B ND1   1 
ATOM   2375 C  CD2   . HIS B 1 98  ? 12.186  51.597 -32.482 1.00 38.21 ? 258 HIS B CD2   1 
ATOM   2376 C  CE1   . HIS B 1 98  ? 13.879  51.608 -31.087 1.00 42.33 ? 258 HIS B CE1   1 
ATOM   2377 N  NE2   . HIS B 1 98  ? 12.780  52.254 -31.431 1.00 42.05 ? 258 HIS B NE2   1 
ATOM   2378 N  N     . VAL B 1 99  ? 13.394  46.547 -34.660 1.00 22.00 ? 259 VAL B N     1 
ATOM   2379 C  CA    . VAL B 1 99  ? 13.113  45.348 -35.438 1.00 20.45 ? 259 VAL B CA    1 
ATOM   2380 C  C     . VAL B 1 99  ? 11.679  45.328 -35.956 1.00 19.58 ? 259 VAL B C     1 
ATOM   2381 O  O     . VAL B 1 99  ? 10.726  45.453 -35.181 1.00 23.80 ? 259 VAL B O     1 
ATOM   2382 C  CB    . VAL B 1 99  ? 13.335  44.087 -34.595 1.00 23.81 ? 259 VAL B CB    1 
ATOM   2383 C  CG1   . VAL B 1 99  ? 13.050  42.839 -35.425 1.00 24.66 ? 259 VAL B CG1   1 
ATOM   2384 C  CG2   . VAL B 1 99  ? 14.750  44.059 -34.056 1.00 27.67 ? 259 VAL B CG2   1 
ATOM   2385 N  N     . HIS B 1 100 ? 11.545  45.161 -37.266 1.00 16.78 ? 260 HIS B N     1 
ATOM   2386 C  CA    . HIS B 1 100 ? 10.245  45.153 -37.927 1.00 18.24 ? 260 HIS B CA    1 
ATOM   2387 C  C     . HIS B 1 100 ? 10.161  43.972 -38.880 1.00 19.04 ? 260 HIS B C     1 
ATOM   2388 O  O     . HIS B 1 100 ? 11.098  43.717 -39.633 1.00 16.85 ? 260 HIS B O     1 
ATOM   2389 C  CB    . HIS B 1 100 ? 10.064  46.441 -38.725 1.00 20.66 ? 260 HIS B CB    1 
ATOM   2390 C  CG    . HIS B 1 100 ? 10.360  47.680 -37.942 1.00 24.41 ? 260 HIS B CG    1 
ATOM   2391 N  ND1   . HIS B 1 100 ? 11.208  48.665 -38.399 1.00 24.78 ? 260 HIS B ND1   1 
ATOM   2392 C  CD2   . HIS B 1 100 ? 9.923   48.091 -36.728 1.00 27.43 ? 260 HIS B CD2   1 
ATOM   2393 C  CE1   . HIS B 1 100 ? 11.275  49.633 -37.503 1.00 27.00 ? 260 HIS B CE1   1 
ATOM   2394 N  NE2   . HIS B 1 100 ? 10.505  49.310 -36.480 1.00 28.64 ? 260 HIS B NE2   1 
ATOM   2395 N  N     . LEU B 1 101 ? 9.037   43.260 -38.854 1.00 14.97 ? 261 LEU B N     1 
ATOM   2396 C  CA    . LEU B 1 101 ? 8.842   42.136 -39.773 1.00 15.39 ? 261 LEU B CA    1 
ATOM   2397 C  C     . LEU B 1 101 ? 8.234   42.616 -41.086 1.00 14.31 ? 261 LEU B C     1 
ATOM   2398 O  O     . LEU B 1 101 ? 7.225   43.314 -41.085 1.00 17.75 ? 261 LEU B O     1 
ATOM   2399 C  CB    . LEU B 1 101 ? 7.932   41.076 -39.151 1.00 16.20 ? 261 LEU B CB    1 
ATOM   2400 C  CG    . LEU B 1 101 ? 7.579   39.865 -40.031 1.00 16.00 ? 261 LEU B CG    1 
ATOM   2401 C  CD1   . LEU B 1 101 ? 8.826   39.045 -40.340 1.00 17.41 ? 261 LEU B CD1   1 
ATOM   2402 C  CD2   . LEU B 1 101 ? 6.515   38.997 -39.350 1.00 16.90 ? 261 LEU B CD2   1 
ATOM   2403 N  N     . HIS B 1 102 ? 8.844   42.233 -42.201 1.00 12.72 ? 262 HIS B N     1 
ATOM   2404 C  CA    . HIS B 1 102 ? 8.297   42.537 -43.520 1.00 14.80 ? 262 HIS B CA    1 
ATOM   2405 C  C     . HIS B 1 102 ? 7.492   41.348 -44.025 1.00 18.29 ? 262 HIS B C     1 
ATOM   2406 O  O     . HIS B 1 102 ? 7.953   40.212 -43.963 1.00 18.49 ? 262 HIS B O     1 
ATOM   2407 C  CB    . HIS B 1 102 ? 9.418   42.849 -44.520 1.00 14.95 ? 262 HIS B CB    1 
ATOM   2408 C  CG    . HIS B 1 102 ? 10.136  44.129 -44.232 1.00 15.05 ? 262 HIS B CG    1 
ATOM   2409 N  ND1   . HIS B 1 102 ? 9.853   45.307 -44.890 1.00 15.83 ? 262 HIS B ND1   1 
ATOM   2410 C  CD2   . HIS B 1 102 ? 11.094  44.425 -43.322 1.00 16.36 ? 262 HIS B CD2   1 
ATOM   2411 C  CE1   . HIS B 1 102 ? 10.620  46.272 -44.411 1.00 18.02 ? 262 HIS B CE1   1 
ATOM   2412 N  NE2   . HIS B 1 102 ? 11.373  45.766 -43.450 1.00 19.05 ? 262 HIS B NE2   1 
ATOM   2413 N  N     . VAL B 1 103 ? 6.288   41.624 -44.515 1.00 13.36 ? 263 VAL B N     1 
ATOM   2414 C  CA    . VAL B 1 103 ? 5.467   40.626 -45.183 1.00 14.32 ? 263 VAL B CA    1 
ATOM   2415 C  C     . VAL B 1 103 ? 5.312   41.124 -46.605 1.00 17.23 ? 263 VAL B C     1 
ATOM   2416 O  O     . VAL B 1 103 ? 4.622   42.123 -46.857 1.00 17.73 ? 263 VAL B O     1 
ATOM   2417 C  CB    . VAL B 1 103 ? 4.091   40.508 -44.519 1.00 17.53 ? 263 VAL B CB    1 
ATOM   2418 C  CG1   . VAL B 1 103 ? 3.289   39.384 -45.155 1.00 17.88 ? 263 VAL B CG1   1 
ATOM   2419 C  CG2   . VAL B 1 103 ? 4.244   40.270 -43.008 1.00 18.56 ? 263 VAL B CG2   1 
ATOM   2420 N  N     . ILE B 1 104 ? 5.967   40.456 -47.545 1.00 15.79 ? 264 ILE B N     1 
ATOM   2421 C  CA    . ILE B 1 104 ? 6.113   41.036 -48.874 1.00 14.64 ? 264 ILE B CA    1 
ATOM   2422 C  C     . ILE B 1 104 ? 5.903   40.025 -49.994 1.00 16.47 ? 264 ILE B C     1 
ATOM   2423 O  O     . ILE B 1 104 ? 6.478   38.932 -49.990 1.00 17.60 ? 264 ILE B O     1 
ATOM   2424 C  CB    . ILE B 1 104 ? 7.473   41.778 -49.027 1.00 15.76 ? 264 ILE B CB    1 
ATOM   2425 C  CG1   . ILE B 1 104 ? 7.547   42.490 -50.388 1.00 17.30 ? 264 ILE B CG1   1 
ATOM   2426 C  CG2   . ILE B 1 104 ? 8.656   40.818 -48.818 1.00 15.69 ? 264 ILE B CG2   1 
ATOM   2427 C  CD1   . ILE B 1 104 ? 8.687   43.480 -50.510 1.00 16.91 ? 264 ILE B CD1   1 
ATOM   2428 N  N     . SER B 1 105 ? 5.054   40.394 -50.948 1.00 17.67 ? 265 SER B N     1 
ATOM   2429 C  CA    . SER B 1 105 ? 4.784   39.528 -52.095 1.00 17.72 ? 265 SER B CA    1 
ATOM   2430 C  C     . SER B 1 105 ? 5.981   39.521 -53.052 1.00 18.27 ? 265 SER B C     1 
ATOM   2431 O  O     . SER B 1 105 ? 6.740   40.487 -53.131 1.00 20.34 ? 265 SER B O     1 
ATOM   2432 C  CB    . SER B 1 105 ? 3.492   39.947 -52.802 1.00 22.54 ? 265 SER B CB    1 
ATOM   2433 O  OG    . SER B 1 105 ? 3.561   41.296 -53.252 1.00 20.01 ? 265 SER B OG    1 
ATOM   2434 N  N     . GLN B 1 106 ? 6.139   38.429 -53.785 1.00 20.07 ? 266 GLN B N     1 
ATOM   2435 C  CA    . GLN B 1 106 ? 7.378   38.166 -54.505 1.00 21.54 ? 266 GLN B CA    1 
ATOM   2436 C  C     . GLN B 1 106 ? 7.369   38.581 -55.981 1.00 26.64 ? 266 GLN B C     1 
ATOM   2437 O  O     . GLN B 1 106 ? 8.255   38.202 -56.749 1.00 28.74 ? 266 GLN B O     1 
ATOM   2438 C  CB    . GLN B 1 106 ? 7.752   36.695 -54.331 1.00 24.03 ? 266 GLN B CB    1 
ATOM   2439 C  CG    . GLN B 1 106 ? 8.033   36.363 -52.869 1.00 22.44 ? 266 GLN B CG    1 
ATOM   2440 C  CD    . GLN B 1 106 ? 9.242   37.112 -52.356 1.00 21.87 ? 266 GLN B CD    1 
ATOM   2441 O  OE1   . GLN B 1 106 ? 10.358  36.875 -52.815 1.00 23.24 ? 266 GLN B OE1   1 
ATOM   2442 N  NE2   . GLN B 1 106 ? 9.027   38.045 -51.423 1.00 19.30 ? 266 GLN B NE2   1 
ATOM   2443 N  N     . ASP B 1 107 ? 6.372   39.372 -56.361 1.00 25.01 ? 267 ASP B N     1 
ATOM   2444 C  CA    . ASP B 1 107 ? 6.316   39.976 -57.688 1.00 26.35 ? 267 ASP B CA    1 
ATOM   2445 C  C     . ASP B 1 107 ? 7.334   41.107 -57.800 1.00 24.10 ? 267 ASP B C     1 
ATOM   2446 O  O     . ASP B 1 107 ? 7.909   41.331 -58.865 1.00 24.56 ? 267 ASP B O     1 
ATOM   2447 C  CB    . ASP B 1 107 ? 4.920   40.551 -57.924 1.00 27.90 ? 267 ASP B CB    1 
ATOM   2448 C  CG    . ASP B 1 107 ? 4.458   41.425 -56.768 1.00 28.54 ? 267 ASP B CG    1 
ATOM   2449 O  OD1   . ASP B 1 107 ? 4.021   40.858 -55.752 1.00 27.97 ? 267 ASP B OD1   1 
ATOM   2450 O  OD2   . ASP B 1 107 ? 4.556   42.670 -56.859 1.00 25.24 ? 267 ASP B OD2   1 
ATOM   2451 N  N     . PHE B 1 108 ? 7.531   41.825 -56.693 1.00 22.39 ? 268 PHE B N     1 
ATOM   2452 C  CA    . PHE B 1 108 ? 8.381   43.024 -56.663 1.00 21.46 ? 268 PHE B CA    1 
ATOM   2453 C  C     . PHE B 1 108 ? 8.027   44.029 -57.758 1.00 23.38 ? 268 PHE B C     1 
ATOM   2454 O  O     . PHE B 1 108 ? 8.895   44.722 -58.297 1.00 24.92 ? 268 PHE B O     1 
ATOM   2455 C  CB    . PHE B 1 108 ? 9.864   42.646 -56.705 1.00 22.69 ? 268 PHE B CB    1 
ATOM   2456 C  CG    . PHE B 1 108 ? 10.313  41.879 -55.497 1.00 22.14 ? 268 PHE B CG    1 
ATOM   2457 C  CD1   . PHE B 1 108 ? 10.482  42.523 -54.279 1.00 22.36 ? 268 PHE B CD1   1 
ATOM   2458 C  CD2   . PHE B 1 108 ? 10.545  40.515 -55.569 1.00 25.37 ? 268 PHE B CD2   1 
ATOM   2459 C  CE1   . PHE B 1 108 ? 10.888  41.818 -53.153 1.00 22.76 ? 268 PHE B CE1   1 
ATOM   2460 C  CE2   . PHE B 1 108 ? 10.950  39.799 -54.448 1.00 24.49 ? 268 PHE B CE2   1 
ATOM   2461 C  CZ    . PHE B 1 108 ? 11.125  40.451 -53.240 1.00 22.14 ? 268 PHE B CZ    1 
ATOM   2462 N  N     . ASP B 1 109 ? 6.737   44.090 -58.070 1.00 23.72 ? 269 ASP B N     1 
ATOM   2463 C  CA    . ASP B 1 109 ? 6.184   45.034 -59.029 1.00 23.75 ? 269 ASP B CA    1 
ATOM   2464 C  C     . ASP B 1 109 ? 5.744   46.294 -58.296 1.00 26.37 ? 269 ASP B C     1 
ATOM   2465 O  O     . ASP B 1 109 ? 4.636   46.357 -57.767 1.00 27.74 ? 269 ASP B O     1 
ATOM   2466 C  CB    . ASP B 1 109 ? 4.981   44.392 -59.730 1.00 26.29 ? 269 ASP B CB    1 
ATOM   2467 C  CG    . ASP B 1 109 ? 4.279   45.332 -60.698 1.00 32.86 ? 269 ASP B CG    1 
ATOM   2468 O  OD1   . ASP B 1 109 ? 4.911   46.290 -61.193 1.00 32.56 ? 269 ASP B OD1   1 
ATOM   2469 O  OD2   . ASP B 1 109 ? 3.087   45.091 -60.986 1.00 35.01 ? 269 ASP B OD2   1 
ATOM   2470 N  N     . SER B 1 110 ? 6.615   47.295 -58.261 1.00 25.32 ? 270 SER B N     1 
ATOM   2471 C  CA    . SER B 1 110 ? 6.292   48.551 -57.591 1.00 23.43 ? 270 SER B CA    1 
ATOM   2472 C  C     . SER B 1 110 ? 7.198   49.677 -58.063 1.00 22.79 ? 270 SER B C     1 
ATOM   2473 O  O     . SER B 1 110 ? 8.408   49.485 -58.215 1.00 20.76 ? 270 SER B O     1 
ATOM   2474 C  CB    . SER B 1 110 ? 6.426   48.405 -56.073 1.00 24.78 ? 270 SER B CB    1 
ATOM   2475 O  OG    . SER B 1 110 ? 6.117   49.633 -55.425 1.00 28.41 ? 270 SER B OG    1 
ATOM   2476 N  N     . PRO B 1 111 ? 6.623   50.869 -58.265 1.00 24.40 ? 271 PRO B N     1 
ATOM   2477 C  CA    . PRO B 1 111 ? 7.455   52.000 -58.689 1.00 25.56 ? 271 PRO B CA    1 
ATOM   2478 C  C     . PRO B 1 111 ? 8.467   52.412 -57.618 1.00 24.66 ? 271 PRO B C     1 
ATOM   2479 O  O     . PRO B 1 111 ? 9.449   53.072 -57.948 1.00 25.28 ? 271 PRO B O     1 
ATOM   2480 C  CB    . PRO B 1 111 ? 6.435   53.117 -58.955 1.00 28.16 ? 271 PRO B CB    1 
ATOM   2481 C  CG    . PRO B 1 111 ? 5.187   52.705 -58.229 1.00 29.75 ? 271 PRO B CG    1 
ATOM   2482 C  CD    . PRO B 1 111 ? 5.189   51.209 -58.201 1.00 26.09 ? 271 PRO B CD    1 
ATOM   2483 N  N     . CYS B 1 112 ? 8.240   52.020 -56.366 1.00 21.22 ? 272 CYS B N     1 
ATOM   2484 C  CA    . CYS B 1 112 ? 9.144   52.375 -55.274 1.00 22.57 ? 272 CYS B CA    1 
ATOM   2485 C  C     . CYS B 1 112 ? 10.451  51.581 -55.287 1.00 23.16 ? 272 CYS B C     1 
ATOM   2486 O  O     . CYS B 1 112 ? 11.428  51.982 -54.662 1.00 23.23 ? 272 CYS B O     1 
ATOM   2487 C  CB    . CYS B 1 112 ? 8.464   52.183 -53.920 1.00 23.62 ? 272 CYS B CB    1 
ATOM   2488 S  SG    . CYS B 1 112 ? 6.935   53.113 -53.691 1.00 31.74 ? 272 CYS B SG    1 
ATOM   2489 N  N     . LEU B 1 113 ? 10.458  50.439 -55.965 1.00 18.91 ? 273 LEU B N     1 
ATOM   2490 C  CA    . LEU B 1 113 ? 11.687  49.669 -56.111 1.00 21.97 ? 273 LEU B CA    1 
ATOM   2491 C  C     . LEU B 1 113 ? 12.529  50.366 -57.182 1.00 23.64 ? 273 LEU B C     1 
ATOM   2492 O  O     . LEU B 1 113 ? 12.224  50.268 -58.371 1.00 25.38 ? 273 LEU B O     1 
ATOM   2493 C  CB    . LEU B 1 113 ? 11.354  48.231 -56.510 1.00 22.89 ? 273 LEU B CB    1 
ATOM   2494 C  CG    . LEU B 1 113 ? 12.361  47.134 -56.155 1.00 27.28 ? 273 LEU B CG    1 
ATOM   2495 C  CD1   . LEU B 1 113 ? 11.782  45.769 -56.507 1.00 33.32 ? 273 LEU B CD1   1 
ATOM   2496 C  CD2   . LEU B 1 113 ? 13.698  47.341 -56.836 1.00 28.32 ? 273 LEU B CD2   1 
ATOM   2497 N  N     . LYS B 1 114 ? 13.579  51.072 -56.756 1.00 19.50 ? 274 LYS B N     1 
ATOM   2498 C  CA    . LYS B 1 114 ? 14.303  51.994 -57.628 1.00 21.43 ? 274 LYS B CA    1 
ATOM   2499 C  C     . LYS B 1 114 ? 15.808  51.754 -57.712 1.00 23.39 ? 274 LYS B C     1 
ATOM   2500 O  O     . LYS B 1 114 ? 16.458  52.249 -58.624 1.00 24.07 ? 274 LYS B O     1 
ATOM   2501 C  CB    . LYS B 1 114 ? 14.073  53.444 -57.177 1.00 23.59 ? 274 LYS B CB    1 
ATOM   2502 C  CG    . LYS B 1 114 ? 12.679  53.968 -57.438 1.00 25.31 ? 274 LYS B CG    1 
ATOM   2503 C  CD    . LYS B 1 114 ? 12.521  55.377 -56.901 1.00 30.17 ? 274 LYS B CD    1 
ATOM   2504 C  CE    . LYS B 1 114 ? 11.163  55.952 -57.263 1.00 34.28 ? 274 LYS B CE    1 
ATOM   2505 N  NZ    . LYS B 1 114 ? 11.002  57.345 -56.759 1.00 36.21 ? 274 LYS B NZ    1 
ATOM   2506 N  N     . ASN B 1 115 ? 16.373  51.023 -56.761 1.00 20.76 ? 275 ASN B N     1 
ATOM   2507 C  CA    . ASN B 1 115 ? 17.821  50.857 -56.754 1.00 23.15 ? 275 ASN B CA    1 
ATOM   2508 C  C     . ASN B 1 115 ? 18.291  49.509 -56.223 1.00 20.45 ? 275 ASN B C     1 
ATOM   2509 O  O     . ASN B 1 115 ? 17.498  48.732 -55.692 1.00 20.64 ? 275 ASN B O     1 
ATOM   2510 C  CB    . ASN B 1 115 ? 18.497  52.018 -56.017 1.00 27.09 ? 275 ASN B CB    1 
ATOM   2511 C  CG    . ASN B 1 115 ? 18.094  52.110 -54.550 1.00 26.11 ? 275 ASN B CG    1 
ATOM   2512 O  OD1   . ASN B 1 115 ? 18.113  51.121 -53.821 1.00 20.37 ? 275 ASN B OD1   1 
ATOM   2513 N  ND2   . ASN B 1 115 ? 17.741  53.314 -54.111 1.00 26.81 ? 275 ASN B ND2   1 
ATOM   2514 N  N     . LYS B 1 116 ? 19.587  49.254 -56.381 1.00 23.23 ? 276 LYS B N     1 
ATOM   2515 C  CA    . LYS B 1 116 ? 20.204  47.976 -56.031 1.00 22.04 ? 276 LYS B CA    1 
ATOM   2516 C  C     . LYS B 1 116 ? 20.036  47.647 -54.549 1.00 21.54 ? 276 LYS B C     1 
ATOM   2517 O  O     . LYS B 1 116 ? 19.856  46.487 -54.173 1.00 20.53 ? 276 LYS B O     1 
ATOM   2518 C  CB    . LYS B 1 116 ? 21.692  48.014 -56.410 1.00 23.72 ? 276 LYS B CB    1 
ATOM   2519 C  CG    . LYS B 1 116 ? 22.491  46.797 -55.996 1.00 29.85 ? 276 LYS B CG    1 
ATOM   2520 C  CD    . LYS B 1 116 ? 23.962  46.952 -56.360 1.00 33.09 ? 276 LYS B CD    1 
ATOM   2521 C  CE    . LYS B 1 116 ? 24.172  46.932 -57.856 1.00 36.47 ? 276 LYS B CE    1 
ATOM   2522 N  NZ    . LYS B 1 116 ? 25.599  47.151 -58.222 1.00 40.43 ? 276 LYS B NZ    1 
ATOM   2523 N  N     . LYS B 1 117 ? 20.102  48.674 -53.709 1.00 21.05 ? 277 LYS B N     1 
ATOM   2524 C  CA    . LYS B 1 117 ? 19.917  48.491 -52.274 1.00 19.69 ? 277 LYS B CA    1 
ATOM   2525 C  C     . LYS B 1 117 ? 18.538  47.923 -51.969 1.00 20.09 ? 277 LYS B C     1 
ATOM   2526 O  O     . LYS B 1 117 ? 18.405  47.006 -51.153 1.00 20.02 ? 277 LYS B O     1 
ATOM   2527 C  CB    . LYS B 1 117 ? 20.137  49.813 -51.529 1.00 26.50 ? 277 LYS B CB    1 
ATOM   2528 C  CG    . LYS B 1 117 ? 19.704  49.779 -50.068 1.00 29.90 ? 277 LYS B CG    1 
ATOM   2529 C  CD    . LYS B 1 117 ? 19.917  51.135 -49.400 1.00 33.28 ? 277 LYS B CD    1 
ATOM   2530 C  CE    . LYS B 1 117 ? 19.105  52.235 -50.079 1.00 32.28 ? 277 LYS B CE    1 
ATOM   2531 N  NZ    . LYS B 1 117 ? 19.308  53.562 -49.408 1.00 32.11 ? 277 LYS B NZ    1 
ATOM   2532 N  N     . HIS B 1 118 ? 17.510  48.452 -52.629 1.00 19.26 ? 278 HIS B N     1 
ATOM   2533 C  CA    . HIS B 1 118 ? 16.158  47.928 -52.458 1.00 17.95 ? 278 HIS B CA    1 
ATOM   2534 C  C     . HIS B 1 118 ? 16.097  46.442 -52.812 1.00 19.06 ? 278 HIS B C     1 
ATOM   2535 O  O     . HIS B 1 118 ? 15.600  45.616 -52.030 1.00 18.77 ? 278 HIS B O     1 
ATOM   2536 C  CB    . HIS B 1 118 ? 15.160  48.697 -53.336 1.00 16.41 ? 278 HIS B CB    1 
ATOM   2537 C  CG    . HIS B 1 118 ? 15.010  50.141 -52.962 1.00 17.52 ? 278 HIS B CG    1 
ATOM   2538 N  ND1   . HIS B 1 118 ? 14.653  51.112 -53.873 1.00 18.56 ? 278 HIS B ND1   1 
ATOM   2539 C  CD2   . HIS B 1 118 ? 15.153  50.775 -51.773 1.00 15.45 ? 278 HIS B CD2   1 
ATOM   2540 C  CE1   . HIS B 1 118 ? 14.586  52.284 -53.263 1.00 21.07 ? 278 HIS B CE1   1 
ATOM   2541 N  NE2   . HIS B 1 118 ? 14.888  52.108 -51.989 1.00 18.69 ? 278 HIS B NE2   1 
ATOM   2542 N  N     . TRP B 1 119 ? 16.605  46.107 -53.995 1.00 18.21 ? 279 TRP B N     1 
ATOM   2543 C  CA    . TRP B 1 119 ? 16.551  44.731 -54.471 1.00 18.50 ? 279 TRP B CA    1 
ATOM   2544 C  C     . TRP B 1 119 ? 17.298  43.785 -53.540 1.00 19.94 ? 279 TRP B C     1 
ATOM   2545 O  O     . TRP B 1 119 ? 16.781  42.746 -53.128 1.00 18.35 ? 279 TRP B O     1 
ATOM   2546 C  CB    . TRP B 1 119 ? 17.152  44.614 -55.873 1.00 19.61 ? 279 TRP B CB    1 
ATOM   2547 C  CG    . TRP B 1 119 ? 17.037  43.215 -56.390 1.00 22.62 ? 279 TRP B CG    1 
ATOM   2548 C  CD1   . TRP B 1 119 ? 18.044  42.302 -56.536 1.00 24.66 ? 279 TRP B CD1   1 
ATOM   2549 C  CD2   . TRP B 1 119 ? 15.832  42.551 -56.774 1.00 21.57 ? 279 TRP B CD2   1 
ATOM   2550 N  NE1   . TRP B 1 119 ? 17.538  41.114 -57.011 1.00 25.11 ? 279 TRP B NE1   1 
ATOM   2551 C  CE2   . TRP B 1 119 ? 16.182  41.244 -57.172 1.00 24.61 ? 279 TRP B CE2   1 
ATOM   2552 C  CE3   . TRP B 1 119 ? 14.488  42.941 -56.839 1.00 21.43 ? 279 TRP B CE3   1 
ATOM   2553 C  CZ2   . TRP B 1 119 ? 15.238  40.321 -57.624 1.00 26.00 ? 279 TRP B CZ2   1 
ATOM   2554 C  CZ3   . TRP B 1 119 ? 13.551  42.024 -57.291 1.00 23.08 ? 279 TRP B CZ3   1 
ATOM   2555 C  CH2   . TRP B 1 119 ? 13.931  40.728 -57.675 1.00 24.99 ? 279 TRP B CH2   1 
ATOM   2556 N  N     . ASN B 1 120 ? 18.530  44.147 -53.221 1.00 19.37 ? 280 ASN B N     1 
ATOM   2557 C  CA    . ASN B 1 120 ? 19.370  43.282 -52.405 1.00 19.40 ? 280 ASN B CA    1 
ATOM   2558 C  C     . ASN B 1 120 ? 18.922  43.164 -50.948 1.00 20.13 ? 280 ASN B C     1 
ATOM   2559 O  O     . ASN B 1 120 ? 19.216  42.172 -50.282 1.00 19.55 ? 280 ASN B O     1 
ATOM   2560 C  CB    . ASN B 1 120 ? 20.831  43.711 -52.515 1.00 20.77 ? 280 ASN B CB    1 
ATOM   2561 C  CG    . ASN B 1 120 ? 21.439  43.332 -53.859 1.00 25.77 ? 280 ASN B CG    1 
ATOM   2562 O  OD1   . ASN B 1 120 ? 20.954  42.418 -54.527 1.00 26.24 ? 280 ASN B OD1   1 
ATOM   2563 N  ND2   . ASN B 1 120 ? 22.498  44.024 -54.256 1.00 24.71 ? 280 ASN B ND2   1 
ATOM   2564 N  N     . SER B 1 121 ? 18.201  44.166 -50.460 1.00 18.84 ? 281 SER B N     1 
ATOM   2565 C  CA    A SER B 1 121 ? 17.716  44.109 -49.088 0.65 20.04 ? 281 SER B CA    1 
ATOM   2566 C  CA    B SER B 1 121 ? 17.669  44.141 -49.101 0.35 20.03 ? 281 SER B CA    1 
ATOM   2567 C  C     . SER B 1 121 ? 16.667  43.010 -48.944 1.00 20.46 ? 281 SER B C     1 
ATOM   2568 O  O     . SER B 1 121 ? 16.478  42.480 -47.854 1.00 22.60 ? 281 SER B O     1 
ATOM   2569 C  CB    A SER B 1 121 ? 17.157  45.463 -48.632 0.65 19.72 ? 281 SER B CB    1 
ATOM   2570 C  CB    B SER B 1 121 ? 16.986  45.468 -48.762 0.35 19.35 ? 281 SER B CB    1 
ATOM   2571 O  OG    A SER B 1 121 ? 15.903  45.724 -49.227 0.65 18.79 ? 281 SER B OG    1 
ATOM   2572 O  OG    B SER B 1 121 ? 17.892  46.550 -48.849 0.35 19.87 ? 281 SER B OG    1 
ATOM   2573 N  N     . PHE B 1 122 ? 16.012  42.652 -50.048 1.00 16.74 ? 282 PHE B N     1 
ATOM   2574 C  CA    . PHE B 1 122 ? 14.994  41.605 -50.018 1.00 18.41 ? 282 PHE B CA    1 
ATOM   2575 C  C     . PHE B 1 122 ? 15.408  40.299 -50.704 1.00 20.91 ? 282 PHE B C     1 
ATOM   2576 O  O     . PHE B 1 122 ? 14.706  39.289 -50.595 1.00 22.24 ? 282 PHE B O     1 
ATOM   2577 C  CB    . PHE B 1 122 ? 13.686  42.118 -50.639 1.00 17.97 ? 282 PHE B CB    1 
ATOM   2578 C  CG    . PHE B 1 122 ? 12.999  43.176 -49.818 1.00 18.37 ? 282 PHE B CG    1 
ATOM   2579 C  CD1   . PHE B 1 122 ? 12.237  42.827 -48.715 1.00 18.33 ? 282 PHE B CD1   1 
ATOM   2580 C  CD2   . PHE B 1 122 ? 13.115  44.517 -50.148 1.00 17.70 ? 282 PHE B CD2   1 
ATOM   2581 C  CE1   . PHE B 1 122 ? 11.600  43.799 -47.956 1.00 18.48 ? 282 PHE B CE1   1 
ATOM   2582 C  CE2   . PHE B 1 122 ? 12.484  45.495 -49.386 1.00 21.41 ? 282 PHE B CE2   1 
ATOM   2583 C  CZ    . PHE B 1 122 ? 11.728  45.131 -48.288 1.00 20.38 ? 282 PHE B CZ    1 
ATOM   2584 N  N     . ASN B 1 123 ? 16.537  40.305 -51.406 1.00 21.83 ? 283 ASN B N     1 
ATOM   2585 C  CA    . ASN B 1 123 ? 16.904  39.145 -52.227 1.00 21.03 ? 283 ASN B CA    1 
ATOM   2586 C  C     . ASN B 1 123 ? 18.332  38.636 -52.060 1.00 25.73 ? 283 ASN B C     1 
ATOM   2587 O  O     . ASN B 1 123 ? 18.882  38.003 -52.958 1.00 29.49 ? 283 ASN B O     1 
ATOM   2588 C  CB    . ASN B 1 123 ? 16.597  39.410 -53.708 1.00 19.78 ? 283 ASN B CB    1 
ATOM   2589 C  CG    . ASN B 1 123 ? 15.107  39.534 -53.973 1.00 23.07 ? 283 ASN B CG    1 
ATOM   2590 O  OD1   . ASN B 1 123 ? 14.396  38.531 -54.058 1.00 24.97 ? 283 ASN B OD1   1 
ATOM   2591 N  ND2   . ASN B 1 123 ? 14.624  40.762 -54.079 1.00 20.31 ? 283 ASN B ND2   1 
ATOM   2592 N  N     . THR B 1 124 ? 18.922  38.908 -50.905 1.00 24.14 ? 284 THR B N     1 
ATOM   2593 C  CA    . THR B 1 124 ? 20.206  38.334 -50.543 1.00 26.85 ? 284 THR B CA    1 
ATOM   2594 C  C     . THR B 1 124 ? 20.100  37.865 -49.102 1.00 26.54 ? 284 THR B C     1 
ATOM   2595 O  O     . THR B 1 124 ? 19.037  37.980 -48.487 1.00 25.01 ? 284 THR B O     1 
ATOM   2596 C  CB    . THR B 1 124 ? 21.346  39.365 -50.646 1.00 28.81 ? 284 THR B CB    1 
ATOM   2597 O  OG1   . THR B 1 124 ? 21.083  40.455 -49.755 1.00 25.81 ? 284 THR B OG1   1 
ATOM   2598 C  CG2   . THR B 1 124 ? 21.483  39.895 -52.068 1.00 27.52 ? 284 THR B CG2   1 
ATOM   2599 N  N     . GLU B 1 125 ? 21.201  37.364 -48.549 1.00 28.11 ? 285 GLU B N     1 
ATOM   2600 C  CA    . GLU B 1 125 ? 21.226  36.964 -47.140 1.00 31.72 ? 285 GLU B CA    1 
ATOM   2601 C  C     . GLU B 1 125 ? 20.978  38.137 -46.191 1.00 27.51 ? 285 GLU B C     1 
ATOM   2602 O  O     . GLU B 1 125 ? 20.903  37.955 -44.979 1.00 28.06 ? 285 GLU B O     1 
ATOM   2603 C  CB    . GLU B 1 125 ? 22.553  36.287 -46.795 1.00 43.46 ? 285 GLU B CB    1 
ATOM   2604 C  CG    . GLU B 1 125 ? 22.838  35.055 -47.629 1.00 56.49 ? 285 GLU B CG    1 
ATOM   2605 C  CD    . GLU B 1 125 ? 21.641  34.127 -47.705 1.00 65.21 ? 285 GLU B CD    1 
ATOM   2606 O  OE1   . GLU B 1 125 ? 21.138  33.714 -46.635 1.00 67.61 ? 285 GLU B OE1   1 
ATOM   2607 O  OE2   . GLU B 1 125 ? 21.195  33.824 -48.834 1.00 67.97 ? 285 GLU B OE2   1 
ATOM   2608 N  N     . TYR B 1 126 ? 20.864  39.341 -46.746 1.00 25.10 ? 286 TYR B N     1 
ATOM   2609 C  CA    . TYR B 1 126 ? 20.525  40.523 -45.969 1.00 23.80 ? 286 TYR B CA    1 
ATOM   2610 C  C     . TYR B 1 126 ? 19.113  40.381 -45.416 1.00 23.58 ? 286 TYR B C     1 
ATOM   2611 O  O     . TYR B 1 126 ? 18.781  40.964 -44.387 1.00 20.02 ? 286 TYR B O     1 
ATOM   2612 C  CB    . TYR B 1 126 ? 20.595  41.763 -46.855 1.00 24.35 ? 286 TYR B CB    1 
ATOM   2613 C  CG    . TYR B 1 126 ? 20.662  43.075 -46.108 1.00 24.64 ? 286 TYR B CG    1 
ATOM   2614 C  CD1   . TYR B 1 126 ? 21.882  43.609 -45.727 1.00 29.13 ? 286 TYR B CD1   1 
ATOM   2615 C  CD2   . TYR B 1 126 ? 19.507  43.794 -45.808 1.00 24.07 ? 286 TYR B CD2   1 
ATOM   2616 C  CE1   . TYR B 1 126 ? 21.960  44.811 -45.059 1.00 30.31 ? 286 TYR B CE1   1 
ATOM   2617 C  CE2   . TYR B 1 126 ? 19.576  44.999 -45.136 1.00 26.63 ? 286 TYR B CE2   1 
ATOM   2618 C  CZ    . TYR B 1 126 ? 20.810  45.500 -44.763 1.00 30.45 ? 286 TYR B CZ    1 
ATOM   2619 O  OH    . TYR B 1 126 ? 20.908  46.702 -44.098 1.00 32.43 ? 286 TYR B OH    1 
ATOM   2620 N  N     . PHE B 1 127 ? 18.288  39.607 -46.119 1.00 19.09 ? 287 PHE B N     1 
ATOM   2621 C  CA    . PHE B 1 127 ? 16.907  39.366 -45.714 1.00 18.48 ? 287 PHE B CA    1 
ATOM   2622 C  C     . PHE B 1 127 ? 16.859  38.028 -44.992 1.00 23.04 ? 287 PHE B C     1 
ATOM   2623 O  O     . PHE B 1 127 ? 17.084  36.982 -45.598 1.00 22.46 ? 287 PHE B O     1 
ATOM   2624 C  CB    . PHE B 1 127 ? 15.999  39.343 -46.945 1.00 19.37 ? 287 PHE B CB    1 
ATOM   2625 C  CG    . PHE B 1 127 ? 14.519  39.337 -46.629 1.00 22.27 ? 287 PHE B CG    1 
ATOM   2626 C  CD1   . PHE B 1 127 ? 13.877  40.499 -46.230 1.00 25.00 ? 287 PHE B CD1   1 
ATOM   2627 C  CD2   . PHE B 1 127 ? 13.769  38.182 -46.763 1.00 25.40 ? 287 PHE B CD2   1 
ATOM   2628 C  CE1   . PHE B 1 127 ? 12.508  40.505 -45.953 1.00 20.91 ? 287 PHE B CE1   1 
ATOM   2629 C  CE2   . PHE B 1 127 ? 12.399  38.187 -46.487 1.00 24.62 ? 287 PHE B CE2   1 
ATOM   2630 C  CZ    . PHE B 1 127 ? 11.776  39.355 -46.087 1.00 20.34 ? 287 PHE B CZ    1 
ATOM   2631 N  N     . LEU B 1 128 ? 16.597  38.067 -43.690 1.00 21.54 ? 288 LEU B N     1 
ATOM   2632 C  CA    . LEU B 1 128 ? 16.554  36.853 -42.883 1.00 22.90 ? 288 LEU B CA    1 
ATOM   2633 C  C     . LEU B 1 128 ? 15.125  36.364 -42.753 1.00 22.09 ? 288 LEU B C     1 
ATOM   2634 O  O     . LEU B 1 128 ? 14.267  37.101 -42.285 1.00 22.26 ? 288 LEU B O     1 
ATOM   2635 C  CB    . LEU B 1 128 ? 17.126  37.103 -41.488 1.00 25.46 ? 288 LEU B CB    1 
ATOM   2636 C  CG    . LEU B 1 128 ? 18.637  37.286 -41.375 1.00 33.64 ? 288 LEU B CG    1 
ATOM   2637 C  CD1   . LEU B 1 128 ? 19.029  38.706 -41.688 1.00 34.51 ? 288 LEU B CD1   1 
ATOM   2638 C  CD2   . LEU B 1 128 ? 19.121  36.885 -39.985 1.00 37.50 ? 288 LEU B CD2   1 
ATOM   2639 N  N     . GLU B 1 129 ? 14.878  35.121 -43.160 1.00 22.83 ? 289 GLU B N     1 
ATOM   2640 C  CA    . GLU B 1 129 ? 13.541  34.541 -43.086 1.00 25.25 ? 289 GLU B CA    1 
ATOM   2641 C  C     . GLU B 1 129 ? 13.033  34.563 -41.656 1.00 21.40 ? 289 GLU B C     1 
ATOM   2642 O  O     . GLU B 1 129 ? 13.784  34.284 -40.720 1.00 21.21 ? 289 GLU B O     1 
ATOM   2643 C  CB    . GLU B 1 129 ? 13.553  33.097 -43.595 1.00 35.96 ? 289 GLU B CB    1 
ATOM   2644 C  CG    . GLU B 1 129 ? 13.875  32.950 -45.073 1.00 46.44 ? 289 GLU B CG    1 
ATOM   2645 C  CD    . GLU B 1 129 ? 12.634  32.916 -45.942 1.00 53.48 ? 289 GLU B CD    1 
ATOM   2646 O  OE1   . GLU B 1 129 ? 11.539  33.219 -45.423 1.00 55.73 ? 289 GLU B OE1   1 
ATOM   2647 O  OE2   . GLU B 1 129 ? 12.754  32.577 -47.140 1.00 55.59 ? 289 GLU B OE2   1 
ATOM   2648 N  N     . SER B 1 130 ? 11.761  34.905 -41.486 1.00 20.64 ? 290 SER B N     1 
ATOM   2649 C  CA    . SER B 1 130 ? 11.152  34.920 -40.163 1.00 21.57 ? 290 SER B CA    1 
ATOM   2650 C  C     . SER B 1 130 ? 11.282  33.555 -39.487 1.00 22.29 ? 290 SER B C     1 
ATOM   2651 O  O     . SER B 1 130 ? 11.693  33.455 -38.322 1.00 21.82 ? 290 SER B O     1 
ATOM   2652 C  CB    . SER B 1 130 ? 9.678   35.333 -40.256 1.00 22.64 ? 290 SER B CB    1 
ATOM   2653 O  OG    . SER B 1 130 ? 9.043   35.215 -38.993 1.00 26.14 ? 290 SER B OG    1 
ATOM   2654 N  N     . GLN B 1 131 ? 10.951  32.502 -40.226 1.00 23.37 ? 291 GLN B N     1 
ATOM   2655 C  CA    . GLN B 1 131 ? 10.999  31.154 -39.676 1.00 26.29 ? 291 GLN B CA    1 
ATOM   2656 C  C     . GLN B 1 131 ? 12.432  30.747 -39.321 1.00 25.65 ? 291 GLN B C     1 
ATOM   2657 O  O     . GLN B 1 131 ? 12.656  30.026 -38.348 1.00 24.93 ? 291 GLN B O     1 
ATOM   2658 C  CB    . GLN B 1 131 ? 10.371  30.149 -40.644 1.00 28.10 ? 291 GLN B CB    1 
ATOM   2659 C  CG    . GLN B 1 131 ? 10.228  28.749 -40.053 1.00 36.86 ? 291 GLN B CG    1 
ATOM   2660 C  CD    . GLN B 1 131 ? 9.383   28.738 -38.785 1.00 41.41 ? 291 GLN B CD    1 
ATOM   2661 O  OE1   . GLN B 1 131 ? 8.270   29.265 -38.761 1.00 41.83 ? 291 GLN B OE1   1 
ATOM   2662 N  NE2   . GLN B 1 131 ? 9.917   28.142 -37.720 1.00 42.37 ? 291 GLN B NE2   1 
ATOM   2663 N  N     . ALA B 1 132 ? 13.399  31.220 -40.100 1.00 24.95 ? 292 ALA B N     1 
ATOM   2664 C  CA    . ALA B 1 132 ? 14.808  30.938 -39.818 1.00 28.61 ? 292 ALA B CA    1 
ATOM   2665 C  C     . ALA B 1 132 ? 15.263  31.654 -38.548 1.00 26.76 ? 292 ALA B C     1 
ATOM   2666 O  O     . ALA B 1 132 ? 16.015  31.099 -37.747 1.00 27.75 ? 292 ALA B O     1 
ATOM   2667 C  CB    . ALA B 1 132 ? 15.683  31.338 -40.999 1.00 30.69 ? 292 ALA B CB    1 
ATOM   2668 N  N     . VAL B 1 133 ? 14.796  32.887 -38.368 1.00 21.16 ? 293 VAL B N     1 
ATOM   2669 C  CA    . VAL B 1 133 ? 15.095  33.659 -37.169 1.00 21.30 ? 293 VAL B CA    1 
ATOM   2670 C  C     . VAL B 1 133 ? 14.523  32.995 -35.914 1.00 24.43 ? 293 VAL B C     1 
ATOM   2671 O  O     . VAL B 1 133 ? 15.211  32.869 -34.900 1.00 25.87 ? 293 VAL B O     1 
ATOM   2672 C  CB    . VAL B 1 133 ? 14.559  35.111 -37.290 1.00 25.05 ? 293 VAL B CB    1 
ATOM   2673 C  CG1   . VAL B 1 133 ? 14.571  35.806 -35.937 1.00 25.63 ? 293 VAL B CG1   1 
ATOM   2674 C  CG2   . VAL B 1 133 ? 15.382  35.892 -38.305 1.00 22.11 ? 293 VAL B CG2   1 
ATOM   2675 N  N     . ILE B 1 134 ? 13.267  32.568 -35.988 1.00 22.31 ? 294 ILE B N     1 
ATOM   2676 C  CA    . ILE B 1 134 ? 12.622  31.898 -34.860 1.00 23.12 ? 294 ILE B CA    1 
ATOM   2677 C  C     . ILE B 1 134 ? 13.371  30.625 -34.483 1.00 25.82 ? 294 ILE B C     1 
ATOM   2678 O  O     . ILE B 1 134 ? 13.591  30.341 -33.303 1.00 27.33 ? 294 ILE B O     1 
ATOM   2679 C  CB    . ILE B 1 134 ? 11.145  31.576 -35.179 1.00 24.81 ? 294 ILE B CB    1 
ATOM   2680 C  CG1   . ILE B 1 134 ? 10.320  32.868 -35.191 1.00 23.75 ? 294 ILE B CG1   1 
ATOM   2681 C  CG2   . ILE B 1 134 ? 10.569  30.585 -34.175 1.00 27.62 ? 294 ILE B CG2   1 
ATOM   2682 C  CD1   . ILE B 1 134 ? 8.998   32.742 -35.890 1.00 25.32 ? 294 ILE B CD1   1 
ATOM   2683 N  N     . GLU B 1 135 ? 13.773  29.866 -35.495 1.00 27.21 ? 295 GLU B N     1 
ATOM   2684 C  CA    . GLU B 1 135 ? 14.490  28.621 -35.268 1.00 32.29 ? 295 GLU B CA    1 
ATOM   2685 C  C     . GLU B 1 135 ? 15.881  28.847 -34.670 1.00 29.00 ? 295 GLU B C     1 
ATOM   2686 O  O     . GLU B 1 135 ? 16.350  28.046 -33.859 1.00 32.48 ? 295 GLU B O     1 
ATOM   2687 C  CB    . GLU B 1 135 ? 14.553  27.798 -36.555 1.00 36.68 ? 295 GLU B CB    1 
ATOM   2688 C  CG    . GLU B 1 135 ? 13.209  27.190 -36.935 1.00 44.07 ? 295 GLU B CG    1 
ATOM   2689 C  CD    . GLU B 1 135 ? 13.252  26.420 -38.241 1.00 53.41 ? 295 GLU B CD    1 
ATOM   2690 O  OE1   . GLU B 1 135 ? 14.342  26.319 -38.843 1.00 58.97 ? 295 GLU B OE1   1 
ATOM   2691 O  OE2   . GLU B 1 135 ? 12.192  25.914 -38.667 1.00 56.05 ? 295 GLU B OE2   1 
ATOM   2692 N  N     . MET B 1 136 ? 16.531  29.938 -35.060 1.00 29.56 ? 296 MET B N     1 
ATOM   2693 C  CA    . MET B 1 136 ? 17.819  30.312 -34.477 1.00 31.15 ? 296 MET B CA    1 
ATOM   2694 C  C     . MET B 1 136 ? 17.692  30.625 -32.991 1.00 30.25 ? 296 MET B C     1 
ATOM   2695 O  O     . MET B 1 136 ? 18.497  30.161 -32.179 1.00 33.60 ? 296 MET B O     1 
ATOM   2696 C  CB    . MET B 1 136 ? 18.412  31.523 -35.197 1.00 30.95 ? 296 MET B CB    1 
ATOM   2697 C  CG    . MET B 1 136 ? 19.213  31.193 -36.435 1.00 35.06 ? 296 MET B CG    1 
ATOM   2698 S  SD    . MET B 1 136 ? 19.876  32.684 -37.202 1.00 49.42 ? 296 MET B SD    1 
ATOM   2699 C  CE    . MET B 1 136 ? 18.558  33.103 -38.333 1.00 41.96 ? 296 MET B CE    1 
ATOM   2700 N  N     . VAL B 1 137 ? 16.680  31.413 -32.643 1.00 27.98 ? 297 VAL B N     1 
ATOM   2701 C  CA    . VAL B 1 137 ? 16.441  31.784 -31.254 1.00 28.68 ? 297 VAL B CA    1 
ATOM   2702 C  C     . VAL B 1 137 ? 16.014  30.572 -30.439 1.00 30.80 ? 297 VAL B C     1 
ATOM   2703 O  O     . VAL B 1 137 ? 16.436  30.399 -29.293 1.00 33.01 ? 297 VAL B O     1 
ATOM   2704 C  CB    . VAL B 1 137 ? 15.390  32.901 -31.145 1.00 30.65 ? 297 VAL B CB    1 
ATOM   2705 C  CG1   . VAL B 1 137 ? 15.155  33.267 -29.689 1.00 31.28 ? 297 VAL B CG1   1 
ATOM   2706 C  CG2   . VAL B 1 137 ? 15.842  34.123 -31.938 1.00 31.30 ? 297 VAL B CG2   1 
ATOM   2707 N  N     . GLN B 1 138 ? 15.194  29.718 -31.042 1.00 31.23 ? 298 GLN B N     1 
ATOM   2708 C  CA    . GLN B 1 138 ? 14.738  28.502 -30.378 1.00 34.19 ? 298 GLN B CA    1 
ATOM   2709 C  C     . GLN B 1 138 ? 15.912  27.618 -29.954 1.00 38.50 ? 298 GLN B C     1 
ATOM   2710 O  O     . GLN B 1 138 ? 15.914  27.056 -28.854 1.00 38.00 ? 298 GLN B O     1 
ATOM   2711 C  CB    . GLN B 1 138 ? 13.778  27.724 -31.287 1.00 39.49 ? 298 GLN B CB    1 
ATOM   2712 C  CG    . GLN B 1 138 ? 12.746  26.880 -30.542 1.00 48.18 ? 298 GLN B CG    1 
ATOM   2713 C  CD    . GLN B 1 138 ? 11.317  27.178 -30.988 1.00 51.21 ? 298 GLN B CD    1 
ATOM   2714 O  OE1   . GLN B 1 138 ? 10.397  27.226 -30.170 1.00 56.40 ? 298 GLN B OE1   1 
ATOM   2715 N  NE2   . GLN B 1 138 ? 11.127  27.377 -32.291 1.00 46.33 ? 298 GLN B NE2   1 
ATOM   2716 N  N     . GLU B 1 139 ? 16.918  27.503 -30.816 1.00 39.67 ? 299 GLU B N     1 
ATOM   2717 C  CA    . GLU B 1 139 ? 18.050  26.628 -30.515 1.00 44.62 ? 299 GLU B CA    1 
ATOM   2718 C  C     . GLU B 1 139 ? 19.183  27.324 -29.756 1.00 42.90 ? 299 GLU B C     1 
ATOM   2719 O  O     . GLU B 1 139 ? 19.758  26.748 -28.830 1.00 43.63 ? 299 GLU B O     1 
ATOM   2720 C  CB    . GLU B 1 139 ? 18.605  25.973 -31.785 1.00 50.15 ? 299 GLU B CB    1 
ATOM   2721 C  CG    . GLU B 1 139 ? 19.592  24.845 -31.482 1.00 61.86 ? 299 GLU B CG    1 
ATOM   2722 C  CD    . GLU B 1 139 ? 20.436  24.436 -32.677 1.00 69.54 ? 299 GLU B CD    1 
ATOM   2723 O  OE1   . GLU B 1 139 ? 20.395  25.134 -33.712 1.00 70.63 ? 299 GLU B OE1   1 
ATOM   2724 O  OE2   . GLU B 1 139 ? 21.147  23.411 -32.574 1.00 74.91 ? 299 GLU B OE2   1 
ATOM   2725 N  N     . ALA B 1 140 ? 19.505  28.553 -30.149 1.00 38.09 ? 300 ALA B N     1 
ATOM   2726 C  CA    . ALA B 1 140 ? 20.703  29.230 -29.642 1.00 40.95 ? 300 ALA B CA    1 
ATOM   2727 C  C     . ALA B 1 140 ? 20.419  30.415 -28.718 1.00 38.41 ? 300 ALA B C     1 
ATOM   2728 O  O     . ALA B 1 140 ? 21.332  30.952 -28.093 1.00 36.79 ? 300 ALA B O     1 
ATOM   2729 C  CB    . ALA B 1 140 ? 21.593  29.672 -30.805 1.00 42.01 ? 300 ALA B CB    1 
ATOM   2730 N  N     . GLY B 1 141 ? 19.161  30.836 -28.648 1.00 34.87 ? 301 GLY B N     1 
ATOM   2731 C  CA    . GLY B 1 141 ? 18.790  31.948 -27.796 1.00 33.18 ? 301 GLY B CA    1 
ATOM   2732 C  C     . GLY B 1 141 ? 19.233  33.291 -28.345 1.00 34.59 ? 301 GLY B C     1 
ATOM   2733 O  O     . GLY B 1 141 ? 19.170  34.311 -27.657 1.00 35.02 ? 301 GLY B O     1 
ATOM   2734 N  N     . ARG B 1 142 ? 19.677  33.294 -29.596 1.00 32.22 ? 302 ARG B N     1 
ATOM   2735 C  CA    . ARG B 1 142 ? 20.103  34.526 -30.242 1.00 30.16 ? 302 ARG B CA    1 
ATOM   2736 C  C     . ARG B 1 142 ? 20.064  34.369 -31.749 1.00 27.69 ? 302 ARG B C     1 
ATOM   2737 O  O     . ARG B 1 142 ? 20.015  33.252 -32.267 1.00 29.63 ? 302 ARG B O     1 
ATOM   2738 C  CB    . ARG B 1 142 ? 21.520  34.893 -29.804 1.00 34.36 ? 302 ARG B CB    1 
ATOM   2739 C  CG    . ARG B 1 142 ? 22.518  33.770 -29.986 1.00 42.84 ? 302 ARG B CG    1 
ATOM   2740 C  CD    . ARG B 1 142 ? 23.887  34.172 -29.481 1.00 52.68 ? 302 ARG B CD    1 
ATOM   2741 N  NE    . ARG B 1 142 ? 24.483  35.203 -30.323 1.00 59.23 ? 302 ARG B NE    1 
ATOM   2742 C  CZ    . ARG B 1 142 ? 25.361  34.958 -31.290 1.00 65.19 ? 302 ARG B CZ    1 
ATOM   2743 N  NH1   . ARG B 1 142 ? 25.750  33.711 -31.530 1.00 68.45 ? 302 ARG B NH1   1 
ATOM   2744 N  NH2   . ARG B 1 142 ? 25.854  35.957 -32.012 1.00 65.27 ? 302 ARG B NH2   1 
ATOM   2745 N  N     . VAL B 1 143 ? 20.112  35.496 -32.446 1.00 27.28 ? 303 VAL B N     1 
ATOM   2746 C  CA    . VAL B 1 143 ? 20.108  35.500 -33.901 1.00 31.10 ? 303 VAL B CA    1 
ATOM   2747 C  C     . VAL B 1 143 ? 21.533  35.646 -34.409 1.00 37.85 ? 303 VAL B C     1 
ATOM   2748 O  O     . VAL B 1 143 ? 22.268  36.524 -33.962 1.00 39.46 ? 303 VAL B O     1 
ATOM   2749 C  CB    . VAL B 1 143 ? 19.254  36.655 -34.452 1.00 28.83 ? 303 VAL B CB    1 
ATOM   2750 C  CG1   . VAL B 1 143 ? 19.261  36.647 -35.978 1.00 28.43 ? 303 VAL B CG1   1 
ATOM   2751 C  CG2   . VAL B 1 143 ? 17.829  36.566 -33.915 1.00 28.29 ? 303 VAL B CG2   1 
ATOM   2752 N  N     . THR B 1 144 ? 21.924  34.768 -35.326 1.00 39.50 ? 304 THR B N     1 
ATOM   2753 C  CA    . THR B 1 144 ? 23.230  34.855 -35.956 1.00 42.17 ? 304 THR B CA    1 
ATOM   2754 C  C     . THR B 1 144 ? 23.178  35.864 -37.096 1.00 39.45 ? 304 THR B C     1 
ATOM   2755 O  O     . THR B 1 144 ? 22.488  35.648 -38.093 1.00 38.99 ? 304 THR B O     1 
ATOM   2756 C  CB    . THR B 1 144 ? 23.673  33.494 -36.519 1.00 46.01 ? 304 THR B CB    1 
ATOM   2757 O  OG1   . THR B 1 144 ? 23.647  32.512 -35.477 1.00 48.52 ? 304 THR B OG1   1 
ATOM   2758 C  CG2   . THR B 1 144 ? 25.078  33.588 -37.098 1.00 47.82 ? 304 THR B CG2   1 
ATOM   2759 N  N     . VAL B 1 145 ? 23.891  36.974 -36.935 1.00 36.89 ? 305 VAL B N     1 
ATOM   2760 C  CA    . VAL B 1 145 ? 23.997  37.970 -37.996 1.00 35.95 ? 305 VAL B CA    1 
ATOM   2761 C  C     . VAL B 1 145 ? 25.455  38.142 -38.381 1.00 38.01 ? 305 VAL B C     1 
ATOM   2762 O  O     . VAL B 1 145 ? 26.244  38.692 -37.616 1.00 38.14 ? 305 VAL B O     1 
ATOM   2763 C  CB    . VAL B 1 145 ? 23.441  39.337 -37.572 1.00 34.00 ? 305 VAL B CB    1 
ATOM   2764 C  CG1   . VAL B 1 145 ? 23.509  40.313 -38.738 1.00 35.39 ? 305 VAL B CG1   1 
ATOM   2765 C  CG2   . VAL B 1 145 ? 22.013  39.200 -37.071 1.00 32.27 ? 305 VAL B CG2   1 
ATOM   2766 N  N     . ARG B 1 146 ? 25.807  37.665 -39.567 1.00 39.17 ? 306 ARG B N     1 
ATOM   2767 C  CA    . ARG B 1 146 ? 27.189  37.693 -40.018 1.00 44.16 ? 306 ARG B CA    1 
ATOM   2768 C  C     . ARG B 1 146 ? 27.663  39.121 -40.254 1.00 39.96 ? 306 ARG B C     1 
ATOM   2769 O  O     . ARG B 1 146 ? 26.858  40.010 -40.534 1.00 35.52 ? 306 ARG B O     1 
ATOM   2770 C  CB    . ARG B 1 146 ? 27.338  36.869 -41.295 1.00 50.99 ? 306 ARG B CB    1 
ATOM   2771 C  CG    . ARG B 1 146 ? 26.833  35.450 -41.140 1.00 57.77 ? 306 ARG B CG    1 
ATOM   2772 C  CD    . ARG B 1 146 ? 27.200  34.580 -42.328 1.00 65.61 ? 306 ARG B CD    1 
ATOM   2773 N  NE    . ARG B 1 146 ? 27.253  33.171 -41.948 1.00 70.36 ? 306 ARG B NE    1 
ATOM   2774 C  CZ    . ARG B 1 146 ? 26.187  32.383 -41.844 1.00 71.32 ? 306 ARG B CZ    1 
ATOM   2775 N  NH1   . ARG B 1 146 ? 24.977  32.863 -42.098 1.00 68.30 ? 306 ARG B NH1   1 
ATOM   2776 N  NH2   . ARG B 1 146 ? 26.331  31.113 -41.487 1.00 74.76 ? 306 ARG B NH2   1 
ATOM   2777 N  N     . ASP B 1 147 ? 28.967  39.335 -40.112 1.00 39.17 ? 307 ASP B N     1 
ATOM   2778 C  CA    . ASP B 1 147 ? 29.573  40.611 -40.464 1.00 41.00 ? 307 ASP B CA    1 
ATOM   2779 C  C     . ASP B 1 147 ? 29.584  40.734 -41.980 1.00 39.06 ? 307 ASP B C     1 
ATOM   2780 O  O     . ASP B 1 147 ? 29.403  39.742 -42.686 1.00 38.39 ? 307 ASP B O     1 
ATOM   2781 C  CB    . ASP B 1 147 ? 31.004  40.699 -39.927 1.00 48.16 ? 307 ASP B CB    1 
ATOM   2782 C  CG    . ASP B 1 147 ? 31.071  40.586 -38.413 1.00 56.64 ? 307 ASP B CG    1 
ATOM   2783 O  OD1   . ASP B 1 147 ? 30.123  41.039 -37.735 1.00 57.28 ? 307 ASP B OD1   1 
ATOM   2784 O  OD2   . ASP B 1 147 ? 32.074  40.044 -37.899 1.00 62.14 ? 307 ASP B OD2   1 
ATOM   2785 N  N     . GLY B 1 148 ? 29.788  41.949 -42.481 1.00 34.66 ? 308 GLY B N     1 
ATOM   2786 C  CA    . GLY B 1 148 ? 29.857  42.172 -43.912 1.00 34.89 ? 308 GLY B CA    1 
ATOM   2787 C  C     . GLY B 1 148 ? 28.497  42.289 -44.585 1.00 32.04 ? 308 GLY B C     1 
ATOM   2788 O  O     . GLY B 1 148 ? 28.407  42.266 -45.810 1.00 32.34 ? 308 GLY B O     1 
ATOM   2789 N  N     . MET B 1 149 ? 27.441  42.409 -43.787 1.00 33.12 ? 309 MET B N     1 
ATOM   2790 C  CA    . MET B 1 149 ? 26.087  42.601 -44.322 1.00 36.06 ? 309 MET B CA    1 
ATOM   2791 C  C     . MET B 1 149 ? 25.939  43.763 -45.317 1.00 37.03 ? 309 MET B C     1 
ATOM   2792 O  O     . MET B 1 149 ? 25.305  43.592 -46.358 1.00 36.32 ? 309 MET B O     1 
ATOM   2793 C  CB    . MET B 1 149 ? 25.054  42.736 -43.195 1.00 35.13 ? 309 MET B CB    1 
ATOM   2794 C  CG    . MET B 1 149 ? 24.677  41.435 -42.516 1.00 37.80 ? 309 MET B CG    1 
ATOM   2795 S  SD    . MET B 1 149 ? 24.028  40.206 -43.666 1.00 51.73 ? 309 MET B SD    1 
ATOM   2796 C  CE    . MET B 1 149 ? 25.399  39.047 -43.720 1.00 46.65 ? 309 MET B CE    1 
ATOM   2797 N  N     . PRO B 1 150 ? 26.512  44.947 -45.009 1.00 40.12 ? 310 PRO B N     1 
ATOM   2798 C  CA    . PRO B 1 150 ? 26.371  46.041 -45.979 1.00 38.39 ? 310 PRO B CA    1 
ATOM   2799 C  C     . PRO B 1 150 ? 26.916  45.691 -47.365 1.00 39.70 ? 310 PRO B C     1 
ATOM   2800 O  O     . PRO B 1 150 ? 26.400  46.196 -48.364 1.00 38.76 ? 310 PRO B O     1 
ATOM   2801 C  CB    . PRO B 1 150 ? 27.206  47.165 -45.360 1.00 42.53 ? 310 PRO B CB    1 
ATOM   2802 C  CG    . PRO B 1 150 ? 27.181  46.885 -43.900 1.00 43.58 ? 310 PRO B CG    1 
ATOM   2803 C  CD    . PRO B 1 150 ? 27.216  45.393 -43.789 1.00 42.34 ? 310 PRO B CD    1 
ATOM   2804 N  N     . GLU B 1 151 ? 27.933  44.834 -47.421 1.00 37.31 ? 311 GLU B N     1 
ATOM   2805 C  CA    . GLU B 1 151 ? 28.521  44.423 -48.694 1.00 41.63 ? 311 GLU B CA    1 
ATOM   2806 C  C     . GLU B 1 151 ? 27.506  43.727 -49.593 1.00 36.18 ? 311 GLU B C     1 
ATOM   2807 O  O     . GLU B 1 151 ? 27.536  43.894 -50.812 1.00 33.63 ? 311 GLU B O     1 
ATOM   2808 C  CB    . GLU B 1 151 ? 29.720  43.502 -48.468 1.00 50.25 ? 311 GLU B CB    1 
ATOM   2809 C  CG    . GLU B 1 151 ? 30.778  44.082 -47.550 1.00 58.81 ? 311 GLU B CG    1 
ATOM   2810 C  CD    . GLU B 1 151 ? 31.307  45.416 -48.036 1.00 65.72 ? 311 GLU B CD    1 
ATOM   2811 O  OE1   . GLU B 1 151 ? 31.575  45.549 -49.252 1.00 67.78 ? 311 GLU B OE1   1 
ATOM   2812 O  OE2   . GLU B 1 151 ? 31.450  46.335 -47.199 1.00 68.35 ? 311 GLU B OE2   1 
ATOM   2813 N  N     . LEU B 1 152 ? 26.615  42.947 -48.984 1.00 33.30 ? 312 LEU B N     1 
ATOM   2814 C  CA    . LEU B 1 152 ? 25.594  42.217 -49.730 1.00 32.54 ? 312 LEU B CA    1 
ATOM   2815 C  C     . LEU B 1 152 ? 24.688  43.156 -50.512 1.00 30.99 ? 312 LEU B C     1 
ATOM   2816 O  O     . LEU B 1 152 ? 24.151  42.791 -51.556 1.00 34.33 ? 312 LEU B O     1 
ATOM   2817 C  CB    . LEU B 1 152 ? 24.744  41.355 -48.794 1.00 29.72 ? 312 LEU B CB    1 
ATOM   2818 C  CG    . LEU B 1 152 ? 25.465  40.252 -48.022 1.00 33.37 ? 312 LEU B CG    1 
ATOM   2819 C  CD1   . LEU B 1 152 ? 24.447  39.446 -47.241 1.00 34.46 ? 312 LEU B CD1   1 
ATOM   2820 C  CD2   . LEU B 1 152 ? 26.257  39.364 -48.965 1.00 35.52 ? 312 LEU B CD2   1 
ATOM   2821 N  N     . LEU B 1 153 ? 24.524  44.370 -50.005 1.00 29.76 ? 313 LEU B N     1 
ATOM   2822 C  CA    . LEU B 1 153 ? 23.659  45.339 -50.663 1.00 29.38 ? 313 LEU B CA    1 
ATOM   2823 C  C     . LEU B 1 153 ? 24.255  45.820 -51.984 1.00 30.69 ? 313 LEU B C     1 
ATOM   2824 O  O     . LEU B 1 153 ? 23.547  46.389 -52.809 1.00 31.09 ? 313 LEU B O     1 
ATOM   2825 C  CB    . LEU B 1 153 ? 23.368  46.523 -49.740 1.00 25.76 ? 313 LEU B CB    1 
ATOM   2826 C  CG    . LEU B 1 153 ? 22.610  46.223 -48.446 1.00 25.36 ? 313 LEU B CG    1 
ATOM   2827 C  CD1   . LEU B 1 153 ? 22.459  47.487 -47.618 1.00 25.78 ? 313 LEU B CD1   1 
ATOM   2828 C  CD2   . LEU B 1 153 ? 21.253  45.616 -48.740 1.00 24.55 ? 313 LEU B CD2   1 
ATOM   2829 N  N     . LYS B 1 154 ? 25.551  45.582 -52.179 1.00 30.22 ? 314 LYS B N     1 
ATOM   2830 C  CA    . LYS B 1 154 ? 26.249  46.015 -53.392 1.00 32.71 ? 314 LYS B CA    1 
ATOM   2831 C  C     . LYS B 1 154 ? 26.390  44.905 -54.434 1.00 32.93 ? 314 LYS B C     1 
ATOM   2832 O  O     . LYS B 1 154 ? 27.019  45.102 -55.480 1.00 35.16 ? 314 LYS B O     1 
ATOM   2833 C  CB    . LYS B 1 154 ? 27.641  46.543 -53.048 1.00 39.17 ? 314 LYS B CB    1 
ATOM   2834 C  CG    . LYS B 1 154 ? 27.663  47.777 -52.165 1.00 42.49 ? 314 LYS B CG    1 
ATOM   2835 C  CD    . LYS B 1 154 ? 29.094  48.260 -51.984 1.00 47.08 ? 314 LYS B CD    1 
ATOM   2836 C  CE    . LYS B 1 154 ? 29.290  48.928 -50.637 1.00 50.05 ? 314 LYS B CE    1 
ATOM   2837 N  NZ    . LYS B 1 154 ? 30.738  49.169 -50.359 1.00 54.36 ? 314 LYS B NZ    1 
ATOM   2838 N  N     . LEU B 1 155 ? 25.821  43.740 -54.146 1.00 33.48 ? 315 LEU B N     1 
ATOM   2839 C  CA    . LEU B 1 155 ? 25.903  42.603 -55.057 1.00 34.55 ? 315 LEU B CA    1 
ATOM   2840 C  C     . LEU B 1 155 ? 25.252  42.911 -56.398 1.00 33.30 ? 315 LEU B C     1 
ATOM   2841 O  O     . LEU B 1 155 ? 24.251  43.624 -56.452 1.00 31.50 ? 315 LEU B O     1 
ATOM   2842 C  CB    . LEU B 1 155 ? 25.225  41.381 -54.440 1.00 33.52 ? 315 LEU B CB    1 
ATOM   2843 C  CG    . LEU B 1 155 ? 26.024  40.617 -53.391 1.00 36.74 ? 315 LEU B CG    1 
ATOM   2844 C  CD1   . LEU B 1 155 ? 25.226  39.425 -52.900 1.00 39.25 ? 315 LEU B CD1   1 
ATOM   2845 C  CD2   . LEU B 1 155 ? 27.361  40.179 -53.963 1.00 40.10 ? 315 LEU B CD2   1 
ATOM   2846 N  N     . PRO B 1 156 ? 25.821  42.374 -57.490 1.00 34.59 ? 316 PRO B N     1 
ATOM   2847 C  CA    . PRO B 1 156 ? 25.195  42.526 -58.807 1.00 35.53 ? 316 PRO B CA    1 
ATOM   2848 C  C     . PRO B 1 156 ? 23.764  42.006 -58.781 1.00 32.91 ? 316 PRO B C     1 
ATOM   2849 O  O     . PRO B 1 156 ? 23.470  41.070 -58.037 1.00 32.33 ? 316 PRO B O     1 
ATOM   2850 C  CB    . PRO B 1 156 ? 26.066  41.643 -59.709 1.00 38.69 ? 316 PRO B CB    1 
ATOM   2851 C  CG    . PRO B 1 156 ? 27.402  41.640 -59.042 1.00 39.89 ? 316 PRO B CG    1 
ATOM   2852 C  CD    . PRO B 1 156 ? 27.102  41.650 -57.565 1.00 36.97 ? 316 PRO B CD    1 
ATOM   2853 N  N     . LEU B 1 157 ? 22.889  42.617 -59.573 1.00 30.29 ? 317 LEU B N     1 
ATOM   2854 C  CA    . LEU B 1 157 ? 21.474  42.268 -59.566 1.00 31.14 ? 317 LEU B CA    1 
ATOM   2855 C  C     . LEU B 1 157 ? 21.252  40.855 -60.084 1.00 32.58 ? 317 LEU B C     1 
ATOM   2856 O  O     . LEU B 1 157 ? 21.743  40.491 -61.150 1.00 35.11 ? 317 LEU B O     1 
ATOM   2857 C  CB    . LEU B 1 157 ? 20.680  43.265 -60.412 1.00 30.75 ? 317 LEU B CB    1 
ATOM   2858 C  CG    . LEU B 1 157 ? 20.644  44.711 -59.908 1.00 29.46 ? 317 LEU B CG    1 
ATOM   2859 C  CD1   . LEU B 1 157 ? 20.081  45.618 -60.981 1.00 30.43 ? 317 LEU B CD1   1 
ATOM   2860 C  CD2   . LEU B 1 157 ? 19.830  44.834 -58.629 1.00 29.00 ? 317 LEU B CD2   1 
ATOM   2861 N  N     . ARG B 1 158 ? 20.517  40.056 -59.318 1.00 31.02 ? 318 ARG B N     1 
ATOM   2862 C  CA    . ARG B 1 158 ? 20.190  38.706 -59.748 1.00 32.50 ? 318 ARG B CA    1 
ATOM   2863 C  C     . ARG B 1 158 ? 18.708  38.426 -59.539 1.00 32.95 ? 318 ARG B C     1 
ATOM   2864 O  O     . ARG B 1 158 ? 18.166  38.700 -58.466 1.00 31.12 ? 318 ARG B O     1 
ATOM   2865 C  CB    . ARG B 1 158 ? 21.029  37.680 -58.990 1.00 38.75 ? 318 ARG B CB    1 
ATOM   2866 C  CG    . ARG B 1 158 ? 20.853  36.270 -59.515 1.00 45.22 ? 318 ARG B CG    1 
ATOM   2867 C  CD    . ARG B 1 158 ? 21.499  35.227 -58.620 1.00 49.72 ? 318 ARG B CD    1 
ATOM   2868 N  NE    . ARG B 1 158 ? 22.950  35.365 -58.542 1.00 53.62 ? 318 ARG B NE    1 
ATOM   2869 C  CZ    . ARG B 1 158 ? 23.796  34.950 -59.482 1.00 57.21 ? 318 ARG B CZ    1 
ATOM   2870 N  NH1   . ARG B 1 158 ? 23.339  34.385 -60.591 1.00 58.23 ? 318 ARG B NH1   1 
ATOM   2871 N  NH2   . ARG B 1 158 ? 25.101  35.112 -59.316 1.00 58.97 ? 318 ARG B NH2   1 
ATOM   2872 N  N     . CYS B 1 159 ? 18.056  37.883 -60.563 1.00 32.63 ? 319 CYS B N     1 
ATOM   2873 C  CA    . CYS B 1 159 ? 16.645  37.521 -60.458 1.00 34.02 ? 319 CYS B CA    1 
ATOM   2874 C  C     . CYS B 1 159 ? 16.434  36.501 -59.349 1.00 32.63 ? 319 CYS B C     1 
ATOM   2875 O  O     . CYS B 1 159 ? 17.233  35.583 -59.180 1.00 35.14 ? 319 CYS B O     1 
ATOM   2876 C  CB    . CYS B 1 159 ? 16.115  36.962 -61.779 1.00 36.34 ? 319 CYS B CB    1 
ATOM   2877 S  SG    . CYS B 1 159 ? 14.343  36.593 -61.725 1.00 35.20 ? 319 CYS B SG    1 
ATOM   2878 N  N     . HIS B 1 160 ? 15.360  36.666 -58.588 1.00 32.56 ? 320 HIS B N     1 
ATOM   2879 C  CA    . HIS B 1 160 ? 15.078  35.762 -57.480 1.00 34.56 ? 320 HIS B CA    1 
ATOM   2880 C  C     . HIS B 1 160 ? 14.370  34.493 -57.945 1.00 35.48 ? 320 HIS B C     1 
ATOM   2881 O  O     . HIS B 1 160 ? 14.322  33.498 -57.221 1.00 37.78 ? 320 HIS B O     1 
ATOM   2882 C  CB    . HIS B 1 160 ? 14.244  36.472 -56.412 1.00 34.84 ? 320 HIS B CB    1 
ATOM   2883 C  CG    . HIS B 1 160 ? 12.863  36.840 -56.864 1.00 34.37 ? 320 HIS B CG    1 
ATOM   2884 N  ND1   . HIS B 1 160 ? 12.618  37.537 -58.028 1.00 30.71 ? 320 HIS B ND1   1 
ATOM   2885 C  CD2   . HIS B 1 160 ? 11.653  36.619 -56.296 1.00 35.14 ? 320 HIS B CD2   1 
ATOM   2886 C  CE1   . HIS B 1 160 ? 11.316  37.721 -58.162 1.00 31.25 ? 320 HIS B CE1   1 
ATOM   2887 N  NE2   . HIS B 1 160 ? 10.709  37.177 -57.122 1.00 31.79 ? 320 HIS B NE2   1 
ATOM   2888 N  N     . GLU B 1 161 ? 13.830  34.527 -59.158 1.00 35.88 ? 321 GLU B N     1 
ATOM   2889 C  CA    . GLU B 1 161 ? 13.097  33.382 -59.698 1.00 42.60 ? 321 GLU B CA    1 
ATOM   2890 C  C     . GLU B 1 161 ? 13.978  32.411 -60.492 1.00 44.13 ? 321 GLU B C     1 
ATOM   2891 O  O     . GLU B 1 161 ? 13.884  31.194 -60.312 1.00 45.40 ? 321 GLU B O     1 
ATOM   2892 C  CB    . GLU B 1 161 ? 11.921  33.852 -60.566 1.00 45.13 ? 321 GLU B CB    1 
ATOM   2893 C  CG    . GLU B 1 161 ? 10.851  34.639 -59.813 1.00 47.22 ? 321 GLU B CG    1 
ATOM   2894 C  CD    . GLU B 1 161 ? 9.965   33.757 -58.946 1.00 52.88 ? 321 GLU B CD    1 
ATOM   2895 O  OE1   . GLU B 1 161 ? 10.003  32.517 -59.115 1.00 55.31 ? 321 GLU B OE1   1 
ATOM   2896 O  OE2   . GLU B 1 161 ? 9.228   34.309 -58.097 1.00 53.38 ? 321 GLU B OE2   1 
ATOM   2897 N  N     . CYS B 1 162 ? 14.827  32.944 -61.368 1.00 41.40 ? 322 CYS B N     1 
ATOM   2898 C  CA    . CYS B 1 162 ? 15.647  32.101 -62.240 1.00 45.68 ? 322 CYS B CA    1 
ATOM   2899 C  C     . CYS B 1 162 ? 17.149  32.367 -62.122 1.00 45.79 ? 322 CYS B C     1 
ATOM   2900 O  O     . CYS B 1 162 ? 17.949  31.746 -62.823 1.00 47.45 ? 322 CYS B O     1 
ATOM   2901 C  CB    . CYS B 1 162 ? 15.213  32.256 -63.699 1.00 46.00 ? 322 CYS B CB    1 
ATOM   2902 S  SG    . CYS B 1 162 ? 15.618  33.864 -64.410 1.00 42.64 ? 322 CYS B SG    1 
ATOM   2903 N  N     . GLN B 1 163 ? 17.517  33.301 -61.249 1.00 42.33 ? 323 GLN B N     1 
ATOM   2904 C  CA    . GLN B 1 163 ? 18.921  33.609 -60.950 1.00 43.75 ? 323 GLN B CA    1 
ATOM   2905 C  C     . GLN B 1 163 ? 19.715  34.191 -62.117 1.00 44.03 ? 323 GLN B C     1 
ATOM   2906 O  O     . GLN B 1 163 ? 20.945  34.157 -62.114 1.00 45.23 ? 323 GLN B O     1 
ATOM   2907 C  CB    . GLN B 1 163 ? 19.657  32.398 -60.357 1.00 48.48 ? 323 GLN B CB    1 
ATOM   2908 C  CG    . GLN B 1 163 ? 19.237  32.030 -58.938 1.00 50.25 ? 323 GLN B CG    1 
ATOM   2909 C  CD    . GLN B 1 163 ? 17.861  31.389 -58.878 1.00 55.04 ? 323 GLN B CD    1 
ATOM   2910 O  OE1   . GLN B 1 163 ? 17.540  30.507 -59.675 1.00 59.25 ? 323 GLN B OE1   1 
ATOM   2911 N  NE2   . GLN B 1 163 ? 17.037  31.840 -57.937 1.00 53.54 ? 323 GLN B NE2   1 
ATOM   2912 N  N     . GLN B 1 164 ? 19.014  34.731 -63.106 1.00 44.73 ? 324 GLN B N     1 
ATOM   2913 C  CA    . GLN B 1 164 ? 19.676  35.428 -64.200 1.00 46.82 ? 324 GLN B CA    1 
ATOM   2914 C  C     . GLN B 1 164 ? 20.316  36.714 -63.678 1.00 43.33 ? 324 GLN B C     1 
ATOM   2915 O  O     . GLN B 1 164 ? 19.755  37.386 -62.809 1.00 35.17 ? 324 GLN B O     1 
ATOM   2916 C  CB    . GLN B 1 164 ? 18.670  35.744 -65.309 1.00 51.22 ? 324 GLN B CB    1 
ATOM   2917 C  CG    . GLN B 1 164 ? 19.269  36.445 -66.520 1.00 58.52 ? 324 GLN B CG    1 
ATOM   2918 C  CD    . GLN B 1 164 ? 18.251  36.673 -67.623 1.00 63.44 ? 324 GLN B CD    1 
ATOM   2919 O  OE1   . GLN B 1 164 ? 17.453  35.790 -67.940 1.00 65.46 ? 324 GLN B OE1   1 
ATOM   2920 N  NE2   . GLN B 1 164 ? 18.271  37.865 -68.211 1.00 64.09 ? 324 GLN B NE2   1 
ATOM   2921 N  N     . LEU B 1 165 ? 21.497  37.046 -64.189 1.00 43.73 ? 325 LEU B N     1 
ATOM   2922 C  CA    . LEU B 1 165 ? 22.138  38.310 -63.838 1.00 40.66 ? 325 LEU B CA    1 
ATOM   2923 C  C     . LEU B 1 165 ? 21.641  39.436 -64.742 1.00 39.58 ? 325 LEU B C     1 
ATOM   2924 O  O     . LEU B 1 165 ? 21.606  39.292 -65.963 1.00 41.14 ? 325 LEU B O     1 
ATOM   2925 C  CB    . LEU B 1 165 ? 23.662  38.195 -63.921 1.00 44.54 ? 325 LEU B CB    1 
ATOM   2926 C  CG    . LEU B 1 165 ? 24.371  37.370 -62.845 1.00 48.47 ? 325 LEU B CG    1 
ATOM   2927 C  CD1   . LEU B 1 165 ? 25.857  37.243 -63.161 1.00 54.05 ? 325 LEU B CD1   1 
ATOM   2928 C  CD2   . LEU B 1 165 ? 24.165  37.981 -61.462 1.00 47.86 ? 325 LEU B CD2   1 
ATOM   2929 N  N     . LEU B 1 166 ? 21.243  40.549 -64.133 1.00 36.93 ? 326 LEU B N     1 
ATOM   2930 C  CA    . LEU B 1 166 ? 20.782  41.717 -64.878 1.00 38.54 ? 326 LEU B CA    1 
ATOM   2931 C  C     . LEU B 1 166 ? 21.692  42.914 -64.601 1.00 37.33 ? 326 LEU B C     1 
ATOM   2932 O  O     . LEU B 1 166 ? 22.129  43.119 -63.467 1.00 36.49 ? 326 LEU B O     1 
ATOM   2933 C  CB    . LEU B 1 166 ? 19.329  42.055 -64.522 1.00 37.60 ? 326 LEU B CB    1 
ATOM   2934 C  CG    . LEU B 1 166 ? 18.203  41.294 -65.238 1.00 39.30 ? 326 LEU B CG    1 
ATOM   2935 C  CD1   . LEU B 1 166 ? 18.398  41.318 -66.746 1.00 44.00 ? 326 LEU B CD1   1 
ATOM   2936 C  CD2   . LEU B 1 166 ? 18.066  39.865 -64.730 1.00 41.46 ? 326 LEU B CD2   1 
ATOM   2937 N  N     . PRO B 1 167 ? 21.982  43.712 -65.637 1.00 38.11 ? 327 PRO B N     1 
ATOM   2938 C  CA    . PRO B 1 167 ? 22.981  44.775 -65.491 1.00 39.80 ? 327 PRO B CA    1 
ATOM   2939 C  C     . PRO B 1 167 ? 22.429  46.094 -64.961 1.00 36.42 ? 327 PRO B C     1 
ATOM   2940 O  O     . PRO B 1 167 ? 23.214  47.007 -64.714 1.00 38.80 ? 327 PRO B O     1 
ATOM   2941 C  CB    . PRO B 1 167 ? 23.499  44.955 -66.918 1.00 43.66 ? 327 PRO B CB    1 
ATOM   2942 C  CG    . PRO B 1 167 ? 22.323  44.610 -67.773 1.00 44.78 ? 327 PRO B CG    1 
ATOM   2943 C  CD    . PRO B 1 167 ? 21.542  43.552 -67.036 1.00 41.59 ? 327 PRO B CD    1 
ATOM   2944 N  N     . SER B 1 168 ? 21.116  46.200 -64.787 1.00 29.59 ? 328 SER B N     1 
ATOM   2945 C  CA    . SER B 1 168 ? 20.532  47.449 -64.311 1.00 30.10 ? 328 SER B CA    1 
ATOM   2946 C  C     . SER B 1 168 ? 19.126  47.261 -63.761 1.00 27.92 ? 328 SER B C     1 
ATOM   2947 O  O     . SER B 1 168 ? 18.445  46.282 -64.073 1.00 27.11 ? 328 SER B O     1 
ATOM   2948 C  CB    . SER B 1 168 ? 20.516  48.501 -65.429 1.00 33.83 ? 328 SER B CB    1 
ATOM   2949 O  OG    . SER B 1 168 ? 19.509  48.221 -66.387 1.00 34.43 ? 328 SER B OG    1 
ATOM   2950 N  N     . ILE B 1 169 ? 18.704  48.206 -62.927 1.00 27.24 ? 329 ILE B N     1 
ATOM   2951 C  CA    . ILE B 1 169 ? 17.349  48.213 -62.388 1.00 27.99 ? 329 ILE B CA    1 
ATOM   2952 C  C     . ILE B 1 169 ? 16.267  48.251 -63.483 1.00 27.53 ? 329 ILE B C     1 
ATOM   2953 O  O     . ILE B 1 169 ? 15.328  47.458 -63.428 1.00 28.14 ? 329 ILE B O     1 
ATOM   2954 C  CB    . ILE B 1 169 ? 17.150  49.340 -61.326 1.00 25.08 ? 329 ILE B CB    1 
ATOM   2955 C  CG1   . ILE B 1 169 ? 17.910  49.004 -60.039 1.00 24.30 ? 329 ILE B CG1   1 
ATOM   2956 C  CG2   . ILE B 1 169 ? 15.671  49.555 -61.022 1.00 26.64 ? 329 ILE B CG2   1 
ATOM   2957 C  CD1   . ILE B 1 169 ? 17.371  47.777 -59.291 1.00 25.23 ? 329 ILE B CD1   1 
ATOM   2958 N  N     . PRO B 1 170 ? 16.399  49.145 -64.490 1.00 30.50 ? 330 PRO B N     1 
ATOM   2959 C  CA    . PRO B 1 170 ? 15.395  49.115 -65.567 1.00 31.35 ? 330 PRO B CA    1 
ATOM   2960 C  C     . PRO B 1 170 ? 15.313  47.763 -66.279 1.00 31.22 ? 330 PRO B C     1 
ATOM   2961 O  O     . PRO B 1 170 ? 14.208  47.312 -66.588 1.00 28.40 ? 330 PRO B O     1 
ATOM   2962 C  CB    . PRO B 1 170 ? 15.895  50.184 -66.542 1.00 34.53 ? 330 PRO B CB    1 
ATOM   2963 C  CG    . PRO B 1 170 ? 16.670  51.119 -65.691 1.00 34.65 ? 330 PRO B CG    1 
ATOM   2964 C  CD    . PRO B 1 170 ? 17.349  50.259 -64.678 1.00 31.72 ? 330 PRO B CD    1 
ATOM   2965 N  N     . GLN B 1 171 ? 16.455  47.124 -66.522 1.00 27.87 ? 331 GLN B N     1 
ATOM   2966 C  CA    . GLN B 1 171 ? 16.454  45.798 -67.136 1.00 31.93 ? 331 GLN B CA    1 
ATOM   2967 C  C     . GLN B 1 171 ? 15.919  44.719 -66.195 1.00 28.30 ? 331 GLN B C     1 
ATOM   2968 O  O     . GLN B 1 171 ? 15.259  43.785 -66.642 1.00 30.48 ? 331 GLN B O     1 
ATOM   2969 C  CB    . GLN B 1 171 ? 17.838  45.419 -67.671 1.00 35.29 ? 331 GLN B CB    1 
ATOM   2970 C  CG    . GLN B 1 171 ? 18.281  46.262 -68.852 1.00 38.18 ? 331 GLN B CG    1 
ATOM   2971 C  CD    . GLN B 1 171 ? 19.525  45.722 -69.528 1.00 46.11 ? 331 GLN B CD    1 
ATOM   2972 O  OE1   . GLN B 1 171 ? 19.669  44.513 -69.722 1.00 48.83 ? 331 GLN B OE1   1 
ATOM   2973 N  NE2   . GLN B 1 171 ? 20.436  46.620 -69.894 1.00 47.67 ? 331 GLN B NE2   1 
ATOM   2974 N  N     . LEU B 1 172 ? 16.194  44.849 -64.899 1.00 28.16 ? 332 LEU B N     1 
ATOM   2975 C  CA    . LEU B 1 172 ? 15.626  43.930 -63.913 1.00 28.69 ? 332 LEU B CA    1 
ATOM   2976 C  C     . LEU B 1 172 ? 14.104  44.025 -63.904 1.00 30.42 ? 332 LEU B C     1 
ATOM   2977 O  O     . LEU B 1 172 ? 13.407  43.010 -63.990 1.00 27.83 ? 332 LEU B O     1 
ATOM   2978 C  CB    . LEU B 1 172 ? 16.163  44.210 -62.505 1.00 24.81 ? 332 LEU B CB    1 
ATOM   2979 C  CG    . LEU B 1 172 ? 15.643  43.260 -61.418 1.00 31.58 ? 332 LEU B CG    1 
ATOM   2980 C  CD1   . LEU B 1 172 ? 16.004  41.817 -61.750 1.00 35.26 ? 332 LEU B CD1   1 
ATOM   2981 C  CD2   . LEU B 1 172 ? 16.183  43.631 -60.046 1.00 32.85 ? 332 LEU B CD2   1 
ATOM   2982 N  N     . LYS B 1 173 ? 13.595  45.251 -63.813 1.00 28.68 ? 333 LYS B N     1 
ATOM   2983 C  CA    . LYS B 1 173 ? 12.158  45.472 -63.717 1.00 34.05 ? 333 LYS B CA    1 
ATOM   2984 C  C     . LYS B 1 173 ? 11.442  44.954 -64.955 1.00 36.13 ? 333 LYS B C     1 
ATOM   2985 O  O     . LYS B 1 173 ? 10.313  44.474 -64.872 1.00 37.70 ? 333 LYS B O     1 
ATOM   2986 C  CB    . LYS B 1 173 ? 11.846  46.951 -63.454 1.00 35.03 ? 333 LYS B CB    1 
ATOM   2987 C  CG    . LYS B 1 173 ? 12.210  47.394 -62.037 1.00 33.89 ? 333 LYS B CG    1 
ATOM   2988 C  CD    . LYS B 1 173 ? 12.229  48.910 -61.870 1.00 36.17 ? 333 LYS B CD    1 
ATOM   2989 C  CE    . LYS B 1 173 ? 10.848  49.492 -61.611 1.00 37.80 ? 333 LYS B CE    1 
ATOM   2990 N  NZ    . LYS B 1 173 ? 10.306  49.104 -60.272 1.00 32.50 ? 333 LYS B NZ    1 
ATOM   2991 N  N     . GLU B 1 174 ? 12.115  45.033 -66.097 1.00 38.66 ? 334 GLU B N     1 
ATOM   2992 C  CA    . GLU B 1 174 ? 11.598  44.462 -67.332 1.00 42.26 ? 334 GLU B CA    1 
ATOM   2993 C  C     . GLU B 1 174 ? 11.631  42.935 -67.293 1.00 38.68 ? 334 GLU B C     1 
ATOM   2994 O  O     . GLU B 1 174 ? 10.686  42.272 -67.723 1.00 37.94 ? 334 GLU B O     1 
ATOM   2995 C  CB    . GLU B 1 174 ? 12.406  44.974 -68.529 1.00 50.02 ? 334 GLU B CB    1 
ATOM   2996 C  CG    . GLU B 1 174 ? 12.207  44.182 -69.812 1.00 60.40 ? 334 GLU B CG    1 
ATOM   2997 C  CD    . GLU B 1 174 ? 10.861  44.434 -70.467 1.00 67.61 ? 334 GLU B CD    1 
ATOM   2998 O  OE1   . GLU B 1 174 ? 10.587  43.804 -71.511 1.00 72.03 ? 334 GLU B OE1   1 
ATOM   2999 O  OE2   . GLU B 1 174 ? 10.081  45.264 -69.948 1.00 68.67 ? 334 GLU B OE2   1 
ATOM   3000 N  N     . HIS B 1 175 ? 12.728  42.383 -66.782 1.00 35.27 ? 335 HIS B N     1 
ATOM   3001 C  CA    . HIS B 1 175 ? 12.891  40.932 -66.700 1.00 37.31 ? 335 HIS B CA    1 
ATOM   3002 C  C     . HIS B 1 175 ? 11.844  40.287 -65.792 1.00 36.26 ? 335 HIS B C     1 
ATOM   3003 O  O     . HIS B 1 175 ? 11.345  39.205 -66.088 1.00 40.86 ? 335 HIS B O     1 
ATOM   3004 C  CB    . HIS B 1 175 ? 14.296  40.572 -66.205 1.00 37.05 ? 335 HIS B CB    1 
ATOM   3005 C  CG    . HIS B 1 175 ? 14.493  39.106 -65.958 1.00 38.43 ? 335 HIS B CG    1 
ATOM   3006 N  ND1   . HIS B 1 175 ? 14.926  38.239 -66.938 1.00 43.84 ? 335 HIS B ND1   1 
ATOM   3007 C  CD2   . HIS B 1 175 ? 14.311  38.355 -64.846 1.00 37.18 ? 335 HIS B CD2   1 
ATOM   3008 C  CE1   . HIS B 1 175 ? 15.006  37.018 -66.440 1.00 44.87 ? 335 HIS B CE1   1 
ATOM   3009 N  NE2   . HIS B 1 175 ? 14.637  37.060 -65.172 1.00 41.07 ? 335 HIS B NE2   1 
ATOM   3010 N  N     . LEU B 1 176 ? 11.521  40.958 -64.689 1.00 36.06 ? 336 LEU B N     1 
ATOM   3011 C  CA    . LEU B 1 176 ? 10.585  40.425 -63.702 1.00 38.38 ? 336 LEU B CA    1 
ATOM   3012 C  C     . LEU B 1 176 ? 9.177   40.225 -64.264 1.00 43.03 ? 336 LEU B C     1 
ATOM   3013 O  O     . LEU B 1 176 ? 8.412   39.412 -63.746 1.00 43.39 ? 336 LEU B O     1 
ATOM   3014 C  CB    . LEU B 1 176 ? 10.537  41.322 -62.462 1.00 35.15 ? 336 LEU B CB    1 
ATOM   3015 C  CG    . LEU B 1 176 ? 11.817  41.358 -61.627 1.00 34.70 ? 336 LEU B CG    1 
ATOM   3016 C  CD1   . LEU B 1 176 ? 11.684  42.344 -60.475 1.00 33.51 ? 336 LEU B CD1   1 
ATOM   3017 C  CD2   . LEU B 1 176 ? 12.169  39.962 -61.113 1.00 36.75 ? 336 LEU B CD2   1 
ATOM   3018 N  N     . ARG B 1 177 ? 8.842   40.961 -65.320 1.00 44.98 ? 337 ARG B N     1 
ATOM   3019 C  CA    A ARG B 1 177 ? 7.532   40.848 -65.957 0.37 48.99 ? 337 ARG B CA    1 
ATOM   3020 C  CA    B ARG B 1 177 ? 7.527   40.843 -65.937 0.63 48.87 ? 337 ARG B CA    1 
ATOM   3021 C  C     . ARG B 1 177 ? 7.295   39.441 -66.496 1.00 52.40 ? 337 ARG B C     1 
ATOM   3022 O  O     . ARG B 1 177 ? 6.162   38.962 -66.537 1.00 54.96 ? 337 ARG B O     1 
ATOM   3023 C  CB    A ARG B 1 177 ? 7.400   41.856 -67.100 0.37 50.84 ? 337 ARG B CB    1 
ATOM   3024 C  CB    B ARG B 1 177 ? 7.344   41.898 -67.032 0.63 51.02 ? 337 ARG B CB    1 
ATOM   3025 C  CG    A ARG B 1 177 ? 7.731   43.287 -66.723 0.37 49.81 ? 337 ARG B CG    1 
ATOM   3026 C  CG    B ARG B 1 177 ? 7.155   43.308 -66.497 0.63 50.72 ? 337 ARG B CG    1 
ATOM   3027 C  CD    A ARG B 1 177 ? 7.364   44.240 -67.848 0.37 53.82 ? 337 ARG B CD    1 
ATOM   3028 C  CD    B ARG B 1 177 ? 6.819   44.294 -67.606 0.63 54.77 ? 337 ARG B CD    1 
ATOM   3029 N  NE    A ARG B 1 177 ? 6.232   45.087 -67.489 0.37 55.66 ? 337 ARG B NE    1 
ATOM   3030 N  NE    B ARG B 1 177 ? 5.687   45.147 -67.251 0.63 56.60 ? 337 ARG B NE    1 
ATOM   3031 C  CZ    A ARG B 1 177 ? 6.348   46.331 -67.037 0.37 54.49 ? 337 ARG B CZ    1 
ATOM   3032 C  CZ    B ARG B 1 177 ? 4.481   45.061 -67.805 0.63 60.41 ? 337 ARG B CZ    1 
ATOM   3033 N  NH1   A ARG B 1 177 ? 7.549   46.875 -66.898 0.37 52.44 ? 337 ARG B NH1   1 
ATOM   3034 N  NH1   B ARG B 1 177 ? 4.246   44.164 -68.754 0.63 63.80 ? 337 ARG B NH1   1 
ATOM   3035 N  NH2   A ARG B 1 177 ? 5.265   47.033 -66.731 0.37 55.88 ? 337 ARG B NH2   1 
ATOM   3036 N  NH2   B ARG B 1 177 ? 3.510   45.877 -67.418 0.63 61.18 ? 337 ARG B NH2   1 
ATOM   3037 N  N     . LYS B 1 178 ? 8.375   38.789 -66.912 1.00 51.53 ? 338 LYS B N     1 
ATOM   3038 C  CA    . LYS B 1 178 ? 8.305   37.447 -67.478 1.00 56.01 ? 338 LYS B CA    1 
ATOM   3039 C  C     . LYS B 1 178 ? 7.860   36.397 -66.458 1.00 55.45 ? 338 LYS B C     1 
ATOM   3040 O  O     . LYS B 1 178 ? 7.355   35.341 -66.833 1.00 58.97 ? 338 LYS B O     1 
ATOM   3041 C  CB    . LYS B 1 178 ? 9.661   37.059 -68.069 1.00 59.40 ? 338 LYS B CB    1 
ATOM   3042 C  CG    . LYS B 1 178 ? 10.196  38.060 -69.086 1.00 64.08 ? 338 LYS B CG    1 
ATOM   3043 C  CD    . LYS B 1 178 ? 11.672  37.823 -69.390 1.00 67.42 ? 338 LYS B CD    1 
ATOM   3044 C  CE    . LYS B 1 178 ? 11.895  36.482 -70.072 1.00 73.97 ? 338 LYS B CE    1 
ATOM   3045 N  NZ    . LYS B 1 178 ? 13.342  36.205 -70.295 1.00 75.81 ? 338 LYS B NZ    1 
ATOM   3046 N  N     . HIS B 1 179 ? 8.046   36.685 -65.173 1.00 51.25 ? 339 HIS B N     1 
ATOM   3047 C  CA    . HIS B 1 179 ? 7.698   35.722 -64.131 1.00 52.86 ? 339 HIS B CA    1 
ATOM   3048 C  C     . HIS B 1 179 ? 6.321   35.974 -63.526 1.00 57.68 ? 339 HIS B C     1 
ATOM   3049 O  O     . HIS B 1 179 ? 5.977   35.396 -62.496 1.00 59.84 ? 339 HIS B O     1 
ATOM   3050 C  CB    . HIS B 1 179 ? 8.757   35.701 -63.026 1.00 47.45 ? 339 HIS B CB    1 
ATOM   3051 C  CG    . HIS B 1 179 ? 10.139  35.412 -63.520 1.00 45.25 ? 339 HIS B CG    1 
ATOM   3052 N  ND1   . HIS B 1 179 ? 10.518  34.175 -63.995 1.00 48.85 ? 339 HIS B ND1   1 
ATOM   3053 C  CD2   . HIS B 1 179 ? 11.235  36.203 -63.612 1.00 43.29 ? 339 HIS B CD2   1 
ATOM   3054 C  CE1   . HIS B 1 179 ? 11.787  34.217 -64.362 1.00 47.15 ? 339 HIS B CE1   1 
ATOM   3055 N  NE2   . HIS B 1 179 ? 12.244  35.436 -64.140 1.00 38.88 ? 339 HIS B NE2   1 
ATOM   3056 N  N     . TRP B 1 180 ? 5.537   36.839 -64.162 1.00 60.86 ? 340 TRP B N     1 
ATOM   3057 C  CA    . TRP B 1 180 ? 4.170   37.083 -63.717 1.00 64.98 ? 340 TRP B CA    1 
ATOM   3058 C  C     . TRP B 1 180 ? 3.202   36.216 -64.517 1.00 68.49 ? 340 TRP B C     1 
ATOM   3059 O  O     . TRP B 1 180 ? 2.362   35.515 -63.952 1.00 70.91 ? 340 TRP B O     1 
ATOM   3060 C  CB    . TRP B 1 180 ? 3.795   38.558 -63.876 1.00 66.62 ? 340 TRP B CB    1 
ATOM   3061 C  CG    . TRP B 1 180 ? 4.736   39.519 -63.210 1.00 65.96 ? 340 TRP B CG    1 
ATOM   3062 C  CD1   . TRP B 1 180 ? 5.690   39.227 -62.277 1.00 65.29 ? 340 TRP B CD1   1 
ATOM   3063 C  CD2   . TRP B 1 180 ? 4.815   40.931 -63.436 1.00 66.13 ? 340 TRP B CD2   1 
ATOM   3064 N  NE1   . TRP B 1 180 ? 6.357   40.372 -61.909 1.00 62.68 ? 340 TRP B NE1   1 
ATOM   3065 C  CE2   . TRP B 1 180 ? 5.838   41.431 -62.607 1.00 62.44 ? 340 TRP B CE2   1 
ATOM   3066 C  CE3   . TRP B 1 180 ? 4.118   41.822 -64.260 1.00 69.06 ? 340 TRP B CE3   1 
ATOM   3067 C  CZ2   . TRP B 1 180 ? 6.182   42.781 -62.578 1.00 62.02 ? 340 TRP B CZ2   1 
ATOM   3068 C  CZ3   . TRP B 1 180 ? 4.459   43.161 -64.228 1.00 67.32 ? 340 TRP B CZ3   1 
ATOM   3069 C  CH2   . TRP B 1 180 ? 5.482   43.628 -63.394 1.00 63.62 ? 340 TRP B CH2   1 
ATOM   3070 O  OP3   . DG  C 2 1   ? 5.762   16.237 -21.684 1.00 29.90 ? 1   DG  D OP3   1 
ATOM   3071 P  P     . DG  C 2 1   ? 5.606   15.653 -20.206 1.00 31.02 ? 1   DG  D P     1 
ATOM   3072 O  OP1   . DG  C 2 1   ? 4.199   15.855 -19.816 1.00 31.07 ? 1   DG  D OP1   1 
ATOM   3073 O  OP2   . DG  C 2 1   ? 6.190   14.293 -20.185 1.00 34.33 ? 1   DG  D OP2   1 
ATOM   3074 O  "O5'" . DG  C 2 1   ? 6.542   16.544 -19.257 1.00 20.97 ? 1   DG  D "O5'" 1 
ATOM   3075 C  "C5'" . DG  C 2 1   ? 6.216   17.912 -19.020 1.00 19.40 ? 1   DG  D "C5'" 1 
ATOM   3076 C  "C4'" . DG  C 2 1   ? 7.502   18.692 -18.873 1.00 18.01 ? 1   DG  D "C4'" 1 
ATOM   3077 O  "O4'" . DG  C 2 1   ? 8.221   18.183 -17.731 1.00 17.55 ? 1   DG  D "O4'" 1 
ATOM   3078 C  "C3'" . DG  C 2 1   ? 8.470   18.497 -20.024 1.00 16.87 ? 1   DG  D "C3'" 1 
ATOM   3079 O  "O3'" . DG  C 2 1   ? 8.190   19.431 -21.041 1.00 17.01 ? 1   DG  D "O3'" 1 
ATOM   3080 C  "C2'" . DG  C 2 1   ? 9.823   18.759 -19.389 1.00 18.39 ? 1   DG  D "C2'" 1 
ATOM   3081 C  "C1'" . DG  C 2 1   ? 9.594   18.074 -18.056 1.00 17.31 ? 1   DG  D "C1'" 1 
ATOM   3082 N  N9    . DG  C 2 1   ? 9.997   16.674 -17.965 1.00 12.48 ? 1   DG  D N9    1 
ATOM   3083 C  C8    . DG  C 2 1   ? 9.208   15.578 -17.702 1.00 12.79 ? 1   DG  D C8    1 
ATOM   3084 N  N7    . DG  C 2 1   ? 9.895   14.468 -17.651 1.00 13.04 ? 1   DG  D N7    1 
ATOM   3085 C  C5    . DG  C 2 1   ? 11.204  14.845 -17.913 1.00 14.38 ? 1   DG  D C5    1 
ATOM   3086 C  C6    . DG  C 2 1   ? 12.387  14.069 -17.996 1.00 14.71 ? 1   DG  D C6    1 
ATOM   3087 O  O6    . DG  C 2 1   ? 12.525  12.846 -17.832 1.00 16.84 ? 1   DG  D O6    1 
ATOM   3088 N  N1    . DG  C 2 1   ? 13.497  14.861 -18.277 1.00 14.88 ? 1   DG  D N1    1 
ATOM   3089 C  C2    . DG  C 2 1   ? 13.468  16.220 -18.460 1.00 14.61 ? 1   DG  D C2    1 
ATOM   3090 N  N2    . DG  C 2 1   ? 14.640  16.800 -18.740 1.00 15.81 ? 1   DG  D N2    1 
ATOM   3091 N  N3    . DG  C 2 1   ? 12.366  16.959 -18.375 1.00 12.67 ? 1   DG  D N3    1 
ATOM   3092 C  C4    . DG  C 2 1   ? 11.278  16.201 -18.118 1.00 13.74 ? 1   DG  D C4    1 
ATOM   3093 P  P     A DT  C 2 2   ? 8.436   19.036 -22.572 0.62 18.15 ? 2   DT  D P     1 
ATOM   3094 P  P     B DT  C 2 2   ? 8.405   19.040 -22.582 0.38 18.69 ? 2   DT  D P     1 
ATOM   3095 O  OP1   A DT  C 2 2   ? 7.880   20.133 -23.397 0.62 20.53 ? 2   DT  D OP1   1 
ATOM   3096 O  OP1   B DT  C 2 2   ? 7.921   20.184 -23.389 0.38 20.13 ? 2   DT  D OP1   1 
ATOM   3097 O  OP2   A DT  C 2 2   ? 7.973   17.641 -22.760 0.62 19.93 ? 2   DT  D OP2   1 
ATOM   3098 O  OP2   B DT  C 2 2   ? 7.846   17.686 -22.798 0.38 19.66 ? 2   DT  D OP2   1 
ATOM   3099 O  "O5'" A DT  C 2 2   ? 10.026  19.024 -22.714 0.62 17.85 ? 2   DT  D "O5'" 1 
ATOM   3100 O  "O5'" B DT  C 2 2   ? 9.991   18.922 -22.742 0.38 17.49 ? 2   DT  D "O5'" 1 
ATOM   3101 C  "C5'" A DT  C 2 2   ? 10.760  20.209 -22.403 0.62 18.11 ? 2   DT  D "C5'" 1 
ATOM   3102 C  "C5'" B DT  C 2 2   ? 10.806  20.092 -22.780 0.38 18.26 ? 2   DT  D "C5'" 1 
ATOM   3103 C  "C4'" A DT  C 2 2   ? 12.246  19.981 -22.555 0.62 19.05 ? 2   DT  D "C4'" 1 
ATOM   3104 C  "C4'" B DT  C 2 2   ? 12.272  19.707 -22.765 0.38 18.72 ? 2   DT  D "C4'" 1 
ATOM   3105 O  "O4'" A DT  C 2 2   ? 12.641  18.814 -21.794 0.62 18.79 ? 2   DT  D "O4'" 1 
ATOM   3106 O  "O4'" B DT  C 2 2   ? 12.499  18.791 -21.666 0.38 18.38 ? 2   DT  D "O4'" 1 
ATOM   3107 C  "C3'" A DT  C 2 2   ? 12.677  19.721 -23.989 0.62 18.72 ? 2   DT  D "C3'" 1 
ATOM   3108 C  "C3'" B DT  C 2 2   ? 12.766  18.974 -24.003 0.38 18.34 ? 2   DT  D "C3'" 1 
ATOM   3109 O  "O3'" A DT  C 2 2   ? 13.902  20.367 -24.245 0.62 22.72 ? 2   DT  D "O3'" 1 
ATOM   3110 O  "O3'" B DT  C 2 2   ? 13.231  19.926 -24.951 0.38 20.95 ? 2   DT  D "O3'" 1 
ATOM   3111 C  "C2'" A DT  C 2 2   ? 12.828  18.207 -24.057 0.62 17.33 ? 2   DT  D "C2'" 1 
ATOM   3112 C  "C2'" B DT  C 2 2   ? 13.917  18.140 -23.451 0.38 17.73 ? 2   DT  D "C2'" 1 
ATOM   3113 C  "C1'" A DT  C 2 2   ? 13.279  17.879 -22.643 0.62 18.29 ? 2   DT  D "C1'" 1 
ATOM   3114 C  "C1'" B DT  C 2 2   ? 13.507  17.860 -22.011 0.38 17.60 ? 2   DT  D "C1'" 1 
ATOM   3115 N  N1    A DT  C 2 2   ? 12.871  16.522 -22.206 0.62 16.58 ? 2   DT  D N1    1 
ATOM   3116 N  N1    B DT  C 2 2   ? 12.985  16.477 -21.821 0.38 16.29 ? 2   DT  D N1    1 
ATOM   3117 C  C2    A DT  C 2 2   ? 13.842  15.567 -22.049 0.62 16.25 ? 2   DT  D C2    1 
ATOM   3118 C  C2    B DT  C 2 2   ? 13.877  15.431 -21.809 0.38 16.40 ? 2   DT  D C2    1 
ATOM   3119 O  O2    A DT  C 2 2   ? 15.021  15.781 -22.250 0.62 15.78 ? 2   DT  D O2    1 
ATOM   3120 O  O2    B DT  C 2 2   ? 15.077  15.579 -21.948 0.38 16.65 ? 2   DT  D O2    1 
ATOM   3121 N  N3    A DT  C 2 2   ? 13.378  14.349 -21.636 0.62 15.88 ? 2   DT  D N3    1 
ATOM   3122 N  N3    B DT  C 2 2   ? 13.308  14.199 -21.625 0.38 15.98 ? 2   DT  D N3    1 
ATOM   3123 C  C4    A DT  C 2 2   ? 12.067  13.995 -21.390 0.62 15.41 ? 2   DT  D C4    1 
ATOM   3124 C  C4    B DT  C 2 2   ? 11.966  13.917 -21.466 0.38 15.29 ? 2   DT  D C4    1 
ATOM   3125 O  O4    A DT  C 2 2   ? 11.775  12.863 -21.017 0.62 16.59 ? 2   DT  D O4    1 
ATOM   3126 O  O4    B DT  C 2 2   ? 11.557  12.772 -21.304 0.38 17.01 ? 2   DT  D O4    1 
ATOM   3127 C  C5    A DT  C 2 2   ? 11.094  15.048 -21.572 0.62 14.41 ? 2   DT  D C5    1 
ATOM   3128 C  C5    B DT  C 2 2   ? 11.085  15.058 -21.486 0.38 14.43 ? 2   DT  D C5    1 
ATOM   3129 C  C7    A DT  C 2 2   ? 9.638   14.788 -21.320 0.62 13.38 ? 2   DT  D C7    1 
ATOM   3130 C  C7    B DT  C 2 2   ? 9.607   14.869 -21.313 0.38 13.46 ? 2   DT  D C7    1 
ATOM   3131 C  C6    A DT  C 2 2   ? 11.538  16.247 -21.971 0.62 14.91 ? 2   DT  D C6    1 
ATOM   3132 C  C6    B DT  C 2 2   ? 11.630  16.268 -21.664 0.38 15.29 ? 2   DT  D C6    1 
ATOM   3133 P  P     A DT  C 2 3   ? 14.465  20.436 -25.748 0.51 26.75 ? 3   DT  D P     1 
ATOM   3134 P  P     B DT  C 2 3   ? 13.452  19.517 -26.490 0.49 26.68 ? 3   DT  D P     1 
ATOM   3135 O  OP1   A DT  C 2 3   ? 15.191  21.715 -25.911 0.51 33.33 ? 3   DT  D OP1   1 
ATOM   3136 O  OP1   B DT  C 2 3   ? 13.660  20.771 -27.247 0.49 26.57 ? 3   DT  D OP1   1 
ATOM   3137 O  OP2   A DT  C 2 3   ? 13.352  20.091 -26.656 0.51 25.93 ? 3   DT  D OP2   1 
ATOM   3138 O  OP2   B DT  C 2 3   ? 12.368  18.593 -26.880 0.49 33.94 ? 3   DT  D OP2   1 
ATOM   3139 O  "O5'" A DT  C 2 3   ? 15.515  19.235 -25.811 0.51 28.57 ? 3   DT  D "O5'" 1 
ATOM   3140 O  "O5'" B DT  C 2 3   ? 14.832  18.706 -26.486 0.49 29.40 ? 3   DT  D "O5'" 1 
ATOM   3141 C  "C5'" A DT  C 2 3   ? 16.678  19.265 -24.998 0.51 29.89 ? 3   DT  D "C5'" 1 
ATOM   3142 C  "C5'" B DT  C 2 3   ? 15.994  19.318 -25.925 0.49 29.61 ? 3   DT  D "C5'" 1 
ATOM   3143 C  "C4'" A DT  C 2 3   ? 17.591  18.110 -25.369 0.51 29.27 ? 3   DT  D "C4'" 1 
ATOM   3144 C  "C4'" B DT  C 2 3   ? 17.143  18.333 -25.810 0.49 29.88 ? 3   DT  D "C4'" 1 
ATOM   3145 O  "O4'" A DT  C 2 3   ? 17.034  16.879 -24.847 0.51 26.59 ? 3   DT  D "O4'" 1 
ATOM   3146 O  "O4'" B DT  C 2 3   ? 16.737  17.155 -25.065 0.49 26.32 ? 3   DT  D "O4'" 1 
ATOM   3147 C  "C3'" A DT  C 2 3   ? 17.797  17.896 -26.867 0.51 30.38 ? 3   DT  D "C3'" 1 
ATOM   3148 C  "C3'" B DT  C 2 3   ? 17.636  17.828 -27.154 0.49 30.00 ? 3   DT  D "C3'" 1 
ATOM   3149 O  "O3'" A DT  C 2 3   ? 19.202  17.757 -27.080 0.51 34.98 ? 3   DT  D "O3'" 1 
ATOM   3150 O  "O3'" B DT  C 2 3   ? 19.054  17.768 -27.158 0.49 34.17 ? 3   DT  D "O3'" 1 
ATOM   3151 C  "C2'" A DT  C 2 3   ? 16.996  16.626 -27.172 0.51 28.48 ? 3   DT  D "C2'" 1 
ATOM   3152 C  "C2'" B DT  C 2 3   ? 16.987  16.452 -27.282 0.49 28.36 ? 3   DT  D "C2'" 1 
ATOM   3153 C  "C1'" A DT  C 2 3   ? 17.053  15.877 -25.847 0.51 25.95 ? 3   DT  D "C1'" 1 
ATOM   3154 C  "C1'" B DT  C 2 3   ? 16.956  15.987 -25.836 0.49 25.95 ? 3   DT  D "C1'" 1 
ATOM   3155 N  N1    A DT  C 2 3   ? 15.898  14.985 -25.540 0.51 22.58 ? 3   DT  D N1    1 
ATOM   3156 N  N1    B DT  C 2 3   ? 15.848  15.058 -25.504 0.49 22.61 ? 3   DT  D N1    1 
ATOM   3157 C  C2    A DT  C 2 3   ? 16.143  13.741 -24.996 0.51 21.73 ? 3   DT  D C2    1 
ATOM   3158 C  C2    B DT  C 2 3   ? 16.124  13.804 -24.999 0.49 21.65 ? 3   DT  D C2    1 
ATOM   3159 O  O2    A DT  C 2 3   ? 17.266  13.307 -24.765 0.51 23.46 ? 3   DT  D O2    1 
ATOM   3160 O  O2    B DT  C 2 3   ? 17.256  13.380 -24.811 0.49 23.74 ? 3   DT  D O2    1 
ATOM   3161 N  N3    A DT  C 2 3   ? 15.018  13.007 -24.730 0.51 18.10 ? 3   DT  D N3    1 
ATOM   3162 N  N3    B DT  C 2 3   ? 15.012  13.053 -24.719 0.49 18.33 ? 3   DT  D N3    1 
ATOM   3163 C  C4    A DT  C 2 3   ? 13.704  13.390 -24.936 0.51 18.68 ? 3   DT  D C4    1 
ATOM   3164 C  C4    B DT  C 2 3   ? 13.688  13.427 -24.880 0.49 18.55 ? 3   DT  D C4    1 
ATOM   3165 O  O4    A DT  C 2 3   ? 12.758  12.663 -24.662 0.51 19.64 ? 3   DT  D O4    1 
ATOM   3166 O  O4    B DT  C 2 3   ? 12.757  12.683 -24.595 0.49 19.24 ? 3   DT  D O4    1 
ATOM   3167 C  C5    A DT  C 2 3   ? 13.517  14.700 -25.502 0.51 18.81 ? 3   DT  D C5    1 
ATOM   3168 C  C5    B DT  C 2 3   ? 13.475  14.748 -25.409 0.49 18.79 ? 3   DT  D C5    1 
ATOM   3169 C  C7    A DT  C 2 3   ? 12.123  15.201 -25.771 0.51 18.03 ? 3   DT  D C7    1 
ATOM   3170 C  C7    B DT  C 2 3   ? 12.078  15.261 -25.633 0.49 17.76 ? 3   DT  D C7    1 
ATOM   3171 C  C6    A DT  C 2 3   ? 14.608  15.431 -25.770 0.51 19.56 ? 3   DT  D C6    1 
ATOM   3172 C  C6    B DT  C 2 3   ? 14.549  15.492 -25.691 0.49 19.54 ? 3   DT  D C6    1 
ATOM   3173 P  P     . DC  C 2 4   ? 19.833  17.741 -28.560 1.00 45.08 ? 4   DC  D P     1 
ATOM   3174 O  OP1   . DC  C 2 4   ? 21.170  18.356 -28.407 1.00 47.30 ? 4   DC  D OP1   1 
ATOM   3175 O  OP2   . DC  C 2 4   ? 18.879  18.264 -29.559 1.00 42.72 ? 4   DC  D OP2   1 
ATOM   3176 O  "O5'" . DC  C 2 4   ? 20.006  16.183 -28.868 1.00 41.42 ? 4   DC  D "O5'" 1 
ATOM   3177 C  "C5'" . DC  C 2 4   ? 20.615  15.374 -27.871 1.00 38.10 ? 4   DC  D "C5'" 1 
ATOM   3178 C  "C4'" . DC  C 2 4   ? 20.332  13.908 -28.144 1.00 34.83 ? 4   DC  D "C4'" 1 
ATOM   3179 O  "O4'" . DC  C 2 4   ? 18.962  13.604 -27.803 1.00 30.62 ? 4   DC  D "O4'" 1 
ATOM   3180 C  "C3'" . DC  C 2 4   ? 20.510  13.474 -29.593 1.00 33.12 ? 4   DC  D "C3'" 1 
ATOM   3181 O  "O3'" . DC  C 2 4   ? 21.607  12.564 -29.628 1.00 34.91 ? 4   DC  D "O3'" 1 
ATOM   3182 C  "C2'" . DC  C 2 4   ? 19.180  12.815 -29.985 1.00 31.18 ? 4   DC  D "C2'" 1 
ATOM   3183 C  "C1'" . DC  C 2 4   ? 18.551  12.536 -28.629 1.00 28.87 ? 4   DC  D "C1'" 1 
ATOM   3184 N  N1    . DC  C 2 4   ? 17.070  12.536 -28.562 1.00 26.64 ? 4   DC  D N1    1 
ATOM   3185 C  C2    . DC  C 2 4   ? 16.431  11.423 -28.014 1.00 25.13 ? 4   DC  D C2    1 
ATOM   3186 O  O2    . DC  C 2 4   ? 17.122  10.473 -27.625 1.00 26.65 ? 4   DC  D O2    1 
ATOM   3187 N  N3    . DC  C 2 4   ? 15.082  11.421 -27.927 1.00 21.06 ? 4   DC  D N3    1 
ATOM   3188 C  C4    . DC  C 2 4   ? 14.378  12.476 -28.345 1.00 20.97 ? 4   DC  D C4    1 
ATOM   3189 N  N4    . DC  C 2 4   ? 13.044  12.419 -28.231 1.00 19.84 ? 4   DC  D N4    1 
ATOM   3190 C  C5    . DC  C 2 4   ? 15.012  13.626 -28.904 1.00 24.53 ? 4   DC  D C5    1 
ATOM   3191 C  C6    . DC  C 2 4   ? 16.350  13.610 -28.991 1.00 27.53 ? 4   DC  D C6    1 
ATOM   3192 P  P     . DT  C 2 5   ? 22.222  12.071 -31.025 1.00 38.99 ? 5   DT  D P     1 
ATOM   3193 O  OP1   . DT  C 2 5   ? 23.614  11.643 -30.758 1.00 40.69 ? 5   DT  D OP1   1 
ATOM   3194 O  OP2   . DT  C 2 5   ? 21.917  13.080 -32.063 1.00 40.58 ? 5   DT  D OP2   1 
ATOM   3195 O  "O5'" . DT  C 2 5   ? 21.361  10.776 -31.390 1.00 34.95 ? 5   DT  D "O5'" 1 
ATOM   3196 C  "C5'" . DT  C 2 5   ? 21.327  9.690  -30.486 1.00 35.10 ? 5   DT  D "C5'" 1 
ATOM   3197 C  "C4'" . DT  C 2 5   ? 20.278  8.710  -30.966 1.00 36.99 ? 5   DT  D "C4'" 1 
ATOM   3198 O  "O4'" . DT  C 2 5   ? 18.958  9.239  -30.696 1.00 34.25 ? 5   DT  D "O4'" 1 
ATOM   3199 C  "C3'" . DT  C 2 5   ? 20.305  8.452  -32.468 1.00 40.84 ? 5   DT  D "C3'" 1 
ATOM   3200 O  "O3'" . DT  C 2 5   ? 20.126  7.077  -32.657 1.00 44.83 ? 5   DT  D "O3'" 1 
ATOM   3201 C  "C2'" . DT  C 2 5   ? 19.080  9.197  -32.991 1.00 39.34 ? 5   DT  D "C2'" 1 
ATOM   3202 C  "C1'" . DT  C 2 5   ? 18.156  8.932  -31.812 1.00 34.82 ? 5   DT  D "C1'" 1 
ATOM   3203 N  N1    . DT  C 2 5   ? 16.935  9.764  -31.755 1.00 32.97 ? 5   DT  D N1    1 
ATOM   3204 C  C2    . DT  C 2 5   ? 15.823  9.223  -31.146 1.00 29.66 ? 5   DT  D C2    1 
ATOM   3205 O  O2    . DT  C 2 5   ? 15.810  8.098  -30.668 1.00 28.45 ? 5   DT  D O2    1 
ATOM   3206 N  N3    . DT  C 2 5   ? 14.732  10.054 -31.125 1.00 26.45 ? 5   DT  D N3    1 
ATOM   3207 C  C4    . DT  C 2 5   ? 14.651  11.331 -31.646 1.00 27.58 ? 5   DT  D C4    1 
ATOM   3208 O  O4    . DT  C 2 5   ? 13.622  11.995 -31.582 1.00 28.83 ? 5   DT  D O4    1 
ATOM   3209 C  C5    . DT  C 2 5   ? 15.860  11.831 -32.265 1.00 32.38 ? 5   DT  D C5    1 
ATOM   3210 C  C7    . DT  C 2 5   ? 15.891  13.208 -32.859 1.00 33.20 ? 5   DT  D C7    1 
ATOM   3211 C  C6    . DT  C 2 5   ? 16.935  11.035 -32.289 1.00 31.80 ? 5   DT  D C6    1 
ATOM   3212 P  P     . DA  C 2 6   ? 21.346  6.160  -33.147 1.00 48.77 ? 6   DA  D P     1 
ATOM   3213 O  OP1   . DA  C 2 6   ? 22.494  6.433  -32.250 1.00 50.46 ? 6   DA  D OP1   1 
ATOM   3214 O  OP2   . DA  C 2 6   ? 21.474  6.357  -34.608 1.00 49.35 ? 6   DA  D OP2   1 
ATOM   3215 O  "O5'" . DA  C 2 6   ? 20.814  4.674  -32.884 1.00 47.88 ? 6   DA  D "O5'" 1 
ATOM   3216 C  "C5'" . DA  C 2 6   ? 20.378  4.330  -31.571 1.00 45.09 ? 6   DA  D "C5'" 1 
ATOM   3217 C  "C4'" . DA  C 2 6   ? 19.224  3.342  -31.592 1.00 43.00 ? 6   DA  D "C4'" 1 
ATOM   3218 O  "O4'" . DA  C 2 6   ? 17.953  4.026  -31.743 1.00 41.34 ? 6   DA  D "O4'" 1 
ATOM   3219 C  "C3'" . DA  C 2 6   ? 19.257  2.305  -32.699 1.00 45.80 ? 6   DA  D "C3'" 1 
ATOM   3220 O  "O3'" . DA  C 2 6   ? 18.747  1.104  -32.144 1.00 47.76 ? 6   DA  D "O3'" 1 
ATOM   3221 C  "C2'" . DA  C 2 6   ? 18.349  2.901  -33.779 1.00 43.57 ? 6   DA  D "C2'" 1 
ATOM   3222 C  "C1'" . DA  C 2 6   ? 17.322  3.677  -32.960 1.00 38.37 ? 6   DA  D "C1'" 1 
ATOM   3223 N  N9    . DA  C 2 6   ? 16.874  4.955  -33.508 1.00 35.67 ? 6   DA  D N9    1 
ATOM   3224 C  C8    . DA  C 2 6   ? 17.559  5.813  -34.325 1.00 32.64 ? 6   DA  D C8    1 
ATOM   3225 N  N7    . DA  C 2 6   ? 16.889  6.903  -34.617 1.00 32.84 ? 6   DA  D N7    1 
ATOM   3226 C  C5    . DA  C 2 6   ? 15.686  6.757  -33.942 1.00 30.45 ? 6   DA  D C5    1 
ATOM   3227 C  C6    . DA  C 2 6   ? 14.535  7.570  -33.840 1.00 27.48 ? 6   DA  D C6    1 
ATOM   3228 N  N6    . DA  C 2 6   ? 14.401  8.755  -34.447 1.00 25.00 ? 6   DA  D N6    1 
ATOM   3229 N  N1    . DA  C 2 6   ? 13.512  7.118  -33.085 1.00 27.09 ? 6   DA  D N1    1 
ATOM   3230 C  C2    . DA  C 2 6   ? 13.640  5.935  -32.470 1.00 29.26 ? 6   DA  D C2    1 
ATOM   3231 N  N3    . DA  C 2 6   ? 14.665  5.086  -32.489 1.00 32.08 ? 6   DA  D N3    1 
ATOM   3232 C  C4    . DA  C 2 6   ? 15.665  5.561  -33.251 1.00 32.19 ? 6   DA  D C4    1 
ATOM   3233 P  P     . DG  C 2 7   ? 18.840  -0.274 -32.960 1.00 54.56 ? 7   DG  D P     1 
ATOM   3234 O  OP1   . DG  C 2 7   ? 19.016  -1.359 -31.970 1.00 57.20 ? 7   DG  D OP1   1 
ATOM   3235 O  OP2   . DG  C 2 7   ? 19.809  -0.104 -34.065 1.00 54.57 ? 7   DG  D OP2   1 
ATOM   3236 O  "O5'" . DG  C 2 7   ? 17.388  -0.423 -33.604 1.00 50.61 ? 7   DG  D "O5'" 1 
ATOM   3237 C  "C5'" . DG  C 2 7   ? 16.290  -0.271 -32.728 1.00 49.37 ? 7   DG  D "C5'" 1 
ATOM   3238 C  "C4'" . DG  C 2 7   ? 14.998  -0.089 -33.494 1.00 46.81 ? 7   DG  D "C4'" 1 
ATOM   3239 O  "O4'" . DG  C 2 7   ? 14.830  1.284  -33.963 1.00 43.70 ? 7   DG  D "O4'" 1 
ATOM   3240 C  "C3'" . DG  C 2 7   ? 14.826  -0.977 -34.746 1.00 49.03 ? 7   DG  D "C3'" 1 
ATOM   3241 O  "O3'" . DG  C 2 7   ? 13.452  -1.204 -34.832 1.00 52.53 ? 7   DG  D "O3'" 1 
ATOM   3242 C  "C2'" . DG  C 2 7   ? 15.088  0.009  -35.869 1.00 44.01 ? 7   DG  D "C2'" 1 
ATOM   3243 C  "C1'" . DG  C 2 7   ? 14.491  1.275  -35.315 1.00 40.04 ? 7   DG  D "C1'" 1 
ATOM   3244 N  N9    . DG  C 2 7   ? 14.863  2.558  -35.890 1.00 37.90 ? 7   DG  D N9    1 
ATOM   3245 C  C8    . DG  C 2 7   ? 15.999  2.922  -36.572 1.00 36.92 ? 7   DG  D C8    1 
ATOM   3246 N  N7    . DG  C 2 7   ? 15.959  4.162  -36.984 1.00 34.95 ? 7   DG  D N7    1 
ATOM   3247 C  C5    . DG  C 2 7   ? 14.716  4.629  -36.564 1.00 33.03 ? 7   DG  D C5    1 
ATOM   3248 C  C6    . DG  C 2 7   ? 14.095  5.886  -36.727 1.00 30.46 ? 7   DG  D C6    1 
ATOM   3249 O  O6    . DG  C 2 7   ? 14.538  6.889  -37.294 1.00 32.46 ? 7   DG  D O6    1 
ATOM   3250 N  N1    . DG  C 2 7   ? 12.830  5.923  -36.144 1.00 29.54 ? 7   DG  D N1    1 
ATOM   3251 C  C2    . DG  C 2 7   ? 12.231  4.875  -35.492 1.00 29.38 ? 7   DG  D C2    1 
ATOM   3252 N  N2    . DG  C 2 7   ? 11.001  5.089  -34.997 1.00 27.73 ? 7   DG  D N2    1 
ATOM   3253 N  N3    . DG  C 2 7   ? 12.800  3.691  -35.335 1.00 31.66 ? 7   DG  D N3    1 
ATOM   3254 C  C4    . DG  C 2 7   ? 14.031  3.647  -35.898 1.00 34.32 ? 7   DG  D C4    1 
ATOM   3255 P  P     . DA  C 2 8   ? 12.855  -2.669 -35.081 1.00 51.83 ? 8   DA  D P     1 
ATOM   3256 O  OP1   . DA  C 2 8   ? 13.290  -3.515 -33.948 1.00 54.17 ? 8   DA  D OP1   1 
ATOM   3257 O  OP2   . DA  C 2 8   ? 13.152  -3.081 -36.471 1.00 57.21 ? 8   DA  D OP2   1 
ATOM   3258 O  "O5'" . DA  C 2 8   ? 11.285  -2.417 -34.951 1.00 46.16 ? 8   DA  D "O5'" 1 
ATOM   3259 C  "C5'" . DA  C 2 8   ? 10.876  -1.585 -33.871 1.00 42.80 ? 8   DA  D "C5'" 1 
ATOM   3260 C  "C4'" . DA  C 2 8   ? 9.703   -0.688 -34.229 1.00 42.90 ? 8   DA  D "C4'" 1 
ATOM   3261 O  "O4'" . DA  C 2 8   ? 10.139  0.550  -34.852 1.00 42.85 ? 8   DA  D "O4'" 1 
ATOM   3262 C  "C3'" . DA  C 2 8   ? 8.680   -1.286 -35.180 1.00 43.15 ? 8   DA  D "C3'" 1 
ATOM   3263 O  "O3'" . DA  C 2 8   ? 7.411   -0.859 -34.710 1.00 44.46 ? 8   DA  D "O3'" 1 
ATOM   3264 C  "C2'" . DA  C 2 8   ? 9.052   -0.677 -36.534 1.00 39.25 ? 8   DA  D "C2'" 1 
ATOM   3265 C  "C1'" . DA  C 2 8   ? 9.535   0.712  -36.126 1.00 39.37 ? 8   DA  D "C1'" 1 
ATOM   3266 N  N9    . DA  C 2 8   ? 10.555  1.308  -36.989 1.00 33.96 ? 8   DA  D N9    1 
ATOM   3267 C  C8    . DA  C 2 8   ? 11.736  0.737  -37.374 1.00 33.34 ? 8   DA  D C8    1 
ATOM   3268 N  N7    . DA  C 2 8   ? 12.472  1.508  -38.136 1.00 34.35 ? 8   DA  D N7    1 
ATOM   3269 C  C5    . DA  C 2 8   ? 11.730  2.674  -38.253 1.00 31.03 ? 8   DA  D C5    1 
ATOM   3270 C  C6    . DA  C 2 8   ? 11.961  3.888  -38.933 1.00 31.72 ? 8   DA  D C6    1 
ATOM   3271 N  N6    . DA  C 2 8   ? 13.059  4.140  -39.654 1.00 36.27 ? 8   DA  D N6    1 
ATOM   3272 N  N1    . DA  C 2 8   ? 11.013  4.840  -38.851 1.00 31.01 ? 8   DA  D N1    1 
ATOM   3273 C  C2    . DA  C 2 8   ? 9.914   4.596  -38.125 1.00 27.31 ? 8   DA  D C2    1 
ATOM   3274 N  N3    . DA  C 2 8   ? 9.585   3.498  -37.450 1.00 24.02 ? 8   DA  D N3    1 
ATOM   3275 C  C4    . DA  C 2 8   ? 10.546  2.568  -37.550 1.00 28.90 ? 8   DA  D C4    1 
ATOM   3276 P  P     . DA  C 2 9   ? 6.066   -1.486 -35.320 1.00 51.11 ? 9   DA  D P     1 
ATOM   3277 O  OP1   . DA  C 2 9   ? 5.077   -1.559 -34.220 1.00 48.76 ? 9   DA  D OP1   1 
ATOM   3278 O  OP2   . DA  C 2 9   ? 6.437   -2.701 -36.082 1.00 53.64 ? 9   DA  D OP2   1 
ATOM   3279 O  "O5'" . DA  C 2 9   ? 5.582   -0.378 -36.368 1.00 45.18 ? 9   DA  D "O5'" 1 
ATOM   3280 C  "C5'" . DA  C 2 9   ? 5.530   0.977  -35.948 1.00 41.67 ? 9   DA  D "C5'" 1 
ATOM   3281 C  "C4'" . DA  C 2 9   ? 5.074   1.864  -37.091 1.00 39.50 ? 9   DA  D "C4'" 1 
ATOM   3282 O  "O4'" . DA  C 2 9   ? 6.215   2.354  -37.843 1.00 37.91 ? 9   DA  D "O4'" 1 
ATOM   3283 C  "C3'" . DA  C 2 9   ? 4.146   1.182  -38.091 1.00 38.84 ? 9   DA  D "C3'" 1 
ATOM   3284 O  "O3'" . DA  C 2 9   ? 3.041   2.056  -38.255 1.00 39.34 ? 9   DA  D "O3'" 1 
ATOM   3285 C  "C2'" . DA  C 2 9   ? 4.998   1.025  -39.353 1.00 35.30 ? 9   DA  D "C2'" 1 
ATOM   3286 C  "C1'" . DA  C 2 9   ? 6.015   2.156  -39.229 1.00 33.84 ? 9   DA  D "C1'" 1 
ATOM   3287 N  N9    . DA  C 2 9   ? 7.336   1.864  -39.784 1.00 34.40 ? 9   DA  D N9    1 
ATOM   3288 C  C8    . DA  C 2 9   ? 8.021   0.685  -39.682 1.00 33.94 ? 9   DA  D C8    1 
ATOM   3289 N  N7    . DA  C 2 9   ? 9.199   0.700  -40.257 1.00 29.87 ? 9   DA  D N7    1 
ATOM   3290 C  C5    . DA  C 2 9   ? 9.304   1.982  -40.761 1.00 27.48 ? 9   DA  D C5    1 
ATOM   3291 C  C6    . DA  C 2 9   ? 10.328  2.629  -41.482 1.00 28.40 ? 9   DA  D C6    1 
ATOM   3292 N  N6    . DA  C 2 9   ? 11.469  2.022  -41.814 1.00 29.66 ? 9   DA  D N6    1 
ATOM   3293 N  N1    . DA  C 2 9   ? 10.127  3.913  -41.850 1.00 28.40 ? 9   DA  D N1    1 
ATOM   3294 C  C2    . DA  C 2 9   ? 8.974   4.499  -41.502 1.00 29.06 ? 9   DA  D C2    1 
ATOM   3295 N  N3    . DA  C 2 9   ? 7.940   3.989  -40.824 1.00 29.24 ? 9   DA  D N3    1 
ATOM   3296 C  C4    . DA  C 2 9   ? 8.171   2.715  -40.477 1.00 29.03 ? 9   DA  D C4    1 
ATOM   3297 P  P     . DC  C 2 10  ? 1.819   1.674  -39.221 1.00 39.99 ? 10  DC  D P     1 
ATOM   3298 O  OP1   . DC  C 2 10  ? 0.635   2.384  -38.685 1.00 37.67 ? 10  DC  D OP1   1 
ATOM   3299 O  OP2   . DC  C 2 10  ? 1.777   0.205  -39.403 1.00 39.73 ? 10  DC  D OP2   1 
ATOM   3300 O  "O5'" . DC  C 2 10  ? 2.222   2.343  -40.615 1.00 37.47 ? 10  DC  D "O5'" 1 
ATOM   3301 C  "C5'" . DC  C 2 10  ? 2.421   3.754  -40.642 1.00 36.88 ? 10  DC  D "C5'" 1 
ATOM   3302 C  "C4'" . DC  C 2 10  ? 3.071   4.185  -41.941 1.00 37.52 ? 10  DC  D "C4'" 1 
ATOM   3303 O  "O4'" . DC  C 2 10  ? 4.472   3.837  -41.913 1.00 36.84 ? 10  DC  D "O4'" 1 
ATOM   3304 C  "C3'" . DC  C 2 10  ? 2.556   3.488  -43.189 1.00 38.84 ? 10  DC  D "C3'" 1 
ATOM   3305 O  "O3'" . DC  C 2 10  ? 1.431   4.180  -43.708 1.00 43.64 ? 10  DC  D "O3'" 1 
ATOM   3306 C  "C2'" . DC  C 2 10  ? 3.735   3.582  -44.152 1.00 37.51 ? 10  DC  D "C2'" 1 
ATOM   3307 C  "C1'" . DC  C 2 10  ? 4.928   3.876  -43.249 1.00 33.03 ? 10  DC  D "C1'" 1 
ATOM   3308 N  N1    . DC  C 2 10  ? 6.030   2.897  -43.408 1.00 32.31 ? 10  DC  D N1    1 
ATOM   3309 C  C2    . DC  C 2 10  ? 7.196   3.297  -44.071 1.00 31.44 ? 10  DC  D C2    1 
ATOM   3310 O  O2    . DC  C 2 10  ? 7.275   4.458  -44.497 1.00 28.85 ? 10  DC  D O2    1 
ATOM   3311 N  N3    . DC  C 2 10  ? 8.200   2.398  -44.223 1.00 31.95 ? 10  DC  D N3    1 
ATOM   3312 C  C4    . DC  C 2 10  ? 8.065   1.162  -43.741 1.00 31.06 ? 10  DC  D C4    1 
ATOM   3313 N  N4    . DC  C 2 10  ? 9.084   0.318  -43.909 1.00 28.76 ? 10  DC  D N4    1 
ATOM   3314 C  C5    . DC  C 2 10  ? 6.881   0.737  -43.066 1.00 31.19 ? 10  DC  D C5    1 
ATOM   3315 C  C6    . DC  C 2 10  ? 5.896   1.630  -42.923 1.00 30.04 ? 10  DC  D C6    1 
ATOM   3316 O  OP3   . DG  D 2 1   ? 19.402  3.680  -49.912 1.00 88.29 ? 1   DG  E OP3   1 
ATOM   3317 P  P     . DG  D 2 1   ? 17.919  3.123  -49.694 1.00 69.45 ? 1   DG  E P     1 
ATOM   3318 O  OP1   . DG  D 2 1   ? 17.494  2.461  -50.946 1.00 69.69 ? 1   DG  E OP1   1 
ATOM   3319 O  OP2   . DG  D 2 1   ? 17.912  2.349  -48.433 1.00 68.09 ? 1   DG  E OP2   1 
ATOM   3320 O  "O5'" . DG  D 2 1   ? 16.974  4.388  -49.465 1.00 51.69 ? 1   DG  E "O5'" 1 
ATOM   3321 C  "C5'" . DG  D 2 1   ? 16.391  5.064  -50.571 1.00 49.08 ? 1   DG  E "C5'" 1 
ATOM   3322 C  "C4'" . DG  D 2 1   ? 15.466  6.165  -50.083 1.00 47.10 ? 1   DG  E "C4'" 1 
ATOM   3323 O  "O4'" . DG  D 2 1   ? 14.281  5.601  -49.465 1.00 45.58 ? 1   DG  E "O4'" 1 
ATOM   3324 C  "C3'" . DG  D 2 1   ? 16.047  7.118  -49.046 1.00 44.60 ? 1   DG  E "C3'" 1 
ATOM   3325 O  "O3'" . DG  D 2 1   ? 15.502  8.400  -49.334 1.00 46.97 ? 1   DG  E "O3'" 1 
ATOM   3326 C  "C2'" . DG  D 2 1   ? 15.570  6.534  -47.714 1.00 39.52 ? 1   DG  E "C2'" 1 
ATOM   3327 C  "C1'" . DG  D 2 1   ? 14.221  5.921  -48.084 1.00 40.75 ? 1   DG  E "C1'" 1 
ATOM   3328 N  N9    . DG  D 2 1   ? 13.861  4.678  -47.399 1.00 39.59 ? 1   DG  E N9    1 
ATOM   3329 C  C8    . DG  D 2 1   ? 14.640  3.556  -47.233 1.00 42.25 ? 1   DG  E C8    1 
ATOM   3330 N  N7    . DG  D 2 1   ? 14.037  2.588  -46.597 1.00 40.81 ? 1   DG  E N7    1 
ATOM   3331 C  C5    . DG  D 2 1   ? 12.768  3.094  -46.334 1.00 37.30 ? 1   DG  E C5    1 
ATOM   3332 C  C6    . DG  D 2 1   ? 11.665  2.500  -45.672 1.00 32.86 ? 1   DG  E C6    1 
ATOM   3333 O  O6    . DG  D 2 1   ? 11.593  1.371  -45.175 1.00 31.93 ? 1   DG  E O6    1 
ATOM   3334 N  N1    . DG  D 2 1   ? 10.562  3.352  -45.618 1.00 29.75 ? 1   DG  E N1    1 
ATOM   3335 C  C2    . DG  D 2 1   ? 10.534  4.622  -46.142 1.00 32.15 ? 1   DG  E C2    1 
ATOM   3336 N  N2    . DG  D 2 1   ? 9.385   5.303  -45.998 1.00 30.09 ? 1   DG  E N2    1 
ATOM   3337 N  N3    . DG  D 2 1   ? 11.560  5.191  -46.764 1.00 33.43 ? 1   DG  E N3    1 
ATOM   3338 C  C4    . DG  D 2 1   ? 12.643  4.375  -46.820 1.00 36.85 ? 1   DG  E C4    1 
ATOM   3339 P  P     . DT  D 2 2   ? 15.816  9.667  -48.397 1.00 59.92 ? 2   DT  E P     1 
ATOM   3340 O  OP1   . DT  D 2 2   ? 15.787  10.860 -49.274 1.00 60.36 ? 2   DT  E OP1   1 
ATOM   3341 O  OP2   . DT  D 2 2   ? 17.011  9.372  -47.575 1.00 59.72 ? 2   DT  E OP2   1 
ATOM   3342 O  "O5'" . DT  D 2 2   ? 14.540  9.745  -47.437 1.00 43.95 ? 2   DT  E "O5'" 1 
ATOM   3343 C  "C5'" . DT  D 2 2   ? 13.281  9.971  -48.055 1.00 42.35 ? 2   DT  E "C5'" 1 
ATOM   3344 C  "C4'" . DT  D 2 2   ? 12.169  10.023 -47.026 1.00 41.38 ? 2   DT  E "C4'" 1 
ATOM   3345 O  "O4'" . DT  D 2 2   ? 11.990  8.719  -46.417 1.00 39.17 ? 2   DT  E "O4'" 1 
ATOM   3346 C  "C3'" . DT  D 2 2   ? 12.373  11.018 -45.888 1.00 39.62 ? 2   DT  E "C3'" 1 
ATOM   3347 O  "O3'" . DT  D 2 2   ? 11.200  11.825 -45.872 1.00 43.33 ? 2   DT  E "O3'" 1 
ATOM   3348 C  "C2'" . DT  D 2 2   ? 12.546  10.130 -44.653 1.00 37.56 ? 2   DT  E "C2'" 1 
ATOM   3349 C  "C1'" . DT  D 2 2   ? 11.775  8.872  -45.033 1.00 36.57 ? 2   DT  E "C1'" 1 
ATOM   3350 N  N1    . DT  D 2 2   ? 12.233  7.592  -44.424 1.00 35.95 ? 2   DT  E N1    1 
ATOM   3351 C  C2    . DT  D 2 2   ? 11.320  6.822  -43.735 1.00 33.89 ? 2   DT  E C2    1 
ATOM   3352 O  O2    . DT  D 2 2   ? 10.156  7.146  -43.583 1.00 32.71 ? 2   DT  E O2    1 
ATOM   3353 N  N3    . DT  D 2 2   ? 11.819  5.653  -43.225 1.00 32.81 ? 2   DT  E N3    1 
ATOM   3354 C  C4    . DT  D 2 2   ? 13.115  5.184  -43.347 1.00 34.30 ? 2   DT  E C4    1 
ATOM   3355 O  O4    . DT  D 2 2   ? 13.470  4.119  -42.856 1.00 36.92 ? 2   DT  E O4    1 
ATOM   3356 C  C5    . DT  D 2 2   ? 14.021  6.034  -44.080 1.00 36.35 ? 2   DT  E C5    1 
ATOM   3357 C  C7    . DT  D 2 2   ? 15.453  5.618  -44.261 1.00 37.06 ? 2   DT  E C7    1 
ATOM   3358 C  C6    . DT  D 2 2   ? 13.544  7.183  -44.585 1.00 36.84 ? 2   DT  E C6    1 
ATOM   3359 P  P     . DT  D 2 3   ? 10.942  12.907 -44.710 1.00 48.69 ? 3   DT  E P     1 
ATOM   3360 O  OP1   . DT  D 2 3   ? 10.242  14.035 -45.364 1.00 48.13 ? 3   DT  E OP1   1 
ATOM   3361 O  OP2   . DT  D 2 3   ? 12.187  13.140 -43.944 1.00 45.66 ? 3   DT  E OP2   1 
ATOM   3362 O  "O5'" . DT  D 2 3   ? 9.912   12.168 -43.734 1.00 42.50 ? 3   DT  E "O5'" 1 
ATOM   3363 C  "C5'" . DT  D 2 3   ? 8.786   11.521 -44.316 1.00 39.45 ? 3   DT  E "C5'" 1 
ATOM   3364 C  "C4'" . DT  D 2 3   ? 7.958   10.819 -43.254 1.00 36.36 ? 3   DT  E "C4'" 1 
ATOM   3365 O  "O4'" . DT  D 2 3   ? 8.662   9.671  -42.712 1.00 31.89 ? 3   DT  E "O4'" 1 
ATOM   3366 C  "C3'" . DT  D 2 3   ? 7.578   11.658 -42.043 1.00 34.55 ? 3   DT  E "C3'" 1 
ATOM   3367 O  "O3'" . DT  D 2 3   ? 6.261   11.248 -41.748 1.00 36.40 ? 3   DT  E "O3'" 1 
ATOM   3368 C  "C2'" . DT  D 2 3   ? 8.599   11.235 -40.984 1.00 31.28 ? 3   DT  E "C2'" 1 
ATOM   3369 C  "C1'" . DT  D 2 3   ? 8.739   9.751  -41.299 1.00 30.86 ? 3   DT  E "C1'" 1 
ATOM   3370 N  N1    . DT  D 2 3   ? 10.011  9.044  -40.957 1.00 30.51 ? 3   DT  E N1    1 
ATOM   3371 C  C2    . DT  D 2 3   ? 9.924   7.820  -40.326 1.00 28.71 ? 3   DT  E C2    1 
ATOM   3372 O  O2    . DT  D 2 3   ? 8.872   7.310  -39.992 1.00 29.75 ? 3   DT  E O2    1 
ATOM   3373 N  N3    . DT  D 2 3   ? 11.121  7.207  -40.080 1.00 28.97 ? 3   DT  E N3    1 
ATOM   3374 C  C4    . DT  D 2 3   ? 12.374  7.686  -40.406 1.00 32.42 ? 3   DT  E C4    1 
ATOM   3375 O  O4    . DT  D 2 3   ? 13.399  7.067  -40.148 1.00 35.16 ? 3   DT  E O4    1 
ATOM   3376 C  C5    . DT  D 2 3   ? 12.400  8.965  -41.069 1.00 33.20 ? 3   DT  E C5    1 
ATOM   3377 C  C7    . DT  D 2 3   ? 13.726  9.561  -41.450 1.00 35.75 ? 3   DT  E C7    1 
ATOM   3378 C  C6    . DT  D 2 3   ? 11.233  9.576  -41.324 1.00 30.56 ? 3   DT  E C6    1 
ATOM   3379 P  P     . DC  D 2 4   ? 5.331   12.110 -40.769 1.00 36.84 ? 4   DC  E P     1 
ATOM   3380 O  OP1   . DC  D 2 4   ? 3.936   11.923 -41.219 1.00 31.45 ? 4   DC  E OP1   1 
ATOM   3381 O  OP2   . DC  D 2 4   ? 5.904   13.470 -40.658 1.00 38.89 ? 4   DC  E OP2   1 
ATOM   3382 O  "O5'" . DC  D 2 4   ? 5.526   11.384 -39.358 1.00 27.31 ? 4   DC  E "O5'" 1 
ATOM   3383 C  "C5'" . DC  D 2 4   ? 5.090   10.034 -39.253 1.00 28.40 ? 4   DC  E "C5'" 1 
ATOM   3384 C  "C4'" . DC  D 2 4   ? 5.603   9.396  -37.978 1.00 27.19 ? 4   DC  E "C4'" 1 
ATOM   3385 O  "O4'" . DC  D 2 4   ? 6.993   9.026  -38.125 1.00 24.81 ? 4   DC  E "O4'" 1 
ATOM   3386 C  "C3'" . DC  D 2 4   ? 5.550   10.273 -36.731 1.00 25.99 ? 4   DC  E "C3'" 1 
ATOM   3387 O  "O3'" . DC  D 2 4   ? 4.371   9.905  -36.024 1.00 25.79 ? 4   DC  E "O3'" 1 
ATOM   3388 C  "C2'" . DC  D 2 4   ? 6.829   9.927  -35.967 1.00 23.88 ? 4   DC  E "C2'" 1 
ATOM   3389 C  "C1'" . DC  D 2 4   ? 7.514   8.868  -36.822 1.00 22.69 ? 4   DC  E "C1'" 1 
ATOM   3390 N  N1    . DC  D 2 4   ? 8.975   9.044  -36.982 1.00 26.24 ? 4   DC  E N1    1 
ATOM   3391 C  C2    . DC  D 2 4   ? 9.852   8.050  -36.535 1.00 23.83 ? 4   DC  E C2    1 
ATOM   3392 O  O2    . DC  D 2 4   ? 9.393   7.039  -35.982 1.00 23.62 ? 4   DC  E O2    1 
ATOM   3393 N  N3    . DC  D 2 4   ? 11.183  8.232  -36.718 1.00 23.71 ? 4   DC  E N3    1 
ATOM   3394 C  C4    . DC  D 2 4   ? 11.632  9.337  -37.321 1.00 28.31 ? 4   DC  E C4    1 
ATOM   3395 N  N4    . DC  D 2 4   ? 12.951  9.472  -37.494 1.00 26.46 ? 4   DC  E N4    1 
ATOM   3396 C  C5    . DC  D 2 4   ? 10.751  10.359 -37.780 1.00 28.32 ? 4   DC  E C5    1 
ATOM   3397 C  C6    . DC  D 2 4   ? 9.443   10.170 -37.594 1.00 28.05 ? 4   DC  E C6    1 
ATOM   3398 P  P     . DT  D 2 5   ? 4.139   10.347 -34.502 1.00 28.31 ? 5   DT  E P     1 
ATOM   3399 O  OP1   . DT  D 2 5   ? 2.669   10.279 -34.317 1.00 28.53 ? 5   DT  E OP1   1 
ATOM   3400 O  OP2   . DT  D 2 5   ? 4.893   11.586 -34.200 1.00 30.60 ? 5   DT  E OP2   1 
ATOM   3401 O  "O5'" . DT  D 2 5   ? 4.813   9.175  -33.647 1.00 25.45 ? 5   DT  E "O5'" 1 
ATOM   3402 C  "C5'" . DT  D 2 5   ? 4.452   7.835  -33.953 1.00 26.09 ? 5   DT  E "C5'" 1 
ATOM   3403 C  "C4'" . DT  D 2 5   ? 5.278   6.855  -33.142 1.00 29.00 ? 5   DT  E "C4'" 1 
ATOM   3404 O  "O4'" . DT  D 2 5   ? 6.690   6.993  -33.442 1.00 26.17 ? 5   DT  E "O4'" 1 
ATOM   3405 C  "C3'" . DT  D 2 5   ? 5.169   6.983  -31.635 1.00 29.27 ? 5   DT  E "C3'" 1 
ATOM   3406 O  "O3'" . DT  D 2 5   ? 5.070   5.643  -31.189 1.00 36.41 ? 5   DT  E "O3'" 1 
ATOM   3407 C  "C2'" . DT  D 2 5   ? 6.472   7.672  -31.218 1.00 25.21 ? 5   DT  E "C2'" 1 
ATOM   3408 C  "C1'" . DT  D 2 5   ? 7.458   7.147  -32.255 1.00 24.72 ? 5   DT  E "C1'" 1 
ATOM   3409 N  N1    . DT  D 2 5   ? 8.655   7.981  -32.591 1.00 27.17 ? 5   DT  E N1    1 
ATOM   3410 C  C2    . DT  D 2 5   ? 9.919   7.420  -32.549 1.00 24.74 ? 5   DT  E C2    1 
ATOM   3411 O  O2    . DT  D 2 5   ? 10.149  6.286  -32.180 1.00 24.61 ? 5   DT  E O2    1 
ATOM   3412 N  N3    . DT  D 2 5   ? 10.933  8.255  -32.928 1.00 22.92 ? 5   DT  E N3    1 
ATOM   3413 C  C4    . DT  D 2 5   ? 10.816  9.558  -33.371 1.00 25.73 ? 5   DT  E C4    1 
ATOM   3414 O  O4    . DT  D 2 5   ? 11.794  10.219 -33.705 1.00 26.06 ? 5   DT  E O4    1 
ATOM   3415 C  C5    . DT  D 2 5   ? 9.472   10.085 -33.401 1.00 25.07 ? 5   DT  E C5    1 
ATOM   3416 C  C7    . DT  D 2 5   ? 9.232   11.496 -33.856 1.00 27.89 ? 5   DT  E C7    1 
ATOM   3417 C  C6    . DT  D 2 5   ? 8.469   9.279  -33.026 1.00 24.79 ? 5   DT  E C6    1 
ATOM   3418 P  P     A DA  D 2 6   ? 4.471   5.313  -29.735 0.24 39.29 ? 6   DA  E P     1 
ATOM   3419 P  P     B DA  D 2 6   ? 4.499   5.300  -29.729 0.76 37.81 ? 6   DA  E P     1 
ATOM   3420 O  OP1   A DA  D 2 6   ? 3.725   4.039  -29.834 0.24 39.98 ? 6   DA  E OP1   1 
ATOM   3421 O  OP1   B DA  D 2 6   ? 3.808   3.994  -29.830 0.76 40.50 ? 6   DA  E OP1   1 
ATOM   3422 O  OP2   A DA  D 2 6   ? 3.791   6.530  -29.240 0.24 39.04 ? 6   DA  E OP2   1 
ATOM   3423 O  OP2   B DA  D 2 6   ? 3.767   6.485  -29.225 0.76 40.83 ? 6   DA  E OP2   1 
ATOM   3424 O  "O5'" A DA  D 2 6   ? 5.770   5.075  -28.835 0.24 34.34 ? 6   DA  E "O5'" 1 
ATOM   3425 O  "O5'" B DA  D 2 6   ? 5.804   5.101  -28.845 0.76 33.48 ? 6   DA  E "O5'" 1 
ATOM   3426 C  "C5'" A DA  D 2 6   ? 6.658   4.015  -29.163 0.24 35.20 ? 6   DA  E "C5'" 1 
ATOM   3427 C  "C5'" B DA  D 2 6   ? 6.669   4.010  -29.133 0.76 35.00 ? 6   DA  E "C5'" 1 
ATOM   3428 C  "C4'" A DA  D 2 6   ? 7.918   4.062  -28.318 0.24 35.21 ? 6   DA  E "C4'" 1 
ATOM   3429 C  "C4'" B DA  D 2 6   ? 7.918   4.078  -28.273 0.76 36.09 ? 6   DA  E "C4'" 1 
ATOM   3430 O  "O4'" A DA  D 2 6   ? 8.819   5.084  -28.814 0.24 33.80 ? 6   DA  E "O4'" 1 
ATOM   3431 O  "O4'" B DA  D 2 6   ? 8.801   5.103  -28.794 0.76 34.16 ? 6   DA  E "O4'" 1 
ATOM   3432 C  "C3'" A DA  D 2 6   ? 7.708   4.375  -26.842 0.24 36.26 ? 6   DA  E "C3'" 1 
ATOM   3433 C  "C3'" B DA  D 2 6   ? 7.697   4.453  -26.815 0.76 37.35 ? 6   DA  E "C3'" 1 
ATOM   3434 O  "O3'" A DA  D 2 6   ? 8.678   3.669  -26.093 0.24 36.91 ? 6   DA  E "O3'" 1 
ATOM   3435 O  "O3'" B DA  D 2 6   ? 8.719   3.850  -26.048 0.76 36.98 ? 6   DA  E "O3'" 1 
ATOM   3436 C  "C2'" A DA  D 2 6   ? 7.983   5.875  -26.783 0.24 34.31 ? 6   DA  E "C2'" 1 
ATOM   3437 C  "C2'" B DA  D 2 6   ? 7.904   5.964  -26.823 0.76 35.46 ? 6   DA  E "C2'" 1 
ATOM   3438 C  "C1'" A DA  D 2 6   ? 9.146   5.970  -27.764 0.24 31.67 ? 6   DA  E "C1'" 1 
ATOM   3439 C  "C1'" B DA  D 2 6   ? 9.103   6.019  -27.761 0.76 32.07 ? 6   DA  E "C1'" 1 
ATOM   3440 N  N9    A DA  D 2 6   ? 9.358   7.287  -28.354 0.24 28.40 ? 6   DA  E N9    1 
ATOM   3441 N  N9    B DA  D 2 6   ? 9.329   7.317  -28.375 0.76 27.99 ? 6   DA  E N9    1 
ATOM   3442 C  C8    A DA  D 2 6   ? 8.450   8.299  -28.495 0.24 27.93 ? 6   DA  E C8    1 
ATOM   3443 C  C8    B DA  D 2 6   ? 8.422   8.320  -28.566 0.76 27.12 ? 6   DA  E C8    1 
ATOM   3444 N  N7    A DA  D 2 6   ? 8.939   9.369  -29.078 0.24 27.16 ? 6   DA  E N7    1 
ATOM   3445 N  N7    B DA  D 2 6   ? 8.923   9.375  -29.169 0.76 28.28 ? 6   DA  E N7    1 
ATOM   3446 C  C5    A DA  D 2 6   ? 10.258  9.033  -29.340 0.24 26.23 ? 6   DA  E C5    1 
ATOM   3447 C  C5    B DA  D 2 6   ? 10.252  9.027  -29.383 0.76 26.92 ? 6   DA  E C5    1 
ATOM   3448 C  C6    A DA  D 2 6   ? 11.319  9.735  -29.945 0.24 25.15 ? 6   DA  E C6    1 
ATOM   3449 C  C6    B DA  D 2 6   ? 11.332  9.704  -29.971 0.76 24.32 ? 6   DA  E C6    1 
ATOM   3450 N  N6    A DA  D 2 6   ? 11.205  10.980 -30.416 0.24 24.58 ? 6   DA  E N6    1 
ATOM   3451 N  N6    B DA  D 2 6   ? 11.240  10.935 -30.480 0.76 24.67 ? 6   DA  E N6    1 
ATOM   3452 N  N1    A DA  D 2 6   ? 12.509  9.105  -30.047 0.24 24.85 ? 6   DA  E N1    1 
ATOM   3453 N  N1    B DA  D 2 6   ? 12.516  9.061  -30.017 0.76 25.02 ? 6   DA  E N1    1 
ATOM   3454 C  C2    A DA  D 2 6   ? 12.623  7.858  -29.575 0.24 25.45 ? 6   DA  E C2    1 
ATOM   3455 C  C2    B DA  D 2 6   ? 12.621  7.831  -29.511 0.76 25.05 ? 6   DA  E C2    1 
ATOM   3456 N  N3    A DA  D 2 6   ? 11.699  7.099  -28.989 0.24 26.00 ? 6   DA  E N3    1 
ATOM   3457 N  N3    B DA  D 2 6   ? 11.674  7.095  -28.935 0.76 26.44 ? 6   DA  E N3    1 
ATOM   3458 C  C4    A DA  D 2 6   ? 10.530  7.752  -28.901 0.24 26.73 ? 6   DA  E C4    1 
ATOM   3459 C  C4    B DA  D 2 6   ? 10.513  7.760  -28.900 0.76 25.47 ? 6   DA  E C4    1 
ATOM   3460 P  P     A DG  D 2 7   ? 8.402   2.165  -25.596 0.24 45.05 ? 7   DG  E P     1 
ATOM   3461 P  P     B DG  D 2 7   ? 8.372   3.095  -24.672 0.76 44.19 ? 7   DG  E P     1 
ATOM   3462 O  OP1   A DG  D 2 7   ? 8.243   1.295  -26.781 0.24 44.96 ? 7   DG  E OP1   1 
ATOM   3463 O  OP1   B DG  D 2 7   ? 7.808   1.768  -25.007 0.76 45.65 ? 7   DG  E OP1   1 
ATOM   3464 O  OP2   A DG  D 2 7   ? 7.341   2.222  -24.565 0.24 45.53 ? 7   DG  E OP2   1 
ATOM   3465 O  OP2   B DG  D 2 7   ? 7.636   4.032  -23.795 0.76 43.35 ? 7   DG  E OP2   1 
ATOM   3466 O  "O5'" A DG  D 2 7   ? 9.762   1.775  -24.861 0.24 36.35 ? 7   DG  E "O5'" 1 
ATOM   3467 O  "O5'" B DG  D 2 7   ? 9.808   2.848  -24.026 0.76 36.49 ? 7   DG  E "O5'" 1 
ATOM   3468 C  "C5'" A DG  D 2 7   ? 10.272  2.705  -23.922 0.24 35.36 ? 7   DG  E "C5'" 1 
ATOM   3469 C  "C5'" B DG  D 2 7   ? 10.797  2.157  -24.784 0.76 34.44 ? 7   DG  E "C5'" 1 
ATOM   3470 C  "C4'" A DG  D 2 7   ? 11.770  2.874  -24.058 0.24 33.94 ? 7   DG  E "C4'" 1 
ATOM   3471 C  "C4'" B DG  D 2 7   ? 12.186  2.662  -24.437 0.76 33.22 ? 7   DG  E "C4'" 1 
ATOM   3472 O  "O4'" A DG  D 2 7   ? 12.079  3.944  -24.992 0.24 31.73 ? 7   DG  E "O4'" 1 
ATOM   3473 O  "O4'" B DG  D 2 7   ? 12.446  3.915  -25.125 0.76 30.96 ? 7   DG  E "O4'" 1 
ATOM   3474 C  "C3'" A DG  D 2 7   ? 12.426  3.287  -22.754 0.24 34.05 ? 7   DG  E "C3'" 1 
ATOM   3475 C  "C3'" B DG  D 2 7   ? 12.437  2.956  -22.964 0.76 34.08 ? 7   DG  E "C3'" 1 
ATOM   3476 O  "O3'" A DG  D 2 7   ? 13.761  2.839  -22.731 0.24 34.92 ? 7   DG  E "O3'" 1 
ATOM   3477 O  "O3'" B DG  D 2 7   ? 13.817  2.804  -22.769 0.76 35.75 ? 7   DG  E "O3'" 1 
ATOM   3478 C  "C2'" A DG  D 2 7   ? 12.351  4.804  -22.832 0.24 31.39 ? 7   DG  E "C2'" 1 
ATOM   3479 C  "C2'" B DG  D 2 7   ? 12.071  4.432  -22.857 0.76 32.90 ? 7   DG  E "C2'" 1 
ATOM   3480 C  "C1'" A DG  D 2 7   ? 12.705  5.008  -24.298 0.24 28.87 ? 7   DG  E "C1'" 1 
ATOM   3481 C  "C1'" B DG  D 2 7   ? 12.694  4.923  -24.158 0.76 29.63 ? 7   DG  E "C1'" 1 
ATOM   3482 N  N9    A DG  D 2 7   ? 12.222  6.277  -24.830 0.24 25.16 ? 7   DG  E N9    1 
ATOM   3483 N  N9    B DG  D 2 7   ? 12.161  6.179  -24.670 0.76 26.24 ? 7   DG  E N9    1 
ATOM   3484 C  C8    A DG  D 2 7   ? 10.936  6.756  -24.779 0.24 25.02 ? 7   DG  E C8    1 
ATOM   3485 C  C8    B DG  D 2 7   ? 10.874  6.657  -24.607 0.76 24.84 ? 7   DG  E C8    1 
ATOM   3486 N  N7    A DG  D 2 7   ? 10.796  7.925  -25.340 0.24 24.04 ? 7   DG  E N7    1 
ATOM   3487 N  N7    B DG  D 2 7   ? 10.733  7.823  -25.181 0.76 24.10 ? 7   DG  E N7    1 
ATOM   3488 C  C5    A DG  D 2 7   ? 12.071  8.240  -25.793 0.24 22.82 ? 7   DG  E C5    1 
ATOM   3489 C  C5    B DG  D 2 7   ? 12.005  8.126  -25.660 0.76 23.22 ? 7   DG  E C5    1 
ATOM   3490 C  C6    A DG  D 2 7   ? 12.536  9.386  -26.481 0.24 22.01 ? 7   DG  E C6    1 
ATOM   3491 C  C6    B DG  D 2 7   ? 12.480  9.254  -26.371 0.76 21.80 ? 7   DG  E C6    1 
ATOM   3492 O  O6    A DG  D 2 7   ? 11.889  10.380 -26.838 0.24 22.47 ? 7   DG  E O6    1 
ATOM   3493 O  O6    B DG  D 2 7   ? 11.842  10.250 -26.731 0.76 22.54 ? 7   DG  E O6    1 
ATOM   3494 N  N1    A DG  D 2 7   ? 13.900  9.308  -26.753 0.24 21.76 ? 7   DG  E N1    1 
ATOM   3495 N  N1    B DG  D 2 7   ? 13.842  9.155  -26.655 0.76 21.85 ? 7   DG  E N1    1 
ATOM   3496 C  C2    A DG  D 2 7   ? 14.711  8.253  -26.404 0.24 22.00 ? 7   DG  E C2    1 
ATOM   3497 C  C2    B DG  D 2 7   ? 14.643  8.090  -26.299 0.76 21.93 ? 7   DG  E C2    1 
ATOM   3498 N  N2    A DG  D 2 7   ? 16.004  8.351  -26.749 0.24 22.48 ? 7   DG  E N2    1 
ATOM   3499 N  N2    B DG  D 2 7   ? 15.938  8.141  -26.648 0.76 22.38 ? 7   DG  E N2    1 
ATOM   3500 N  N3    A DG  D 2 7   ? 14.288  7.174  -25.758 0.24 22.06 ? 7   DG  E N3    1 
ATOM   3501 N  N3    B DG  D 2 7   ? 14.207  7.033  -25.634 0.76 22.11 ? 7   DG  E N3    1 
ATOM   3502 C  C4    A DG  D 2 7   ? 12.962  7.237  -25.485 0.24 22.33 ? 7   DG  E C4    1 
ATOM   3503 C  C4    B DG  D 2 7   ? 12.890  7.124  -25.350 0.76 21.96 ? 7   DG  E C4    1 
ATOM   3504 P  P     . DA  D 2 8   ? 14.411  2.371  -21.343 1.00 35.26 ? 8   DA  E P     1 
ATOM   3505 O  OP1   . DA  D 2 8   ? 14.538  0.899  -21.360 1.00 40.30 ? 8   DA  E OP1   1 
ATOM   3506 O  OP2   . DA  D 2 8   ? 13.650  3.043  -20.264 1.00 35.18 ? 8   DA  E OP2   1 
ATOM   3507 O  "O5'" . DA  D 2 8   ? 15.864  3.009  -21.361 1.00 28.65 ? 8   DA  E "O5'" 1 
ATOM   3508 C  "C5'" . DA  D 2 8   ? 16.732  2.791  -22.458 1.00 24.41 ? 8   DA  E "C5'" 1 
ATOM   3509 C  "C4'" . DA  D 2 8   ? 17.875  3.784  -22.379 1.00 25.75 ? 8   DA  E "C4'" 1 
ATOM   3510 O  "O4'" . DA  D 2 8   ? 17.462  5.074  -22.909 1.00 22.94 ? 8   DA  E "O4'" 1 
ATOM   3511 C  "C3'" . DA  D 2 8   ? 18.386  4.046  -20.972 1.00 21.22 ? 8   DA  E "C3'" 1 
ATOM   3512 O  "O3'" . DA  D 2 8   ? 19.800  4.212  -21.048 1.00 21.31 ? 8   DA  E "O3'" 1 
ATOM   3513 C  "C2'" . DA  D 2 8   ? 17.678  5.348  -20.582 1.00 20.49 ? 8   DA  E "C2'" 1 
ATOM   3514 C  "C1'" . DA  D 2 8   ? 17.532  6.076  -21.916 1.00 18.57 ? 8   DA  E "C1'" 1 
ATOM   3515 N  N9    . DA  D 2 8   ? 16.300  6.869  -22.072 1.00 20.32 ? 8   DA  E N9    1 
ATOM   3516 C  C8    . DA  D 2 8   ? 15.037  6.538  -21.652 1.00 19.46 ? 8   DA  E C8    1 
ATOM   3517 N  N7    . DA  D 2 8   ? 14.122  7.441  -21.954 1.00 19.91 ? 8   DA  E N7    1 
ATOM   3518 C  C5    . DA  D 2 8   ? 14.835  8.429  -22.619 1.00 19.52 ? 8   DA  E C5    1 
ATOM   3519 C  C6    . DA  D 2 8   ? 14.447  9.658  -23.200 1.00 18.48 ? 8   DA  E C6    1 
ATOM   3520 N  N6    . DA  D 2 8   ? 13.187  10.114 -23.191 1.00 15.82 ? 8   DA  E N6    1 
ATOM   3521 N  N1    . DA  D 2 8   ? 15.409  10.406 -23.786 1.00 18.68 ? 8   DA  E N1    1 
ATOM   3522 C  C2    . DA  D 2 8   ? 16.673  9.953  -23.795 1.00 20.52 ? 8   DA  E C2    1 
ATOM   3523 N  N3    . DA  D 2 8   ? 17.148  8.814  -23.286 1.00 20.31 ? 8   DA  E N3    1 
ATOM   3524 C  C4    . DA  D 2 8   ? 16.176  8.091  -22.702 1.00 18.69 ? 8   DA  E C4    1 
ATOM   3525 P  P     . DA  D 2 9   ? 20.665  4.446  -19.716 1.00 22.30 ? 9   DA  E P     1 
ATOM   3526 O  OP1   . DA  D 2 9   ? 22.058  4.029  -19.999 1.00 20.85 ? 9   DA  E OP1   1 
ATOM   3527 O  OP2   . DA  D 2 9   ? 19.955  3.848  -18.562 1.00 22.60 ? 9   DA  E OP2   1 
ATOM   3528 O  "O5'" . DA  D 2 9   ? 20.687  6.026  -19.552 1.00 18.80 ? 9   DA  E "O5'" 1 
ATOM   3529 C  "C5'" . DA  D 2 9   ? 21.471  6.780  -20.465 1.00 19.61 ? 9   DA  E "C5'" 1 
ATOM   3530 C  "C4'" . DA  D 2 9   ? 21.277  8.274  -20.264 1.00 23.14 ? 9   DA  E "C4'" 1 
ATOM   3531 O  "O4'" . DA  D 2 9   ? 19.913  8.625  -20.614 1.00 23.04 ? 9   DA  E "O4'" 1 
ATOM   3532 C  "C3'" . DA  D 2 9   ? 21.525  8.804  -18.849 1.00 22.55 ? 9   DA  E "C3'" 1 
ATOM   3533 O  "O3'" . DA  D 2 9   ? 22.444  9.887  -18.881 1.00 28.50 ? 9   DA  E "O3'" 1 
ATOM   3534 C  "C2'" . DA  D 2 9   ? 20.171  9.378  -18.440 1.00 21.46 ? 9   DA  E "C2'" 1 
ATOM   3535 C  "C1'" . DA  D 2 9   ? 19.543  9.701  -19.795 1.00 19.08 ? 9   DA  E "C1'" 1 
ATOM   3536 N  N9    . DA  D 2 9   ? 18.098  9.734  -19.726 1.00 20.19 ? 9   DA  E N9    1 
ATOM   3537 C  C8    . DA  D 2 9   ? 17.292  8.806  -19.128 1.00 21.87 ? 9   DA  E C8    1 
ATOM   3538 N  N7    . DA  D 2 9   ? 16.019  9.088  -19.211 1.00 20.87 ? 9   DA  E N7    1 
ATOM   3539 C  C5    . DA  D 2 9   ? 15.991  10.274 -19.925 1.00 19.18 ? 9   DA  E C5    1 
ATOM   3540 C  C6    . DA  D 2 9   ? 14.929  11.103 -20.329 1.00 19.13 ? 9   DA  E C6    1 
ATOM   3541 N  N6    . DA  D 2 9   ? 13.654  10.810 -20.072 1.00 15.94 ? 9   DA  E N6    1 
ATOM   3542 N  N1    . DA  D 2 9   ? 15.232  12.220 -21.022 1.00 18.28 ? 9   DA  E N1    1 
ATOM   3543 C  C2    . DA  D 2 9   ? 16.519  12.494 -21.268 1.00 19.51 ? 9   DA  E C2    1 
ATOM   3544 N  N3    . DA  D 2 9   ? 17.602  11.804 -20.922 1.00 17.94 ? 9   DA  E N3    1 
ATOM   3545 C  C4    . DA  D 2 9   ? 17.258  10.693 -20.252 1.00 20.33 ? 9   DA  E C4    1 
ATOM   3546 P  P     . DC  D 2 10  ? 24.024  9.635  -18.834 1.00 26.39 ? 10  DC  E P     1 
ATOM   3547 O  OP1   . DC  D 2 10  ? 24.642  10.961 -19.057 1.00 30.98 ? 10  DC  E OP1   1 
ATOM   3548 O  OP2   . DC  D 2 10  ? 24.380  8.499  -19.695 1.00 22.56 ? 10  DC  E OP2   1 
ATOM   3549 O  "O5'" . DC  D 2 10  ? 24.329  9.190  -17.335 1.00 18.43 ? 10  DC  E "O5'" 1 
ATOM   3550 C  "C5'" . DC  D 2 10  ? 24.259  10.097 -16.253 1.00 18.19 ? 10  DC  E "C5'" 1 
ATOM   3551 C  "C4'" . DC  D 2 10  ? 24.946  9.449  -15.066 1.00 20.24 ? 10  DC  E "C4'" 1 
ATOM   3552 O  "O4'" . DC  D 2 10  ? 24.172  8.316  -14.602 1.00 21.28 ? 10  DC  E "O4'" 1 
ATOM   3553 C  "C3'" . DC  D 2 10  ? 26.326  8.903  -15.400 1.00 22.53 ? 10  DC  E "C3'" 1 
ATOM   3554 O  "O3'" . DC  D 2 10  ? 27.183  9.219  -14.331 1.00 25.46 ? 10  DC  E "O3'" 1 
ATOM   3555 C  "C2'" . DC  D 2 10  ? 26.135  7.391  -15.535 1.00 19.16 ? 10  DC  E "C2'" 1 
ATOM   3556 C  "C1'" . DC  D 2 10  ? 24.953  7.136  -14.621 1.00 17.76 ? 10  DC  E "C1'" 1 
ATOM   3557 N  N1    . DC  D 2 10  ? 24.090  6.017  -15.102 1.00 17.23 ? 10  DC  E N1    1 
ATOM   3558 C  C2    . DC  D 2 10  ? 24.406  4.722  -14.698 1.00 16.09 ? 10  DC  E C2    1 
ATOM   3559 O  O2    . DC  D 2 10  ? 25.392  4.539  -13.962 1.00 18.48 ? 10  DC  E O2    1 
ATOM   3560 N  N3    . DC  D 2 10  ? 23.633  3.707  -15.123 1.00 15.61 ? 10  DC  E N3    1 
ATOM   3561 C  C4    . DC  D 2 10  ? 22.584  3.929  -15.913 1.00 16.82 ? 10  DC  E C4    1 
ATOM   3562 N  N4    . DC  D 2 10  ? 21.871  2.869  -16.290 1.00 16.67 ? 10  DC  E N4    1 
ATOM   3563 C  C5    . DC  D 2 10  ? 22.245  5.246  -16.353 1.00 16.58 ? 10  DC  E C5    1 
ATOM   3564 C  C6    . DC  D 2 10  ? 23.023  6.253  -15.926 1.00 16.73 ? 10  DC  E C6    1 
ATOM   3565 O  OP3   . DG  E 2 1   ? 16.004  52.094 -48.797 1.00 27.87 ? 1   DG  G OP3   1 
ATOM   3566 P  P     . DG  E 2 1   ? 16.468  52.041 -47.267 1.00 27.92 ? 1   DG  G P     1 
ATOM   3567 O  OP1   . DG  E 2 1   ? 16.522  50.604 -46.899 1.00 31.66 ? 1   DG  G OP1   1 
ATOM   3568 O  OP2   . DG  E 2 1   ? 17.680  52.865 -47.127 1.00 25.37 ? 1   DG  G OP2   1 
ATOM   3569 O  "O5'" . DG  E 2 1   ? 15.341  52.735 -46.382 1.00 23.52 ? 1   DG  G "O5'" 1 
ATOM   3570 C  "C5'" . DG  E 2 1   ? 14.061  52.139 -46.273 1.00 21.41 ? 1   DG  G "C5'" 1 
ATOM   3571 C  "C4'" . DG  E 2 1   ? 13.032  53.249 -46.196 1.00 18.53 ? 1   DG  G "C4'" 1 
ATOM   3572 O  "O4'" . DG  E 2 1   ? 13.152  53.936 -44.920 1.00 22.87 ? 1   DG  G "O4'" 1 
ATOM   3573 C  "C3'" . DG  E 2 1   ? 13.180  54.323 -47.255 1.00 19.30 ? 1   DG  G "C3'" 1 
ATOM   3574 O  "O3'" . DG  E 2 1   ? 12.407  53.969 -48.383 1.00 19.05 ? 1   DG  G "O3'" 1 
ATOM   3575 C  "C2'" . DG  E 2 1   ? 12.627  55.569 -46.559 1.00 17.30 ? 1   DG  G "C2'" 1 
ATOM   3576 C  "C1'" . DG  E 2 1   ? 13.091  55.339 -45.124 1.00 19.89 ? 1   DG  G "C1'" 1 
ATOM   3577 N  N9    . DG  E 2 1   ? 14.405  55.900 -44.812 1.00 17.93 ? 1   DG  G N9    1 
ATOM   3578 C  C8    . DG  E 2 1   ? 15.540  55.211 -44.451 1.00 18.55 ? 1   DG  G C8    1 
ATOM   3579 N  N7    . DG  E 2 1   ? 16.563  55.997 -44.220 1.00 20.23 ? 1   DG  G N7    1 
ATOM   3580 C  C5    . DG  E 2 1   ? 16.070  57.283 -44.444 1.00 18.53 ? 1   DG  G C5    1 
ATOM   3581 C  C6    . DG  E 2 1   ? 16.700  58.544 -44.352 1.00 18.15 ? 1   DG  G C6    1 
ATOM   3582 O  O6    . DG  E 2 1   ? 17.866  58.797 -44.028 1.00 18.85 ? 1   DG  G O6    1 
ATOM   3583 N  N1    . DG  E 2 1   ? 15.833  59.597 -44.661 1.00 15.10 ? 1   DG  G N1    1 
ATOM   3584 C  C2    . DG  E 2 1   ? 14.520  59.429 -45.014 1.00 15.54 ? 1   DG  G C2    1 
ATOM   3585 N  N2    . DG  E 2 1   ? 13.841  60.548 -45.272 1.00 13.88 ? 1   DG  G N2    1 
ATOM   3586 N  N3    . DG  E 2 1   ? 13.908  58.255 -45.103 1.00 16.35 ? 1   DG  G N3    1 
ATOM   3587 C  C4    . DG  E 2 1   ? 14.743  57.233 -44.807 1.00 14.20 ? 1   DG  G C4    1 
ATOM   3588 P  P     . DT  E 2 2   ? 12.964  54.265 -49.857 1.00 19.06 ? 2   DT  G P     1 
ATOM   3589 O  OP1   . DT  E 2 2   ? 12.078  53.595 -50.829 1.00 21.64 ? 2   DT  G OP1   1 
ATOM   3590 O  OP2   . DT  E 2 2   ? 14.422  54.002 -49.855 1.00 19.12 ? 2   DT  G OP2   1 
ATOM   3591 O  "O5'" . DT  E 2 2   ? 12.757  55.832 -50.010 1.00 16.85 ? 2   DT  G "O5'" 1 
ATOM   3592 C  "C5'" . DT  E 2 2   ? 11.445  56.355 -50.031 1.00 18.91 ? 2   DT  G "C5'" 1 
ATOM   3593 C  "C4'" . DT  E 2 2   ? 11.506  57.873 -49.966 1.00 20.49 ? 2   DT  G "C4'" 1 
ATOM   3594 O  "O4'" . DT  E 2 2   ? 12.226  58.250 -48.765 1.00 21.59 ? 2   DT  G "O4'" 1 
ATOM   3595 C  "C3'" . DT  E 2 2   ? 12.258  58.551 -51.095 1.00 18.43 ? 2   DT  G "C3'" 1 
ATOM   3596 O  "O3'" . DT  E 2 2   ? 11.356  58.827 -52.169 1.00 18.17 ? 2   DT  G "O3'" 1 
ATOM   3597 C  "C2'" . DT  E 2 2   ? 12.707  59.859 -50.450 1.00 17.06 ? 2   DT  G "C2'" 1 
ATOM   3598 C  "C1'" . DT  E 2 2   ? 12.921  59.459 -49.005 1.00 17.38 ? 2   DT  G "C1'" 1 
ATOM   3599 N  N1    . DT  E 2 2   ? 14.339  59.244 -48.638 1.00 18.48 ? 2   DT  G N1    1 
ATOM   3600 C  C2    . DT  E 2 2   ? 15.104  60.357 -48.388 1.00 16.82 ? 2   DT  G C2    1 
ATOM   3601 O  O2    . DT  E 2 2   ? 14.659  61.483 -48.499 1.00 18.71 ? 2   DT  G O2    1 
ATOM   3602 N  N3    . DT  E 2 2   ? 16.395  60.096 -48.029 1.00 15.14 ? 2   DT  G N3    1 
ATOM   3603 C  C4    . DT  E 2 2   ? 16.968  58.848 -47.892 1.00 14.76 ? 2   DT  G C4    1 
ATOM   3604 O  O4    . DT  E 2 2   ? 18.129  58.711 -47.546 1.00 18.70 ? 2   DT  G O4    1 
ATOM   3605 C  C5    . DT  E 2 2   ? 16.107  57.717 -48.167 1.00 14.80 ? 2   DT  G C5    1 
ATOM   3606 C  C7    . DT  E 2 2   ? 16.638  56.315 -48.053 1.00 17.35 ? 2   DT  G C7    1 
ATOM   3607 C  C6    . DT  E 2 2   ? 14.846  57.969 -48.525 1.00 15.29 ? 2   DT  G C6    1 
ATOM   3608 P  P     . DT  E 2 3   ? 11.909  59.203 -53.623 1.00 24.87 ? 3   DT  G P     1 
ATOM   3609 O  OP1   . DT  E 2 3   ? 10.751  59.174 -54.535 1.00 26.16 ? 3   DT  G OP1   1 
ATOM   3610 O  OP2   . DT  E 2 3   ? 13.113  58.379 -53.892 1.00 24.66 ? 3   DT  G OP2   1 
ATOM   3611 O  "O5'" . DT  E 2 3   ? 12.383  60.729 -53.492 1.00 22.01 ? 3   DT  G "O5'" 1 
ATOM   3612 C  "C5'" . DT  E 2 3   ? 11.467  61.758 -53.078 1.00 23.17 ? 3   DT  G "C5'" 1 
ATOM   3613 C  "C4'" . DT  E 2 3   ? 12.244  63.050 -52.947 1.00 20.84 ? 3   DT  G "C4'" 1 
ATOM   3614 O  "O4'" . DT  E 2 3   ? 13.284  62.889 -51.948 1.00 20.03 ? 3   DT  G "O4'" 1 
ATOM   3615 C  "C3'" . DT  E 2 3   ? 12.941  63.426 -54.244 1.00 22.94 ? 3   DT  G "C3'" 1 
ATOM   3616 O  "O3'" . DT  E 2 3   ? 12.654  64.758 -54.566 1.00 32.06 ? 3   DT  G "O3'" 1 
ATOM   3617 C  "C2'" . DT  E 2 3   ? 14.428  63.253 -53.959 1.00 25.19 ? 3   DT  G "C2'" 1 
ATOM   3618 C  "C1'" . DT  E 2 3   ? 14.527  63.323 -52.444 1.00 22.27 ? 3   DT  G "C1'" 1 
ATOM   3619 N  N1    . DT  E 2 3   ? 15.588  62.394 -51.957 1.00 20.75 ? 3   DT  G N1    1 
ATOM   3620 C  C2    . DT  E 2 3   ? 16.696  62.912 -51.320 1.00 23.84 ? 3   DT  G C2    1 
ATOM   3621 O  O2    . DT  E 2 3   ? 16.863  64.100 -51.104 1.00 22.04 ? 3   DT  G O2    1 
ATOM   3622 N  N3    . DT  E 2 3   ? 17.613  61.975 -50.922 1.00 19.81 ? 3   DT  G N3    1 
ATOM   3623 C  C4    . DT  E 2 3   ? 17.536  60.609 -51.108 1.00 19.58 ? 3   DT  G C4    1 
ATOM   3624 O  O4    . DT  E 2 3   ? 18.424  59.869 -50.712 1.00 20.44 ? 3   DT  G O4    1 
ATOM   3625 C  C5    . DT  E 2 3   ? 16.358  60.128 -51.794 1.00 20.64 ? 3   DT  G C5    1 
ATOM   3626 C  C7    . DT  E 2 3   ? 16.168  58.660 -52.054 1.00 21.68 ? 3   DT  G C7    1 
ATOM   3627 C  C6    . DT  E 2 3   ? 15.451  61.032 -52.182 1.00 17.92 ? 3   DT  G C6    1 
ATOM   3628 P  P     . DC  E 2 4   ? 12.947  65.305 -56.041 1.00 41.43 ? 4   DC  G P     1 
ATOM   3629 O  OP1   . DC  E 2 4   ? 11.997  66.415 -56.270 1.00 44.87 ? 4   DC  G OP1   1 
ATOM   3630 O  OP2   . DC  E 2 4   ? 12.994  64.155 -56.971 1.00 41.01 ? 4   DC  G OP2   1 
ATOM   3631 O  "O5'" . DC  E 2 4   ? 14.432  65.886 -55.938 1.00 37.29 ? 4   DC  G "O5'" 1 
ATOM   3632 C  "C5'" . DC  E 2 4   ? 14.679  66.937 -55.022 1.00 36.47 ? 4   DC  G "C5'" 1 
ATOM   3633 C  "C4'" . DC  E 2 4   ? 16.160  67.226 -54.970 1.00 34.32 ? 4   DC  G "C4'" 1 
ATOM   3634 O  "O4'" . DC  E 2 4   ? 16.818  66.156 -54.258 1.00 30.24 ? 4   DC  G "O4'" 1 
ATOM   3635 C  "C3'" . DC  E 2 4   ? 16.837  67.330 -56.335 1.00 37.48 ? 4   DC  G "C3'" 1 
ATOM   3636 O  "O3'" . DC  E 2 4   ? 17.344  68.642 -56.487 1.00 42.93 ? 4   DC  G "O3'" 1 
ATOM   3637 C  "C2'" . DC  E 2 4   ? 17.968  66.306 -56.298 1.00 34.61 ? 4   DC  G "C2'" 1 
ATOM   3638 C  "C1'" . DC  E 2 4   ? 18.099  65.980 -54.815 1.00 29.59 ? 4   DC  G "C1'" 1 
ATOM   3639 N  N1    . DC  E 2 4   ? 18.492  64.579 -54.523 1.00 25.75 ? 4   DC  G N1    1 
ATOM   3640 C  C2    . DC  E 2 4   ? 19.666  64.342 -53.816 1.00 25.75 ? 4   DC  G C2    1 
ATOM   3641 O  O2    . DC  E 2 4   ? 20.345  65.315 -53.469 1.00 29.34 ? 4   DC  G O2    1 
ATOM   3642 N  N3    . DC  E 2 4   ? 20.022  63.061 -53.539 1.00 23.06 ? 4   DC  G N3    1 
ATOM   3643 C  C4    . DC  E 2 4   ? 19.250  62.052 -53.940 1.00 21.09 ? 4   DC  G C4    1 
ATOM   3644 N  N4    . DC  E 2 4   ? 19.632  60.808 -53.641 1.00 23.79 ? 4   DC  G N4    1 
ATOM   3645 C  C5    . DC  E 2 4   ? 18.038  62.271 -54.657 1.00 23.37 ? 4   DC  G C5    1 
ATOM   3646 C  C6    . DC  E 2 4   ? 17.699  63.538 -54.919 1.00 24.73 ? 4   DC  G C6    1 
ATOM   3647 P  P     . DT  E 2 5   ? 18.001  69.107 -57.877 1.00 54.23 ? 5   DT  G P     1 
ATOM   3648 O  OP1   . DT  E 2 5   ? 17.820  70.574 -57.943 1.00 58.89 ? 5   DT  G OP1   1 
ATOM   3649 O  OP2   . DT  E 2 5   ? 17.499  68.234 -58.965 1.00 50.20 ? 5   DT  G OP2   1 
ATOM   3650 O  "O5'" . DT  E 2 5   ? 19.552  68.783 -57.692 1.00 44.64 ? 5   DT  G "O5'" 1 
ATOM   3651 C  "C5'" . DT  E 2 5   ? 20.253  69.346 -56.592 1.00 45.74 ? 5   DT  G "C5'" 1 
ATOM   3652 C  "C4'" . DT  E 2 5   ? 21.689  68.857 -56.588 1.00 45.42 ? 5   DT  G "C4'" 1 
ATOM   3653 O  "O4'" . DT  E 2 5   ? 21.739  67.488 -56.124 1.00 40.08 ? 5   DT  G "O4'" 1 
ATOM   3654 C  "C3'" . DT  E 2 5   ? 22.372  68.886 -57.951 1.00 47.55 ? 5   DT  G "C3'" 1 
ATOM   3655 O  "O3'" . DT  E 2 5   ? 23.418  69.850 -57.884 1.00 51.41 ? 5   DT  G "O3'" 1 
ATOM   3656 C  "C2'" . DT  E 2 5   ? 22.884  67.460 -58.183 1.00 45.19 ? 5   DT  G "C2'" 1 
ATOM   3657 C  "C1'" . DT  E 2 5   ? 22.747  66.785 -56.819 1.00 41.00 ? 5   DT  G "C1'" 1 
ATOM   3658 N  N1    . DT  E 2 5   ? 22.298  65.364 -56.826 1.00 36.61 ? 5   DT  G N1    1 
ATOM   3659 C  C2    . DT  E 2 5   ? 23.064  64.410 -56.196 1.00 36.75 ? 5   DT  G C2    1 
ATOM   3660 O  O2    . DT  E 2 5   ? 24.119  64.661 -55.643 1.00 43.15 ? 5   DT  G O2    1 
ATOM   3661 N  N3    . DT  E 2 5   ? 22.557  63.143 -56.245 1.00 31.90 ? 5   DT  G N3    1 
ATOM   3662 C  C4    . DT  E 2 5   ? 21.375  62.747 -56.839 1.00 30.18 ? 5   DT  G C4    1 
ATOM   3663 O  O4    . DT  E 2 5   ? 20.995  61.586 -56.830 1.00 28.21 ? 5   DT  G O4    1 
ATOM   3664 C  C5    . DT  E 2 5   ? 20.619  63.795 -57.479 1.00 30.62 ? 5   DT  G C5    1 
ATOM   3665 C  C7    . DT  E 2 5   ? 19.320  63.480 -58.163 1.00 30.47 ? 5   DT  G C7    1 
ATOM   3666 C  C6    . DT  E 2 5   ? 21.108  65.035 -57.436 1.00 32.05 ? 5   DT  G C6    1 
ATOM   3667 P  P     . DA  E 2 6   ? 24.260  70.239 -59.194 1.00 55.46 ? 6   DA  G P     1 
ATOM   3668 O  OP1   . DA  E 2 6   ? 24.764  71.614 -58.987 1.00 57.07 ? 6   DA  G OP1   1 
ATOM   3669 O  OP2   . DA  E 2 6   ? 23.450  69.914 -60.392 1.00 55.73 ? 6   DA  G OP2   1 
ATOM   3670 O  "O5'" . DA  E 2 6   ? 25.499  69.235 -59.149 1.00 52.15 ? 6   DA  G "O5'" 1 
ATOM   3671 C  "C5'" . DA  E 2 6   ? 26.236  69.154 -57.938 1.00 51.78 ? 6   DA  G "C5'" 1 
ATOM   3672 C  "C4'" . DA  E 2 6   ? 27.409  68.206 -58.090 1.00 53.44 ? 6   DA  G "C4'" 1 
ATOM   3673 O  "O4'" . DA  E 2 6   ? 26.965  66.836 -57.936 1.00 51.41 ? 6   DA  G "O4'" 1 
ATOM   3674 C  "C3'" . DA  E 2 6   ? 28.112  68.284 -59.436 1.00 56.19 ? 6   DA  G "C3'" 1 
ATOM   3675 O  "O3'" . DA  E 2 6   ? 29.507  68.224 -59.201 1.00 60.15 ? 6   DA  G "O3'" 1 
ATOM   3676 C  "C2'" . DA  E 2 6   ? 27.602  67.064 -60.198 1.00 53.20 ? 6   DA  G "C2'" 1 
ATOM   3677 C  "C1'" . DA  E 2 6   ? 27.274  66.077 -59.084 1.00 49.03 ? 6   DA  G "C1'" 1 
ATOM   3678 N  N9    . DA  E 2 6   ? 26.104  65.255 -59.358 1.00 45.41 ? 6   DA  G N9    1 
ATOM   3679 C  C8    . DA  E 2 6   ? 25.006  65.613 -60.088 1.00 46.61 ? 6   DA  G C8    1 
ATOM   3680 N  N7    . DA  E 2 6   ? 24.095  64.673 -60.162 1.00 45.06 ? 6   DA  G N7    1 
ATOM   3681 C  C5    . DA  E 2 6   ? 24.629  63.629 -59.425 1.00 39.77 ? 6   DA  G C5    1 
ATOM   3682 C  C6    . DA  E 2 6   ? 24.152  62.342 -59.122 1.00 38.26 ? 6   DA  G C6    1 
ATOM   3683 N  N6    . DA  E 2 6   ? 22.970  61.878 -59.544 1.00 40.35 ? 6   DA  G N6    1 
ATOM   3684 N  N1    . DA  E 2 6   ? 24.937  61.545 -58.366 1.00 37.70 ? 6   DA  G N1    1 
ATOM   3685 C  C2    . DA  E 2 6   ? 26.119  62.014 -57.947 1.00 35.98 ? 6   DA  G C2    1 
ATOM   3686 N  N3    . DA  E 2 6   ? 26.670  63.207 -58.167 1.00 39.12 ? 6   DA  G N3    1 
ATOM   3687 C  C4    . DA  E 2 6   ? 25.867  63.973 -58.919 1.00 40.37 ? 6   DA  G C4    1 
ATOM   3688 P  P     . DG  E 2 7   ? 30.545  68.532 -60.385 1.00 67.57 ? 7   DG  G P     1 
ATOM   3689 O  OP1   . DG  E 2 7   ? 31.636  69.331 -59.787 1.00 69.89 ? 7   DG  G OP1   1 
ATOM   3690 O  OP2   . DG  E 2 7   ? 29.807  69.037 -61.566 1.00 67.89 ? 7   DG  G OP2   1 
ATOM   3691 O  "O5'" . DG  E 2 7   ? 31.116  67.090 -60.754 1.00 55.60 ? 7   DG  G "O5'" 1 
ATOM   3692 C  "C5'" . DG  E 2 7   ? 31.699  66.341 -59.708 1.00 53.79 ? 7   DG  G "C5'" 1 
ATOM   3693 C  "C4'" . DG  E 2 7   ? 31.549  64.860 -59.977 1.00 53.48 ? 7   DG  G "C4'" 1 
ATOM   3694 O  "O4'" . DG  E 2 7   ? 30.154  64.527 -60.177 1.00 51.75 ? 7   DG  G "O4'" 1 
ATOM   3695 C  "C3'" . DG  E 2 7   ? 32.297  64.337 -61.202 1.00 54.77 ? 7   DG  G "C3'" 1 
ATOM   3696 O  "O3'" . DG  E 2 7   ? 33.304  63.473 -60.682 1.00 57.82 ? 7   DG  G "O3'" 1 
ATOM   3697 C  "C2'" . DG  E 2 7   ? 31.219  63.633 -62.030 1.00 51.12 ? 7   DG  G "C2'" 1 
ATOM   3698 C  "C1'" . DG  E 2 7   ? 30.144  63.373 -60.984 1.00 48.30 ? 7   DG  G "C1'" 1 
ATOM   3699 N  N9    . DG  E 2 7   ? 28.790  63.183 -61.490 1.00 42.59 ? 7   DG  G N9    1 
ATOM   3700 C  C8    . DG  E 2 7   ? 28.027  64.056 -62.226 1.00 40.50 ? 7   DG  G C8    1 
ATOM   3701 N  N7    . DG  E 2 7   ? 26.844  63.583 -62.513 1.00 39.72 ? 7   DG  G N7    1 
ATOM   3702 C  C5    . DG  E 2 7   ? 26.827  62.321 -61.927 1.00 37.06 ? 7   DG  G C5    1 
ATOM   3703 C  C6    . DG  E 2 7   ? 25.817  61.332 -61.901 1.00 34.47 ? 7   DG  G C6    1 
ATOM   3704 O  O6    . DG  E 2 7   ? 24.693  61.381 -62.412 1.00 32.47 ? 7   DG  G O6    1 
ATOM   3705 N  N1    . DG  E 2 7   ? 26.218  60.195 -61.195 1.00 34.79 ? 7   DG  G N1    1 
ATOM   3706 C  C2    . DG  E 2 7   ? 27.444  60.035 -60.593 1.00 34.84 ? 7   DG  G C2    1 
ATOM   3707 N  N2    . DG  E 2 7   ? 27.660  58.874 -59.957 1.00 34.65 ? 7   DG  G N2    1 
ATOM   3708 N  N3    . DG  E 2 7   ? 28.397  60.957 -60.607 1.00 36.64 ? 7   DG  G N3    1 
ATOM   3709 C  C4    . DG  E 2 7   ? 28.018  62.064 -61.293 1.00 38.26 ? 7   DG  G C4    1 
ATOM   3710 P  P     . DA  E 2 8   ? 34.221  62.576 -61.646 1.00 60.88 ? 8   DA  G P     1 
ATOM   3711 O  OP1   . DA  E 2 8   ? 35.578  62.577 -61.059 1.00 65.08 ? 8   DA  G OP1   1 
ATOM   3712 O  OP2   . DA  E 2 8   ? 34.030  62.984 -63.055 1.00 62.07 ? 8   DA  G OP2   1 
ATOM   3713 O  "O5'" . DA  E 2 8   ? 33.617  61.113 -61.464 1.00 58.48 ? 8   DA  G "O5'" 1 
ATOM   3714 C  "C5'" . DA  E 2 8   ? 33.249  60.692 -60.157 1.00 55.04 ? 8   DA  G "C5'" 1 
ATOM   3715 C  "C4'" . DA  E 2 8   ? 32.895  59.214 -60.124 1.00 52.68 ? 8   DA  G "C4'" 1 
ATOM   3716 O  "O4'" . DA  E 2 8   ? 31.531  58.999 -60.569 1.00 50.54 ? 8   DA  G "O4'" 1 
ATOM   3717 C  "C3'" . DA  E 2 8   ? 33.746  58.305 -60.999 1.00 52.47 ? 8   DA  G "C3'" 1 
ATOM   3718 O  "O3'" . DA  E 2 8   ? 33.812  57.055 -60.329 1.00 53.07 ? 8   DA  G "O3'" 1 
ATOM   3719 C  "C2'" . DA  E 2 8   ? 32.953  58.238 -62.305 1.00 48.64 ? 8   DA  G "C2'" 1 
ATOM   3720 C  "C1'" . DA  E 2 8   ? 31.514  58.300 -61.804 1.00 45.83 ? 8   DA  G "C1'" 1 
ATOM   3721 N  N9    . DA  E 2 8   ? 30.568  59.031 -62.641 1.00 40.83 ? 8   DA  G N9    1 
ATOM   3722 C  C8    . DA  E 2 8   ? 30.723  60.277 -63.183 1.00 40.75 ? 8   DA  G C8    1 
ATOM   3723 N  N7    . DA  E 2 8   ? 29.680  60.690 -63.866 1.00 37.94 ? 8   DA  G N7    1 
ATOM   3724 C  C5    . DA  E 2 8   ? 28.780  59.644 -63.763 1.00 34.63 ? 8   DA  G C5    1 
ATOM   3725 C  C6    . DA  E 2 8   ? 27.479  59.456 -64.269 1.00 33.33 ? 8   DA  G C6    1 
ATOM   3726 N  N6    . DA  E 2 8   ? 26.838  60.368 -65.008 1.00 31.18 ? 8   DA  G N6    1 
ATOM   3727 N  N1    . DA  E 2 8   ? 26.855  58.291 -63.978 1.00 32.69 ? 8   DA  G N1    1 
ATOM   3728 C  C2    . DA  E 2 8   ? 27.490  57.385 -63.229 1.00 30.57 ? 8   DA  G C2    1 
ATOM   3729 N  N3    . DA  E 2 8   ? 28.710  57.450 -62.701 1.00 33.86 ? 8   DA  G N3    1 
ATOM   3730 C  C4    . DA  E 2 8   ? 29.306  58.617 -63.005 1.00 36.92 ? 8   DA  G C4    1 
ATOM   3731 P  P     . DA  E 2 9   ? 34.796  55.899 -60.848 1.00 68.43 ? 9   DA  G P     1 
ATOM   3732 O  OP1   . DA  E 2 9   ? 35.263  55.165 -59.649 1.00 69.38 ? 9   DA  G OP1   1 
ATOM   3733 O  OP2   . DA  E 2 9   ? 35.772  56.508 -61.780 1.00 68.21 ? 9   DA  G OP2   1 
ATOM   3734 O  "O5'" . DA  E 2 9   ? 33.834  54.942 -61.693 1.00 53.88 ? 9   DA  G "O5'" 1 
ATOM   3735 C  "C5'" . DA  E 2 9   ? 32.588  54.546 -61.130 1.00 50.35 ? 9   DA  G "C5'" 1 
ATOM   3736 C  "C4'" . DA  E 2 9   ? 31.779  53.778 -62.159 1.00 49.58 ? 9   DA  G "C4'" 1 
ATOM   3737 O  "O4'" . DA  E 2 9   ? 30.913  54.688 -62.883 1.00 47.60 ? 9   DA  G "O4'" 1 
ATOM   3738 C  "C3'" . DA  E 2 9   ? 32.612  53.047 -63.211 1.00 50.80 ? 9   DA  G "C3'" 1 
ATOM   3739 O  "O3'" . DA  E 2 9   ? 32.090  51.740 -63.376 1.00 51.71 ? 9   DA  G "O3'" 1 
ATOM   3740 C  "C2'" . DA  E 2 9   ? 32.418  53.886 -64.472 1.00 49.29 ? 9   DA  G "C2'" 1 
ATOM   3741 C  "C1'" . DA  E 2 9   ? 30.998  54.398 -64.264 1.00 46.05 ? 9   DA  G "C1'" 1 
ATOM   3742 N  N9    . DA  E 2 9   ? 30.688  55.617 -65.003 1.00 40.79 ? 9   DA  G N9    1 
ATOM   3743 C  C8    . DA  E 2 9   ? 31.509  56.691 -65.204 1.00 38.96 ? 9   DA  G C8    1 
ATOM   3744 N  N7    . DA  E 2 9   ? 30.953  57.652 -65.900 1.00 39.45 ? 9   DA  G N7    1 
ATOM   3745 C  C5    . DA  E 2 9   ? 29.678  57.179 -66.173 1.00 39.16 ? 9   DA  G C5    1 
ATOM   3746 C  C6    . DA  E 2 9   ? 28.587  57.725 -66.882 1.00 37.50 ? 9   DA  G C6    1 
ATOM   3747 N  N6    . DA  E 2 9   ? 28.616  58.926 -67.471 1.00 35.15 ? 9   DA  G N6    1 
ATOM   3748 N  N1    . DA  E 2 9   ? 27.461  56.986 -66.965 1.00 33.75 ? 9   DA  G N1    1 
ATOM   3749 C  C2    . DA  E 2 9   ? 27.429  55.785 -66.376 1.00 34.48 ? 9   DA  G C2    1 
ATOM   3750 N  N3    . DA  E 2 9   ? 28.389  55.165 -65.689 1.00 35.89 ? 9   DA  G N3    1 
ATOM   3751 C  C4    . DA  E 2 9   ? 29.498  55.923 -65.624 1.00 39.02 ? 9   DA  G C4    1 
ATOM   3752 P  P     . DC  E 2 10  ? 32.980  50.583 -64.046 1.00 61.15 ? 10  DC  G P     1 
ATOM   3753 O  OP1   . DC  E 2 10  ? 32.840  49.398 -63.171 1.00 60.93 ? 10  DC  G OP1   1 
ATOM   3754 O  OP2   . DC  E 2 10  ? 34.323  51.115 -64.374 1.00 59.89 ? 10  DC  G OP2   1 
ATOM   3755 O  "O5'" . DC  E 2 10  ? 32.234  50.296 -65.428 1.00 59.05 ? 10  DC  G "O5'" 1 
ATOM   3756 C  "C5'" . DC  E 2 10  ? 30.831  50.086 -65.373 1.00 55.94 ? 10  DC  G "C5'" 1 
ATOM   3757 C  "C4'" . DC  E 2 10  ? 30.148  50.494 -66.663 1.00 55.03 ? 10  DC  G "C4'" 1 
ATOM   3758 O  "O4'" . DC  E 2 10  ? 30.107  51.928 -66.840 1.00 52.19 ? 10  DC  G "O4'" 1 
ATOM   3759 C  "C3'" . DC  E 2 10  ? 30.820  50.031 -67.951 1.00 57.78 ? 10  DC  G "C3'" 1 
ATOM   3760 O  "O3'" . DC  E 2 10  ? 30.197  48.844 -68.428 1.00 62.57 ? 10  DC  G "O3'" 1 
ATOM   3761 C  "C2'" . DC  E 2 10  ? 30.625  51.184 -68.946 1.00 54.81 ? 10  DC  G "C2'" 1 
ATOM   3762 C  "C1'" . DC  E 2 10  ? 29.822  52.228 -68.177 1.00 49.52 ? 10  DC  G "C1'" 1 
ATOM   3763 N  N1    . DC  E 2 10  ? 30.253  53.626 -68.446 1.00 44.11 ? 10  DC  G N1    1 
ATOM   3764 C  C2    . DC  E 2 10  ? 29.299  54.498 -68.974 1.00 41.96 ? 10  DC  G C2    1 
ATOM   3765 O  O2    . DC  E 2 10  ? 28.147  54.079 -69.144 1.00 37.59 ? 10  DC  G O2    1 
ATOM   3766 N  N3    . DC  E 2 10  ? 29.656  55.771 -69.264 1.00 38.40 ? 10  DC  G N3    1 
ATOM   3767 C  C4    . DC  E 2 10  ? 30.909  56.173 -69.049 1.00 39.08 ? 10  DC  G C4    1 
ATOM   3768 N  N4    . DC  E 2 10  ? 31.208  57.439 -69.351 1.00 39.56 ? 10  DC  G N4    1 
ATOM   3769 C  C5    . DC  E 2 10  ? 31.903  55.297 -68.517 1.00 40.94 ? 10  DC  G C5    1 
ATOM   3770 C  C6    . DC  E 2 10  ? 31.538  54.038 -68.239 1.00 42.65 ? 10  DC  G C6    1 
ATOM   3771 O  OP3   . DG  F 2 1   ? 22.734  63.405 -76.929 1.00 56.40 ? 1   DG  H OP3   1 
ATOM   3772 P  P     . DG  F 2 1   ? 24.016  62.920 -76.104 1.00 57.55 ? 1   DG  H P     1 
ATOM   3773 O  OP1   . DG  F 2 1   ? 25.094  62.655 -77.079 1.00 58.22 ? 1   DG  H OP1   1 
ATOM   3774 O  OP2   . DG  F 2 1   ? 24.243  63.881 -75.003 1.00 56.22 ? 1   DG  H OP2   1 
ATOM   3775 O  "O5'" . DG  F 2 1   ? 23.637  61.528 -75.419 1.00 49.99 ? 1   DG  H "O5'" 1 
ATOM   3776 C  "C5'" . DG  F 2 1   ? 23.203  60.448 -76.234 1.00 47.39 ? 1   DG  H "C5'" 1 
ATOM   3777 C  "C4'" . DG  F 2 1   ? 22.549  59.377 -75.380 1.00 42.61 ? 1   DG  H "C4'" 1 
ATOM   3778 O  "O4'" . DG  F 2 1   ? 23.564  58.637 -74.659 1.00 39.66 ? 1   DG  H "O4'" 1 
ATOM   3779 C  "C3'" . DG  F 2 1   ? 21.580  59.901 -74.331 1.00 40.58 ? 1   DG  H "C3'" 1 
ATOM   3780 O  "O3'" . DG  F 2 1   ? 20.480  59.004 -74.259 1.00 43.61 ? 1   DG  H "O3'" 1 
ATOM   3781 C  "C2'" . DG  F 2 1   ? 22.402  59.925 -73.042 1.00 38.45 ? 1   DG  H "C2'" 1 
ATOM   3782 C  "C1'" . DG  F 2 1   ? 23.435  58.828 -73.261 1.00 39.41 ? 1   DG  H "C1'" 1 
ATOM   3783 N  N9    . DG  F 2 1   ? 24.766  59.161 -72.771 1.00 39.73 ? 1   DG  H N9    1 
ATOM   3784 C  C8    . DG  F 2 1   ? 25.447  60.343 -72.941 1.00 41.62 ? 1   DG  H C8    1 
ATOM   3785 N  N7    . DG  F 2 1   ? 26.633  60.337 -72.400 1.00 41.76 ? 1   DG  H N7    1 
ATOM   3786 C  C5    . DG  F 2 1   ? 26.746  59.068 -71.845 1.00 38.22 ? 1   DG  H C5    1 
ATOM   3787 C  C6    . DG  F 2 1   ? 27.812  58.477 -71.132 1.00 38.79 ? 1   DG  H C6    1 
ATOM   3788 O  O6    . DG  F 2 1   ? 28.904  58.980 -70.838 1.00 40.16 ? 1   DG  H O6    1 
ATOM   3789 N  N1    . DG  F 2 1   ? 27.516  57.170 -70.752 1.00 37.85 ? 1   DG  H N1    1 
ATOM   3790 C  C2    . DG  F 2 1   ? 26.335  56.521 -71.027 1.00 36.55 ? 1   DG  H C2    1 
ATOM   3791 N  N2    . DG  F 2 1   ? 26.221  55.263 -70.580 1.00 36.02 ? 1   DG  H N2    1 
ATOM   3792 N  N3    . DG  F 2 1   ? 25.327  57.063 -71.692 1.00 36.03 ? 1   DG  H N3    1 
ATOM   3793 C  C4    . DG  F 2 1   ? 25.605  58.332 -72.069 1.00 36.91 ? 1   DG  H C4    1 
ATOM   3794 P  P     . DT  F 2 2   ? 19.394  59.117 -73.079 1.00 48.26 ? 2   DT  H P     1 
ATOM   3795 O  OP1   . DT  F 2 2   ? 18.114  58.640 -73.649 1.00 50.01 ? 2   DT  H OP1   1 
ATOM   3796 O  OP2   . DT  F 2 2   ? 19.466  60.461 -72.464 1.00 47.18 ? 2   DT  H OP2   1 
ATOM   3797 O  "O5'" . DT  F 2 2   ? 19.892  58.047 -72.003 1.00 42.91 ? 2   DT  H "O5'" 1 
ATOM   3798 C  "C5'" . DT  F 2 2   ? 20.113  56.711 -72.439 1.00 40.21 ? 2   DT  H "C5'" 1 
ATOM   3799 C  "C4'" . DT  F 2 2   ? 20.497  55.812 -71.278 1.00 36.86 ? 2   DT  H "C4'" 1 
ATOM   3800 O  "O4'" . DT  F 2 2   ? 21.833  56.137 -70.821 1.00 35.09 ? 2   DT  H "O4'" 1 
ATOM   3801 C  "C3'" . DT  F 2 2   ? 19.598  55.891 -70.050 1.00 35.79 ? 2   DT  H "C3'" 1 
ATOM   3802 O  "O3'" . DT  F 2 2   ? 19.348  54.546 -69.643 1.00 35.55 ? 2   DT  H "O3'" 1 
ATOM   3803 C  "C2'" . DT  F 2 2   ? 20.423  56.695 -69.040 1.00 33.78 ? 2   DT  H "C2'" 1 
ATOM   3804 C  "C1'" . DT  F 2 2   ? 21.842  56.289 -69.414 1.00 32.40 ? 2   DT  H "C1'" 1 
ATOM   3805 N  N1    . DT  F 2 2   ? 22.936  57.266 -69.132 1.00 33.46 ? 2   DT  H N1    1 
ATOM   3806 C  C2    . DT  F 2 2   ? 24.044  56.828 -68.442 1.00 32.76 ? 2   DT  H C2    1 
ATOM   3807 O  O2    . DT  F 2 2   ? 24.157  55.692 -68.026 1.00 35.41 ? 2   DT  H O2    1 
ATOM   3808 N  N3    . DT  F 2 2   ? 25.020  57.768 -68.251 1.00 33.00 ? 2   DT  H N3    1 
ATOM   3809 C  C4    . DT  F 2 2   ? 24.998  59.083 -68.674 1.00 35.55 ? 2   DT  H C4    1 
ATOM   3810 O  O4    . DT  F 2 2   ? 25.927  59.853 -68.456 1.00 34.44 ? 2   DT  H O4    1 
ATOM   3811 C  C5    . DT  F 2 2   ? 23.815  59.484 -69.392 1.00 35.10 ? 2   DT  H C5    1 
ATOM   3812 C  C7    . DT  F 2 2   ? 23.696  60.894 -69.895 1.00 37.77 ? 2   DT  H C7    1 
ATOM   3813 C  C6    . DT  F 2 2   ? 22.855  58.569 -69.594 1.00 33.70 ? 2   DT  H C6    1 
ATOM   3814 P  P     . DT  F 2 3   ? 18.263  54.212 -68.504 1.00 42.99 ? 3   DT  H P     1 
ATOM   3815 O  OP1   . DT  F 2 3   ? 17.557  52.983 -68.931 1.00 44.35 ? 3   DT  H OP1   1 
ATOM   3816 O  OP2   . DT  F 2 3   ? 17.502  55.438 -68.176 1.00 43.37 ? 3   DT  H OP2   1 
ATOM   3817 O  "O5'" . DT  F 2 3   ? 19.158  53.866 -67.236 1.00 36.25 ? 3   DT  H "O5'" 1 
ATOM   3818 C  "C5'" . DT  F 2 3   ? 20.124  52.841 -67.355 1.00 34.28 ? 3   DT  H "C5'" 1 
ATOM   3819 C  "C4'" . DT  F 2 3   ? 21.067  52.913 -66.173 1.00 33.72 ? 3   DT  H "C4'" 1 
ATOM   3820 O  "O4'" . DT  F 2 3   ? 21.905  54.085 -66.301 1.00 29.31 ? 3   DT  H "O4'" 1 
ATOM   3821 C  "C3'" . DT  F 2 3   ? 20.408  52.998 -64.795 1.00 30.54 ? 3   DT  H "C3'" 1 
ATOM   3822 O  "O3'" . DT  F 2 3   ? 20.829  51.827 -64.110 1.00 30.40 ? 3   DT  H "O3'" 1 
ATOM   3823 C  "C2'" . DT  F 2 3   ? 20.943  54.302 -64.188 1.00 27.43 ? 3   DT  H "C2'" 1 
ATOM   3824 C  "C1'" . DT  F 2 3   ? 22.216  54.527 -64.999 1.00 28.70 ? 3   DT  H "C1'" 1 
ATOM   3825 N  N1    . DT  F 2 3   ? 22.678  55.938 -65.126 1.00 28.80 ? 3   DT  H N1    1 
ATOM   3826 C  C2    . DT  F 2 3   ? 23.968  56.252 -64.764 1.00 32.59 ? 3   DT  H C2    1 
ATOM   3827 O  O2    . DT  F 2 3   ? 24.749  55.435 -64.325 1.00 33.11 ? 3   DT  H O2    1 
ATOM   3828 N  N3    . DT  F 2 3   ? 24.313  57.572 -64.928 1.00 29.95 ? 3   DT  H N3    1 
ATOM   3829 C  C4    . DT  F 2 3   ? 23.505  58.580 -65.422 1.00 30.58 ? 3   DT  H C4    1 
ATOM   3830 O  O4    . DT  F 2 3   ? 23.909  59.737 -65.541 1.00 29.94 ? 3   DT  H O4    1 
ATOM   3831 C  C5    . DT  F 2 3   ? 22.167  58.181 -65.789 1.00 28.87 ? 3   DT  H C5    1 
ATOM   3832 C  C7    . DT  F 2 3   ? 21.203  59.194 -66.331 1.00 29.64 ? 3   DT  H C7    1 
ATOM   3833 C  C6    . DT  F 2 3   ? 21.822  56.892 -65.636 1.00 28.28 ? 3   DT  H C6    1 
ATOM   3834 P  P     . DC  F 2 4   ? 20.587  51.628 -62.536 1.00 34.63 ? 4   DC  H P     1 
ATOM   3835 O  OP1   . DC  F 2 4   ? 20.532  50.165 -62.318 1.00 35.97 ? 4   DC  H OP1   1 
ATOM   3836 O  OP2   . DC  F 2 4   ? 19.489  52.503 -62.058 1.00 34.92 ? 4   DC  H OP2   1 
ATOM   3837 O  "O5'" . DC  F 2 4   ? 21.935  52.171 -61.881 1.00 33.59 ? 4   DC  H "O5'" 1 
ATOM   3838 C  "C5'" . DC  F 2 4   ? 23.175  51.645 -62.333 1.00 34.33 ? 4   DC  H "C5'" 1 
ATOM   3839 C  "C4'" . DC  F 2 4   ? 24.284  52.169 -61.446 1.00 38.35 ? 4   DC  H "C4'" 1 
ATOM   3840 O  "O4'" . DC  F 2 4   ? 24.532  53.560 -61.763 1.00 37.24 ? 4   DC  H "O4'" 1 
ATOM   3841 C  "C3'" . DC  F 2 4   ? 23.979  52.110 -59.953 1.00 39.27 ? 4   DC  H "C3'" 1 
ATOM   3842 O  "O3'" . DC  F 2 4   ? 25.080  51.455 -59.330 1.00 43.71 ? 4   DC  H "O3'" 1 
ATOM   3843 C  "C2'" . DC  F 2 4   ? 23.802  53.571 -59.530 1.00 36.36 ? 4   DC  H "C2'" 1 
ATOM   3844 C  "C1'" . DC  F 2 4   ? 24.594  54.338 -60.587 1.00 35.31 ? 4   DC  H "C1'" 1 
ATOM   3845 N  N1    . DC  F 2 4   ? 24.078  55.690 -60.974 1.00 32.04 ? 4   DC  H N1    1 
ATOM   3846 C  C2    . DC  F 2 4   ? 24.896  56.817 -60.819 1.00 31.72 ? 4   DC  H C2    1 
ATOM   3847 O  O2    . DC  F 2 4   ? 26.027  56.679 -60.336 1.00 29.57 ? 4   DC  H O2    1 
ATOM   3848 N  N3    . DC  F 2 4   ? 24.423  58.033 -61.194 1.00 31.44 ? 4   DC  H N3    1 
ATOM   3849 C  C4    . DC  F 2 4   ? 23.197  58.142 -61.707 1.00 29.86 ? 4   DC  H C4    1 
ATOM   3850 N  N4    . DC  F 2 4   ? 22.777  59.362 -62.055 1.00 30.83 ? 4   DC  H N4    1 
ATOM   3851 C  C5    . DC  F 2 4   ? 22.348  57.007 -61.875 1.00 28.81 ? 4   DC  H C5    1 
ATOM   3852 C  C6    . DC  F 2 4   ? 22.829  55.813 -61.508 1.00 30.76 ? 4   DC  H C6    1 
ATOM   3853 P  P     . DT  F 2 5   ? 25.100  51.200 -57.742 1.00 46.99 ? 5   DT  H P     1 
ATOM   3854 O  OP1   . DT  F 2 5   ? 25.884  49.959 -57.554 1.00 47.35 ? 5   DT  H OP1   1 
ATOM   3855 O  OP2   . DT  F 2 5   ? 23.723  51.330 -57.207 1.00 42.63 ? 5   DT  H OP2   1 
ATOM   3856 O  "O5'" . DT  F 2 5   ? 25.924  52.445 -57.163 1.00 51.72 ? 5   DT  H "O5'" 1 
ATOM   3857 C  "C5'" . DT  F 2 5   ? 27.220  52.743 -57.660 1.00 52.06 ? 5   DT  H "C5'" 1 
ATOM   3858 C  "C4'" . DT  F 2 5   ? 27.783  53.937 -56.912 1.00 52.65 ? 5   DT  H "C4'" 1 
ATOM   3859 O  "O4'" . DT  F 2 5   ? 27.196  55.165 -57.408 1.00 49.42 ? 5   DT  H "O4'" 1 
ATOM   3860 C  "C3'" . DT  F 2 5   ? 27.531  53.913 -55.409 1.00 53.42 ? 5   DT  H "C3'" 1 
ATOM   3861 O  "O3'" . DT  F 2 5   ? 28.800  54.010 -54.762 1.00 58.45 ? 5   DT  H "O3'" 1 
ATOM   3862 C  "C2'" . DT  F 2 5   ? 26.600  55.101 -55.135 1.00 48.31 ? 5   DT  H "C2'" 1 
ATOM   3863 C  "C1'" . DT  F 2 5   ? 26.838  56.012 -56.335 1.00 46.13 ? 5   DT  H "C1'" 1 
ATOM   3864 N  N1    . DT  F 2 5   ? 25.671  56.798 -56.834 1.00 39.55 ? 5   DT  H N1    1 
ATOM   3865 C  C2    . DT  F 2 5   ? 25.829  58.146 -57.081 1.00 35.84 ? 5   DT  H C2    1 
ATOM   3866 O  O2    . DT  F 2 5   ? 26.876  58.733 -56.883 1.00 34.29 ? 5   DT  H O2    1 
ATOM   3867 N  N3    . DT  F 2 5   ? 24.712  58.787 -57.561 1.00 33.09 ? 5   DT  H N3    1 
ATOM   3868 C  C4    . DT  F 2 5   ? 23.480  58.213 -57.818 1.00 34.01 ? 5   DT  H C4    1 
ATOM   3869 O  O4    . DT  F 2 5   ? 22.529  58.853 -58.252 1.00 36.33 ? 5   DT  H O4    1 
ATOM   3870 C  C5    . DT  F 2 5   ? 23.384  56.804 -57.542 1.00 35.56 ? 5   DT  H C5    1 
ATOM   3871 C  C7    . DT  F 2 5   ? 22.089  56.091 -57.783 1.00 36.40 ? 5   DT  H C7    1 
ATOM   3872 C  C6    . DT  F 2 5   ? 24.468  56.168 -57.074 1.00 39.30 ? 5   DT  H C6    1 
ATOM   3873 P  P     . DA  F 2 6   ? 28.919  53.889 -53.164 1.00 78.53 ? 6   DA  H P     1 
ATOM   3874 O  OP1   . DA  F 2 6   ? 30.205  53.212 -52.878 1.00 78.76 ? 6   DA  H OP1   1 
ATOM   3875 O  OP2   . DA  F 2 6   ? 27.653  53.337 -52.632 1.00 77.62 ? 6   DA  H OP2   1 
ATOM   3876 O  "O5'" . DA  F 2 6   ? 29.020  55.408 -52.684 1.00 55.61 ? 6   DA  H "O5'" 1 
ATOM   3877 C  "C5'" . DA  F 2 6   ? 30.022  56.213 -53.280 1.00 54.67 ? 6   DA  H "C5'" 1 
ATOM   3878 C  "C4'" . DA  F 2 6   ? 29.905  57.652 -52.821 1.00 52.45 ? 6   DA  H "C4'" 1 
ATOM   3879 O  "O4'" . DA  F 2 6   ? 28.785  58.289 -53.480 1.00 49.16 ? 6   DA  H "O4'" 1 
ATOM   3880 C  "C3'" . DA  F 2 6   ? 29.702  57.851 -51.324 1.00 51.49 ? 6   DA  H "C3'" 1 
ATOM   3881 O  "O3'" . DA  F 2 6   ? 30.587  58.892 -50.938 1.00 52.36 ? 6   DA  H "O3'" 1 
ATOM   3882 C  "C2'" . DA  F 2 6   ? 28.227  58.235 -51.207 1.00 48.90 ? 6   DA  H "C2'" 1 
ATOM   3883 C  "C1'" . DA  F 2 6   ? 27.973  58.947 -52.532 1.00 46.57 ? 6   DA  H "C1'" 1 
ATOM   3884 N  N9    . DA  F 2 6   ? 26.610  58.858 -53.046 1.00 40.83 ? 6   DA  H N9    1 
ATOM   3885 C  C8    . DA  F 2 6   ? 25.782  57.770 -53.009 1.00 39.02 ? 6   DA  H C8    1 
ATOM   3886 N  N7    . DA  F 2 6   ? 24.614  57.980 -53.571 1.00 37.21 ? 6   DA  H N7    1 
ATOM   3887 C  C5    . DA  F 2 6   ? 24.687  59.291 -54.015 1.00 33.49 ? 6   DA  H C5    1 
ATOM   3888 C  C6    . DA  F 2 6   ? 23.769  60.119 -54.694 1.00 31.57 ? 6   DA  H C6    1 
ATOM   3889 N  N6    . DA  F 2 6   ? 22.546  59.718 -55.059 1.00 30.50 ? 6   DA  H N6    1 
ATOM   3890 N  N1    . DA  F 2 6   ? 24.157  61.376 -54.982 1.00 30.92 ? 6   DA  H N1    1 
ATOM   3891 C  C2    . DA  F 2 6   ? 25.381  61.779 -54.614 1.00 30.85 ? 6   DA  H C2    1 
ATOM   3892 N  N3    . DA  F 2 6   ? 26.324  61.093 -53.977 1.00 32.31 ? 6   DA  H N3    1 
ATOM   3893 C  C4    . DA  F 2 6   ? 25.911  59.846 -53.705 1.00 33.78 ? 6   DA  H C4    1 
ATOM   3894 P  P     . DG  F 2 7   ? 30.717  59.338 -49.400 1.00 63.75 ? 7   DG  H P     1 
ATOM   3895 O  OP1   . DG  F 2 7   ? 32.156  59.573 -49.143 1.00 64.65 ? 7   DG  H OP1   1 
ATOM   3896 O  OP2   . DG  F 2 7   ? 29.960  58.384 -48.559 1.00 62.14 ? 7   DG  H OP2   1 
ATOM   3897 O  "O5'" . DG  F 2 7   ? 29.967  60.748 -49.360 1.00 47.25 ? 7   DG  H "O5'" 1 
ATOM   3898 C  "C5'" . DG  F 2 7   ? 30.341  61.713 -50.338 1.00 47.17 ? 7   DG  H "C5'" 1 
ATOM   3899 C  "C4'" . DG  F 2 7   ? 29.463  62.943 -50.241 1.00 45.04 ? 7   DG  H "C4'" 1 
ATOM   3900 O  "O4'" . DG  F 2 7   ? 28.188  62.702 -50.888 1.00 42.74 ? 7   DG  H "O4'" 1 
ATOM   3901 C  "C3'" . DG  F 2 7   ? 29.152  63.383 -48.815 1.00 43.03 ? 7   DG  H "C3'" 1 
ATOM   3902 O  "O3'" . DG  F 2 7   ? 29.356  64.788 -48.763 1.00 41.66 ? 7   DG  H "O3'" 1 
ATOM   3903 C  "C2'" . DG  F 2 7   ? 27.696  62.960 -48.612 1.00 41.36 ? 7   DG  H "C2'" 1 
ATOM   3904 C  "C1'" . DG  F 2 7   ? 27.132  63.077 -50.023 1.00 39.32 ? 7   DG  H "C1'" 1 
ATOM   3905 N  N9    . DG  F 2 7   ? 26.002  62.205 -50.348 1.00 33.82 ? 7   DG  H N9    1 
ATOM   3906 C  C8    . DG  F 2 7   ? 25.861  60.862 -50.080 1.00 31.90 ? 7   DG  H C8    1 
ATOM   3907 N  N7    . DG  F 2 7   ? 24.738  60.359 -50.523 1.00 30.70 ? 7   DG  H N7    1 
ATOM   3908 C  C5    . DG  F 2 7   ? 24.095  61.437 -51.132 1.00 28.52 ? 7   DG  H C5    1 
ATOM   3909 C  C6    . DG  F 2 7   ? 22.842  61.515 -51.792 1.00 24.05 ? 7   DG  H C6    1 
ATOM   3910 O  O6    . DG  F 2 7   ? 22.013  60.615 -51.983 1.00 26.04 ? 7   DG  H O6    1 
ATOM   3911 N  N1    . DG  F 2 7   ? 22.576  62.797 -52.254 1.00 24.53 ? 7   DG  H N1    1 
ATOM   3912 C  C2    . DG  F 2 7   ? 23.420  63.873 -52.106 1.00 28.40 ? 7   DG  H C2    1 
ATOM   3913 N  N2    . DG  F 2 7   ? 23.002  65.038 -52.622 1.00 28.68 ? 7   DG  H N2    1 
ATOM   3914 N  N3    . DG  F 2 7   ? 24.595  63.817 -51.497 1.00 28.69 ? 7   DG  H N3    1 
ATOM   3915 C  C4    . DG  F 2 7   ? 24.865  62.575 -51.032 1.00 28.98 ? 7   DG  H C4    1 
ATOM   3916 P  P     . DA  F 2 8   ? 29.151  65.598 -47.391 1.00 40.36 ? 8   DA  H P     1 
ATOM   3917 O  OP1   . DA  F 2 8   ? 29.984  66.818 -47.486 1.00 43.33 ? 8   DA  H OP1   1 
ATOM   3918 O  OP2   . DA  F 2 8   ? 29.304  64.673 -46.247 1.00 40.71 ? 8   DA  H OP2   1 
ATOM   3919 O  "O5'" . DA  F 2 8   ? 27.617  66.032 -47.445 1.00 31.11 ? 8   DA  H "O5'" 1 
ATOM   3920 C  "C5'" . DA  F 2 8   ? 27.167  66.846 -48.515 1.00 27.65 ? 8   DA  H "C5'" 1 
ATOM   3921 C  "C4'" . DA  F 2 8   ? 25.692  67.120 -48.324 1.00 25.56 ? 8   DA  H "C4'" 1 
ATOM   3922 O  "O4'" . DA  F 2 8   ? 24.920  65.989 -48.796 1.00 25.93 ? 8   DA  H "O4'" 1 
ATOM   3923 C  "C3'" . DA  F 2 8   ? 25.281  67.342 -46.872 1.00 24.35 ? 8   DA  H "C3'" 1 
ATOM   3924 O  "O3'" . DA  F 2 8   ? 24.804  68.677 -46.778 1.00 19.96 ? 8   DA  H "O3'" 1 
ATOM   3925 C  "C2'" . DA  F 2 8   ? 24.181  66.305 -46.613 1.00 23.68 ? 8   DA  H "C2'" 1 
ATOM   3926 C  "C1'" . DA  F 2 8   ? 23.749  65.907 -48.024 1.00 23.70 ? 8   DA  H "C1'" 1 
ATOM   3927 N  N9    . DA  F 2 8   ? 23.219  64.550 -48.156 1.00 23.76 ? 8   DA  H N9    1 
ATOM   3928 C  C8    . DA  F 2 8   ? 23.766  63.394 -47.677 1.00 23.30 ? 8   DA  H C8    1 
ATOM   3929 N  N7    . DA  F 2 8   ? 23.051  62.328 -47.955 1.00 20.84 ? 8   DA  H N7    1 
ATOM   3930 C  C5    . DA  F 2 8   ? 21.969  62.811 -48.666 1.00 19.24 ? 8   DA  H C5    1 
ATOM   3931 C  C6    . DA  F 2 8   ? 20.846  62.182 -49.249 1.00 20.04 ? 8   DA  H C6    1 
ATOM   3932 N  N6    . DA  F 2 8   ? 20.631  60.857 -49.197 1.00 18.89 ? 8   DA  H N6    1 
ATOM   3933 N  N1    . DA  F 2 8   ? 19.951  62.967 -49.885 1.00 21.02 ? 8   DA  H N1    1 
ATOM   3934 C  C2    . DA  F 2 8   ? 20.163  64.291 -49.936 1.00 22.23 ? 8   DA  H C2    1 
ATOM   3935 N  N3    . DA  F 2 8   ? 21.181  64.988 -49.424 1.00 21.43 ? 8   DA  H N3    1 
ATOM   3936 C  C4    . DA  F 2 8   ? 22.055  64.183 -48.798 1.00 20.52 ? 8   DA  H C4    1 
ATOM   3937 P  P     . DA  F 2 9   ? 24.261  69.260 -45.392 1.00 20.64 ? 9   DA  H P     1 
ATOM   3938 O  OP1   . DA  F 2 9   ? 24.481  70.729 -45.443 1.00 24.29 ? 9   DA  H OP1   1 
ATOM   3939 O  OP2   . DA  F 2 9   ? 24.785  68.461 -44.259 1.00 19.05 ? 9   DA  H OP2   1 
ATOM   3940 O  "O5'" . DA  F 2 9   ? 22.698  68.941 -45.436 1.00 17.17 ? 9   DA  H "O5'" 1 
ATOM   3941 C  "C5'" . DA  F 2 9   ? 21.887  69.432 -46.512 1.00 17.79 ? 9   DA  H "C5'" 1 
ATOM   3942 C  "C4'" . DA  F 2 9   ? 20.464  68.948 -46.294 1.00 18.21 ? 9   DA  H "C4'" 1 
ATOM   3943 O  "O4'" . DA  F 2 9   ? 20.414  67.541 -46.622 1.00 18.85 ? 9   DA  H "O4'" 1 
ATOM   3944 C  "C3'" . DA  F 2 9   ? 19.955  69.059 -44.851 1.00 15.02 ? 9   DA  H "C3'" 1 
ATOM   3945 O  "O3'" . DA  F 2 9   ? 18.696  69.739 -44.838 1.00 20.05 ? 9   DA  H "O3'" 1 
ATOM   3946 C  "C2'" . DA  F 2 9   ? 19.793  67.613 -44.393 1.00 15.69 ? 9   DA  H "C2'" 1 
ATOM   3947 C  "C1'" . DA  F 2 9   ? 19.520  66.933 -45.728 1.00 16.20 ? 9   DA  H "C1'" 1 
ATOM   3948 N  N9    . DA  F 2 9   ? 19.769  65.501 -45.678 1.00 18.93 ? 9   DA  H N9    1 
ATOM   3949 C  C8    . DA  F 2 9   ? 20.772  64.857 -45.019 1.00 17.77 ? 9   DA  H C8    1 
ATOM   3950 N  N7    . DA  F 2 9   ? 20.723  63.554 -45.158 1.00 20.52 ? 9   DA  H N7    1 
ATOM   3951 C  C5    . DA  F 2 9   ? 19.610  63.344 -45.951 1.00 19.66 ? 9   DA  H C5    1 
ATOM   3952 C  C6    . DA  F 2 9   ? 19.020  62.171 -46.448 1.00 16.49 ? 9   DA  H C6    1 
ATOM   3953 N  N6    . DA  F 2 9   ? 19.512  60.958 -46.181 1.00 17.48 ? 9   DA  H N6    1 
ATOM   3954 N  N1    . DA  F 2 9   ? 17.913  62.298 -47.201 1.00 18.34 ? 9   DA  H N1    1 
ATOM   3955 C  C2    . DA  F 2 9   ? 17.436  63.524 -47.454 1.00 17.32 ? 9   DA  H C2    1 
ATOM   3956 N  N3    . DA  F 2 9   ? 17.907  64.701 -47.039 1.00 17.91 ? 9   DA  H N3    1 
ATOM   3957 C  C4    . DA  F 2 9   ? 19.004  64.530 -46.277 1.00 18.32 ? 9   DA  H C4    1 
ATOM   3958 P  P     . DC  F 2 10  ? 18.645  71.345 -44.703 1.00 22.75 ? 10  DC  H P     1 
ATOM   3959 O  OP1   . DC  F 2 10  ? 17.253  71.772 -44.985 1.00 24.51 ? 10  DC  H OP1   1 
ATOM   3960 O  OP2   . DC  F 2 10  ? 19.752  71.905 -45.485 1.00 22.40 ? 10  DC  H OP2   1 
ATOM   3961 O  "O5'" . DC  F 2 10  ? 19.002  71.608 -43.167 1.00 20.64 ? 10  DC  H "O5'" 1 
ATOM   3962 C  "C5'" . DC  F 2 10  ? 18.082  71.545 -42.110 1.00 21.96 ? 10  DC  H "C5'" 1 
ATOM   3963 C  "C4'" . DC  F 2 10  ? 18.546  72.490 -41.011 1.00 25.05 ? 10  DC  H "C4'" 1 
ATOM   3964 O  "O4'" . DC  F 2 10  ? 19.791  72.019 -40.435 1.00 26.20 ? 10  DC  H "O4'" 1 
ATOM   3965 C  "C3'" . DC  F 2 10  ? 18.825  73.912 -41.478 1.00 29.49 ? 10  DC  H "C3'" 1 
ATOM   3966 O  "O3'" . DC  F 2 10  ? 18.423  74.814 -40.459 1.00 35.35 ? 10  DC  H "O3'" 1 
ATOM   3967 C  "C2'" . DC  F 2 10  ? 20.340  73.946 -41.689 1.00 25.07 ? 10  DC  H "C2'" 1 
ATOM   3968 C  "C1'" . DC  F 2 10  ? 20.826  72.959 -40.645 1.00 20.67 ? 10  DC  H "C1'" 1 
ATOM   3969 N  N1    . DC  F 2 10  ? 22.042  72.214 -41.056 1.00 17.39 ? 10  DC  H N1    1 
ATOM   3970 C  C2    . DC  F 2 10  ? 23.296  72.741 -40.739 1.00 20.00 ? 10  DC  H C2    1 
ATOM   3971 O  O2    . DC  F 2 10  ? 23.358  73.826 -40.137 1.00 22.27 ? 10  DC  H O2    1 
ATOM   3972 N  N3    . DC  F 2 10  ? 24.406  72.060 -41.108 1.00 18.70 ? 10  DC  H N3    1 
ATOM   3973 C  C4    . DC  F 2 10  ? 24.292  70.900 -41.761 1.00 17.21 ? 10  DC  H C4    1 
ATOM   3974 N  N4    . DC  F 2 10  ? 25.416  70.264 -42.103 1.00 18.88 ? 10  DC  H N4    1 
ATOM   3975 C  C5    . DC  F 2 10  ? 23.020  70.353 -42.091 1.00 15.90 ? 10  DC  H C5    1 
ATOM   3976 C  C6    . DC  F 2 10  ? 21.927  71.031 -41.721 1.00 18.06 ? 10  DC  H C6    1 
HETATM 3977 P  P     . AMP G 3 .   ? 3.335   19.397 -15.701 1.00 20.65 ? 401 AMP A P     1 
HETATM 3978 O  O1P   . AMP G 3 .   ? 3.085   18.068 -16.553 1.00 36.05 ? 401 AMP A O1P   1 
HETATM 3979 O  O2P   . AMP G 3 .   ? 2.092   20.130 -15.271 1.00 20.96 ? 401 AMP A O2P   1 
HETATM 3980 O  O3P   . AMP G 3 .   ? 4.365   19.251 -14.609 1.00 22.14 ? 401 AMP A O3P   1 
HETATM 3981 O  "O5'" . AMP G 3 .   ? 3.910   20.346 -16.826 1.00 33.85 ? 401 AMP A "O5'" 1 
HETATM 3982 C  "C5'" . AMP G 3 .   ? 4.977   21.231 -16.569 1.00 27.28 ? 401 AMP A "C5'" 1 
HETATM 3983 C  "C4'" . AMP G 3 .   ? 4.903   22.406 -17.498 1.00 20.52 ? 401 AMP A "C4'" 1 
HETATM 3984 O  "O4'" . AMP G 3 .   ? 6.025   23.264 -17.241 1.00 19.33 ? 401 AMP A "O4'" 1 
HETATM 3985 C  "C3'" . AMP G 3 .   ? 4.931   22.057 -18.978 1.00 18.73 ? 401 AMP A "C3'" 1 
HETATM 3986 O  "O3'" . AMP G 3 .   ? 3.933   22.824 -19.650 1.00 20.93 ? 401 AMP A "O3'" 1 
HETATM 3987 C  "C2'" . AMP G 3 .   ? 6.340   22.456 -19.437 1.00 16.86 ? 401 AMP A "C2'" 1 
HETATM 3988 O  "O2'" . AMP G 3 .   ? 6.389   22.957 -20.754 1.00 16.94 ? 401 AMP A "O2'" 1 
HETATM 3989 C  "C1'" . AMP G 3 .   ? 6.745   23.530 -18.424 1.00 16.80 ? 401 AMP A "C1'" 1 
HETATM 3990 N  N9    . AMP G 3 .   ? 8.156   23.574 -18.078 1.00 17.69 ? 401 AMP A N9    1 
HETATM 3991 C  C8    . AMP G 3 .   ? 9.036   22.562 -18.041 1.00 20.12 ? 401 AMP A C8    1 
HETATM 3992 N  N7    . AMP G 3 .   ? 10.252  23.010 -17.633 1.00 19.88 ? 401 AMP A N7    1 
HETATM 3993 C  C5    . AMP G 3 .   ? 10.131  24.331 -17.399 1.00 18.86 ? 401 AMP A C5    1 
HETATM 3994 C  C6    . AMP G 3 .   ? 11.015  25.422 -16.950 1.00 22.43 ? 401 AMP A C6    1 
HETATM 3995 N  N6    . AMP G 3 .   ? 12.312  25.171 -16.663 1.00 25.88 ? 401 AMP A N6    1 
HETATM 3996 N  N1    . AMP G 3 .   ? 10.482  26.660 -16.838 1.00 20.16 ? 401 AMP A N1    1 
HETATM 3997 C  C2    . AMP G 3 .   ? 9.190   26.914 -17.123 1.00 18.70 ? 401 AMP A C2    1 
HETATM 3998 N  N3    . AMP G 3 .   ? 8.325   25.970 -17.542 1.00 16.08 ? 401 AMP A N3    1 
HETATM 3999 C  C4    . AMP G 3 .   ? 8.742   24.692 -17.689 1.00 17.59 ? 401 AMP A C4    1 
HETATM 4000 ZN ZN    . ZN  H 4 .   ? -10.957 18.899 -35.937 1.00 28.19 ? 402 ZN  A ZN    1 
HETATM 4001 P  P     . AMP I 3 .   ? 13.424  48.265 -41.803 1.00 24.33 ? 401 AMP B P     1 
HETATM 4002 O  O1P   . AMP I 3 .   ? 14.480  49.178 -42.581 1.00 26.09 ? 401 AMP B O1P   1 
HETATM 4003 O  O2P   . AMP I 3 .   ? 13.517  46.796 -42.131 1.00 23.49 ? 401 AMP B O2P   1 
HETATM 4004 O  O3P   . AMP I 3 .   ? 13.257  48.558 -40.330 1.00 29.67 ? 401 AMP B O3P   1 
HETATM 4005 O  "O5'" . AMP I 3 .   ? 12.025  48.655 -42.439 1.00 24.76 ? 401 AMP B "O5'" 1 
HETATM 4006 C  "C5'" . AMP I 3 .   ? 11.458  49.941 -42.272 1.00 23.76 ? 401 AMP B "C5'" 1 
HETATM 4007 C  "C4'" . AMP I 3 .   ? 10.349  50.134 -43.272 1.00 20.68 ? 401 AMP B "C4'" 1 
HETATM 4008 O  "O4'" . AMP I 3 .   ? 9.456   51.171 -42.826 1.00 20.93 ? 401 AMP B "O4'" 1 
HETATM 4009 C  "C3'" . AMP I 3 .   ? 10.815  50.539 -44.678 1.00 20.75 ? 401 AMP B "C3'" 1 
HETATM 4010 O  "O3'" . AMP I 3 .   ? 10.406  49.545 -45.619 1.00 22.43 ? 401 AMP B "O3'" 1 
HETATM 4011 C  "C2'" . AMP I 3 .   ? 10.079  51.867 -44.953 1.00 18.66 ? 401 AMP B "C2'" 1 
HETATM 4012 O  "O2'" . AMP I 3 .   ? 9.618   52.014 -46.277 1.00 20.39 ? 401 AMP B "O2'" 1 
HETATM 4013 C  "C1'" . AMP I 3 .   ? 8.932   51.818 -43.955 1.00 21.15 ? 401 AMP B "C1'" 1 
HETATM 4014 N  N9    . AMP I 3 .   ? 8.420   53.108 -43.505 1.00 23.34 ? 401 AMP B N9    1 
HETATM 4015 C  C8    . AMP I 3 .   ? 9.116   54.231 -43.225 1.00 22.06 ? 401 AMP B C8    1 
HETATM 4016 N  N7    . AMP I 3 .   ? 8.280   55.212 -42.800 1.00 19.64 ? 401 AMP B N7    1 
HETATM 4017 C  C5    . AMP I 3 .   ? 7.028   54.710 -42.820 1.00 20.69 ? 401 AMP B C5    1 
HETATM 4018 C  C6    . AMP I 3 .   ? 5.670   55.196 -42.507 1.00 21.18 ? 401 AMP B C6    1 
HETATM 4019 N  N6    . AMP I 3 .   ? 5.469   56.461 -42.068 1.00 22.74 ? 401 AMP B N6    1 
HETATM 4020 N  N1    . AMP I 3 .   ? 4.635   54.336 -42.669 1.00 20.51 ? 401 AMP B N1    1 
HETATM 4021 C  C2    . AMP I 3 .   ? 4.817   53.075 -43.102 1.00 20.85 ? 401 AMP B C2    1 
HETATM 4022 N  N3    . AMP I 3 .   ? 6.018   52.565 -43.411 1.00 18.21 ? 401 AMP B N3    1 
HETATM 4023 C  C4    . AMP I 3 .   ? 7.132   53.325 -43.292 1.00 19.35 ? 401 AMP B C4    1 
HETATM 4024 ZN ZN    . ZN  J 4 .   ? 14.204  35.593 -63.837 1.00 39.29 ? 402 ZN  B ZN    1 
HETATM 4025 O  O     . HOH K 5 .   ? 2.909   29.247 -31.344 1.00 33.72 ? 501 HOH A O     1 
HETATM 4026 O  O     . HOH K 5 .   ? -9.666  15.252 -28.128 1.00 35.88 ? 502 HOH A O     1 
HETATM 4027 O  O     . HOH K 5 .   ? 3.564   26.352 -34.515 1.00 41.08 ? 503 HOH A O     1 
HETATM 4028 O  O     . HOH K 5 .   ? -6.405  22.100 -22.313 1.00 19.22 ? 504 HOH A O     1 
HETATM 4029 O  O     . HOH K 5 .   ? -10.495 35.770 -18.887 1.00 23.49 ? 505 HOH A O     1 
HETATM 4030 O  O     . HOH K 5 .   ? -6.712  18.650 5.611   1.00 37.25 ? 506 HOH A O     1 
HETATM 4031 O  O     . HOH K 5 .   ? -7.110  26.823 -9.379  1.00 18.55 ? 507 HOH A O     1 
HETATM 4032 O  O     . HOH K 5 .   ? 8.390   29.104 -1.580  1.00 17.62 ? 508 HOH A O     1 
HETATM 4033 O  O     . HOH K 5 .   ? -6.613  12.071 -28.089 1.00 22.60 ? 509 HOH A O     1 
HETATM 4034 O  O     . HOH K 5 .   ? -14.644 18.175 -8.711  1.00 21.80 ? 510 HOH A O     1 
HETATM 4035 O  O     . HOH K 5 .   ? 10.228  19.908 -4.429  1.00 38.94 ? 511 HOH A O     1 
HETATM 4036 O  O     . HOH K 5 .   ? 3.525   19.893 -9.090  1.00 21.98 ? 512 HOH A O     1 
HETATM 4037 O  O     . HOH K 5 .   ? 3.901   15.922 -17.157 1.00 29.07 ? 513 HOH A O     1 
HETATM 4038 O  O     . HOH K 5 .   ? 1.113   35.340 0.355   1.00 29.01 ? 514 HOH A O     1 
HETATM 4039 O  O     . HOH K 5 .   ? 25.081  16.429 -6.758  1.00 33.72 ? 515 HOH A O     1 
HETATM 4040 O  O     . HOH K 5 .   ? -1.685  5.613  -36.382 1.00 39.45 ? 516 HOH A O     1 
HETATM 4041 O  O     . HOH K 5 .   ? 1.842   8.629  -24.826 1.00 29.55 ? 517 HOH A O     1 
HETATM 4042 O  O     . HOH K 5 .   ? 8.613   31.914 -3.734  1.00 20.96 ? 518 HOH A O     1 
HETATM 4043 O  O     . HOH K 5 .   ? -1.127  19.093 -11.127 1.00 26.94 ? 519 HOH A O     1 
HETATM 4044 O  O     . HOH K 5 .   ? -10.166 37.634 -13.187 1.00 20.78 ? 520 HOH A O     1 
HETATM 4045 O  O     . HOH K 5 .   ? 23.850  18.717 -10.909 1.00 34.91 ? 521 HOH A O     1 
HETATM 4046 O  O     . HOH K 5 .   ? -20.523 25.790 -0.099  1.00 42.98 ? 522 HOH A O     1 
HETATM 4047 O  O     . HOH K 5 .   ? 15.589  31.248 -15.569 1.00 30.39 ? 523 HOH A O     1 
HETATM 4048 O  O     . HOH K 5 .   ? 2.710   8.083  -22.507 1.00 38.86 ? 524 HOH A O     1 
HETATM 4049 O  O     . HOH K 5 .   ? 15.505  22.859 -23.116 0.87 33.61 ? 525 HOH A O     1 
HETATM 4050 O  O     . HOH K 5 .   ? -9.655  33.601 -3.314  1.00 21.42 ? 526 HOH A O     1 
HETATM 4051 O  O     . HOH K 5 .   ? 15.519  32.528 -11.239 1.00 27.74 ? 527 HOH A O     1 
HETATM 4052 O  O     . HOH K 5 .   ? -10.545 38.867 -15.657 1.00 29.72 ? 528 HOH A O     1 
HETATM 4053 O  O     . HOH K 5 .   ? 12.742  37.799 -8.837  1.00 31.44 ? 529 HOH A O     1 
HETATM 4054 O  O     . HOH K 5 .   ? -10.533 20.023 5.797   1.00 20.76 ? 530 HOH A O     1 
HETATM 4055 O  O     . HOH K 5 .   ? -2.934  29.265 1.290   1.00 39.47 ? 531 HOH A O     1 
HETATM 4056 O  O     . HOH K 5 .   ? -10.226 17.650 -25.550 1.00 39.83 ? 532 HOH A O     1 
HETATM 4057 O  O     . HOH K 5 .   ? 4.083   10.223 -26.137 1.00 22.02 ? 533 HOH A O     1 
HETATM 4058 O  O     . HOH K 5 .   ? -3.715  27.111 8.645   1.00 43.43 ? 534 HOH A O     1 
HETATM 4059 O  O     . HOH K 5 .   ? 5.936   17.694 -34.647 1.00 54.87 ? 535 HOH A O     1 
HETATM 4060 O  O     . HOH K 5 .   ? 7.559   20.390 -33.658 1.00 35.15 ? 536 HOH A O     1 
HETATM 4061 O  O     . HOH K 5 .   ? -11.155 14.068 -3.020  1.00 26.05 ? 537 HOH A O     1 
HETATM 4062 O  O     . HOH K 5 .   ? 8.217   40.630 -12.929 1.00 36.62 ? 538 HOH A O     1 
HETATM 4063 O  O     . HOH K 5 .   ? 8.641   14.354 -11.606 1.00 25.66 ? 539 HOH A O     1 
HETATM 4064 O  O     . HOH K 5 .   ? 16.274  35.431 -9.955  1.00 42.21 ? 540 HOH A O     1 
HETATM 4065 O  O     . HOH K 5 .   ? 1.433   6.710  -19.959 1.00 25.96 ? 541 HOH A O     1 
HETATM 4066 O  O     . HOH K 5 .   ? 3.802   13.520 -10.110 1.00 42.11 ? 542 HOH A O     1 
HETATM 4067 O  O     . HOH K 5 .   ? -4.009  16.111 -41.464 1.00 32.34 ? 543 HOH A O     1 
HETATM 4068 O  O     . HOH K 5 .   ? -10.394 34.616 -5.708  1.00 35.67 ? 544 HOH A O     1 
HETATM 4069 O  O     . HOH K 5 .   ? -14.034 27.331 -15.413 1.00 49.04 ? 545 HOH A O     1 
HETATM 4070 O  O     . HOH K 5 .   ? 4.047   41.720 -18.071 1.00 33.97 ? 546 HOH A O     1 
HETATM 4071 O  O     . HOH K 5 .   ? -0.933  23.003 -35.491 1.00 37.26 ? 547 HOH A O     1 
HETATM 4072 O  O     . HOH K 5 .   ? -11.995 31.738 -8.613  1.00 44.99 ? 548 HOH A O     1 
HETATM 4073 O  O     . HOH K 5 .   ? -4.667  14.230 -1.567  1.00 40.45 ? 549 HOH A O     1 
HETATM 4074 O  O     . HOH K 5 .   ? -8.836  36.146 -25.602 1.00 38.74 ? 550 HOH A O     1 
HETATM 4075 O  O     . HOH K 5 .   ? 7.088   21.811 -1.197  1.00 40.23 ? 551 HOH A O     1 
HETATM 4076 O  O     . HOH K 5 .   ? 1.454   37.255 -24.412 1.00 33.55 ? 552 HOH A O     1 
HETATM 4077 O  O     . HOH K 5 .   ? -9.726  14.229 -10.327 1.00 46.73 ? 553 HOH A O     1 
HETATM 4078 O  O     . HOH K 5 .   ? 1.313   9.511  -16.137 1.00 34.20 ? 554 HOH A O     1 
HETATM 4079 O  O     . HOH K 5 .   ? 18.442  18.728 -16.290 1.00 33.56 ? 555 HOH A O     1 
HETATM 4080 O  O     . HOH K 5 .   ? 9.374   41.040 -15.403 1.00 33.98 ? 556 HOH A O     1 
HETATM 4081 O  O     . HOH K 5 .   ? 14.550  34.302 -20.952 1.00 39.57 ? 557 HOH A O     1 
HETATM 4082 O  O     . HOH K 5 .   ? 4.551   38.778 -22.016 1.00 36.01 ? 558 HOH A O     1 
HETATM 4083 O  O     . HOH K 5 .   ? 0.766   21.152 -10.371 1.00 31.89 ? 559 HOH A O     1 
HETATM 4084 O  O     . HOH K 5 .   ? -14.443 19.003 -14.887 1.00 32.07 ? 560 HOH A O     1 
HETATM 4085 O  O     . HOH K 5 .   ? 7.854   21.908 -3.827  1.00 35.76 ? 561 HOH A O     1 
HETATM 4086 O  O     . HOH K 5 .   ? -16.991 21.225 -11.827 1.00 40.81 ? 562 HOH A O     1 
HETATM 4087 O  O     . HOH K 5 .   ? -12.939 33.648 -6.680  1.00 43.95 ? 563 HOH A O     1 
HETATM 4088 O  O     . HOH K 5 .   ? 17.207  32.285 -13.429 1.00 33.63 ? 564 HOH A O     1 
HETATM 4089 O  O     . HOH K 5 .   ? -15.352 22.045 -13.877 1.00 34.12 ? 565 HOH A O     1 
HETATM 4090 O  O     . HOH K 5 .   ? 8.235   12.204 -13.344 1.00 37.76 ? 566 HOH A O     1 
HETATM 4091 O  O     . HOH K 5 .   ? 17.847  20.762 -14.913 1.00 31.54 ? 567 HOH A O     1 
HETATM 4092 O  O     . HOH K 5 .   ? 2.492   8.466  -13.837 1.00 35.96 ? 568 HOH A O     1 
HETATM 4093 O  O     . HOH K 5 .   ? 19.983  16.328 -10.616 1.00 29.28 ? 569 HOH A O     1 
HETATM 4094 O  O     . HOH K 5 .   ? -0.121  14.958 -8.089  1.00 53.39 ? 570 HOH A O     1 
HETATM 4095 O  O     . HOH K 5 .   ? -4.956  17.056 -1.867  1.00 17.95 ? 571 HOH A O     1 
HETATM 4096 O  O     . HOH K 5 .   ? 1.599   31.984 -1.928  1.00 14.55 ? 572 HOH A O     1 
HETATM 4097 O  O     . HOH K 5 .   ? -8.956  28.734 2.222   1.00 23.09 ? 573 HOH A O     1 
HETATM 4098 O  O     . HOH K 5 .   ? 3.956   10.657 -30.173 1.00 20.56 ? 574 HOH A O     1 
HETATM 4099 O  O     . HOH K 5 .   ? -12.119 25.540 -14.797 1.00 22.83 ? 575 HOH A O     1 
HETATM 4100 O  O     . HOH K 5 .   ? -6.708  22.794 5.587   1.00 14.76 ? 576 HOH A O     1 
HETATM 4101 O  O     . HOH K 5 .   ? 18.202  16.805 -14.230 1.00 15.56 ? 577 HOH A O     1 
HETATM 4102 O  O     . HOH K 5 .   ? 9.727   22.558 -10.748 1.00 15.22 ? 578 HOH A O     1 
HETATM 4103 O  O     . HOH K 5 .   ? -8.665  21.001 -24.724 1.00 23.03 ? 579 HOH A O     1 
HETATM 4104 O  O     . HOH K 5 .   ? -8.407  19.851 3.993   1.00 17.11 ? 580 HOH A O     1 
HETATM 4105 O  O     . HOH K 5 .   ? 10.501  36.841 -7.789  1.00 20.90 ? 581 HOH A O     1 
HETATM 4106 O  O     . HOH K 5 .   ? -5.621  29.816 0.798   1.00 19.03 ? 582 HOH A O     1 
HETATM 4107 O  O     . HOH K 5 .   ? 3.014   36.638 -22.133 1.00 28.21 ? 583 HOH A O     1 
HETATM 4108 O  O     . HOH K 5 .   ? 3.194   26.195 1.648   1.00 27.78 ? 584 HOH A O     1 
HETATM 4109 O  O     . HOH K 5 .   ? -3.954  7.132  -12.091 1.00 31.16 ? 585 HOH A O     1 
HETATM 4110 O  O     . HOH K 5 .   ? -0.227  20.531 -13.789 1.00 26.05 ? 586 HOH A O     1 
HETATM 4111 O  O     . HOH K 5 .   ? -3.060  24.629 -34.494 1.00 25.05 ? 587 HOH A O     1 
HETATM 4112 O  O     . HOH K 5 .   ? -0.479  17.986 -8.884  1.00 29.23 ? 588 HOH A O     1 
HETATM 4113 O  O     . HOH K 5 .   ? 10.932  39.861 -10.118 1.00 28.16 ? 589 HOH A O     1 
HETATM 4114 O  O     . HOH K 5 .   ? 2.429   42.363 -12.011 1.00 28.34 ? 590 HOH A O     1 
HETATM 4115 O  O     . HOH K 5 .   ? -12.877 30.375 -0.847  1.00 18.18 ? 591 HOH A O     1 
HETATM 4116 O  O     . HOH K 5 .   ? 1.167   25.234 2.567   1.00 37.38 ? 592 HOH A O     1 
HETATM 4117 O  O     . HOH K 5 .   ? 3.357   20.815 -21.540 1.00 24.09 ? 593 HOH A O     1 
HETATM 4118 O  O     . HOH K 5 .   ? -15.831 31.246 -4.128  1.00 39.07 ? 594 HOH A O     1 
HETATM 4119 O  O     . HOH K 5 .   ? -8.783  36.904 -6.045  1.00 35.51 ? 595 HOH A O     1 
HETATM 4120 O  O     . HOH K 5 .   ? 0.753   41.930 -15.459 1.00 42.33 ? 596 HOH A O     1 
HETATM 4121 O  O     . HOH K 5 .   ? -7.829  5.210  -18.273 1.00 27.93 ? 597 HOH A O     1 
HETATM 4122 O  O     . HOH K 5 .   ? 0.899   22.283 -33.244 1.00 25.90 ? 598 HOH A O     1 
HETATM 4123 O  O     . HOH K 5 .   ? 15.881  34.127 -18.467 1.00 37.83 ? 599 HOH A O     1 
HETATM 4124 O  O     . HOH K 5 .   ? -12.726 10.218 -37.045 1.00 34.97 ? 600 HOH A O     1 
HETATM 4125 O  O     . HOH K 5 .   ? -5.457  10.202 -5.823  1.00 34.75 ? 601 HOH A O     1 
HETATM 4126 O  O     . HOH K 5 .   ? 14.426  26.486 -15.058 1.00 24.76 ? 602 HOH A O     1 
HETATM 4127 O  O     . HOH K 5 .   ? -8.005  16.734 -41.600 1.00 45.60 ? 603 HOH A O     1 
HETATM 4128 O  O     . HOH K 5 .   ? 1.486   34.451 -28.703 1.00 36.17 ? 604 HOH A O     1 
HETATM 4129 O  O     . HOH K 5 .   ? -8.672  13.132 -26.845 1.00 28.36 ? 605 HOH A O     1 
HETATM 4130 O  O     . HOH K 5 .   ? -20.386 24.858 -9.413  1.00 41.71 ? 606 HOH A O     1 
HETATM 4131 O  O     . HOH K 5 .   ? 14.744  30.192 -7.393  1.00 31.92 ? 607 HOH A O     1 
HETATM 4132 O  O     . HOH K 5 .   ? -16.669 26.646 -8.493  1.00 46.73 ? 608 HOH A O     1 
HETATM 4133 O  O     . HOH K 5 .   ? -10.096 4.582  -9.451  1.00 39.07 ? 609 HOH A O     1 
HETATM 4134 O  O     . HOH K 5 .   ? 3.813   29.351 -28.642 1.00 28.86 ? 610 HOH A O     1 
HETATM 4135 O  O     . HOH K 5 .   ? 9.746   30.234 -19.014 1.00 35.28 ? 611 HOH A O     1 
HETATM 4136 O  O     . HOH K 5 .   ? -9.808  17.497 -20.675 1.00 41.79 ? 612 HOH A O     1 
HETATM 4137 O  O     . HOH K 5 .   ? 1.609   29.716 -36.683 1.00 45.54 ? 613 HOH A O     1 
HETATM 4138 O  O     . HOH K 5 .   ? -0.507  43.566 -22.550 1.00 40.60 ? 614 HOH A O     1 
HETATM 4139 O  O     . HOH K 5 .   ? 14.367  28.879 -16.033 1.00 31.18 ? 615 HOH A O     1 
HETATM 4140 O  O     . HOH K 5 .   ? -11.471 20.938 -25.194 1.00 37.78 ? 616 HOH A O     1 
HETATM 4141 O  O     . HOH K 5 .   ? 9.490   34.258 -25.161 1.00 26.15 ? 617 HOH A O     1 
HETATM 4142 O  O     . HOH K 5 .   ? -3.714  32.838 -37.062 1.00 30.64 ? 618 HOH A O     1 
HETATM 4143 O  O     . HOH K 5 .   ? 6.244   25.103 3.570   1.00 46.36 ? 619 HOH A O     1 
HETATM 4144 O  O     . HOH K 5 .   ? -6.215  32.630 -38.313 1.00 40.71 ? 620 HOH A O     1 
HETATM 4145 O  O     . HOH K 5 .   ? 2.183   18.741 -39.468 1.00 39.06 ? 621 HOH A O     1 
HETATM 4146 O  O     . HOH K 5 .   ? -11.181 12.421 -0.708  1.00 34.11 ? 622 HOH A O     1 
HETATM 4147 O  O     . HOH K 5 .   ? 16.869  36.682 -15.724 1.00 32.00 ? 623 HOH A O     1 
HETATM 4148 O  O     . HOH K 5 .   ? 11.519  34.606 -21.151 1.00 41.15 ? 624 HOH A O     1 
HETATM 4149 O  O     . HOH K 5 .   ? -12.448 37.272 -17.240 1.00 34.47 ? 625 HOH A O     1 
HETATM 4150 O  O     . HOH K 5 .   ? 8.368   25.783 2.129   1.00 26.60 ? 626 HOH A O     1 
HETATM 4151 O  O     . HOH K 5 .   ? 20.731  17.276 -13.332 1.00 35.40 ? 627 HOH A O     1 
HETATM 4152 O  O     . HOH K 5 .   ? -9.781  39.938 -11.724 1.00 31.13 ? 628 HOH A O     1 
HETATM 4153 O  O     . HOH K 5 .   ? 10.270  31.625 -21.646 1.00 36.08 ? 629 HOH A O     1 
HETATM 4154 O  O     . HOH K 5 .   ? 15.100  17.048 -6.947  1.00 36.06 ? 630 HOH A O     1 
HETATM 4155 O  O     . HOH K 5 .   ? -12.287 36.255 -12.792 1.00 35.86 ? 631 HOH A O     1 
HETATM 4156 O  O     . HOH K 5 .   ? 4.964   40.832 -20.221 1.00 41.43 ? 632 HOH A O     1 
HETATM 4157 O  O     . HOH K 5 .   ? -4.493  13.820 -42.322 1.00 44.91 ? 633 HOH A O     1 
HETATM 4158 O  O     . HOH K 5 .   ? -6.893  35.793 -2.375  1.00 46.87 ? 634 HOH A O     1 
HETATM 4159 O  O     . HOH K 5 .   ? -14.302 8.745  -8.022  1.00 51.80 ? 635 HOH A O     1 
HETATM 4160 O  O     . HOH K 5 .   ? -9.708  41.561 -15.865 1.00 42.04 ? 636 HOH A O     1 
HETATM 4161 O  O     . HOH K 5 .   ? -12.484 13.466 1.474   1.00 43.84 ? 637 HOH A O     1 
HETATM 4162 O  O     . HOH K 5 .   ? -13.723 36.160 -15.434 1.00 49.74 ? 638 HOH A O     1 
HETATM 4163 O  O     . HOH K 5 .   ? -16.532 27.212 -5.871  1.00 46.67 ? 639 HOH A O     1 
HETATM 4164 O  O     . HOH K 5 .   ? 13.687  22.021 -16.007 1.00 30.09 ? 640 HOH A O     1 
HETATM 4165 O  O     . HOH K 5 .   ? -11.273 8.886  -18.141 1.00 29.83 ? 641 HOH A O     1 
HETATM 4166 O  O     . HOH K 5 .   ? 4.360   23.162 -35.141 1.00 39.22 ? 642 HOH A O     1 
HETATM 4167 O  O     . HOH K 5 .   ? 3.297   16.127 -3.897  1.00 30.68 ? 643 HOH A O     1 
HETATM 4168 O  O     . HOH K 5 .   ? -9.188  8.990  -28.243 1.00 37.81 ? 644 HOH A O     1 
HETATM 4169 O  O     . HOH K 5 .   ? -5.884  29.755 4.642   1.00 33.59 ? 645 HOH A O     1 
HETATM 4170 O  O     . HOH K 5 .   ? 2.289   22.586 -37.038 1.00 46.94 ? 646 HOH A O     1 
HETATM 4171 O  O     . HOH K 5 .   ? -2.578  28.406 4.016   1.00 38.77 ? 647 HOH A O     1 
HETATM 4172 O  O     . HOH K 5 .   ? 16.221  22.676 -11.563 1.00 21.40 ? 648 HOH A O     1 
HETATM 4173 O  O     . HOH K 5 .   ? -11.000 26.029 -18.130 1.00 22.21 ? 649 HOH A O     1 
HETATM 4174 O  O     . HOH K 5 .   ? -12.041 18.334 -14.930 1.00 21.80 ? 650 HOH A O     1 
HETATM 4175 O  O     . HOH K 5 .   ? 11.249  29.563 -6.034  1.00 27.33 ? 651 HOH A O     1 
HETATM 4176 O  O     . HOH K 5 .   ? 9.076   13.384 -28.209 1.00 31.91 ? 652 HOH A O     1 
HETATM 4177 O  O     . HOH K 5 .   ? -11.888 31.092 -23.058 1.00 28.73 ? 653 HOH A O     1 
HETATM 4178 O  O     . HOH K 5 .   ? -11.704 31.370 -19.954 1.00 50.54 ? 654 HOH A O     1 
HETATM 4179 O  O     . HOH K 5 .   ? 15.516  24.340 -7.729  1.00 28.12 ? 655 HOH A O     1 
HETATM 4180 O  O     . HOH K 5 .   ? -6.573  24.397 -33.544 1.00 31.11 ? 656 HOH A O     1 
HETATM 4181 O  O     . HOH K 5 .   ? 0.076   43.117 -8.616  1.00 35.51 ? 657 HOH A O     1 
HETATM 4182 O  O     . HOH K 5 .   ? 5.661   40.800 -13.578 1.00 35.79 ? 658 HOH A O     1 
HETATM 4183 O  O     . HOH K 5 .   ? -9.312  27.907 -30.064 1.00 38.67 ? 659 HOH A O     1 
HETATM 4184 O  O     . HOH K 5 .   ? -15.263 16.635 3.872   1.00 42.02 ? 660 HOH A O     1 
HETATM 4185 O  O     . HOH K 5 .   ? -9.570  30.331 4.025   1.00 44.64 ? 661 HOH A O     1 
HETATM 4186 O  O     . HOH K 5 .   ? -17.603 16.070 -3.366  1.00 39.64 ? 662 HOH A O     1 
HETATM 4187 O  O     . HOH K 5 .   ? -5.287  17.311 2.068   1.00 34.35 ? 663 HOH A O     1 
HETATM 4188 O  O     . HOH K 5 .   ? 11.246  13.471 -10.930 1.00 39.90 ? 664 HOH A O     1 
HETATM 4189 O  O     . HOH K 5 .   ? -14.523 29.250 -7.752  1.00 41.42 ? 665 HOH A O     1 
HETATM 4190 O  O     . HOH K 5 .   ? 14.182  22.711 -5.228  1.00 40.44 ? 666 HOH A O     1 
HETATM 4191 O  O     . HOH K 5 .   ? 2.787   8.012  -17.876 1.00 39.58 ? 667 HOH A O     1 
HETATM 4192 O  O     . HOH K 5 .   ? 4.871   40.689 -5.956  1.00 39.19 ? 668 HOH A O     1 
HETATM 4193 O  O     . HOH K 5 .   ? -8.714  25.819 -32.271 1.00 41.42 ? 669 HOH A O     1 
HETATM 4194 O  O     . HOH K 5 .   ? 3.623   22.378 1.660   1.00 49.93 ? 670 HOH A O     1 
HETATM 4195 O  O     . HOH K 5 .   ? 0.503   20.523 2.444   1.00 48.48 ? 671 HOH A O     1 
HETATM 4196 O  O     . HOH K 5 .   ? -4.359  44.918 -21.857 1.00 41.50 ? 672 HOH A O     1 
HETATM 4197 O  O     . HOH K 5 .   ? 3.345   13.925 -2.814  1.00 43.20 ? 673 HOH A O     1 
HETATM 4198 O  O     . HOH K 5 .   ? -1.467  12.878 -8.995  1.00 44.59 ? 674 HOH A O     1 
HETATM 4199 O  O     . HOH K 5 .   ? 21.799  10.651 -9.931  1.00 52.29 ? 675 HOH A O     1 
HETATM 4200 O  O     . HOH K 5 .   ? 2.335   43.963 -18.404 1.00 43.99 ? 676 HOH A O     1 
HETATM 4201 O  O     . HOH K 5 .   ? 4.251   20.556 -0.209  1.00 23.71 ? 677 HOH A O     1 
HETATM 4202 O  O     . HOH K 5 .   ? 4.483   18.155 -0.057  1.00 34.78 ? 678 HOH A O     1 
HETATM 4203 O  O     . HOH K 5 .   ? -21.200 21.483 -1.840  1.00 33.23 ? 679 HOH A O     1 
HETATM 4204 O  O     . HOH K 5 .   ? 2.451   17.433 -21.437 1.00 31.82 ? 680 HOH A O     1 
HETATM 4205 O  O     . HOH K 5 .   ? 6.933   15.462 -33.360 1.00 32.38 ? 681 HOH A O     1 
HETATM 4206 O  O     . HOH K 5 .   ? -18.527 28.286 -3.027  1.00 33.86 ? 682 HOH A O     1 
HETATM 4207 O  O     A HOH K 5 .   ? -3.888  7.904  -33.173 0.52 16.48 ? 683 HOH A O     1 
HETATM 4208 O  O     B HOH K 5 .   ? -2.004  7.291  -32.541 0.48 30.91 ? 683 HOH A O     1 
HETATM 4209 O  O     A HOH K 5 .   ? 4.870   30.645 -23.210 0.59 23.37 ? 684 HOH A O     1 
HETATM 4210 O  O     B HOH K 5 .   ? 6.556   31.116 -23.674 0.41 12.14 ? 684 HOH A O     1 
HETATM 4211 O  O     . HOH K 5 .   ? 1.385   7.640  -35.028 1.00 39.30 ? 685 HOH A O     1 
HETATM 4212 O  O     . HOH K 5 .   ? 2.390   13.989 -16.448 1.00 45.23 ? 686 HOH A O     1 
HETATM 4213 O  O     . HOH K 5 .   ? 0.395   39.782 -25.028 1.00 36.56 ? 687 HOH A O     1 
HETATM 4214 O  O     A HOH K 5 .   ? -10.674 15.487 -15.407 0.60 29.22 ? 688 HOH A O     1 
HETATM 4215 O  O     B HOH K 5 .   ? -10.620 10.929 -20.948 0.40 13.88 ? 688 HOH A O     1 
HETATM 4216 O  O     . HOH K 5 .   ? -0.432  -0.132 -18.383 1.00 49.05 ? 689 HOH A O     1 
HETATM 4217 O  O     . HOH K 5 .   ? -9.374  7.370  -6.336  1.00 46.91 ? 690 HOH A O     1 
HETATM 4218 O  O     . HOH K 5 .   ? -2.891  3.969  -12.078 1.00 50.99 ? 691 HOH A O     1 
HETATM 4219 O  O     . HOH K 5 .   ? 0.145   29.601 -41.418 1.00 37.91 ? 692 HOH A O     1 
HETATM 4220 O  O     A HOH K 5 .   ? -2.677  34.366 -31.942 0.55 27.01 ? 693 HOH A O     1 
HETATM 4221 O  O     B HOH K 5 .   ? -4.305  33.020 -32.224 0.45 23.30 ? 693 HOH A O     1 
HETATM 4222 O  O     . HOH K 5 .   ? -4.944  32.234 1.544   1.00 36.35 ? 694 HOH A O     1 
HETATM 4223 O  O     . HOH K 5 .   ? 1.349   42.378 -24.184 1.00 37.92 ? 695 HOH A O     1 
HETATM 4224 O  O     . HOH K 5 .   ? 16.162  24.490 -14.848 1.00 55.28 ? 696 HOH A O     1 
HETATM 4225 O  O     . HOH K 5 .   ? -0.423  4.871  -27.965 1.00 44.94 ? 697 HOH A O     1 
HETATM 4226 O  O     . HOH K 5 .   ? 9.294   15.705 -33.470 1.00 46.13 ? 698 HOH A O     1 
HETATM 4227 O  O     . HOH K 5 .   ? 3.950   43.818 -9.777  1.00 49.34 ? 699 HOH A O     1 
HETATM 4228 O  O     . HOH K 5 .   ? -11.489 36.248 -21.364 1.00 41.00 ? 700 HOH A O     1 
HETATM 4229 O  O     . HOH K 5 .   ? -10.591 39.539 -32.316 1.00 48.86 ? 701 HOH A O     1 
HETATM 4230 O  O     . HOH K 5 .   ? -2.466  42.818 -8.440  1.00 55.09 ? 702 HOH A O     1 
HETATM 4231 O  O     . HOH K 5 .   ? -20.557 27.376 -2.155  1.00 38.57 ? 703 HOH A O     1 
HETATM 4232 O  O     . HOH K 5 .   ? -12.568 27.084 -22.721 1.00 48.46 ? 704 HOH A O     1 
HETATM 4233 O  O     . HOH K 5 .   ? -14.870 28.616 -23.188 1.00 43.82 ? 705 HOH A O     1 
HETATM 4234 O  O     A HOH K 5 .   ? -2.088  40.643 -3.916  0.33 17.97 ? 706 HOH A O     1 
HETATM 4235 O  O     B HOH K 5 .   ? -2.523  39.081 1.065   0.67 53.52 ? 706 HOH A O     1 
HETATM 4236 O  O     . HOH K 5 .   ? 10.625  29.584 -24.217 1.00 53.56 ? 707 HOH A O     1 
HETATM 4237 O  O     . HOH K 5 .   ? 12.740  30.734 -22.231 1.00 48.97 ? 708 HOH A O     1 
HETATM 4238 O  O     . HOH K 5 .   ? 14.269  23.110 -18.778 1.00 49.85 ? 709 HOH A O     1 
HETATM 4239 O  O     . HOH K 5 .   ? -13.140 24.273 -20.155 1.00 47.41 ? 710 HOH A O     1 
HETATM 4240 O  O     . HOH K 5 .   ? -6.589  33.975 -33.260 1.00 52.34 ? 711 HOH A O     1 
HETATM 4241 O  O     . HOH K 5 .   ? 11.664  22.073 -2.555  1.00 45.48 ? 712 HOH A O     1 
HETATM 4242 O  O     . HOH K 5 .   ? -5.879  33.676 -0.850  1.00 46.56 ? 713 HOH A O     1 
HETATM 4243 O  O     . HOH K 5 .   ? -3.004  35.484 2.216   1.00 43.60 ? 714 HOH A O     1 
HETATM 4244 O  O     . HOH L 5 .   ? 8.628   48.318 -32.656 1.00 31.50 ? 501 HOH B O     1 
HETATM 4245 O  O     . HOH L 5 .   ? 3.355   49.787 -55.157 1.00 29.85 ? 502 HOH B O     1 
HETATM 4246 O  O     . HOH L 5 .   ? 23.566  49.158 -53.046 1.00 34.08 ? 503 HOH B O     1 
HETATM 4247 O  O     . HOH L 5 .   ? -1.580  32.749 -38.772 1.00 21.31 ? 504 HOH B O     1 
HETATM 4248 O  O     . HOH L 5 .   ? 10.224  53.206 -60.344 1.00 35.32 ? 505 HOH B O     1 
HETATM 4249 O  O     . HOH L 5 .   ? -8.045  46.663 -41.115 1.00 39.56 ? 506 HOH B O     1 
HETATM 4250 O  O     . HOH L 5 .   ? 0.808   52.775 -44.019 1.00 20.28 ? 507 HOH B O     1 
HETATM 4251 O  O     . HOH L 5 .   ? -0.721  32.928 -44.734 1.00 26.15 ? 508 HOH B O     1 
HETATM 4252 O  O     . HOH L 5 .   ? 2.690   47.954 -57.316 1.00 36.81 ? 509 HOH B O     1 
HETATM 4253 O  O     . HOH L 5 .   ? 15.495  53.693 -60.610 1.00 33.55 ? 510 HOH B O     1 
HETATM 4254 O  O     . HOH L 5 .   ? 1.922   54.914 -42.933 1.00 25.54 ? 511 HOH B O     1 
HETATM 4255 O  O     . HOH L 5 .   ? -0.826  46.695 -50.982 1.00 32.99 ? 512 HOH B O     1 
HETATM 4256 O  O     . HOH L 5 .   ? 0.415   30.989 -38.803 1.00 26.48 ? 513 HOH B O     1 
HETATM 4257 O  O     . HOH L 5 .   ? 17.073  35.406 -51.664 1.00 46.85 ? 514 HOH B O     1 
HETATM 4258 O  O     . HOH L 5 .   ? -10.969 40.006 -46.921 1.00 38.32 ? 515 HOH B O     1 
HETATM 4259 O  O     . HOH L 5 .   ? 11.753  39.029 -49.922 1.00 21.82 ? 516 HOH B O     1 
HETATM 4260 O  O     . HOH L 5 .   ? 0.016   53.700 -46.512 1.00 31.01 ? 517 HOH B O     1 
HETATM 4261 O  O     . HOH L 5 .   ? 29.823  43.366 -52.533 1.00 49.32 ? 518 HOH B O     1 
HETATM 4262 O  O     . HOH L 5 .   ? -7.142  49.884 -35.370 1.00 40.66 ? 519 HOH B O     1 
HETATM 4263 O  O     . HOH L 5 .   ? -2.951  32.511 -41.053 1.00 27.88 ? 520 HOH B O     1 
HETATM 4264 O  O     . HOH L 5 .   ? 1.946   48.192 -53.561 1.00 26.98 ? 521 HOH B O     1 
HETATM 4265 O  O     . HOH L 5 .   ? 3.908   33.419 -29.612 1.00 27.72 ? 522 HOH B O     1 
HETATM 4266 O  O     . HOH L 5 .   ? 21.105  40.553 -56.490 1.00 26.00 ? 523 HOH B O     1 
HETATM 4267 O  O     . HOH L 5 .   ? 14.026  46.352 -38.654 1.00 22.60 ? 524 HOH B O     1 
HETATM 4268 O  O     . HOH L 5 .   ? 20.834  37.340 -27.367 1.00 37.71 ? 525 HOH B O     1 
HETATM 4269 O  O     . HOH L 5 .   ? -1.835  30.935 -43.119 1.00 32.25 ? 526 HOH B O     1 
HETATM 4270 O  O     . HOH L 5 .   ? 26.077  49.118 -48.453 1.00 37.25 ? 527 HOH B O     1 
HETATM 4271 O  O     . HOH L 5 .   ? 9.899   43.366 -27.045 1.00 37.94 ? 528 HOH B O     1 
HETATM 4272 O  O     . HOH L 5 .   ? -3.481  29.305 -44.118 1.00 40.33 ? 529 HOH B O     1 
HETATM 4273 O  O     . HOH L 5 .   ? 4.975   55.259 -52.364 1.00 42.51 ? 530 HOH B O     1 
HETATM 4274 O  O     . HOH L 5 .   ? 13.711  63.426 -33.611 1.00 44.61 ? 531 HOH B O     1 
HETATM 4275 O  O     . HOH L 5 .   ? 15.844  44.155 -38.383 1.00 28.44 ? 532 HOH B O     1 
HETATM 4276 O  O     . HOH L 5 .   ? 2.223   48.784 -48.945 1.00 25.09 ? 533 HOH B O     1 
HETATM 4277 O  O     . HOH L 5 .   ? 5.396   48.987 -60.797 1.00 45.35 ? 534 HOH B O     1 
HETATM 4278 O  O     . HOH L 5 .   ? 8.030   32.229 -50.239 1.00 35.06 ? 535 HOH B O     1 
HETATM 4279 O  O     . HOH L 5 .   ? -5.181  45.130 -48.744 1.00 42.47 ? 536 HOH B O     1 
HETATM 4280 O  O     . HOH L 5 .   ? 14.206  49.023 -28.719 1.00 42.66 ? 537 HOH B O     1 
HETATM 4281 O  O     . HOH L 5 .   ? 10.289  69.569 -31.984 1.00 42.40 ? 538 HOH B O     1 
HETATM 4282 O  O     . HOH L 5 .   ? 14.765  48.934 -45.140 1.00 31.75 ? 539 HOH B O     1 
HETATM 4283 O  O     . HOH L 5 .   ? 0.727   48.957 -50.911 1.00 29.17 ? 540 HOH B O     1 
HETATM 4284 O  O     . HOH L 5 .   ? 3.097   45.014 -25.955 1.00 42.39 ? 541 HOH B O     1 
HETATM 4285 O  O     . HOH L 5 .   ? 2.386   32.530 -32.083 1.00 32.87 ? 542 HOH B O     1 
HETATM 4286 O  O     . HOH L 5 .   ? 4.818   31.237 -35.367 1.00 31.14 ? 543 HOH B O     1 
HETATM 4287 O  O     . HOH L 5 .   ? -5.684  32.643 -40.831 1.00 37.17 ? 544 HOH B O     1 
HETATM 4288 O  O     . HOH L 5 .   ? 16.405  36.037 -53.951 1.00 37.67 ? 545 HOH B O     1 
HETATM 4289 O  O     . HOH L 5 .   ? 13.448  44.421 -40.956 1.00 21.07 ? 546 HOH B O     1 
HETATM 4290 O  O     . HOH L 5 .   ? -1.428  51.091 -43.418 1.00 17.83 ? 547 HOH B O     1 
HETATM 4291 O  O     . HOH L 5 .   ? 0.336   45.900 -48.700 1.00 25.06 ? 548 HOH B O     1 
HETATM 4292 O  O     . HOH L 5 .   ? 9.294   36.502 -36.632 1.00 23.31 ? 549 HOH B O     1 
HETATM 4293 O  O     . HOH L 5 .   ? 9.754   56.082 -54.073 1.00 31.40 ? 550 HOH B O     1 
HETATM 4294 O  O     . HOH L 5 .   ? 4.892   44.332 -27.939 1.00 27.03 ? 551 HOH B O     1 
HETATM 4295 O  O     . HOH L 5 .   ? 20.261  38.036 -31.203 1.00 24.85 ? 552 HOH B O     1 
HETATM 4296 O  O     . HOH L 5 .   ? 9.545   32.801 -42.796 1.00 26.60 ? 553 HOH B O     1 
HETATM 4297 O  O     . HOH L 5 .   ? 9.323   46.669 -60.103 1.00 32.82 ? 554 HOH B O     1 
HETATM 4298 O  O     . HOH L 5 .   ? 7.648   55.681 -55.864 1.00 35.48 ? 555 HOH B O     1 
HETATM 4299 O  O     . HOH L 5 .   ? -3.971  45.920 -46.301 1.00 34.47 ? 556 HOH B O     1 
HETATM 4300 O  O     . HOH L 5 .   ? 16.818  33.256 -43.959 1.00 27.47 ? 557 HOH B O     1 
HETATM 4301 O  O     . HOH L 5 .   ? -3.829  50.932 -44.622 1.00 37.24 ? 558 HOH B O     1 
HETATM 4302 O  O     . HOH L 5 .   ? 8.927   33.533 -45.552 1.00 23.97 ? 559 HOH B O     1 
HETATM 4303 O  O     . HOH L 5 .   ? 9.672   56.226 -36.010 1.00 21.80 ? 560 HOH B O     1 
HETATM 4304 O  O     . HOH L 5 .   ? 23.404  36.766 -50.387 1.00 31.43 ? 561 HOH B O     1 
HETATM 4305 O  O     . HOH L 5 .   ? 16.958  36.423 -49.184 1.00 34.34 ? 562 HOH B O     1 
HETATM 4306 O  O     . HOH L 5 .   ? 0.130   34.228 -31.478 1.00 33.99 ? 563 HOH B O     1 
HETATM 4307 O  O     . HOH L 5 .   ? 21.822  51.162 -54.167 1.00 34.27 ? 564 HOH B O     1 
HETATM 4308 O  O     . HOH L 5 .   ? -1.632  39.123 -28.048 1.00 40.27 ? 565 HOH B O     1 
HETATM 4309 O  O     . HOH L 5 .   ? 23.902  44.558 -61.500 1.00 38.10 ? 566 HOH B O     1 
HETATM 4310 O  O     . HOH L 5 .   ? 21.949  31.892 -33.602 1.00 40.04 ? 567 HOH B O     1 
HETATM 4311 O  O     . HOH L 5 .   ? -0.743  59.069 -35.273 1.00 33.74 ? 568 HOH B O     1 
HETATM 4312 O  O     . HOH L 5 .   ? 8.299   37.622 -26.227 1.00 28.34 ? 569 HOH B O     1 
HETATM 4313 O  O     . HOH L 5 .   ? 10.918  46.528 -32.664 1.00 20.53 ? 570 HOH B O     1 
HETATM 4314 O  O     . HOH L 5 .   ? 9.286   50.134 -26.617 1.00 47.81 ? 571 HOH B O     1 
HETATM 4315 O  O     . HOH L 5 .   ? 12.968  36.946 -52.544 1.00 23.94 ? 572 HOH B O     1 
HETATM 4316 O  O     . HOH L 5 .   ? 5.718   27.682 -29.315 1.00 42.33 ? 573 HOH B O     1 
HETATM 4317 O  O     . HOH L 5 .   ? 8.524   61.380 -41.680 1.00 30.75 ? 574 HOH B O     1 
HETATM 4318 O  O     . HOH L 5 .   ? 18.472  34.141 -24.851 1.00 35.38 ? 575 HOH B O     1 
HETATM 4319 O  O     . HOH L 5 .   ? 3.533   32.289 -50.025 1.00 31.12 ? 576 HOH B O     1 
HETATM 4320 O  O     . HOH L 5 .   ? 14.181  50.696 -39.085 1.00 30.44 ? 577 HOH B O     1 
HETATM 4321 O  O     . HOH L 5 .   ? 18.492  55.300 -51.336 1.00 32.95 ? 578 HOH B O     1 
HETATM 4322 O  O     . HOH L 5 .   ? 18.267  44.196 -37.125 1.00 31.46 ? 579 HOH B O     1 
HETATM 4323 O  O     . HOH L 5 .   ? 28.752  37.979 -44.915 1.00 45.09 ? 580 HOH B O     1 
HETATM 4324 O  O     . HOH L 5 .   ? 12.932  34.310 -53.235 1.00 34.63 ? 581 HOH B O     1 
HETATM 4325 O  O     . HOH L 5 .   ? -7.379  45.136 -35.522 1.00 33.71 ? 582 HOH B O     1 
HETATM 4326 O  O     . HOH L 5 .   ? 7.786   63.019 -38.205 1.00 32.25 ? 583 HOH B O     1 
HETATM 4327 O  O     . HOH L 5 .   ? 19.156  31.723 -23.778 1.00 39.47 ? 584 HOH B O     1 
HETATM 4328 O  O     . HOH L 5 .   ? 24.524  50.162 -50.631 1.00 36.06 ? 585 HOH B O     1 
HETATM 4329 O  O     . HOH L 5 .   ? 4.600   34.960 -56.618 1.00 43.57 ? 586 HOH B O     1 
HETATM 4330 O  O     . HOH L 5 .   ? 17.444  28.977 -38.609 1.00 40.94 ? 587 HOH B O     1 
HETATM 4331 O  O     . HOH L 5 .   ? 5.859   42.403 -26.295 1.00 43.67 ? 588 HOH B O     1 
HETATM 4332 O  O     . HOH L 5 .   ? 15.982  36.286 -22.593 1.00 36.59 ? 589 HOH B O     1 
HETATM 4333 O  O     . HOH L 5 .   ? 7.657   49.779 -61.501 1.00 44.38 ? 590 HOH B O     1 
HETATM 4334 O  O     . HOH L 5 .   ? 12.287  44.391 -25.878 1.00 53.20 ? 591 HOH B O     1 
HETATM 4335 O  O     . HOH L 5 .   ? 15.703  68.040 -35.056 1.00 39.88 ? 592 HOH B O     1 
HETATM 4336 O  O     . HOH L 5 .   ? 6.820   29.121 -41.142 1.00 38.51 ? 593 HOH B O     1 
HETATM 4337 O  O     . HOH L 5 .   ? -3.201  52.652 -31.175 1.00 50.72 ? 594 HOH B O     1 
HETATM 4338 O  O     . HOH L 5 .   ? 6.180   29.712 -36.945 1.00 50.31 ? 595 HOH B O     1 
HETATM 4339 O  O     . HOH L 5 .   ? 30.022  44.446 -41.001 1.00 41.43 ? 596 HOH B O     1 
HETATM 4340 O  O     . HOH L 5 .   ? 15.534  42.939 -69.300 1.00 49.18 ? 597 HOH B O     1 
HETATM 4341 O  O     . HOH L 5 .   ? 25.537  35.420 -49.413 1.00 44.24 ? 598 HOH B O     1 
HETATM 4342 O  O     . HOH L 5 .   ? 24.893  49.750 -46.257 1.00 42.74 ? 599 HOH B O     1 
HETATM 4343 O  O     . HOH L 5 .   ? 0.685   56.238 -46.809 1.00 45.46 ? 600 HOH B O     1 
HETATM 4344 O  O     . HOH L 5 .   ? 10.812  31.515 -48.884 1.00 46.88 ? 601 HOH B O     1 
HETATM 4345 O  O     . HOH L 5 .   ? 16.045  45.930 -27.328 1.00 47.91 ? 602 HOH B O     1 
HETATM 4346 O  O     . HOH L 5 .   ? -1.610  32.171 -47.289 1.00 43.75 ? 603 HOH B O     1 
HETATM 4347 O  O     . HOH L 5 .   ? 22.606  36.478 -54.447 1.00 47.55 ? 604 HOH B O     1 
HETATM 4348 O  O     . HOH L 5 .   ? 20.279  38.117 -55.216 1.00 38.12 ? 605 HOH B O     1 
HETATM 4349 O  O     . HOH L 5 .   ? 18.246  36.896 -56.258 1.00 34.74 ? 606 HOH B O     1 
HETATM 4350 O  O     . HOH L 5 .   ? 7.590   58.272 -42.172 1.00 38.93 ? 607 HOH B O     1 
HETATM 4351 O  O     . HOH L 5 .   ? 4.852   29.240 -33.727 1.00 39.51 ? 608 HOH B O     1 
HETATM 4352 O  O     . HOH L 5 .   ? 10.912  53.813 -35.429 1.00 50.58 ? 609 HOH B O     1 
HETATM 4353 O  O     . HOH L 5 .   ? 24.687  38.642 -57.394 1.00 51.09 ? 610 HOH B O     1 
HETATM 4354 O  O     . HOH L 5 .   ? 10.686  65.332 -30.586 1.00 44.39 ? 611 HOH B O     1 
HETATM 4355 O  O     . HOH L 5 .   ? 13.480  55.883 -36.327 1.00 50.71 ? 612 HOH B O     1 
HETATM 4356 O  O     . HOH L 5 .   ? 8.895   26.916 -35.368 1.00 51.17 ? 613 HOH B O     1 
HETATM 4357 O  O     . HOH L 5 .   ? 9.483   51.025 -34.336 1.00 47.86 ? 614 HOH B O     1 
HETATM 4358 O  O     . HOH L 5 .   ? 12.840  48.372 -46.581 1.00 36.04 ? 615 HOH B O     1 
HETATM 4359 O  O     . HOH L 5 .   ? 1.899   32.903 -23.457 1.00 34.60 ? 616 HOH B O     1 
HETATM 4360 O  O     . HOH L 5 .   ? 1.387   52.391 -48.582 1.00 31.75 ? 617 HOH B O     1 
HETATM 4361 O  O     . HOH L 5 .   ? 18.419  34.100 -56.407 1.00 45.27 ? 618 HOH B O     1 
HETATM 4362 O  O     . HOH L 5 .   ? 7.080   33.625 -56.804 1.00 44.24 ? 619 HOH B O     1 
HETATM 4363 O  O     . HOH L 5 .   ? 23.498  35.030 -65.229 1.00 49.26 ? 620 HOH B O     1 
HETATM 4364 O  O     . HOH L 5 .   ? 18.760  48.038 -43.892 1.00 42.24 ? 621 HOH B O     1 
HETATM 4365 O  O     . HOH L 5 .   ? 7.422   36.767 -59.477 1.00 46.03 ? 622 HOH B O     1 
HETATM 4366 O  O     . HOH L 5 .   ? -0.950  33.981 -51.581 1.00 53.08 ? 623 HOH B O     1 
HETATM 4367 O  O     . HOH L 5 .   ? 17.789  50.519 -33.234 1.00 47.92 ? 624 HOH B O     1 
HETATM 4368 O  O     . HOH L 5 .   ? -4.239  59.414 -41.292 1.00 44.76 ? 625 HOH B O     1 
HETATM 4369 O  O     A HOH L 5 .   ? 9.679   65.300 -42.181 0.59 21.15 ? 626 HOH B O     1 
HETATM 4370 O  O     B HOH L 5 .   ? -10.640 7.000  -14.473 0.41 17.93 ? 626 HOH B O     1 
HETATM 4371 O  O     . HOH L 5 .   ? 12.879  49.275 -48.729 1.00 36.30 ? 627 HOH B O     1 
HETATM 4372 O  O     . HOH L 5 .   ? -1.026  40.508 -58.425 1.00 37.31 ? 628 HOH B O     1 
HETATM 4373 O  O     . HOH L 5 .   ? 13.119  32.451 -51.427 1.00 45.60 ? 629 HOH B O     1 
HETATM 4374 O  O     . HOH L 5 .   ? 3.488   32.222 -46.538 1.00 55.18 ? 630 HOH B O     1 
HETATM 4375 O  O     . HOH L 5 .   ? 7.986   30.495 -43.285 1.00 50.41 ? 631 HOH B O     1 
HETATM 4376 O  O     . HOH L 5 .   ? -9.860  36.836 -40.054 1.00 41.09 ? 632 HOH B O     1 
HETATM 4377 O  O     . HOH L 5 .   ? -5.932  52.631 -32.504 1.00 52.92 ? 633 HOH B O     1 
HETATM 4378 O  O     . HOH L 5 .   ? 12.698  58.838 -58.491 1.00 49.47 ? 634 HOH B O     1 
HETATM 4379 O  O     . HOH L 5 .   ? -6.946  50.292 -41.874 1.00 53.75 ? 635 HOH B O     1 
HETATM 4380 O  O     . HOH L 5 .   ? 10.164  57.272 -39.818 1.00 40.05 ? 636 HOH B O     1 
HETATM 4381 O  O     . HOH L 5 .   ? 23.365  37.689 -31.932 1.00 51.45 ? 637 HOH B O     1 
HETATM 4382 O  O     . HOH L 5 .   ? 4.899   39.500 -26.549 1.00 45.97 ? 638 HOH B O     1 
HETATM 4383 O  O     . HOH L 5 .   ? 20.004  49.456 -68.777 1.00 44.63 ? 639 HOH B O     1 
HETATM 4384 O  O     . HOH L 5 .   ? 10.395  49.831 -48.236 1.00 42.58 ? 640 HOH B O     1 
HETATM 4385 O  O     A HOH L 5 .   ? 3.715   34.667 -24.151 0.37 24.91 ? 641 HOH B O     1 
HETATM 4386 O  O     B HOH L 5 .   ? 7.816   30.686 -27.246 0.63 25.88 ? 641 HOH B O     1 
HETATM 4387 O  O     A HOH L 5 .   ? 3.901   28.969 -37.760 0.43 24.53 ? 642 HOH B O     1 
HETATM 4388 O  O     B HOH L 5 .   ? 3.536   28.902 -39.958 0.57 40.67 ? 642 HOH B O     1 
HETATM 4389 O  O     . HOH L 5 .   ? 8.798   31.643 -24.366 1.00 61.90 ? 643 HOH B O     1 
HETATM 4390 O  O     . HOH L 5 .   ? 14.726  70.320 -33.843 1.00 46.68 ? 644 HOH B O     1 
HETATM 4391 O  O     . HOH M 5 .   ? 8.804   15.639 -24.597 1.00 19.03 ? 101 HOH D O     1 
HETATM 4392 O  O     . HOH M 5 .   ? 17.537  16.414 -21.726 1.00 33.60 ? 102 HOH D O     1 
HETATM 4393 O  O     . HOH M 5 .   ? 8.502   20.229 -26.033 1.00 21.53 ? 103 HOH D O     1 
HETATM 4394 O  O     . HOH M 5 .   ? 10.003  13.028 -24.357 1.00 22.97 ? 104 HOH D O     1 
HETATM 4395 O  O     . HOH M 5 .   ? 6.436   6.014  -39.822 1.00 32.58 ? 105 HOH D O     1 
HETATM 4396 O  O     . HOH M 5 .   ? 9.699   17.748 -26.376 1.00 32.37 ? 106 HOH D O     1 
HETATM 4397 O  O     . HOH M 5 .   ? 19.679  13.031 -33.632 1.00 34.55 ? 107 HOH D O     1 
HETATM 4398 O  O     . HOH M 5 .   ? 4.789   7.409  -41.392 1.00 35.52 ? 108 HOH D O     1 
HETATM 4399 O  O     . HOH M 5 .   ? 5.383   5.886  -37.248 1.00 36.68 ? 109 HOH D O     1 
HETATM 4400 O  O     . HOH M 5 .   ? 9.680   11.354 -19.920 1.00 39.62 ? 110 HOH D O     1 
HETATM 4401 O  O     . HOH M 5 .   ? 13.050  16.634 -28.771 1.00 39.38 ? 111 HOH D O     1 
HETATM 4402 O  O     . HOH M 5 .   ? 17.463  16.211 -30.960 1.00 37.59 ? 112 HOH D O     1 
HETATM 4403 O  O     . HOH M 5 .   ? 19.928  13.225 -24.773 1.00 41.76 ? 113 HOH D O     1 
HETATM 4404 O  O     . HOH M 5 .   ? 15.078  17.404 -30.549 1.00 42.49 ? 114 HOH D O     1 
HETATM 4405 O  O     . HOH M 5 .   ? 6.012   14.121 -23.408 1.00 26.15 ? 115 HOH D O     1 
HETATM 4406 O  O     . HOH M 5 .   ? 12.244  14.199 -32.339 1.00 42.31 ? 116 HOH D O     1 
HETATM 4407 O  O     . HOH M 5 .   ? 19.773  9.544  -26.658 1.00 40.25 ? 117 HOH D O     1 
HETATM 4408 O  O     . HOH M 5 .   ? -0.919  3.308  -42.494 1.00 44.74 ? 118 HOH D O     1 
HETATM 4409 O  O     . HOH M 5 .   ? 11.531  14.673 -29.178 1.00 25.47 ? 119 HOH D O     1 
HETATM 4410 O  O     A HOH M 5 .   ? 7.599   10.472 -17.407 0.80 32.36 ? 120 HOH D O     1 
HETATM 4411 O  O     B HOH M 5 .   ? 7.791   12.659 -15.760 0.20 5.82  ? 120 HOH D O     1 
HETATM 4412 O  O     . HOH M 5 .   ? 16.354  10.548 -35.760 1.00 32.14 ? 121 HOH D O     1 
HETATM 4413 O  O     A HOH M 5 .   ? 8.843   12.397 -17.157 0.43 15.07 ? 122 HOH D O     1 
HETATM 4414 O  O     B HOH M 5 .   ? 10.641  11.075 -17.035 0.57 26.19 ? 122 HOH D O     1 
HETATM 4415 O  O     . HOH M 5 .   ? 17.494  5.956  -29.393 1.00 49.60 ? 123 HOH D O     1 
HETATM 4416 O  O     . HOH M 5 .   ? 14.938  1.462  -39.683 1.00 48.84 ? 124 HOH D O     1 
HETATM 4417 O  O     . HOH M 5 .   ? 14.961  19.748 -19.248 1.00 42.37 ? 125 HOH D O     1 
HETATM 4418 O  O     . HOH M 5 .   ? 10.814  -1.360 -40.641 1.00 46.31 ? 126 HOH D O     1 
HETATM 4419 O  O     . HOH M 5 .   ? 12.939  20.574 -18.081 1.00 49.81 ? 127 HOH D O     1 
HETATM 4420 O  O     . HOH M 5 .   ? 10.313  23.534 -29.974 1.00 39.43 ? 128 HOH D O     1 
HETATM 4421 O  O     . HOH M 5 .   ? 10.437  21.869 -27.307 1.00 35.69 ? 129 HOH D O     1 
HETATM 4422 O  O     . HOH M 5 .   ? 22.082  15.567 -32.625 1.00 37.62 ? 130 HOH D O     1 
HETATM 4423 O  O     A HOH M 5 .   ? 12.148  18.429 -27.576 0.58 26.17 ? 131 HOH D O     1 
HETATM 4424 O  O     B HOH M 5 .   ? 15.415  22.471 -25.284 0.42 22.60 ? 131 HOH D O     1 
HETATM 4425 O  O     . HOH M 5 .   ? 7.456   12.176 -22.877 1.00 41.56 ? 132 HOH D O     1 
HETATM 4426 O  O     . HOH M 5 .   ? -0.344  -0.706 -40.328 1.00 46.46 ? 133 HOH D O     1 
HETATM 4427 O  O     . HOH M 5 .   ? 6.180   10.305 -24.264 1.00 47.22 ? 134 HOH D O     1 
HETATM 4428 O  O     . HOH M 5 .   ? 3.103   18.945 -19.715 1.00 42.28 ? 135 HOH D O     1 
HETATM 4429 O  O     . HOH M 5 .   ? 7.205   7.260  -43.674 1.00 41.82 ? 136 HOH D O     1 
HETATM 4430 O  O     . HOH N 5 .   ? 9.594   11.700 -26.534 1.00 23.67 ? 101 HOH E O     1 
HETATM 4431 O  O     . HOH N 5 .   ? 5.786   12.080 -31.607 1.00 20.27 ? 102 HOH E O     1 
HETATM 4432 O  O     . HOH N 5 .   ? 1.954   9.719  -31.724 1.00 25.68 ? 103 HOH E O     1 
HETATM 4433 O  O     . HOH N 5 .   ? 19.845  8.554  -23.929 1.00 30.50 ? 104 HOH E O     1 
HETATM 4434 O  O     . HOH N 5 .   ? 8.246   11.975 -30.360 1.00 29.64 ? 105 HOH E O     1 
HETATM 4435 O  O     . HOH N 5 .   ? 6.401   13.642 -35.162 1.00 21.76 ? 106 HOH E O     1 
HETATM 4436 O  O     . HOH N 5 .   ? 12.393  12.662 -34.833 1.00 30.97 ? 107 HOH E O     1 
HETATM 4437 O  O     . HOH N 5 .   ? 10.424  14.349 -36.163 1.00 33.87 ? 108 HOH E O     1 
HETATM 4438 O  O     . HOH N 5 .   ? 8.131   13.193 -37.016 1.00 26.11 ? 109 HOH E O     1 
HETATM 4439 O  O     . HOH N 5 .   ? 14.116  7.294  -18.121 1.00 30.52 ? 110 HOH E O     1 
HETATM 4440 O  O     . HOH N 5 .   ? 14.548  12.610 -36.191 1.00 33.23 ? 111 HOH E O     1 
HETATM 4441 O  O     . HOH N 5 .   ? 12.362  4.803  -28.013 1.00 34.25 ? 112 HOH E O     1 
HETATM 4442 O  O     . HOH N 5 .   ? 7.467   14.773 -39.256 1.00 38.77 ? 113 HOH E O     1 
HETATM 4443 O  O     . HOH N 5 .   ? 1.699   6.972  -30.969 1.00 35.02 ? 114 HOH E O     1 
HETATM 4444 O  O     . HOH N 5 .   ? 14.697  4.654  -18.524 1.00 45.08 ? 115 HOH E O     1 
HETATM 4445 O  O     . HOH N 5 .   ? 2.178   6.260  -26.832 1.00 31.52 ? 116 HOH E O     1 
HETATM 4446 O  O     . HOH N 5 .   ? 11.583  7.675  -21.259 1.00 37.73 ? 117 HOH E O     1 
HETATM 4447 O  O     . HOH N 5 .   ? 7.509   4.724  -35.490 1.00 38.32 ? 118 HOH E O     1 
HETATM 4448 O  O     . HOH N 5 .   ? 1.822   10.578 -40.576 1.00 35.50 ? 119 HOH E O     1 
HETATM 4449 O  O     . HOH N 5 .   ? 19.931  12.804 -21.952 1.00 28.55 ? 120 HOH E O     1 
HETATM 4450 O  O     . HOH N 5 .   ? 25.809  8.930  -21.911 1.00 24.26 ? 121 HOH E O     1 
HETATM 4451 O  O     . HOH N 5 .   ? 14.024  11.735 -38.687 1.00 34.34 ? 122 HOH E O     1 
HETATM 4452 O  O     . HOH N 5 .   ? 12.311  8.800  -18.730 1.00 39.87 ? 123 HOH E O     1 
HETATM 4453 O  O     . HOH N 5 .   ? 26.887  7.389  -18.958 1.00 19.74 ? 124 HOH E O     1 
HETATM 4454 O  O     . HOH N 5 .   ? 28.150  5.024  -13.483 1.00 39.86 ? 125 HOH E O     1 
HETATM 4455 O  O     . HOH N 5 .   ? 8.414   9.248  -25.268 1.00 41.63 ? 126 HOH E O     1 
HETATM 4456 O  O     . HOH N 5 .   ? 22.441  11.816 -21.385 1.00 35.68 ? 127 HOH E O     1 
HETATM 4457 O  O     . HOH N 5 .   ? 1.234   5.585  -33.202 1.00 44.19 ? 128 HOH E O     1 
HETATM 4458 O  O     . HOH N 5 .   ? 8.325   8.334  -46.678 1.00 46.52 ? 129 HOH E O     1 
HETATM 4459 O  O     . HOH N 5 .   ? 2.970   3.772  -34.358 1.00 42.90 ? 130 HOH E O     1 
HETATM 4460 O  O     . HOH N 5 .   ? 4.561   2.830  -32.498 1.00 44.89 ? 131 HOH E O     1 
HETATM 4461 O  O     . HOH N 5 .   ? 29.476  9.280  -15.343 1.00 65.34 ? 132 HOH E O     1 
HETATM 4462 O  O     . HOH N 5 .   ? 19.180  1.250  -17.906 1.00 38.12 ? 133 HOH E O     1 
HETATM 4463 O  O     . HOH N 5 .   ? 7.470   3.423  -33.288 1.00 33.12 ? 134 HOH E O     1 
HETATM 4464 O  O     . HOH N 5 .   ? 16.109  5.006  -25.412 1.00 38.66 ? 135 HOH E O     1 
HETATM 4465 O  O     . HOH N 5 .   ? 4.969   8.861  -28.226 1.00 25.12 ? 136 HOH E O     1 
HETATM 4466 O  O     . HOH N 5 .   ? 15.849  6.860  -40.445 1.00 41.21 ? 137 HOH E O     1 
HETATM 4467 O  O     A HOH N 5 .   ? 11.544  2.414  -29.270 0.45 20.11 ? 138 HOH E O     1 
HETATM 4468 O  O     B HOH N 5 .   ? 10.233  4.080  -31.050 0.55 33.66 ? 138 HOH E O     1 
HETATM 4469 O  O     . HOH N 5 .   ? 11.875  2.533  -31.550 1.00 46.76 ? 139 HOH E O     1 
HETATM 4470 O  O     . HOH N 5 .   ? 6.816   17.090 -38.311 1.00 46.31 ? 140 HOH E O     1 
HETATM 4471 O  O     . HOH O 5 .   ? 13.040  63.490 -48.329 1.00 42.33 ? 101 HOH G O     1 
HETATM 4472 O  O     . HOH O 5 .   ? 13.944  55.959 -53.733 1.00 20.73 ? 102 HOH G O     1 
HETATM 4473 O  O     . HOH O 5 .   ? 28.602  55.622 -60.598 1.00 39.36 ? 103 HOH G O     1 
HETATM 4474 O  O     . HOH O 5 .   ? 11.140  58.156 -44.485 1.00 25.40 ? 104 HOH G O     1 
HETATM 4475 O  O     . HOH O 5 .   ? 11.748  54.115 -53.185 1.00 22.22 ? 105 HOH G O     1 
HETATM 4476 O  O     . HOH O 5 .   ? 15.822  48.824 -48.863 1.00 27.01 ? 106 HOH G O     1 
HETATM 4477 O  O     . HOH O 5 .   ? 17.248  66.836 -51.133 1.00 33.75 ? 107 HOH G O     1 
HETATM 4478 O  O     . HOH O 5 .   ? 18.861  60.088 -57.271 1.00 32.81 ? 108 HOH G O     1 
HETATM 4479 O  O     . HOH O 5 .   ? 8.189   59.858 -52.767 1.00 45.94 ? 109 HOH G O     1 
HETATM 4480 O  O     . HOH O 5 .   ? 15.638  63.946 -57.466 1.00 46.16 ? 110 HOH G O     1 
HETATM 4481 O  O     . HOH O 5 .   ? 15.979  55.280 -51.685 1.00 22.68 ? 111 HOH G O     1 
HETATM 4482 O  O     . HOH O 5 .   ? 20.101  56.936 -47.411 1.00 39.35 ? 112 HOH G O     1 
HETATM 4483 O  O     . HOH O 5 .   ? 17.967  58.774 -55.392 1.00 30.79 ? 113 HOH G O     1 
HETATM 4484 O  O     . HOH O 5 .   ? 32.497  59.694 -66.648 1.00 39.10 ? 114 HOH G O     1 
HETATM 4485 O  O     . HOH O 5 .   ? 12.759  68.991 -57.324 1.00 47.27 ? 115 HOH G O     1 
HETATM 4486 O  O     . HOH O 5 .   ? 28.181  52.962 -61.576 1.00 45.58 ? 116 HOH G O     1 
HETATM 4487 O  O     . HOH O 5 .   ? 20.439  67.872 -52.608 1.00 40.09 ? 117 HOH G O     1 
HETATM 4488 O  O     . HOH O 5 .   ? 30.405  61.172 -67.879 1.00 44.72 ? 118 HOH G O     1 
HETATM 4489 O  O     . HOH O 5 .   ? 10.039  60.617 -56.548 1.00 46.73 ? 119 HOH G O     1 
HETATM 4490 O  O     . HOH O 5 .   ? 28.893  64.242 -56.439 1.00 47.93 ? 120 HOH G O     1 
HETATM 4491 O  O     . HOH O 5 .   ? 33.903  58.364 -68.649 1.00 45.93 ? 121 HOH G O     1 
HETATM 4492 O  O     . HOH O 5 .   ? 14.979  59.540 -55.543 1.00 34.64 ? 122 HOH G O     1 
HETATM 4493 O  O     A HOH O 5 .   ? 19.357  54.445 -44.708 0.66 53.52 ? 123 HOH G O     1 
HETATM 4494 O  O     B HOH O 5 .   ? 20.366  53.524 -43.666 0.34 22.00 ? 123 HOH G O     1 
HETATM 4495 O  O     . HOH O 5 .   ? 19.585  57.489 -50.883 1.00 35.22 ? 124 HOH G O     1 
HETATM 4496 O  O     . HOH O 5 .   ? 10.828  61.128 -46.008 1.00 48.19 ? 125 HOH G O     1 
HETATM 4497 O  O     . HOH O 5 .   ? 29.618  62.737 -65.502 1.00 44.61 ? 126 HOH G O     1 
HETATM 4498 O  O     . HOH O 5 .   ? 9.433   63.364 -55.741 1.00 52.31 ? 127 HOH G O     1 
HETATM 4499 O  O     A HOH O 5 .   ? 20.245  57.469 -44.321 0.50 27.97 ? 128 HOH G O     1 
HETATM 4500 O  O     B HOH O 5 .   ? 20.992  55.858 -42.966 0.50 34.69 ? 128 HOH G O     1 
HETATM 4501 O  O     . HOH O 5 .   ? 19.538  57.572 -41.959 1.00 39.42 ? 129 HOH G O     1 
HETATM 4502 O  O     . HOH P 5 .   ? 19.498  52.626 -59.605 1.00 47.19 ? 101 HOH H O     1 
HETATM 4503 O  O     . HOH P 5 .   ? 21.139  67.694 -50.093 1.00 31.76 ? 102 HOH H O     1 
HETATM 4504 O  O     . HOH P 5 .   ? 19.897  60.386 -69.793 1.00 42.55 ? 103 HOH H O     1 
HETATM 4505 O  O     . HOH P 5 .   ? 27.476  67.655 -43.758 1.00 46.13 ? 104 HOH H O     1 
HETATM 4506 O  O     . HOH P 5 .   ? 23.473  62.288 -66.157 1.00 38.92 ? 105 HOH H O     1 
HETATM 4507 O  O     . HOH P 5 .   ? 18.968  55.324 -58.485 1.00 36.15 ? 106 HOH H O     1 
HETATM 4508 O  O     . HOH P 5 .   ? 15.746  71.242 -46.629 1.00 39.90 ? 107 HOH H O     1 
HETATM 4509 O  O     . HOH P 5 .   ? 22.222  72.670 -44.642 1.00 17.93 ? 108 HOH H O     1 
HETATM 4510 O  O     . HOH P 5 .   ? 21.107  50.902 -58.201 1.00 25.24 ? 109 HOH H O     1 
HETATM 4511 O  O     . HOH P 5 .   ? 21.718  48.965 -60.132 1.00 29.30 ? 110 HOH H O     1 
HETATM 4512 O  O     . HOH P 5 .   ? 17.556  53.970 -62.702 1.00 38.58 ? 111 HOH H O     1 
HETATM 4513 O  O     . HOH P 5 .   ? 26.946  62.276 -69.194 1.00 37.41 ? 112 HOH H O     1 
HETATM 4514 O  O     . HOH P 5 .   ? 16.838  66.710 -48.436 1.00 30.17 ? 113 HOH H O     1 
HETATM 4515 O  O     . HOH P 5 .   ? 15.568  76.000 -46.134 1.00 35.58 ? 114 HOH H O     1 
HETATM 4516 O  O     . HOH P 5 .   ? 23.727  53.695 -70.772 1.00 39.30 ? 115 HOH H O     1 
HETATM 4517 O  O     . HOH P 5 .   ? 20.134  58.168 -59.182 1.00 35.26 ? 116 HOH H O     1 
HETATM 4518 O  O     . HOH P 5 .   ? 18.331  56.866 -66.056 1.00 42.59 ? 117 HOH H O     1 
HETATM 4519 O  O     . HOH P 5 .   ? 23.607  47.552 -61.228 1.00 40.63 ? 118 HOH H O     1 
HETATM 4520 O  O     . HOH P 5 .   ? 26.476  66.112 -52.164 1.00 39.70 ? 119 HOH H O     1 
HETATM 4521 O  O     . HOH P 5 .   ? 20.761  62.708 -68.040 1.00 42.95 ? 120 HOH H O     1 
HETATM 4522 O  O     . HOH P 5 .   ? 23.842  52.850 -68.224 1.00 37.28 ? 121 HOH H O     1 
HETATM 4523 O  O     . HOH P 5 .   ? 24.229  67.692 -51.621 1.00 49.45 ? 122 HOH H O     1 
HETATM 4524 O  O     . HOH P 5 .   ? 26.048  70.190 -49.602 1.00 45.58 ? 123 HOH H O     1 
HETATM 4525 O  O     . HOH P 5 .   ? 18.393  56.854 -63.395 1.00 49.06 ? 124 HOH H O     1 
HETATM 4526 O  O     . HOH P 5 .   ? 23.396  70.158 -49.840 1.00 51.82 ? 125 HOH H O     1 
HETATM 4527 O  O     . HOH P 5 .   ? 20.139  72.471 -47.944 1.00 28.09 ? 126 HOH H O     1 
HETATM 4528 O  O     . HOH P 5 .   ? 23.014  66.479 -43.088 1.00 28.81 ? 127 HOH H O     1 
HETATM 4529 O  O     . HOH P 5 .   ? 22.264  58.497 -47.724 1.00 36.48 ? 128 HOH H O     1 
HETATM 4530 O  O     . HOH P 5 .   ? 22.765  62.183 -44.190 1.00 32.39 ? 129 HOH H O     1 
HETATM 4531 O  O     . HOH P 5 .   ? 28.510  62.503 -72.934 1.00 47.87 ? 130 HOH H O     1 
HETATM 4532 O  O     . HOH P 5 .   ? 21.902  59.709 -44.053 1.00 39.43 ? 131 HOH H O     1 
HETATM 4533 O  O     A HOH P 5 .   ? 14.373  72.136 -43.333 0.65 39.60 ? 132 HOH H O     1 
HETATM 4534 O  O     B HOH P 5 .   ? 14.609  71.908 -41.127 0.35 19.58 ? 132 HOH H O     1 
HETATM 4535 O  O     . HOH P 5 .   ? 17.205  74.516 -45.161 1.00 45.69 ? 133 HOH H O     1 
HETATM 4536 O  O     . HOH P 5 .   ? 21.657  58.265 -51.822 1.00 44.79 ? 134 HOH H O     1 
HETATM 4537 O  O     . HOH P 5 .   ? 21.424  57.731 -54.265 0.85 39.09 ? 135 HOH H O     1 
HETATM 4538 O  O     . HOH P 5 .   ? 19.682  59.518 -63.131 1.00 49.37 ? 136 HOH H O     1 
HETATM 4539 O  O     . HOH P 5 .   ? 29.068  69.261 -46.152 1.00 41.73 ? 137 HOH H O     1 
HETATM 4540 O  O     . HOH P 5 .   ? 26.689  53.346 -63.777 1.00 44.18 ? 138 HOH H O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . GLY A 1   ? 0.3870 0.4720 0.5304 0.0402  -0.0818 -0.0956 161 GLY A N     
2    C CA    . GLY A 1   ? 0.3861 0.4796 0.5539 0.0322  -0.0786 -0.0989 161 GLY A CA    
3    C C     . GLY A 1   ? 0.3452 0.4202 0.4881 0.0328  -0.0892 -0.1006 161 GLY A C     
4    O O     . GLY A 1   ? 0.3583 0.4143 0.4659 0.0400  -0.0985 -0.0991 161 GLY A O     
5    N N     . SER A 2   ? 0.2593 0.3378 0.4191 0.0258  -0.0869 -0.1033 162 SER A N     
6    C CA    . SER A 2   ? 0.2318 0.2919 0.3679 0.0279  -0.0961 -0.1052 162 SER A CA    
7    C C     . SER A 2   ? 0.2212 0.2665 0.3206 0.0251  -0.0864 -0.0937 162 SER A C     
8    O O     . SER A 2   ? 0.2132 0.2629 0.3103 0.0195  -0.0701 -0.0836 162 SER A O     
9    C CB    . SER A 2   ? 0.2365 0.3022 0.4011 0.0217  -0.0947 -0.1107 162 SER A CB    
10   O OG    . SER A 2   ? 0.2139 0.2877 0.3920 0.0104  -0.0787 -0.1045 162 SER A OG    
11   N N     . HIS A 3   ? 0.2165 0.2433 0.2861 0.0302  -0.0955 -0.0950 163 HIS A N     
12   C CA    A HIS A 3   ? 0.2666 0.2804 0.3043 0.0277  -0.0844 -0.0840 163 HIS A CA    
13   C CA    B HIS A 3   ? 0.2666 0.2802 0.3041 0.0277  -0.0845 -0.0841 163 HIS A CA    
14   C C     . HIS A 3   ? 0.2378 0.2586 0.2903 0.0186  -0.0722 -0.0810 163 HIS A C     
15   O O     . HIS A 3   ? 0.2145 0.2373 0.2596 0.0134  -0.0572 -0.0712 163 HIS A O     
16   C CB    A HIS A 3   ? 0.3254 0.3169 0.3260 0.0372  -0.0955 -0.0858 163 HIS A CB    
17   C CB    B HIS A 3   ? 0.3154 0.3070 0.3168 0.0370  -0.0956 -0.0861 163 HIS A CB    
18   C CG    A HIS A 3   ? 0.3861 0.3649 0.3647 0.0471  -0.1043 -0.0854 163 HIS A CG    
19   C CG    B HIS A 3   ? 0.3419 0.3236 0.3178 0.0342  -0.0839 -0.0770 163 HIS A CG    
20   N ND1   A HIS A 3   ? 0.4330 0.4064 0.3943 0.0460  -0.0961 -0.0762 163 HIS A ND1   
21   N ND1   B HIS A 3   ? 0.3906 0.3676 0.3458 0.0316  -0.0710 -0.0653 163 HIS A ND1   
22   C CD2   A HIS A 3   ? 0.4401 0.4090 0.4126 0.0585  -0.1166 -0.0901 163 HIS A CD2   
23   C CD2   B HIS A 3   ? 0.3770 0.3535 0.3471 0.0338  -0.0834 -0.0787 163 HIS A CD2   
24   C CE1   A HIS A 3   ? 0.4572 0.4161 0.4000 0.0563  -0.1059 -0.0774 163 HIS A CE1   
25   C CE1   B HIS A 3   ? 0.3823 0.3538 0.3216 0.0300  -0.0625 -0.0603 163 HIS A CE1   
26   N NE2   A HIS A 3   ? 0.4746 0.4309 0.4240 0.0644  -0.1171 -0.0849 163 HIS A NE2   
27   N NE2   B HIS A 3   ? 0.3747 0.3450 0.3206 0.0319  -0.0697 -0.0680 163 HIS A NE2   
28   N N     . MET A 4   ? 0.2126 0.2359 0.2861 0.0172  -0.0797 -0.0903 164 MET A N     
29   C CA    . MET A 4   ? 0.2012 0.2265 0.2860 0.0092  -0.0688 -0.0875 164 MET A CA    
30   C C     . MET A 4   ? 0.2154 0.2556 0.3245 0.0009  -0.0510 -0.0804 164 MET A C     
31   O O     . MET A 4   ? 0.2243 0.2626 0.3286 -0.0036 -0.0375 -0.0730 164 MET A O     
32   C CB    . MET A 4   ? 0.2353 0.2584 0.3407 0.0089  -0.0816 -0.1002 164 MET A CB    
33   C CG    . MET A 4   ? 0.2237 0.2619 0.3707 0.0074  -0.0892 -0.1100 164 MET A CG    
34   S SD    . MET A 4   ? 0.4602 0.4929 0.6267 0.0086  -0.0998 -0.1198 164 MET A SD    
35   C CE    . MET A 4   ? 0.6013 0.6137 0.7240 0.0252  -0.1180 -0.1230 164 MET A CE    
36   N N     . GLY A 5   ? 0.1834 0.2371 0.3155 0.0009  -0.0510 -0.0827 165 GLY A N     
37   C CA    . GLY A 5   ? 0.1893 0.2561 0.3429 -0.0046 -0.0337 -0.0763 165 GLY A CA    
38   C C     . GLY A 5   ? 0.1805 0.2477 0.3126 -0.0019 -0.0241 -0.0665 165 GLY A C     
39   O O     . GLY A 5   ? 0.1624 0.2381 0.3054 -0.0037 -0.0099 -0.0609 165 GLY A O     
40   N N     . HIS A 6   ? 0.1290 0.1855 0.2299 0.0030  -0.0313 -0.0646 166 HIS A N     
41   C CA    . HIS A 6   ? 0.1402 0.1960 0.2230 0.0049  -0.0243 -0.0569 166 HIS A CA    
42   C C     . HIS A 6   ? 0.1261 0.1815 0.1999 0.0016  -0.0097 -0.0486 166 HIS A C     
43   O O     . HIS A 6   ? 0.1625 0.2120 0.2296 -0.0007 -0.0074 -0.0475 166 HIS A O     
44   C CB    . HIS A 6   ? 0.1711 0.2134 0.2246 0.0094  -0.0338 -0.0562 166 HIS A CB    
45   C CG    . HIS A 6   ? 0.1880 0.2287 0.2278 0.0107  -0.0292 -0.0504 166 HIS A CG    
46   N ND1   . HIS A 6   ? 0.1698 0.2048 0.1905 0.0084  -0.0221 -0.0436 166 HIS A ND1   
47   C CD2   . HIS A 6   ? 0.2033 0.2475 0.2474 0.0143  -0.0314 -0.0514 166 HIS A CD2   
48   C CE1   . HIS A 6   ? 0.1910 0.2255 0.2061 0.0097  -0.0209 -0.0411 166 HIS A CE1   
49   N NE2   . HIS A 6   ? 0.1943 0.2331 0.2214 0.0137  -0.0265 -0.0454 166 HIS A NE2   
50   N N     . TRP A 7   ? 0.1315 0.1920 0.2035 0.0032  -0.0010 -0.0438 167 TRP A N     
51   C CA    . TRP A 7   ? 0.1395 0.1995 0.2023 0.0027  0.0113  -0.0372 167 TRP A CA    
52   C C     . TRP A 7   ? 0.1612 0.2130 0.2021 0.0018  0.0100  -0.0348 167 TRP A C     
53   O O     . TRP A 7   ? 0.1598 0.2102 0.1962 0.0014  0.0176  -0.0317 167 TRP A O     
54   C CB    . TRP A 7   ? 0.1333 0.1978 0.1923 0.0073  0.0174  -0.0340 167 TRP A CB    
55   C CG    . TRP A 7   ? 0.1259 0.1865 0.1700 0.0096  0.0092  -0.0347 167 TRP A CG    
56   C CD1   . TRP A 7   ? 0.1380 0.1995 0.1857 0.0128  0.0021  -0.0379 167 TRP A CD1   
57   C CD2   . TRP A 7   ? 0.1218 0.1764 0.1472 0.0087  0.0076  -0.0324 167 TRP A CD2   
58   N NE1   . TRP A 7   ? 0.1452 0.1986 0.1756 0.0134  -0.0035 -0.0371 167 TRP A NE1   
59   C CE2   . TRP A 7   ? 0.1553 0.2054 0.1740 0.0101  0.0002  -0.0337 167 TRP A CE2   
60   C CE3   . TRP A 7   ? 0.1229 0.1759 0.1384 0.0070  0.0120  -0.0297 167 TRP A CE3   
61   C CZ2   . TRP A 7   ? 0.1646 0.2084 0.1697 0.0081  -0.0018 -0.0321 167 TRP A CZ2   
62   C CZ3   . TRP A 7   ? 0.1530 0.2028 0.1565 0.0057  0.0096  -0.0288 167 TRP A CZ3   
63   C CH2   . TRP A 7   ? 0.1877 0.2329 0.1875 0.0055  0.0033  -0.0298 167 TRP A CH2   
64   N N     . SER A 8   ? 0.1375 0.1832 0.1646 0.0023  0.0013  -0.0359 168 SER A N     
65   C CA    . SER A 8   ? 0.1738 0.2132 0.1818 0.0015  0.0023  -0.0331 168 SER A CA    
66   C C     . SER A 8   ? 0.1806 0.2148 0.1853 0.0008  0.0015  -0.0346 168 SER A C     
67   O O     . SER A 8   ? 0.1826 0.2139 0.1738 0.0011  0.0049  -0.0322 168 SER A O     
68   C CB    . SER A 8   ? 0.1595 0.1908 0.1528 0.0021  -0.0042 -0.0326 168 SER A CB    
69   O OG    . SER A 8   ? 0.1810 0.2045 0.1720 0.0045  -0.0142 -0.0368 168 SER A OG    
70   N N     . GLN A 9   ? 0.1449 0.1786 0.1639 0.0003  -0.0034 -0.0396 169 GLN A N     
71   C CA    . GLN A 9   ? 0.1597 0.1862 0.1760 0.0003  -0.0069 -0.0430 169 GLN A CA    
72   C C     . GLN A 9   ? 0.1737 0.2021 0.2028 -0.0024 0.0018  -0.0418 169 GLN A C     
73   O O     . GLN A 9   ? 0.1723 0.1937 0.2034 -0.0030 -0.0012 -0.0455 169 GLN A O     
74   C CB    . GLN A 9   ? 0.1969 0.2194 0.2216 0.0020  -0.0206 -0.0513 169 GLN A CB    
75   C CG    . GLN A 9   ? 0.2428 0.2586 0.2498 0.0069  -0.0295 -0.0519 169 GLN A CG    
76   C CD    . GLN A 9   ? 0.2975 0.3031 0.2748 0.0093  -0.0263 -0.0466 169 GLN A CD    
77   O OE1   . GLN A 9   ? 0.3270 0.3242 0.2917 0.0120  -0.0282 -0.0483 169 GLN A OE1   
78   N NE2   . GLN A 9   ? 0.2996 0.3056 0.2670 0.0084  -0.0208 -0.0405 169 GLN A NE2   
79   N N     . GLY A 10  ? 0.1417 0.1770 0.1767 -0.0030 0.0125  -0.0368 170 GLY A N     
80   C CA    . GLY A 10  ? 0.1553 0.1897 0.2011 -0.0046 0.0230  -0.0342 170 GLY A CA    
81   C C     . GLY A 10  ? 0.1557 0.1811 0.1879 -0.0033 0.0267  -0.0324 170 GLY A C     
82   O O     . GLY A 10  ? 0.1659 0.1848 0.2077 -0.0055 0.0318  -0.0324 170 GLY A O     
83   N N     . LEU A 11  ? 0.1609 0.1853 0.1721 0.0003  0.0250  -0.0311 171 LEU A N     
84   C CA    . LEU A 11  ? 0.1613 0.1785 0.1589 0.0033  0.0280  -0.0302 171 LEU A CA    
85   C C     . LEU A 11  ? 0.2144 0.2211 0.2131 0.0021  0.0206  -0.0356 171 LEU A C     
86   O O     . LEU A 11  ? 0.1928 0.1902 0.1871 0.0035  0.0235  -0.0358 171 LEU A O     
87   C CB    . LEU A 11  ? 0.1657 0.1874 0.1448 0.0074  0.0283  -0.0284 171 LEU A CB    
88   C CG    . LEU A 11  ? 0.1737 0.2053 0.1515 0.0095  0.0332  -0.0251 171 LEU A CG    
89   C CD1   . LEU A 11  ? 0.1952 0.2325 0.1609 0.0126  0.0336  -0.0249 171 LEU A CD1   
90   C CD2   . LEU A 11  ? 0.1821 0.2116 0.1617 0.0130  0.0415  -0.0221 171 LEU A CD2   
91   N N     . LYS A 12  ? 0.1847 0.1909 0.1873 0.0008  0.0098  -0.0409 172 LYS A N     
92   C CA    . LYS A 12  ? 0.2106 0.2058 0.2129 0.0016  -0.0003 -0.0482 172 LYS A CA    
93   C C     . LYS A 12  ? 0.2263 0.2173 0.2533 -0.0038 0.0011  -0.0515 172 LYS A C     
94   O O     . LYS A 12  ? 0.2429 0.2221 0.2701 -0.0035 -0.0043 -0.0568 172 LYS A O     
95   C CB    . LYS A 12  ? 0.2501 0.2442 0.2488 0.0039  -0.0134 -0.0539 172 LYS A CB    
96   C CG    . LYS A 12  ? 0.3281 0.3218 0.3001 0.0089  -0.0122 -0.0494 172 LYS A CG    
97   C CD    . LYS A 12  ? 0.3926 0.3799 0.3539 0.0132  -0.0240 -0.0536 172 LYS A CD    
98   C CE    . LYS A 12  ? 0.3774 0.3614 0.3117 0.0173  -0.0189 -0.0474 172 LYS A CE    
99   N NZ    . LYS A 12  ? 0.3649 0.3417 0.2792 0.0225  -0.0153 -0.0466 172 LYS A NZ    
100  N N     . ILE A 13  ? 0.1897 0.1893 0.2375 -0.0086 0.0092  -0.0481 173 ILE A N     
101  C CA    A ILE A 13  ? 0.1957 0.1919 0.2700 -0.0149 0.0152  -0.0491 173 ILE A CA    
102  C CA    B ILE A 13  ? 0.1898 0.1859 0.2640 -0.0149 0.0152  -0.0491 173 ILE A CA    
103  C C     . ILE A 13  ? 0.1953 0.1815 0.2585 -0.0137 0.0292  -0.0415 173 ILE A C     
104  O O     . ILE A 13  ? 0.1942 0.1669 0.2624 -0.0161 0.0301  -0.0435 173 ILE A O     
105  C CB    A ILE A 13  ? 0.2259 0.2355 0.3270 -0.0194 0.0207  -0.0479 173 ILE A CB    
106  C CB    B ILE A 13  ? 0.2204 0.2299 0.3216 -0.0194 0.0208  -0.0478 173 ILE A CB    
107  C CG1   A ILE A 13  ? 0.2448 0.2628 0.3588 -0.0194 0.0048  -0.0571 173 ILE A CG1   
108  C CG1   B ILE A 13  ? 0.2331 0.2509 0.3484 -0.0197 0.0050  -0.0573 173 ILE A CG1   
109  C CG2   A ILE A 13  ? 0.2422 0.2484 0.3717 -0.0266 0.0321  -0.0465 173 ILE A CG2   
110  C CG2   B ILE A 13  ? 0.2417 0.2475 0.3705 -0.0265 0.0326  -0.0461 173 ILE A CG2   
111  C CD1   A ILE A 13  ? 0.2115 0.2448 0.3481 -0.0213 0.0088  -0.0564 173 ILE A CD1   
112  C CD1   B ILE A 13  ? 0.1972 0.2073 0.3259 -0.0217 -0.0094 -0.0687 173 ILE A CD1   
113  N N     . SER A 14  ? 0.2119 0.2030 0.2588 -0.0090 0.0390  -0.0334 174 SER A N     
114  C CA    . SER A 14  ? 0.2013 0.1821 0.2342 -0.0049 0.0515  -0.0264 174 SER A CA    
115  C C     . SER A 14  ? 0.2244 0.1922 0.2374 -0.0004 0.0474  -0.0285 174 SER A C     
116  O O     . SER A 14  ? 0.2433 0.1961 0.2518 0.0010  0.0549  -0.0255 174 SER A O     
117  C CB    . SER A 14  ? 0.1826 0.1718 0.1997 0.0018  0.0586  -0.0201 174 SER A CB    
118  O OG    . SER A 14  ? 0.2330 0.2311 0.2658 -0.0006 0.0643  -0.0176 174 SER A OG    
119  N N     . MET A 15  ? 0.1977 0.1698 0.1972 0.0030  0.0364  -0.0332 175 MET A N     
120  C CA    . MET A 15  ? 0.2385 0.2001 0.2175 0.0092  0.0334  -0.0352 175 MET A CA    
121  C C     . MET A 15  ? 0.2023 0.1464 0.1897 0.0060  0.0282  -0.0410 175 MET A C     
122  O O     . MET A 15  ? 0.2358 0.1668 0.2073 0.0115  0.0276  -0.0421 175 MET A O     
123  C CB    . MET A 15  ? 0.2540 0.2240 0.2165 0.0140  0.0255  -0.0380 175 MET A CB    
124  C CG    . MET A 15  ? 0.2468 0.2159 0.2146 0.0115  0.0131  -0.0448 175 MET A CG    
125  S SD    . MET A 15  ? 0.2765 0.2531 0.2208 0.0179  0.0094  -0.0444 175 MET A SD    
126  C CE    . MET A 15  ? 0.2959 0.2596 0.2173 0.0269  0.0078  -0.0476 175 MET A CE    
127  N N     . GLN A 16  ? 0.2074 0.1518 0.2217 -0.0024 0.0238  -0.0455 176 GLN A N     
128  C CA    . GLN A 16  ? 0.2276 0.1560 0.2566 -0.0070 0.0175  -0.0527 176 GLN A CA    
129  C C     . GLN A 16  ? 0.2833 0.2029 0.3353 -0.0151 0.0308  -0.0480 176 GLN A C     
130  O O     . GLN A 16  ? 0.2659 0.1719 0.3365 -0.0212 0.0272  -0.0538 176 GLN A O     
131  C CB    . GLN A 16  ? 0.2421 0.1756 0.2892 -0.0105 0.0010  -0.0638 176 GLN A CB    
132  C CG    . GLN A 16  ? 0.2411 0.1807 0.2639 -0.0022 -0.0104 -0.0672 176 GLN A CG    
133  C CD    . GLN A 16  ? 0.2486 0.1741 0.2419 0.0072  -0.0163 -0.0705 176 GLN A CD    
134  O OE1   . GLN A 16  ? 0.2718 0.1813 0.2648 0.0073  -0.0163 -0.0731 176 GLN A OE1   
135  N NE2   . GLN A 16  ? 0.2313 0.1613 0.1992 0.0154  -0.0205 -0.0702 176 GLN A NE2   
136  N N     . ASP A 17  ? 0.1741 0.2600 0.2912 -0.0532 0.0022  -0.0069 177 ASP A N     
137  C CA    . ASP A 17  ? 0.2048 0.2936 0.3219 -0.0647 0.0100  -0.0055 177 ASP A CA    
138  C C     . ASP A 17  ? 0.2139 0.2696 0.3083 -0.0693 0.0126  -0.0021 177 ASP A C     
139  O O     . ASP A 17  ? 0.2069 0.2477 0.2905 -0.0600 0.0135  0.0008  177 ASP A O     
140  C CB    . ASP A 17  ? 0.2097 0.3151 0.3360 -0.0580 0.0166  -0.0047 177 ASP A CB    
141  C CG    . ASP A 17  ? 0.2809 0.3924 0.4071 -0.0704 0.0263  -0.0036 177 ASP A CG    
142  O OD1   . ASP A 17  ? 0.2678 0.3644 0.3826 -0.0843 0.0281  -0.0021 177 ASP A OD1   
143  O OD2   . ASP A 17  ? 0.3017 0.4316 0.4380 -0.0665 0.0329  -0.0046 177 ASP A OD2   
144  N N     . PRO A 18  ? 0.2217 0.2654 0.3084 -0.0840 0.0134  -0.0025 178 PRO A N     
145  C CA    . PRO A 18  ? 0.2699 0.2775 0.3334 -0.0873 0.0149  0.0011  178 PRO A CA    
146  C C     . PRO A 18  ? 0.3235 0.3211 0.3760 -0.0850 0.0210  0.0071  178 PRO A C     
147  O O     . PRO A 18  ? 0.3467 0.3172 0.3818 -0.0787 0.0195  0.0110  178 PRO A O     
148  C CB    . PRO A 18  ? 0.3106 0.3119 0.3703 -0.1066 0.0166  -0.0007 178 PRO A CB    
149  C CG    . PRO A 18  ? 0.3038 0.3360 0.3840 -0.1106 0.0122  -0.0065 178 PRO A CG    
150  C CD    . PRO A 18  ? 0.2544 0.3171 0.3535 -0.0985 0.0128  -0.0063 178 PRO A CD    
151  N N     . LYS A 19  ? 0.2692 0.2896 0.3317 -0.0894 0.0276  0.0074  179 LYS A N     
152  C CA    . LYS A 19  ? 0.2807 0.2924 0.3301 -0.0891 0.0340  0.0126  179 LYS A CA    
153  C C     . LYS A 19  ? 0.2640 0.2740 0.3108 -0.0719 0.0310  0.0137  179 LYS A C     
154  O O     . LYS A 19  ? 0.2801 0.2781 0.3118 -0.0701 0.0338  0.0183  179 LYS A O     
155  C CB    . LYS A 19  ? 0.2899 0.3277 0.3506 -0.0994 0.0437  0.0113  179 LYS A CB    
156  C CG    . LYS A 19  ? 0.3112 0.3510 0.3729 -0.1198 0.0483  0.0106  179 LYS A CG    
157  C CD    . LYS A 19  ? 0.3901 0.4603 0.4659 -0.1274 0.0583  0.0085  179 LYS A CD    
158  C CE    . LYS A 19  ? 0.4325 0.5047 0.5092 -0.1413 0.0601  0.0078  179 LYS A CE    
159  N NZ    . LYS A 19  ? 0.4492 0.5527 0.5422 -0.1434 0.0680  0.0052  179 LYS A NZ    
160  N N     . MET A 20  ? 0.2160 0.2381 0.2761 -0.0606 0.0252  0.0096  180 MET A N     
161  C CA    . MET A 20  ? 0.2035 0.2242 0.2616 -0.0462 0.0223  0.0100  180 MET A CA    
162  C C     . MET A 20  ? 0.2219 0.2225 0.2714 -0.0380 0.0149  0.0107  180 MET A C     
163  O O     . MET A 20  ? 0.1952 0.1915 0.2404 -0.0279 0.0124  0.0117  180 MET A O     
164  C CB    . MET A 20  ? 0.2112 0.2576 0.2884 -0.0387 0.0221  0.0052  180 MET A CB    
165  C CG    . MET A 20  ? 0.2566 0.3257 0.3452 -0.0435 0.0303  0.0034  180 MET A CG    
166  S SD    . MET A 20  ? 0.3123 0.4064 0.4220 -0.0310 0.0292  -0.0017 180 MET A SD    
167  C CE    . MET A 20  ? 0.3084 0.4275 0.4306 -0.0365 0.0408  -0.0044 180 MET A CE    
168  N N     . GLN A 21  ? 0.2102 0.1995 0.2575 -0.0429 0.0120  0.0095  181 GLN A N     
169  C CA    . GLN A 21  ? 0.2148 0.1862 0.2554 -0.0348 0.0063  0.0088  181 GLN A CA    
170  C C     . GLN A 21  ? 0.2359 0.1801 0.2583 -0.0328 0.0058  0.0143  181 GLN A C     
171  O O     . GLN A 21  ? 0.2742 0.2039 0.2852 -0.0427 0.0090  0.0181  181 GLN A O     
172  C CB    . GLN A 21  ? 0.2141 0.1822 0.2574 -0.0410 0.0039  0.0043  181 GLN A CB    
173  C CG    . GLN A 21  ? 0.2014 0.1957 0.2615 -0.0418 0.0021  -0.0003 181 GLN A CG    
174  C CD    . GLN A 21  ? 0.2197 0.2116 0.2800 -0.0510 -0.0008 -0.0046 181 GLN A CD    
175  O OE1   . GLN A 21  ? 0.2255 0.1989 0.2751 -0.0610 0.0007  -0.0044 181 GLN A OE1   
176  N NE2   . GLN A 21  ? 0.1543 0.1627 0.2244 -0.0484 -0.0052 -0.0083 181 GLN A NE2   
177  N N     . VAL A 22  ? 0.1862 0.1238 0.2059 -0.0202 0.0016  0.0149  182 VAL A N     
178  C CA    . VAL A 22  ? 0.2478 0.1603 0.2516 -0.0154 -0.0009 0.0204  182 VAL A CA    
179  C C     . VAL A 22  ? 0.2948 0.1914 0.2974 -0.0071 -0.0048 0.0175  182 VAL A C     
180  O O     . VAL A 22  ? 0.2939 0.1658 0.2837 -0.0028 -0.0069 0.0214  182 VAL A O     
181  C CB    . VAL A 22  ? 0.2895 0.2074 0.2899 -0.0071 -0.0031 0.0245  182 VAL A CB    
182  C CG1   . VAL A 22  ? 0.3246 0.2562 0.3241 -0.0152 0.0022  0.0262  182 VAL A CG1   
183  C CG2   . VAL A 22  ? 0.2826 0.2163 0.2958 0.0040  -0.0068 0.0198  182 VAL A CG2   
184  N N     . TYR A 23  ? 0.2499 0.1599 0.2647 -0.0045 -0.0054 0.0105  183 TYR A N     
185  C CA    . TYR A 23  ? 0.2756 0.1737 0.2900 0.0028  -0.0073 0.0059  183 TYR A CA    
186  C C     . TYR A 23  ? 0.2557 0.1674 0.2790 -0.0017 -0.0064 -0.0014 183 TYR A C     
187  O O     . TYR A 23  ? 0.2436 0.1780 0.2772 -0.0033 -0.0062 -0.0024 183 TYR A O     
188  C CB    . TYR A 23  ? 0.2916 0.1947 0.3107 0.0176  -0.0105 0.0062  183 TYR A CB    
189  C CG    . TYR A 23  ? 0.3211 0.2195 0.3441 0.0262  -0.0109 -0.0003 183 TYR A CG    
190  C CD1   . TYR A 23  ? 0.3264 0.2422 0.3593 0.0261  -0.0094 -0.0069 183 TYR A CD1   
191  C CD2   . TYR A 23  ? 0.4506 0.3264 0.4664 0.0348  -0.0121 0.0003  183 TYR A CD2   
192  C CE1   . TYR A 23  ? 0.3467 0.2591 0.3818 0.0328  -0.0081 -0.0134 183 TYR A CE1   
193  C CE2   . TYR A 23  ? 0.4869 0.3598 0.5073 0.0433  -0.0109 -0.0069 183 TYR A CE2   
194  C CZ    . TYR A 23  ? 0.4125 0.3047 0.4424 0.0416  -0.0083 -0.0140 183 TYR A CZ    
195  O OH    . TYR A 23  ? 0.4168 0.3071 0.4499 0.0489  -0.0055 -0.0218 183 TYR A OH    
196  N N     . LYS A 24  ? 0.2362 0.1323 0.2538 -0.0035 -0.0060 -0.0063 184 LYS A N     
197  C CA    . LYS A 24  ? 0.2476 0.1537 0.2697 -0.0080 -0.0060 -0.0133 184 LYS A CA    
198  C C     . LYS A 24  ? 0.2277 0.1173 0.2437 -0.0014 -0.0051 -0.0196 184 LYS A C     
199  O O     . LYS A 24  ? 0.2620 0.1260 0.2677 0.0005  -0.0042 -0.0195 184 LYS A O     
200  C CB    . LYS A 24  ? 0.3281 0.2321 0.3466 -0.0236 -0.0056 -0.0147 184 LYS A CB    
201  C CG    . LYS A 24  ? 0.3460 0.2718 0.3739 -0.0315 -0.0054 -0.0109 184 LYS A CG    
202  C CD    . LYS A 24  ? 0.3731 0.3045 0.4020 -0.0465 -0.0062 -0.0144 184 LYS A CD    
203  C CE    . LYS A 24  ? 0.4991 0.4046 0.5144 -0.0576 -0.0040 -0.0144 184 LYS A CE    
204  N NZ    . LYS A 24  ? 0.5583 0.4722 0.5757 -0.0739 -0.0053 -0.0189 184 LYS A NZ    
205  N N     . ASP A 25  ? 0.2051 0.1076 0.2264 0.0022  -0.0049 -0.0250 185 ASP A N     
206  C CA    . ASP A 25  ? 0.2792 0.1672 0.2933 0.0053  -0.0024 -0.0329 185 ASP A CA    
207  C C     . ASP A 25  ? 0.2715 0.1712 0.2844 -0.0024 -0.0028 -0.0386 185 ASP A C     
208  O O     . ASP A 25  ? 0.2496 0.1641 0.2661 -0.0112 -0.0059 -0.0360 185 ASP A O     
209  C CB    . ASP A 25  ? 0.3028 0.1886 0.3213 0.0208  -0.0004 -0.0347 185 ASP A CB    
210  C CG    . ASP A 25  ? 0.3014 0.2136 0.3323 0.0263  -0.0004 -0.0344 185 ASP A CG    
211  O OD1   . ASP A 25  ? 0.2500 0.1778 0.2831 0.0195  -0.0010 -0.0350 185 ASP A OD1   
212  O OD2   . ASP A 25  ? 0.2615 0.1784 0.3000 0.0377  -0.0001 -0.0334 185 ASP A OD2   
213  N N     . GLU A 26  ? 0.2418 0.1354 0.2491 0.0011  0.0004  -0.0463 186 GLU A N     
214  C CA    A GLU A 26  ? 0.2690 0.1702 0.2703 -0.0069 -0.0003 -0.0517 186 GLU A CA    
215  C CA    B GLU A 26  ? 0.2715 0.1727 0.2728 -0.0070 -0.0003 -0.0516 186 GLU A CA    
216  C C     . GLU A 26  ? 0.2523 0.1784 0.2623 -0.0050 -0.0020 -0.0484 186 GLU A C     
217  O O     . GLU A 26  ? 0.2330 0.1675 0.2380 -0.0119 -0.0046 -0.0499 186 GLU A O     
218  C CB    A GLU A 26  ? 0.3226 0.2081 0.3125 -0.0044 0.0050  -0.0617 186 GLU A CB    
219  C CB    B GLU A 26  ? 0.3229 0.2079 0.3125 -0.0045 0.0050  -0.0617 186 GLU A CB    
220  C CG    A GLU A 26  ? 0.3700 0.2260 0.3474 -0.0078 0.0069  -0.0664 186 GLU A CG    
221  C CG    B GLU A 26  ? 0.3527 0.2471 0.3486 0.0072  0.0102  -0.0647 186 GLU A CG    
222  C CD    A GLU A 26  ? 0.4870 0.3277 0.4503 -0.0081 0.0123  -0.0782 186 GLU A CD    
223  C CD    B GLU A 26  ? 0.4190 0.3085 0.4248 0.0211  0.0125  -0.0626 186 GLU A CD    
224  O OE1   A GLU A 26  ? 0.5158 0.3705 0.4795 -0.0053 0.0152  -0.0821 186 GLU A OE1   
225  O OE1   B GLU A 26  ? 0.4426 0.3209 0.4492 0.0221  0.0094  -0.0570 186 GLU A OE1   
226  O OE2   A GLU A 26  ? 0.5275 0.3409 0.4778 -0.0117 0.0144  -0.0837 186 GLU A OE2   
227  O OE2   B GLU A 26  ? 0.4311 0.3289 0.4438 0.0309  0.0173  -0.0665 186 GLU A OE2   
228  N N     . GLN A 27  ? 0.2055 0.1419 0.2268 0.0041  -0.0011 -0.0437 187 GLN A N     
229  C CA    . GLN A 27  ? 0.2017 0.1573 0.2292 0.0058  -0.0017 -0.0412 187 GLN A CA    
230  C C     . GLN A 27  ? 0.1626 0.1313 0.2002 0.0062  -0.0051 -0.0334 187 GLN A C     
231  O O     . GLN A 27  ? 0.1523 0.1335 0.1923 0.0044  -0.0072 -0.0309 187 GLN A O     
232  C CB    . GLN A 27  ? 0.2612 0.2207 0.2929 0.0148  0.0035  -0.0444 187 GLN A CB    
233  C CG    . GLN A 27  ? 0.3467 0.2970 0.3690 0.0150  0.0089  -0.0534 187 GLN A CG    
234  C CD    . GLN A 27  ? 0.4516 0.4123 0.4805 0.0223  0.0149  -0.0569 187 GLN A CD    
235  O OE1   . GLN A 27  ? 0.4794 0.4531 0.5087 0.0192  0.0160  -0.0558 187 GLN A OE1   
236  N NE2   . GLN A 27  ? 0.5029 0.4582 0.5376 0.0319  0.0189  -0.0611 187 GLN A NE2   
237  N N     . VAL A 28  ? 0.1440 0.1081 0.1860 0.0092  -0.0054 -0.0297 188 VAL A N     
238  C CA    . VAL A 28  ? 0.1530 0.1287 0.2032 0.0103  -0.0071 -0.0235 188 VAL A CA    
239  C C     . VAL A 28  ? 0.1776 0.1473 0.2273 0.0060  -0.0082 -0.0193 188 VAL A C     
240  O O     . VAL A 28  ? 0.1902 0.1436 0.2328 0.0031  -0.0076 -0.0205 188 VAL A O     
241  C CB    . VAL A 28  ? 0.1499 0.1310 0.2061 0.0192  -0.0057 -0.0222 188 VAL A CB    
242  C CG1   . VAL A 28  ? 0.1652 0.1545 0.2228 0.0215  -0.0034 -0.0261 188 VAL A CG1   
243  C CG2   . VAL A 28  ? 0.1675 0.1358 0.2222 0.0255  -0.0052 -0.0222 188 VAL A CG2   
244  N N     . VAL A 29  ? 0.1437 0.1253 0.1996 0.0051  -0.0089 -0.0148 189 VAL A N     
245  C CA    . VAL A 29  ? 0.1465 0.1248 0.2017 0.0008  -0.0083 -0.0106 189 VAL A CA    
246  C C     . VAL A 29  ? 0.1622 0.1469 0.2205 0.0066  -0.0076 -0.0068 189 VAL A C     
247  O O     . VAL A 29  ? 0.1768 0.1727 0.2403 0.0110  -0.0078 -0.0075 189 VAL A O     
248  C CB    . VAL A 29  ? 0.1139 0.1035 0.1739 -0.0083 -0.0090 -0.0103 189 VAL A CB    
249  C CG1   . VAL A 29  ? 0.1418 0.1508 0.2113 -0.0051 -0.0101 -0.0098 189 VAL A CG1   
250  C CG2   . VAL A 29  ? 0.1467 0.1329 0.2052 -0.0151 -0.0066 -0.0066 189 VAL A CG2   
251  N N     . VAL A 30  ? 0.1500 0.1252 0.2026 0.0060  -0.0069 -0.0027 190 VAL A N     
252  C CA    . VAL A 30  ? 0.1602 0.1410 0.2128 0.0097  -0.0066 0.0009  190 VAL A CA    
253  C C     . VAL A 30  ? 0.1578 0.1413 0.2085 0.0018  -0.0036 0.0041  190 VAL A C     
254  O O     . VAL A 30  ? 0.1684 0.1402 0.2124 -0.0050 -0.0024 0.0061  190 VAL A O     
255  C CB    . VAL A 30  ? 0.1822 0.1499 0.2275 0.0164  -0.0090 0.0038  190 VAL A CB    
256  C CG1   . VAL A 30  ? 0.1646 0.1400 0.2085 0.0192  -0.0099 0.0070  190 VAL A CG1   
257  C CG2   . VAL A 30  ? 0.1905 0.1570 0.2399 0.0242  -0.0107 -0.0004 190 VAL A CG2   
258  N N     . ILE A 31  ? 0.1343 0.1328 0.1907 0.0020  -0.0016 0.0040  191 ILE A N     
259  C CA    . ILE A 31  ? 0.1296 0.1336 0.1852 -0.0048 0.0030  0.0061  191 ILE A CA    
260  C C     . ILE A 31  ? 0.1419 0.1467 0.1909 -0.0020 0.0046  0.0083  191 ILE A C     
261  O O     . ILE A 31  ? 0.1460 0.1521 0.1947 0.0049  0.0019  0.0072  191 ILE A O     
262  C CB    . ILE A 31  ? 0.1297 0.1526 0.1989 -0.0074 0.0052  0.0030  191 ILE A CB    
263  C CG1   . ILE A 31  ? 0.1516 0.1844 0.2273 0.0006  0.0044  0.0005  191 ILE A CG1   
264  C CG2   . ILE A 31  ? 0.1456 0.1691 0.2198 -0.0119 0.0024  0.0008  191 ILE A CG2   
265  C CD1   . ILE A 31  ? 0.1650 0.2154 0.2539 0.0009  0.0062  -0.0018 191 ILE A CD1   
266  N N     . LYS A 32  ? 0.1454 0.1492 0.1876 -0.0087 0.0094  0.0111  192 LYS A N     
267  C CA    . LYS A 32  ? 0.1797 0.1862 0.2143 -0.0078 0.0122  0.0122  192 LYS A CA    
268  C C     . LYS A 32  ? 0.1868 0.2109 0.2337 -0.0048 0.0157  0.0068  192 LYS A C     
269  O O     . LYS A 32  ? 0.1758 0.2119 0.2354 -0.0071 0.0187  0.0043  192 LYS A O     
270  C CB    . LYS A 32  ? 0.2437 0.2450 0.2668 -0.0174 0.0181  0.0161  192 LYS A CB    
271  C CG    . LYS A 32  ? 0.3005 0.2791 0.3076 -0.0204 0.0147  0.0227  192 LYS A CG    
272  C CD    . LYS A 32  ? 0.4385 0.4093 0.4302 -0.0314 0.0212  0.0276  192 LYS A CD    
273  C CE    . LYS A 32  ? 0.4907 0.4729 0.4927 -0.0426 0.0289  0.0250  192 LYS A CE    
274  N NZ    . LYS A 32  ? 0.5215 0.4948 0.5069 -0.0555 0.0364  0.0300  192 LYS A NZ    
275  N N     . ASP A 33  ? 0.1423 0.1675 0.1856 0.0004  0.0149  0.0050  193 ASP A N     
276  C CA    . ASP A 33  ? 0.1325 0.1693 0.1837 0.0034  0.0192  -0.0001 193 ASP A CA    
277  C C     . ASP A 33  ? 0.1691 0.2138 0.2202 -0.0021 0.0280  -0.0009 193 ASP A C     
278  O O     . ASP A 33  ? 0.1634 0.2016 0.2005 -0.0079 0.0309  0.0022  193 ASP A O     
279  C CB    . ASP A 33  ? 0.1770 0.2099 0.2199 0.0072  0.0174  -0.0022 193 ASP A CB    
280  C CG    . ASP A 33  ? 0.1740 0.2132 0.2243 0.0115  0.0208  -0.0078 193 ASP A CG    
281  O OD1   . ASP A 33  ? 0.1983 0.2435 0.2500 0.0109  0.0281  -0.0106 193 ASP A OD1   
282  O OD2   . ASP A 33  ? 0.1896 0.2270 0.2439 0.0156  0.0167  -0.0095 193 ASP A OD2   
283  N N     . LYS A 34  ? 0.1082 0.1673 0.1745 0.0000  0.0324  -0.0048 194 LYS A N     
284  C CA    . LYS A 34  ? 0.1286 0.1999 0.1992 -0.0047 0.0419  -0.0067 194 LYS A CA    
285  C C     . LYS A 34  ? 0.1517 0.2211 0.2105 -0.0041 0.0490  -0.0099 194 LYS A C     
286  O O     . LYS A 34  ? 0.1503 0.2253 0.2046 -0.0104 0.0580  -0.0107 194 LYS A O     
287  C CB    . LYS A 34  ? 0.1205 0.2107 0.2137 -0.0005 0.0435  -0.0103 194 LYS A CB    
288  C CG    . LYS A 34  ? 0.1502 0.2592 0.2536 -0.0056 0.0535  -0.0128 194 LYS A CG    
289  C CD    . LYS A 34  ? 0.2175 0.3482 0.3461 -0.0017 0.0520  -0.0152 194 LYS A CD    
290  C CE    . LYS A 34  ? 0.3238 0.4782 0.4667 -0.0058 0.0628  -0.0188 194 LYS A CE    
291  N NZ    . LYS A 34  ? 0.3705 0.5427 0.5330 0.0001  0.0571  -0.0184 194 LYS A NZ    
292  N N     . TYR A 35  ? 0.1312 0.1924 0.1838 0.0022  0.0455  -0.0124 195 TYR A N     
293  C CA    . TYR A 35  ? 0.1362 0.1932 0.1754 0.0024  0.0512  -0.0166 195 TYR A CA    
294  C C     . TYR A 35  ? 0.1549 0.1976 0.1775 0.0020  0.0433  -0.0145 195 TYR A C     
295  O O     . TYR A 35  ? 0.1759 0.2144 0.1974 0.0064  0.0408  -0.0186 195 TYR A O     
296  C CB    . TYR A 35  ? 0.1386 0.2011 0.1889 0.0108  0.0557  -0.0238 195 TYR A CB    
297  C CG    . TYR A 35  ? 0.1483 0.2288 0.2199 0.0139  0.0614  -0.0258 195 TYR A CG    
298  C CD1   . TYR A 35  ? 0.1552 0.2478 0.2291 0.0109  0.0731  -0.0294 195 TYR A CD1   
299  C CD2   . TYR A 35  ? 0.1759 0.2632 0.2654 0.0194  0.0551  -0.0241 195 TYR A CD2   
300  C CE1   . TYR A 35  ? 0.1886 0.3025 0.2855 0.0139  0.0781  -0.0317 195 TYR A CE1   
301  C CE2   . TYR A 35  ? 0.1684 0.2755 0.2789 0.0224  0.0587  -0.0257 195 TYR A CE2   
302  C CZ    . TYR A 35  ? 0.2032 0.3249 0.3190 0.0199  0.0700  -0.0296 195 TYR A CZ    
303  O OH    . TYR A 35  ? 0.2306 0.3711 0.3639 0.0230  0.0703  -0.0290 195 TYR A OH    
304  N N     . PRO A 36  ? 0.1530 0.1882 0.1629 -0.0035 0.0389  -0.0081 196 PRO A N     
305  C CA    . PRO A 36  ? 0.1630 0.1884 0.1618 -0.0024 0.0290  -0.0050 196 PRO A CA    
306  C C     . PRO A 36  ? 0.1812 0.2033 0.1656 -0.0031 0.0296  -0.0096 196 PRO A C     
307  O O     . PRO A 36  ? 0.2128 0.2344 0.1847 -0.0075 0.0373  -0.0120 196 PRO A O     
308  C CB    . PRO A 36  ? 0.1641 0.1808 0.1500 -0.0075 0.0261  0.0031  196 PRO A CB    
309  C CG    . PRO A 36  ? 0.1915 0.2120 0.1742 -0.0146 0.0369  0.0032  196 PRO A CG    
310  C CD    . PRO A 36  ? 0.1636 0.1988 0.1683 -0.0112 0.0433  -0.0033 196 PRO A CD    
311  N N     . LYS A 37  ? 0.2059 0.2263 0.1915 0.0001  0.0222  -0.0114 197 LYS A N     
312  C CA    . LYS A 37  ? 0.2015 0.2189 0.1740 -0.0020 0.0220  -0.0168 197 LYS A CA    
313  C C     . LYS A 37  ? 0.1965 0.2106 0.1526 -0.0052 0.0127  -0.0124 197 LYS A C     
314  O O     . LYS A 37  ? 0.1892 0.2023 0.1339 -0.0081 0.0098  -0.0166 197 LYS A O     
315  C CB    . LYS A 37  ? 0.2081 0.2261 0.1915 0.0016  0.0205  -0.0226 197 LYS A CB    
316  C CG    . LYS A 37  ? 0.1849 0.2046 0.1829 0.0065  0.0282  -0.0262 197 LYS A CG    
317  C CD    . LYS A 37  ? 0.2031 0.2231 0.1954 0.0057  0.0394  -0.0309 197 LYS A CD    
318  C CE    . LYS A 37  ? 0.2073 0.2298 0.2154 0.0129  0.0460  -0.0353 197 LYS A CE    
319  N NZ    . LYS A 37  ? 0.1789 0.2101 0.2060 0.0168  0.0429  -0.0300 197 LYS A NZ    
320  N N     . ALA A 38  ? 0.2007 0.2123 0.1550 -0.0047 0.0076  -0.0039 198 ALA A N     
321  C CA    . ALA A 38  ? 0.1999 0.2072 0.1377 -0.0060 -0.0020 0.0021  198 ALA A CA    
322  C C     . ALA A 38  ? 0.2326 0.2310 0.1634 -0.0068 -0.0022 0.0114  198 ALA A C     
323  O O     . ALA A 38  ? 0.2218 0.2195 0.1610 -0.0081 0.0056  0.0119  198 ALA A O     
324  C CB    . ALA A 38  ? 0.1867 0.2003 0.1354 -0.0007 -0.0134 0.0025  198 ALA A CB    
325  N N     . ARG A 39  ? 0.2263 0.2175 0.1415 -0.0063 -0.0116 0.0189  199 ARG A N     
326  C CA    . ARG A 39  ? 0.2333 0.2107 0.1373 -0.0078 -0.0119 0.0286  199 ARG A CA    
327  C C     . ARG A 39  ? 0.2484 0.2232 0.1712 -0.0027 -0.0126 0.0310  199 ARG A C     
328  O O     . ARG A 39  ? 0.2633 0.2283 0.1827 -0.0069 -0.0071 0.0352  199 ARG A O     
329  C CB    . ARG A 39  ? 0.2651 0.2331 0.1475 -0.0064 -0.0237 0.0372  199 ARG A CB    
330  C CG    . ARG A 39  ? 0.3394 0.3061 0.1962 -0.0143 -0.0218 0.0361  199 ARG A CG    
331  C CD    . ARG A 39  ? 0.3548 0.3130 0.1894 -0.0123 -0.0356 0.0454  199 ARG A CD    
332  N NE    . ARG A 39  ? 0.3603 0.3163 0.1667 -0.0212 -0.0341 0.0442  199 ARG A NE    
333  C CZ    . ARG A 39  ? 0.4072 0.3570 0.1893 -0.0213 -0.0465 0.0517  199 ARG A CZ    
334  N NH1   . ARG A 39  ? 0.4339 0.3797 0.2192 -0.0113 -0.0612 0.0611  199 ARG A NH1   
335  N NH2   . ARG A 39  ? 0.4344 0.3817 0.1884 -0.0307 -0.0443 0.0498  199 ARG A NH2   
336  N N     . TYR A 40  ? 0.2085 0.1918 0.1498 0.0052  -0.0190 0.0277  200 TYR A N     
337  C CA    . TYR A 40  ? 0.1844 0.1663 0.1435 0.0098  -0.0187 0.0277  200 TYR A CA    
338  C C     . TYR A 40  ? 0.2082 0.2045 0.1874 0.0115  -0.0151 0.0189  200 TYR A C     
339  O O     . TYR A 40  ? 0.2057 0.2116 0.1899 0.0141  -0.0193 0.0147  200 TYR A O     
340  C CB    . TYR A 40  ? 0.1906 0.1669 0.1518 0.0188  -0.0296 0.0328  200 TYR A CB    
341  C CG    . TYR A 40  ? 0.2243 0.1823 0.1637 0.0189  -0.0347 0.0429  200 TYR A CG    
342  C CD1   . TYR A 40  ? 0.2510 0.1901 0.1844 0.0171  -0.0317 0.0486  200 TYR A CD1   
343  C CD2   . TYR A 40  ? 0.2770 0.2349 0.2001 0.0198  -0.0427 0.0471  200 TYR A CD2   
344  C CE1   . TYR A 40  ? 0.3285 0.2464 0.2388 0.0167  -0.0363 0.0590  200 TYR A CE1   
345  C CE2   . TYR A 40  ? 0.3584 0.2971 0.2585 0.0202  -0.0483 0.0578  200 TYR A CE2   
346  C CZ    . TYR A 40  ? 0.3792 0.2966 0.2726 0.0188  -0.0447 0.0640  200 TYR A CZ    
347  O OH    . TYR A 40  ? 0.4454 0.3397 0.3133 0.0187  -0.0501 0.0755  200 TYR A OH    
348  N N     . HIS A 41  ? 0.1644 0.1621 0.1544 0.0093  -0.0078 0.0164  201 HIS A N     
349  C CA    . HIS A 41  ? 0.1370 0.1457 0.1436 0.0112  -0.0050 0.0094  201 HIS A CA    
350  C C     . HIS A 41  ? 0.1601 0.1679 0.1786 0.0113  -0.0022 0.0094  201 HIS A C     
351  O O     . HIS A 41  ? 0.1661 0.1738 0.1846 0.0063  0.0039  0.0100  201 HIS A O     
352  C CB    . HIS A 41  ? 0.1312 0.1459 0.1353 0.0076  0.0022  0.0042  201 HIS A CB    
353  C CG    . HIS A 41  ? 0.1277 0.1496 0.1450 0.0103  0.0041  -0.0022 201 HIS A CG    
354  N ND1   . HIS A 41  ? 0.1514 0.1760 0.1676 0.0092  0.0103  -0.0077 201 HIS A ND1   
355  C CD2   . HIS A 41  ? 0.1020 0.1267 0.1317 0.0141  0.0010  -0.0037 201 HIS A CD2   
356  C CE1   . HIS A 41  ? 0.1620 0.1889 0.1890 0.0124  0.0102  -0.0115 201 HIS A CE1   
357  N NE2   . HIS A 41  ? 0.1348 0.1625 0.1696 0.0147  0.0047  -0.0090 201 HIS A NE2   
358  N N     . TRP A 42  ? 0.1265 0.1347 0.1545 0.0162  -0.0066 0.0085  202 TRP A N     
359  C CA    . TRP A 42  ? 0.1198 0.1266 0.1571 0.0157  -0.0049 0.0077  202 TRP A CA    
360  C C     . TRP A 42  ? 0.1165 0.1324 0.1658 0.0184  -0.0046 0.0025  202 TRP A C     
361  O O     . TRP A 42  ? 0.1448 0.1657 0.1954 0.0209  -0.0065 -0.0001 202 TRP A O     
362  C CB    . TRP A 42  ? 0.1376 0.1331 0.1728 0.0191  -0.0096 0.0107  202 TRP A CB    
363  C CG    . TRP A 42  ? 0.1857 0.1666 0.2065 0.0173  -0.0110 0.0173  202 TRP A CG    
364  C CD1   . TRP A 42  ? 0.1900 0.1612 0.2035 0.0098  -0.0069 0.0206  202 TRP A CD1   
365  C CD2   . TRP A 42  ? 0.1860 0.1594 0.1971 0.0227  -0.0175 0.0220  202 TRP A CD2   
366  N NE1   . TRP A 42  ? 0.2232 0.1778 0.2203 0.0098  -0.0098 0.0276  202 TRP A NE1   
367  C CE2   . TRP A 42  ? 0.2125 0.1682 0.2079 0.0187  -0.0171 0.0289  202 TRP A CE2   
368  C CE3   . TRP A 42  ? 0.1994 0.1805 0.2139 0.0303  -0.0241 0.0211  202 TRP A CE3   
369  C CZ2   . TRP A 42  ? 0.2417 0.1848 0.2229 0.0233  -0.0238 0.0359  202 TRP A CZ2   
370  C CZ3   . TRP A 42  ? 0.2315 0.2041 0.2350 0.0353  -0.0313 0.0273  202 TRP A CZ3   
371  C CH2   . TRP A 42  ? 0.2621 0.2147 0.2482 0.0324  -0.0315 0.0351  202 TRP A CH2   
372  N N     . LEU A 43  ? 0.1060 0.1232 0.1624 0.0168  -0.0028 0.0012  203 LEU A N     
373  C CA    . LEU A 43  ? 0.0981 0.1207 0.1628 0.0189  -0.0032 -0.0024 203 LEU A CA    
374  C C     . LEU A 43  ? 0.1366 0.1539 0.2031 0.0192  -0.0054 -0.0027 203 LEU A C     
375  O O     . LEU A 43  ? 0.1272 0.1389 0.1919 0.0156  -0.0050 -0.0011 203 LEU A O     
376  C CB    . LEU A 43  ? 0.0930 0.1229 0.1636 0.0173  0.0001  -0.0037 203 LEU A CB    
377  C CG    . LEU A 43  ? 0.1180 0.1520 0.1868 0.0174  0.0041  -0.0047 203 LEU A CG    
378  C CD1   . LEU A 43  ? 0.1352 0.1776 0.2130 0.0181  0.0072  -0.0061 203 LEU A CD1   
379  C CD2   . LEU A 43  ? 0.1458 0.1783 0.2110 0.0199  0.0032  -0.0072 203 LEU A CD2   
380  N N     . VAL A 44  ? 0.1090 0.1273 0.1781 0.0225  -0.0069 -0.0054 204 VAL A N     
381  C CA    . VAL A 44  ? 0.1239 0.1371 0.1936 0.0229  -0.0077 -0.0073 204 VAL A CA    
382  C C     . VAL A 44  ? 0.1415 0.1596 0.2139 0.0208  -0.0070 -0.0096 204 VAL A C     
383  O O     . VAL A 44  ? 0.1343 0.1574 0.2080 0.0220  -0.0064 -0.0108 204 VAL A O     
384  C CB    . VAL A 44  ? 0.1475 0.1599 0.2185 0.0283  -0.0088 -0.0094 204 VAL A CB    
385  C CG1   . VAL A 44  ? 0.1710 0.1757 0.2408 0.0291  -0.0082 -0.0124 204 VAL A CG1   
386  C CG2   . VAL A 44  ? 0.1842 0.1935 0.2526 0.0322  -0.0115 -0.0061 204 VAL A CG2   
387  N N     . LEU A 45  ? 0.1220 0.1375 0.1936 0.0172  -0.0077 -0.0100 205 LEU A N     
388  C CA    . LEU A 45  ? 0.1105 0.1308 0.1830 0.0153  -0.0088 -0.0111 205 LEU A CA    
389  C C     . LEU A 45  ? 0.1631 0.1772 0.2305 0.0126  -0.0098 -0.0141 205 LEU A C     
390  O O     . LEU A 45  ? 0.1767 0.1835 0.2415 0.0098  -0.0100 -0.0149 205 LEU A O     
391  C CB    . LEU A 45  ? 0.1416 0.1698 0.2193 0.0128  -0.0098 -0.0089 205 LEU A CB    
392  C CG    . LEU A 45  ? 0.1189 0.1528 0.2009 0.0149  -0.0073 -0.0070 205 LEU A CG    
393  C CD1   . LEU A 45  ? 0.1820 0.2138 0.2631 0.0115  -0.0053 -0.0054 205 LEU A CD1   
394  C CD2   . LEU A 45  ? 0.1666 0.2106 0.2556 0.0163  -0.0081 -0.0063 205 LEU A CD2   
395  N N     . PRO A 46  ? 0.1439 0.1591 0.2077 0.0126  -0.0101 -0.0159 206 PRO A N     
396  C CA    . PRO A 46  ? 0.1511 0.1604 0.2075 0.0088  -0.0109 -0.0194 206 PRO A CA    
397  C C     . PRO A 46  ? 0.1540 0.1671 0.2105 0.0033  -0.0155 -0.0182 206 PRO A C     
398  O O     . PRO A 46  ? 0.1603 0.1832 0.2231 0.0040  -0.0181 -0.0146 206 PRO A O     
399  C CB    . PRO A 46  ? 0.1913 0.2015 0.2419 0.0094  -0.0096 -0.0207 206 PRO A CB    
400  C CG    . PRO A 46  ? 0.2169 0.2332 0.2720 0.0120  -0.0101 -0.0166 206 PRO A CG    
401  C CD    . PRO A 46  ? 0.1758 0.1948 0.2394 0.0148  -0.0093 -0.0150 206 PRO A CD    
402  N N     . TRP A 47  ? 0.1336 0.1395 0.1836 -0.0021 -0.0164 -0.0217 207 TRP A N     
403  C CA    . TRP A 47  ? 0.1125 0.1243 0.1624 -0.0091 -0.0217 -0.0215 207 TRP A CA    
404  C C     . TRP A 47  ? 0.1740 0.1935 0.2205 -0.0085 -0.0263 -0.0198 207 TRP A C     
405  O O     . TRP A 47  ? 0.1873 0.2193 0.2406 -0.0095 -0.0318 -0.0166 207 TRP A O     
406  C CB    . TRP A 47  ? 0.1701 0.1697 0.2101 -0.0163 -0.0217 -0.0270 207 TRP A CB    
407  C CG    . TRP A 47  ? 0.1623 0.1504 0.2030 -0.0180 -0.0183 -0.0278 207 TRP A CG    
408  C CD1   . TRP A 47  ? 0.1847 0.1541 0.2168 -0.0164 -0.0142 -0.0320 207 TRP A CD1   
409  C CD2   . TRP A 47  ? 0.1974 0.1899 0.2461 -0.0216 -0.0184 -0.0241 207 TRP A CD2   
410  N NE1   . TRP A 47  ? 0.2049 0.1641 0.2376 -0.0186 -0.0128 -0.0302 207 TRP A NE1   
411  C CE2   . TRP A 47  ? 0.1931 0.1664 0.2351 -0.0229 -0.0149 -0.0253 207 TRP A CE2   
412  C CE3   . TRP A 47  ? 0.1771 0.1878 0.2377 -0.0238 -0.0206 -0.0201 207 TRP A CE3   
413  C CZ2   . TRP A 47  ? 0.2072 0.1773 0.2515 -0.0279 -0.0134 -0.0219 207 TRP A CZ2   
414  C CZ3   . TRP A 47  ? 0.1817 0.1924 0.2467 -0.0289 -0.0181 -0.0179 207 TRP A CZ3   
415  C CH2   . TRP A 47  ? 0.1978 0.1875 0.2534 -0.0316 -0.0146 -0.0184 207 TRP A CH2   
416  N N     . THR A 48  ? 0.1855 0.1979 0.2216 -0.0067 -0.0239 -0.0217 208 THR A N     
417  C CA    . THR A 48  ? 0.2011 0.2162 0.2290 -0.0070 -0.0282 -0.0192 208 THR A CA    
418  C C     . THR A 48  ? 0.2196 0.2416 0.2559 -0.0004 -0.0293 -0.0132 208 THR A C     
419  O O     . THR A 48  ? 0.2108 0.2322 0.2541 0.0040  -0.0243 -0.0126 208 THR A O     
420  C CB    . THR A 48  ? 0.2092 0.2139 0.2214 -0.0087 -0.0236 -0.0233 208 THR A CB    
421  O OG1   . THR A 48  ? 0.2774 0.2821 0.2768 -0.0114 -0.0289 -0.0204 208 THR A OG1   
422  C CG2   . THR A 48  ? 0.1810 0.1837 0.1970 -0.0034 -0.0161 -0.0235 208 THR A CG2   
423  N N     . SER A 49  ? 0.2263 0.2539 0.2610 0.0007  -0.0363 -0.0088 209 SER A N     
424  C CA    A SER A 49  ? 0.2211 0.2529 0.2638 0.0081  -0.0374 -0.0034 209 SER A CA    
425  C CA    B SER A 49  ? 0.2207 0.2525 0.2634 0.0081  -0.0373 -0.0035 209 SER A CA    
426  C C     . SER A 49  ? 0.2250 0.2450 0.2559 0.0105  -0.0343 -0.0012 209 SER A C     
427  O O     . SER A 49  ? 0.2529 0.2662 0.2687 0.0081  -0.0374 0.0007  209 SER A O     
428  C CB    A SER A 49  ? 0.2450 0.2890 0.2941 0.0106  -0.0468 0.0008  209 SER A CB    
429  C CB    B SER A 49  ? 0.2453 0.2896 0.2949 0.0106  -0.0466 0.0007  209 SER A CB    
430  O OG    A SER A 49  ? 0.2549 0.3017 0.3130 0.0195  -0.0468 0.0050  209 SER A OG    
431  O OG    B SER A 49  ? 0.2369 0.2954 0.3027 0.0088  -0.0473 -0.0011 209 SER A OG    
432  N N     . ILE A 50  ? 0.1941 0.2112 0.2306 0.0139  -0.0282 -0.0015 210 ILE A N     
433  C CA    . ILE A 50  ? 0.2068 0.2129 0.2337 0.0148  -0.0246 0.0004  210 ILE A CA    
434  C C     . ILE A 50  ? 0.2133 0.2205 0.2503 0.0215  -0.0242 0.0029  210 ILE A C     
435  O O     . ILE A 50  ? 0.2034 0.2172 0.2520 0.0229  -0.0209 0.0003  210 ILE A O     
436  C CB    . ILE A 50  ? 0.2334 0.2365 0.2584 0.0109  -0.0164 -0.0047 210 ILE A CB    
437  C CG1   . ILE A 50  ? 0.2660 0.2693 0.2845 0.0058  -0.0152 -0.0092 210 ILE A CG1   
438  C CG2   . ILE A 50  ? 0.2393 0.2325 0.2541 0.0089  -0.0123 -0.0032 210 ILE A CG2   
439  C CD1   . ILE A 50  ? 0.2917 0.2959 0.3131 0.0045  -0.0075 -0.0150 210 ILE A CD1   
440  N N     . SER A 51  ? 0.2140 0.2132 0.2449 0.0259  -0.0274 0.0079  211 SER A N     
441  C CA    . SER A 51  ? 0.2348 0.2348 0.2756 0.0340  -0.0275 0.0098  211 SER A CA    
442  C C     . SER A 51  ? 0.2502 0.2455 0.2934 0.0331  -0.0196 0.0061  211 SER A C     
443  O O     . SER A 51  ? 0.2194 0.2217 0.2742 0.0368  -0.0174 0.0041  211 SER A O     
444  C CB    . SER A 51  ? 0.3033 0.2910 0.3348 0.0402  -0.0327 0.0161  211 SER A CB    
445  O OG    . SER A 51  ? 0.3713 0.3399 0.3840 0.0351  -0.0293 0.0177  211 SER A OG    
446  N N     . SER A 52  ? 0.2567 0.2413 0.2884 0.0271  -0.0152 0.0048  212 SER A N     
447  C CA    . SER A 52  ? 0.2155 0.1973 0.2488 0.0245  -0.0088 0.0010  212 SER A CA    
448  C C     . SER A 52  ? 0.2245 0.2026 0.2488 0.0159  -0.0046 -0.0013 212 SER A C     
449  O O     . SER A 52  ? 0.2355 0.2122 0.2517 0.0125  -0.0056 -0.0002 212 SER A O     
450  C CB    . SER A 52  ? 0.2430 0.2112 0.2723 0.0288  -0.0075 0.0025  212 SER A CB    
451  O OG    . SER A 52  ? 0.3359 0.2860 0.3488 0.0256  -0.0073 0.0060  212 SER A OG    
452  N N     . LEU A 53  ? 0.2186 0.1965 0.2444 0.0120  0.0004  -0.0050 213 LEU A N     
453  C CA    . LEU A 53  ? 0.2044 0.1825 0.2246 0.0034  0.0052  -0.0079 213 LEU A CA    
454  C C     . LEU A 53  ? 0.2444 0.2057 0.2472 -0.0018 0.0067  -0.0042 213 LEU A C     
455  O O     . LEU A 53  ? 0.2434 0.2057 0.2397 -0.0098 0.0111  -0.0061 213 LEU A O     
456  C CB    . LEU A 53  ? 0.2367 0.2203 0.2630 -0.0005 0.0089  -0.0126 213 LEU A CB    
457  C CG    . LEU A 53  ? 0.2553 0.2556 0.2959 0.0027  0.0078  -0.0160 213 LEU A CG    
458  C CD1   . LEU A 53  ? 0.2651 0.2720 0.3097 -0.0022 0.0101  -0.0204 213 LEU A CD1   
459  C CD2   . LEU A 53  ? 0.2825 0.2929 0.3279 0.0035  0.0075  -0.0174 213 LEU A CD2   
460  N N     . LYS A 54  ? 0.2477 0.1932 0.2423 0.0030  0.0033  0.0010  214 LYS A N     
461  C CA    . LYS A 54  ? 0.3181 0.2432 0.2928 -0.0008 0.0034  0.0063  214 LYS A CA    
462  C C     . LYS A 54  ? 0.3101 0.2373 0.2755 -0.0033 0.0010  0.0090  214 LYS A C     
463  O O     . LYS A 54  ? 0.3191 0.2327 0.2660 -0.0107 0.0035  0.0120  214 LYS A O     
464  C CB    . LYS A 54  ? 0.4234 0.3310 0.3925 0.0084  -0.0015 0.0122  214 LYS A CB    
465  C CG    . LYS A 54  ? 0.4704 0.3665 0.4402 0.0093  0.0023  0.0097  214 LYS A CG    
466  C CD    . LYS A 54  ? 0.5681 0.4431 0.5300 0.0198  -0.0019 0.0157  214 LYS A CD    
467  C CE    . LYS A 54  ? 0.6364 0.4931 0.5939 0.0195  0.0030  0.0125  214 LYS A CE    
468  N NZ    . LYS A 54  ? 0.7098 0.5414 0.6573 0.0308  -0.0005 0.0185  214 LYS A NZ    
469  N N     . ALA A 55  ? 0.2559 0.1988 0.2323 0.0018  -0.0034 0.0078  215 ALA A N     
470  C CA    . ALA A 55  ? 0.3006 0.2453 0.2674 -0.0006 -0.0065 0.0093  215 ALA A CA    
471  C C     . ALA A 55  ? 0.2618 0.2195 0.2327 -0.0070 -0.0004 0.0021  215 ALA A C     
472  O O     . ALA A 55  ? 0.3257 0.2848 0.2879 -0.0099 -0.0013 0.0014  215 ALA A O     
473  C CB    . ALA A 55  ? 0.3407 0.2930 0.3152 0.0079  -0.0158 0.0122  215 ALA A CB    
474  N N     . VAL A 56  ? 0.2158 0.1830 0.1996 -0.0087 0.0056  -0.0035 216 VAL A N     
475  C CA    . VAL A 56  ? 0.2454 0.2261 0.2360 -0.0123 0.0114  -0.0106 216 VAL A CA    
476  C C     . VAL A 56  ? 0.2613 0.2385 0.2384 -0.0223 0.0193  -0.0127 216 VAL A C     
477  O O     . VAL A 56  ? 0.2983 0.2662 0.2667 -0.0285 0.0229  -0.0105 216 VAL A O     
478  C CB    . VAL A 56  ? 0.2582 0.2520 0.2679 -0.0095 0.0135  -0.0152 216 VAL A CB    
479  C CG1   . VAL A 56  ? 0.2840 0.2915 0.3014 -0.0124 0.0199  -0.0223 216 VAL A CG1   
480  C CG2   . VAL A 56  ? 0.2147 0.2135 0.2360 -0.0011 0.0073  -0.0142 216 VAL A CG2   
481  N N     . ALA A 57  ? 0.2676 0.2512 0.2418 -0.0245 0.0228  -0.0173 217 ALA A N     
482  C CA    . ALA A 57  ? 0.2277 0.2115 0.1903 -0.0343 0.0323  -0.0209 217 ALA A CA    
483  C C     . ALA A 57  ? 0.1942 0.1957 0.1708 -0.0328 0.0390  -0.0305 217 ALA A C     
484  O O     . ALA A 57  ? 0.1668 0.1770 0.1598 -0.0243 0.0353  -0.0331 217 ALA A O     
485  C CB    . ALA A 57  ? 0.2526 0.2210 0.1893 -0.0390 0.0304  -0.0163 217 ALA A CB    
486  N N     . ARG A 58  ? 0.1796 0.2216 0.2684 0.0100  0.0057  -0.0291 218 ARG A N     
487  C CA    . ARG A 58  ? 0.1747 0.1843 0.2379 0.0064  0.0076  -0.0470 218 ARG A CA    
488  C C     . ARG A 58  ? 0.2016 0.1946 0.2338 -0.0157 0.0007  -0.0450 218 ARG A C     
489  O O     . ARG A 58  ? 0.2050 0.1661 0.2158 -0.0146 0.0066  -0.0562 218 ARG A O     
490  C CB    . ARG A 58  ? 0.1544 0.1472 0.2074 0.0097  0.0144  -0.0578 218 ARG A CB    
491  C CG    . ARG A 58  ? 0.1519 0.1541 0.2080 0.0181  0.0145  -0.0452 218 ARG A CG    
492  C CD    . ARG A 58  ? 0.1972 0.1907 0.2412 0.0189  0.0181  -0.0452 218 ARG A CD    
493  N NE    . ARG A 58  ? 0.1980 0.1993 0.2488 0.0211  0.0176  -0.0417 218 ARG A NE    
494  C CZ    . ARG A 58  ? 0.2262 0.2314 0.2818 0.0200  0.0183  -0.0414 218 ARG A CZ    
495  N NH1   . ARG A 58  ? 0.2111 0.2161 0.2674 0.0192  0.0195  -0.0416 218 ARG A NH1   
496  N NH2   . ARG A 58  ? 0.2014 0.2114 0.2631 0.0196  0.0185  -0.0421 218 ARG A NH2   
497  N N     . GLU A 59  ? 0.1635 0.1774 0.1907 -0.0379 -0.0113 -0.0278 219 GLU A N     
498  C CA    . GLU A 59  ? 0.2064 0.2049 0.1974 -0.0685 -0.0212 -0.0231 219 GLU A CA    
499  C C     . GLU A 59  ? 0.1918 0.1941 0.1931 -0.0636 -0.0217 -0.0208 219 GLU A C     
500  O O     . GLU A 59  ? 0.2417 0.2149 0.2065 -0.0855 -0.0255 -0.0234 219 GLU A O     
501  C CB    . GLU A 59  ? 0.2554 0.2924 0.2454 -0.0988 -0.0389 0.0034  219 GLU A CB    
502  C CG    . GLU A 59  ? 0.2540 0.3573 0.3007 -0.0859 -0.0436 0.0334  219 GLU A CG    
503  C CD    . GLU A 59  ? 0.4141 0.5557 0.4574 -0.1087 -0.0579 0.0668  219 GLU A CD    
504  O OE1   . GLU A 59  ? 0.4428 0.6207 0.5172 -0.0936 -0.0554 0.0887  219 GLU A OE1   
505  O OE2   . GLU A 59  ? 0.5066 0.6331 0.5085 -0.1374 -0.0678 0.0723  219 GLU A OE2   
506  N N     . HIS A 60  ? 0.1677 0.1981 0.2112 -0.0368 -0.0161 -0.0168 220 HIS A N     
507  C CA    . HIS A 60  ? 0.1614 0.1984 0.2156 -0.0309 -0.0156 -0.0132 220 HIS A CA    
508  C C     . HIS A 60  ? 0.1695 0.1763 0.2195 -0.0109 -0.0048 -0.0332 220 HIS A C     
509  O O     . HIS A 60  ? 0.1677 0.1783 0.2257 -0.0041 -0.0035 -0.0315 220 HIS A O     
510  C CB    . HIS A 60  ? 0.1342 0.2178 0.2306 -0.0156 -0.0127 0.0078  220 HIS A CB    
511  C CG    . HIS A 60  ? 0.1522 0.2819 0.2659 -0.0306 -0.0221 0.0386  220 HIS A CG    
512  N ND1   . HIS A 60  ? 0.1681 0.3245 0.3090 -0.0155 -0.0154 0.0535  220 HIS A ND1   
513  C CD2   . HIS A 60  ? 0.1338 0.2903 0.2407 -0.0614 -0.0381 0.0614  220 HIS A CD2   
514  C CE1   . HIS A 60  ? 0.1752 0.3578 0.3136 -0.0297 -0.0240 0.0809  220 HIS A CE1   
515  N NE2   . HIS A 60  ? 0.1504 0.3360 0.2687 -0.0573 -0.0383 0.0869  220 HIS A NE2   
516  N N     . LEU A 61  ? 0.1676 0.1502 0.2075 -0.0018 0.0028  -0.0480 221 LEU A N     
517  C CA    . LEU A 61  ? 0.2110 0.1841 0.2514 0.0156  0.0103  -0.0520 221 LEU A CA    
518  C C     . LEU A 61  ? 0.1954 0.1436 0.2157 0.0143  0.0128  -0.0526 221 LEU A C     
519  O O     . LEU A 61  ? 0.2160 0.1743 0.2444 0.0227  0.0129  -0.0470 221 LEU A O     
520  C CB    . LEU A 61  ? 0.2145 0.1813 0.2412 0.0205  0.0146  -0.0471 221 LEU A CB    
521  C CG    . LEU A 61  ? 0.2033 0.1740 0.2289 0.0303  0.0174  -0.0395 221 LEU A CG    
522  C CD1   . LEU A 61  ? 0.1876 0.1800 0.2313 0.0288  0.0125  -0.0375 221 LEU A CD1   
523  C CD2   . LEU A 61  ? 0.2313 0.1995 0.2542 0.0357  0.0220  -0.0392 221 LEU A CD2   
524  N N     . GLU A 62  ? 0.2319 0.1434 0.2185 0.0002  0.0146  -0.0577 222 GLU A N     
525  C CA    . GLU A 62  ? 0.2690 0.1521 0.2335 -0.0027 0.0180  -0.0570 222 GLU A CA    
526  C C     . GLU A 62  ? 0.2907 0.1834 0.2633 -0.0132 0.0118  -0.0540 222 GLU A C     
527  O O     . GLU A 62  ? 0.2336 0.1166 0.2070 -0.0038 0.0162  -0.0529 222 GLU A O     
528  C CB    . GLU A 62  ? 0.3664 0.2117 0.2864 -0.0235 0.0226  -0.0578 222 GLU A CB    
529  C CG    . GLU A 62  ? 0.5256 0.3457 0.4309 -0.0088 0.0389  -0.0569 222 GLU A CG    
530  C CD    . GLU A 62  ? 0.6666 0.4388 0.5155 -0.0296 0.0491  -0.0577 222 GLU A CD    
531  O OE1   . GLU A 62  ? 0.6398 0.4111 0.4745 -0.0432 0.0459  -0.0594 222 GLU A OE1   
532  O OE2   . GLU A 62  ? 0.7537 0.4854 0.5672 -0.0335 0.0617  -0.0558 222 GLU A OE2   
533  N N     . LEU A 63  ? 0.2224 0.1515 0.2089 -0.0293 -0.0015 -0.0430 223 LEU A N     
534  C CA    . LEU A 63  ? 0.1968 0.1563 0.1997 -0.0367 -0.0101 -0.0286 223 LEU A CA    
535  C C     . LEU A 63  ? 0.1734 0.1569 0.2101 -0.0099 -0.0045 -0.0288 223 LEU A C     
536  O O     . LEU A 63  ? 0.1771 0.1605 0.2143 -0.0086 -0.0044 -0.0250 223 LEU A O     
537  C CB    . LEU A 63  ? 0.1881 0.1916 0.2063 -0.0556 -0.0224 -0.0085 223 LEU A CB    
538  C CG    . LEU A 63  ? 0.2138 0.2628 0.2591 -0.0603 -0.0285 0.0149  223 LEU A CG    
539  C CD1   . LEU A 63  ? 0.2299 0.2560 0.2448 -0.0849 -0.0351 0.0176  223 LEU A CD1   
540  C CD2   . LEU A 63  ? 0.2221 0.3253 0.2917 -0.0739 -0.0381 0.0428  223 LEU A CD2   
541  N N     . LEU A 64  ? 0.1392 0.1382 0.1971 0.0078  0.0004  -0.0334 224 LEU A N     
542  C CA    . LEU A 64  ? 0.1738 0.1836 0.2481 0.0259  0.0062  -0.0360 224 LEU A CA    
543  C C     . LEU A 64  ? 0.1494 0.1408 0.2112 0.0313  0.0078  -0.0407 224 LEU A C     
544  O O     . LEU A 64  ? 0.1585 0.1564 0.2221 0.0353  0.0083  -0.0372 224 LEU A O     
545  C CB    . LEU A 64  ? 0.1675 0.1806 0.2378 0.0307  0.0096  -0.0347 224 LEU A CB    
546  C CG    . LEU A 64  ? 0.2013 0.2326 0.2855 0.0335  0.0131  -0.0258 224 LEU A CG    
547  C CD1   . LEU A 64  ? 0.2344 0.2542 0.3000 0.0351  0.0160  -0.0252 224 LEU A CD1   
548  C CD2   . LEU A 64  ? 0.1938 0.2402 0.2848 0.0406  0.0193  -0.0142 224 LEU A CD2   
549  N N     . LYS A 65  ? 0.1318 0.1027 0.1759 0.0310  0.0104  -0.0418 225 LYS A N     
550  C CA    . LYS A 65  ? 0.1525 0.1120 0.1863 0.0394  0.0148  -0.0368 225 LYS A CA    
551  C C     . LYS A 65  ? 0.2087 0.1455 0.2368 0.0377  0.0163  -0.0393 225 LYS A C     
552  O O     . LYS A 65  ? 0.2004 0.1404 0.2333 0.0460  0.0173  -0.0339 225 LYS A O     
553  C CB    . LYS A 65  ? 0.1983 0.1421 0.2155 0.0467  0.0197  -0.0351 225 LYS A CB    
554  C CG    . LYS A 65  ? 0.1711 0.1368 0.1982 0.0486  0.0200  -0.0302 225 LYS A CG    
555  C CD    . LYS A 65  ? 0.2152 0.1736 0.2335 0.0562  0.0205  -0.0320 225 LYS A CD    
556  C CE    . LYS A 65  ? 0.2056 0.1830 0.2363 0.0569  0.0230  -0.0276 225 LYS A CE    
557  N NZ    . LYS A 65  ? 0.2162 0.1936 0.2537 0.0644  0.0248  -0.0325 225 LYS A NZ    
558  N N     . HIS A 66  ? 0.2034 0.1179 0.2132 0.0202  0.0150  -0.0425 226 HIS A N     
559  C CA    . HIS A 66  ? 0.2544 0.1459 0.2418 0.0069  0.0141  -0.0371 226 HIS A CA    
560  C C     . HIS A 66  ? 0.2217 0.1510 0.2321 0.0065  0.0061  -0.0280 226 HIS A C     
561  O O     . HIS A 66  ? 0.1886 0.1084 0.1930 0.0081  0.0077  -0.0231 226 HIS A O     
562  C CB    . HIS A 66  ? 0.2922 0.1565 0.2435 -0.0236 0.0097  -0.0372 226 HIS A CB    
563  C CG    . HIS A 66  ? 0.3345 0.1672 0.2530 -0.0446 0.0084  -0.0318 226 HIS A CG    
564  N ND1   . HIS A 66  ? 0.4149 0.1876 0.2960 -0.0401 0.0239  -0.0360 226 HIS A ND1   
565  C CD2   . HIS A 66  ? 0.3407 0.1963 0.2594 -0.0696 -0.0050 -0.0189 226 HIS A CD2   
566  C CE1   . HIS A 66  ? 0.4424 0.1954 0.2963 -0.0639 0.0193  -0.0296 226 HIS A CE1   
567  N NE2   . HIS A 66  ? 0.3911 0.1940 0.2669 -0.0850 0.0001  -0.0190 226 HIS A NE2   
568  N N     . MET A 67  ? 0.1626 0.1310 0.1968 0.0061  0.0012  -0.0239 227 MET A N     
569  C CA    . MET A 67  ? 0.1604 0.1593 0.2131 0.0107  0.0010  -0.0144 227 MET A CA    
570  C C     . MET A 67  ? 0.1796 0.1747 0.2337 0.0262  0.0052  -0.0193 227 MET A C     
571  O O     . MET A 67  ? 0.1403 0.1392 0.1924 0.0257  0.0053  -0.0128 227 MET A O     
572  C CB    . MET A 67  ? 0.1336 0.1645 0.2086 0.0165  0.0041  -0.0083 227 MET A CB    
573  C CG    . MET A 67  ? 0.1276 0.1801 0.2090 -0.0013 -0.0029 0.0072  227 MET A CG    
574  S SD    . MET A 67  ? 0.1769 0.2635 0.2865 0.0105  0.0039  0.0184  227 MET A SD    
575  C CE    . MET A 67  ? 0.1258 0.2288 0.2526 0.0338  0.0226  0.0286  227 MET A CE    
576  N N     . HIS A 68  ? 0.1508 0.1427 0.2079 0.0368  0.0070  -0.0279 228 HIS A N     
577  C CA    . HIS A 68  ? 0.2018 0.1983 0.2597 0.0451  0.0068  -0.0275 228 HIS A CA    
578  C C     . HIS A 68  ? 0.1737 0.1559 0.2249 0.0482  0.0072  -0.0195 228 HIS A C     
579  O O     . HIS A 68  ? 0.1929 0.1838 0.2428 0.0489  0.0050  -0.0126 228 HIS A O     
580  C CB    . HIS A 68  ? 0.1999 0.2024 0.2629 0.0498  0.0064  -0.0317 228 HIS A CB    
581  C CG    . HIS A 68  ? 0.2296 0.2480 0.2946 0.0512  0.0017  -0.0270 228 HIS A CG    
582  N ND1   . HIS A 68  ? 0.2422 0.2674 0.2962 0.0425  -0.0003 -0.0319 228 HIS A ND1   
583  C CD2   . HIS A 68  ? 0.2577 0.2859 0.3290 0.0565  -0.0011 -0.0138 228 HIS A CD2   
584  C CE1   . HIS A 68  ? 0.2764 0.3173 0.3268 0.0364  -0.0082 -0.0229 228 HIS A CE1   
585  N NE2   . HIS A 68  ? 0.2854 0.3353 0.3522 0.0467  -0.0096 -0.0092 228 HIS A NE2   
586  N N     . THR A 69  ? 0.1770 0.1313 0.2185 0.0501  0.0127  -0.0195 229 THR A N     
587  C CA    A THR A 69  ? 0.2198 0.1476 0.2493 0.0568  0.0200  -0.0103 229 THR A CA    
588  C CA    B THR A 69  ? 0.2167 0.1463 0.2472 0.0572  0.0197  -0.0099 229 THR A CA    
589  C C     . THR A 69  ? 0.2325 0.1518 0.2491 0.0442  0.0166  -0.0058 229 THR A C     
590  O O     . THR A 69  ? 0.2187 0.1334 0.2331 0.0503  0.0188  0.0046  229 THR A O     
591  C CB    A THR A 69  ? 0.2827 0.1634 0.2892 0.0596  0.0337  -0.0136 229 THR A CB    
592  C CB    B THR A 69  ? 0.2792 0.1654 0.2901 0.0630  0.0338  -0.0113 229 THR A CB    
593  O OG1   A THR A 69  ? 0.2848 0.1897 0.3062 0.0664  0.0323  -0.0146 229 THR A OG1   
594  O OG1   B THR A 69  ? 0.2917 0.1453 0.2738 0.0424  0.0338  -0.0211 229 THR A OG1   
595  C CG2   A THR A 69  ? 0.3350 0.1844 0.3236 0.0659  0.0449  -0.0029 229 THR A CG2   
596  C CG2   B THR A 69  ? 0.2763 0.1895 0.3037 0.0697  0.0317  -0.0122 229 THR A CG2   
597  N N     . VAL A 70  ? 0.1993 0.1219 0.2098 0.0260  0.0111  -0.0096 230 VAL A N     
598  C CA    . VAL A 70  ? 0.2055 0.1287 0.2075 0.0107  0.0069  -0.0013 230 VAL A CA    
599  C C     . VAL A 70  ? 0.1947 0.1531 0.2151 0.0185  0.0047  0.0046  230 VAL A C     
600  O O     . VAL A 70  ? 0.2080 0.1632 0.2221 0.0157  0.0045  0.0132  230 VAL A O     
601  C CB    . VAL A 70  ? 0.2013 0.1341 0.1989 -0.0131 -0.0001 0.0016  230 VAL A CB    
602  C CG1   . VAL A 70  ? 0.2040 0.1612 0.2078 -0.0264 -0.0052 0.0164  230 VAL A CG1   
603  C CG2   . VAL A 70  ? 0.2479 0.1301 0.2067 -0.0321 0.0017  -0.0034 230 VAL A CG2   
604  N N     . GLY A 71  ? 0.1735 0.1579 0.2094 0.0268  0.0048  -0.0005 231 GLY A N     
605  C CA    . GLY A 71  ? 0.1605 0.1637 0.1988 0.0318  0.0066  0.0020  231 GLY A CA    
606  C C     . GLY A 71  ? 0.1844 0.1833 0.2162 0.0369  0.0037  0.0070  231 GLY A C     
607  O O     . GLY A 71  ? 0.1744 0.1790 0.1992 0.0344  0.0037  0.0142  231 GLY A O     
608  N N     . GLU A 72  ? 0.1645 0.1574 0.2007 0.0449  0.0024  0.0074  232 GLU A N     
609  C CA    . GLU A 72  ? 0.2267 0.2261 0.2651 0.0522  0.0001  0.0210  232 GLU A CA    
610  C C     . GLU A 72  ? 0.2282 0.2054 0.2579 0.0539  0.0044  0.0321  232 GLU A C     
611  O O     . GLU A 72  ? 0.2197 0.2077 0.2486 0.0556  0.0016  0.0454  232 GLU A O     
612  C CB    . GLU A 72  ? 0.2842 0.2900 0.3369 0.0642  0.0014  0.0263  232 GLU A CB    
613  C CG    . GLU A 72  ? 0.3485 0.3818 0.4069 0.0578  -0.0063 0.0203  232 GLU A CG    
614  C CD    . GLU A 72  ? 0.5286 0.5789 0.6066 0.0681  -0.0060 0.0311  232 GLU A CD    
615  O OE1   . GLU A 72  ? 0.5838 0.6121 0.6673 0.0818  0.0057  0.0309  232 GLU A OE1   
616  O OE2   . GLU A 72  ? 0.6045 0.6896 0.6890 0.0602  -0.0167 0.0415  232 GLU A OE2   
617  N N     . LYS A 73  ? 0.2214 0.1643 0.2389 0.0495  0.0110  0.0273  233 LYS A N     
618  C CA    . LYS A 73  ? 0.2624 0.1710 0.2609 0.0460  0.0169  0.0362  233 LYS A CA    
619  C C     . LYS A 73  ? 0.2724 0.1978 0.2680 0.0323  0.0104  0.0406  233 LYS A C     
620  O O     . LYS A 73  ? 0.2907 0.2063 0.2785 0.0334  0.0121  0.0527  233 LYS A O     
621  C CB    . LYS A 73  ? 0.3346 0.1937 0.3062 0.0348  0.0247  0.0283  233 LYS A CB    
622  C CG    . LYS A 73  ? 0.4534 0.2638 0.3921 0.0235  0.0319  0.0355  233 LYS A CG    
623  C CD    . LYS A 73  ? 0.5714 0.3185 0.4670 0.0063  0.0412  0.0262  233 LYS A CD    
624  C CE    . LYS A 73  ? 0.6522 0.3524 0.5057 -0.0209 0.0426  0.0309  233 LYS A CE    
625  N NZ    . LYS A 73  ? 0.6795 0.3603 0.5298 -0.0040 0.0531  0.0454  233 LYS A NZ    
626  N N     . VAL A 74  ? 0.2185 0.1698 0.2220 0.0219  0.0056  0.0338  234 VAL A N     
627  C CA    . VAL A 74  ? 0.2256 0.1975 0.2298 0.0130  0.0043  0.0413  234 VAL A CA    
628  C C     . VAL A 74  ? 0.2123 0.2003 0.2157 0.0214  0.0038  0.0465  234 VAL A C     
629  O O     . VAL A 74  ? 0.2449 0.2339 0.2408 0.0171  0.0041  0.0570  234 VAL A O     
630  C CB    . VAL A 74  ? 0.2267 0.2266 0.2443 0.0079  0.0058  0.0389  234 VAL A CB    
631  C CG1   . VAL A 74  ? 0.2195 0.2432 0.2400 0.0071  0.0116  0.0493  234 VAL A CG1   
632  C CG2   . VAL A 74  ? 0.2742 0.2676 0.2907 -0.0093 0.0018  0.0418  234 VAL A CG2   
633  N N     . ILE A 75  ? 0.2006 0.2007 0.2076 0.0292  0.0016  0.0405  235 ILE A N     
634  C CA    . ILE A 75  ? 0.2089 0.2242 0.2071 0.0292  -0.0026 0.0471  235 ILE A CA    
635  C C     . ILE A 75  ? 0.2631 0.2739 0.2621 0.0340  -0.0057 0.0654  235 ILE A C     
636  O O     . ILE A 75  ? 0.2456 0.2641 0.2339 0.0290  -0.0078 0.0756  235 ILE A O     
637  C CB    . ILE A 75  ? 0.2329 0.2620 0.2321 0.0298  -0.0081 0.0414  235 ILE A CB    
638  C CG1   . ILE A 75  ? 0.2085 0.2343 0.1987 0.0254  -0.0011 0.0244  235 ILE A CG1   
639  C CG2   . ILE A 75  ? 0.2469 0.2949 0.2329 0.0219  -0.0174 0.0538  235 ILE A CG2   
640  C CD1   . ILE A 75  ? 0.2146 0.2461 0.2012 0.0219  -0.0061 0.0167  235 ILE A CD1   
641  N N     . VAL A 76  ? 0.2330 0.2275 0.2421 0.0456  -0.0026 0.0711  236 VAL A N     
642  C CA    . VAL A 76  ? 0.2586 0.2426 0.2693 0.0566  0.0009  0.0927  236 VAL A CA    
643  C C     . VAL A 76  ? 0.3102 0.2674 0.3037 0.0485  0.0055  0.0968  236 VAL A C     
644  O O     . VAL A 76  ? 0.2995 0.2631 0.2898 0.0501  0.0040  0.1140  236 VAL A O     
645  C CB    . VAL A 76  ? 0.2924 0.2505 0.3111 0.0753  0.0127  0.0986  236 VAL A CB    
646  C CG1   . VAL A 76  ? 0.3989 0.3286 0.4127 0.0907  0.0255  0.1221  236 VAL A CG1   
647  C CG2   . VAL A 76  ? 0.2747 0.2710 0.3170 0.0847  0.0074  0.1046  236 VAL A CG2   
648  N N     . ASP A 77  ? 0.2863 0.2177 0.2686 0.0365  0.0093  0.0838  237 ASP A N     
649  C CA    . ASP A 77  ? 0.3419 0.2457 0.3053 0.0229  0.0126  0.0898  237 ASP A CA    
650  C C     . ASP A 77  ? 0.3286 0.2640 0.2934 0.0114  0.0070  0.0945  237 ASP A C     
651  O O     . ASP A 77  ? 0.3451 0.2679 0.2981 0.0044  0.0085  0.1067  237 ASP A O     
652  C CB    . ASP A 77  ? 0.4329 0.3045 0.3800 0.0053  0.0151  0.0787  237 ASP A CB    
653  C CG    . ASP A 77  ? 0.5646 0.3848 0.4944 0.0144  0.0267  0.0743  237 ASP A CG    
654  O OD1   . ASP A 77  ? 0.6114 0.4159 0.5433 0.0375  0.0371  0.0858  237 ASP A OD1   
655  O OD2   . ASP A 77  ? 0.6196 0.4157 0.5326 -0.0013 0.0273  0.0624  237 ASP A OD2   
656  N N     . PHE A 78  ? 0.2845 0.2552 0.2597 0.0104  0.0041  0.0858  238 PHE A N     
657  C CA    . PHE A 78  ? 0.2758 0.2698 0.2481 0.0025  0.0063  0.0905  238 PHE A CA    
658  C C     . PHE A 78  ? 0.2957 0.3073 0.2578 0.0069  0.0053  0.0928  238 PHE A C     
659  O O     . PHE A 78  ? 0.3304 0.3513 0.2811 0.0014  0.0098  0.0996  238 PHE A O     
660  C CB    . PHE A 78  ? 0.2862 0.2993 0.2699 -0.0021 0.0114  0.0838  238 PHE A CB    
661  C CG    . PHE A 78  ? 0.3100 0.3173 0.2992 -0.0176 0.0089  0.0894  238 PHE A CG    
662  C CD1   . PHE A 78  ? 0.3641 0.3516 0.3527 -0.0213 0.0048  0.0802  238 PHE A CD1   
663  C CD2   . PHE A 78  ? 0.3740 0.3963 0.3650 -0.0327 0.0100  0.1057  238 PHE A CD2   
664  C CE1   . PHE A 78  ? 0.4030 0.3813 0.3855 -0.0441 0.0001  0.0860  238 PHE A CE1   
665  C CE2   . PHE A 78  ? 0.4053 0.4261 0.3965 -0.0560 0.0037  0.1144  238 PHE A CE2   
666  C CZ    . PHE A 78  ? 0.4095 0.4059 0.3928 -0.0640 -0.0021 0.1038  238 PHE A CZ    
667  N N     . ALA A 79  ? 0.2850 0.3017 0.2477 0.0134  -0.0008 0.0892  239 ALA A N     
668  C CA    . ALA A 79  ? 0.3395 0.3726 0.2836 0.0080  -0.0054 0.0916  239 ALA A CA    
669  C C     . ALA A 79  ? 0.3434 0.3911 0.2948 0.0116  -0.0180 0.1063  239 ALA A C     
670  O O     . ALA A 79  ? 0.3912 0.4577 0.3265 0.0006  -0.0268 0.1093  239 ALA A O     
671  C CB    . ALA A 79  ? 0.3530 0.3862 0.2826 0.0036  0.0011  0.0733  239 ALA A CB    
672  N N     . GLY A 80  ? 0.3238 0.3616 0.2962 0.0256  -0.0170 0.1183  240 GLY A N     
673  C CA    . GLY A 80  ? 0.3377 0.3952 0.3278 0.0366  -0.0235 0.1394  240 GLY A CA    
674  C C     . GLY A 80  ? 0.3678 0.4583 0.3516 0.0289  -0.0353 0.1649  240 GLY A C     
675  O O     . GLY A 80  ? 0.3880 0.5162 0.3796 0.0241  -0.0480 0.1802  240 GLY A O     
676  N N     . SER A 81  ? 0.4213 0.5020 0.3903 0.0243  -0.0330 0.1725  241 SER A N     
677  C CA    . SER A 81  ? 0.4807 0.5930 0.4420 0.0159  -0.0449 0.2001  241 SER A CA    
678  C C     . SER A 81  ? 0.5271 0.6572 0.4515 -0.0130 -0.0561 0.1892  241 SER A C     
679  O O     . SER A 81  ? 0.5984 0.7571 0.5092 -0.0288 -0.0694 0.2085  241 SER A O     
680  C CB    . SER A 81  ? 0.5108 0.6033 0.4663 0.0206  -0.0374 0.2139  241 SER A CB    
681  O OG    . SER A 81  ? 0.5058 0.5778 0.4355 0.0066  -0.0309 0.1921  241 SER A OG    
682  N N     . SER A 82  ? 0.5270 0.6346 0.4319 -0.0207 -0.0479 0.1572  242 SER A N     
683  C CA    . SER A 82  ? 0.5794 0.6830 0.4355 -0.0469 -0.0500 0.1431  242 SER A CA    
684  C C     . SER A 82  ? 0.5673 0.6968 0.4148 -0.0651 -0.0675 0.1484  242 SER A C     
685  O O     . SER A 82  ? 0.5405 0.6702 0.3381 -0.0959 -0.0759 0.1470  242 SER A O     
686  C CB    . SER A 82  ? 0.6250 0.6926 0.4644 -0.0438 -0.0292 0.1121  242 SER A CB    
687  O OG    . SER A 82  ? 0.6370 0.6995 0.4792 -0.0442 -0.0290 0.0953  242 SER A OG    
688  N N     . LYS A 83  ? 0.4861 0.5090 0.5367 0.0709  -0.0550 0.1421  243 LYS A N     
689  C CA    . LYS A 83  ? 0.5451 0.5960 0.6173 0.0779  -0.0583 0.1343  243 LYS A CA    
690  C C     . LYS A 83  ? 0.5245 0.6020 0.6002 0.0667  -0.0658 0.1216  243 LYS A C     
691  O O     . LYS A 83  ? 0.5300 0.6323 0.6151 0.0686  -0.0754 0.1162  243 LYS A O     
692  C CB    . LYS A 83  ? 0.6195 0.6866 0.6982 0.0916  -0.0639 0.1414  243 LYS A CB    
693  C CG    . LYS A 83  ? 0.6842 0.7375 0.7719 0.1080  -0.0565 0.1479  243 LYS A CG    
694  C CD    . LYS A 83  ? 0.7546 0.7641 0.8194 0.1142  -0.0522 0.1578  243 LYS A CD    
695  C CE    . LYS A 83  ? 0.8200 0.8145 0.8883 0.1349  -0.0468 0.1626  243 LYS A CE    
696  N NZ    . LYS A 83  ? 0.8906 0.8376 0.9333 0.1409  -0.0472 0.1719  243 LYS A NZ    
697  N N     . LEU A 84  ? 0.4864 0.5548 0.5518 0.0549  -0.0629 0.1163  244 LEU A N     
698  C CA    . LEU A 84  ? 0.4411 0.5259 0.5036 0.0463  -0.0692 0.1021  244 LEU A CA    
699  C C     . LEU A 84  ? 0.3355 0.4253 0.4198 0.0428  -0.0679 0.0944  244 LEU A C     
700  O O     . LEU A 84  ? 0.3300 0.4081 0.4278 0.0477  -0.0587 0.0998  244 LEU A O     
701  C CB    . LEU A 84  ? 0.5115 0.5880 0.5543 0.0370  -0.0651 0.1003  244 LEU A CB    
702  C CG    . LEU A 84  ? 0.6095 0.6910 0.6308 0.0388  -0.0654 0.1059  244 LEU A CG    
703  C CD1   . LEU A 84  ? 0.5915 0.6721 0.6004 0.0298  -0.0587 0.1050  244 LEU A CD1   
704  C CD2   . LEU A 84  ? 0.6599 0.7550 0.6705 0.0466  -0.0770 0.0964  244 LEU A CD2   
705  N N     . ARG A 85  ? 0.2543 0.3575 0.3393 0.0358  -0.0764 0.0813  245 ARG A N     
706  C CA    . ARG A 85  ? 0.2248 0.3329 0.3303 0.0290  -0.0747 0.0751  245 ARG A CA    
707  C C     . ARG A 85  ? 0.1864 0.2788 0.2811 0.0207  -0.0690 0.0688  245 ARG A C     
708  O O     . ARG A 85  ? 0.1784 0.2647 0.2478 0.0177  -0.0711 0.0637  245 ARG A O     
709  C CB    . ARG A 85  ? 0.3155 0.4393 0.4258 0.0229  -0.0884 0.0652  245 ARG A CB    
710  C CG    . ARG A 85  ? 0.4079 0.5414 0.5465 0.0148  -0.0861 0.0648  245 ARG A CG    
711  C CD    . ARG A 85  ? 0.4895 0.6383 0.6367 0.0070  -0.1019 0.0602  245 ARG A CD    
712  N NE    . ARG A 85  ? 0.5266 0.6608 0.6465 -0.0005 -0.1129 0.0449  245 ARG A NE    
713  C CZ    . ARG A 85  ? 0.5504 0.6719 0.6686 -0.0118 -0.1127 0.0372  245 ARG A CZ    
714  N NH1   . ARG A 85  ? 0.5217 0.6461 0.6651 -0.0175 -0.1018 0.0435  245 ARG A NH1   
715  N NH2   . ARG A 85  ? 0.5718 0.6767 0.6607 -0.0149 -0.1218 0.0240  245 ARG A NH2   
716  N N     . PHE A 86  ? 0.1194 0.2061 0.2319 0.0196  -0.0599 0.0696  246 PHE A N     
717  C CA    . PHE A 86  ? 0.1565 0.2221 0.2526 0.0111  -0.0507 0.0586  246 PHE A CA    
718  C C     . PHE A 86  ? 0.1134 0.1850 0.2262 0.0053  -0.0481 0.0515  246 PHE A C     
719  O O     . PHE A 86  ? 0.1317 0.2216 0.2730 0.0090  -0.0473 0.0588  246 PHE A O     
720  C CB    . PHE A 86  ? 0.1718 0.2085 0.2577 0.0152  -0.0367 0.0617  246 PHE A CB    
721  C CG    . PHE A 86  ? 0.1967 0.2200 0.2624 0.0130  -0.0388 0.0687  246 PHE A CG    
722  C CD1   . PHE A 86  ? 0.2078 0.2314 0.2751 0.0216  -0.0421 0.0827  246 PHE A CD1   
723  C CD2   . PHE A 86  ? 0.1979 0.2110 0.2456 0.0020  -0.0372 0.0644  246 PHE A CD2   
724  C CE1   . PHE A 86  ? 0.2339 0.2458 0.2849 0.0174  -0.0437 0.0933  246 PHE A CE1   
725  C CE2   . PHE A 86  ? 0.2067 0.2141 0.2419 -0.0028 -0.0392 0.0759  246 PHE A CE2   
726  C CZ    . PHE A 86  ? 0.1943 0.1998 0.2313 0.0039  -0.0422 0.0909  246 PHE A CZ    
727  N N     . ARG A 87  ? 0.1146 0.1743 0.2113 -0.0034 -0.0466 0.0400  247 ARG A N     
728  C CA    . ARG A 87  ? 0.1447 0.2026 0.2527 -0.0086 -0.0401 0.0351  247 ARG A CA    
729  C C     . ARG A 87  ? 0.1585 0.1919 0.2465 -0.0085 -0.0260 0.0287  247 ARG A C     
730  O O     . ARG A 87  ? 0.1820 0.2035 0.2473 -0.0104 -0.0267 0.0255  247 ARG A O     
731  C CB    . ARG A 87  ? 0.1432 0.2059 0.2497 -0.0192 -0.0546 0.0273  247 ARG A CB    
732  C CG    . ARG A 87  ? 0.1553 0.2353 0.2761 -0.0211 -0.0691 0.0315  247 ARG A CG    
733  C CD    . ARG A 87  ? 0.1933 0.2615 0.2991 -0.0301 -0.0799 0.0209  247 ARG A CD    
734  N NE    . ARG A 87  ? 0.2035 0.2701 0.3271 -0.0388 -0.0743 0.0234  247 ARG A NE    
735  C CZ    . ARG A 87  ? 0.2680 0.3166 0.3774 -0.0464 -0.0801 0.0155  247 ARG A CZ    
736  N NH1   . ARG A 87  ? 0.2620 0.2923 0.3385 -0.0440 -0.0907 0.0036  247 ARG A NH1   
737  N NH2   . ARG A 87  ? 0.2817 0.3307 0.4082 -0.0539 -0.0740 0.0210  247 ARG A NH2   
738  N N     . LEU A 88  ? 0.1189 0.1480 0.2162 -0.0060 -0.0136 0.0288  248 LEU A N     
739  C CA    . LEU A 88  ? 0.1254 0.1300 0.2010 -0.0052 -0.0023 0.0215  248 LEU A CA    
740  C C     . LEU A 88  ? 0.1317 0.1397 0.2117 -0.0108 0.0014  0.0172  248 LEU A C     
741  O O     . LEU A 88  ? 0.1320 0.1571 0.2375 -0.0100 0.0050  0.0250  248 LEU A O     
742  C CB    . LEU A 88  ? 0.1512 0.1397 0.2241 0.0090  0.0109  0.0259  248 LEU A CB    
743  C CG    . LEU A 88  ? 0.1895 0.1616 0.2523 0.0159  0.0081  0.0306  248 LEU A CG    
744  C CD1   . LEU A 88  ? 0.2219 0.2192 0.3097 0.0230  0.0033  0.0425  248 LEU A CD1   
745  C CD2   . LEU A 88  ? 0.2672 0.2042 0.3090 0.0297  0.0194  0.0283  248 LEU A CD2   
746  N N     . GLY A 89  ? 0.1298 0.1243 0.1872 -0.0165 0.0005  0.0077  249 GLY A N     
747  C CA    . GLY A 89  ? 0.1321 0.1260 0.1910 -0.0212 0.0033  0.0047  249 GLY A CA    
748  C C     . GLY A 89  ? 0.1347 0.1140 0.1660 -0.0240 0.0028  -0.0052 249 GLY A C     
749  O O     . GLY A 89  ? 0.1506 0.1238 0.1635 -0.0234 0.0011  -0.0087 249 GLY A O     
750  N N     . TYR A 90  ? 0.1432 0.1189 0.1740 -0.0277 0.0034  -0.0072 250 TYR A N     
751  C CA    . TYR A 90  ? 0.1550 0.1176 0.1604 -0.0271 0.0051  -0.0150 250 TYR A CA    
752  C C     . TYR A 90  ? 0.1666 0.1238 0.1645 -0.0309 -0.0066 -0.0193 250 TYR A C     
753  O O     . TYR A 90  ? 0.1955 0.1530 0.2108 -0.0377 -0.0134 -0.0153 250 TYR A O     
754  C CB    . TYR A 90  ? 0.1624 0.1164 0.1658 -0.0235 0.0197  -0.0128 250 TYR A CB    
755  C CG    . TYR A 90  ? 0.1897 0.1386 0.1895 -0.0153 0.0307  -0.0113 250 TYR A CG    
756  C CD1   . TYR A 90  ? 0.2156 0.1500 0.1894 -0.0131 0.0306  -0.0184 250 TYR A CD1   
757  C CD2   . TYR A 90  ? 0.1774 0.1347 0.1978 -0.0088 0.0397  -0.0020 250 TYR A CD2   
758  C CE1   . TYR A 90  ? 0.2349 0.1555 0.1980 -0.0054 0.0359  -0.0186 250 TYR A CE1   
759  C CE2   . TYR A 90  ? 0.2311 0.1753 0.2389 0.0039  0.0494  -0.0023 250 TYR A CE2   
760  C CZ    . TYR A 90  ? 0.2474 0.1672 0.2232 0.0051  0.0466  -0.0125 250 TYR A CZ    
761  O OH    . TYR A 90  ? 0.2458 0.1469 0.2032 0.0163  0.0500  -0.0139 250 TYR A OH    
762  N N     . HIS A 91  ? 0.1948 0.1512 0.1700 -0.0232 -0.0095 -0.0247 251 HIS A N     
763  C CA    . HIS A 91  ? 0.2165 0.1676 0.1824 -0.0195 -0.0160 -0.0281 251 HIS A CA    
764  C C     . HIS A 91  ? 0.2232 0.1599 0.1888 -0.0216 -0.0110 -0.0265 251 HIS A C     
765  O O     . HIS A 91  ? 0.2345 0.1709 0.1947 -0.0190 -0.0008 -0.0245 251 HIS A O     
766  C CB    . HIS A 91  ? 0.2075 0.1710 0.1579 -0.0092 -0.0152 -0.0294 251 HIS A CB    
767  C CG    . HIS A 91  ? 0.2409 0.2155 0.1876 -0.0073 -0.0205 -0.0285 251 HIS A CG    
768  N ND1   . HIS A 91  ? 0.2765 0.2664 0.2152 -0.0032 -0.0171 -0.0241 251 HIS A ND1   
769  C CD2   . HIS A 91  ? 0.3066 0.2793 0.2574 -0.0103 -0.0298 -0.0287 251 HIS A CD2   
770  C CE1   . HIS A 91  ? 0.2715 0.2664 0.2066 -0.0014 -0.0228 -0.0217 251 HIS A CE1   
771  N NE2   . HIS A 91  ? 0.3024 0.2891 0.2445 -0.0045 -0.0308 -0.0257 251 HIS A NE2   
772  N N     . ALA A 92  ? 0.2160 0.2041 0.2857 -0.0353 0.0217  0.0013  252 ALA A N     
773  C CA    . ALA A 92  ? 0.2243 0.2045 0.2890 -0.0396 0.0284  0.0087  252 ALA A CA    
774  C C     . ALA A 92  ? 0.2955 0.2567 0.3455 -0.0317 0.0283  0.0135  252 ALA A C     
775  O O     . ALA A 92  ? 0.3112 0.2675 0.3513 -0.0297 0.0329  0.0209  252 ALA A O     
776  C CB    . ALA A 92  ? 0.2350 0.2084 0.3062 -0.0527 0.0312  0.0083  252 ALA A CB    
777  N N     . ILE A 93  ? 0.2369 0.1888 0.2847 -0.0266 0.0230  0.0089  253 ILE A N     
778  C CA    . ILE A 93  ? 0.2356 0.1740 0.2718 -0.0164 0.0207  0.0105  253 ILE A CA    
779  C C     . ILE A 93  ? 0.2820 0.2315 0.3229 -0.0095 0.0153  0.0029  253 ILE A C     
780  O O     . ILE A 93  ? 0.3622 0.3107 0.4072 -0.0108 0.0129  -0.0028 253 ILE A O     
781  C CB    . ILE A 93  ? 0.2824 0.1962 0.3117 -0.0175 0.0202  0.0113  253 ILE A CB    
782  C CG1   . ILE A 93  ? 0.3126 0.2128 0.3395 -0.0292 0.0263  0.0185  253 ILE A CG1   
783  C CG2   . ILE A 93  ? 0.3521 0.2528 0.3680 -0.0039 0.0169  0.0130  253 ILE A CG2   
784  C CD1   . ILE A 93  ? 0.3896 0.2607 0.4097 -0.0319 0.0250  0.0184  253 ILE A CD1   
785  N N     . PRO A 94  ? 0.2715 0.2322 0.3115 -0.0028 0.0138  0.0025  254 PRO A N     
786  C CA    . PRO A 94  ? 0.2714 0.2430 0.3176 0.0003  0.0097  -0.0045 254 PRO A CA    
787  C C     . PRO A 94  ? 0.2410 0.2088 0.2844 0.0083  0.0067  -0.0084 254 PRO A C     
788  O O     . PRO A 94  ? 0.2792 0.2347 0.3132 0.0147  0.0062  -0.0052 254 PRO A O     
789  C CB    . PRO A 94  ? 0.2989 0.2817 0.3454 0.0040  0.0087  -0.0046 254 PRO A CB    
790  C CG    . PRO A 94  ? 0.3279 0.3048 0.3638 0.0089  0.0110  0.0017  254 PRO A CG    
791  C CD    . PRO A 94  ? 0.3297 0.2936 0.3625 0.0018  0.0157  0.0076  254 PRO A CD    
792  N N     . SER A 95  ? 0.2161 0.1946 0.2669 0.0082  0.0048  -0.0152 255 SER A N     
793  C CA    . SER A 95  ? 0.2058 0.1884 0.2576 0.0162  0.0020  -0.0213 255 SER A CA    
794  C C     . SER A 95  ? 0.2100 0.2072 0.2661 0.0212  -0.0011 -0.0251 255 SER A C     
795  O O     . SER A 95  ? 0.1880 0.1887 0.2423 0.0315  -0.0048 -0.0287 255 SER A O     
796  C CB    . SER A 95  ? 0.2277 0.2172 0.2861 0.0120  0.0032  -0.0274 255 SER A CB    
797  O OG    . SER A 95  ? 0.2784 0.2545 0.3324 0.0101  0.0042  -0.0268 255 SER A OG    
798  N N     . MET A 96  ? 0.1836 0.1886 0.2451 0.0145  -0.0004 -0.0254 256 MET A N     
799  C CA    . MET A 96  ? 0.1514 0.1693 0.2188 0.0165  -0.0038 -0.0308 256 MET A CA    
800  C C     . MET A 96  ? 0.1609 0.1764 0.2209 0.0225  -0.0061 -0.0279 256 MET A C     
801  O O     . MET A 96  ? 0.1937 0.2019 0.2483 0.0198  -0.0036 -0.0218 256 MET A O     
802  C CB    . MET A 96  ? 0.1563 0.1794 0.2316 0.0058  -0.0022 -0.0328 256 MET A CB    
803  C CG    . MET A 96  ? 0.1514 0.1779 0.2310 -0.0008 0.0016  -0.0346 256 MET A CG    
804  S SD    . MET A 96  ? 0.1937 0.2398 0.2842 0.0022  0.0013  -0.0445 256 MET A SD    
805  C CE    . MET A 96  ? 0.1065 0.1637 0.2072 -0.0048 -0.0007 -0.0494 256 MET A CE    
806  N N     . SER A 97  ? 0.1343 0.1589 0.1947 0.0310  -0.0112 -0.0334 257 SER A N     
807  C CA    . SER A 97  ? 0.1661 0.1909 0.2179 0.0382  -0.0140 -0.0323 257 SER A CA    
808  C C     . SER A 97  ? 0.1825 0.2115 0.2398 0.0322  -0.0149 -0.0354 257 SER A C     
809  O O     . SER A 97  ? 0.1795 0.2118 0.2478 0.0232  -0.0148 -0.0397 257 SER A O     
810  C CB    . SER A 97  ? 0.2253 0.2602 0.2753 0.0506  -0.0210 -0.0391 257 SER A CB    
811  O OG    . SER A 97  ? 0.2971 0.3243 0.3384 0.0595  -0.0215 -0.0358 257 SER A OG    
812  N N     . HIS A 98  ? 0.1605 0.1881 0.2083 0.0379  -0.0156 -0.0332 258 HIS A N     
813  C CA    . HIS A 98  ? 0.1644 0.1940 0.2138 0.0361  -0.0175 -0.0368 258 HIS A CA    
814  C C     . HIS A 98  ? 0.1669 0.1894 0.2166 0.0291  -0.0122 -0.0305 258 HIS A C     
815  O O     . HIS A 98  ? 0.1928 0.2109 0.2493 0.0204  -0.0102 -0.0292 258 HIS A O     
816  C CB    . HIS A 98  ? 0.1593 0.1942 0.2211 0.0311  -0.0228 -0.0471 258 HIS A CB    
817  C CG    . HIS A 98  ? 0.1806 0.2151 0.2411 0.0335  -0.0275 -0.0534 258 HIS A CG    
818  N ND1   . HIS A 98  ? 0.2347 0.2779 0.2957 0.0403  -0.0348 -0.0635 258 HIS A ND1   
819  C CD2   . HIS A 98  ? 0.1865 0.2132 0.2450 0.0314  -0.0269 -0.0523 258 HIS A CD2   
820  C CE1   . HIS A 98  ? 0.2361 0.2751 0.2951 0.0418  -0.0383 -0.0686 258 HIS A CE1   
821  N NE2   . HIS A 98  ? 0.1934 0.2221 0.2506 0.0372  -0.0336 -0.0617 258 HIS A NE2   
822  N N     . VAL A 99  ? 0.1450 0.1687 0.1868 0.0336  -0.0100 -0.0272 259 VAL A N     
823  C CA    A VAL A 99  ? 0.1482 0.1704 0.1916 0.0286  -0.0056 -0.0226 259 VAL A CA    
824  C CA    B VAL A 99  ? 0.1419 0.1637 0.1854 0.0283  -0.0055 -0.0224 259 VAL A CA    
825  C C     . VAL A 99  ? 0.1704 0.1881 0.2219 0.0228  -0.0088 -0.0266 259 VAL A C     
826  O O     . VAL A 99  ? 0.1768 0.1929 0.2299 0.0247  -0.0143 -0.0336 259 VAL A O     
827  C CB    A VAL A 99  ? 0.1902 0.2206 0.2266 0.0357  -0.0038 -0.0223 259 VAL A CB    
828  C CB    B VAL A 99  ? 0.1854 0.2150 0.2215 0.0344  -0.0022 -0.0202 259 VAL A CB    
829  C CG1   A VAL A 99  ? 0.1800 0.2137 0.2219 0.0325  -0.0019 -0.0220 259 VAL A CG1   
830  C CG1   B VAL A 99  ? 0.1784 0.2133 0.2123 0.0427  -0.0081 -0.0289 259 VAL A CG1   
831  C CG2   A VAL A 99  ? 0.1850 0.2169 0.2107 0.0385  0.0024  -0.0144 259 VAL A CG2   
832  C CG2   B VAL A 99  ? 0.1754 0.2081 0.2166 0.0286  0.0025  -0.0164 259 VAL A CG2   
833  N N     . HIS A 100 ? 0.1825 0.1963 0.2375 0.0158  -0.0059 -0.0224 260 HIS A N     
834  C CA    . HIS A 100 ? 0.1704 0.1772 0.2289 0.0111  -0.0088 -0.0242 260 HIS A CA    
835  C C     . HIS A 100 ? 0.1671 0.1749 0.2263 0.0090  -0.0067 -0.0204 260 HIS A C     
836  O O     . HIS A 100 ? 0.1728 0.1836 0.2333 0.0053  -0.0023 -0.0163 260 HIS A O     
837  C CB    . HIS A 100 ? 0.1558 0.1573 0.2178 0.0038  -0.0087 -0.0248 260 HIS A CB    
838  C CG    . HIS A 100 ? 0.1714 0.1754 0.2343 0.0011  -0.0045 -0.0213 260 HIS A CG    
839  N ND1   . HIS A 100 ? 0.2116 0.2198 0.2734 0.0056  -0.0038 -0.0218 260 HIS A ND1   
840  C CD2   . HIS A 100 ? 0.2277 0.2289 0.2910 -0.0042 -0.0016 -0.0182 260 HIS A CD2   
841  C CE1   . HIS A 100 ? 0.2070 0.2128 0.2687 0.0032  -0.0007 -0.0190 260 HIS A CE1   
842  N NE2   . HIS A 100 ? 0.2241 0.2265 0.2873 -0.0032 0.0008  -0.0173 260 HIS A NE2   
843  N N     . LEU A 101 ? 0.1329 0.1377 0.1912 0.0119  -0.0107 -0.0227 261 LEU A N     
844  C CA    . LEU A 101 ? 0.1074 0.1152 0.1670 0.0117  -0.0109 -0.0210 261 LEU A CA    
845  C C     . LEU A 101 ? 0.1344 0.1297 0.1910 0.0061  -0.0130 -0.0189 261 LEU A C     
846  O O     . LEU A 101 ? 0.1497 0.1314 0.2016 0.0053  -0.0164 -0.0198 261 LEU A O     
847  C CB    . LEU A 101 ? 0.1203 0.1317 0.1787 0.0214  -0.0154 -0.0255 261 LEU A CB    
848  C CG    . LEU A 101 ? 0.1408 0.1576 0.2009 0.0249  -0.0184 -0.0263 261 LEU A CG    
849  C CD1   . LEU A 101 ? 0.1309 0.1681 0.1998 0.0214  -0.0125 -0.0249 261 LEU A CD1   
850  C CD2   . LEU A 101 ? 0.1793 0.1964 0.2367 0.0373  -0.0247 -0.0325 261 LEU A CD2   
851  N N     . HIS A 102 ? 0.1372 0.1365 0.1955 0.0017  -0.0107 -0.0163 262 HIS A N     
852  C CA    . HIS A 102 ? 0.1364 0.1262 0.1892 -0.0021 -0.0126 -0.0143 262 HIS A CA    
853  C C     . HIS A 102 ? 0.1558 0.1428 0.2038 0.0046  -0.0189 -0.0151 262 HIS A C     
854  O O     . HIS A 102 ? 0.1453 0.1463 0.1991 0.0097  -0.0203 -0.0179 262 HIS A O     
855  C CB    . HIS A 102 ? 0.1228 0.1186 0.1783 -0.0077 -0.0092 -0.0132 262 HIS A CB    
856  C CG    . HIS A 102 ? 0.1559 0.1506 0.2133 -0.0126 -0.0044 -0.0127 262 HIS A CG    
857  N ND1   . HIS A 102 ? 0.1451 0.1338 0.1985 -0.0169 -0.0029 -0.0121 262 HIS A ND1   
858  C CD2   . HIS A 102 ? 0.1761 0.1753 0.2379 -0.0126 -0.0010 -0.0127 262 HIS A CD2   
859  C CE1   . HIS A 102 ? 0.1611 0.1528 0.2183 -0.0183 0.0005  -0.0134 262 HIS A CE1   
860  N NE2   . HIS A 102 ? 0.1631 0.1590 0.2242 -0.0153 0.0012  -0.0133 262 HIS A NE2   
861  N N     . VAL A 103 ? 0.1406 0.1099 0.1777 0.0046  -0.0224 -0.0128 263 VAL A N     
862  C CA    . VAL A 103 ? 0.1543 0.1158 0.1824 0.0127  -0.0297 -0.0125 263 VAL A CA    
863  C C     . VAL A 103 ? 0.1901 0.1407 0.2063 0.0077  -0.0294 -0.0073 263 VAL A C     
864  O O     . VAL A 103 ? 0.2229 0.1566 0.2300 0.0013  -0.0271 -0.0028 263 VAL A O     
865  C CB    . VAL A 103 ? 0.1937 0.1365 0.2140 0.0187  -0.0350 -0.0133 263 VAL A CB    
866  C CG1   . VAL A 103 ? 0.2368 0.1683 0.2452 0.0299  -0.0439 -0.0130 263 VAL A CG1   
867  C CG2   . VAL A 103 ? 0.2183 0.1729 0.2487 0.0240  -0.0347 -0.0195 263 VAL A CG2   
868  N N     . ILE A 104 ? 0.1728 0.1348 0.1894 0.0099  -0.0314 -0.0085 264 ILE A N     
869  C CA    . ILE A 104 ? 0.1949 0.1514 0.2009 0.0046  -0.0297 -0.0048 264 ILE A CA    
870  C C     . ILE A 104 ? 0.2006 0.1582 0.1964 0.0128  -0.0374 -0.0053 264 ILE A C     
871  O O     . ILE A 104 ? 0.2122 0.1883 0.2186 0.0187  -0.0419 -0.0116 264 ILE A O     
872  C CB    . ILE A 104 ? 0.1912 0.1615 0.2080 -0.0041 -0.0226 -0.0071 264 ILE A CB    
873  C CG1   . ILE A 104 ? 0.2060 0.1711 0.2108 -0.0089 -0.0200 -0.0044 264 ILE A CG1   
874  C CG2   . ILE A 104 ? 0.1559 0.1464 0.1876 -0.0026 -0.0236 -0.0131 264 ILE A CG2   
875  C CD1   . ILE A 104 ? 0.1804 0.1558 0.1940 -0.0157 -0.0137 -0.0077 264 ILE A CD1   
876  N N     . SER A 105 ? 0.2156 0.1542 0.1904 0.0132  -0.0390 0.0011  265 SER A N     
877  C CA    . SER A 105 ? 0.2171 0.1544 0.1773 0.0227  -0.0474 0.0013  265 SER A CA    
878  C C     . SER A 105 ? 0.2067 0.1637 0.1724 0.0194  -0.0464 -0.0039 265 SER A C     
879  O O     . SER A 105 ? 0.2101 0.1724 0.1823 0.0091  -0.0382 -0.0045 265 SER A O     
880  C CB    . SER A 105 ? 0.2510 0.1582 0.1824 0.0243  -0.0488 0.0116  265 SER A CB    
881  O OG    . SER A 105 ? 0.2526 0.1539 0.1776 0.0112  -0.0385 0.0172  265 SER A OG    
882  N N     . GLN A 106 ? 0.2179 0.1863 0.1812 0.0291  -0.0557 -0.0091 266 GLN A N     
883  C CA    . GLN A 106 ? 0.2434 0.2342 0.2180 0.0259  -0.0566 -0.0177 266 GLN A CA    
884  C C     . GLN A 106 ? 0.2937 0.2790 0.2469 0.0272  -0.0587 -0.0163 266 GLN A C     
885  O O     . GLN A 106 ? 0.2650 0.2674 0.2235 0.0278  -0.0629 -0.0250 266 GLN A O     
886  C CB    . GLN A 106 ? 0.2367 0.2515 0.2288 0.0335  -0.0650 -0.0276 266 GLN A CB    
887  C CG    . GLN A 106 ? 0.2141 0.2387 0.2279 0.0304  -0.0603 -0.0296 266 GLN A CG    
888  C CD    . GLN A 106 ? 0.1971 0.2294 0.2276 0.0162  -0.0501 -0.0312 266 GLN A CD    
889  O OE1   . GLN A 106 ? 0.2153 0.2637 0.2579 0.0106  -0.0503 -0.0383 266 GLN A OE1   
890  N NE2   . GLN A 106 ? 0.1746 0.1940 0.2050 0.0106  -0.0421 -0.0252 266 GLN A NE2   
891  N N     . ASP A 107 ? 0.2432 0.2048 0.1721 0.0268  -0.0552 -0.0055 267 ASP A N     
892  C CA    . ASP A 107 ? 0.2742 0.2302 0.1805 0.0263  -0.0537 -0.0024 267 ASP A CA    
893  C C     . ASP A 107 ? 0.2456 0.2115 0.1626 0.0143  -0.0434 -0.0063 267 ASP A C     
894  O O     . ASP A 107 ? 0.2715 0.2454 0.1804 0.0147  -0.0439 -0.0110 267 ASP A O     
895  C CB    . ASP A 107 ? 0.3424 0.2691 0.2198 0.0266  -0.0504 0.0118  267 ASP A CB    
896  C CG    . ASP A 107 ? 0.3218 0.2359 0.2086 0.0158  -0.0407 0.0179  267 ASP A CG    
897  O OD1   . ASP A 107 ? 0.3008 0.2075 0.1954 0.0198  -0.0448 0.0183  267 ASP A OD1   
898  O OD2   . ASP A 107 ? 0.3289 0.2428 0.2160 0.0040  -0.0294 0.0208  267 ASP A OD2   
899  N N     . PHE A 108 ? 0.2423 0.2075 0.1764 0.0053  -0.0350 -0.0050 268 PHE A N     
900  C CA    . PHE A 108 ? 0.2610 0.2323 0.2034 -0.0044 -0.0251 -0.0074 268 PHE A CA    
901  C C     . PHE A 108 ? 0.2931 0.2586 0.2132 -0.0069 -0.0189 -0.0027 268 PHE A C     
902  O O     . PHE A 108 ? 0.2942 0.2704 0.2161 -0.0096 -0.0148 -0.0090 268 PHE A O     
903  C CB    . PHE A 108 ? 0.2390 0.2278 0.2006 -0.0058 -0.0272 -0.0192 268 PHE A CB    
904  C CG    . PHE A 108 ? 0.2398 0.2357 0.2242 -0.0066 -0.0294 -0.0225 268 PHE A CG    
905  C CD1   . PHE A 108 ? 0.1897 0.1829 0.1868 -0.0121 -0.0225 -0.0199 268 PHE A CD1   
906  C CD2   . PHE A 108 ? 0.2183 0.2263 0.2114 -0.0017 -0.0381 -0.0288 268 PHE A CD2   
907  C CE1   . PHE A 108 ? 0.2141 0.2141 0.2289 -0.0126 -0.0234 -0.0220 268 PHE A CE1   
908  C CE2   . PHE A 108 ? 0.2170 0.2343 0.2307 -0.0034 -0.0382 -0.0315 268 PHE A CE2   
909  C CZ    . PHE A 108 ? 0.1642 0.1765 0.1873 -0.0088 -0.0304 -0.0274 268 PHE A CZ    
910  N N     . ASP A 109 ? 0.2708 0.2184 0.1688 -0.0059 -0.0180 0.0083  269 ASP A N     
911  C CA    . ASP A 109 ? 0.2884 0.2295 0.1625 -0.0098 -0.0101 0.0153  269 ASP A CA    
912  C C     . ASP A 109 ? 0.3169 0.2548 0.1987 -0.0225 0.0026  0.0205  269 ASP A C     
913  O O     . ASP A 109 ? 0.3496 0.2692 0.2249 -0.0269 0.0047  0.0300  269 ASP A O     
914  C CB    . ASP A 109 ? 0.3270 0.2469 0.1698 -0.0026 -0.0156 0.0261  269 ASP A CB    
915  C CG    . ASP A 109 ? 0.4164 0.3256 0.2312 -0.0088 -0.0052 0.0368  269 ASP A CG    
916  O OD1   . ASP A 109 ? 0.3944 0.3202 0.2109 -0.0142 0.0037  0.0322  269 ASP A OD1   
917  O OD2   . ASP A 109 ? 0.4568 0.3401 0.2469 -0.0081 -0.0055 0.0499  269 ASP A OD2   
918  N N     . SER A 110 ? 0.2724 0.2283 0.1686 -0.0278 0.0100  0.0131  270 SER A N     
919  C CA    . SER A 110 ? 0.2691 0.2286 0.1768 -0.0388 0.0211  0.0151  270 SER A CA    
920  C C     . SER A 110 ? 0.2569 0.2378 0.1713 -0.0411 0.0290  0.0068  270 SER A C     
921  O O     . SER A 110 ? 0.2839 0.2758 0.2071 -0.0347 0.0244  -0.0036 270 SER A O     
922  C CB    . SER A 110 ? 0.3037 0.2632 0.2363 -0.0401 0.0181  0.0119  270 SER A CB    
923  O OG    . SER A 110 ? 0.3342 0.3007 0.2797 -0.0496 0.0272  0.0115  270 SER A OG    
924  N N     . PRO A 111 ? 0.2879 0.2748 0.1989 -0.0504 0.0411  0.0105  271 PRO A N     
925  C CA    . PRO A 111 ? 0.3326 0.3433 0.2521 -0.0508 0.0486  0.0008  271 PRO A CA    
926  C C     . PRO A 111 ? 0.2856 0.3076 0.2341 -0.0492 0.0465  -0.0091 271 PRO A C     
927  O O     . PRO A 111 ? 0.3086 0.3472 0.2649 -0.0446 0.0484  -0.0196 271 PRO A O     
928  C CB    . PRO A 111 ? 0.3748 0.3912 0.2860 -0.0629 0.0628  0.0082  271 PRO A CB    
929  C CG    . PRO A 111 ? 0.4233 0.4170 0.3317 -0.0713 0.0621  0.0201  271 PRO A CG    
930  C CD    . PRO A 111 ? 0.3854 0.3578 0.2833 -0.0611 0.0485  0.0233  271 PRO A CD    
931  N N     . CYS A 112 ? 0.2493 0.2616 0.2113 -0.0514 0.0422  -0.0062 272 CYS A N     
932  C CA    . CYS A 112 ? 0.2540 0.2751 0.2398 -0.0488 0.0399  -0.0143 272 CYS A CA    
933  C C     . CYS A 112 ? 0.2415 0.2605 0.2320 -0.0392 0.0311  -0.0213 272 CYS A C     
934  O O     . CYS A 112 ? 0.2363 0.2612 0.2416 -0.0355 0.0297  -0.0282 272 CYS A O     
935  C CB    . CYS A 112 ? 0.2260 0.2381 0.2228 -0.0534 0.0379  -0.0097 272 CYS A CB    
936  S SG    . CYS A 112 ? 0.3630 0.3742 0.3571 -0.0677 0.0476  -0.0023 272 CYS A SG    
937  N N     . LEU A 113 ? 0.2378 0.2477 0.2155 -0.0355 0.0249  -0.0194 273 LEU A N     
938  C CA    . LEU A 113 ? 0.2345 0.2441 0.2172 -0.0291 0.0174  -0.0272 273 LEU A CA    
939  C C     . LEU A 113 ? 0.2803 0.3000 0.2575 -0.0253 0.0197  -0.0365 273 LEU A C     
940  O O     . LEU A 113 ? 0.2671 0.2891 0.2266 -0.0238 0.0204  -0.0364 273 LEU A O     
941  C CB    . LEU A 113 ? 0.2649 0.2659 0.2384 -0.0262 0.0091  -0.0241 273 LEU A CB    
942  C CG    . LEU A 113 ? 0.3499 0.3502 0.3363 -0.0234 0.0011  -0.0298 273 LEU A CG    
943  C CD1   . LEU A 113 ? 0.3674 0.3637 0.3477 -0.0204 -0.0067 -0.0264 273 LEU A CD1   
944  C CD2   . LEU A 113 ? 0.3462 0.3514 0.3341 -0.0209 -0.0013 -0.0408 273 LEU A CD2   
945  N N     . LYS A 114 ? 0.2241 0.2486 0.2145 -0.0224 0.0202  -0.0447 274 LYS A N     
946  C CA    . LYS A 114 ? 0.2428 0.2782 0.2294 -0.0176 0.0235  -0.0546 274 LYS A CA    
947  C C     . LYS A 114 ? 0.2654 0.2946 0.2578 -0.0112 0.0167  -0.0657 274 LYS A C     
948  O O     . LYS A 114 ? 0.2499 0.2847 0.2359 -0.0055 0.0169  -0.0758 274 LYS A O     
949  C CB    . LYS A 114 ? 0.2462 0.2960 0.2418 -0.0185 0.0320  -0.0560 274 LYS A CB    
950  C CG    . LYS A 114 ? 0.3556 0.4146 0.3439 -0.0267 0.0413  -0.0477 274 LYS A CG    
951  C CD    . LYS A 114 ? 0.3628 0.4430 0.3629 -0.0277 0.0499  -0.0529 274 LYS A CD    
952  C CE    . LYS A 114 ? 0.3806 0.4672 0.3799 -0.0400 0.0589  -0.0435 274 LYS A CE    
953  N NZ    . LYS A 114 ? 0.3871 0.5004 0.4012 -0.0421 0.0677  -0.0504 274 LYS A NZ    
954  N N     . ASN A 115 ? 0.2161 0.2328 0.2199 -0.0123 0.0111  -0.0642 275 ASN A N     
955  C CA    . ASN A 115 ? 0.2297 0.2360 0.2387 -0.0084 0.0056  -0.0736 275 ASN A CA    
956  C C     . ASN A 115 ? 0.2234 0.2171 0.2391 -0.0132 -0.0009 -0.0713 275 ASN A C     
957  O O     . ASN A 115 ? 0.2171 0.2119 0.2353 -0.0179 -0.0013 -0.0627 275 ASN A O     
958  C CB    . ASN A 115 ? 0.2676 0.2725 0.2850 -0.0029 0.0079  -0.0769 275 ASN A CB    
959  C CG    . ASN A 115 ? 0.2708 0.2749 0.2980 -0.0058 0.0101  -0.0674 275 ASN A CG    
960  O OD1   . ASN A 115 ? 0.2334 0.2276 0.2649 -0.0104 0.0072  -0.0610 275 ASN A OD1   
961  N ND2   . ASN A 115 ? 0.2488 0.2660 0.2802 -0.0031 0.0152  -0.0675 275 ASN A ND2   
962  N N     . LYS A 116 ? 0.2330 0.1769 0.1886 -0.0150 -0.0130 -0.0188 276 LYS A N     
963  C CA    . LYS A 116 ? 0.2290 0.1720 0.1966 -0.0200 -0.0069 -0.0263 276 LYS A CA    
964  C C     . LYS A 116 ? 0.2533 0.1878 0.2212 -0.0143 -0.0045 -0.0177 276 LYS A C     
965  O O     . LYS A 116 ? 0.2499 0.1913 0.2267 -0.0174 -0.0063 -0.0220 276 LYS A O     
966  C CB    . LYS A 116 ? 0.2588 0.1865 0.2303 -0.0282 0.0121  -0.0373 276 LYS A CB    
967  C CG    . LYS A 116 ? 0.3150 0.2381 0.2981 -0.0396 0.0267  -0.0504 276 LYS A CG    
968  C CD    . LYS A 116 ? 0.3211 0.2247 0.3064 -0.0553 0.0534  -0.0684 276 LYS A CD    
969  C CE    . LYS A 116 ? 0.3521 0.2975 0.3521 -0.0713 0.0468  -0.0928 276 LYS A CE    
970  N NZ    . LYS A 116 ? 0.4208 0.3535 0.4255 -0.0901 0.0763  -0.1127 276 LYS A NZ    
971  N N     . LYS A 117 ? 0.2738 0.2016 0.2319 -0.0044 -0.0008 -0.0074 277 LYS A N     
972  C CA    . LYS A 117 ? 0.2785 0.2061 0.2364 0.0023  0.0015  -0.0005 277 LYS A CA    
973  C C     . LYS A 117 ? 0.2673 0.2068 0.2293 -0.0025 -0.0103 -0.0012 277 LYS A C     
974  O O     . LYS A 117 ? 0.2690 0.2071 0.2374 -0.0029 -0.0099 -0.0008 277 LYS A O     
975  C CB    . LYS A 117 ? 0.3051 0.2409 0.2504 0.0187  0.0070  0.0082  277 LYS A CB    
976  C CG    . LYS A 117 ? 0.3456 0.2925 0.2910 0.0266  0.0081  0.0133  277 LYS A CG    
977  C CD    . LYS A 117 ? 0.4179 0.3833 0.3477 0.0511  0.0163  0.0219  277 LYS A CD    
978  C CE    . LYS A 117 ? 0.4522 0.4370 0.3830 0.0590  0.0166  0.0250  277 LYS A CE    
979  N NZ    . LYS A 117 ? 0.4937 0.5146 0.4071 0.0892  0.0229  0.0323  277 LYS A NZ    
980  N N     . HIS A 118 ? 0.2306 0.1761 0.1855 -0.0059 -0.0167 -0.0022 278 HIS A N     
981  C CA    . HIS A 118 ? 0.2425 0.1841 0.1927 -0.0089 -0.0194 -0.0016 278 HIS A CA    
982  C C     . HIS A 118 ? 0.2456 0.1858 0.2010 -0.0049 -0.0236 -0.0019 278 HIS A C     
983  O O     . HIS A 118 ? 0.2411 0.1789 0.1985 -0.0021 -0.0232 0.0000  278 HIS A O     
984  C CB    . HIS A 118 ? 0.2406 0.1761 0.1761 -0.0133 -0.0183 -0.0028 278 HIS A CB    
985  C CG    . HIS A 118 ? 0.2433 0.1917 0.1745 -0.0208 -0.0128 -0.0089 278 HIS A CG    
986  N ND1   . HIS A 118 ? 0.2697 0.2186 0.1905 -0.0275 -0.0101 -0.0135 278 HIS A ND1   
987  C CD2   . HIS A 118 ? 0.2481 0.2196 0.1841 -0.0221 -0.0092 -0.0141 278 HIS A CD2   
988  C CE1   . HIS A 118 ? 0.2696 0.2448 0.1910 -0.0345 -0.0050 -0.0239 278 HIS A CE1   
989  N NE2   . HIS A 118 ? 0.2485 0.2419 0.1788 -0.0300 -0.0049 -0.0248 278 HIS A NE2   
990  N N     . TRP A 119 ? 0.2024 0.1523 0.1607 -0.0042 -0.0272 -0.0071 279 TRP A N     
991  C CA    . TRP A 119 ? 0.1811 0.1501 0.1448 0.0016  -0.0321 -0.0128 279 TRP A CA    
992  C C     . TRP A 119 ? 0.2167 0.1934 0.1971 -0.0029 -0.0288 -0.0196 279 TRP A C     
993  O O     . TRP A 119 ? 0.2233 0.2103 0.2049 0.0046  -0.0322 -0.0193 279 TRP A O     
994  C CB    . TRP A 119 ? 0.1888 0.1822 0.1562 0.0000  -0.0354 -0.0240 279 TRP A CB    
995  C CG    . TRP A 119 ? 0.2010 0.2340 0.1748 0.0083  -0.0411 -0.0347 279 TRP A CG    
996  C CD1   . TRP A 119 ? 0.1806 0.2480 0.1756 -0.0032 -0.0378 -0.0567 279 TRP A CD1   
997  C CD2   . TRP A 119 ? 0.2315 0.2781 0.1877 0.0321  -0.0476 -0.0260 279 TRP A CD2   
998  N NE1   . TRP A 119 ? 0.2129 0.3299 0.2088 0.0119  -0.0463 -0.0652 279 TRP A NE1   
999  C CE2   . TRP A 119 ? 0.2090 0.3120 0.1785 0.0382  -0.0529 -0.0434 279 TRP A CE2   
1000 C CE3   . TRP A 119 ? 0.2541 0.2687 0.1809 0.0497  -0.0449 -0.0062 279 TRP A CE3   
1001 C CZ2   . TRP A 119 ? 0.2074 0.3427 0.1602 0.0690  -0.0594 -0.0383 279 TRP A CZ2   
1002 C CZ3   . TRP A 119 ? 0.2792 0.3089 0.1852 0.0793  -0.0463 0.0016  279 TRP A CZ3   
1003 C CH2   . TRP A 119 ? 0.2801 0.3732 0.1984 0.0925  -0.0555 -0.0126 279 TRP A CH2   
1004 N N     . ASN A 120 ? 0.2124 0.1800 0.2018 -0.0133 -0.0188 -0.0250 280 ASN A N     
1005 C CA    . ASN A 120 ? 0.2075 0.1754 0.2096 -0.0205 -0.0092 -0.0333 280 ASN A CA    
1006 C C     . ASN A 120 ? 0.2254 0.1800 0.2253 -0.0146 -0.0087 -0.0215 280 ASN A C     
1007 O O     . ASN A 120 ? 0.2326 0.1918 0.2420 -0.0181 -0.0044 -0.0272 280 ASN A O     
1008 C CB    . ASN A 120 ? 0.2059 0.1536 0.2099 -0.0316 0.0106  -0.0412 280 ASN A CB    
1009 C CG    . ASN A 120 ? 0.2636 0.2332 0.2771 -0.0454 0.0152  -0.0632 280 ASN A CG    
1010 O OD1   . ASN A 120 ? 0.2577 0.2709 0.2819 -0.0472 0.0047  -0.0777 280 ASN A OD1   
1011 N ND2   . ASN A 120 ? 0.2659 0.2106 0.2741 -0.0527 0.0322  -0.0670 280 ASN A ND2   
1012 N N     . SER A 121 ? 0.2085 0.1529 0.1971 -0.0078 -0.0121 -0.0090 281 SER A N     
1013 C CA    . SER A 121 ? 0.2289 0.1707 0.2168 -0.0040 -0.0112 -0.0022 281 SER A CA    
1014 C C     . SER A 121 ? 0.2418 0.1892 0.2314 -0.0018 -0.0178 -0.0030 281 SER A C     
1015 O O     . SER A 121 ? 0.2639 0.2112 0.2576 -0.0011 -0.0160 -0.0013 281 SER A O     
1016 C CB    . SER A 121 ? 0.2319 0.1764 0.2095 -0.0009 -0.0107 0.0034  281 SER A CB    
1017 O OG    . SER A 121 ? 0.2718 0.2153 0.2414 -0.0046 -0.0149 0.0019  281 SER A OG    
1018 N N     . PHE A 122 ? 0.2001 0.1525 0.1833 0.0032  -0.0238 -0.0042 282 PHE A N     
1019 C CA    . PHE A 122 ? 0.1984 0.1525 0.1748 0.0145  -0.0265 -0.0014 282 PHE A CA    
1020 C C     . PHE A 122 ? 0.2243 0.2118 0.2100 0.0221  -0.0328 -0.0112 282 PHE A C     
1021 O O     . PHE A 122 ? 0.2469 0.2448 0.2269 0.0374  -0.0353 -0.0092 282 PHE A O     
1022 C CB    . PHE A 122 ? 0.2367 0.1700 0.1886 0.0231  -0.0231 0.0071  282 PHE A CB    
1023 C CG    . PHE A 122 ? 0.2620 0.1706 0.2054 0.0119  -0.0125 0.0093  282 PHE A CG    
1024 C CD1   . PHE A 122 ? 0.2706 0.1650 0.2105 0.0104  -0.0036 0.0099  282 PHE A CD1   
1025 C CD2   . PHE A 122 ? 0.2963 0.2040 0.2370 0.0012  -0.0101 0.0065  282 PHE A CD2   
1026 C CE1   . PHE A 122 ? 0.2668 0.1502 0.2018 -0.0050 0.0091  0.0040  282 PHE A CE1   
1027 C CE2   . PHE A 122 ? 0.2182 0.1202 0.1540 -0.0118 0.0007  0.0011  282 PHE A CE2   
1028 C CZ    . PHE A 122 ? 0.2630 0.1552 0.1968 -0.0167 0.0110  -0.0020 282 PHE A CZ    
1029 N N     . ASN A 123 ? 0.1734 0.1819 0.1726 0.0116  -0.0328 -0.0246 283 ASN A N     
1030 C CA    . ASN A 123 ? 0.1767 0.2343 0.1864 0.0153  -0.0376 -0.0423 283 ASN A CA    
1031 C C     . ASN A 123 ? 0.2476 0.3249 0.2808 -0.0071 -0.0277 -0.0654 283 ASN A C     
1032 O O     . ASN A 123 ? 0.2589 0.3833 0.3043 -0.0139 -0.0273 -0.0889 283 ASN A O     
1033 C CB    . ASN A 123 ? 0.1981 0.2771 0.1972 0.0253  -0.0439 -0.0442 283 ASN A CB    
1034 C CG    . ASN A 123 ? 0.2381 0.2994 0.2077 0.0522  -0.0476 -0.0235 283 ASN A CG    
1035 O OD1   . ASN A 123 ? 0.2290 0.3119 0.1878 0.0763  -0.0510 -0.0202 283 ASN A OD1   
1036 N ND2   . ASN A 123 ? 0.2324 0.2514 0.1859 0.0489  -0.0430 -0.0100 283 ASN A ND2   
1037 N N     . THR A 124 ? 0.2403 0.2831 0.2778 -0.0189 -0.0163 -0.0608 284 THR A N     
1038 C CA    . THR A 124 ? 0.2273 0.2738 0.2805 -0.0397 0.0010  -0.0806 284 THR A CA    
1039 C C     . THR A 124 ? 0.2630 0.2917 0.3172 -0.0372 0.0039  -0.0710 284 THR A C     
1040 O O     . THR A 124 ? 0.2417 0.2630 0.2872 -0.0209 -0.0083 -0.0532 284 THR A O     
1041 C CB    . THR A 124 ? 0.2591 0.2642 0.3070 -0.0540 0.0218  -0.0808 284 THR A CB    
1042 O OG1   . THR A 124 ? 0.2411 0.2038 0.2728 -0.0414 0.0225  -0.0543 284 THR A OG1   
1043 C CG2   . THR A 124 ? 0.2512 0.2701 0.2976 -0.0572 0.0191  -0.0892 284 THR A CG2   
1044 N N     . GLU A 125 ? 0.2601 0.2774 0.3226 -0.0547 0.0241  -0.0839 285 GLU A N     
1045 C CA    A GLU A 125 ? 0.2942 0.2936 0.3565 -0.0528 0.0294  -0.0750 285 GLU A CA    
1046 C CA    B GLU A 125 ? 0.2876 0.2883 0.3500 -0.0521 0.0284  -0.0747 285 GLU A CA    
1047 C C     . GLU A 125 ? 0.2932 0.2526 0.3377 -0.0380 0.0287  -0.0467 285 GLU A C     
1048 O O     . GLU A 125 ? 0.3246 0.2764 0.3670 -0.0317 0.0284  -0.0365 285 GLU A O     
1049 C CB    A GLU A 125 ? 0.3607 0.3475 0.4302 -0.0760 0.0584  -0.0950 285 GLU A CB    
1050 C CB    B GLU A 125 ? 0.3476 0.3439 0.4200 -0.0754 0.0547  -0.0970 285 GLU A CB    
1051 C CG    A GLU A 125 ? 0.3649 0.4092 0.4566 -0.0954 0.0615  -0.1320 285 GLU A CG    
1052 C CG    B GLU A 125 ? 0.4277 0.3710 0.4862 -0.0751 0.0770  -0.0818 285 GLU A CG    
1053 C CD    A GLU A 125 ? 0.3997 0.4619 0.4922 -0.1052 0.0713  -0.1482 285 GLU A CD    
1054 C CD    B GLU A 125 ? 0.4791 0.4306 0.5400 -0.0631 0.0644  -0.0694 285 GLU A CD    
1055 O OE1   A GLU A 125 ? 0.3966 0.4249 0.4768 -0.1015 0.0723  -0.1351 285 GLU A OE1   
1056 O OE1   B GLU A 125 ? 0.4945 0.4105 0.5413 -0.0561 0.0784  -0.0532 285 GLU A OE1   
1057 O OE2   A GLU A 125 ? 0.3792 0.4927 0.4848 -0.1163 0.0799  -0.1755 285 GLU A OE2   
1058 O OE2   B GLU A 125 ? 0.5268 0.5203 0.6006 -0.0574 0.0423  -0.0749 285 GLU A OE2   
1059 N N     . TYR A 126 ? 0.2400 0.1829 0.2722 -0.0323 0.0282  -0.0367 286 TYR A N     
1060 C CA    . TYR A 126 ? 0.2082 0.1339 0.2251 -0.0171 0.0251  -0.0155 286 TYR A CA    
1061 C C     . TYR A 126 ? 0.2408 0.1843 0.2596 -0.0094 0.0073  -0.0092 286 TYR A C     
1062 O O     . TYR A 126 ? 0.2433 0.1857 0.2555 -0.0021 0.0070  0.0007  286 TYR A O     
1063 C CB    . TYR A 126 ? 0.2492 0.1675 0.2556 -0.0131 0.0239  -0.0109 286 TYR A CB    
1064 C CG    . TYR A 126 ? 0.2553 0.1630 0.2446 0.0026  0.0285  0.0053  286 TYR A CG    
1065 C CD1   . TYR A 126 ? 0.3457 0.2251 0.3188 0.0119  0.0509  0.0128  286 TYR A CD1   
1066 C CD2   . TYR A 126 ? 0.2885 0.2173 0.2747 0.0095  0.0143  0.0110  286 TYR A CD2   
1067 C CE1   . TYR A 126 ? 0.3798 0.2620 0.3337 0.0347  0.0546  0.0281  286 TYR A CE1   
1068 C CE2   . TYR A 126 ? 0.3142 0.2533 0.2868 0.0246  0.0179  0.0199  286 TYR A CE2   
1069 C CZ    . TYR A 126 ? 0.3785 0.2993 0.3348 0.0407  0.0357  0.0297  286 TYR A CZ    
1070 O OH    . TYR A 126 ? 0.4565 0.3988 0.3956 0.0642  0.0389  0.0394  286 TYR A OH    
1071 N N     . PHE A 127 ? 0.2081 0.1698 0.2330 -0.0096 -0.0045 -0.0162 287 PHE A N     
1072 C CA    . PHE A 127 ? 0.1885 0.1534 0.2090 -0.0013 -0.0133 -0.0100 287 PHE A CA    
1073 C C     . PHE A 127 ? 0.1917 0.1671 0.2226 -0.0012 -0.0128 -0.0146 287 PHE A C     
1074 O O     . PHE A 127 ? 0.2203 0.2184 0.2602 -0.0005 -0.0160 -0.0257 287 PHE A O     
1075 C CB    . PHE A 127 ? 0.1865 0.1574 0.1979 0.0074  -0.0213 -0.0099 287 PHE A CB    
1076 C CG    . PHE A 127 ? 0.2184 0.1739 0.2153 0.0168  -0.0207 -0.0016 287 PHE A CG    
1077 C CD1   . PHE A 127 ? 0.2573 0.1920 0.2421 0.0115  -0.0143 0.0033  287 PHE A CD1   
1078 C CD2   . PHE A 127 ? 0.2419 0.2042 0.2352 0.0308  -0.0223 -0.0012 287 PHE A CD2   
1079 C CE1   . PHE A 127 ? 0.2888 0.2001 0.2574 0.0145  -0.0046 0.0066  287 PHE A CE1   
1080 C CE2   . PHE A 127 ? 0.2845 0.2188 0.2578 0.0408  -0.0138 0.0074  287 PHE A CE2   
1081 C CZ    . PHE A 127 ? 0.3000 0.2041 0.2607 0.0298  -0.0026 0.0103  287 PHE A CZ    
1082 N N     . LEU A 128 ? 0.2006 0.1682 0.2313 -0.0015 -0.0088 -0.0086 288 LEU A N     
1083 C CA    . LEU A 128 ? 0.2236 0.1997 0.2641 -0.0021 -0.0076 -0.0124 288 LEU A CA    
1084 C C     . LEU A 128 ? 0.1744 0.1516 0.2102 0.0068  -0.0131 -0.0106 288 LEU A C     
1085 O O     . LEU A 128 ? 0.2052 0.1679 0.2306 0.0073  -0.0100 -0.0053 288 LEU A O     
1086 C CB    . LEU A 128 ? 0.2321 0.2023 0.2717 -0.0037 0.0007  -0.0064 288 LEU A CB    
1087 C CG    . LEU A 128 ? 0.2845 0.2419 0.3166 -0.0030 0.0133  -0.0011 288 LEU A CG    
1088 C CD1   . LEU A 128 ? 0.2981 0.2598 0.3241 0.0053  0.0202  0.0073  288 LEU A CD1   
1089 C CD2   . LEU A 128 ? 0.2941 0.2410 0.3319 -0.0130 0.0257  -0.0110 288 LEU A CD2   
1090 N N     . GLU A 129 ? 0.1608 0.1565 0.2025 0.0142  -0.0176 -0.0173 289 GLU A N     
1091 C CA    . GLU A 129 ? 0.1830 0.1735 0.2133 0.0303  -0.0184 -0.0126 289 GLU A CA    
1092 C C     . GLU A 129 ? 0.1618 0.1359 0.1929 0.0244  -0.0112 -0.0096 289 GLU A C     
1093 O O     . GLU A 129 ? 0.1653 0.1500 0.2108 0.0140  -0.0102 -0.0136 289 GLU A O     
1094 C CB    . GLU A 129 ? 0.2679 0.2953 0.3045 0.0446  -0.0251 -0.0217 289 GLU A CB    
1095 C CG    . GLU A 129 ? 0.3705 0.4275 0.4023 0.0571  -0.0322 -0.0272 289 GLU A CG    
1096 C CD    . GLU A 129 ? 0.5146 0.5533 0.5158 0.0862  -0.0306 -0.0121 289 GLU A CD    
1097 O OE1   . GLU A 129 ? 0.5741 0.5730 0.5582 0.0946  -0.0205 0.0000  289 GLU A OE1   
1098 O OE2   . GLU A 129 ? 0.5278 0.5893 0.5193 0.1011  -0.0359 -0.0131 289 GLU A OE2   
1099 N N     . SER A 130 ? 0.1735 0.1198 0.1867 0.0301  -0.0022 -0.0041 290 SER A N     
1100 C CA    . SER A 130 ? 0.1765 0.1113 0.1911 0.0209  0.0082  -0.0068 290 SER A CA    
1101 C C     . SER A 130 ? 0.2128 0.1659 0.2410 0.0260  0.0042  -0.0103 290 SER A C     
1102 O O     . SER A 130 ? 0.1839 0.1487 0.2257 0.0139  0.0055  -0.0149 290 SER A O     
1103 C CB    . SER A 130 ? 0.2374 0.1307 0.2266 0.0247  0.0268  -0.0042 290 SER A CB    
1104 O OG    . SER A 130 ? 0.2920 0.1757 0.2833 0.0137  0.0406  -0.0117 290 SER A OG    
1105 N N     . GLN A 131 ? 0.2115 0.1744 0.2351 0.0462  -0.0006 -0.0091 291 GLN A N     
1106 C CA    . GLN A 131 ? 0.2217 0.2093 0.2586 0.0518  -0.0046 -0.0152 291 GLN A CA    
1107 C C     . GLN A 131 ? 0.1696 0.1868 0.2321 0.0328  -0.0110 -0.0250 291 GLN A C     
1108 O O     . GLN A 131 ? 0.1840 0.2102 0.2586 0.0260  -0.0091 -0.0296 291 GLN A O     
1109 C CB    . GLN A 131 ? 0.3146 0.3258 0.3419 0.0813  -0.0104 -0.0152 291 GLN A CB    
1110 C CG    . GLN A 131 ? 0.4721 0.4897 0.4972 0.0979  -0.0069 -0.0161 291 GLN A CG    
1111 C CD    . GLN A 131 ? 0.6029 0.5625 0.6046 0.1021  0.0131  -0.0055 291 GLN A CD    
1112 O OE1   . GLN A 131 ? 0.6118 0.5608 0.6249 0.0834  0.0197  -0.0106 291 GLN A OE1   
1113 N NE2   . GLN A 131 ? 0.6922 0.6126 0.6588 0.1260  0.0267  0.0075  291 GLN A NE2   
1114 N N     . ALA A 132 ? 0.1507 0.1770 0.2180 0.0245  -0.0144 -0.0280 292 ALA A N     
1115 C CA    . ALA A 132 ? 0.1418 0.1798 0.2248 0.0068  -0.0107 -0.0362 292 ALA A CA    
1116 C C     . ALA A 132 ? 0.1873 0.2060 0.2687 -0.0023 -0.0028 -0.0280 292 ALA A C     
1117 O O     . ALA A 132 ? 0.1855 0.2084 0.2747 -0.0096 0.0040  -0.0311 292 ALA A O     
1118 C CB    . ALA A 132 ? 0.1851 0.2279 0.2688 -0.0001 -0.0098 -0.0419 292 ALA A CB    
1119 N N     . VAL A 133 ? 0.1669 0.1700 0.2366 -0.0007 -0.0021 -0.0192 293 VAL A N     
1120 C CA    . VAL A 133 ? 0.1618 0.1655 0.2289 -0.0046 0.0039  -0.0145 293 VAL A CA    
1121 C C     . VAL A 133 ? 0.1623 0.1755 0.2360 -0.0060 0.0060  -0.0183 293 VAL A C     
1122 O O     . VAL A 133 ? 0.1545 0.1794 0.2317 -0.0072 0.0106  -0.0172 293 VAL A O     
1123 C CB    . VAL A 133 ? 0.1970 0.1972 0.2529 -0.0051 0.0047  -0.0119 293 VAL A CB    
1124 C CG1   . VAL A 133 ? 0.2037 0.2263 0.2589 -0.0073 0.0100  -0.0137 293 VAL A CG1   
1125 C CG2   . VAL A 133 ? 0.2088 0.2018 0.2580 -0.0031 0.0034  -0.0070 293 VAL A CG2   
1126 N N     . ILE A 134 ? 0.1388 0.1437 0.2105 -0.0031 0.0054  -0.0218 294 ILE A N     
1127 C CA    . ILE A 134 ? 0.1495 0.1586 0.2264 -0.0048 0.0101  -0.0269 294 ILE A CA    
1128 C C     . ILE A 134 ? 0.1534 0.1794 0.2442 -0.0042 0.0068  -0.0296 294 ILE A C     
1129 O O     . ILE A 134 ? 0.1528 0.1913 0.2503 -0.0092 0.0106  -0.0317 294 ILE A O     
1130 C CB    . ILE A 134 ? 0.1543 0.1386 0.2190 0.0039  0.0159  -0.0276 294 ILE A CB    
1131 C CG1   . ILE A 134 ? 0.1722 0.1330 0.2214 -0.0043 0.0288  -0.0296 294 ILE A CG1   
1132 C CG2   . ILE A 134 ? 0.1794 0.1652 0.2493 0.0056  0.0215  -0.0328 294 ILE A CG2   
1133 C CD1   . ILE A 134 ? 0.2206 0.1390 0.2462 0.0087  0.0419  -0.0254 294 ILE A CD1   
1134 N N     . GLU A 135 ? 0.1123 0.1444 0.2075 0.0006  0.0013  -0.0325 295 GLU A N     
1135 C CA    . GLU A 135 ? 0.1451 0.1971 0.2544 -0.0038 0.0018  -0.0411 295 GLU A CA    
1136 C C     . GLU A 135 ? 0.1565 0.2041 0.2670 -0.0149 0.0117  -0.0388 295 GLU A C     
1137 O O     . GLU A 135 ? 0.1782 0.2327 0.2953 -0.0201 0.0180  -0.0422 295 GLU A O     
1138 C CB    . GLU A 135 ? 0.1523 0.2268 0.2675 0.0013  -0.0041 -0.0522 295 GLU A CB    
1139 C CG    . GLU A 135 ? 0.1934 0.2765 0.3016 0.0232  -0.0108 -0.0517 295 GLU A CG    
1140 C CD    . GLU A 135 ? 0.3066 0.4253 0.4149 0.0373  -0.0187 -0.0613 295 GLU A CD    
1141 O OE1   . GLU A 135 ? 0.3200 0.4588 0.4386 0.0231  -0.0185 -0.0733 295 GLU A OE1   
1142 O OE2   . GLU A 135 ? 0.3609 0.4888 0.4562 0.0647  -0.0224 -0.0577 295 GLU A OE2   
1143 N N     . MET A 136 ? 0.1569 0.1895 0.2568 -0.0156 0.0156  -0.0314 296 MET A N     
1144 C CA    . MET A 136 ? 0.1825 0.2014 0.2731 -0.0175 0.0306  -0.0241 296 MET A CA    
1145 C C     . MET A 136 ? 0.1561 0.1848 0.2408 -0.0098 0.0331  -0.0152 296 MET A C     
1146 O O     . MET A 136 ? 0.1737 0.1990 0.2530 -0.0079 0.0458  -0.0111 296 MET A O     
1147 C CB    . MET A 136 ? 0.2153 0.2160 0.2921 -0.0143 0.0351  -0.0165 296 MET A CB    
1148 C CG    . MET A 136 ? 0.3212 0.2985 0.3790 -0.0083 0.0562  -0.0050 296 MET A CG    
1149 S SD    . MET A 136 ? 0.3475 0.2980 0.3873 -0.0031 0.0653  0.0028  296 MET A SD    
1150 C CE    . MET A 136 ? 0.5960 0.5431 0.6532 -0.0264 0.0670  -0.0199 296 MET A CE    
1151 N N     . VAL A 137 ? 0.1228 0.1662 0.2067 -0.0062 0.0243  -0.0146 297 VAL A N     
1152 C CA    . VAL A 137 ? 0.1059 0.1755 0.1880 -0.0018 0.0266  -0.0138 297 VAL A CA    
1153 C C     . VAL A 137 ? 0.1160 0.1948 0.2107 -0.0070 0.0272  -0.0207 297 VAL A C     
1154 O O     . VAL A 137 ? 0.1247 0.2203 0.2162 -0.0017 0.0337  -0.0173 297 VAL A O     
1155 C CB    . VAL A 137 ? 0.1230 0.2117 0.2048 -0.0052 0.0222  -0.0212 297 VAL A CB    
1156 C CG1   . VAL A 137 ? 0.1142 0.2447 0.1991 -0.0057 0.0259  -0.0291 297 VAL A CG1   
1157 C CG2   . VAL A 137 ? 0.1678 0.2569 0.2367 0.0015  0.0221  -0.0148 297 VAL A CG2   
1158 N N     . GLN A 138 ? 0.0960 0.1664 0.2022 -0.0133 0.0211  -0.0294 298 GLN A N     
1159 C CA    . GLN A 138 ? 0.1241 0.2048 0.2421 -0.0166 0.0214  -0.0368 298 GLN A CA    
1160 C C     . GLN A 138 ? 0.1580 0.2384 0.2783 -0.0188 0.0292  -0.0356 298 GLN A C     
1161 O O     . GLN A 138 ? 0.1536 0.2469 0.2763 -0.0191 0.0344  -0.0359 298 GLN A O     
1162 C CB    . GLN A 138 ? 0.1444 0.2174 0.2684 -0.0146 0.0151  -0.0441 298 GLN A CB    
1163 C CG    . GLN A 138 ? 0.1923 0.2763 0.3266 -0.0147 0.0159  -0.0520 298 GLN A CG    
1164 C CD    . GLN A 138 ? 0.2543 0.3258 0.3841 -0.0035 0.0143  -0.0550 298 GLN A CD    
1165 O OE1   . GLN A 138 ? 0.2678 0.3163 0.3844 -0.0008 0.0199  -0.0523 298 GLN A OE1   
1166 N NE2   . GLN A 138 ? 0.2390 0.3257 0.3764 0.0051  0.0099  -0.0609 298 GLN A NE2   
1167 N N     . GLU A 139 ? 0.1150 0.1798 0.2332 -0.0226 0.0339  -0.0366 299 GLU A N     
1168 C CA    . GLU A 139 ? 0.1232 0.1809 0.2431 -0.0318 0.0488  -0.0422 299 GLU A CA    
1169 C C     . GLU A 139 ? 0.2146 0.2477 0.3118 -0.0258 0.0699  -0.0272 299 GLU A C     
1170 O O     . GLU A 139 ? 0.2114 0.2361 0.3032 -0.0285 0.0866  -0.0267 299 GLU A O     
1171 C CB    . GLU A 139 ? 0.1597 0.2177 0.2885 -0.0436 0.0506  -0.0579 299 GLU A CB    
1172 C CG    . GLU A 139 ? 0.1889 0.2811 0.3361 -0.0421 0.0339  -0.0734 299 GLU A CG    
1173 C CD    . GLU A 139 ? 0.2695 0.3846 0.4275 -0.0524 0.0356  -0.0950 299 GLU A CD    
1174 O OE1   . GLU A 139 ? 0.1937 0.3484 0.3638 -0.0447 0.0226  -0.1083 299 GLU A OE1   
1175 O OE2   . GLU A 139 ? 0.3083 0.4057 0.4611 -0.0667 0.0521  -0.1002 299 GLU A OE2   
1176 N N     . ALA A 140 ? 0.2145 0.2345 0.2947 -0.0144 0.0717  -0.0141 300 ALA A N     
1177 C CA    . ALA A 140 ? 0.2355 0.2276 0.2858 0.0002  0.0952  0.0035  300 ALA A CA    
1178 C C     . ALA A 140 ? 0.2340 0.2544 0.2688 0.0253  0.0900  0.0192  300 ALA A C     
1179 O O     . ALA A 140 ? 0.2935 0.3019 0.2986 0.0478  0.1095  0.0371  300 ALA A O     
1180 C CB    . ALA A 140 ? 0.2766 0.2328 0.3140 -0.0025 0.1079  0.0057  300 ALA A CB    
1181 N N     . GLY A 141 ? 0.2335 0.2196 0.3390 -0.1119 0.0899  -0.0330 301 GLY A N     
1182 C CA    . GLY A 141 ? 0.2258 0.2091 0.3390 -0.1026 0.0950  -0.0344 301 GLY A CA    
1183 C C     . GLY A 141 ? 0.2325 0.2072 0.3287 -0.0748 0.0813  -0.0338 301 GLY A C     
1184 O O     . GLY A 141 ? 0.2324 0.2134 0.3181 -0.0455 0.0696  -0.0340 301 GLY A O     
1185 N N     . ARG A 142 ? 0.2397 0.2043 0.3304 -0.0798 0.0794  -0.0343 302 ARG A N     
1186 C CA    . ARG A 142 ? 0.2498 0.2056 0.3192 -0.0503 0.0639  -0.0337 302 ARG A CA    
1187 C C     . ARG A 142 ? 0.2347 0.2010 0.3224 -0.0637 0.0620  -0.0350 302 ARG A C     
1188 O O     . ARG A 142 ? 0.2696 0.2321 0.3668 -0.0948 0.0750  -0.0372 302 ARG A O     
1189 C CB    . ARG A 142 ? 0.4623 0.3381 0.4444 -0.0283 0.0681  -0.0305 302 ARG A CB    
1190 C CG    . ARG A 142 ? 0.5975 0.4016 0.5248 -0.0510 0.0887  -0.0290 302 ARG A CG    
1191 C CD    . ARG A 142 ? 0.7852 0.5002 0.6166 -0.0258 0.0957  -0.0245 302 ARG A CD    
1192 N NE    . ARG A 142 ? 0.8662 0.5885 0.6800 0.0199  0.0735  -0.0240 302 ARG A NE    
1193 C CZ    . ARG A 142 ? 1.0144 0.6775 0.7610 0.0458  0.0714  -0.0216 302 ARG A CZ    
1194 N NH1   . ARG A 142 ? 1.0813 0.6666 0.7681 0.0287  0.0924  -0.0184 302 ARG A NH1   
1195 N NH2   . ARG A 142 ? 1.0520 0.7344 0.7906 0.0888  0.0496  -0.0241 302 ARG A NH2   
1196 N N     . VAL A 143 ? 0.2201 0.2016 0.3124 -0.0403 0.0460  -0.0357 303 VAL A N     
1197 C CA    . VAL A 143 ? 0.2155 0.2059 0.3221 -0.0492 0.0426  -0.0368 303 VAL A CA    
1198 C C     . VAL A 143 ? 0.2982 0.2177 0.3344 -0.0396 0.0465  -0.0352 303 VAL A C     
1199 O O     . VAL A 143 ? 0.3277 0.2213 0.3241 -0.0072 0.0375  -0.0342 303 VAL A O     
1200 C CB    . VAL A 143 ? 0.1873 0.2353 0.3414 -0.0314 0.0250  -0.0393 303 VAL A CB    
1201 C CG1   . VAL A 143 ? 0.2108 0.2618 0.3731 -0.0397 0.0220  -0.0399 303 VAL A CG1   
1202 C CG2   . VAL A 143 ? 0.1583 0.2636 0.3653 -0.0378 0.0227  -0.0387 303 VAL A CG2   
1203 N N     . THR A 144 ? 0.3064 0.1961 0.3265 -0.0673 0.0605  -0.0366 304 THR A N     
1204 C CA    . THR A 144 ? 0.4081 0.2280 0.3616 -0.0616 0.0671  -0.0356 304 THR A CA    
1205 C C     . THR A 144 ? 0.3983 0.2427 0.3805 -0.0761 0.0631  -0.0394 304 THR A C     
1206 O O     . THR A 144 ? 0.3953 0.2920 0.4336 -0.1015 0.0642  -0.0439 304 THR A O     
1207 C CB    . THR A 144 ? 0.5441 0.2900 0.4373 -0.0844 0.0933  -0.0364 304 THR A CB    
1208 O OG1   . THR A 144 ? 0.5251 0.3053 0.4633 -0.1257 0.1061  -0.0437 304 THR A OG1   
1209 C CG2   . THR A 144 ? 0.5680 0.2782 0.4199 -0.0655 0.0974  -0.0315 304 THR A CG2   
1210 N N     . VAL A 145 ? 0.4140 0.2222 0.3568 -0.0576 0.0580  -0.0380 305 VAL A N     
1211 C CA    . VAL A 145 ? 0.4035 0.2291 0.3673 -0.0710 0.0550  -0.0418 305 VAL A CA    
1212 C C     . VAL A 145 ? 0.4742 0.2199 0.3682 -0.0819 0.0725  -0.0434 305 VAL A C     
1213 O O     . VAL A 145 ? 0.5349 0.2087 0.3573 -0.0629 0.0801  -0.0390 305 VAL A O     
1214 C CB    . VAL A 145 ? 0.5081 0.3768 0.5026 -0.0423 0.0324  -0.0407 305 VAL A CB    
1215 C CG1   . VAL A 145 ? 0.4283 0.3677 0.4847 -0.0324 0.0197  -0.0407 305 VAL A CG1   
1216 C CG2   . VAL A 145 ? 0.5493 0.3664 0.4829 -0.0067 0.0264  -0.0382 305 VAL A CG2   
1217 N N     . ARG A 146 ? 0.4929 0.2488 0.4041 -0.1121 0.0802  -0.0506 306 ARG A N     
1218 C CA    . ARG A 146 ? 0.6410 0.3230 0.4885 -0.1287 0.1007  -0.0548 306 ARG A CA    
1219 C C     . ARG A 146 ? 0.6227 0.2633 0.4263 -0.0988 0.0918  -0.0499 306 ARG A C     
1220 O O     . ARG A 146 ? 0.5507 0.2375 0.3885 -0.0715 0.0686  -0.0461 306 ARG A O     
1221 C CB    . ARG A 146 ? 0.7545 0.4939 0.6446 -0.1562 0.1039  -0.0628 306 ARG A CB    
1222 C CG    . ARG A 146 ? 0.8467 0.6301 0.7674 -0.1727 0.1107  -0.0675 306 ARG A CG    
1223 C CD    . ARG A 146 ? 0.9144 0.7371 0.8581 -0.1901 0.1134  -0.0777 306 ARG A CD    
1224 N NE    . ARG A 146 ? 0.9275 0.7983 0.9048 -0.1991 0.1143  -0.0838 306 ARG A NE    
1225 C CZ    . ARG A 146 ? 0.9025 0.8349 0.9335 -0.1875 0.0956  -0.0786 306 ARG A CZ    
1226 N NH1   . ARG A 146 ? 0.8723 0.8305 0.9324 -0.1688 0.0763  -0.0681 306 ARG A NH1   
1227 N NH2   . ARG A 146 ? 0.9051 0.8686 0.9552 -0.1933 0.0974  -0.0840 306 ARG A NH2   
1228 N N     . ASP A 147 ? 0.6360 0.2011 0.3673 -0.1013 0.1099  -0.0492 307 ASP A N     
1229 C CA    . ASP A 147 ? 0.7596 0.2828 0.4470 -0.0767 0.1043  -0.0457 307 ASP A CA    
1230 C C     . ASP A 147 ? 0.6884 0.2602 0.4270 -0.0938 0.0951  -0.0532 307 ASP A C     
1231 O O     . ASP A 147 ? 0.6904 0.3236 0.4871 -0.1250 0.0967  -0.0604 307 ASP A O     
1232 C CB    . ASP A 147 ? 0.9039 0.3566 0.5124 -0.0796 0.1275  -0.0419 307 ASP A CB    
1233 C CG    . ASP A 147 ? 1.0557 0.4536 0.6012 -0.0583 0.1369  -0.0332 307 ASP A CG    
1234 O OD1   . ASP A 147 ? 1.0397 0.4521 0.5984 -0.0324 0.1210  -0.0293 307 ASP A OD1   
1235 O OD2   . ASP A 147 ? 1.1711 0.5118 0.6515 -0.0666 0.1609  -0.0312 307 ASP A OD2   
1236 N N     . GLY A 148 ? 0.6550 0.2111 0.3748 -0.0682 0.0832  -0.0506 308 GLY A N     
1237 C CA    . GLY A 148 ? 0.6166 0.2125 0.3752 -0.0821 0.0756  -0.0565 308 GLY A CA    
1238 C C     . GLY A 148 ? 0.5202 0.2100 0.3596 -0.0700 0.0496  -0.0555 308 GLY A C     
1239 O O     . GLY A 148 ? 0.5055 0.2320 0.3794 -0.0810 0.0429  -0.0600 308 GLY A O     
1240 N N     . MET A 149 ? 0.4609 0.1872 0.3281 -0.0481 0.0368  -0.0505 309 MET A N     
1241 C CA    . MET A 149 ? 0.4172 0.2252 0.3554 -0.0369 0.0160  -0.0505 309 MET A CA    
1242 C C     . MET A 149 ? 0.3952 0.2092 0.3325 -0.0135 0.0023  -0.0509 309 MET A C     
1243 O O     . MET A 149 ? 0.3448 0.2089 0.3299 -0.0217 -0.0062 -0.0536 309 MET A O     
1244 C CB    . MET A 149 ? 0.3883 0.2306 0.3525 -0.0181 0.0072  -0.0473 309 MET A CB    
1245 C CG    . MET A 149 ? 0.4136 0.2745 0.4020 -0.0430 0.0173  -0.0475 309 MET A CG    
1246 S SD    . MET A 149 ? 0.4420 0.3705 0.4999 -0.0786 0.0180  -0.0531 309 MET A SD    
1247 C CE    . MET A 149 ? 0.5270 0.4021 0.5423 -0.1162 0.0420  -0.0607 309 MET A CE    
1248 N N     . PRO A 150 ? 0.4542 0.2165 0.3350 0.0172  0.0002  -0.0488 310 PRO A N     
1249 C CA    . PRO A 150 ? 0.4606 0.2349 0.3456 0.0384  -0.0128 -0.0512 310 PRO A CA    
1250 C C     . PRO A 150 ? 0.5008 0.2654 0.3856 0.0145  -0.0070 -0.0538 310 PRO A C     
1251 O O     . PRO A 150 ? 0.4860 0.2908 0.4061 0.0196  -0.0186 -0.0565 310 PRO A O     
1252 C CB    . PRO A 150 ? 0.5622 0.2740 0.3760 0.0752  -0.0133 -0.0494 310 PRO A CB    
1253 C CG    . PRO A 150 ? 0.5733 0.2738 0.3715 0.0834  -0.0097 -0.0463 310 PRO A CG    
1254 C CD    . PRO A 150 ? 0.5425 0.2436 0.3586 0.0401  0.0064  -0.0449 310 PRO A CD    
1255 N N     . GLU A 151 ? 0.4922 0.2051 0.3380 -0.0125 0.0120  -0.0548 311 GLU A N     
1256 C CA    . GLU A 151 ? 0.4804 0.1858 0.3253 -0.0379 0.0189  -0.0602 311 GLU A CA    
1257 C C     . GLU A 151 ? 0.4052 0.1905 0.3250 -0.0602 0.0104  -0.0646 311 GLU A C     
1258 O O     . GLU A 151 ? 0.4081 0.2097 0.3421 -0.0682 0.0064  -0.0687 311 GLU A O     
1259 C CB    . GLU A 151 ? 0.6668 0.3027 0.4558 -0.0669 0.0449  -0.0642 311 GLU A CB    
1260 C CG    . GLU A 151 ? 0.7898 0.3312 0.4901 -0.0449 0.0568  -0.0596 311 GLU A CG    
1261 C CD    . GLU A 151 ? 0.8889 0.4065 0.5591 -0.0109 0.0526  -0.0516 311 GLU A CD    
1262 O OE1   . GLU A 151 ? 1.0033 0.4903 0.6290 0.0258  0.0471  -0.0445 311 GLU A OE1   
1263 O OE2   . GLU A 151 ? 0.8295 0.3764 0.5285 -0.0202 0.0531  -0.0509 311 GLU A OE2   
1264 N N     . LEU A 152 ? 0.3607 0.1928 0.3241 -0.0685 0.0080  -0.0639 312 LEU A N     
1265 C CA    . LEU A 152 ? 0.3033 0.2092 0.3330 -0.0838 -0.0002 -0.0672 312 LEU A CA    
1266 C C     . LEU A 152 ? 0.2580 0.2039 0.3204 -0.0619 -0.0174 -0.0648 312 LEU A C     
1267 O O     . LEU A 152 ? 0.2389 0.2257 0.3362 -0.0721 -0.0227 -0.0678 312 LEU A O     
1268 C CB    . LEU A 152 ? 0.2712 0.2158 0.3375 -0.0895 -0.0001 -0.0655 312 LEU A CB    
1269 C CG    . LEU A 152 ? 0.3093 0.2350 0.3617 -0.1193 0.0175  -0.0711 312 LEU A CG    
1270 C CD1   . LEU A 152 ? 0.2888 0.2611 0.3834 -0.1206 0.0149  -0.0684 312 LEU A CD1   
1271 C CD2   . LEU A 152 ? 0.3428 0.2839 0.3991 -0.1407 0.0227  -0.0766 312 LEU A CD2   
1272 N N     . LEU A 153 ? 0.2527 0.1866 0.3014 -0.0311 -0.0251 -0.0611 313 LEU A N     
1273 C CA    . LEU A 153 ? 0.2700 0.2406 0.3485 -0.0114 -0.0384 -0.0617 313 LEU A CA    
1274 C C     . LEU A 153 ? 0.3022 0.2554 0.3640 -0.0126 -0.0400 -0.0645 313 LEU A C     
1275 O O     . LEU A 153 ? 0.3107 0.2956 0.3995 -0.0030 -0.0487 -0.0661 313 LEU A O     
1276 C CB    . LEU A 153 ? 0.2411 0.2088 0.3102 0.0211  -0.0455 -0.0618 313 LEU A CB    
1277 C CG    . LEU A 153 ? 0.2417 0.2338 0.3325 0.0244  -0.0453 -0.0602 313 LEU A CG    
1278 C CD1   . LEU A 153 ? 0.2734 0.2623 0.3489 0.0579  -0.0528 -0.0639 313 LEU A CD1   
1279 C CD2   . LEU A 153 ? 0.2050 0.2593 0.3574 0.0126  -0.0480 -0.0603 313 LEU A CD2   
1280 N N     . LYS A 154 ? 0.2942 0.1949 0.3099 -0.0263 -0.0293 -0.0660 314 LYS A N     
1281 C CA    A LYS A 154 ? 0.3341 0.2105 0.3270 -0.0282 -0.0289 -0.0692 314 LYS A CA    
1282 C CA    B LYS A 154 ? 0.3336 0.2105 0.3269 -0.0281 -0.0290 -0.0691 314 LYS A CA    
1283 C C     . LYS A 154 ? 0.3227 0.2184 0.3335 -0.0611 -0.0237 -0.0748 314 LYS A C     
1284 O O     . LYS A 154 ? 0.3839 0.2608 0.3764 -0.0683 -0.0216 -0.0790 314 LYS A O     
1285 C CB    A LYS A 154 ? 0.4239 0.2219 0.3455 -0.0189 -0.0186 -0.0685 314 LYS A CB    
1286 C CB    B LYS A 154 ? 0.4313 0.2300 0.3534 -0.0178 -0.0191 -0.0684 314 LYS A CB    
1287 C CG    A LYS A 154 ? 0.4954 0.2722 0.3908 0.0182  -0.0247 -0.0647 314 LYS A CG    
1288 C CG    B LYS A 154 ? 0.4956 0.2741 0.3928 0.0172  -0.0242 -0.0644 314 LYS A CG    
1289 C CD    A LYS A 154 ? 0.5600 0.3242 0.4367 0.0467  -0.0337 -0.0668 314 LYS A CD    
1290 C CD    B LYS A 154 ? 0.5189 0.3084 0.4175 0.0497  -0.0378 -0.0666 314 LYS A CD    
1291 C CE    A LYS A 154 ? 0.6283 0.3598 0.4626 0.0854  -0.0378 -0.0658 314 LYS A CE    
1292 C CE    B LYS A 154 ? 0.6298 0.3475 0.4557 0.0751  -0.0335 -0.0659 314 LYS A CE    
1293 N NZ    A LYS A 154 ? 0.7231 0.3697 0.4809 0.0858  -0.0217 -0.0614 314 LYS A NZ    
1294 N NZ    B LYS A 154 ? 0.6695 0.3758 0.4716 0.1092  -0.0389 -0.0648 314 LYS A NZ    
1295 N N     . LEU A 155 ? 0.3386 0.2698 0.2436 -0.0833 0.0610  -0.0530 315 LEU A N     
1296 C CA    . LEU A 155 ? 0.3287 0.2737 0.2665 -0.0978 0.0514  -0.0515 315 LEU A CA    
1297 C C     . LEU A 155 ? 0.3224 0.2622 0.2536 -0.0987 0.0323  -0.0623 315 LEU A C     
1298 O O     . LEU A 155 ? 0.3118 0.2500 0.2245 -0.0881 0.0302  -0.0670 315 LEU A O     
1299 C CB    . LEU A 155 ? 0.3179 0.2990 0.2867 -0.0936 0.0601  -0.0452 315 LEU A CB    
1300 C CG    . LEU A 155 ? 0.3454 0.3445 0.3319 -0.0942 0.0808  -0.0287 315 LEU A CG    
1301 C CD1   . LEU A 155 ? 0.3509 0.3888 0.3567 -0.0789 0.0901  -0.0260 315 LEU A CD1   
1302 C CD2   . LEU A 155 ? 0.3460 0.3459 0.3666 -0.1186 0.0776  -0.0171 315 LEU A CD2   
1303 N N     . PRO A 156 ? 0.3488 0.2862 0.2960 -0.1111 0.0174  -0.0649 316 PRO A N     
1304 C CA    . PRO A 156 ? 0.3625 0.2974 0.2997 -0.1078 -0.0010 -0.0742 316 PRO A CA    
1305 C C     . PRO A 156 ? 0.3574 0.3162 0.3051 -0.0992 -0.0007 -0.0729 316 PRO A C     
1306 O O     . PRO A 156 ? 0.3180 0.2990 0.2916 -0.0984 0.0075  -0.0681 316 PRO A O     
1307 C CB    . PRO A 156 ? 0.4199 0.3534 0.3823 -0.1223 -0.0186 -0.0775 316 PRO A CB    
1308 C CG    . PRO A 156 ? 0.4489 0.3654 0.4199 -0.1349 -0.0117 -0.0708 316 PRO A CG    
1309 C CD    . PRO A 156 ? 0.4045 0.3370 0.3778 -0.1286 0.0145  -0.0588 316 PRO A CD    
1310 N N     . LEU A 157 ? 0.3250 0.2787 0.2513 -0.0907 -0.0089 -0.0756 317 LEU A N     
1311 C CA    . LEU A 157 ? 0.3742 0.3416 0.3075 -0.0829 -0.0104 -0.0721 317 LEU A CA    
1312 C C     . LEU A 157 ? 0.3543 0.3390 0.3126 -0.0842 -0.0231 -0.0737 317 LEU A C     
1313 O O     . LEU A 157 ? 0.3636 0.3451 0.3175 -0.0862 -0.0383 -0.0784 317 LEU A O     
1314 C CB    . LEU A 157 ? 0.3939 0.3525 0.3003 -0.0753 -0.0135 -0.0684 317 LEU A CB    
1315 C CG    . LEU A 157 ? 0.3537 0.3031 0.2405 -0.0722 -0.0024 -0.0657 317 LEU A CG    
1316 C CD1   . LEU A 157 ? 0.3426 0.2937 0.2097 -0.0650 -0.0043 -0.0576 317 LEU A CD1   
1317 C CD2   . LEU A 157 ? 0.3372 0.2895 0.2367 -0.0709 0.0059  -0.0641 317 LEU A CD2   
1318 N N     . ARG A 158 ? 0.3107 0.3136 0.2925 -0.0796 -0.0187 -0.0714 318 ARG A N     
1319 C CA    A ARG A 158 ? 0.3075 0.3325 0.3165 -0.0775 -0.0302 -0.0727 318 ARG A CA    
1320 C CA    B ARG A 158 ? 0.3076 0.3332 0.3175 -0.0777 -0.0297 -0.0726 318 ARG A CA    
1321 C C     . ARG A 158 ? 0.2931 0.3215 0.3030 -0.0628 -0.0323 -0.0708 318 ARG A C     
1322 O O     . ARG A 158 ? 0.2884 0.3124 0.2947 -0.0551 -0.0224 -0.0702 318 ARG A O     
1323 C CB    A ARG A 158 ? 0.3110 0.3632 0.3587 -0.0857 -0.0238 -0.0710 318 ARG A CB    
1324 C CB    B ARG A 158 ? 0.2906 0.3430 0.3377 -0.0848 -0.0208 -0.0703 318 ARG A CB    
1325 C CG    A ARG A 158 ? 0.3530 0.3993 0.4105 -0.1036 -0.0315 -0.0727 318 ARG A CG    
1326 C CG    B ARG A 158 ? 0.2993 0.3856 0.3850 -0.0827 -0.0310 -0.0705 318 ARG A CG    
1327 C CD    A ARG A 158 ? 0.4217 0.5027 0.5317 -0.1151 -0.0287 -0.0662 318 ARG A CD    
1328 C CD    B ARG A 158 ? 0.3455 0.4644 0.4752 -0.0942 -0.0203 -0.0630 318 ARG A CD    
1329 N NE    A ARG A 158 ? 0.4721 0.5407 0.5969 -0.1359 -0.0401 -0.0670 318 ARG A NE    
1330 N NE    B ARG A 158 ? 0.4076 0.5071 0.5365 -0.1146 -0.0219 -0.0615 318 ARG A NE    
1331 C CZ    A ARG A 158 ? 0.4957 0.5606 0.6322 -0.1438 -0.0679 -0.0766 318 ARG A CZ    
1332 C CZ    B ARG A 158 ? 0.4622 0.5568 0.6071 -0.1297 -0.0438 -0.0669 318 ARG A CZ    
1333 N NH1   A ARG A 158 ? 0.5022 0.5784 0.6353 -0.1313 -0.0844 -0.0843 318 ARG A NH1   
1334 N NH1   B ARG A 158 ? 0.4864 0.5990 0.6498 -0.1263 -0.0652 -0.0736 318 ARG A NH1   
1335 N NH2   A ARG A 158 ? 0.5193 0.5654 0.6689 -0.1628 -0.0819 -0.0791 318 ARG A NH2   
1336 N NH2   B ARG A 158 ? 0.4842 0.5524 0.6242 -0.1461 -0.0475 -0.0670 318 ARG A NH2   
1337 N N     . CYS A 159 ? 0.3030 0.3348 0.3145 -0.0570 -0.0482 -0.0707 319 CYS A N     
1338 C CA    . CYS A 159 ? 0.3092 0.3376 0.3207 -0.0423 -0.0542 -0.0682 319 CYS A CA    
1339 C C     . CYS A 159 ? 0.3040 0.3556 0.3419 -0.0317 -0.0476 -0.0722 319 CYS A C     
1340 O O     . CYS A 159 ? 0.2979 0.3811 0.3648 -0.0354 -0.0438 -0.0737 319 CYS A O     
1341 C CB    . CYS A 159 ? 0.3261 0.3557 0.3338 -0.0358 -0.0729 -0.0663 319 CYS A CB    
1342 S SG    . CYS A 159 ? 0.3432 0.3595 0.3482 -0.0169 -0.0829 -0.0609 319 CYS A SG    
1343 N N     . HIS A 160 ? 0.3112 0.3476 0.3399 -0.0175 -0.0470 -0.0733 320 HIS A N     
1344 C CA    . HIS A 160 ? 0.3145 0.3708 0.3585 0.0006  -0.0403 -0.0789 320 HIS A CA    
1345 C C     . HIS A 160 ? 0.3267 0.4018 0.3886 0.0172  -0.0533 -0.0810 320 HIS A C     
1346 O O     . HIS A 160 ? 0.3307 0.4356 0.4111 0.0351  -0.0472 -0.0848 320 HIS A O     
1347 C CB    . HIS A 160 ? 0.3516 0.3776 0.3733 0.0134  -0.0398 -0.0840 320 HIS A CB    
1348 C CG    . HIS A 160 ? 0.3655 0.3551 0.3738 0.0191  -0.0593 -0.0827 320 HIS A CG    
1349 N ND1   . HIS A 160 ? 0.3485 0.3206 0.3487 0.0039  -0.0675 -0.0718 320 HIS A ND1   
1350 C CD2   . HIS A 160 ? 0.4009 0.3660 0.4019 0.0392  -0.0727 -0.0893 320 HIS A CD2   
1351 C CE1   . HIS A 160 ? 0.3734 0.3137 0.3661 0.0112  -0.0832 -0.0678 320 HIS A CE1   
1352 N NE2   . HIS A 160 ? 0.4044 0.3361 0.3980 0.0316  -0.0889 -0.0797 320 HIS A NE2   
1353 N N     . GLU A 161 ? 0.3365 0.3965 0.3908 0.0146  -0.0704 -0.0773 321 GLU A N     
1354 C CA    . GLU A 161 ? 0.3785 0.4526 0.4459 0.0326  -0.0857 -0.0791 321 GLU A CA    
1355 C C     . GLU A 161 ? 0.3781 0.4941 0.4759 0.0255  -0.0913 -0.0796 321 GLU A C     
1356 O O     . GLU A 161 ? 0.3709 0.5250 0.4991 0.0401  -0.0944 -0.0830 321 GLU A O     
1357 C CB    . GLU A 161 ? 0.4123 0.4443 0.4531 0.0384  -0.1032 -0.0727 321 GLU A CB    
1358 C CG    . GLU A 161 ? 0.4916 0.4800 0.5121 0.0444  -0.1046 -0.0719 321 GLU A CG    
1359 C CD    . GLU A 161 ? 0.5906 0.5778 0.6158 0.0725  -0.1097 -0.0835 321 GLU A CD    
1360 O OE1   . GLU A 161 ? 0.6307 0.6582 0.6768 0.0889  -0.1079 -0.0900 321 GLU A OE1   
1361 O OE2   . GLU A 161 ? 0.6527 0.5989 0.6614 0.0799  -0.1172 -0.0867 321 GLU A OE2   
1362 N N     . CYS A 162 ? 0.3378 0.4480 0.4288 0.0051  -0.0947 -0.0774 322 CYS A N     
1363 C CA    . CYS A 162 ? 0.3382 0.4800 0.4565 -0.0025 -0.1080 -0.0808 322 CYS A CA    
1364 C C     . CYS A 162 ? 0.3240 0.4774 0.4594 -0.0269 -0.0998 -0.0817 322 CYS A C     
1365 O O     . CYS A 162 ? 0.3289 0.5024 0.4893 -0.0374 -0.1147 -0.0858 322 CYS A O     
1366 C CB    . CYS A 162 ? 0.3610 0.4804 0.4507 0.0020  -0.1300 -0.0802 322 CYS A CB    
1367 S SG    . CYS A 162 ? 0.3795 0.4582 0.4220 -0.0126 -0.1263 -0.0760 322 CYS A SG    
1368 N N     . GLN A 163 ? 0.3119 0.4485 0.4329 -0.0352 -0.0796 -0.0784 323 GLN A N     
1369 C CA    . GLN A 163 ? 0.3737 0.5149 0.5079 -0.0566 -0.0696 -0.0771 323 GLN A CA    
1370 C C     . GLN A 163 ? 0.3753 0.4910 0.4889 -0.0709 -0.0849 -0.0821 323 GLN A C     
1371 O O     . GLN A 163 ? 0.3373 0.4537 0.4661 -0.0888 -0.0842 -0.0829 323 GLN A O     
1372 C CB    . GLN A 163 ? 0.3977 0.5895 0.5896 -0.0635 -0.0635 -0.0727 323 GLN A CB    
1373 C CG    . GLN A 163 ? 0.4273 0.6452 0.6320 -0.0476 -0.0396 -0.0661 323 GLN A CG    
1374 C CD    . GLN A 163 ? 0.4818 0.7126 0.6860 -0.0195 -0.0466 -0.0705 323 GLN A CD    
1375 O OE1   . GLN A 163 ? 0.5063 0.7647 0.7384 -0.0145 -0.0633 -0.0728 323 GLN A OE1   
1376 N NE2   . GLN A 163 ? 0.5077 0.7153 0.6795 0.0003  -0.0373 -0.0730 323 GLN A NE2   
1377 N N     . GLN A 164 ? 0.3304 0.4214 0.4070 -0.0610 -0.0987 -0.0846 324 GLN A N     
1378 C CA    . GLN A 164 ? 0.3500 0.4165 0.3966 -0.0664 -0.1125 -0.0905 324 GLN A CA    
1379 C C     . GLN A 164 ? 0.3452 0.3850 0.3640 -0.0745 -0.0961 -0.0885 324 GLN A C     
1380 O O     . GLN A 164 ? 0.3314 0.3616 0.3353 -0.0705 -0.0780 -0.0811 324 GLN A O     
1381 C CB    . GLN A 164 ? 0.4863 0.5373 0.4949 -0.0487 -0.1268 -0.0892 324 GLN A CB    
1382 C CG    . GLN A 164 ? 0.5490 0.5760 0.5160 -0.0459 -0.1394 -0.0954 324 GLN A CG    
1383 C CD    . GLN A 164 ? 0.6308 0.6490 0.5598 -0.0248 -0.1529 -0.0911 324 GLN A CD    
1384 O OE1   . GLN A 164 ? 0.6236 0.6553 0.5655 -0.0146 -0.1631 -0.0884 324 GLN A OE1   
1385 N NE2   . GLN A 164 ? 0.6970 0.6939 0.5766 -0.0151 -0.1519 -0.0890 324 GLN A NE2   
1386 N N     . LEU A 165 ? 0.3614 0.3871 0.3736 -0.0847 -0.1057 -0.0965 325 LEU A N     
1387 C CA    . LEU A 165 ? 0.4099 0.4086 0.3922 -0.0888 -0.0933 -0.0963 325 LEU A CA    
1388 C C     . LEU A 165 ? 0.4374 0.4147 0.3666 -0.0727 -0.0956 -0.0958 325 LEU A C     
1389 O O     . LEU A 165 ? 0.4602 0.4321 0.3682 -0.0619 -0.1153 -0.1024 325 LEU A O     
1390 C CB    . LEU A 165 ? 0.4567 0.4428 0.4517 -0.1043 -0.1054 -0.1052 325 LEU A CB    
1391 C CG    . LEU A 165 ? 0.5271 0.4786 0.4839 -0.1040 -0.0991 -0.1084 325 LEU A CG    
1392 C CD1   . LEU A 165 ? 0.5073 0.4605 0.4676 -0.1082 -0.0703 -0.0970 325 LEU A CD1   
1393 C CD2   . LEU A 165 ? 0.6048 0.5334 0.5698 -0.1167 -0.1210 -0.1201 325 LEU A CD2   
1394 N N     . LEU A 166 ? 0.4065 0.3753 0.3156 -0.0694 -0.0754 -0.0870 326 LEU A N     
1395 C CA    . LEU A 166 ? 0.4296 0.3870 0.2953 -0.0551 -0.0718 -0.0809 326 LEU A CA    
1396 C C     . LEU A 166 ? 0.4199 0.3614 0.2628 -0.0554 -0.0610 -0.0835 326 LEU A C     
1397 O O     . LEU A 166 ? 0.4341 0.3741 0.2940 -0.0659 -0.0483 -0.0830 326 LEU A O     
1398 C CB    . LEU A 166 ? 0.4366 0.4025 0.3055 -0.0507 -0.0597 -0.0643 326 LEU A CB    
1399 C CG    . LEU A 166 ? 0.4784 0.4518 0.3506 -0.0419 -0.0712 -0.0576 326 LEU A CG    
1400 C CD1   . LEU A 166 ? 0.5292 0.4986 0.3661 -0.0268 -0.0862 -0.0599 326 LEU A CD1   
1401 C CD2   . LEU A 166 ? 0.4563 0.4436 0.3677 -0.0474 -0.0797 -0.0652 326 LEU A CD2   
1402 N N     . PRO A 167 ? 0.4762 0.4066 0.2769 -0.0398 -0.0659 -0.0863 327 PRO A N     
1403 C CA    . PRO A 167 ? 0.4812 0.3946 0.2564 -0.0353 -0.0596 -0.0922 327 PRO A CA    
1404 C C     . PRO A 167 ? 0.4734 0.3977 0.2425 -0.0315 -0.0363 -0.0778 327 PRO A C     
1405 O O     . PRO A 167 ? 0.5088 0.4221 0.2626 -0.0281 -0.0295 -0.0823 327 PRO A O     
1406 C CB    . PRO A 167 ? 0.5454 0.4460 0.2738 -0.0132 -0.0760 -0.1023 327 PRO A CB    
1407 C CG    . PRO A 167 ? 0.5820 0.5014 0.3032 -0.0022 -0.0776 -0.0903 327 PRO A CG    
1408 C CD    . PRO A 167 ? 0.5415 0.4738 0.3113 -0.0211 -0.0791 -0.0855 327 PRO A CD    
1409 N N     . SER A 168 ? 0.3932 0.3370 0.1760 -0.0322 -0.0268 -0.0609 328 SER A N     
1410 C CA    . SER A 168 ? 0.3769 0.3336 0.1612 -0.0307 -0.0091 -0.0461 328 SER A CA    
1411 C C     . SER A 168 ? 0.4356 0.4038 0.2523 -0.0410 -0.0049 -0.0313 328 SER A C     
1412 O O     . SER A 168 ? 0.3566 0.3246 0.1847 -0.0431 -0.0141 -0.0290 328 SER A O     
1413 C CB    . SER A 168 ? 0.4038 0.3725 0.1525 -0.0103 -0.0026 -0.0356 328 SER A CB    
1414 O OG    . SER A 168 ? 0.4164 0.3985 0.1614 -0.0039 -0.0036 -0.0187 328 SER A OG    
1415 N N     . ILE A 169 ? 0.2664 0.3417 0.2260 -0.0680 0.0355  -0.0899 329 ILE A N     
1416 C CA    . ILE A 169 ? 0.2905 0.3543 0.2459 -0.0778 0.0366  -0.0930 329 ILE A CA    
1417 C C     . ILE A 169 ? 0.2913 0.3498 0.2252 -0.0948 0.0374  -0.0874 329 ILE A C     
1418 O O     . ILE A 169 ? 0.3039 0.3384 0.2400 -0.0937 0.0321  -0.0773 329 ILE A O     
1419 C CB    . ILE A 169 ? 0.2995 0.3690 0.2675 -0.0757 0.0382  -0.0981 329 ILE A CB    
1420 C CG1   . ILE A 169 ? 0.2858 0.3424 0.2570 -0.0523 0.0344  -0.0967 329 ILE A CG1   
1421 C CG2   . ILE A 169 ? 0.3206 0.3763 0.2930 -0.0919 0.0355  -0.1066 329 ILE A CG2   
1422 C CD1   . ILE A 169 ? 0.2830 0.3133 0.2480 -0.0436 0.0328  -0.0994 329 ILE A CD1   
1423 N N     . PRO A 170 ? 0.3322 0.4078 0.2508 -0.1001 0.0463  -0.0802 330 PRO A N     
1424 C CA    . PRO A 170 ? 0.3296 0.3908 0.2289 -0.1023 0.0527  -0.0563 330 PRO A CA    
1425 C C     . PRO A 170 ? 0.3474 0.3920 0.2216 -0.0860 0.0371  -0.0492 330 PRO A C     
1426 O O     . PRO A 170 ? 0.3781 0.3966 0.2418 -0.0832 0.0381  -0.0302 330 PRO A O     
1427 C CB    . PRO A 170 ? 0.3720 0.4566 0.2500 -0.1009 0.0681  -0.0508 330 PRO A CB    
1428 C CG    . PRO A 170 ? 0.3468 0.4583 0.2533 -0.1082 0.0721  -0.0702 330 PRO A CG    
1429 C CD    . PRO A 170 ? 0.2775 0.3786 0.2017 -0.0974 0.0524  -0.0847 330 PRO A CD    
1430 N N     . GLN A 171 ? 0.3167 0.3756 0.1870 -0.0744 0.0217  -0.0659 331 GLN A N     
1431 C CA    . GLN A 171 ? 0.3502 0.4024 0.2112 -0.0577 -0.0003 -0.0664 331 GLN A CA    
1432 C C     . GLN A 171 ? 0.3259 0.3636 0.2206 -0.0572 -0.0068 -0.0652 331 GLN A C     
1433 O O     . GLN A 171 ? 0.3186 0.3431 0.2041 -0.0440 -0.0197 -0.0552 331 GLN A O     
1434 C CB    . GLN A 171 ? 0.3455 0.4182 0.2105 -0.0485 -0.0181 -0.0904 331 GLN A CB    
1435 C CG    . GLN A 171 ? 0.3945 0.4728 0.2076 -0.0361 -0.0196 -0.0908 331 GLN A CG    
1436 C CD    . GLN A 171 ? 0.4796 0.5572 0.3065 -0.0216 -0.0437 -0.1094 331 GLN A CD    
1437 O OE1   . GLN A 171 ? 0.5023 0.5849 0.3493 -0.0140 -0.0700 -0.1227 331 GLN A OE1   
1438 N NE2   . GLN A 171 ? 0.4631 0.5356 0.2855 -0.0191 -0.0352 -0.1107 331 GLN A NE2   
1439 N N     . LEU A 172 ? 0.2886 0.3269 0.2158 -0.0659 0.0028  -0.0746 332 LEU A N     
1440 C CA    . LEU A 172 ? 0.2916 0.3124 0.2432 -0.0607 0.0019  -0.0723 332 LEU A CA    
1441 C C     . LEU A 172 ? 0.3058 0.2955 0.2411 -0.0635 0.0052  -0.0549 332 LEU A C     
1442 O O     . LEU A 172 ? 0.3286 0.2996 0.2656 -0.0519 -0.0025 -0.0458 332 LEU A O     
1443 C CB    . LEU A 172 ? 0.2742 0.2952 0.2465 -0.0613 0.0150  -0.0845 332 LEU A CB    
1444 C CG    . LEU A 172 ? 0.3370 0.3359 0.3244 -0.0490 0.0187  -0.0823 332 LEU A CG    
1445 C CD1   . LEU A 172 ? 0.3861 0.3942 0.4053 -0.0368 0.0125  -0.0798 332 LEU A CD1   
1446 C CD2   . LEU A 172 ? 0.3339 0.3273 0.3214 -0.0407 0.0334  -0.0931 332 LEU A CD2   
1447 N N     . LYS A 173 ? 0.2848 0.2686 0.2117 -0.0788 0.0175  -0.0507 333 LYS A N     
1448 C CA    . LYS A 173 ? 0.3954 0.3450 0.3206 -0.0867 0.0241  -0.0354 333 LYS A CA    
1449 C C     . LYS A 173 ? 0.4190 0.3487 0.3128 -0.0755 0.0238  -0.0101 333 LYS A C     
1450 O O     . LYS A 173 ? 0.4047 0.2972 0.2948 -0.0705 0.0243  0.0040  333 LYS A O     
1451 C CB    . LYS A 173 ? 0.3895 0.3448 0.3306 -0.1084 0.0382  -0.0377 333 LYS A CB    
1452 C CG    . LYS A 173 ? 0.3970 0.3649 0.3628 -0.1117 0.0325  -0.0650 333 LYS A CG    
1453 C CD    . LYS A 173 ? 0.3875 0.3761 0.3793 -0.1306 0.0406  -0.0729 333 LYS A CD    
1454 C CE    . LYS A 173 ? 0.4075 0.3682 0.4317 -0.1501 0.0462  -0.0656 333 LYS A CE    
1455 N NZ    . LYS A 173 ? 0.3835 0.3134 0.4242 -0.1465 0.0278  -0.0873 333 LYS A NZ    
1456 N N     . GLU A 174 ? 0.4123 0.3627 0.2766 -0.0661 0.0218  -0.0052 334 GLU A N     
1457 C CA    . GLU A 174 ? 0.4983 0.4290 0.3173 -0.0448 0.0188  0.0177  334 GLU A CA    
1458 C C     . GLU A 174 ? 0.5281 0.4566 0.3500 -0.0217 -0.0077 0.0118  334 GLU A C     
1459 O O     . GLU A 174 ? 0.4939 0.3908 0.2905 -0.0038 -0.0102 0.0319  334 GLU A O     
1460 C CB    . GLU A 174 ? 0.5801 0.5316 0.3561 -0.0329 0.0201  0.0200  334 GLU A CB    
1461 C CG    . GLU A 174 ? 0.7613 0.6812 0.4755 -0.0105 0.0336  0.0535  334 GLU A CG    
1462 C CD    . GLU A 174 ? 0.8877 0.7717 0.6141 -0.0302 0.0716  0.0837  334 GLU A CD    
1463 O OE1   . GLU A 174 ? 0.8906 0.7897 0.6650 -0.0612 0.0884  0.0753  334 GLU A OE1   
1464 O OE2   . GLU A 174 ? 0.9844 0.8241 0.6768 -0.0137 0.0838  0.1146  334 GLU A OE2   
1465 N N     . HIS A 175 ? 0.3941 0.3560 0.2521 -0.0210 -0.0247 -0.0144 335 HIS A N     
1466 C CA    . HIS A 175 ? 0.3923 0.3628 0.2754 -0.0017 -0.0475 -0.0225 335 HIS A CA    
1467 C C     . HIS A 175 ? 0.4011 0.3394 0.2992 0.0013  -0.0402 -0.0112 335 HIS A C     
1468 O O     . HIS A 175 ? 0.4336 0.3611 0.3265 0.0241  -0.0541 -0.0027 335 HIS A O     
1469 C CB    . HIS A 175 ? 0.3395 0.3494 0.2764 -0.0069 -0.0566 -0.0501 335 HIS A CB    
1470 C CG    . HIS A 175 ? 0.3693 0.3944 0.3554 0.0089  -0.0731 -0.0580 335 HIS A CG    
1471 N ND1   . HIS A 175 ? 0.3894 0.4419 0.3913 0.0278  -0.1051 -0.0711 335 HIS A ND1   
1472 C CD2   . HIS A 175 ? 0.3626 0.3816 0.3887 0.0117  -0.0621 -0.0559 335 HIS A CD2   
1473 C CE1   . HIS A 175 ? 0.3637 0.4319 0.4254 0.0379  -0.1120 -0.0761 335 HIS A CE1   
1474 N NE2   . HIS A 175 ? 0.3182 0.3648 0.3918 0.0294  -0.0829 -0.0646 335 HIS A NE2   
1475 N N     . LEU A 176 ? 0.3791 0.3011 0.2925 -0.0176 -0.0214 -0.0140 336 LEU A N     
1476 C CA    . LEU A 176 ? 0.3928 0.2797 0.3172 -0.0123 -0.0164 -0.0099 336 LEU A CA    
1477 C C     . LEU A 176 ? 0.4563 0.2964 0.3486 -0.0024 -0.0149 0.0148  336 LEU A C     
1478 O O     . LEU A 176 ? 0.4794 0.2911 0.3759 0.0130  -0.0177 0.0194  336 LEU A O     
1479 C CB    . LEU A 176 ? 0.4256 0.3001 0.3620 -0.0305 -0.0028 -0.0226 336 LEU A CB    
1480 C CG    . LEU A 176 ? 0.4095 0.3149 0.3703 -0.0300 0.0008  -0.0435 336 LEU A CG    
1481 C CD1   . LEU A 176 ? 0.4257 0.3186 0.3840 -0.0420 0.0084  -0.0573 336 LEU A CD1   
1482 C CD2   . LEU A 176 ? 0.4233 0.3302 0.4076 -0.0071 0.0007  -0.0461 336 LEU A CD2   
1483 N N     . ARG A 177 ? 0.4919 0.3198 0.3498 -0.0083 -0.0060 0.0331  337 ARG A N     
1484 C CA    . ARG A 177 ? 0.5657 0.3422 0.3873 0.0040  0.0031  0.0633  337 ARG A CA    
1485 C C     . ARG A 177 ? 0.7010 0.4749 0.5013 0.0423  -0.0184 0.0713  337 ARG A C     
1486 O O     . ARG A 177 ? 0.6576 0.3824 0.4363 0.0590  -0.0139 0.0920  337 ARG A O     
1487 C CB    . ARG A 177 ? 0.7460 0.5151 0.5299 -0.0017 0.0227  0.0858  337 ARG A CB    
1488 C CG    . ARG A 177 ? 0.7302 0.4953 0.5439 -0.0387 0.0485  0.0846  337 ARG A CG    
1489 C CD    . ARG A 177 ? 0.8210 0.5775 0.5994 -0.0390 0.0762  0.1140  337 ARG A CD    
1490 N NE    . ARG A 177 ? 0.8574 0.5777 0.6692 -0.0680 0.1096  0.1313  337 ARG A NE    
1491 C CZ    . ARG A 177 ? 0.9725 0.6320 0.7672 -0.0626 0.1358  0.1674  337 ARG A CZ    
1492 N NH1   . ARG A 177 ? 1.0234 0.6509 0.7548 -0.0234 0.1307  0.1915  337 ARG A NH1   
1493 N NH2   . ARG A 177 ? 1.0210 0.6511 0.8667 -0.0951 0.1671  0.1789  337 ARG A NH2   
1494 N N     . LYS A 178 ? 0.5678 0.3942 0.3797 0.0568  -0.0432 0.0528  338 LYS A N     
1495 C CA    . LYS A 178 ? 0.6573 0.4954 0.4635 0.0946  -0.0711 0.0530  338 LYS A CA    
1496 C C     . LYS A 178 ? 0.6335 0.4602 0.4782 0.1051  -0.0734 0.0500  338 LYS A C     
1497 O O     . LYS A 178 ? 0.6718 0.4940 0.5083 0.1392  -0.0912 0.0575  338 LYS A O     
1498 C CB    . LYS A 178 ? 0.6552 0.5571 0.4877 0.1022  -0.1004 0.0254  338 LYS A CB    
1499 C CG    . LYS A 178 ? 0.7488 0.6589 0.5291 0.1049  -0.1042 0.0265  338 LYS A CG    
1500 C CD    . LYS A 178 ? 0.7804 0.7475 0.5895 0.1152  -0.1404 -0.0073 338 LYS A CD    
1501 C CE    . LYS A 178 ? 0.8577 0.8258 0.5989 0.1280  -0.1476 -0.0079 338 LYS A CE    
1502 N NZ    . LYS A 178 ? 0.8724 0.8902 0.6412 0.1404  -0.1899 -0.0472 338 LYS A NZ    
1503 N N     . HIS A 179 ? 0.5449 0.3662 0.4261 0.0816  -0.0561 0.0385  339 HIS A N     
1504 C CA    . HIS A 179 ? 0.5794 0.3895 0.4918 0.0961  -0.0547 0.0340  339 HIS A CA    
1505 C C     . HIS A 179 ? 0.6874 0.4258 0.5721 0.0957  -0.0387 0.0483  339 HIS A C     
1506 O O     . HIS A 179 ? 0.7275 0.4480 0.6303 0.1041  -0.0332 0.0400  339 HIS A O     
1507 C CB    . HIS A 179 ? 0.4759 0.3223 0.4399 0.0830  -0.0460 0.0110  339 HIS A CB    
1508 C CG    . HIS A 179 ? 0.4525 0.3643 0.4629 0.0843  -0.0596 -0.0046 339 HIS A CG    
1509 N ND1   . HIS A 179 ? 0.4702 0.4174 0.5209 0.1099  -0.0797 -0.0083 339 HIS A ND1   
1510 C CD2   . HIS A 179 ? 0.4150 0.3622 0.4451 0.0633  -0.0574 -0.0198 339 HIS A CD2   
1511 C CE1   . HIS A 179 ? 0.3984 0.3998 0.4989 0.1011  -0.0903 -0.0274 339 HIS A CE1   
1512 N NE2   . HIS A 179 ? 0.3695 0.3680 0.4540 0.0734  -0.0758 -0.0334 339 HIS A NE2   
1513 N N     . TRP A 180 ? 0.7125 0.4063 0.5546 0.0876  -0.0290 0.0697  340 TRP A N     
1514 C CA    . TRP A 180 ? 0.7657 0.3843 0.5904 0.0854  -0.0139 0.0836  340 TRP A CA    
1515 C C     . TRP A 180 ? 0.8506 0.4359 0.6515 0.1264  -0.0224 0.1019  340 TRP A C     
1516 O O     . TRP A 180 ? 0.8972 0.4965 0.6692 0.1536  -0.0345 0.1182  340 TRP A O     
1517 C CB    . TRP A 180 ? 0.8037 0.3840 0.6045 0.0608  0.0074  0.1045  340 TRP A CB    
1518 C CG    . TRP A 180 ? 0.7398 0.3467 0.5701 0.0209  0.0172  0.0865  340 TRP A CG    
1519 C CD1   . TRP A 180 ? 0.6993 0.3522 0.5632 0.0082  0.0082  0.0548  340 TRP A CD1   
1520 C CD2   . TRP A 180 ? 0.7480 0.3371 0.5781 -0.0077 0.0405  0.1012  340 TRP A CD2   
1521 N NE1   . TRP A 180 ? 0.5977 0.2640 0.4789 -0.0246 0.0192  0.0462  340 TRP A NE1   
1522 C CE2   . TRP A 180 ? 0.6516 0.2832 0.5191 -0.0367 0.0393  0.0735  340 TRP A CE2   
1523 C CE3   . TRP A 180 ? 0.7916 0.3316 0.5954 -0.0090 0.0668  0.1380  340 TRP A CE3   
1524 C CZ2   . TRP A 180 ? 0.6540 0.2889 0.5417 -0.0682 0.0595  0.0781  340 TRP A CZ2   
1525 C CZ3   . TRP A 180 ? 0.7959 0.3364 0.6226 -0.0423 0.0931  0.1460  340 TRP A CZ3   
1526 C CH2   . TRP A 180 ? 0.7241 0.3157 0.5967 -0.0723 0.0874  0.1144  340 TRP A CH2   
1527 N N     . HIS B 3   ? 0.7037 0.9985 0.7517 -0.0991 -0.0586 0.0257  163 HIS B N     
1528 C CA    A HIS B 3   ? 0.6621 0.9469 0.7222 -0.0626 -0.0464 0.0479  163 HIS B CA    
1529 C CA    B HIS B 3   ? 0.6605 0.9464 0.7221 -0.0627 -0.0463 0.0480  163 HIS B CA    
1530 C C     . HIS B 3   ? 0.6002 0.8258 0.6581 -0.0563 -0.0237 0.0418  163 HIS B C     
1531 O O     . HIS B 3   ? 0.5840 0.7902 0.6476 -0.0764 -0.0181 0.0293  163 HIS B O     
1532 C CB    A HIS B 3   ? 0.6774 0.9520 0.7044 -0.0437 -0.0512 0.0580  163 HIS B CB    
1533 C CB    B HIS B 3   ? 0.6749 0.9558 0.7074 -0.0416 -0.0518 0.0610  163 HIS B CB    
1534 C CG    A HIS B 3   ? 0.6822 0.9634 0.7267 -0.0085 -0.0445 0.0850  163 HIS B CG    
1535 C CG    B HIS B 3   ? 0.6944 0.9329 0.6784 -0.0545 -0.0495 0.0413  163 HIS B CG    
1536 N ND1   A HIS B 3   ? 0.6857 1.0191 0.7773 0.0061  -0.0485 0.1050  163 HIS B ND1   
1537 N ND1   B HIS B 3   ? 0.6959 0.8941 0.6691 -0.0752 -0.0394 0.0143  163 HIS B ND1   
1538 C CD2   A HIS B 3   ? 0.6951 0.9345 0.7191 0.0144  -0.0312 0.0938  163 HIS B CD2   
1539 C CD2   B HIS B 3   ? 0.7178 0.9468 0.6627 -0.0490 -0.0526 0.0451  163 HIS B CD2   
1540 C CE1   A HIS B 3   ? 0.6863 1.0036 0.7839 0.0387  -0.0362 0.1243  163 HIS B CE1   
1541 C CE1   B HIS B 3   ? 0.7204 0.8893 0.6553 -0.0805 -0.0343 -0.0002 163 HIS B CE1   
1542 N NE2   A HIS B 3   ? 0.6932 0.9520 0.7472 0.0422  -0.0263 0.1177  163 HIS B NE2   
1543 N NE2   B HIS B 3   ? 0.7294 0.9169 0.6433 -0.0670 -0.0417 0.0176  163 HIS B NE2   
1544 N N     . MET B 4   ? 0.5424 0.7379 0.5894 -0.0304 -0.0123 0.0522  164 MET B N     
1545 C CA    . MET B 4   ? 0.4507 0.5975 0.4931 -0.0244 0.0048  0.0505  164 MET B CA    
1546 C C     . MET B 4   ? 0.3895 0.4890 0.4136 -0.0382 0.0065  0.0334  164 MET B C     
1547 O O     . MET B 4   ? 0.4048 0.4952 0.4122 -0.0443 0.0019  0.0209  164 MET B O     
1548 C CB    . MET B 4   ? 0.4620 0.5890 0.4942 0.0018  0.0151  0.0630  164 MET B CB    
1549 C CG    . MET B 4   ? 0.5029 0.6692 0.5563 0.0222  0.0155  0.0818  164 MET B CG    
1550 S SD    . MET B 4   ? 0.7474 0.9508 0.8444 0.0215  0.0268  0.0877  164 MET B SD    
1551 C CE    . MET B 4   ? 0.8043 0.9473 0.8790 0.0265  0.0523  0.0836  164 MET B CE    
1552 N N     . GLY B 5   ? 0.2817 0.3505 0.3091 -0.0422 0.0144  0.0343  165 GLY B N     
1553 C CA    . GLY B 5   ? 0.2752 0.3011 0.2964 -0.0524 0.0146  0.0235  165 GLY B CA    
1554 C C     . GLY B 5   ? 0.2972 0.2928 0.3078 -0.0382 0.0170  0.0213  165 GLY B C     
1555 O O     . GLY B 5   ? 0.2592 0.2612 0.2613 -0.0232 0.0198  0.0281  165 GLY B O     
1556 N N     . HIS B 6   ? 0.2834 0.2456 0.2992 -0.0431 0.0172  0.0126  166 HIS B N     
1557 C CA    . HIS B 6   ? 0.2804 0.2209 0.2991 -0.0307 0.0201  0.0097  166 HIS B CA    
1558 C C     . HIS B 6   ? 0.2663 0.2015 0.2809 -0.0196 0.0188  0.0254  166 HIS B C     
1559 O O     . HIS B 6   ? 0.2833 0.2172 0.2970 -0.0103 0.0219  0.0242  166 HIS B O     
1560 C CB    . HIS B 6   ? 0.3015 0.2080 0.3389 -0.0343 0.0209  0.0019  166 HIS B CB    
1561 C CG    . HIS B 6   ? 0.3498 0.2505 0.3871 -0.0463 0.0278  -0.0210 166 HIS B CG    
1562 N ND1   . HIS B 6   ? 0.4254 0.2894 0.4792 -0.0525 0.0326  -0.0308 166 HIS B ND1   
1563 C CD2   . HIS B 6   ? 0.3340 0.2573 0.3520 -0.0553 0.0309  -0.0365 166 HIS B CD2   
1564 C CE1   . HIS B 6   ? 0.4708 0.3324 0.5139 -0.0669 0.0414  -0.0560 166 HIS B CE1   
1565 N NE2   . HIS B 6   ? 0.4563 0.3565 0.4749 -0.0703 0.0386  -0.0594 166 HIS B NE2   
1566 N N     . TRP B 7   ? 0.2693 0.2002 0.2778 -0.0243 0.0162  0.0382  167 TRP B N     
1567 C CA    . TRP B 7   ? 0.2764 0.1984 0.2710 -0.0198 0.0159  0.0497  167 TRP B CA    
1568 C C     . TRP B 7   ? 0.3078 0.2428 0.2918 -0.0090 0.0243  0.0483  167 TRP B C     
1569 O O     . TRP B 7   ? 0.2903 0.2129 0.2650 -0.0059 0.0252  0.0509  167 TRP B O     
1570 C CB    . TRP B 7   ? 0.3371 0.2558 0.3166 -0.0298 0.0185  0.0602  167 TRP B CB    
1571 C CG    . TRP B 7   ? 0.2786 0.2262 0.2586 -0.0283 0.0302  0.0589  167 TRP B CG    
1572 C CD1   . TRP B 7   ? 0.2778 0.2489 0.2731 -0.0371 0.0314  0.0561  167 TRP B CD1   
1573 C CD2   . TRP B 7   ? 0.2715 0.2299 0.2427 -0.0168 0.0423  0.0612  167 TRP B CD2   
1574 N NE1   . TRP B 7   ? 0.2678 0.2722 0.2707 -0.0297 0.0410  0.0587  167 TRP B NE1   
1575 C CE2   . TRP B 7   ? 0.2670 0.2605 0.2557 -0.0149 0.0493  0.0623  167 TRP B CE2   
1576 C CE3   . TRP B 7   ? 0.2771 0.2176 0.2299 -0.0087 0.0486  0.0621  167 TRP B CE3   
1577 C CZ2   . TRP B 7   ? 0.2678 0.2785 0.2615 0.0005  0.0632  0.0667  167 TRP B CZ2   
1578 C CZ3   . TRP B 7   ? 0.2821 0.2304 0.2323 0.0037  0.0650  0.0637  167 TRP B CZ3   
1579 C CH2   . TRP B 7   ? 0.2836 0.2666 0.2567 0.0109  0.0725  0.0672  167 TRP B CH2   
1580 N N     . SER B 8   ? 0.2508 0.2101 0.2361 -0.0048 0.0290  0.0455  168 SER B N     
1581 C CA    . SER B 8   ? 0.2490 0.2174 0.2246 0.0079  0.0370  0.0499  168 SER B CA    
1582 C C     . SER B 8   ? 0.2661 0.2262 0.2365 0.0124  0.0385  0.0449  168 SER B C     
1583 O O     . SER B 8   ? 0.2820 0.2381 0.2403 0.0215  0.0462  0.0506  168 SER B O     
1584 C CB    . SER B 8   ? 0.2572 0.2605 0.2407 0.0124  0.0367  0.0543  168 SER B CB    
1585 O OG    . SER B 8   ? 0.2775 0.2971 0.2625 0.0057  0.0279  0.0461  168 SER B OG    
1586 N N     . GLN B 9   ? 0.2704 0.2251 0.2513 0.0061  0.0344  0.0343  169 GLN B N     
1587 C CA    A GLN B 9   ? 0.3034 0.2540 0.2830 0.0082  0.0409  0.0270  169 GLN B CA    
1588 C CA    B GLN B 9   ? 0.3032 0.2538 0.2830 0.0081  0.0409  0.0269  169 GLN B CA    
1589 C C     . GLN B 9   ? 0.3320 0.2668 0.3226 0.0080  0.0419  0.0279  169 GLN B C     
1590 O O     . GLN B 9   ? 0.2947 0.2287 0.2903 0.0081  0.0500  0.0223  169 GLN B O     
1591 C CB    A GLN B 9   ? 0.3315 0.2861 0.3190 0.0017  0.0421  0.0109  169 GLN B CB    
1592 C CB    B GLN B 9   ? 0.3277 0.2816 0.3162 0.0016  0.0419  0.0108  169 GLN B CB    
1593 C CG    A GLN B 9   ? 0.3578 0.3327 0.3294 -0.0046 0.0379  0.0079  169 GLN B CG    
1594 C CG    B GLN B 9   ? 0.3529 0.3264 0.3267 -0.0051 0.0377  0.0072  169 GLN B CG    
1595 C CD    A GLN B 9   ? 0.3822 0.3541 0.3522 -0.0165 0.0419  -0.0133 169 GLN B CD    
1596 C CD    B GLN B 9   ? 0.3796 0.3707 0.3281 0.0001  0.0386  0.0169  169 GLN B CD    
1597 O OE1   A GLN B 9   ? 0.4266 0.4022 0.3992 -0.0282 0.0360  -0.0210 169 GLN B OE1   
1598 O OE1   B GLN B 9   ? 0.4475 0.4364 0.3777 -0.0018 0.0462  0.0114  169 GLN B OE1   
1599 N NE2   A GLN B 9   ? 0.4051 0.3683 0.3693 -0.0163 0.0553  -0.0251 169 GLN B NE2   
1600 N NE2   B GLN B 9   ? 0.3648 0.3727 0.3135 0.0075  0.0324  0.0331  169 GLN B NE2   
1601 N N     . GLY B 10  ? 0.3098 0.2351 0.3026 0.0049  0.0335  0.0354  170 GLY B N     
1602 C CA    . GLY B 10  ? 0.3273 0.2437 0.3295 0.0004  0.0277  0.0382  170 GLY B CA    
1603 C C     . GLY B 10  ? 0.3102 0.2212 0.2998 -0.0014 0.0374  0.0376  170 GLY B C     
1604 O O     . GLY B 10  ? 0.3078 0.2232 0.3171 -0.0058 0.0368  0.0341  170 GLY B O     
1605 N N     . LEU B 11  ? 0.3010 0.2020 0.2624 0.0021  0.0479  0.0416  171 LEU B N     
1606 C CA    . LEU B 11  ? 0.3480 0.2325 0.2933 -0.0004 0.0604  0.0418  171 LEU B CA    
1607 C C     . LEU B 11  ? 0.3703 0.2617 0.3239 0.0006  0.0699  0.0379  171 LEU B C     
1608 O O     . LEU B 11  ? 0.3842 0.2698 0.3430 -0.0091 0.0758  0.0345  171 LEU B O     
1609 C CB    . LEU B 11  ? 0.3851 0.2531 0.3042 0.0088  0.0730  0.0485  171 LEU B CB    
1610 C CG    . LEU B 11  ? 0.4379 0.2752 0.3362 0.0074  0.0898  0.0498  171 LEU B CG    
1611 C CD1   . LEU B 11  ? 0.4167 0.2363 0.3079 -0.0133 0.0874  0.0412  171 LEU B CD1   
1612 C CD2   . LEU B 11  ? 0.4393 0.2595 0.3218 0.0229  0.1040  0.0578  171 LEU B CD2   
1613 N N     . LYS B 12  ? 0.3576 0.2630 0.3101 0.0085  0.0720  0.0374  172 LYS B N     
1614 C CA    A LYS B 12  ? 0.3761 0.2867 0.3261 0.0065  0.0837  0.0326  172 LYS B CA    
1615 C CA    B LYS B 12  ? 0.3758 0.2867 0.3260 0.0066  0.0836  0.0325  172 LYS B CA    
1616 C C     . LYS B 12  ? 0.3510 0.2731 0.3364 -0.0012 0.0854  0.0199  172 LYS B C     
1617 O O     . LYS B 12  ? 0.3074 0.2301 0.2977 -0.0081 0.0997  0.0156  172 LYS B O     
1618 C CB    A LYS B 12  ? 0.4151 0.3402 0.3503 0.0116  0.0822  0.0324  172 LYS B CB    
1619 C CB    B LYS B 12  ? 0.4033 0.3293 0.3404 0.0114  0.0814  0.0316  172 LYS B CB    
1620 C CG    A LYS B 12  ? 0.4913 0.4176 0.4064 0.0066  0.0963  0.0291  172 LYS B CG    
1621 C CG    B LYS B 12  ? 0.4630 0.3925 0.3841 0.0058  0.0951  0.0254  172 LYS B CG    
1622 C CD    A LYS B 12  ? 0.5605 0.4658 0.4491 0.0080  0.1077  0.0446  172 LYS B CD    
1623 C CD    B LYS B 12  ? 0.4920 0.4380 0.4049 0.0025  0.0907  0.0146  172 LYS B CD    
1624 C CE    A LYS B 12  ? 0.6352 0.5390 0.4940 0.0004  0.1225  0.0453  172 LYS B CE    
1625 C CE    B LYS B 12  ? 0.5082 0.4670 0.4122 0.0082  0.0733  0.0252  172 LYS B CE    
1626 N NZ    A LYS B 12  ? 0.6768 0.5968 0.5056 0.0029  0.1125  0.0507  172 LYS B NZ    
1627 N NZ    B LYS B 12  ? 0.5416 0.5027 0.4173 0.0167  0.0708  0.0470  172 LYS B NZ    
1628 N N     . ILE B 13  ? 0.2940 0.2256 0.3080 0.0005  0.0722  0.0155  173 ILE B N     
1629 C CA    . ILE B 13  ? 0.2697 0.2147 0.3296 -0.0012 0.0719  0.0070  173 ILE B CA    
1630 C C     . ILE B 13  ? 0.2613 0.2105 0.3389 -0.0104 0.0669  0.0119  173 ILE B C     
1631 O O     . ILE B 13  ? 0.2639 0.2297 0.3749 -0.0151 0.0764  0.0053  173 ILE B O     
1632 C CB    . ILE B 13  ? 0.3086 0.2551 0.3939 0.0049  0.0569  0.0067  173 ILE B CB    
1633 C CG1   . ILE B 13  ? 0.3577 0.3011 0.4317 0.0079  0.0660  -0.0053 173 ILE B CG1   
1634 C CG2   . ILE B 13  ? 0.2973 0.2577 0.4393 0.0078  0.0512  0.0056  173 ILE B CG2   
1635 C CD1   . ILE B 13  ? 0.3827 0.3171 0.4624 0.0097  0.0526  -0.0033 173 ILE B CD1   
1636 N N     . SER B 14  ? 0.2752 0.2109 0.3297 -0.0157 0.0541  0.0216  174 SER B N     
1637 C CA    . SER B 14  ? 0.2852 0.2223 0.3463 -0.0307 0.0469  0.0241  174 SER B CA    
1638 C C     . SER B 14  ? 0.3076 0.2369 0.3571 -0.0413 0.0675  0.0194  174 SER B C     
1639 O O     . SER B 14  ? 0.3100 0.2550 0.3874 -0.0559 0.0664  0.0161  174 SER B O     
1640 C CB    . SER B 14  ? 0.3384 0.2555 0.3643 -0.0379 0.0332  0.0314  174 SER B CB    
1641 O OG    . SER B 14  ? 0.3689 0.2924 0.4047 -0.0321 0.0142  0.0385  174 SER B OG    
1642 N N     . MET B 15  ? 0.3088 0.2156 0.3198 -0.0350 0.0852  0.0213  175 MET B N     
1643 C CA    . MET B 15  ? 0.3803 0.2719 0.3746 -0.0442 0.1074  0.0209  175 MET B CA    
1644 C C     . MET B 15  ? 0.3528 0.2717 0.3847 -0.0515 0.1199  0.0119  175 MET B C     
1645 O O     . MET B 15  ? 0.3701 0.2852 0.4046 -0.0679 0.1353  0.0098  175 MET B O     
1646 C CB    . MET B 15  ? 0.4256 0.2963 0.3786 -0.0313 0.1206  0.0295  175 MET B CB    
1647 C CG    . MET B 15  ? 0.5028 0.3475 0.4237 -0.0203 0.1168  0.0400  175 MET B CG    
1648 S SD    . MET B 15  ? 0.5832 0.4209 0.4713 -0.0033 0.1264  0.0549  175 MET B SD    
1649 C CE    . MET B 15  ? 0.4606 0.2710 0.3276 -0.0166 0.1506  0.0603  175 MET B CE    
1650 N N     . GLN B 16  ? 0.3636 0.3074 0.4252 -0.0402 0.1171  0.0051  176 GLN B N     
1651 C CA    A GLN B 16  ? 0.3922 0.3610 0.4908 -0.0433 0.1362  -0.0070 176 GLN B CA    
1652 C CA    B GLN B 16  ? 0.3931 0.3618 0.4915 -0.0435 0.1363  -0.0069 176 GLN B CA    
1653 C C     . GLN B 16  ? 0.3657 0.3714 0.5366 -0.0463 0.1256  -0.0117 176 GLN B C     
1654 O O     . GLN B 16  ? 0.3859 0.4187 0.6030 -0.0474 0.1437  -0.0225 176 GLN B O     
1655 C CB    A GLN B 16  ? 0.4025 0.3727 0.4916 -0.0304 0.1446  -0.0157 176 GLN B CB    
1656 C CB    B GLN B 16  ? 0.4091 0.3783 0.4956 -0.0310 0.1456  -0.0154 176 GLN B CB    
1657 C CG    A GLN B 16  ? 0.4493 0.3953 0.4721 -0.0293 0.1530  -0.0093 176 GLN B CG    
1658 C CG    B GLN B 16  ? 0.4570 0.4008 0.4761 -0.0299 0.1529  -0.0077 176 GLN B CG    
1659 C CD    A GLN B 16  ? 0.5001 0.4401 0.4973 -0.0418 0.1816  -0.0112 176 GLN B CD    
1660 C CD    B GLN B 16  ? 0.4737 0.4206 0.4748 -0.0230 0.1553  -0.0170 176 GLN B CD    
1661 O OE1   A GLN B 16  ? 0.5257 0.4814 0.5581 -0.0527 0.1997  -0.0205 176 GLN B OE1   
1662 O OE1   B GLN B 16  ? 0.4782 0.4319 0.5022 -0.0147 0.1417  -0.0234 176 GLN B OE1   
1663 N NE2   A GLN B 16  ? 0.5382 0.4580 0.4753 -0.0410 0.1856  -0.0002 176 GLN B NE2   
1664 N NE2   B GLN B 16  ? 0.5287 0.4679 0.4840 -0.0296 0.1724  -0.0175 176 GLN B NE2   
1665 N N     . ASP B 17  ? 0.3419 0.2984 0.4083 0.0791  0.1247  0.0167  177 ASP B N     
1666 C CA    . ASP B 17  ? 0.3760 0.3467 0.4743 0.0974  0.1317  0.0326  177 ASP B CA    
1667 C C     . ASP B 17  ? 0.3318 0.3521 0.4642 0.0977  0.1254  0.0501  177 ASP B C     
1668 O O     . ASP B 17  ? 0.3101 0.3495 0.4504 0.0835  0.1058  0.0554  177 ASP B O     
1669 C CB    . ASP B 17  ? 0.3613 0.3187 0.4646 0.0962  0.1200  0.0371  177 ASP B CB    
1670 C CG    . ASP B 17  ? 0.4267 0.3937 0.5539 0.1130  0.1236  0.0535  177 ASP B CG    
1671 O OD1   . ASP B 17  ? 0.4520 0.4447 0.5971 0.1219  0.1298  0.0631  177 ASP B OD1   
1672 O OD2   . ASP B 17  ? 0.4723 0.4220 0.5970 0.1138  0.1177  0.0570  177 ASP B OD2   
1673 N N     . PRO B 18  ? 0.3804 0.4179 0.5266 0.1086  0.1375  0.0577  178 PRO B N     
1674 C CA    . PRO B 18  ? 0.3538 0.4368 0.5296 0.1041  0.1298  0.0730  178 PRO B CA    
1675 C C     . PRO B 18  ? 0.3247 0.4321 0.5263 0.0998  0.1095  0.0876  178 PRO B C     
1676 O O     . PRO B 18  ? 0.3542 0.4906 0.5700 0.0864  0.0955  0.0950  178 PRO B O     
1677 C CB    . PRO B 18  ? 0.3714 0.4605 0.5559 0.1186  0.1466  0.0780  178 PRO B CB    
1678 C CG    . PRO B 18  ? 0.4133 0.4586 0.5633 0.1265  0.1649  0.0611  178 PRO B CG    
1679 C CD    . PRO B 18  ? 0.3995 0.4121 0.5311 0.1224  0.1571  0.0516  178 PRO B CD    
1680 N N     . LYS B 19  ? 0.2997 0.3918 0.5025 0.1093  0.1075  0.0911  179 LYS B N     
1681 C CA    . LYS B 19  ? 0.3208 0.4323 0.5410 0.1053  0.0881  0.1046  179 LYS B CA    
1682 C C     . LYS B 19  ? 0.3059 0.4151 0.5175 0.0892  0.0710  0.1007  179 LYS B C     
1683 O O     . LYS B 19  ? 0.3104 0.4406 0.5327 0.0800  0.0527  0.1105  179 LYS B O     
1684 C CB    . LYS B 19  ? 0.3837 0.4759 0.6027 0.1197  0.0917  0.1098  179 LYS B CB    
1685 C CG    . LYS B 19  ? 0.4376 0.5364 0.6701 0.1367  0.1073  0.1169  179 LYS B CG    
1686 C CD    . LYS B 19  ? 0.5055 0.5909 0.7409 0.1502  0.1083  0.1256  179 LYS B CD    
1687 C CE    . LYS B 19  ? 0.5381 0.6340 0.7914 0.1685  0.1239  0.1348  179 LYS B CE    
1688 N NZ    . LYS B 19  ? 0.5621 0.6468 0.8202 0.1828  0.1247  0.1454  179 LYS B NZ    
1689 N N     . MET B 20  ? 0.2541 0.3349 0.4409 0.0832  0.0758  0.0849  180 MET B N     
1690 C CA    . MET B 20  ? 0.2081 0.2795 0.3756 0.0636  0.0583  0.0775  180 MET B CA    
1691 C C     . MET B 20  ? 0.2140 0.3020 0.3790 0.0481  0.0520  0.0745  180 MET B C     
1692 O O     . MET B 20  ? 0.2058 0.2919 0.3609 0.0334  0.0376  0.0719  180 MET B O     
1693 C CB    . MET B 20  ? 0.2438 0.2737 0.3805 0.0600  0.0619  0.0613  180 MET B CB    
1694 C CG    . MET B 20  ? 0.3397 0.3447 0.4736 0.0711  0.0669  0.0636  180 MET B CG    
1695 S SD    . MET B 20  ? 0.4588 0.4777 0.6045 0.0691  0.0492  0.0799  180 MET B SD    
1696 C CE    . MET B 20  ? 0.5194 0.5616 0.6973 0.0922  0.0562  0.1000  180 MET B CE    
1697 N N     . GLN B 21  ? 0.1963 0.2978 0.3685 0.0521  0.0646  0.0753  181 GLN B N     
1698 C CA    . GLN B 21  ? 0.1904 0.3012 0.3556 0.0380  0.0615  0.0726  181 GLN B CA    
1699 C C     . GLN B 21  ? 0.2370 0.3812 0.4267 0.0270  0.0488  0.0858  181 GLN B C     
1700 O O     . GLN B 21  ? 0.2816 0.4528 0.4953 0.0313  0.0529  0.0967  181 GLN B O     
1701 C CB    . GLN B 21  ? 0.2601 0.3703 0.4191 0.0452  0.0811  0.0689  181 GLN B CB    
1702 C CG    . GLN B 21  ? 0.2751 0.3483 0.4020 0.0511  0.0917  0.0527  181 GLN B CG    
1703 C CD    . GLN B 21  ? 0.3086 0.3787 0.4250 0.0600  0.1132  0.0489  181 GLN B CD    
1704 O OE1   . GLN B 21  ? 0.2806 0.3778 0.4211 0.0677  0.1248  0.0603  181 GLN B OE1   
1705 N NE2   . GLN B 21  ? 0.3508 0.3888 0.4306 0.0583  0.1189  0.0329  181 GLN B NE2   
1706 N N     . VAL B 22  ? 0.1976 0.3343 0.3752 0.0114  0.0326  0.0827  182 VAL B N     
1707 C CA    . VAL B 22  ? 0.1806 0.3409 0.3738 -0.0030 0.0191  0.0922  182 VAL B CA    
1708 C C     . VAL B 22  ? 0.1766 0.3441 0.3687 -0.0113 0.0247  0.0927  182 VAL B C     
1709 O O     . VAL B 22  ? 0.1764 0.3617 0.3806 -0.0180 0.0198  0.0994  182 VAL B O     
1710 C CB    . VAL B 22  ? 0.1937 0.3334 0.3655 -0.0161 0.0032  0.0856  182 VAL B CB    
1711 C CG1   . VAL B 22  ? 0.2083 0.3589 0.3826 -0.0328 -0.0100 0.0901  182 VAL B CG1   
1712 C CG2   . VAL B 22  ? 0.1839 0.3133 0.3511 -0.0084 -0.0023 0.0855  182 VAL B CG2   
1713 N N     . TYR B 23  ? 0.1463 0.2969 0.3201 -0.0109 0.0346  0.0852  183 TYR B N     
1714 C CA    . TYR B 23  ? 0.1988 0.3532 0.3680 -0.0179 0.0418  0.0871  183 TYR B CA    
1715 C C     . TYR B 23  ? 0.1537 0.2884 0.2984 -0.0091 0.0553  0.0782  183 TYR B C     
1716 O O     . TYR B 23  ? 0.1989 0.3093 0.3226 -0.0055 0.0515  0.0673  183 TYR B O     
1717 C CB    . TYR B 23  ? 0.2222 0.3631 0.3772 -0.0350 0.0284  0.0852  183 TYR B CB    
1718 C CG    . TYR B 23  ? 0.2469 0.3808 0.3887 -0.0413 0.0357  0.0863  183 TYR B CG    
1719 C CD1   . TYR B 23  ? 0.2483 0.3616 0.3654 -0.0389 0.0403  0.0812  183 TYR B CD1   
1720 C CD2   . TYR B 23  ? 0.3320 0.4779 0.4832 -0.0493 0.0369  0.0922  183 TYR B CD2   
1721 C CE1   . TYR B 23  ? 0.2767 0.3837 0.3799 -0.0440 0.0467  0.0853  183 TYR B CE1   
1722 C CE2   . TYR B 23  ? 0.3559 0.4932 0.4939 -0.0550 0.0445  0.0945  183 TYR B CE2   
1723 C CZ    . TYR B 23  ? 0.3312 0.4488 0.4445 -0.0518 0.0494  0.0919  183 TYR B CZ    
1724 O OH    . TYR B 23  ? 0.3573 0.4650 0.4542 -0.0564 0.0563  0.0962  183 TYR B OH    
1725 N N     . LYS B 24  ? 0.1732 0.3169 0.3174 -0.0067 0.0705  0.0821  184 LYS B N     
1726 C CA    . LYS B 24  ? 0.2582 0.3791 0.3692 -0.0017 0.0802  0.0724  184 LYS B CA    
1727 C C     . LYS B 24  ? 0.2120 0.3401 0.3157 -0.0067 0.0914  0.0793  184 LYS B C     
1728 O O     . LYS B 24  ? 0.2113 0.3617 0.3372 -0.0089 0.0973  0.0888  184 LYS B O     
1729 C CB    . LYS B 24  ? 0.3196 0.4307 0.4237 0.0146  0.0938  0.0642  184 LYS B CB    
1730 C CG    . LYS B 24  ? 0.4024 0.5335 0.5239 0.0262  0.1154  0.0715  184 LYS B CG    
1731 C CD    . LYS B 24  ? 0.4749 0.5834 0.5769 0.0422  0.1313  0.0598  184 LYS B CD    
1732 C CE    . LYS B 24  ? 0.5533 0.6740 0.6655 0.0545  0.1517  0.0642  184 LYS B CE    
1733 N NZ    . LYS B 24  ? 0.6321 0.7228 0.7182 0.0691  0.1686  0.0507  184 LYS B NZ    
1734 N N     . ASP B 25  ? 0.2471 0.3531 0.3162 -0.0092 0.0907  0.0731  185 ASP B N     
1735 C CA    . ASP B 25  ? 0.2820 0.3895 0.3351 -0.0120 0.1033  0.0795  185 ASP B CA    
1736 C C     . ASP B 25  ? 0.2810 0.3648 0.2915 -0.0063 0.1076  0.0684  185 ASP B C     
1737 O O     . ASP B 25  ? 0.2901 0.3592 0.2886 0.0000  0.1042  0.0554  185 ASP B O     
1738 C CB    . ASP B 25  ? 0.3386 0.4468 0.3944 -0.0268 0.0941  0.0902  185 ASP B CB    
1739 C CG    . ASP B 25  ? 0.3625 0.4473 0.3998 -0.0314 0.0754  0.0844  185 ASP B CG    
1740 O OD1   . ASP B 25  ? 0.3144 0.3833 0.3281 -0.0251 0.0709  0.0738  185 ASP B OD1   
1741 O OD2   . ASP B 25  ? 0.3637 0.4461 0.4107 -0.0420 0.0658  0.0907  185 ASP B OD2   
1742 N N     . GLU B 26  ? 0.2713 0.3504 0.2573 -0.0102 0.1143  0.0741  186 GLU B N     
1743 C CA    . GLU B 26  ? 0.3369 0.3955 0.2780 -0.0065 0.1173  0.0647  186 GLU B CA    
1744 C C     . GLU B 26  ? 0.3244 0.3658 0.2479 -0.0098 0.0955  0.0555  186 GLU B C     
1745 O O     . GLU B 26  ? 0.4113 0.4374 0.3029 -0.0077 0.0938  0.0439  186 GLU B O     
1746 C CB    . GLU B 26  ? 0.3799 0.4379 0.2969 -0.0107 0.1275  0.0760  186 GLU B CB    
1747 C CG    . GLU B 26  ? 0.4664 0.5411 0.3963 -0.0074 0.1513  0.0829  186 GLU B CG    
1748 C CD    . GLU B 26  ? 0.5217 0.6186 0.4975 -0.0158 0.1476  0.0942  186 GLU B CD    
1749 O OE1   . GLU B 26  ? 0.5288 0.6269 0.5231 -0.0234 0.1312  0.0983  186 GLU B OE1   
1750 O OE2   . GLU B 26  ? 0.5650 0.6772 0.5562 -0.0153 0.1609  0.0981  186 GLU B OE2   
1751 N N     . GLN B 27  ? 0.2699 0.3142 0.2144 -0.0156 0.0795  0.0603  187 GLN B N     
1752 C CA    . GLN B 27  ? 0.3049 0.3372 0.2372 -0.0180 0.0605  0.0548  187 GLN B CA    
1753 C C     . GLN B 27  ? 0.2921 0.3235 0.2449 -0.0169 0.0505  0.0456  187 GLN B C     
1754 O O     . GLN B 27  ? 0.2984 0.3215 0.2397 -0.0172 0.0398  0.0366  187 GLN B O     
1755 C CB    . GLN B 27  ? 0.3381 0.3685 0.2720 -0.0235 0.0512  0.0676  187 GLN B CB    
1756 C CG    . GLN B 27  ? 0.3952 0.4230 0.3061 -0.0253 0.0595  0.0793  187 GLN B CG    
1757 C CD    . GLN B 27  ? 0.4767 0.4979 0.3922 -0.0303 0.0522  0.0932  187 GLN B CD    
1758 O OE1   . GLN B 27  ? 0.5238 0.5363 0.4327 -0.0284 0.0379  0.0939  187 GLN B OE1   
1759 N NE2   . GLN B 27  ? 0.4934 0.5183 0.4224 -0.0368 0.0625  0.1046  187 GLN B NE2   
1760 N N     . VAL B 28  ? 0.2135 0.2549 0.1966 -0.0170 0.0530  0.0492  188 VAL B N     
1761 C CA    . VAL B 28  ? 0.2067 0.2462 0.2070 -0.0167 0.0433  0.0431  188 VAL B CA    
1762 C C     . VAL B 28  ? 0.1969 0.2463 0.2203 -0.0118 0.0510  0.0430  188 VAL B C     
1763 O O     . VAL B 28  ? 0.1890 0.2524 0.2243 -0.0094 0.0629  0.0501  188 VAL B O     
1764 C CB    . VAL B 28  ? 0.2300 0.2684 0.2422 -0.0231 0.0312  0.0492  188 VAL B CB    
1765 C CG1   . VAL B 28  ? 0.2644 0.2933 0.2579 -0.0248 0.0234  0.0517  188 VAL B CG1   
1766 C CG2   . VAL B 28  ? 0.2257 0.2752 0.2567 -0.0289 0.0350  0.0601  188 VAL B CG2   
1767 N N     . VAL B 29  ? 0.2005 0.2440 0.2316 -0.0097 0.0446  0.0364  189 VAL B N     
1768 C CA    . VAL B 29  ? 0.2004 0.2534 0.2552 -0.0047 0.0481  0.0395  189 VAL B CA    
1769 C C     . VAL B 29  ? 0.1820 0.2336 0.2477 -0.0101 0.0342  0.0406  189 VAL B C     
1770 O O     . VAL B 29  ? 0.1972 0.2362 0.2513 -0.0139 0.0258  0.0350  189 VAL B O     
1771 C CB    . VAL B 29  ? 0.2133 0.2551 0.2622 0.0056  0.0583  0.0308  189 VAL B CB    
1772 C CG1   . VAL B 29  ? 0.2604 0.2812 0.2916 0.0025  0.0504  0.0189  189 VAL B CG1   
1773 C CG2   . VAL B 29  ? 0.2601 0.3131 0.3356 0.0138  0.0622  0.0375  189 VAL B CG2   
1774 N N     . VAL B 30  ? 0.1742 0.2406 0.2619 -0.0108 0.0319  0.0487  190 VAL B N     
1775 C CA    . VAL B 30  ? 0.1638 0.2269 0.2566 -0.0160 0.0197  0.0494  190 VAL B CA    
1776 C C     . VAL B 30  ? 0.1698 0.2358 0.2743 -0.0079 0.0207  0.0509  190 VAL B C     
1777 O O     . VAL B 30  ? 0.1320 0.2148 0.2541 -0.0008 0.0272  0.0582  190 VAL B O     
1778 C CB    . VAL B 30  ? 0.1712 0.2462 0.2745 -0.0270 0.0122  0.0579  190 VAL B CB    
1779 C CG1   . VAL B 30  ? 0.1795 0.2465 0.2804 -0.0328 0.0004  0.0567  190 VAL B CG1   
1780 C CG2   . VAL B 30  ? 0.1600 0.2279 0.2513 -0.0342 0.0129  0.0585  190 VAL B CG2   
1781 N N     . ILE B 31  ? 0.1523 0.2027 0.2483 -0.0080 0.0152  0.0456  191 ILE B N     
1782 C CA    . ILE B 31  ? 0.1586 0.2082 0.2631 -0.0007 0.0153  0.0492  191 ILE B CA    
1783 C C     . ILE B 31  ? 0.1803 0.2237 0.2794 -0.0076 0.0040  0.0503  191 ILE B C     
1784 O O     . ILE B 31  ? 0.1588 0.1926 0.2456 -0.0157 -0.0006 0.0449  191 ILE B O     
1785 C CB    . ILE B 31  ? 0.2042 0.2340 0.2994 0.0080  0.0250  0.0411  191 ILE B CB    
1786 C CG1   . ILE B 31  ? 0.2235 0.2340 0.3016 0.0008  0.0211  0.0308  191 ILE B CG1   
1787 C CG2   . ILE B 31  ? 0.1875 0.2176 0.2800 0.0146  0.0380  0.0374  191 ILE B CG2   
1788 C CD1   . ILE B 31  ? 0.2836 0.2729 0.3515 0.0046  0.0292  0.0217  191 ILE B CD1   
1789 N N     . LYS B 32  ? 0.1790 0.2278 0.2862 -0.0035 0.0003  0.0582  192 LYS B N     
1790 C CA    A LYS B 32  ? 0.2010 0.2396 0.2965 -0.0092 -0.0084 0.0587  192 LYS B CA    
1791 C CA    B LYS B 32  ? 0.2012 0.2397 0.2967 -0.0092 -0.0084 0.0587  192 LYS B CA    
1792 C C     . LYS B 32  ? 0.1998 0.2146 0.2819 -0.0071 -0.0021 0.0501  192 LYS B C     
1793 O O     . LYS B 32  ? 0.1692 0.1754 0.2535 0.0009  0.0067  0.0477  192 LYS B O     
1794 C CB    A LYS B 32  ? 0.2196 0.2701 0.3246 -0.0045 -0.0148 0.0713  192 LYS B CB    
1795 C CB    B LYS B 32  ? 0.2182 0.2690 0.3232 -0.0048 -0.0149 0.0713  192 LYS B CB    
1796 C CG    A LYS B 32  ? 0.2430 0.3237 0.3665 -0.0086 -0.0234 0.0818  192 LYS B CG    
1797 C CG    B LYS B 32  ? 0.2429 0.3226 0.3643 -0.0103 -0.0247 0.0813  192 LYS B CG    
1798 C CD    A LYS B 32  ? 0.2823 0.3780 0.4151 -0.0039 -0.0329 0.0960  192 LYS B CD    
1799 C CD    B LYS B 32  ? 0.2756 0.3689 0.4036 -0.0072 -0.0352 0.0948  192 LYS B CD    
1800 C CE    A LYS B 32  ? 0.3209 0.4088 0.4614 0.0147  -0.0223 0.1013  192 LYS B CE    
1801 C CE    B LYS B 32  ? 0.2950 0.4245 0.4460 -0.0132 -0.0463 0.1066  192 LYS B CE    
1802 N NZ    A LYS B 32  ? 0.3809 0.4863 0.5338 0.0226  -0.0315 0.1189  192 LYS B NZ    
1803 N NZ    B LYS B 32  ? 0.3279 0.4810 0.5096 -0.0018 -0.0354 0.1130  192 LYS B NZ    
1804 N N     . ASP B 33  ? 0.1742 0.1776 0.2426 -0.0146 -0.0055 0.0452  193 ASP B N     
1805 C CA    . ASP B 33  ? 0.1901 0.1758 0.2504 -0.0142 0.0003  0.0393  193 ASP B CA    
1806 C C     . ASP B 33  ? 0.1853 0.1635 0.2456 -0.0081 0.0023  0.0467  193 ASP B C     
1807 O O     . ASP B 33  ? 0.1972 0.1820 0.2563 -0.0074 -0.0045 0.0561  193 ASP B O     
1808 C CB    . ASP B 33  ? 0.2018 0.1800 0.2506 -0.0214 -0.0016 0.0352  193 ASP B CB    
1809 C CG    . ASP B 33  ? 0.2537 0.2216 0.3014 -0.0227 0.0052  0.0285  193 ASP B CG    
1810 O OD1   . ASP B 33  ? 0.2764 0.2338 0.3218 -0.0217 0.0097  0.0304  193 ASP B OD1   
1811 O OD2   . ASP B 33  ? 0.2521 0.2237 0.3023 -0.0251 0.0056  0.0226  193 ASP B OD2   
1812 N N     . LYS B 34  ? 0.2095 0.1725 0.2696 -0.0045 0.0109  0.0430  194 LYS B N     
1813 C CA    . LYS B 34  ? 0.2365 0.1860 0.2956 0.0026  0.0153  0.0507  194 LYS B CA    
1814 C C     . LYS B 34  ? 0.2109 0.1506 0.2572 -0.0024 0.0134  0.0551  194 LYS B C     
1815 O O     . LYS B 34  ? 0.2386 0.1707 0.2807 0.0031  0.0134  0.0661  194 LYS B O     
1816 C CB    . LYS B 34  ? 0.2661 0.1954 0.3248 0.0049  0.0263  0.0430  194 LYS B CB    
1817 C CG    . LYS B 34  ? 0.3283 0.2370 0.3857 0.0139  0.0337  0.0510  194 LYS B CG    
1818 C CD    . LYS B 34  ? 0.4156 0.2994 0.4692 0.0139  0.0452  0.0401  194 LYS B CD    
1819 C CE    . LYS B 34  ? 0.5315 0.3861 0.5813 0.0224  0.0549  0.0476  194 LYS B CE    
1820 N NZ    . LYS B 34  ? 0.6049 0.4665 0.6650 0.0412  0.0573  0.0596  194 LYS B NZ    
1821 N N     . TYR B 35  ? 0.1946 0.1343 0.2340 -0.0118 0.0129  0.0477  195 TYR B N     
1822 C CA    . TYR B 35  ? 0.2178 0.1477 0.2429 -0.0165 0.0143  0.0509  195 TYR B CA    
1823 C C     . TYR B 35  ? 0.2493 0.1876 0.2653 -0.0220 0.0084  0.0480  195 TYR B C     
1824 O O     . TYR B 35  ? 0.2495 0.1852 0.2630 -0.0267 0.0132  0.0411  195 TYR B O     
1825 C CB    . TYR B 35  ? 0.2059 0.1233 0.2324 -0.0220 0.0245  0.0446  195 TYR B CB    
1826 C CG    . TYR B 35  ? 0.2733 0.1758 0.3056 -0.0191 0.0311  0.0449  195 TYR B CG    
1827 C CD1   . TYR B 35  ? 0.2804 0.1658 0.3055 -0.0140 0.0351  0.0557  195 TYR B CD1   
1828 C CD2   . TYR B 35  ? 0.2978 0.2001 0.3394 -0.0212 0.0333  0.0346  195 TYR B CD2   
1829 C CE1   . TYR B 35  ? 0.3484 0.2169 0.3754 -0.0104 0.0415  0.0541  195 TYR B CE1   
1830 C CE2   . TYR B 35  ? 0.3419 0.2237 0.3837 -0.0196 0.0406  0.0327  195 TYR B CE2   
1831 C CZ    . TYR B 35  ? 0.3615 0.2273 0.3959 -0.0135 0.0446  0.0418  195 TYR B CZ    
1832 O OH    . TYR B 35  ? 0.4348 0.2804 0.4663 -0.0108 0.0512  0.0384  195 TYR B OH    
1833 N N     . PRO B 36  ? 0.2453 0.1935 0.2573 -0.0216 -0.0019 0.0537  196 PRO B N     
1834 C CA    . PRO B 36  ? 0.2233 0.1757 0.2258 -0.0285 -0.0079 0.0492  196 PRO B CA    
1835 C C     . PRO B 36  ? 0.2337 0.1704 0.2135 -0.0333 -0.0032 0.0462  196 PRO B C     
1836 O O     . PRO B 36  ? 0.2758 0.2028 0.2410 -0.0329 -0.0012 0.0524  196 PRO B O     
1837 C CB    . PRO B 36  ? 0.2221 0.1880 0.2244 -0.0296 -0.0209 0.0581  196 PRO B CB    
1838 C CG    . PRO B 36  ? 0.2567 0.2223 0.2614 -0.0218 -0.0212 0.0696  196 PRO B CG    
1839 C CD    . PRO B 36  ? 0.2225 0.1784 0.2392 -0.0152 -0.0085 0.0657  196 PRO B CD    
1840 N N     . LYS B 37  ? 0.2247 0.1576 0.2006 -0.0366 0.0002  0.0377  197 LYS B N     
1841 C CA    . LYS B 37  ? 0.2773 0.1942 0.2324 -0.0390 0.0086  0.0339  197 LYS B CA    
1842 C C     . LYS B 37  ? 0.2926 0.1989 0.2211 -0.0457 0.0017  0.0315  197 LYS B C     
1843 O O     . LYS B 37  ? 0.3395 0.2281 0.2454 -0.0475 0.0097  0.0262  197 LYS B O     
1844 C CB    . LYS B 37  ? 0.2280 0.1459 0.1970 -0.0360 0.0196  0.0269  197 LYS B CB    
1845 C CG    . LYS B 37  ? 0.2223 0.1494 0.2140 -0.0335 0.0254  0.0280  197 LYS B CG    
1846 C CD    . LYS B 37  ? 0.2738 0.1917 0.2563 -0.0344 0.0307  0.0345  197 LYS B CD    
1847 C CE    . LYS B 37  ? 0.2653 0.1870 0.2681 -0.0352 0.0385  0.0341  197 LYS B CE    
1848 N NZ    . LYS B 37  ? 0.2366 0.1670 0.2572 -0.0341 0.0319  0.0318  197 LYS B NZ    
1849 N N     . ALA B 38  ? 0.2718 0.1887 0.2031 -0.0501 -0.0126 0.0352  198 ALA B N     
1850 C CA    . ALA B 38  ? 0.2765 0.1850 0.1826 -0.0606 -0.0229 0.0333  198 ALA B CA    
1851 C C     . ALA B 38  ? 0.2946 0.2252 0.2121 -0.0644 -0.0398 0.0432  198 ALA B C     
1852 O O     . ALA B 38  ? 0.2769 0.2258 0.2206 -0.0562 -0.0402 0.0508  198 ALA B O     
1853 C CB    . ALA B 38  ? 0.2629 0.1610 0.1669 -0.0649 -0.0203 0.0237  198 ALA B CB    
1854 N N     . ARG B 39  ? 0.3135 0.2425 0.2119 -0.0770 -0.0531 0.0429  199 ARG B N     
1855 C CA    . ARG B 39  ? 0.3333 0.2897 0.2468 -0.0821 -0.0709 0.0539  199 ARG B CA    
1856 C C     . ARG B 39  ? 0.2936 0.2740 0.2461 -0.0783 -0.0707 0.0567  199 ARG B C     
1857 O O     . ARG B 39  ? 0.2678 0.2752 0.2460 -0.0725 -0.0768 0.0683  199 ARG B O     
1858 C CB    . ARG B 39  ? 0.3527 0.3031 0.2384 -0.1008 -0.0865 0.0510  199 ARG B CB    
1859 C CG    . ARG B 39  ? 0.4450 0.3770 0.2890 -0.1049 -0.0903 0.0515  199 ARG B CG    
1860 C CD    . ARG B 39  ? 0.4918 0.4130 0.3014 -0.1261 -0.1064 0.0458  199 ARG B CD    
1861 N NE    . ARG B 39  ? 0.5781 0.4711 0.3371 -0.1300 -0.1048 0.0418  199 ARG B NE    
1862 C CZ    . ARG B 39  ? 0.6657 0.5384 0.3921 -0.1439 -0.1088 0.0323  199 ARG B CZ    
1863 N NH1   . ARG B 39  ? 0.6617 0.5381 0.3977 -0.1571 -0.1163 0.0273  199 ARG B NH1   
1864 N NH2   . ARG B 39  ? 0.6998 0.5480 0.3851 -0.1439 -0.1029 0.0285  199 ARG B NH2   
1865 N N     . TYR B 40  ? 0.2304 0.2002 0.1863 -0.0804 -0.0626 0.0471  200 TYR B N     
1866 C CA    . TYR B 40  ? 0.2350 0.2231 0.2224 -0.0761 -0.0592 0.0492  200 TYR B CA    
1867 C C     . TYR B 40  ? 0.2518 0.2269 0.2433 -0.0658 -0.0439 0.0420  200 TYR B C     
1868 O O     . TYR B 40  ? 0.2747 0.2273 0.2490 -0.0675 -0.0373 0.0335  200 TYR B O     
1869 C CB    . TYR B 40  ? 0.2607 0.2517 0.2496 -0.0907 -0.0664 0.0474  200 TYR B CB    
1870 C CG    . TYR B 40  ? 0.3083 0.3181 0.2973 -0.1043 -0.0843 0.0550  200 TYR B CG    
1871 C CD1   . TYR B 40  ? 0.3095 0.3573 0.3323 -0.1019 -0.0913 0.0679  200 TYR B CD1   
1872 C CD2   . TYR B 40  ? 0.3889 0.3795 0.3440 -0.1195 -0.0943 0.0497  200 TYR B CD2   
1873 C CE1   . TYR B 40  ? 0.3688 0.4361 0.3940 -0.1103 -0.1049 0.0757  200 TYR B CE1   
1874 C CE2   . TYR B 40  ? 0.4328 0.4416 0.3871 -0.1300 -0.1096 0.0566  200 TYR B CE2   
1875 C CZ    . TYR B 40  ? 0.4205 0.4687 0.4119 -0.1246 -0.1142 0.0700  200 TYR B CZ    
1876 O OH    . TYR B 40  ? 0.4598 0.5273 0.4540 -0.1330 -0.1269 0.0773  200 TYR B OH    
1877 N N     . HIS B 41  ? 0.1950 0.1843 0.2090 -0.0550 -0.0382 0.0455  201 HIS B N     
1878 C CA    . HIS B 41  ? 0.1739 0.1549 0.1924 -0.0472 -0.0266 0.0392  201 HIS B CA    
1879 C C     . HIS B 41  ? 0.2182 0.2162 0.2590 -0.0406 -0.0235 0.0420  201 HIS B C     
1880 O O     . HIS B 41  ? 0.1958 0.2015 0.2466 -0.0333 -0.0216 0.0465  201 HIS B O     
1881 C CB    . HIS B 41  ? 0.1701 0.1397 0.1805 -0.0416 -0.0200 0.0377  201 HIS B CB    
1882 C CG    . HIS B 41  ? 0.1926 0.1560 0.2080 -0.0369 -0.0101 0.0311  201 HIS B CG    
1883 N ND1   . HIS B 41  ? 0.2143 0.1697 0.2268 -0.0340 -0.0026 0.0295  201 HIS B ND1   
1884 C CD2   . HIS B 41  ? 0.2033 0.1702 0.2276 -0.0353 -0.0075 0.0272  201 HIS B CD2   
1885 C CE1   . HIS B 41  ? 0.2159 0.1733 0.2383 -0.0317 0.0031  0.0245  201 HIS B CE1   
1886 N NE2   . HIS B 41  ? 0.1727 0.1367 0.2009 -0.0317 -0.0004 0.0233  201 HIS B NE2   
1887 N N     . TRP B 42  ? 0.1570 0.1579 0.2029 -0.0426 -0.0218 0.0399  202 TRP B N     
1888 C CA    . TRP B 42  ? 0.1783 0.1924 0.2392 -0.0368 -0.0169 0.0415  202 TRP B CA    
1889 C C     . TRP B 42  ? 0.1806 0.1862 0.2375 -0.0330 -0.0108 0.0348  202 TRP B C     
1890 O O     . TRP B 42  ? 0.1912 0.1849 0.2389 -0.0349 -0.0107 0.0310  202 TRP B O     
1891 C CB    . TRP B 42  ? 0.1789 0.2071 0.2491 -0.0428 -0.0196 0.0470  202 TRP B CB    
1892 C CG    . TRP B 42  ? 0.1811 0.2267 0.2621 -0.0478 -0.0275 0.0554  202 TRP B CG    
1893 C CD1   . TRP B 42  ? 0.1978 0.2640 0.2975 -0.0403 -0.0268 0.0634  202 TRP B CD1   
1894 C CD2   . TRP B 42  ? 0.2105 0.2558 0.2851 -0.0619 -0.0380 0.0575  202 TRP B CD2   
1895 N NE1   . TRP B 42  ? 0.1849 0.2696 0.2942 -0.0486 -0.0379 0.0721  202 TRP B NE1   
1896 C CE2   . TRP B 42  ? 0.2080 0.2795 0.3002 -0.0637 -0.0458 0.0677  202 TRP B CE2   
1897 C CE3   . TRP B 42  ? 0.2249 0.2486 0.2796 -0.0731 -0.0412 0.0515  202 TRP B CE3   
1898 C CZ2   . TRP B 42  ? 0.2562 0.3350 0.3454 -0.0785 -0.0590 0.0714  202 TRP B CZ2   
1899 C CZ3   . TRP B 42  ? 0.2512 0.2759 0.2984 -0.0868 -0.0519 0.0529  202 TRP B CZ3   
1900 C CH2   . TRP B 42  ? 0.2551 0.3074 0.3180 -0.0898 -0.0613 0.0622  202 TRP B CH2   
1901 N N     . LEU B 43  ? 0.1542 0.1663 0.2175 -0.0272 -0.0057 0.0338  203 LEU B N     
1902 C CA    . LEU B 43  ? 0.1598 0.1681 0.2183 -0.0254 -0.0026 0.0283  203 LEU B CA    
1903 C C     . LEU B 43  ? 0.1617 0.1787 0.2210 -0.0249 0.0002  0.0310  203 LEU B C     
1904 O O     . LEU B 43  ? 0.1873 0.2138 0.2541 -0.0220 0.0044  0.0345  203 LEU B O     
1905 C CB    . LEU B 43  ? 0.1850 0.1885 0.2431 -0.0213 0.0016  0.0226  203 LEU B CB    
1906 C CG    . LEU B 43  ? 0.2140 0.2085 0.2719 -0.0217 0.0018  0.0210  203 LEU B CG    
1907 C CD1   . LEU B 43  ? 0.2460 0.2331 0.3033 -0.0198 0.0069  0.0154  203 LEU B CD1   
1908 C CD2   . LEU B 43  ? 0.2340 0.2248 0.2888 -0.0251 -0.0004 0.0189  203 LEU B CD2   
1909 N N     . VAL B 44  ? 0.1698 0.1840 0.2217 -0.0266 -0.0011 0.0309  204 VAL B N     
1910 C CA    . VAL B 44  ? 0.1824 0.2025 0.2301 -0.0261 0.0026  0.0341  204 VAL B CA    
1911 C C     . VAL B 44  ? 0.1752 0.1929 0.2119 -0.0229 0.0032  0.0279  204 VAL B C     
1912 O O     . VAL B 44  ? 0.2127 0.2271 0.2459 -0.0233 -0.0023 0.0259  204 VAL B O     
1913 C CB    . VAL B 44  ? 0.1991 0.2153 0.2429 -0.0309 0.0004  0.0407  204 VAL B CB    
1914 C CG1   . VAL B 44  ? 0.2078 0.2303 0.2463 -0.0311 0.0060  0.0461  204 VAL B CG1   
1915 C CG2   . VAL B 44  ? 0.2010 0.2157 0.2521 -0.0379 -0.0025 0.0443  204 VAL B CG2   
1916 N N     . LEU B 45  ? 0.1516 0.1713 0.1828 -0.0200 0.0098  0.0247  205 LEU B N     
1917 C CA    . LEU B 45  ? 0.2074 0.2217 0.2239 -0.0196 0.0097  0.0162  205 LEU B CA    
1918 C C     . LEU B 45  ? 0.2358 0.2520 0.2351 -0.0188 0.0147  0.0178  205 LEU B C     
1919 O O     . LEU B 45  ? 0.2319 0.2518 0.2328 -0.0156 0.0249  0.0212  205 LEU B O     
1920 C CB    . LEU B 45  ? 0.2407 0.2470 0.2586 -0.0168 0.0159  0.0085  205 LEU B CB    
1921 C CG    . LEU B 45  ? 0.3024 0.3074 0.3370 -0.0162 0.0140  0.0108  205 LEU B CG    
1922 C CD1   . LEU B 45  ? 0.3972 0.3981 0.4382 -0.0096 0.0228  0.0110  205 LEU B CD1   
1923 C CD2   . LEU B 45  ? 0.3207 0.3194 0.3550 -0.0208 0.0078  0.0051  205 LEU B CD2   
1924 N N     . PRO B 46  ? 0.2522 0.2678 0.2351 -0.0213 0.0076  0.0165  206 PRO B N     
1925 C CA    . PRO B 46  ? 0.2541 0.2694 0.2144 -0.0208 0.0127  0.0184  206 PRO B CA    
1926 C C     . PRO B 46  ? 0.2836 0.2889 0.2241 -0.0204 0.0201  0.0061  206 PRO B C     
1927 O O     . PRO B 46  ? 0.3064 0.3043 0.2459 -0.0234 0.0155  -0.0042 206 PRO B O     
1928 C CB    . PRO B 46  ? 0.3006 0.3193 0.2496 -0.0232 -0.0001 0.0228  206 PRO B CB    
1929 C CG    . PRO B 46  ? 0.3216 0.3429 0.2849 -0.0253 -0.0104 0.0178  206 PRO B CG    
1930 C CD    . PRO B 46  ? 0.2815 0.2998 0.2673 -0.0240 -0.0049 0.0163  206 PRO B CD    
1931 N N     . TRP B 47  ? 0.2825 0.2855 0.2066 -0.0171 0.0329  0.0071  207 TRP B N     
1932 C CA    . TRP B 47  ? 0.3318 0.3197 0.2305 -0.0157 0.0430  -0.0058 207 TRP B CA    
1933 C C     . TRP B 47  ? 0.3962 0.3763 0.2641 -0.0241 0.0303  -0.0149 207 TRP B C     
1934 O O     . TRP B 47  ? 0.4573 0.4216 0.3100 -0.0282 0.0303  -0.0294 207 TRP B O     
1935 C CB    . TRP B 47  ? 0.3440 0.3324 0.2304 -0.0094 0.0619  -0.0015 207 TRP B CB    
1936 C CG    . TRP B 47  ? 0.4003 0.4001 0.3196 -0.0015 0.0749  0.0064  207 TRP B CG    
1937 C CD1   . TRP B 47  ? 0.3799 0.3983 0.3188 -0.0008 0.0801  0.0212  207 TRP B CD1   
1938 C CD2   . TRP B 47  ? 0.4113 0.4063 0.3492 0.0059  0.0829  0.0014  207 TRP B CD2   
1939 N NE1   . TRP B 47  ? 0.3763 0.4062 0.3466 0.0059  0.0892  0.0257  207 TRP B NE1   
1940 C CE2   . TRP B 47  ? 0.4202 0.4360 0.3902 0.0116  0.0911  0.0146  207 TRP B CE2   
1941 C CE3   . TRP B 47  ? 0.4586 0.4332 0.3893 0.0077  0.0837  -0.0118 207 TRP B CE3   
1942 C CZ2   . TRP B 47  ? 0.4522 0.4721 0.4479 0.0212  0.0989  0.0162  207 TRP B CZ2   
1943 C CZ3   . TRP B 47  ? 0.4951 0.4683 0.4490 0.0177  0.0935  -0.0103 207 TRP B CZ3   
1944 C CH2   . TRP B 47  ? 0.4698 0.4670 0.4563 0.0254  0.1003  0.0043  207 TRP B CH2   
1945 N N     . THR B 48  ? 0.3975 0.3882 0.2560 -0.0272 0.0189  -0.0055 208 THR B N     
1946 C CA    . THR B 48  ? 0.4600 0.4511 0.2948 -0.0355 0.0022  -0.0107 208 THR B CA    
1947 C C     . THR B 48  ? 0.4460 0.4511 0.3101 -0.0385 -0.0148 -0.0066 208 THR B C     
1948 O O     . THR B 48  ? 0.4103 0.4278 0.2918 -0.0345 -0.0205 0.0074  208 THR B O     
1949 C CB    . THR B 48  ? 0.5137 0.5096 0.3199 -0.0355 -0.0015 -0.0003 208 THR B CB    
1950 O OG1   . THR B 48  ? 0.5684 0.5519 0.3469 -0.0321 0.0177  -0.0031 208 THR B OG1   
1951 C CG2   . THR B 48  ? 0.5382 0.5383 0.3196 -0.0447 -0.0217 -0.0050 208 THR B CG2   
1952 N N     . SER B 49  ? 0.4145 0.4156 0.2838 -0.0456 -0.0210 -0.0189 209 SER B N     
1953 C CA    . SER B 49  ? 0.3836 0.3983 0.2854 -0.0477 -0.0321 -0.0155 209 SER B CA    
1954 C C     . SER B 49  ? 0.3612 0.3971 0.2657 -0.0502 -0.0507 -0.0064 209 SER B C     
1955 O O     . SER B 49  ? 0.3526 0.3920 0.2293 -0.0545 -0.0597 -0.0062 209 SER B O     
1956 C CB    . SER B 49  ? 0.4043 0.4085 0.3113 -0.0562 -0.0321 -0.0300 209 SER B CB    
1957 O OG    . SER B 49  ? 0.5034 0.5038 0.3834 -0.0685 -0.0421 -0.0412 209 SER B OG    
1958 N N     . ILE B 50  ? 0.3341 0.3840 0.2714 -0.0464 -0.0557 0.0021  210 ILE B N     
1959 C CA    . ILE B 50  ? 0.3521 0.4255 0.3020 -0.0464 -0.0723 0.0116  210 ILE B CA    
1960 C C     . ILE B 50  ? 0.3343 0.4186 0.3098 -0.0542 -0.0779 0.0046  210 ILE B C     
1961 O O     . ILE B 50  ? 0.3125 0.3876 0.3060 -0.0527 -0.0673 0.0008  210 ILE B O     
1962 C CB    . ILE B 50  ? 0.3735 0.4522 0.3423 -0.0335 -0.0698 0.0280  210 ILE B CB    
1963 C CG1   . ILE B 50  ? 0.4318 0.4950 0.3800 -0.0278 -0.0595 0.0345  210 ILE B CG1   
1964 C CG2   . ILE B 50  ? 0.3824 0.4855 0.3630 -0.0296 -0.0858 0.0406  210 ILE B CG2   
1965 C CD1   . ILE B 50  ? 0.4412 0.4999 0.4061 -0.0180 -0.0536 0.0477  210 ILE B CD1   
1966 N N     . SER B 51  ? 0.4023 0.5073 0.3795 -0.0634 -0.0948 0.0037  211 SER B N     
1967 C CA    . SER B 51  ? 0.4189 0.5345 0.4186 -0.0753 -0.0997 -0.0043 211 SER B CA    
1968 C C     . SER B 51  ? 0.3676 0.4963 0.4084 -0.0671 -0.0940 0.0044  211 SER B C     
1969 O O     . SER B 51  ? 0.3943 0.5146 0.4494 -0.0720 -0.0852 -0.0028 211 SER B O     
1970 C CB    . SER B 51  ? 0.4782 0.6186 0.4739 -0.0887 -0.1212 -0.0056 211 SER B CB    
1971 O OG    . SER B 51  ? 0.5050 0.6725 0.5194 -0.0763 -0.1305 0.0117  211 SER B OG    
1972 N N     . SER B 52  ? 0.3096 0.4560 0.3667 -0.0538 -0.0976 0.0202  212 SER B N     
1973 C CA    . SER B 52  ? 0.3169 0.4712 0.4079 -0.0435 -0.0892 0.0283  212 SER B CA    
1974 C C     . SER B 52  ? 0.2917 0.4500 0.3865 -0.0262 -0.0891 0.0445  212 SER B C     
1975 O O     . SER B 52  ? 0.3007 0.4608 0.3754 -0.0235 -0.0978 0.0510  212 SER B O     
1976 C CB    . SER B 52  ? 0.3406 0.5261 0.4652 -0.0512 -0.0970 0.0293  212 SER B CB    
1977 O OG    . SER B 52  ? 0.3451 0.5564 0.4787 -0.0448 -0.1091 0.0395  212 SER B OG    
1978 N N     . LEU B 53  ? 0.2667 0.4225 0.3837 -0.0145 -0.0780 0.0509  213 LEU B N     
1979 C CA    . LEU B 53  ? 0.2906 0.4434 0.4110 0.0027  -0.0754 0.0657  213 LEU B CA    
1980 C C     . LEU B 53  ? 0.2997 0.4845 0.4321 0.0086  -0.0917 0.0798  213 LEU B C     
1981 O O     . LEU B 53  ? 0.3095 0.4896 0.4319 0.0203  -0.0944 0.0929  213 LEU B O     
1982 C CB    . LEU B 53  ? 0.2626 0.4064 0.4037 0.0134  -0.0601 0.0682  213 LEU B CB    
1983 C CG    . LEU B 53  ? 0.2795 0.3890 0.4040 0.0107  -0.0455 0.0587  213 LEU B CG    
1984 C CD1   . LEU B 53  ? 0.2906 0.3899 0.4300 0.0206  -0.0312 0.0607  213 LEU B CD1   
1985 C CD2   . LEU B 53  ? 0.2823 0.3685 0.3793 0.0122  -0.0445 0.0613  213 LEU B CD2   
1986 N N     . LYS B 54  ? 0.2939 0.5053 0.4435 -0.0002 -0.1003 0.0752  214 LYS B N     
1987 C CA    . LYS B 54  ? 0.3211 0.5565 0.4782 0.0045  -0.1125 0.0836  214 LYS B CA    
1988 C C     . LYS B 54  ? 0.3056 0.5380 0.4282 -0.0009 -0.1268 0.0845  214 LYS B C     
1989 O O     . LYS B 54  ? 0.2971 0.5431 0.4193 0.0068  -0.1366 0.0953  214 LYS B O     
1990 C CB    . LYS B 54  ? 0.3542 0.6170 0.5379 -0.0055 -0.1173 0.0772  214 LYS B CB    
1991 C CG    . LYS B 54  ? 0.3609 0.6301 0.5789 0.0026  -0.1018 0.0795  214 LYS B CG    
1992 C CD    . LYS B 54  ? 0.4166 0.7196 0.6648 -0.0029 -0.1077 0.0795  214 LYS B CD    
1993 C CE    . LYS B 54  ? 0.4339 0.7437 0.7142 0.0072  -0.0900 0.0833  214 LYS B CE    
1994 N NZ    . LYS B 54  ? 0.4528 0.7992 0.7658 0.0025  -0.0949 0.0852  214 LYS B NZ    
1995 N N     . ALA B 55  ? 0.3328 0.5464 0.4249 -0.0136 -0.1268 0.0735  215 ALA B N     
1996 C CA    . ALA B 55  ? 0.3554 0.5624 0.4088 -0.0195 -0.1373 0.0725  215 ALA B CA    
1997 C C     . ALA B 55  ? 0.3551 0.5401 0.3845 -0.0082 -0.1305 0.0837  215 ALA B C     
1998 O O     . ALA B 55  ? 0.4079 0.5859 0.4040 -0.0098 -0.1363 0.0863  215 ALA B O     
1999 C CB    . ALA B 55  ? 0.3551 0.5508 0.3836 -0.0394 -0.1392 0.0533  215 ALA B CB    
2000 N N     . VAL B 56  ? 0.2768 0.4486 0.3216 0.0026  -0.1170 0.0902  216 VAL B N     
2001 C CA    . VAL B 56  ? 0.2968 0.4418 0.3210 0.0121  -0.1071 0.0997  216 VAL B CA    
2002 C C     . VAL B 56  ? 0.3178 0.4659 0.3348 0.0244  -0.1135 0.1162  216 VAL B C     
2003 O O     . VAL B 56  ? 0.3201 0.4846 0.3621 0.0343  -0.1177 0.1233  216 VAL B O     
2004 C CB    . VAL B 56  ? 0.2522 0.3744 0.2938 0.0200  -0.0884 0.0984  216 VAL B CB    
2005 C CG1   . VAL B 56  ? 0.2863 0.3815 0.3117 0.0293  -0.0793 0.1104  216 VAL B CG1   
2006 C CG2   . VAL B 56  ? 0.2694 0.3772 0.3079 0.0079  -0.0779 0.0795  216 VAL B CG2   
2007 N N     . ALA B 57  ? 0.3579 0.4889 0.3399 0.0237  -0.1125 0.1214  217 ALA B N     
2008 C CA    . ALA B 57  ? 0.3296 0.4563 0.3002 0.0353  -0.1164 0.1367  217 ALA B CA    
2009 C C     . ALA B 57  ? 0.3417 0.4354 0.2879 0.0388  -0.1028 0.1449  217 ALA B C     
2010 O O     . ALA B 57  ? 0.3208 0.3984 0.2626 0.0324  -0.0907 0.1391  217 ALA B O     
2011 C CB    . ALA B 57  ? 0.3834 0.5274 0.3319 0.0285  -0.1334 0.1351  217 ALA B CB    
2012 N N     . ARG B 58  ? 0.3505 0.3256 0.3674 0.0151  -0.0814 0.1352  218 ARG B N     
2013 C CA    . ARG B 58  ? 0.3749 0.3401 0.3778 0.0138  -0.0699 0.1392  218 ARG B CA    
2014 C C     . ARG B 58  ? 0.3795 0.3491 0.3528 0.0101  -0.0616 0.1320  218 ARG B C     
2015 O O     . ARG B 58  ? 0.3980 0.3682 0.3711 0.0066  -0.0485 0.1334  218 ARG B O     
2016 C CB    . ARG B 58  ? 0.4666 0.4248 0.4661 0.0140  -0.0795 0.1586  218 ARG B CB    
2017 C CG    . ARG B 58  ? 0.5351 0.4864 0.5664 0.0220  -0.0829 0.1586  218 ARG B CG    
2018 C CD    . ARG B 58  ? 0.5583 0.4971 0.5884 0.0204  -0.0904 0.1712  218 ARG B CD    
2019 N NE    . ARG B 58  ? 0.5814 0.5129 0.6409 0.0334  -0.0982 0.1684  218 ARG B NE    
2020 C CZ    . ARG B 58  ? 0.6186 0.5327 0.6970 0.0427  -0.0987 0.1611  218 ARG B CZ    
2021 N NH1   . ARG B 58  ? 0.6136 0.5147 0.6871 0.0359  -0.0922 0.1577  218 ARG B NH1   
2022 N NH2   . ARG B 58  ? 0.6442 0.5545 0.7462 0.0610  -0.1074 0.1554  218 ARG B NH2   
2023 N N     . GLU B 59  ? 0.3813 0.3549 0.3312 0.0129  -0.0718 0.1232  219 GLU B N     
2024 C CA    . GLU B 59  ? 0.4166 0.3991 0.3357 0.0175  -0.0657 0.1107  219 GLU B CA    
2025 C C     . GLU B 59  ? 0.3801 0.3620 0.3131 0.0165  -0.0542 0.0968  219 GLU B C     
2026 O O     . GLU B 59  ? 0.3869 0.3807 0.3025 0.0213  -0.0441 0.0888  219 GLU B O     
2027 C CB    . GLU B 59  ? 0.5135 0.4920 0.4054 0.0259  -0.0868 0.0959  219 GLU B CB    
2028 C CG    . GLU B 59  ? 0.5962 0.5581 0.5121 0.0229  -0.1051 0.0840  219 GLU B CG    
2029 C CD    . GLU B 59  ? 0.7225 0.6715 0.6234 0.0264  -0.1369 0.0767  219 GLU B CD    
2030 O OE1   . GLU B 59  ? 0.7876 0.7242 0.6646 0.0363  -0.1532 0.0535  219 GLU B OE1   
2031 O OE2   . GLU B 59  ? 0.7550 0.7045 0.6691 0.0208  -0.1487 0.0926  219 GLU B OE2   
2032 N N     . HIS B 60  ? 0.2949 0.2695 0.2595 0.0117  -0.0555 0.0954  220 HIS B N     
2033 C CA    . HIS B 60  ? 0.2640 0.2397 0.2423 0.0095  -0.0470 0.0851  220 HIS B CA    
2034 C C     . HIS B 60  ? 0.2378 0.2154 0.2311 0.0058  -0.0306 0.0910  220 HIS B C     
2035 O O     . HIS B 60  ? 0.2841 0.2639 0.2876 0.0037  -0.0235 0.0837  220 HIS B O     
2036 C CB    . HIS B 60  ? 0.2602 0.2356 0.2637 0.0055  -0.0594 0.0840  220 HIS B CB    
2037 C CG    . HIS B 60  ? 0.3311 0.2966 0.3279 0.0059  -0.0844 0.0785  220 HIS B CG    
2038 N ND1   . HIS B 60  ? 0.3736 0.3394 0.3811 0.0028  -0.1024 0.0892  220 HIS B ND1   
2039 C CD2   . HIS B 60  ? 0.3779 0.3295 0.3599 0.0105  -0.0992 0.0618  220 HIS B CD2   
2040 C CE1   . HIS B 60  ? 0.3745 0.3241 0.3739 0.0027  -0.1295 0.0801  220 HIS B CE1   
2041 N NE2   . HIS B 60  ? 0.4074 0.3455 0.3899 0.0091  -0.1290 0.0613  220 HIS B NE2   
2042 N N     . LEU B 61  ? 0.2474 0.2203 0.2433 0.0050  -0.0294 0.1039  221 LEU B N     
2043 C CA    . LEU B 61  ? 0.3124 0.2768 0.3252 0.0029  -0.0231 0.1068  221 LEU B CA    
2044 C C     . LEU B 61  ? 0.3051 0.2733 0.3149 -0.0039 -0.0129 0.1063  221 LEU B C     
2045 O O     . LEU B 61  ? 0.2974 0.2601 0.3206 -0.0053 -0.0096 0.0990  221 LEU B O     
2046 C CB    . LEU B 61  ? 0.3250 0.2760 0.3436 0.0033  -0.0314 0.1219  221 LEU B CB    
2047 C CG    . LEU B 61  ? 0.3763 0.3066 0.4141 0.0041  -0.0351 0.1219  221 LEU B CG    
2048 C CD1   . LEU B 61  ? 0.3819 0.3141 0.4329 0.0166  -0.0332 0.1022  221 LEU B CD1   
2049 C CD2   . LEU B 61  ? 0.4022 0.3132 0.4486 0.0050  -0.0502 0.1385  221 LEU B CD2   
2050 N N     A GLU B 62  ? 0.3012 0.2847 0.2933 -0.0065 -0.0082 0.1147  222 GLU B N     
2051 N N     B GLU B 62  ? 0.3003 0.2838 0.2920 -0.0064 -0.0084 0.1147  222 GLU B N     
2052 C CA    A GLU B 62  ? 0.2936 0.2919 0.2883 -0.0125 0.0024  0.1187  222 GLU B CA    
2053 C CA    B GLU B 62  ? 0.3052 0.3049 0.2979 -0.0120 0.0025  0.1189  222 GLU B CA    
2054 C C     A GLU B 62  ? 0.2483 0.2507 0.2460 -0.0084 0.0073  0.0987  222 GLU B C     
2055 C C     B GLU B 62  ? 0.2546 0.2567 0.2521 -0.0083 0.0071  0.0989  222 GLU B C     
2056 O O     A GLU B 62  ? 0.2328 0.2370 0.2447 -0.0142 0.0123  0.0983  222 GLU B O     
2057 O O     B GLU B 62  ? 0.2296 0.2319 0.2421 -0.0145 0.0116  0.0987  222 GLU B O     
2058 C CB    A GLU B 62  ? 0.3618 0.3919 0.3370 -0.0126 0.0093  0.1350  222 GLU B CB    
2059 C CB    B GLU B 62  ? 0.3663 0.3981 0.3354 -0.0091 0.0090  0.1307  222 GLU B CB    
2060 C CG    A GLU B 62  ? 0.4317 0.4629 0.4124 -0.0238 0.0039  0.1659  222 GLU B CG    
2061 C CG    B GLU B 62  ? 0.4154 0.4790 0.3908 -0.0148 0.0220  0.1433  222 GLU B CG    
2062 C CD    A GLU B 62  ? 0.4698 0.4732 0.4832 -0.0372 -0.0050 0.1764  222 GLU B CD    
2063 C CD    B GLU B 62  ? 0.5731 0.6846 0.5218 -0.0063 0.0319  0.1550  222 GLU B CD    
2064 O OE1   A GLU B 62  ? 0.3862 0.3976 0.4151 -0.0453 -0.0004 0.1781  222 GLU B OE1   
2065 O OE1   B GLU B 62  ? 0.6118 0.7293 0.5305 0.0122  0.0300  0.1339  222 GLU B OE1   
2066 O OE2   A GLU B 62  ? 0.5670 0.5396 0.5910 -0.0367 -0.0194 0.1767  222 GLU B OE2   
2067 O OE2   B GLU B 62  ? 0.6177 0.7635 0.5755 -0.0176 0.0393  0.1863  222 GLU B OE2   
2068 N N     . LEU B 63  ? 0.2473 0.2485 0.2345 0.0004  0.0015  0.0840  223 LEU B N     
2069 C CA    . LEU B 63  ? 0.2266 0.2272 0.2209 0.0029  0.0003  0.0685  223 LEU B CA    
2070 C C     . LEU B 63  ? 0.2321 0.2238 0.2481 -0.0035 -0.0002 0.0680  223 LEU B C     
2071 O O     . LEU B 63  ? 0.2469 0.2422 0.2725 -0.0063 0.0037  0.0632  223 LEU B O     
2072 C CB    . LEU B 63  ? 0.2645 0.2579 0.2483 0.0110  -0.0149 0.0564  223 LEU B CB    
2073 C CG    . LEU B 63  ? 0.2503 0.2369 0.2464 0.0119  -0.0247 0.0443  223 LEU B CG    
2074 C CD1   . LEU B 63  ? 0.2810 0.2792 0.2754 0.0180  -0.0155 0.0355  223 LEU B CD1   
2075 C CD2   . LEU B 63  ? 0.2979 0.2689 0.2858 0.0185  -0.0487 0.0342  223 LEU B CD2   
2076 N N     . LEU B 64  ? 0.2503 0.2354 0.2730 -0.0030 -0.0049 0.0726  224 LEU B N     
2077 C CA    . LEU B 64  ? 0.2552 0.2422 0.2934 -0.0026 -0.0039 0.0701  224 LEU B CA    
2078 C C     . LEU B 64  ? 0.2437 0.2225 0.2855 -0.0052 0.0009  0.0678  224 LEU B C     
2079 O O     . LEU B 64  ? 0.2214 0.2049 0.2689 -0.0055 0.0026  0.0607  224 LEU B O     
2080 C CB    . LEU B 64  ? 0.2710 0.2606 0.3163 0.0040  -0.0088 0.0746  224 LEU B CB    
2081 C CG    . LEU B 64  ? 0.2999 0.3017 0.3507 0.0031  -0.0180 0.0802  224 LEU B CG    
2082 C CD1   . LEU B 64  ? 0.3379 0.3492 0.3998 0.0103  -0.0223 0.0881  224 LEU B CD1   
2083 C CD2   . LEU B 64  ? 0.2859 0.3050 0.3500 -0.0019 -0.0199 0.0812  224 LEU B CD2   
2084 N N     . LYS B 65  ? 0.2314 0.1985 0.2711 -0.0087 -0.0003 0.0765  225 LYS B N     
2085 C CA    . LYS B 65  ? 0.2150 0.1691 0.2639 -0.0151 -0.0032 0.0785  225 LYS B CA    
2086 C C     . LYS B 65  ? 0.2590 0.2274 0.3108 -0.0229 0.0036  0.0782  225 LYS B C     
2087 O O     . LYS B 65  ? 0.2365 0.1984 0.2972 -0.0267 0.0000  0.0726  225 LYS B O     
2088 C CB    . LYS B 65  ? 0.2635 0.2054 0.3162 -0.0223 -0.0101 0.0972  225 LYS B CB    
2089 C CG    . LYS B 65  ? 0.2796 0.2016 0.3347 -0.0136 -0.0214 0.0980  225 LYS B CG    
2090 C CD    . LYS B 65  ? 0.3442 0.2533 0.4066 -0.0245 -0.0321 0.1228  225 LYS B CD    
2091 C CE    . LYS B 65  ? 0.4368 0.3195 0.5063 -0.0144 -0.0482 0.1231  225 LYS B CE    
2092 N NZ    . LYS B 65  ? 0.5100 0.3857 0.5864 -0.0269 -0.0600 0.1484  225 LYS B NZ    
2093 N N     . HIS B 66  ? 0.2259 0.2143 0.2693 -0.0225 0.0114  0.0821  226 HIS B N     
2094 C CA    . HIS B 66  ? 0.2411 0.2484 0.2893 -0.0250 0.0180  0.0806  226 HIS B CA    
2095 C C     . HIS B 66  ? 0.2322 0.2372 0.2856 -0.0226 0.0157  0.0662  226 HIS B C     
2096 O O     . HIS B 66  ? 0.2187 0.2296 0.2832 -0.0277 0.0164  0.0653  226 HIS B O     
2097 C CB    . HIS B 66  ? 0.2264 0.2580 0.2602 -0.0165 0.0252  0.0816  226 HIS B CB    
2098 C CG    . HIS B 66  ? 0.2438 0.3008 0.2847 -0.0134 0.0324  0.0788  226 HIS B CG    
2099 N ND1   . HIS B 66  ? 0.2921 0.3732 0.3491 -0.0227 0.0391  0.0960  226 HIS B ND1   
2100 C CD2   . HIS B 66  ? 0.2525 0.3155 0.2911 -0.0015 0.0310  0.0623  226 HIS B CD2   
2101 C CE1   . HIS B 66  ? 0.3027 0.4093 0.3662 -0.0147 0.0451  0.0894  226 HIS B CE1   
2102 N NE2   . HIS B 66  ? 0.2678 0.3606 0.3193 -0.0004 0.0395  0.0671  226 HIS B NE2   
2103 N N     . MET B 67  ? 0.1936 0.1939 0.2421 -0.0168 0.0111  0.0593  227 MET B N     
2104 C CA    . MET B 67  ? 0.2006 0.2053 0.2566 -0.0174 0.0071  0.0536  227 MET B CA    
2105 C C     . MET B 67  ? 0.1943 0.1971 0.2545 -0.0199 0.0069  0.0509  227 MET B C     
2106 O O     . MET B 67  ? 0.1591 0.1690 0.2248 -0.0232 0.0053  0.0483  227 MET B O     
2107 C CB    . MET B 67  ? 0.2127 0.2197 0.2692 -0.0146 -0.0004 0.0553  227 MET B CB    
2108 C CG    . MET B 67  ? 0.2187 0.2205 0.2704 -0.0108 -0.0088 0.0523  227 MET B CG    
2109 S SD    . MET B 67  ? 0.3254 0.3239 0.3807 -0.0112 -0.0242 0.0587  227 MET B SD    
2110 C CE    . MET B 67  ? 0.2193 0.2350 0.2985 -0.0208 -0.0317 0.0709  227 MET B CE    
2111 N N     . HIS B 68  ? 0.1858 0.1770 0.2423 -0.0161 0.0053  0.0497  228 HIS B N     
2112 C CA    . HIS B 68  ? 0.2193 0.2024 0.2750 -0.0126 -0.0001 0.0404  228 HIS B CA    
2113 C C     . HIS B 68  ? 0.2020 0.1749 0.2654 -0.0232 -0.0049 0.0410  228 HIS B C     
2114 O O     . HIS B 68  ? 0.2455 0.2209 0.3084 -0.0237 -0.0097 0.0330  228 HIS B O     
2115 C CB    . HIS B 68  ? 0.2214 0.1865 0.2740 -0.0027 -0.0063 0.0361  228 HIS B CB    
2116 C CG    . HIS B 68  ? 0.3149 0.2695 0.3620 0.0092  -0.0160 0.0185  228 HIS B CG    
2117 N ND1   . HIS B 68  ? 0.3473 0.3256 0.3848 0.0274  -0.0128 0.0072  228 HIS B ND1   
2118 C CD2   . HIS B 68  ? 0.4011 0.3267 0.4500 0.0072  -0.0315 0.0097  228 HIS B CD2   
2119 C CE1   . HIS B 68  ? 0.4169 0.3812 0.4446 0.0407  -0.0246 -0.0131 228 HIS B CE1   
2120 N NE2   . HIS B 68  ? 0.4501 0.3763 0.4852 0.0278  -0.0390 -0.0130 228 HIS B NE2   
2121 N N     . THR B 69  ? 0.2126 0.1801 0.2844 -0.0323 -0.0044 0.0537  229 THR B N     
2122 C CA    A THR B 69  ? 0.2219 0.1881 0.3092 -0.0455 -0.0100 0.0622  229 THR B CA    
2123 C CA    B THR B 69  ? 0.2215 0.1871 0.3088 -0.0454 -0.0105 0.0616  229 THR B CA    
2124 C C     . THR B 69  ? 0.2334 0.2221 0.3265 -0.0481 -0.0043 0.0603  229 THR B C     
2125 O O     . THR B 69  ? 0.2163 0.2030 0.3197 -0.0555 -0.0128 0.0591  229 THR B O     
2126 C CB    A THR B 69  ? 0.2530 0.2285 0.3504 -0.0550 -0.0063 0.0847  229 THR B CB    
2127 C CB    B THR B 69  ? 0.2510 0.2218 0.3509 -0.0567 -0.0097 0.0846  229 THR B CB    
2128 O OG1   A THR B 69  ? 0.2632 0.2134 0.3595 -0.0549 -0.0167 0.0900  229 THR B OG1   
2129 O OG1   B THR B 69  ? 0.2370 0.2408 0.3325 -0.0532 0.0069  0.0920  229 THR B OG1   
2130 C CG2   A THR B 69  ? 0.2459 0.2337 0.3673 -0.0712 -0.0113 0.1013  229 THR B CG2   
2131 C CG2   B THR B 69  ? 0.2631 0.2092 0.3592 -0.0545 -0.0186 0.0892  229 THR B CG2   
2132 N N     . VAL B 70  ? 0.1615 0.1681 0.2493 -0.0414 0.0061  0.0596  230 VAL B N     
2133 C CA    . VAL B 70  ? 0.1776 0.2014 0.2733 -0.0408 0.0078  0.0572  230 VAL B CA    
2134 C C     . VAL B 70  ? 0.1730 0.1929 0.2658 -0.0412 0.0001  0.0491  230 VAL B C     
2135 O O     . VAL B 70  ? 0.2041 0.2311 0.3068 -0.0463 -0.0046 0.0493  230 VAL B O     
2136 C CB    . VAL B 70  ? 0.1915 0.2254 0.2815 -0.0303 0.0128  0.0543  230 VAL B CB    
2137 C CG1   . VAL B 70  ? 0.1838 0.2246 0.2834 -0.0274 0.0069  0.0491  230 VAL B CG1   
2138 C CG2   . VAL B 70  ? 0.1981 0.2506 0.2879 -0.0261 0.0221  0.0613  230 VAL B CG2   
2139 N N     . GLY B 71  ? 0.1822 0.1974 0.2616 -0.0351 -0.0009 0.0442  231 GLY B N     
2140 C CA    . GLY B 71  ? 0.2016 0.2265 0.2743 -0.0329 -0.0057 0.0397  231 GLY B CA    
2141 C C     . GLY B 71  ? 0.2284 0.2438 0.2969 -0.0346 -0.0146 0.0307  231 GLY B C     
2142 O O     . GLY B 71  ? 0.2416 0.2681 0.3097 -0.0375 -0.0203 0.0296  231 GLY B O     
2143 N N     . GLU B 72  ? 0.2103 0.2019 0.2770 -0.0335 -0.0204 0.0249  232 GLU B N     
2144 C CA    . GLU B 72  ? 0.2301 0.2022 0.2950 -0.0354 -0.0373 0.0141  232 GLU B CA    
2145 C C     . GLU B 72  ? 0.2515 0.2274 0.3374 -0.0520 -0.0432 0.0245  232 GLU B C     
2146 O O     . GLU B 72  ? 0.2624 0.2344 0.3459 -0.0547 -0.0573 0.0168  232 GLU B O     
2147 C CB    . GLU B 72  ? 0.3402 0.2781 0.4050 -0.0319 -0.0494 0.0083  232 GLU B CB    
2148 C CG    . GLU B 72  ? 0.4270 0.3661 0.4743 -0.0120 -0.0437 -0.0026 232 GLU B CG    
2149 C CD    . GLU B 72  ? 0.6379 0.5397 0.6790 0.0010  -0.0640 -0.0202 232 GLU B CD    
2150 O OE1   . GLU B 72  ? 0.7344 0.6037 0.7935 -0.0115 -0.0788 -0.0105 232 GLU B OE1   
2151 O OE2   . GLU B 72  ? 0.6806 0.5887 0.7002 0.0251  -0.0668 -0.0424 232 GLU B OE2   
2152 N N     . LYS B 73  ? 0.2324 0.2214 0.3379 -0.0605 -0.0325 0.0415  233 LYS B N     
2153 C CA    . LYS B 73  ? 0.2311 0.2364 0.3619 -0.0729 -0.0345 0.0543  233 LYS B CA    
2154 C C     . LYS B 73  ? 0.2335 0.2572 0.3647 -0.0707 -0.0343 0.0508  233 LYS B C     
2155 O O     . LYS B 73  ? 0.2244 0.2541 0.3708 -0.0796 -0.0450 0.0543  233 LYS B O     
2156 C CB    . LYS B 73  ? 0.2701 0.2980 0.4162 -0.0743 -0.0192 0.0708  233 LYS B CB    
2157 C CG    . LYS B 73  ? 0.3728 0.4327 0.5485 -0.0823 -0.0168 0.0863  233 LYS B CG    
2158 C CD    . LYS B 73  ? 0.4372 0.5309 0.6172 -0.0727 0.0025  0.0956  233 LYS B CD    
2159 C CE    . LYS B 73  ? 0.4915 0.6236 0.6950 -0.0754 0.0066  0.1122  233 LYS B CE    
2160 N NZ    . LYS B 73  ? 0.5006 0.6432 0.7200 -0.0751 0.0000  0.1081  233 LYS B NZ    
2161 N N     . VAL B 74  ? 0.2150 0.2476 0.3335 -0.0610 -0.0257 0.0473  234 VAL B N     
2162 C CA    . VAL B 74  ? 0.2137 0.2617 0.3353 -0.0606 -0.0296 0.0491  234 VAL B CA    
2163 C C     . VAL B 74  ? 0.2144 0.2618 0.3216 -0.0629 -0.0425 0.0426  234 VAL B C     
2164 O O     . VAL B 74  ? 0.2240 0.2823 0.3406 -0.0687 -0.0515 0.0470  234 VAL B O     
2165 C CB    . VAL B 74  ? 0.2153 0.2699 0.3307 -0.0535 -0.0245 0.0520  234 VAL B CB    
2166 C CG1   . VAL B 74  ? 0.2236 0.2924 0.3451 -0.0568 -0.0344 0.0598  234 VAL B CG1   
2167 C CG2   . VAL B 74  ? 0.2740 0.3279 0.4004 -0.0477 -0.0173 0.0534  234 VAL B CG2   
2168 N N     . ILE B 75  ? 0.1929 0.2292 0.2759 -0.0554 -0.0447 0.0302  235 ILE B N     
2169 C CA    . ILE B 75  ? 0.2157 0.2524 0.2768 -0.0510 -0.0585 0.0173  235 ILE B CA    
2170 C C     . ILE B 75  ? 0.2696 0.2887 0.3444 -0.0625 -0.0770 0.0145  235 ILE B C     
2171 O O     . ILE B 75  ? 0.2618 0.2905 0.3320 -0.0659 -0.0895 0.0131  235 ILE B O     
2172 C CB    . ILE B 75  ? 0.2381 0.2640 0.2712 -0.0340 -0.0595 -0.0015 235 ILE B CB    
2173 C CG1   . ILE B 75  ? 0.2217 0.2772 0.2447 -0.0235 -0.0426 0.0055  235 ILE B CG1   
2174 C CG2   . ILE B 75  ? 0.3137 0.3365 0.3191 -0.0234 -0.0778 -0.0226 235 ILE B CG2   
2175 C CD1   . ILE B 75  ? 0.2503 0.2994 0.2544 -0.0042 -0.0398 -0.0105 235 ILE B CD1   
2176 N N     . VAL B 76  ? 0.2774 0.2741 0.3717 -0.0706 -0.0809 0.0179  236 VAL B N     
2177 C CA    . VAL B 76  ? 0.2810 0.2637 0.3976 -0.0861 -0.1020 0.0221  236 VAL B CA    
2178 C C     . VAL B 76  ? 0.2844 0.2965 0.4288 -0.0971 -0.0993 0.0392  236 VAL B C     
2179 O O     . VAL B 76  ? 0.2777 0.2894 0.4288 -0.1055 -0.1189 0.0386  236 VAL B O     
2180 C CB    . VAL B 76  ? 0.2973 0.2607 0.4387 -0.0971 -0.1063 0.0340  236 VAL B CB    
2181 C CG1   . VAL B 76  ? 0.3684 0.3271 0.5387 -0.1144 -0.1266 0.0472  236 VAL B CG1   
2182 C CG2   . VAL B 76  ? 0.2932 0.2197 0.4115 -0.0855 -0.1166 0.0159  236 VAL B CG2   
2183 N N     . ASP B 77  ? 0.2200 0.2565 0.3799 -0.0945 -0.0780 0.0523  237 ASP B N     
2184 C CA    . ASP B 77  ? 0.2815 0.3446 0.4680 -0.0971 -0.0743 0.0654  237 ASP B CA    
2185 C C     . ASP B 77  ? 0.2706 0.3464 0.4518 -0.0942 -0.0799 0.0644  237 ASP B C     
2186 O O     . ASP B 77  ? 0.2865 0.3733 0.4816 -0.0947 -0.0846 0.0707  237 ASP B O     
2187 C CB    . ASP B 77  ? 0.3371 0.4191 0.5369 -0.0883 -0.0527 0.0739  237 ASP B CB    
2188 C CG    . ASP B 77  ? 0.4090 0.4920 0.6185 -0.0930 -0.0479 0.0838  237 ASP B CG    
2189 O OD1   . ASP B 77  ? 0.4725 0.5408 0.6864 -0.1038 -0.0635 0.0875  237 ASP B OD1   
2190 O OD2   . ASP B 77  ? 0.4146 0.5141 0.6279 -0.0862 -0.0313 0.0895  237 ASP B OD2   
2191 N N     . PHE B 78  ? 0.2578 0.3316 0.4118 -0.0867 -0.0768 0.0578  238 PHE B N     
2192 C CA    . PHE B 78  ? 0.2798 0.3704 0.4313 -0.0856 -0.0821 0.0651  238 PHE B CA    
2193 C C     . PHE B 78  ? 0.3809 0.4772 0.4979 -0.0843 -0.0924 0.0593  238 PHE B C     
2194 O O     . PHE B 78  ? 0.4566 0.5729 0.5714 -0.0867 -0.0998 0.0709  238 PHE B O     
2195 C CB    . PHE B 78  ? 0.2660 0.3614 0.4226 -0.0782 -0.0712 0.0721  238 PHE B CB    
2196 C CG    . PHE B 78  ? 0.2741 0.3695 0.4581 -0.0720 -0.0634 0.0734  238 PHE B CG    
2197 C CD1   . PHE B 78  ? 0.2579 0.3481 0.4416 -0.0673 -0.0496 0.0682  238 PHE B CD1   
2198 C CD2   . PHE B 78  ? 0.2996 0.4012 0.5037 -0.0667 -0.0695 0.0784  238 PHE B CD2   
2199 C CE1   . PHE B 78  ? 0.2617 0.3634 0.4663 -0.0578 -0.0413 0.0687  238 PHE B CE1   
2200 C CE2   . PHE B 78  ? 0.2976 0.4097 0.5289 -0.0561 -0.0636 0.0765  238 PHE B CE2   
2201 C CZ    . PHE B 78  ? 0.2726 0.3887 0.5028 -0.0508 -0.0484 0.0714  238 PHE B CZ    
2202 N N     . ALA B 79  ? 0.2760 0.5395 0.4971 -0.0954 -0.0021 -0.0920 239 ALA B N     
2203 C CA    . ALA B 79  ? 0.3489 0.5726 0.5615 -0.0954 -0.0154 -0.0861 239 ALA B CA    
2204 C C     . ALA B 79  ? 0.5273 0.7297 0.7175 -0.1302 -0.0117 -0.0789 239 ALA B C     
2205 O O     . ALA B 79  ? 0.5904 0.7368 0.7544 -0.1395 -0.0146 -0.0695 239 ALA B O     
2206 C CB    . ALA B 79  ? 0.3161 0.4874 0.5112 -0.0814 -0.0162 -0.0734 239 ALA B CB    
2207 N N     . GLY B 80  ? 0.6020 0.8448 0.7999 -0.1483 -0.0058 -0.0852 240 GLY B N     
2208 C CA    . GLY B 80  ? 0.6651 0.8856 0.8397 -0.1836 -0.0019 -0.0774 240 GLY B CA    
2209 C C     . GLY B 80  ? 0.7022 0.8913 0.8688 -0.1896 -0.0165 -0.0797 240 GLY B C     
2210 O O     . GLY B 80  ? 0.7740 0.9040 0.9087 -0.2080 -0.0172 -0.0693 240 GLY B O     
2211 N N     A SER B 81  ? 0.6679 0.8953 0.8611 -0.1722 -0.0295 -0.0943 241 SER B N     
2212 N N     B SER B 81  ? 0.6658 0.8876 0.8571 -0.1709 -0.0304 -0.0936 241 SER B N     
2213 C CA    A SER B 81  ? 0.6770 0.8888 0.8641 -0.1780 -0.0449 -0.0999 241 SER B CA    
2214 C CA    B SER B 81  ? 0.6642 0.8601 0.8443 -0.1764 -0.0456 -0.0976 241 SER B CA    
2215 C C     A SER B 81  ? 0.6175 0.7796 0.7851 -0.1598 -0.0560 -0.0971 241 SER B C     
2216 C C     B SER B 81  ? 0.6015 0.7646 0.7713 -0.1514 -0.0586 -0.0978 241 SER B C     
2217 O O     A SER B 81  ? 0.6342 0.7713 0.7855 -0.1640 -0.0681 -0.1019 241 SER B O     
2218 O O     B SER B 81  ? 0.6103 0.7775 0.7796 -0.1446 -0.0747 -0.1056 241 SER B O     
2219 C CB    A SER B 81  ? 0.6962 0.9732 0.9170 -0.1669 -0.0559 -0.1158 241 SER B CB    
2220 C CB    B SER B 81  ? 0.6978 0.9520 0.9049 -0.1793 -0.0547 -0.1122 241 SER B CB    
2221 O OG    A SER B 81  ? 0.6784 0.9883 0.9238 -0.1331 -0.0590 -0.1212 241 SER B OG    
2222 O OG    B SER B 81  ? 0.6924 0.9613 0.9125 -0.1507 -0.0735 -0.1195 241 SER B OG    
2223 N N     A SER B 82  ? 0.5537 0.7044 0.7220 -0.1398 -0.0512 -0.0915 242 SER B N     
2224 N N     B SER B 82  ? 0.5428 0.6746 0.7019 -0.1394 -0.0512 -0.0896 242 SER B N     
2225 C CA    A SER B 82  ? 0.4940 0.5937 0.6385 -0.1205 -0.0568 -0.0861 242 SER B CA    
2226 C CA    B SER B 82  ? 0.4775 0.5785 0.6236 -0.1095 -0.0602 -0.0854 242 SER B CA    
2227 C C     A SER B 82  ? 0.4797 0.5117 0.5836 -0.1369 -0.0513 -0.0791 242 SER B C     
2228 C C     B SER B 82  ? 0.4695 0.5078 0.5741 -0.1119 -0.0621 -0.0815 242 SER B C     
2229 O O     A SER B 82  ? 0.4947 0.5069 0.5881 -0.1604 -0.0411 -0.0724 242 SER B O     
2230 O O     B SER B 82  ? 0.4629 0.4905 0.5538 -0.0941 -0.0723 -0.0820 242 SER B O     
2231 C CB    A SER B 82  ? 0.4545 0.5476 0.6019 -0.0937 -0.0499 -0.0748 242 SER B CB    
2232 C CB    B SER B 82  ? 0.4459 0.5361 0.5926 -0.0877 -0.0504 -0.0732 242 SER B CB    
2233 O OG    A SER B 82  ? 0.4463 0.4857 0.5617 -0.0774 -0.0496 -0.0633 242 SER B OG    
2234 O OG    B SER B 82  ? 0.4532 0.4897 0.5685 -0.0926 -0.0386 -0.0601 242 SER B OG    
2235 N N     A LYS B 83  ? 0.4772 0.4729 0.5561 -0.1243 -0.0597 -0.0816 243 LYS B N     
2236 N N     B LYS B 83  ? 0.4782 0.4741 0.5606 -0.1334 -0.0534 -0.0779 243 LYS B N     
2237 C CA    A LYS B 83  ? 0.5068 0.4358 0.5489 -0.1297 -0.0569 -0.0803 243 LYS B CA    
2238 C CA    B LYS B 83  ? 0.5103 0.4416 0.5547 -0.1325 -0.0559 -0.0794 243 LYS B CA    
2239 C C     A LYS B 83  ? 0.4829 0.3821 0.5088 -0.0993 -0.0506 -0.0706 243 LYS B C     
2240 C C     B LYS B 83  ? 0.4879 0.3839 0.5140 -0.1028 -0.0491 -0.0692 243 LYS B C     
2241 O O     A LYS B 83  ? 0.5315 0.3893 0.5306 -0.0893 -0.0519 -0.0763 243 LYS B O     
2242 O O     B LYS B 83  ? 0.5303 0.3758 0.5289 -0.0965 -0.0494 -0.0726 243 LYS B O     
2243 C CB    A LYS B 83  ? 0.5352 0.4488 0.5594 -0.1390 -0.0695 -0.0971 243 LYS B CB    
2244 C CB    B LYS B 83  ? 0.5248 0.4626 0.5613 -0.1351 -0.0703 -0.0959 243 LYS B CB    
2245 C CG    A LYS B 83  ? 0.5566 0.4932 0.5951 -0.1694 -0.0750 -0.1050 243 LYS B CG    
2246 C CG    B LYS B 83  ? 0.5788 0.4574 0.5772 -0.1317 -0.0735 -0.1054 243 LYS B CG    
2247 C CD    A LYS B 83  ? 0.6007 0.5018 0.6158 -0.1756 -0.0841 -0.1191 243 LYS B CD    
2248 C CD    B LYS B 83  ? 0.6409 0.4683 0.6255 -0.1489 -0.0691 -0.1037 243 LYS B CD    
2249 C CE    A LYS B 83  ? 0.6423 0.5508 0.6679 -0.2044 -0.0859 -0.1207 243 LYS B CE    
2250 C CE    B LYS B 83  ? 0.6660 0.4345 0.6195 -0.1289 -0.0690 -0.1118 243 LYS B CE    
2251 N NZ    A LYS B 83  ? 0.7076 0.5721 0.7098 -0.2111 -0.0944 -0.1357 243 LYS B NZ    
2252 N NZ    B LYS B 83  ? 0.7033 0.4235 0.6481 -0.1331 -0.0645 -0.1016 243 LYS B NZ    
2253 N N     . LEU B 84  ? 0.4087 0.3337 0.4525 -0.0847 -0.0439 -0.0592 244 LEU B N     
2254 C CA    . LEU B 84  ? 0.4371 0.3426 0.4694 -0.0603 -0.0373 -0.0500 244 LEU B CA    
2255 C C     . LEU B 84  ? 0.4467 0.3157 0.4670 -0.0616 -0.0292 -0.0406 244 LEU B C     
2256 O O     . LEU B 84  ? 0.4787 0.3486 0.5038 -0.0817 -0.0259 -0.0347 244 LEU B O     
2257 C CB    . LEU B 84  ? 0.3649 0.3078 0.4186 -0.0451 -0.0369 -0.0425 244 LEU B CB    
2258 C CG    . LEU B 84  ? 0.3875 0.3547 0.4457 -0.0380 -0.0500 -0.0464 244 LEU B CG    
2259 C CD1   . LEU B 84  ? 0.3650 0.3571 0.4445 -0.0244 -0.0540 -0.0393 244 LEU B CD1   
2260 C CD2   . LEU B 84  ? 0.4444 0.3910 0.4723 -0.0297 -0.0514 -0.0474 244 LEU B CD2   
2261 N N     . ARG B 85  ? 0.4346 0.2760 0.4386 -0.0407 -0.0270 -0.0396 245 ARG B N     
2262 C CA    . ARG B 85  ? 0.4096 0.2193 0.4036 -0.0339 -0.0235 -0.0295 245 ARG B CA    
2263 C C     . ARG B 85  ? 0.3437 0.1888 0.3559 -0.0259 -0.0159 -0.0172 245 ARG B C     
2264 O O     . ARG B 85  ? 0.3164 0.1956 0.3425 -0.0159 -0.0143 -0.0184 245 ARG B O     
2265 C CB    . ARG B 85  ? 0.4413 0.2195 0.4177 -0.0092 -0.0259 -0.0388 245 ARG B CB    
2266 C CG    . ARG B 85  ? 0.5442 0.2814 0.5084 0.0028  -0.0289 -0.0307 245 ARG B CG    
2267 C CD    . ARG B 85  ? 0.5911 0.3082 0.5448 0.0296  -0.0323 -0.0466 245 ARG B CD    
2268 N NE    . ARG B 85  ? 0.5505 0.3075 0.5132 0.0517  -0.0260 -0.0582 245 ARG B NE    
2269 C CZ    . ARG B 85  ? 0.5807 0.3619 0.5542 0.0729  -0.0215 -0.0549 245 ARG B CZ    
2270 N NH1   . ARG B 85  ? 0.5748 0.3440 0.5509 0.0762  -0.0241 -0.0397 245 ARG B NH1   
2271 N NH2   . ARG B 85  ? 0.5696 0.4007 0.5520 0.0835  -0.0123 -0.0636 245 ARG B NH2   
2272 N N     . PHE B 86  ? 0.3278 0.1613 0.3361 -0.0326 -0.0132 -0.0050 246 PHE B N     
2273 C CA    . PHE B 86  ? 0.3042 0.1691 0.3263 -0.0248 -0.0067 0.0038  246 PHE B CA    
2274 C C     . PHE B 86  ? 0.3366 0.1756 0.3443 -0.0091 -0.0081 0.0131  246 PHE B C     
2275 O O     . PHE B 86  ? 0.3768 0.1680 0.3624 -0.0093 -0.0154 0.0168  246 PHE B O     
2276 C CB    . PHE B 86  ? 0.3012 0.1936 0.3335 -0.0478 -0.0016 0.0080  246 PHE B CB    
2277 C CG    . PHE B 86  ? 0.2585 0.1981 0.3184 -0.0527 -0.0010 -0.0039 246 PHE B CG    
2278 C CD1   . PHE B 86  ? 0.2990 0.2441 0.3631 -0.0686 -0.0054 -0.0131 246 PHE B CD1   
2279 C CD2   . PHE B 86  ? 0.2351 0.2113 0.3169 -0.0400 0.0009  -0.0074 246 PHE B CD2   
2280 C CE1   . PHE B 86  ? 0.3067 0.2985 0.3989 -0.0684 -0.0089 -0.0253 246 PHE B CE1   
2281 C CE2   . PHE B 86  ? 0.2398 0.2536 0.3476 -0.0386 -0.0036 -0.0198 246 PHE B CE2   
2282 C CZ    . PHE B 86  ? 0.2273 0.2514 0.3415 -0.0511 -0.0090 -0.0286 246 PHE B CZ    
2283 N N     . ARG B 87  ? 0.2652 0.1332 0.2852 0.0047  -0.0040 0.0162  247 ARG B N     
2284 C CA    . ARG B 87  ? 0.3093 0.1659 0.3199 0.0164  -0.0066 0.0262  247 ARG B CA    
2285 C C     . ARG B 87  ? 0.2670 0.1566 0.2863 0.0061  -0.0009 0.0334  247 ARG B C     
2286 O O     . ARG B 87  ? 0.2249 0.1503 0.2641 0.0016  0.0046  0.0264  247 ARG B O     
2287 C CB    . ARG B 87  ? 0.2887 0.1570 0.3062 0.0429  -0.0075 0.0195  247 ARG B CB    
2288 C CG    . ARG B 87  ? 0.3344 0.1742 0.3418 0.0582  -0.0129 0.0073  247 ARG B CG    
2289 C CD    . ARG B 87  ? 0.3578 0.2270 0.3761 0.0834  -0.0110 -0.0029 247 ARG B CD    
2290 N NE    . ARG B 87  ? 0.3592 0.2258 0.3777 0.0993  -0.0179 0.0027  247 ARG B NE    
2291 C CZ    . ARG B 87  ? 0.3875 0.2959 0.4223 0.1150  -0.0157 -0.0035 247 ARG B CZ    
2292 N NH1   . ARG B 87  ? 0.3633 0.3156 0.4115 0.1170  -0.0059 -0.0141 247 ARG B NH1   
2293 N NH2   . ARG B 87  ? 0.4310 0.3391 0.4669 0.1266  -0.0243 0.0015  247 ARG B NH2   
2294 N N     . LEU B 88  ? 0.2576 0.1322 0.2593 0.0036  -0.0046 0.0465  248 LEU B N     
2295 C CA    . LEU B 88  ? 0.2276 0.1354 0.2322 -0.0057 0.0007  0.0514  248 LEU B CA    
2296 C C     . LEU B 88  ? 0.2743 0.1817 0.2738 0.0144  -0.0063 0.0579  248 LEU B C     
2297 O O     . LEU B 88  ? 0.2845 0.1538 0.2641 0.0254  -0.0179 0.0674  248 LEU B O     
2298 C CB    . LEU B 88  ? 0.2638 0.1611 0.2451 -0.0342 0.0023  0.0634  248 LEU B CB    
2299 C CG    . LEU B 88  ? 0.3375 0.2546 0.3280 -0.0604 0.0109  0.0551  248 LEU B CG    
2300 C CD1   . LEU B 88  ? 0.4011 0.2772 0.3842 -0.0651 0.0049  0.0538  248 LEU B CD1   
2301 C CD2   . LEU B 88  ? 0.3605 0.2939 0.3313 -0.0923 0.0174  0.0651  248 LEU B CD2   
2302 N N     . GLY B 89  ? 0.2336 0.1816 0.2516 0.0206  -0.0021 0.0513  249 GLY B N     
2303 C CA    . GLY B 89  ? 0.2419 0.1989 0.2587 0.0379  -0.0095 0.0554  249 GLY B CA    
2304 C C     . GLY B 89  ? 0.1835 0.1849 0.2187 0.0373  -0.0051 0.0475  249 GLY B C     
2305 O O     . GLY B 89  ? 0.1843 0.2043 0.2324 0.0257  0.0024  0.0381  249 GLY B O     
2306 N N     . TYR B 90  ? 0.2198 0.2369 0.2572 0.0514  -0.0125 0.0495  250 TYR B N     
2307 C CA    . TYR B 90  ? 0.1916 0.2482 0.2419 0.0483  -0.0116 0.0428  250 TYR B CA    
2308 C C     . TYR B 90  ? 0.1964 0.2784 0.2679 0.0604  -0.0130 0.0351  250 TYR B C     
2309 O O     . TYR B 90  ? 0.2021 0.2815 0.2753 0.0788  -0.0185 0.0360  250 TYR B O     
2310 C CB    . TYR B 90  ? 0.1813 0.2449 0.2119 0.0488  -0.0209 0.0528  250 TYR B CB    
2311 C CG    . TYR B 90  ? 0.2138 0.2621 0.2177 0.0300  -0.0178 0.0618  250 TYR B CG    
2312 C CD1   . TYR B 90  ? 0.2053 0.2819 0.2125 0.0126  -0.0080 0.0506  250 TYR B CD1   
2313 C CD2   . TYR B 90  ? 0.2871 0.2938 0.2617 0.0281  -0.0251 0.0797  250 TYR B CD2   
2314 C CE1   . TYR B 90  ? 0.2083 0.2858 0.1925 -0.0075 -0.0020 0.0555  250 TYR B CE1   
2315 C CE2   . TYR B 90  ? 0.3305 0.3291 0.2774 0.0030  -0.0205 0.0897  250 TYR B CE2   
2316 C CZ    . TYR B 90  ? 0.2508 0.2918 0.2039 -0.0153 -0.0072 0.0767  250 TYR B CZ    
2317 O OH    . TYR B 90  ? 0.2836 0.3311 0.2109 -0.0429 0.0004  0.0831  250 TYR B OH    
2318 N N     . HIS B 91  ? 0.1518 0.2595 0.2392 0.0491  -0.0086 0.0260  251 HIS B N     
2319 C CA    . HIS B 91  ? 0.1428 0.2852 0.2480 0.0518  -0.0093 0.0202  251 HIS B CA    
2320 C C     . HIS B 91  ? 0.1660 0.3395 0.2728 0.0599  -0.0189 0.0209  251 HIS B C     
2321 O O     . HIS B 91  ? 0.1976 0.3713 0.2930 0.0531  -0.0231 0.0230  251 HIS B O     
2322 C CB    . HIS B 91  ? 0.1520 0.3016 0.2673 0.0315  -0.0051 0.0134  251 HIS B CB    
2323 C CG    . HIS B 91  ? 0.2020 0.3251 0.3156 0.0256  0.0001  0.0141  251 HIS B CG    
2324 N ND1   . HIS B 91  ? 0.2455 0.3479 0.3592 0.0127  -0.0011 0.0109  251 HIS B ND1   
2325 C CD2   . HIS B 91  ? 0.1970 0.3109 0.3076 0.0327  0.0041  0.0161  251 HIS B CD2   
2326 C CE1   . HIS B 91  ? 0.2483 0.3305 0.3584 0.0116  0.0006  0.0139  251 HIS B CE1   
2327 N NE2   . HIS B 91  ? 0.2507 0.3409 0.3578 0.0217  0.0050  0.0167  251 HIS B NE2   
2328 N N     . ALA B 92  ? 0.1646 0.2936 0.2201 0.0365  -0.0159 0.0585  252 ALA B N     
2329 C CA    . ALA B 92  ? 0.1917 0.3678 0.2568 0.0421  -0.0234 0.0730  252 ALA B CA    
2330 C C     . ALA B 92  ? 0.2166 0.4184 0.2786 0.0162  -0.0382 0.0668  252 ALA B C     
2331 O O     . ALA B 92  ? 0.2371 0.4635 0.2932 0.0142  -0.0477 0.0732  252 ALA B O     
2332 C CB    . ALA B 92  ? 0.1709 0.3852 0.2588 0.0580  -0.0178 0.0869  252 ALA B CB    
2333 N N     . ILE B 93  ? 0.2044 0.3957 0.2656 -0.0045 -0.0397 0.0542  253 ILE B N     
2334 C CA    . ILE B 93  ? 0.2455 0.4454 0.2953 -0.0330 -0.0517 0.0449  253 ILE B CA    
2335 C C     . ILE B 93  ? 0.2652 0.4083 0.2933 -0.0426 -0.0471 0.0268  253 ILE B C     
2336 O O     . ILE B 93  ? 0.3044 0.4235 0.3372 -0.0380 -0.0386 0.0236  253 ILE B O     
2337 C CB    . ILE B 93  ? 0.2798 0.5222 0.3484 -0.0510 -0.0568 0.0501  253 ILE B CB    
2338 C CG1   . ILE B 93  ? 0.2849 0.5925 0.3821 -0.0340 -0.0582 0.0716  253 ILE B CG1   
2339 C CG2   . ILE B 93  ? 0.3418 0.5878 0.3922 -0.0863 -0.0702 0.0398  253 ILE B CG2   
2340 C CD1   . ILE B 93  ? 0.2924 0.6554 0.4146 -0.0503 -0.0615 0.0802  253 ILE B CD1   
2341 N N     . PRO B 94  ? 0.2947 0.4170 0.2973 -0.0535 -0.0518 0.0158  254 PRO B N     
2342 C CA    . PRO B 94  ? 0.3096 0.3800 0.2916 -0.0574 -0.0455 0.0004  254 PRO B CA    
2343 C C     . PRO B 94  ? 0.3083 0.3643 0.2872 -0.0766 -0.0463 -0.0057 254 PRO B C     
2344 O O     . PRO B 94  ? 0.2831 0.3684 0.2658 -0.0969 -0.0551 -0.0025 254 PRO B O     
2345 C CB    . PRO B 94  ? 0.3563 0.4141 0.3083 -0.0660 -0.0499 -0.0094 254 PRO B CB    
2346 C CG    . PRO B 94  ? 0.3915 0.4931 0.3498 -0.0617 -0.0579 0.0030  254 PRO B CG    
2347 C CD    . PRO B 94  ? 0.3409 0.4872 0.3294 -0.0618 -0.0626 0.0174  254 PRO B CD    
2348 N N     . SER B 95  ? 0.3252 0.3399 0.2968 -0.0716 -0.0379 -0.0123 255 SER B N     
2349 C CA    . SER B 95  ? 0.3843 0.3768 0.3471 -0.0898 -0.0376 -0.0164 255 SER B CA    
2350 C C     . SER B 95  ? 0.4322 0.3879 0.3583 -0.1097 -0.0410 -0.0305 255 SER B C     
2351 O O     . SER B 95  ? 0.4655 0.4078 0.3780 -0.1355 -0.0445 -0.0339 255 SER B O     
2352 C CB    . SER B 95  ? 0.4222 0.3830 0.3870 -0.0754 -0.0280 -0.0160 255 SER B CB    
2353 O OG    . SER B 95  ? 0.4086 0.3321 0.3545 -0.0620 -0.0224 -0.0244 255 SER B OG    
2354 N N     . MET B 96  ? 0.4434 0.3793 0.3497 -0.0989 -0.0384 -0.0390 256 MET B N     
2355 C CA    . MET B 96  ? 0.5171 0.4112 0.3806 -0.1145 -0.0391 -0.0547 256 MET B CA    
2356 C C     . MET B 96  ? 0.5797 0.5033 0.4325 -0.1226 -0.0482 -0.0570 256 MET B C     
2357 O O     . MET B 96  ? 0.6379 0.5924 0.4895 -0.1484 -0.0611 -0.0553 256 MET B O     
2358 C CB    . MET B 96  ? 0.5468 0.3869 0.3890 -0.0926 -0.0252 -0.0633 256 MET B CB    
2359 C CG    . MET B 96  ? 0.5938 0.3985 0.4366 -0.0888 -0.0183 -0.0607 256 MET B CG    
2360 S SD    . MET B 96  ? 0.6082 0.3814 0.4505 -0.0514 -0.0032 -0.0593 256 MET B SD    
2361 C CE    . MET B 96  ? 0.5784 0.4143 0.4667 -0.0331 -0.0053 -0.0464 256 MET B CE    
2362 N N     . SER B 97  ? 0.5128 0.4328 0.3588 -0.1017 -0.0420 -0.0591 257 SER B N     
2363 C CA    . SER B 97  ? 0.5156 0.4696 0.3548 -0.1049 -0.0500 -0.0568 257 SER B CA    
2364 C C     . SER B 97  ? 0.4626 0.4267 0.3157 -0.0762 -0.0407 -0.0493 257 SER B C     
2365 O O     . SER B 97  ? 0.4762 0.4197 0.3395 -0.0577 -0.0290 -0.0492 257 SER B O     
2366 C CB    . SER B 97  ? 0.6612 0.5821 0.4488 -0.1246 -0.0527 -0.0748 257 SER B CB    
2367 O OG    . SER B 97  ? 0.7606 0.6240 0.5194 -0.1086 -0.0366 -0.0883 257 SER B OG    
2368 N N     . HIS B 98  ? 0.4350 0.4335 0.2882 -0.0743 -0.0468 -0.0414 258 HIS B N     
2369 C CA    . HIS B 98  ? 0.3865 0.3915 0.2447 -0.0527 -0.0379 -0.0341 258 HIS B CA    
2370 C C     . HIS B 98  ? 0.3654 0.3859 0.2616 -0.0353 -0.0329 -0.0190 258 HIS B C     
2371 O O     . HIS B 98  ? 0.4156 0.4319 0.3326 -0.0344 -0.0320 -0.0175 258 HIS B O     
2372 C CB    . HIS B 98  ? 0.4047 0.3707 0.2365 -0.0431 -0.0235 -0.0477 258 HIS B CB    
2373 C CG    . HIS B 98  ? 0.5144 0.4532 0.2987 -0.0580 -0.0249 -0.0651 258 HIS B CG    
2374 N ND1   . HIS B 98  ? 0.5859 0.5449 0.3499 -0.0795 -0.0398 -0.0663 258 HIS B ND1   
2375 C CD2   . HIS B 98  ? 0.6039 0.4947 0.3530 -0.0542 -0.0128 -0.0823 258 HIS B CD2   
2376 C CE1   . HIS B 98  ? 0.6577 0.5785 0.3722 -0.0922 -0.0376 -0.0857 258 HIS B CE1   
2377 N NE2   . HIS B 98  ? 0.6731 0.5481 0.3764 -0.0753 -0.0197 -0.0960 258 HIS B NE2   
2378 N N     . VAL B 99  ? 0.3007 0.3345 0.2006 -0.0230 -0.0289 -0.0085 259 VAL B N     
2379 C CA    . VAL B 99  ? 0.2702 0.3104 0.1965 -0.0094 -0.0236 0.0049  259 VAL B CA    
2380 C C     . VAL B 99  ? 0.2644 0.2840 0.1957 -0.0011 -0.0111 0.0006  259 VAL B C     
2381 O O     . VAL B 99  ? 0.3245 0.3386 0.2411 0.0019  -0.0036 -0.0032 259 VAL B O     
2382 C CB    . VAL B 99  ? 0.3073 0.3664 0.2311 -0.0020 -0.0249 0.0207  259 VAL B CB    
2383 C CG1   . VAL B 99  ? 0.3138 0.3663 0.2569 0.0101  -0.0178 0.0329  259 VAL B CG1   
2384 C CG2   . VAL B 99  ? 0.3460 0.4371 0.2682 -0.0074 -0.0387 0.0286  259 VAL B CG2   
2385 N N     . HIS B 100 ? 0.2240 0.2375 0.1761 0.0022  -0.0091 0.0023  260 HIS B N     
2386 C CA    . HIS B 100 ? 0.2431 0.2461 0.2037 0.0079  -0.0003 0.0000  260 HIS B CA    
2387 C C     . HIS B 100 ? 0.2472 0.2512 0.2249 0.0101  0.0011  0.0093  260 HIS B C     
2388 O O     . HIS B 100 ? 0.2168 0.2207 0.2027 0.0101  -0.0030 0.0124  260 HIS B O     
2389 C CB    . HIS B 100 ? 0.2788 0.2664 0.2397 0.0077  0.0001  -0.0100 260 HIS B CB    
2390 C CG    . HIS B 100 ? 0.3395 0.3121 0.2760 0.0030  -0.0009 -0.0213 260 HIS B CG    
2391 N ND1   . HIS B 100 ? 0.3514 0.3090 0.2812 -0.0067 -0.0065 -0.0277 260 HIS B ND1   
2392 C CD2   . HIS B 100 ? 0.3879 0.3540 0.3002 0.0044  0.0038  -0.0282 260 HIS B CD2   
2393 C CE1   . HIS B 100 ? 0.3961 0.3336 0.2961 -0.0128 -0.0059 -0.0391 260 HIS B CE1   
2394 N NE2   . HIS B 100 ? 0.4194 0.3613 0.3073 -0.0047 0.0007  -0.0403 260 HIS B NE2   
2395 N N     . LEU B 101 ? 0.1945 0.1990 0.1752 0.0105  0.0078  0.0134  261 LEU B N     
2396 C CA    . LEU B 101 ? 0.1997 0.1963 0.1887 0.0080  0.0094  0.0198  261 LEU B CA    
2397 C C     . LEU B 101 ? 0.1827 0.1779 0.1832 0.0059  0.0088  0.0143  261 LEU B C     
2398 O O     . LEU B 101 ? 0.2210 0.2270 0.2265 0.0070  0.0112  0.0109  261 LEU B O     
2399 C CB    . LEU B 101 ? 0.2117 0.2084 0.1955 0.0028  0.0160  0.0277  261 LEU B CB    
2400 C CG    . LEU B 101 ? 0.2149 0.1942 0.1989 -0.0054 0.0186  0.0326  261 LEU B CG    
2401 C CD1   . LEU B 101 ? 0.2434 0.1996 0.2187 0.0016  0.0178  0.0378  261 LEU B CD1   
2402 C CD2   . LEU B 101 ? 0.2279 0.2087 0.2058 -0.0166 0.0255  0.0403  261 LEU B CD2   
2403 N N     . HIS B 102 ? 0.1654 0.1491 0.1687 0.0051  0.0065  0.0146  262 HIS B N     
2404 C CA    . HIS B 102 ? 0.1900 0.1724 0.2000 0.0018  0.0049  0.0109  262 HIS B CA    
2405 C C     . HIS B 102 ? 0.2374 0.2132 0.2444 -0.0087 0.0070  0.0139  262 HIS B C     
2406 O O     . HIS B 102 ? 0.2505 0.2060 0.2462 -0.0109 0.0101  0.0175  262 HIS B O     
2407 C CB    . HIS B 102 ? 0.1949 0.1681 0.2050 0.0048  0.0022  0.0088  262 HIS B CB    
2408 C CG    . HIS B 102 ? 0.1940 0.1722 0.2057 0.0082  -0.0008 0.0055  262 HIS B CG    
2409 N ND1   . HIS B 102 ? 0.2044 0.1799 0.2173 0.0086  -0.0025 0.0015  262 HIS B ND1   
2410 C CD2   . HIS B 102 ? 0.2096 0.1935 0.2184 0.0088  -0.0029 0.0059  262 HIS B CD2   
2411 C CE1   . HIS B 102 ? 0.2348 0.2070 0.2429 0.0075  -0.0043 -0.0016 262 HIS B CE1   
2412 N NE2   . HIS B 102 ? 0.2456 0.2263 0.2519 0.0058  -0.0056 0.0004  262 HIS B NE2   
2413 N N     . VAL B 103 ? 0.1666 0.1592 0.1818 -0.0153 0.0053  0.0132  263 VAL B N     
2414 C CA    . VAL B 103 ? 0.1808 0.1712 0.1921 -0.0320 0.0045  0.0147  263 VAL B CA    
2415 C C     . VAL B 103 ? 0.2154 0.2102 0.2290 -0.0338 -0.0019 0.0109  263 VAL B C     
2416 O O     . VAL B 103 ? 0.2079 0.2302 0.2355 -0.0284 -0.0055 0.0122  263 VAL B O     
2417 C CB    . VAL B 103 ? 0.2074 0.2288 0.2298 -0.0413 0.0065  0.0199  263 VAL B CB    
2418 C CG1   . VAL B 103 ? 0.2149 0.2340 0.2307 -0.0661 0.0045  0.0217  263 VAL B CG1   
2419 C CG2   . VAL B 103 ? 0.2221 0.2426 0.2407 -0.0366 0.0137  0.0243  263 VAL B CG2   
2420 N N     . ILE B 104 ? 0.2122 0.1786 0.2093 -0.0388 -0.0022 0.0071  264 ILE B N     
2421 C CA    . ILE B 104 ? 0.1981 0.1656 0.1928 -0.0377 -0.0073 0.0036  264 ILE B CA    
2422 C C     . ILE B 104 ? 0.2356 0.1820 0.2083 -0.0547 -0.0090 -0.0010 264 ILE B C     
2423 O O     . ILE B 104 ? 0.2693 0.1785 0.2208 -0.0583 -0.0023 -0.0042 264 ILE B O     
2424 C CB    . ILE B 104 ? 0.2160 0.1722 0.2106 -0.0215 -0.0047 0.0022  264 ILE B CB    
2425 C CG1   . ILE B 104 ? 0.2359 0.1946 0.2270 -0.0208 -0.0091 0.0008  264 ILE B CG1   
2426 C CG2   . ILE B 104 ? 0.2287 0.1570 0.2103 -0.0168 0.0027  0.0016  264 ILE B CG2   
2427 C CD1   . ILE B 104 ? 0.2311 0.1861 0.2254 -0.0090 -0.0069 0.0015  264 ILE B CD1   
2428 N N     . SER B 105 ? 0.2429 0.2114 0.2173 -0.0646 -0.0178 -0.0011 265 SER B N     
2429 C CA    . SER B 105 ? 0.2585 0.2081 0.2066 -0.0848 -0.0216 -0.0073 265 SER B CA    
2430 C C     . SER B 105 ? 0.2842 0.2001 0.2101 -0.0749 -0.0165 -0.0136 265 SER B C     
2431 O O     . SER B 105 ? 0.3039 0.2275 0.2414 -0.0562 -0.0145 -0.0109 265 SER B O     
2432 C CB    . SER B 105 ? 0.3017 0.2954 0.2593 -0.0992 -0.0348 -0.0034 265 SER B CB    
2433 O OG    . SER B 105 ? 0.2558 0.2755 0.2291 -0.0803 -0.0393 0.0023  265 SER B OG    
2434 N N     . GLN B 106 ? 0.3315 0.2083 0.2227 -0.0887 -0.0130 -0.0223 266 GLN B N     
2435 C CA    . GLN B 106 ? 0.3707 0.2101 0.2376 -0.0757 -0.0026 -0.0284 266 GLN B CA    
2436 C C     . GLN B 106 ? 0.4407 0.2829 0.2888 -0.0806 -0.0076 -0.0329 266 GLN B C     
2437 O O     . GLN B 106 ? 0.4875 0.2967 0.3079 -0.0735 0.0024  -0.0396 266 GLN B O     
2438 C CB    . GLN B 106 ? 0.4324 0.2151 0.2656 -0.0803 0.0093  -0.0353 266 GLN B CB    
2439 C CG    . GLN B 106 ? 0.4077 0.1869 0.2581 -0.0690 0.0158  -0.0275 266 GLN B CG    
2440 C CD    . GLN B 106 ? 0.3861 0.1837 0.2612 -0.0400 0.0215  -0.0205 266 GLN B CD    
2441 O OE1   . GLN B 106 ? 0.4146 0.1916 0.2770 -0.0231 0.0321  -0.0219 266 GLN B OE1   
2442 N NE2   . GLN B 106 ? 0.3286 0.1671 0.2378 -0.0350 0.0149  -0.0129 266 GLN B NE2   
2443 N N     . ASP B 107 ? 0.4011 0.2853 0.2639 -0.0903 -0.0222 -0.0278 267 ASP B N     
2444 C CA    . ASP B 107 ? 0.4191 0.3145 0.2675 -0.0923 -0.0289 -0.0279 267 ASP B CA    
2445 C C     . ASP B 107 ? 0.3832 0.2858 0.2467 -0.0678 -0.0227 -0.0211 267 ASP B C     
2446 O O     . ASP B 107 ? 0.3996 0.2916 0.2420 -0.0646 -0.0194 -0.0229 267 ASP B O     
2447 C CB    . ASP B 107 ? 0.4164 0.3624 0.2813 -0.1054 -0.0469 -0.0197 267 ASP B CB    
2448 C CG    . ASP B 107 ? 0.3970 0.3815 0.3060 -0.0907 -0.0490 -0.0079 267 ASP B CG    
2449 O OD1   . ASP B 107 ? 0.3843 0.3726 0.3059 -0.0977 -0.0471 -0.0081 267 ASP B OD1   
2450 O OD2   . ASP B 107 ? 0.3422 0.3479 0.2690 -0.0719 -0.0510 0.0015  267 ASP B OD2   
2451 N N     . PHE B 108 ? 0.3445 0.2646 0.2416 -0.0531 -0.0209 -0.0135 268 PHE B N     
2452 C CA    . PHE B 108 ? 0.3251 0.2530 0.2372 -0.0356 -0.0168 -0.0064 268 PHE B CA    
2453 C C     . PHE B 108 ? 0.3461 0.2899 0.2523 -0.0350 -0.0246 0.0006  268 PHE B C     
2454 O O     . PHE B 108 ? 0.3696 0.3067 0.2707 -0.0270 -0.0190 0.0044  268 PHE B O     
2455 C CB    . PHE B 108 ? 0.3515 0.2556 0.2548 -0.0259 -0.0024 -0.0101 268 PHE B CB    
2456 C CG    . PHE B 108 ? 0.3448 0.2384 0.2581 -0.0203 0.0048  -0.0121 268 PHE B CG    
2457 C CD1   . PHE B 108 ? 0.3326 0.2436 0.2735 -0.0128 0.0035  -0.0064 268 PHE B CD1   
2458 C CD2   . PHE B 108 ? 0.4040 0.2659 0.2942 -0.0223 0.0132  -0.0193 268 PHE B CD2   
2459 C CE1   . PHE B 108 ? 0.3375 0.2420 0.2853 -0.0075 0.0088  -0.0063 268 PHE B CE1   
2460 C CE2   . PHE B 108 ? 0.3942 0.2449 0.2914 -0.0145 0.0200  -0.0180 268 PHE B CE2   
2461 C CZ    . PHE B 108 ? 0.3460 0.2218 0.2735 -0.0072 0.0169  -0.0107 268 PHE B CZ    
2462 N N     . ASP B 109 ? 0.3419 0.3103 0.2492 -0.0441 -0.0376 0.0043  269 ASP B N     
2463 C CA    . ASP B 109 ? 0.3363 0.3264 0.2397 -0.0410 -0.0474 0.0148  269 ASP B CA    
2464 C C     . ASP B 109 ? 0.3531 0.3637 0.2853 -0.0233 -0.0497 0.0272  269 ASP B C     
2465 O O     . ASP B 109 ? 0.3538 0.3950 0.3052 -0.0221 -0.0569 0.0323  269 ASP B O     
2466 C CB    . ASP B 109 ? 0.3647 0.3791 0.2552 -0.0603 -0.0618 0.0140  269 ASP B CB    
2467 C CG    . ASP B 109 ? 0.4380 0.4846 0.3261 -0.0555 -0.0746 0.0283  269 ASP B CG    
2468 O OD1   . ASP B 109 ? 0.4402 0.4750 0.3219 -0.0406 -0.0702 0.0362  269 ASP B OD1   
2469 O OD2   . ASP B 109 ? 0.4510 0.5368 0.3424 -0.0678 -0.0894 0.0331  269 ASP B OD2   
2470 N N     . SER B 110 ? 0.3457 0.3378 0.2786 -0.0100 -0.0421 0.0321  270 SER B N     
2471 C CA    . SER B 110 ? 0.3146 0.3108 0.2648 0.0072  -0.0417 0.0420  270 SER B CA    
2472 C C     . SER B 110 ? 0.3193 0.2892 0.2573 0.0147  -0.0355 0.0489  270 SER B C     
2473 O O     . SER B 110 ? 0.3031 0.2534 0.2324 0.0075  -0.0271 0.0433  270 SER B O     
2474 C CB    . SER B 110 ? 0.3266 0.3185 0.2963 0.0106  -0.0354 0.0353  270 SER B CB    
2475 O OG    . SER B 110 ? 0.3709 0.3586 0.3497 0.0276  -0.0330 0.0425  270 SER B OG    
2476 N N     . PRO B 111 ? 0.3401 0.3097 0.2772 0.0297  -0.0383 0.0626  271 PRO B N     
2477 C CA    . PRO B 111 ? 0.3711 0.3077 0.2921 0.0340  -0.0316 0.0705  271 PRO B CA    
2478 C C     . PRO B 111 ? 0.3675 0.2756 0.2940 0.0306  -0.0212 0.0628  271 PRO B C     
2479 O O     . PRO B 111 ? 0.3883 0.2709 0.3015 0.0242  -0.0147 0.0662  271 PRO B O     
2480 C CB    . PRO B 111 ? 0.4047 0.3428 0.3225 0.0550  -0.0362 0.0876  271 PRO B CB    
2481 C CG    . PRO B 111 ? 0.4047 0.3795 0.3460 0.0648  -0.0424 0.0869  271 PRO B CG    
2482 C CD    . PRO B 111 ? 0.3472 0.3477 0.2964 0.0441  -0.0471 0.0734  271 PRO B CD    
2483 N N     . CYS B 112 ? 0.3158 0.2307 0.2598 0.0320  -0.0202 0.0534  272 CYS B N     
2484 C CA    . CYS B 112 ? 0.3392 0.2321 0.2863 0.0268  -0.0128 0.0457  272 CYS B CA    
2485 C C     . CYS B 112 ? 0.3442 0.2417 0.2941 0.0105  -0.0087 0.0381  272 CYS B C     
2486 O O     . CYS B 112 ? 0.3488 0.2340 0.2996 0.0022  -0.0040 0.0350  272 CYS B O     
2487 C CB    . CYS B 112 ? 0.3449 0.2460 0.3064 0.0344  -0.0128 0.0389  272 CYS B CB    
2488 S SG    . CYS B 112 ? 0.4472 0.3495 0.4094 0.0599  -0.0136 0.0485  272 CYS B SG    
2489 N N     . LEU B 113 ? 0.2840 0.2002 0.2342 0.0063  -0.0102 0.0353  273 LEU B N     
2490 C CA    . LEU B 113 ? 0.3212 0.2416 0.2721 -0.0026 -0.0034 0.0302  273 LEU B CA    
2491 C C     . LEU B 113 ? 0.3501 0.2616 0.2867 -0.0081 0.0020  0.0381  273 LEU B C     
2492 O O     . LEU B 113 ? 0.3774 0.2894 0.2976 -0.0073 0.0009  0.0425  273 LEU B O     
2493 C CB    . LEU B 113 ? 0.3304 0.2616 0.2775 -0.0036 -0.0043 0.0236  273 LEU B CB    
2494 C CG    . LEU B 113 ? 0.3839 0.3175 0.3351 -0.0050 0.0041  0.0168  273 LEU B CG    
2495 C CD1   . LEU B 113 ? 0.4660 0.3954 0.4048 -0.0065 0.0035  0.0094  273 LEU B CD1   
2496 C CD2   . LEU B 113 ? 0.3981 0.3335 0.3444 -0.0065 0.0141  0.0206  273 LEU B CD2   
2497 N N     . LYS B 114 ? 0.2981 0.2036 0.2391 -0.0161 0.0075  0.0404  274 LYS B N     
2498 C CA    . LYS B 114 ? 0.3308 0.2252 0.2582 -0.0248 0.0131  0.0503  274 LYS B CA    
2499 C C     . LYS B 114 ? 0.3461 0.2602 0.2824 -0.0367 0.0226  0.0513  274 LYS B C     
2500 O O     . LYS B 114 ? 0.3586 0.2720 0.2840 -0.0449 0.0295  0.0602  274 LYS B O     
2501 C CB    . LYS B 114 ? 0.3719 0.2342 0.2902 -0.0279 0.0112  0.0558  274 LYS B CB    
2502 C CG    . LYS B 114 ? 0.4038 0.2478 0.3101 -0.0116 0.0050  0.0614  274 LYS B CG    
2503 C CD    . LYS B 114 ? 0.4840 0.2862 0.3762 -0.0105 0.0067  0.0660  274 LYS B CD    
2504 C CE    . LYS B 114 ? 0.5449 0.3321 0.4256 0.0122  0.0026  0.0756  274 LYS B CE    
2505 N NZ    . LYS B 114 ? 0.5937 0.3285 0.4537 0.0179  0.0076  0.0802  274 LYS B NZ    
2506 N N     . ASN B 115 ? 0.2989 0.2345 0.2553 -0.0368 0.0236  0.0445  275 ASN B N     
2507 C CA    . ASN B 115 ? 0.3147 0.2799 0.2849 -0.0458 0.0322  0.0485  275 ASN B CA    
2508 C C     . ASN B 115 ? 0.2651 0.2589 0.2529 -0.0343 0.0359  0.0434  275 ASN B C     
2509 O O     . ASN B 115 ? 0.2703 0.2555 0.2585 -0.0231 0.0309  0.0357  275 ASN B O     
2510 C CB    . ASN B 115 ? 0.3633 0.3267 0.3391 -0.0663 0.0297  0.0523  275 ASN B CB    
2511 C CG    . ASN B 115 ? 0.3511 0.3068 0.3342 -0.0670 0.0203  0.0437  275 ASN B CG    
2512 O OD1   . ASN B 115 ? 0.2662 0.2434 0.2644 -0.0571 0.0183  0.0384  275 ASN B OD1   
2513 N ND2   . ASN B 115 ? 0.3769 0.2972 0.3445 -0.0780 0.0159  0.0427  275 ASN B ND2   
2514 N N     . LYS B 116 ? 0.2839 0.3129 0.2860 -0.0365 0.0455  0.0497  276 LYS B N     
2515 C CA    . LYS B 116 ? 0.2542 0.3115 0.2715 -0.0201 0.0525  0.0488  276 LYS B CA    
2516 C C     . LYS B 116 ? 0.2407 0.3044 0.2734 -0.0176 0.0427  0.0448  276 LYS B C     
2517 O O     . LYS B 116 ? 0.2276 0.2905 0.2619 -0.0002 0.0449  0.0412  276 LYS B O     
2518 C CB    . LYS B 116 ? 0.2538 0.3584 0.2889 -0.0227 0.0649  0.0602  276 LYS B CB    
2519 C CG    . LYS B 116 ? 0.3133 0.4536 0.3672 -0.0011 0.0738  0.0634  276 LYS B CG    
2520 C CD    . LYS B 116 ? 0.3270 0.5264 0.4038 -0.0030 0.0864  0.0776  276 LYS B CD    
2521 C CE    . LYS B 116 ? 0.3778 0.5719 0.4360 0.0019  0.1033  0.0802  276 LYS B CE    
2522 N NZ    . LYS B 116 ? 0.3981 0.6569 0.4813 -0.0012 0.1175  0.0959  276 LYS B NZ    
2523 N N     . LYS B 117 ? 0.2318 0.2971 0.2710 -0.0360 0.0327  0.0453  277 LYS B N     
2524 C CA    . LYS B 117 ? 0.2099 0.2801 0.2583 -0.0360 0.0229  0.0410  277 LYS B CA    
2525 C C     . LYS B 117 ? 0.2307 0.2666 0.2662 -0.0230 0.0187  0.0318  277 LYS B C     
2526 O O     . LYS B 117 ? 0.2255 0.2681 0.2671 -0.0119 0.0171  0.0301  277 LYS B O     
2527 C CB    . LYS B 117 ? 0.2979 0.3644 0.3446 -0.0610 0.0137  0.0403  277 LYS B CB    
2528 C CG    . LYS B 117 ? 0.3430 0.4038 0.3891 -0.0621 0.0034  0.0331  277 LYS B CG    
2529 C CD    . LYS B 117 ? 0.3945 0.4409 0.4289 -0.0890 -0.0043 0.0295  277 LYS B CD    
2530 C CE    . LYS B 117 ? 0.4082 0.4009 0.4173 -0.0945 -0.0021 0.0260  277 LYS B CE    
2531 N NZ    . LYS B 117 ? 0.4224 0.3864 0.4113 -0.1205 -0.0073 0.0210  277 LYS B NZ    
2532 N N     . HIS B 118 ? 0.2371 0.2398 0.2551 -0.0244 0.0169  0.0281  278 HIS B N     
2533 C CA    . HIS B 118 ? 0.2310 0.2113 0.2399 -0.0144 0.0127  0.0213  278 HIS B CA    
2534 C C     . HIS B 118 ? 0.2449 0.2274 0.2517 -0.0012 0.0187  0.0195  278 HIS B C     
2535 O O     . HIS B 118 ? 0.2421 0.2207 0.2505 0.0051  0.0166  0.0160  278 HIS B O     
2536 C CB    . HIS B 118 ? 0.2250 0.1806 0.2179 -0.0158 0.0101  0.0214  278 HIS B CB    
2537 C CG    . HIS B 118 ? 0.2469 0.1848 0.2341 -0.0246 0.0061  0.0229  278 HIS B CG    
2538 N ND1   . HIS B 118 ? 0.2724 0.1888 0.2441 -0.0266 0.0065  0.0284  278 HIS B ND1   
2539 C CD2   . HIS B 118 ? 0.2220 0.1542 0.2109 -0.0316 0.0025  0.0194  278 HIS B CD2   
2540 C CE1   . HIS B 118 ? 0.3148 0.2075 0.2782 -0.0331 0.0047  0.0282  278 HIS B CE1   
2541 N NE2   . HIS B 118 ? 0.2789 0.1800 0.2512 -0.0375 0.0022  0.0215  278 HIS B NE2   
2542 N N     . TRP B 119 ? 0.2364 0.2204 0.2349 0.0025  0.0276  0.0217  279 TRP B N     
2543 C CA    . TRP B 119 ? 0.2477 0.2212 0.2341 0.0149  0.0357  0.0179  279 TRP B CA    
2544 C C     . TRP B 119 ? 0.2571 0.2444 0.2562 0.0275  0.0409  0.0207  279 TRP B C     
2545 O O     . TRP B 119 ? 0.2464 0.2142 0.2366 0.0350  0.0418  0.0167  279 TRP B O     
2546 C CB    . TRP B 119 ? 0.2669 0.2399 0.2385 0.0182  0.0472  0.0195  279 TRP B CB    
2547 C CG    . TRP B 119 ? 0.3201 0.2701 0.2694 0.0305  0.0571  0.0128  279 TRP B CG    
2548 C CD1   . TRP B 119 ? 0.3453 0.2995 0.2923 0.0481  0.0728  0.0148  279 TRP B CD1   
2549 C CD2   . TRP B 119 ? 0.3266 0.2430 0.2501 0.0258  0.0523  0.0029  279 TRP B CD2   
2550 N NE1   . TRP B 119 ? 0.3751 0.2888 0.2900 0.0551  0.0796  0.0050  279 TRP B NE1   
2551 C CE2   . TRP B 119 ? 0.3812 0.2725 0.2812 0.0381  0.0660  -0.0028 279 TRP B CE2   
2552 C CE3   . TRP B 119 ? 0.3299 0.2371 0.2473 0.0122  0.0381  -0.0007 279 TRP B CE3   
2553 C CZ2   . TRP B 119 ? 0.4233 0.2749 0.2898 0.0314  0.0649  -0.0141 279 TRP B CZ2   
2554 C CZ3   . TRP B 119 ? 0.3683 0.2493 0.2594 0.0058  0.0357  -0.0098 279 TRP B CZ3   
2555 C CH2   . TRP B 119 ? 0.4117 0.2622 0.2756 0.0125  0.0484  -0.0173 279 TRP B CH2   
2556 N N     . ASN B 120 ? 0.2314 0.2541 0.2506 0.0289  0.0443  0.0294  280 ASN B N     
2557 C CA    . ASN B 120 ? 0.2193 0.2649 0.2529 0.0445  0.0492  0.0361  280 ASN B CA    
2558 C C     . ASN B 120 ? 0.2259 0.2719 0.2670 0.0423  0.0381  0.0358  280 ASN B C     
2559 O O     . ASN B 120 ? 0.2165 0.2662 0.2602 0.0581  0.0416  0.0407  280 ASN B O     
2560 C CB    . ASN B 120 ? 0.2119 0.3085 0.2687 0.0453  0.0550  0.0479  280 ASN B CB    
2561 C CG    . ASN B 120 ? 0.2772 0.3767 0.3253 0.0576  0.0724  0.0504  280 ASN B CG    
2562 O OD1   . ASN B 120 ? 0.3044 0.3658 0.3268 0.0713  0.0817  0.0432  280 ASN B OD1   
2563 N ND2   . ASN B 120 ? 0.2428 0.3866 0.3093 0.0507  0.0775  0.0603  280 ASN B ND2   
2564 N N     . SER B 121 ? 0.2119 0.2511 0.2531 0.0248  0.0261  0.0307  281 SER B N     
2565 C CA    A SER B 121 ? 0.2263 0.2648 0.2703 0.0225  0.0171  0.0293  281 SER B CA    
2566 C CA    B SER B 121 ? 0.2268 0.2641 0.2703 0.0220  0.0169  0.0289  281 SER B CA    
2567 C C     . SER B 121 ? 0.2471 0.2540 0.2763 0.0313  0.0194  0.0249  281 SER B C     
2568 O O     . SER B 121 ? 0.2737 0.2812 0.3037 0.0355  0.0167  0.0273  281 SER B O     
2569 C CB    A SER B 121 ? 0.2250 0.2572 0.2669 0.0046  0.0071  0.0236  281 SER B CB    
2570 C CB    B SER B 121 ? 0.2227 0.2500 0.2625 0.0047  0.0075  0.0226  281 SER B CB    
2571 O OG    A SER B 121 ? 0.2279 0.2296 0.2564 0.0028  0.0064  0.0168  281 SER B OG    
2572 O OG    B SER B 121 ? 0.2203 0.2670 0.2675 -0.0093 0.0050  0.0257  281 SER B OG    
2573 N N     . PHE B 122 ? 0.2142 0.1942 0.2276 0.0316  0.0242  0.0192  282 PHE B N     
2574 C CA    . PHE B 122 ? 0.2513 0.2004 0.2478 0.0332  0.0258  0.0145  282 PHE B CA    
2575 C C     . PHE B 122 ? 0.2974 0.2218 0.2753 0.0462  0.0385  0.0144  282 PHE B C     
2576 O O     . PHE B 122 ? 0.3313 0.2233 0.2903 0.0454  0.0411  0.0109  282 PHE B O     
2577 C CB    . PHE B 122 ? 0.2529 0.1891 0.2408 0.0196  0.0192  0.0073  282 PHE B CB    
2578 C CG    . PHE B 122 ? 0.2496 0.1991 0.2494 0.0122  0.0098  0.0070  282 PHE B CG    
2579 C CD1   . PHE B 122 ? 0.2485 0.1976 0.2504 0.0108  0.0069  0.0068  282 PHE B CD1   
2580 C CD2   . PHE B 122 ? 0.2365 0.1944 0.2416 0.0076  0.0060  0.0072  282 PHE B CD2   
2581 C CE1   . PHE B 122 ? 0.2446 0.2038 0.2538 0.0074  0.0014  0.0056  282 PHE B CE1   
2582 C CE2   . PHE B 122 ? 0.2811 0.2416 0.2907 0.0043  0.0002  0.0060  282 PHE B CE2   
2583 C CZ    . PHE B 122 ? 0.2668 0.2291 0.2785 0.0054  -0.0016 0.0046  282 PHE B CZ    
2584 N N     . ASN B 123 ? 0.3041 0.2409 0.2845 0.0576  0.0480  0.0183  283 ASN B N     
2585 C CA    . ASN B 123 ? 0.3122 0.2186 0.2682 0.0730  0.0634  0.0163  283 ASN B CA    
2586 C C     . ASN B 123 ? 0.3612 0.2887 0.3277 0.0989  0.0767  0.0277  283 ASN B C     
2587 O O     . ASN B 123 ? 0.4204 0.3310 0.3691 0.1151  0.0927  0.0266  283 ASN B O     
2588 C CB    . ASN B 123 ? 0.3089 0.1987 0.2441 0.0643  0.0667  0.0073  283 ASN B CB    
2589 C CG    . ASN B 123 ? 0.3634 0.2304 0.2830 0.0427  0.0550  -0.0023 283 ASN B CG    
2590 O OD1   . ASN B 123 ? 0.4086 0.2378 0.3026 0.0379  0.0568  -0.0093 283 ASN B OD1   
2591 N ND2   . ASN B 123 ? 0.3156 0.2060 0.2501 0.0294  0.0431  -0.0016 283 ASN B ND2   
2592 N N     . THR B 124 ? 0.3187 0.2856 0.3128 0.1039  0.0704  0.0390  284 THR B N     
2593 C CA    . THR B 124 ? 0.3385 0.3350 0.3467 0.1308  0.0807  0.0536  284 THR B CA    
2594 C C     . THR B 124 ? 0.3311 0.3318 0.3457 0.1368  0.0732  0.0624  284 THR B C     
2595 O O     . THR B 124 ? 0.3218 0.3002 0.3282 0.1195  0.0624  0.0557  284 THR B O     
2596 C CB    . THR B 124 ? 0.3295 0.3935 0.3715 0.1275  0.0783  0.0631  284 THR B CB    
2597 O OG1   . THR B 124 ? 0.2764 0.3674 0.3368 0.1027  0.0593  0.0627  284 THR B OG1   
2598 C CG2   . THR B 124 ? 0.3164 0.3781 0.3510 0.1203  0.0866  0.0567  284 THR B CG2   
2599 N N     . GLU B 125 ? 0.3345 0.3692 0.3646 0.1623  0.0791  0.0793  285 GLU B N     
2600 C CA    . GLU B 125 ? 0.3751 0.4205 0.4095 0.1662  0.0700  0.0897  285 GLU B CA    
2601 C C     . GLU B 125 ? 0.3014 0.3866 0.3572 0.1415  0.0499  0.0891  285 GLU B C     
2602 O O     . GLU B 125 ? 0.3041 0.4004 0.3618 0.1424  0.0411  0.0969  285 GLU B O     
2603 C CB    . GLU B 125 ? 0.5099 0.5893 0.5520 0.1870  0.0758  0.1056  285 GLU B CB    
2604 C CG    . GLU B 125 ? 0.6995 0.7340 0.7128 0.2078  0.0952  0.1049  285 GLU B CG    
2605 C CD    . GLU B 125 ? 0.8494 0.8047 0.8235 0.2036  0.1004  0.0934  285 GLU B CD    
2606 O OE1   . GLU B 125 ? 0.8868 0.8276 0.8545 0.2008  0.0941  0.0974  285 GLU B OE1   
2607 O OE2   . GLU B 125 ? 0.9084 0.8177 0.8567 0.2001  0.1102  0.0803  285 GLU B OE2   
2608 N N     . TYR B 126 ? 0.2622 0.3635 0.3281 0.1174  0.0431  0.0789  286 TYR B N     
2609 C CA    . TYR B 126 ? 0.2358 0.3578 0.3109 0.0901  0.0259  0.0735  286 TYR B CA    
2610 C C     . TYR B 126 ? 0.2549 0.3317 0.3092 0.0798  0.0209  0.0632  286 TYR B C     
2611 O O     . TYR B 126 ? 0.2058 0.2935 0.2613 0.0662  0.0094  0.0613  286 TYR B O     
2612 C CB    . TYR B 126 ? 0.2373 0.3688 0.3192 0.0689  0.0234  0.0649  286 TYR B CB    
2613 C CG    . TYR B 126 ? 0.2300 0.3859 0.3203 0.0426  0.0082  0.0615  286 TYR B CG    
2614 C CD1   . TYR B 126 ? 0.2606 0.4738 0.3723 0.0341  0.0020  0.0714  286 TYR B CD1   
2615 C CD2   . TYR B 126 ? 0.2395 0.3608 0.3141 0.0255  0.0010  0.0483  286 TYR B CD2   
2616 C CE1   . TYR B 126 ? 0.2711 0.4979 0.3826 0.0056  -0.0117 0.0662  286 TYR B CE1   
2617 C CE2   . TYR B 126 ? 0.2685 0.4006 0.3426 0.0030  -0.0102 0.0434  286 TYR B CE2   
2618 C CZ    . TYR B 126 ? 0.2956 0.4761 0.3853 -0.0088 -0.0169 0.0513  286 TYR B CZ    
2619 O OH    . TYR B 126 ? 0.3223 0.5058 0.4042 -0.0358 -0.0281 0.0444  286 TYR B OH    
2620 N N     . PHE B 127 ? 0.2029 0.2890 0.2336 0.0605  0.0370  0.0565  287 PHE B N     
2621 C CA    . PHE B 127 ? 0.2131 0.2698 0.2194 0.0423  0.0169  0.0314  287 PHE B CA    
2622 C C     . PHE B 127 ? 0.2814 0.3095 0.2847 0.0530  0.0300  0.0286  287 PHE B C     
2623 O O     . PHE B 127 ? 0.3000 0.2841 0.2693 0.0672  0.0536  0.0219  287 PHE B O     
2624 C CB    . PHE B 127 ? 0.2559 0.2721 0.2078 0.0293  0.0146  0.0088  287 PHE B CB    
2625 C CG    . PHE B 127 ? 0.3007 0.3020 0.2433 0.0060  -0.0114 -0.0086 287 PHE B CG    
2626 C CD1   . PHE B 127 ? 0.3156 0.3525 0.2817 -0.0084 -0.0383 -0.0080 287 PHE B CD1   
2627 C CD2   . PHE B 127 ? 0.3673 0.3186 0.2791 -0.0006 -0.0101 -0.0219 287 PHE B CD2   
2628 C CE1   . PHE B 127 ? 0.2650 0.2985 0.2309 -0.0250 -0.0574 -0.0177 287 PHE B CE1   
2629 C CE2   . PHE B 127 ? 0.3563 0.3056 0.2735 -0.0240 -0.0343 -0.0286 287 PHE B CE2   
2630 C CZ    . PHE B 127 ? 0.2764 0.2724 0.2240 -0.0342 -0.0548 -0.0251 287 PHE B CZ    
2631 N N     . LEU B 128 ? 0.2462 0.2936 0.2785 0.0486  0.0143  0.0345  288 LEU B N     
2632 C CA    . LEU B 128 ? 0.2705 0.2951 0.3044 0.0567  0.0241  0.0364  288 LEU B CA    
2633 C C     . LEU B 128 ? 0.2769 0.2738 0.2887 0.0375  0.0129  0.0209  288 LEU B C     
2634 O O     . LEU B 128 ? 0.2670 0.2892 0.2894 0.0239  -0.0064 0.0193  288 LEU B O     
2635 C CB    . LEU B 128 ? 0.2784 0.3371 0.3521 0.0641  0.0138  0.0561  288 LEU B CB    
2636 C CG    . LEU B 128 ? 0.3600 0.4473 0.4708 0.0819  0.0213  0.0815  288 LEU B CG    
2637 C CD1   . LEU B 128 ? 0.3529 0.4762 0.4822 0.0725  0.0020  0.0909  288 LEU B CD1   
2638 C CD2   . LEU B 128 ? 0.4009 0.4924 0.5315 0.0857  0.0131  0.0948  288 LEU B CD2   
2639 N N     . GLU B 129 ? 0.3139 0.2578 0.2959 0.0376  0.0235  0.0126  289 GLU B N     
2640 C CA    . GLU B 129 ? 0.3580 0.2746 0.3268 0.0144  0.0084  0.0052  289 GLU B CA    
2641 C C     . GLU B 129 ? 0.2842 0.2384 0.2904 0.0099  0.0010  0.0207  289 GLU B C     
2642 O O     . GLU B 129 ? 0.2716 0.2383 0.2961 0.0264  0.0104  0.0337  289 GLU B O     
2643 C CB    . GLU B 129 ? 0.5321 0.3740 0.4604 0.0165  0.0158  -0.0024 289 GLU B CB    
2644 C CG    . GLU B 129 ? 0.7032 0.4892 0.5723 0.0245  0.0233  -0.0205 289 GLU B CG    
2645 C CD    . GLU B 129 ? 0.8190 0.5627 0.6505 -0.0056 -0.0038 -0.0353 289 GLU B CD    
2646 O OE1   . GLU B 129 ? 0.8244 0.6013 0.6916 -0.0328 -0.0266 -0.0276 289 GLU B OE1   
2647 O OE2   . GLU B 129 ? 0.8905 0.5665 0.6553 -0.0004 -0.0026 -0.0523 289 GLU B OE2   
2648 N N     . SER B 130 ? 0.2646 0.2381 0.2814 -0.0102 -0.0149 0.0221  290 SER B N     
2649 C CA    . SER B 130 ? 0.2545 0.2646 0.3003 -0.0101 -0.0164 0.0397  290 SER B CA    
2650 C C     . SER B 130 ? 0.2718 0.2546 0.3207 -0.0090 -0.0072 0.0529  290 SER B C     
2651 O O     . SER B 130 ? 0.2548 0.2571 0.3170 0.0059  0.0006  0.0671  290 SER B O     
2652 C CB    . SER B 130 ? 0.2540 0.2905 0.3157 -0.0299 -0.0302 0.0445  290 SER B CB    
2653 O OG    . SER B 130 ? 0.2777 0.3505 0.3651 -0.0253 -0.0245 0.0664  290 SER B OG    
2654 N N     . GLN B 131 ? 0.3095 0.2387 0.3397 -0.0251 -0.0119 0.0482  291 GLN B N     
2655 C CA    . GLN B 131 ? 0.3588 0.2515 0.3887 -0.0273 -0.0083 0.0611  291 GLN B CA    
2656 C C     . GLN B 131 ? 0.3593 0.2346 0.3807 0.0021  0.0099  0.0604  291 GLN B C     
2657 O O     . GLN B 131 ? 0.3468 0.2194 0.3812 0.0085  0.0154  0.0771  291 GLN B O     
2658 C CB    . GLN B 131 ? 0.4149 0.2371 0.4158 -0.0516 -0.0256 0.0543  291 GLN B CB    
2659 C CG    . GLN B 131 ? 0.5395 0.3190 0.5419 -0.0601 -0.0296 0.0713  291 GLN B CG    
2660 C CD    . GLN B 131 ? 0.5595 0.3999 0.6139 -0.0730 -0.0299 0.1043  291 GLN B CD    
2661 O OE1   . GLN B 131 ? 0.5395 0.4256 0.6243 -0.0932 -0.0403 0.1174  291 GLN B OE1   
2662 N NE2   . GLN B 131 ? 0.5673 0.4106 0.6319 -0.0584 -0.0165 0.1205  291 GLN B NE2   
2663 N N     . ALA B 132 ? 0.3584 0.2269 0.3628 0.0204  0.0196  0.0456  292 ALA B N     
2664 C CA    . ALA B 132 ? 0.4041 0.2693 0.4135 0.0503  0.0378  0.0515  292 ALA B CA    
2665 C C     . ALA B 132 ? 0.3484 0.2729 0.3955 0.0600  0.0360  0.0694  292 ALA B C     
2666 O O     . ALA B 132 ? 0.3569 0.2795 0.4181 0.0756  0.0424  0.0844  292 ALA B O     
2667 C CB    . ALA B 132 ? 0.4407 0.2954 0.4299 0.0680  0.0514  0.0390  292 ALA B CB    
2668 N N     . VAL B 133 ? 0.2592 0.2284 0.3163 0.0518  0.0239  0.0677  293 VAL B N     
2669 C CA    . VAL B 133 ? 0.2414 0.2513 0.3165 0.0612  0.0152  0.0814  293 VAL B CA    
2670 C C     . VAL B 133 ? 0.2804 0.2903 0.3575 0.0600  0.0156  0.0972  293 VAL B C     
2671 O O     . VAL B 133 ? 0.2952 0.3099 0.3779 0.0741  0.0141  0.1121  293 VAL B O     
2672 C CB    . VAL B 133 ? 0.2785 0.3222 0.3512 0.0551  -0.0001 0.0733  293 VAL B CB    
2673 C CG1   . VAL B 133 ? 0.2786 0.3454 0.3498 0.0662  -0.0127 0.0849  293 VAL B CG1   
2674 C CG2   . VAL B 133 ? 0.2379 0.2886 0.3136 0.0580  -0.0027 0.0657  293 VAL B CG2   
2675 N N     . ILE B 134 ? 0.2558 0.2614 0.3304 0.0419  0.0161  0.0982  294 ILE B N     
2676 C CA    . ILE B 134 ? 0.2620 0.2737 0.3428 0.0390  0.0199  0.1197  294 ILE B CA    
2677 C C     . ILE B 134 ? 0.3085 0.2827 0.3898 0.0452  0.0264  0.1306  294 ILE B C     
2678 O O     . ILE B 134 ? 0.3247 0.3061 0.4076 0.0554  0.0288  0.1495  294 ILE B O     
2679 C CB    . ILE B 134 ? 0.2774 0.2961 0.3691 0.0139  0.0176  0.1265  294 ILE B CB    
2680 C CG1   . ILE B 134 ? 0.2465 0.3130 0.3431 0.0146  0.0137  0.1234  294 ILE B CG1   
2681 C CG2   . ILE B 134 ? 0.3079 0.3287 0.4129 0.0072  0.0238  0.1558  294 ILE B CG2   
2682 C CD1   . ILE B 134 ? 0.2560 0.3336 0.3725 -0.0117 0.0068  0.1284  294 ILE B CD1   
2683 N N     . GLU B 135 ? 0.3442 0.2723 0.4172 0.0421  0.0291  0.1185  295 GLU B N     
2684 C CA    . GLU B 135 ? 0.4246 0.3080 0.4942 0.0520  0.0355  0.1268  295 GLU B CA    
2685 C C     . GLU B 135 ? 0.3738 0.2723 0.4557 0.0797  0.0409  0.1350  295 GLU B C     
2686 O O     . GLU B 135 ? 0.4211 0.3040 0.5092 0.0891  0.0429  0.1521  295 GLU B O     
2687 C CB    . GLU B 135 ? 0.5107 0.3291 0.5539 0.0483  0.0369  0.1092  295 GLU B CB    
2688 C CG    . GLU B 135 ? 0.6184 0.4051 0.6510 0.0156  0.0215  0.1100  295 GLU B CG    
2689 C CD    . GLU B 135 ? 0.7792 0.4831 0.7672 0.0122  0.0151  0.0891  295 GLU B CD    
2690 O OE1   . GLU B 135 ? 0.8680 0.5416 0.8311 0.0413  0.0304  0.0742  295 GLU B OE1   
2691 O OE2   . GLU B 135 ? 0.8289 0.4958 0.8048 -0.0185 -0.0062 0.0901  295 GLU B OE2   
2692 N N     . MET B 136 ? 0.3681 0.2974 0.4576 0.0901  0.0396  0.1268  296 MET B N     
2693 C CA    . MET B 136 ? 0.3741 0.3294 0.4801 0.1048  0.0354  0.1340  296 MET B CA    
2694 C C     . MET B 136 ? 0.3574 0.3340 0.4578 0.0997  0.0207  0.1426  296 MET B C     
2695 O O     . MET B 136 ? 0.3998 0.3732 0.5034 0.1042  0.0162  0.1496  296 MET B O     
2696 C CB    . MET B 136 ? 0.3584 0.3449 0.4728 0.1058  0.0309  0.1242  296 MET B CB    
2697 C CG    . MET B 136 ? 0.4129 0.3866 0.5328 0.1188  0.0492  0.1196  296 MET B CG    
2698 S SD    . MET B 136 ? 0.5754 0.5928 0.7095 0.1151  0.0430  0.1166  296 MET B SD    
2699 C CE    . MET B 136 ? 0.4944 0.4953 0.6046 0.1099  0.0469  0.0993  296 MET B CE    
2700 N N     . VAL B 137 ? 0.3272 0.3219 0.4141 0.0929  0.0139  0.1418  297 VAL B N     
2701 C CA    . VAL B 137 ? 0.3395 0.3447 0.4056 0.0936  0.0037  0.1467  297 VAL B CA    
2702 C C     . VAL B 137 ? 0.3723 0.3621 0.4358 0.0935  0.0132  0.1657  297 VAL B C     
2703 O O     . VAL B 137 ? 0.4067 0.3915 0.4560 0.0981  0.0060  0.1717  297 VAL B O     
2704 C CB    . VAL B 137 ? 0.3637 0.3903 0.4106 0.0921  -0.0005 0.1403  297 VAL B CB    
2705 C CG1   . VAL B 137 ? 0.3828 0.4087 0.3970 0.0992  -0.0072 0.1435  297 VAL B CG1   
2706 C CG2   . VAL B 137 ? 0.3688 0.4042 0.4163 0.0888  -0.0138 0.1205  297 VAL B CG2   
2707 N N     . GLN B 138 ? 0.3788 0.3538 0.4539 0.0847  0.0258  0.1760  298 GLN B N     
2708 C CA    . GLN B 138 ? 0.4222 0.3789 0.4979 0.0774  0.0322  0.1956  298 GLN B CA    
2709 C C     . GLN B 138 ? 0.4851 0.4153 0.5623 0.0859  0.0288  0.1960  298 GLN B C     
2710 O O     . GLN B 138 ? 0.4829 0.4095 0.5516 0.0864  0.0271  0.2101  298 GLN B O     
2711 C CB    . GLN B 138 ? 0.4934 0.4257 0.5813 0.0565  0.0374  0.2020  298 GLN B CB    
2712 C CG    . GLN B 138 ? 0.6002 0.5361 0.6942 0.0389  0.0404  0.2275  298 GLN B CG    
2713 C CD    . GLN B 138 ? 0.6236 0.5883 0.7340 0.0158  0.0412  0.2359  298 GLN B CD    
2714 O OE1   . GLN B 138 ? 0.6725 0.6780 0.7923 0.0113  0.0485  0.2575  298 GLN B OE1   
2715 N NE2   . GLN B 138 ? 0.5666 0.5148 0.6787 0.0022  0.0326  0.2120  298 GLN B NE2   
2716 N N     . GLU B 139 ? 0.5016 0.4164 0.5894 0.0942  0.0291  0.1824  299 GLU B N     
2717 C CA    . GLU B 139 ? 0.5690 0.4636 0.6629 0.1045  0.0278  0.1851  299 GLU B CA    
2718 C C     . GLU B 139 ? 0.5367 0.4583 0.6348 0.1122  0.0145  0.1839  299 GLU B C     
2719 O O     . GLU B 139 ? 0.5495 0.4622 0.6459 0.1161  0.0072  0.1940  299 GLU B O     
2720 C CB    . GLU B 139 ? 0.6482 0.5095 0.7478 0.1139  0.0385  0.1743  299 GLU B CB    
2721 C CG    . GLU B 139 ? 0.8036 0.6392 0.9077 0.1270  0.0394  0.1801  299 GLU B CG    
2722 C CD    . GLU B 139 ? 0.9075 0.7207 1.0138 0.1459  0.0530  0.1685  299 GLU B CD    
2723 O OE1   . GLU B 139 ? 0.9189 0.7414 1.0233 0.1490  0.0620  0.1559  299 GLU B OE1   
2724 O OE2   . GLU B 139 ? 0.9845 0.7704 1.0916 0.1601  0.0558  0.1728  299 GLU B OE2   
2725 N N     . ALA B 140 ? 0.4656 0.4143 0.5674 0.1118  0.0078  0.1725  300 ALA B N     
2726 C CA    . ALA B 140 ? 0.4944 0.4591 0.6023 0.1145  -0.0095 0.1718  300 ALA B CA    
2727 C C     . ALA B 140 ? 0.4706 0.4408 0.5480 0.1094  -0.0310 0.1659  300 ALA B C     
2728 O O     . ALA B 140 ? 0.4529 0.4212 0.5238 0.1109  -0.0512 0.1656  300 ALA B O     
2729 C CB    . ALA B 140 ? 0.4924 0.4758 0.6278 0.1178  -0.0035 0.1666  300 ALA B CB    
2730 N N     . GLY B 141 ? 0.3685 0.4362 0.5203 0.1255  0.0035  0.1139  301 GLY B N     
2731 C CA    . GLY B 141 ? 0.3508 0.4217 0.4880 0.1117  -0.0146 0.1119  301 GLY B CA    
2732 C C     . GLY B 141 ? 0.3639 0.4518 0.4985 0.1026  -0.0229 0.1140  301 GLY B C     
2733 O O     . GLY B 141 ? 0.3730 0.4648 0.4929 0.0900  -0.0380 0.1133  301 GLY B O     
2734 N N     . ARG B 142 ? 0.3278 0.4231 0.4735 0.1086  -0.0125 0.1154  302 ARG B N     
2735 C CA    . ARG B 142 ? 0.2960 0.4096 0.4404 0.0994  -0.0202 0.1175  302 ARG B CA    
2736 C C     . ARG B 142 ? 0.2658 0.3717 0.4148 0.1084  -0.0062 0.1115  302 ARG B C     
2737 O O     . ARG B 142 ? 0.2941 0.3832 0.4485 0.1224  0.0114  0.1082  302 ARG B O     
2738 C CB    . ARG B 142 ? 0.3293 0.4835 0.4926 0.0953  -0.0237 0.1373  302 ARG B CB    
2739 C CG    . ARG B 142 ? 0.4213 0.5940 0.6124 0.1116  -0.0053 0.1528  302 ARG B CG    
2740 C CD    . ARG B 142 ? 0.5260 0.7394 0.7362 0.1056  -0.0102 0.1747  302 ARG B CD    
2741 N NE    . ARG B 142 ? 0.6003 0.8363 0.8140 0.0969  -0.0142 0.1794  302 ARG B NE    
2742 C CZ    . ARG B 142 ? 0.6616 0.9196 0.8959 0.1072  0.0011  0.1909  302 ARG B CZ    
2743 N NH1   . ARG B 142 ? 0.6981 0.9545 0.9483 0.1271  0.0219  0.1980  302 ARG B NH1   
2744 N NH2   . ARG B 142 ? 0.6550 0.9340 0.8910 0.0973  -0.0040 0.1947  302 ARG B NH2   
2745 N N     . VAL B 143 ? 0.2592 0.3749 0.4022 0.0991  -0.0142 0.1088  303 VAL B N     
2746 C CA    . VAL B 143 ? 0.3090 0.4177 0.4548 0.1075  -0.0007 0.1023  303 VAL B CA    
2747 C C     . VAL B 143 ? 0.3729 0.5225 0.5427 0.1122  0.0081  0.1188  303 VAL B C     
2748 O O     . VAL B 143 ? 0.3801 0.5637 0.5556 0.0981  -0.0064 0.1309  303 VAL B O     
2749 C CB    . VAL B 143 ? 0.2918 0.3876 0.4161 0.0944  -0.0149 0.0896  303 VAL B CB    
2750 C CG1   . VAL B 143 ? 0.2958 0.3731 0.4113 0.0967  0.0014  0.0741  303 VAL B CG1   
2751 C CG2   . VAL B 143 ? 0.3069 0.3619 0.4062 0.0886  -0.0235 0.0752  303 VAL B CG2   
2752 N N     . THR B 144 ? 0.3938 0.5345 0.5724 0.1299  0.0323  0.1182  304 THR B N     
2753 C CA    . THR B 144 ? 0.4090 0.5848 0.6084 0.1363  0.0444  0.1335  304 THR B CA    
2754 C C     . THR B 144 ? 0.3737 0.5570 0.5683 0.1309  0.0441  0.1258  304 THR B C     
2755 O O     . THR B 144 ? 0.3861 0.5319 0.5633 0.1385  0.0578  0.1067  304 THR B O     
2756 C CB    . THR B 144 ? 0.4626 0.6199 0.6657 0.1572  0.0715  0.1348  304 THR B CB    
2757 O OG1   . THR B 144 ? 0.4953 0.6459 0.7024 0.1616  0.0712  0.1409  304 THR B OG1   
2758 C CG2   . THR B 144 ? 0.4661 0.6606 0.6904 0.1647  0.0844  0.1539  304 THR B CG2   
2759 N N     . VAL B 145 ? 0.3234 0.5502 0.5282 0.1145  0.0275  0.1386  305 VAL B N     
2760 C CA    . VAL B 145 ? 0.3091 0.5487 0.5083 0.1044  0.0255  0.1317  305 VAL B CA    
2761 C C     . VAL B 145 ? 0.3115 0.5963 0.5364 0.1070  0.0342  0.1537  305 VAL B C     
2762 O O     . VAL B 145 ? 0.3002 0.6158 0.5332 0.0917  0.0175  0.1712  305 VAL B O     
2763 C CB    . VAL B 145 ? 0.2933 0.5324 0.4663 0.0730  -0.0065 0.1218  305 VAL B CB    
2764 C CG1   . VAL B 145 ? 0.3176 0.5548 0.4721 0.0570  -0.0078 0.1077  305 VAL B CG1   
2765 C CG2   . VAL B 145 ? 0.2984 0.4876 0.4399 0.0673  -0.0157 0.1006  305 VAL B CG2   
2766 N N     . ARG B 146 ? 0.3273 0.6050 0.5562 0.1245  0.0614  0.1505  306 ARG B N     
2767 C CA    . ARG B 146 ? 0.3721 0.6847 0.6211 0.1293  0.0727  0.1714  306 ARG B CA    
2768 C C     . ARG B 146 ? 0.3049 0.6563 0.5573 0.1051  0.0532  0.1781  306 ARG B C     
2769 O O     . ARG B 146 ? 0.2565 0.6015 0.4914 0.0880  0.0383  0.1606  306 ARG B O     
2770 C CB    . ARG B 146 ? 0.4712 0.7545 0.7119 0.1523  0.1059  0.1625  306 ARG B CB    
2771 C CG    . ARG B 146 ? 0.5779 0.8123 0.8046 0.1713  0.1221  0.1530  306 ARG B CG    
2772 C CD    . ARG B 146 ? 0.6927 0.8952 0.9048 0.1912  0.1516  0.1479  306 ARG B CD    
2773 N NE    . ARG B 146 ? 0.7634 0.9386 0.9713 0.2072  0.1637  0.1516  306 ARG B NE    
2774 C CZ    . ARG B 146 ? 0.8015 0.9247 0.9835 0.2090  0.1645  0.1316  306 ARG B CZ    
2775 N NH1   . ARG B 146 ? 0.7826 0.8724 0.9401 0.1968  0.1546  0.1068  306 ARG B NH1   
2776 N NH2   . ARG B 146 ? 0.8519 0.9566 1.0320 0.2218  0.1744  0.1373  306 ARG B NH2   
2777 N N     . ASP B 147 ? 0.2758 0.6646 0.5477 0.1022  0.0519  0.2037  307 ASP B N     
2778 C CA    . ASP B 147 ? 0.2889 0.7085 0.5606 0.0800  0.0361  0.2115  307 ASP B CA    
2779 C C     . ASP B 147 ? 0.2662 0.6828 0.5353 0.0889  0.0570  0.2003  307 ASP B C     
2780 O O     . ASP B 147 ? 0.2674 0.6569 0.5344 0.1142  0.0862  0.1914  307 ASP B O     
2781 C CB    . ASP B 147 ? 0.3598 0.8168 0.6534 0.0769  0.0321  0.2443  307 ASP B CB    
2782 C CG    . ASP B 147 ? 0.4672 0.9244 0.7606 0.0667  0.0146  0.2547  307 ASP B CG    
2783 O OD1   . ASP B 147 ? 0.4916 0.9241 0.7608 0.0506  -0.0045 0.2368  307 ASP B OD1   
2784 O OD2   . ASP B 147 ? 0.5217 1.0016 0.8377 0.0749  0.0211  0.2805  307 ASP B OD2   
2785 N N     . GLY B 148 ? 0.2066 0.6420 0.4684 0.0669  0.0424  0.1987  308 GLY B N     
2786 C CA    . GLY B 148 ? 0.2118 0.6452 0.4687 0.0722  0.0618  0.1882  308 GLY B CA    
2787 C C     . GLY B 148 ? 0.2008 0.5914 0.4252 0.0678  0.0669  0.1528  308 GLY B C     
2788 O O     . GLY B 148 ? 0.2195 0.5846 0.4247 0.0739  0.0869  0.1371  308 GLY B O     
2789 N N     . MET B 149 ? 0.2341 0.5910 0.4333 0.0538  0.0452  0.1348  309 MET B N     
2790 C CA    . MET B 149 ? 0.3098 0.6010 0.4595 0.0425  0.0417  0.0963  309 MET B CA    
2791 C C     . MET B 149 ? 0.3330 0.6174 0.4566 0.0200  0.0332  0.0795  309 MET B C     
2792 O O     . MET B 149 ? 0.3500 0.5871 0.4431 0.0228  0.0477  0.0540  309 MET B O     
2793 C CB    . MET B 149 ? 0.3125 0.5789 0.4434 0.0289  0.0168  0.0851  309 MET B CB    
2794 C CG    . MET B 149 ? 0.3508 0.5950 0.4902 0.0515  0.0293  0.0873  309 MET B CG    
2795 S SD    . MET B 149 ? 0.5564 0.7363 0.6728 0.0755  0.0634  0.0637  309 MET B SD    
2796 C CE    . MET B 149 ? 0.4650 0.6817 0.6257 0.1113  0.0951  0.0950  309 MET B CE    
2797 N N     . PRO B 150 ? 0.3539 0.6831 0.4874 -0.0035 0.0084  0.0938  310 PRO B N     
2798 C CA    . PRO B 150 ? 0.3429 0.6647 0.4509 -0.0247 0.0006  0.0777  310 PRO B CA    
2799 C C     . PRO B 150 ? 0.3586 0.6790 0.4709 -0.0081 0.0321  0.0764  310 PRO B C     
2800 O O     . PRO B 150 ? 0.3686 0.6562 0.4481 -0.0190 0.0340  0.0521  310 PRO B O     
2801 C CB    . PRO B 150 ? 0.3706 0.7484 0.4970 -0.0476 -0.0277 0.1022  310 PRO B CB    
2802 C CG    . PRO B 150 ? 0.3882 0.7536 0.5140 -0.0450 -0.0406 0.1130  310 PRO B CG    
2803 C CD    . PRO B 150 ? 0.3551 0.7368 0.5169 -0.0144 -0.0161 0.1232  310 PRO B CD    
2804 N N     . GLU B 151 ? 0.3044 0.6582 0.4548 0.0188  0.0570  0.1027  311 GLU B N     
2805 C CA    . GLU B 151 ? 0.3587 0.7107 0.5126 0.0392  0.0905  0.1046  311 GLU B CA    
2806 C C     . GLU B 151 ? 0.3301 0.6050 0.4397 0.0510  0.1110  0.0703  311 GLU B C     
2807 O O     . GLU B 151 ? 0.3121 0.5653 0.4003 0.0532  0.1273  0.0574  311 GLU B O     
2808 C CB    . GLU B 151 ? 0.4362 0.8343 0.6386 0.0700  0.1156  0.1405  311 GLU B CB    
2809 C CG    . GLU B 151 ? 0.5160 0.9678 0.7507 0.0567  0.0890  0.1724  311 GLU B CG    
2810 C CD    . GLU B 151 ? 0.5957 1.0744 0.8272 0.0316  0.0705  0.1775  311 GLU B CD    
2811 O OE1   . GLU B 151 ? 0.6254 1.0997 0.8504 0.0379  0.0902  0.1719  311 GLU B OE1   
2812 O OE2   . GLU B 151 ? 0.6246 1.1197 0.8528 0.0059  0.0362  0.1859  311 GLU B OE2   
2813 N N     . LEU B 152 ? 0.3123 0.5453 0.4075 0.0579  0.1094  0.0567  312 LEU B N     
2814 C CA    . LEU B 152 ? 0.3421 0.4992 0.3951 0.0672  0.1253  0.0262  312 LEU B CA    
2815 C C     . LEU B 152 ? 0.3495 0.4683 0.3597 0.0406  0.1104  -0.0044 312 LEU B C     
2816 O O     . LEU B 152 ? 0.4220 0.4855 0.3970 0.0461  0.1264  -0.0267 312 LEU B O     
2817 C CB    . LEU B 152 ? 0.3189 0.4435 0.3669 0.0739  0.1198  0.0195  312 LEU B CB    
2818 C CG    . LEU B 152 ? 0.3440 0.4948 0.4292 0.1022  0.1358  0.0461  312 LEU B CG    
2819 C CD1   . LEU B 152 ? 0.3760 0.4849 0.4484 0.1061  0.1297  0.0344  312 LEU B CD1   
2820 C CD2   . LEU B 152 ? 0.3719 0.5156 0.4620 0.1341  0.1743  0.0554  312 LEU B CD2   
2821 N N     . LEU B 153 ? 0.3247 0.4705 0.3356 0.0115  0.0792  -0.0048 313 LEU B N     
2822 C CA    . LEU B 153 ? 0.3441 0.4566 0.3157 -0.0147 0.0631  -0.0324 313 LEU B CA    
2823 C C     . LEU B 153 ? 0.3617 0.4796 0.3249 -0.0159 0.0774  -0.0352 313 LEU B C     
2824 O O     . LEU B 153 ? 0.3913 0.4716 0.3182 -0.0322 0.0718  -0.0604 313 LEU B O     
2825 C CB    . LEU B 153 ? 0.2898 0.4278 0.2613 -0.0437 0.0266  -0.0309 313 LEU B CB    
2826 C CG    . LEU B 153 ? 0.2886 0.4150 0.2602 -0.0457 0.0098  -0.0314 313 LEU B CG    
2827 C CD1   . LEU B 153 ? 0.2877 0.4379 0.2538 -0.0732 -0.0246 -0.0282 313 LEU B CD1   
2828 C CD2   . LEU B 153 ? 0.3118 0.3709 0.2500 -0.0432 0.0149  -0.0590 313 LEU B CD2   
2829 N N     . LYS B 154 ? 0.3284 0.4938 0.3259 0.0018  0.0965  -0.0081 314 LYS B N     
2830 C CA    . LYS B 154 ? 0.3569 0.5345 0.3513 0.0034  0.1127  -0.0058 314 LYS B CA    
2831 C C     . LYS B 154 ? 0.3790 0.5148 0.3573 0.0343  0.1518  -0.0118 314 LYS B C     
2832 O O     . LYS B 154 ? 0.4064 0.5486 0.3808 0.0414  0.1711  -0.0084 314 LYS B O     
2833 C CB    . LYS B 154 ? 0.3954 0.6547 0.4381 0.0030  0.1098  0.0312  314 LYS B CB    
2834 C CG    . LYS B 154 ? 0.4205 0.7203 0.4738 -0.0296 0.0703  0.0392  314 LYS B CG    
2835 C CD    . LYS B 154 ? 0.4365 0.8153 0.5369 -0.0307 0.0682  0.0778  314 LYS B CD    
2836 C CE    . LYS B 154 ? 0.4531 0.8741 0.5743 -0.0525 0.0321  0.0964  314 LYS B CE    
2837 N NZ    . LYS B 154 ? 0.4795 0.9493 0.6367 -0.0470 0.0269  0.1333  314 LYS B NZ    
2838 N N     . LEU B 155 ? 0.3633 0.5287 0.3802 0.0943  0.0124  0.0694  315 LEU B N     
2839 C CA    . LEU B 155 ? 0.3752 0.5273 0.4104 0.1190  0.0316  0.0626  315 LEU B CA    
2840 C C     . LEU B 155 ? 0.3720 0.5053 0.3881 0.1064  0.0553  0.0440  315 LEU B C     
2841 O O     . LEU B 155 ? 0.3699 0.4769 0.3502 0.0847  0.0546  0.0408  315 LEU B O     
2842 C CB    . LEU B 155 ? 0.3870 0.4852 0.4013 0.1369  0.0269  0.0722  315 LEU B CB    
2843 C CG    . LEU B 155 ? 0.4164 0.5267 0.4530 0.1615  0.0059  0.0937  315 LEU B CG    
2844 C CD1   . LEU B 155 ? 0.4800 0.5238 0.4877 0.1747  0.0054  0.1052  315 LEU B CD1   
2845 C CD2   . LEU B 155 ? 0.4211 0.5813 0.5211 0.1890  0.0109  0.0912  315 LEU B CD2   
2846 N N     . PRO B 156 ? 0.3760 0.5234 0.4149 0.1213  0.0763  0.0316  316 PRO B N     
2847 C CA    . PRO B 156 ? 0.4049 0.5302 0.4148 0.1098  0.0971  0.0140  316 PRO B CA    
2848 C C     . PRO B 156 ? 0.4066 0.4690 0.3750 0.1052  0.0936  0.0098  316 PRO B C     
2849 O O     . PRO B 156 ? 0.4093 0.4408 0.3782 0.1193  0.0860  0.0166  316 PRO B O     
2850 C CB    . PRO B 156 ? 0.4300 0.5720 0.4679 0.1345  0.1208  -0.0002 316 PRO B CB    
2851 C CG    . PRO B 156 ? 0.4055 0.6072 0.5029 0.1510  0.1138  0.0119  316 PRO B CG    
2852 C CD    . PRO B 156 ? 0.3745 0.5628 0.4674 0.1502  0.0822  0.0325  316 PRO B CD    
2853 N N     . LEU B 157 ? 0.3900 0.4357 0.3252 0.0846  0.0979  0.0013  317 LEU B N     
2854 C CA    . LEU B 157 ? 0.4268 0.4249 0.3317 0.0759  0.0922  -0.0022 317 LEU B CA    
2855 C C     . LEU B 157 ? 0.4594 0.4199 0.3588 0.0902  0.1021  -0.0167 317 LEU B C     
2856 O O     . LEU B 157 ? 0.4919 0.4548 0.3875 0.0975  0.1184  -0.0337 317 LEU B O     
2857 C CB    . LEU B 157 ? 0.4316 0.4278 0.3088 0.0537  0.0910  -0.0068 317 LEU B CB    
2858 C CG    . LEU B 157 ? 0.4086 0.4246 0.2861 0.0380  0.0808  0.0061  317 LEU B CG    
2859 C CD1   . LEU B 157 ? 0.4307 0.4426 0.2827 0.0215  0.0810  0.0039  317 LEU B CD1   
2860 C CD2   . LEU B 157 ? 0.4086 0.4078 0.2855 0.0353  0.0679  0.0152  317 LEU B CD2   
2861 N N     . ARG B 158 ? 0.4536 0.3757 0.3495 0.0926  0.0944  -0.0107 318 ARG B N     
2862 C CA    . ARG B 158 ? 0.4907 0.3650 0.3793 0.1016  0.1024  -0.0245 318 ARG B CA    
2863 C C     . ARG B 158 ? 0.5152 0.3518 0.3849 0.0807  0.0941  -0.0243 318 ARG B C     
2864 O O     . ARG B 158 ? 0.4910 0.3279 0.3635 0.0727  0.0849  -0.0060 318 ARG B O     
2865 C CB    . ARG B 158 ? 0.5663 0.4258 0.4803 0.1300  0.1037  -0.0145 318 ARG B CB    
2866 C CG    . ARG B 158 ? 0.6699 0.4710 0.5775 0.1424  0.1148  -0.0314 318 ARG B CG    
2867 C CD    . ARG B 158 ? 0.7279 0.5019 0.6595 0.1718  0.1123  -0.0150 318 ARG B CD    
2868 N NE    . ARG B 158 ? 0.7482 0.5703 0.7190 0.2018  0.1158  -0.0099 318 ARG B NE    
2869 C CZ    . ARG B 158 ? 0.7844 0.6151 0.7743 0.2248  0.1360  -0.0319 318 ARG B CZ    
2870 N NH1   . ARG B 158 ? 0.8207 0.6085 0.7834 0.2200  0.1538  -0.0627 318 ARG B NH1   
2871 N NH2   . ARG B 158 ? 0.7725 0.6585 0.8095 0.2515  0.1389  -0.0246 318 ARG B NH2   
2872 N N     . CYS B 159 ? 0.5275 0.3345 0.3777 0.0704  0.0981  -0.0459 319 CYS B N     
2873 C CA    . CYS B 159 ? 0.5580 0.3352 0.3993 0.0477  0.0895  -0.0476 319 CYS B CA    
2874 C C     . CYS B 159 ? 0.5501 0.2872 0.4026 0.0524  0.0902  -0.0330 319 CYS B C     
2875 O O     . CYS B 159 ? 0.5898 0.2974 0.4481 0.0742  0.0976  -0.0328 319 CYS B O     
2876 C CB    . CYS B 159 ? 0.6046 0.3546 0.4217 0.0348  0.0905  -0.0761 319 CYS B CB    
2877 S SG    . CYS B 159 ? 0.5975 0.3249 0.4150 0.0013  0.0757  -0.0789 319 CYS B SG    
2878 N N     . HIS B 160 ? 0.5483 0.2842 0.4047 0.0329  0.0841  -0.0191 320 HIS B N     
2879 C CA    . HIS B 160 ? 0.5852 0.2824 0.4455 0.0322  0.0868  -0.0005 320 HIS B CA    
2880 C C     . HIS B 160 ? 0.6177 0.2566 0.4738 0.0175  0.0902  -0.0143 320 HIS B C     
2881 O O     . HIS B 160 ? 0.6630 0.2534 0.5189 0.0190  0.0947  -0.0001 320 HIS B O     
2882 C CB    . HIS B 160 ? 0.5792 0.3013 0.4434 0.0160  0.0848  0.0195  320 HIS B CB    
2883 C CG    . HIS B 160 ? 0.5647 0.3028 0.4385 -0.0115 0.0823  0.0092  320 HIS B CG    
2884 N ND1   . HIS B 160 ? 0.5086 0.2748 0.3835 -0.0174 0.0739  -0.0098 320 HIS B ND1   
2885 C CD2   . HIS B 160 ? 0.5715 0.3061 0.4576 -0.0345 0.0864  0.0172  320 HIS B CD2   
2886 C CE1   . HIS B 160 ? 0.5050 0.2860 0.3963 -0.0405 0.0691  -0.0129 320 HIS B CE1   
2887 N NE2   . HIS B 160 ? 0.5132 0.2788 0.4157 -0.0516 0.0783  0.0021  320 HIS B NE2   
2888 N N     . GLU B 161 ? 0.6246 0.2647 0.4739 0.0014  0.0864  -0.0413 321 GLU B N     
2889 C CA    . GLU B 161 ? 0.7301 0.3154 0.5733 -0.0189 0.0864  -0.0599 321 GLU B CA    
2890 C C     . GLU B 161 ? 0.7727 0.3058 0.5982 0.0005  0.0951  -0.0841 321 GLU B C     
2891 O O     . GLU B 161 ? 0.8121 0.2774 0.6354 -0.0012 0.1006  -0.0875 321 GLU B O     
2892 C CB    . GLU B 161 ? 0.7525 0.3659 0.5963 -0.0505 0.0729  -0.0775 321 GLU B CB    
2893 C CG    . GLU B 161 ? 0.7542 0.4144 0.6254 -0.0696 0.0671  -0.0571 321 GLU B CG    
2894 C CD    . GLU B 161 ? 0.8303 0.4587 0.7201 -0.0928 0.0735  -0.0439 321 GLU B CD    
2895 O OE1   . GLU B 161 ? 0.8856 0.4501 0.7660 -0.1005 0.0775  -0.0533 321 GLU B OE1   
2896 O OE2   . GLU B 161 ? 0.8167 0.4818 0.7299 -0.1039 0.0770  -0.0245 321 GLU B OE2   
2897 N N     . CYS B 162 ? 0.7328 0.2947 0.5456 0.0187  0.0989  -0.1012 322 CYS B N     
2898 C CA    . CYS B 162 ? 0.8072 0.3260 0.6024 0.0384  0.1124  -0.1300 322 CYS B CA    
2899 C C     . CYS B 162 ? 0.7948 0.3414 0.6036 0.0789  0.1260  -0.1237 322 CYS B C     
2900 O O     . CYS B 162 ? 0.8271 0.3476 0.6283 0.1013  0.1423  -0.1478 322 CYS B O     
2901 C CB    . CYS B 162 ? 0.8224 0.3434 0.5821 0.0181  0.1088  -0.1661 322 CYS B CB    
2902 S SG    . CYS B 162 ? 0.7565 0.3608 0.5029 0.0201  0.1057  -0.1640 322 CYS B SG    
2903 N N     . GLN B 163 ? 0.7253 0.3271 0.5560 0.0870  0.1201  -0.0935 323 GLN B N     
2904 C CA    . GLN B 163 ? 0.7231 0.3620 0.5772 0.1213  0.1282  -0.0825 323 GLN B CA    
2905 C C     . GLN B 163 ? 0.7155 0.3953 0.5621 0.1301  0.1420  -0.1054 323 GLN B C     
2906 O O     . GLN B 163 ? 0.7138 0.4193 0.5855 0.1600  0.1547  -0.1045 323 GLN B O     
2907 C CB    . GLN B 163 ? 0.7920 0.3829 0.6670 0.1541  0.1349  -0.0745 323 GLN B CB    
2908 C CG    . GLN B 163 ? 0.8206 0.3850 0.7037 0.1511  0.1214  -0.0389 323 GLN B CG    
2909 C CD    . GLN B 163 ? 0.9078 0.4137 0.7696 0.1179  0.1180  -0.0422 323 GLN B CD    
2910 O OE1   . GLN B 163 ? 0.9847 0.4338 0.8327 0.1117  0.1257  -0.0693 323 GLN B OE1   
2911 N NE2   . GLN B 163 ? 0.8843 0.4056 0.7443 0.0944  0.1079  -0.0165 323 GLN B NE2   
2912 N N     . GLN B 164 ? 0.7323 0.4218 0.5456 0.1036  0.1395  -0.1236 324 GLN B N     
2913 C CA    . GLN B 164 ? 0.7511 0.4808 0.5469 0.1058  0.1528  -0.1400 324 GLN B CA    
2914 C C     . GLN B 164 ? 0.6758 0.4740 0.4966 0.1087  0.1492  -0.1138 324 GLN B C     
2915 O O     . GLN B 164 ? 0.5635 0.3780 0.3949 0.0955  0.1309  -0.0899 324 GLN B O     
2916 C CB    . GLN B 164 ? 0.8260 0.5470 0.5732 0.0743  0.1443  -0.1597 324 GLN B CB    
2917 C CG    . GLN B 164 ? 0.9179 0.6731 0.6325 0.0724  0.1587  -0.1746 324 GLN B CG    
2918 C CD    . GLN B 164 ? 1.0032 0.7453 0.6620 0.0418  0.1448  -0.1918 324 GLN B CD    
2919 O OE1   . GLN B 164 ? 1.0523 0.7457 0.6892 0.0285  0.1361  -0.2131 324 GLN B OE1   
2920 N NE2   . GLN B 164 ? 1.0051 0.7895 0.6405 0.0288  0.1403  -0.1813 324 GLN B NE2   
2921 N N     . LEU B 165 ? 0.6641 0.5018 0.4955 0.1248  0.1684  -0.1198 325 LEU B N     
2922 C CA    . LEU B 165 ? 0.5964 0.4983 0.4501 0.1212  0.1655  -0.0980 325 LEU B CA    
2923 C C     . LEU B 165 ? 0.5895 0.5108 0.4037 0.0927  0.1626  -0.0999 325 LEU B C     
2924 O O     . LEU B 165 ? 0.6257 0.5367 0.4006 0.0864  0.1764  -0.1218 325 LEU B O     
2925 C CB    . LEU B 165 ? 0.6180 0.5627 0.5118 0.1485  0.1874  -0.1003 325 LEU B CB    
2926 C CG    . LEU B 165 ? 0.6508 0.5941 0.5966 0.1810  0.1838  -0.0877 325 LEU B CG    
2927 C CD1   . LEU B 165 ? 0.6886 0.6834 0.6815 0.2096  0.2075  -0.0942 325 LEU B CD1   
2928 C CD2   . LEU B 165 ? 0.6307 0.5922 0.5954 0.1724  0.1556  -0.0552 325 LEU B CD2   
2929 N N     . LEU B 166 ? 0.5462 0.4906 0.3665 0.0762  0.1441  -0.0767 326 LEU B N     
2930 C CA    . LEU B 166 ? 0.5726 0.5317 0.3600 0.0522  0.1379  -0.0719 326 LEU B CA    
2931 C C     . LEU B 166 ? 0.5340 0.5412 0.3433 0.0480  0.1419  -0.0533 326 LEU B C     
2932 O O     . LEU B 166 ? 0.5041 0.5302 0.3520 0.0551  0.1346  -0.0387 326 LEU B O     
2933 C CB    . LEU B 166 ? 0.5720 0.5092 0.3474 0.0349  0.1122  -0.0629 326 LEU B CB    
2934 C CG    . LEU B 166 ? 0.6169 0.5159 0.3604 0.0242  0.1033  -0.0810 326 LEU B CG    
2935 C CD1   . LEU B 166 ? 0.6938 0.5904 0.3877 0.0163  0.1131  -0.0994 326 LEU B CD1   
2936 C CD2   . LEU B 166 ? 0.6518 0.5131 0.4105 0.0359  0.1072  -0.0934 326 LEU B CD2   
2937 N N     . PRO B 167 ? 0.5476 0.5723 0.3282 0.0335  0.1525  -0.0533 327 PRO B N     
2938 C CA    . PRO B 167 ? 0.5466 0.6157 0.3499 0.0257  0.1608  -0.0373 327 PRO B CA    
2939 C C     . PRO B 167 ? 0.5054 0.5724 0.3062 0.0063  0.1390  -0.0152 327 PRO B C     
2940 O O     . PRO B 167 ? 0.5188 0.6157 0.3396 -0.0040 0.1428  -0.0022 327 PRO B O     
2941 C CB    . PRO B 167 ? 0.6037 0.6854 0.3698 0.0166  0.1865  -0.0466 327 PRO B CB    
2942 C CG    . PRO B 167 ? 0.6522 0.6899 0.3593 0.0088  0.1758  -0.0583 327 PRO B CG    
2943 C CD    . PRO B 167 ? 0.6175 0.6220 0.3407 0.0228  0.1599  -0.0690 327 PRO B CD    
2944 N N     . SER B 168 ? 0.4368 0.4699 0.2176 0.0012  0.1174  -0.0124 328 SER B N     
2945 C CA    . SER B 168 ? 0.4457 0.4722 0.2259 -0.0123 0.0992  0.0058  328 SER B CA    
2946 C C     . SER B 168 ? 0.4273 0.4260 0.2074 -0.0095 0.0787  0.0059  328 SER B C     
2947 O O     . SER B 168 ? 0.4260 0.4079 0.1960 -0.0047 0.0759  -0.0066 328 SER B O     
2948 C CB    . SER B 168 ? 0.5063 0.5301 0.2490 -0.0305 0.1009  0.0168  328 SER B CB    
2949 O OG    . SER B 168 ? 0.5358 0.5356 0.2369 -0.0335 0.0911  0.0118  328 SER B OG    
2950 N N     . ILE B 169 ? 0.4157 0.4101 0.2090 -0.0139 0.0663  0.0184  329 ILE B N     
2951 C CA    . ILE B 169 ? 0.4294 0.4053 0.2290 -0.0114 0.0510  0.0195  329 ILE B CA    
2952 C C     . ILE B 169 ? 0.4354 0.3990 0.2117 -0.0167 0.0385  0.0190  329 ILE B C     
2953 O O     . ILE B 169 ? 0.4432 0.3999 0.2263 -0.0143 0.0309  0.0107  329 ILE B O     
2954 C CB    . ILE B 169 ? 0.3885 0.3605 0.2039 -0.0135 0.0444  0.0296  329 ILE B CB    
2955 C CG1   . ILE B 169 ? 0.3685 0.3513 0.2035 -0.0084 0.0500  0.0274  329 ILE B CG1   
2956 C CG2   . ILE B 169 ? 0.4101 0.3681 0.2339 -0.0099 0.0327  0.0309  329 ILE B CG2   
2957 C CD1   . ILE B 169 ? 0.3789 0.3556 0.2242 0.0020  0.0507  0.0215  329 ILE B CD1   
2958 N N     . PRO B 170 ? 0.4833 0.4445 0.2311 -0.0258 0.0346  0.0294  330 PRO B N     
2959 C CA    . PRO B 170 ? 0.5062 0.4581 0.2267 -0.0306 0.0173  0.0306  330 PRO B CA    
2960 C C     . PRO B 170 ? 0.5121 0.4624 0.2115 -0.0320 0.0207  0.0101  330 PRO B C     
2961 O O     . PRO B 170 ? 0.4787 0.4239 0.1764 -0.0348 0.0025  0.0041  330 PRO B O     
2962 C CB    . PRO B 170 ? 0.5608 0.5075 0.2436 -0.0412 0.0173  0.0476  330 PRO B CB    
2963 C CG    . PRO B 170 ? 0.5544 0.5021 0.2602 -0.0426 0.0274  0.0585  330 PRO B CG    
2964 C CD    . PRO B 170 ? 0.5008 0.4655 0.2389 -0.0349 0.0426  0.0432  330 PRO B CD    
2965 N N     . GLN B 171 ? 0.4721 0.4272 0.1596 -0.0299 0.0436  -0.0021 331 GLN B N     
2966 C CA    . GLN B 171 ? 0.5339 0.4785 0.2006 -0.0287 0.0508  -0.0262 331 GLN B CA    
2967 C C     . GLN B 171 ? 0.4799 0.4129 0.1824 -0.0207 0.0479  -0.0377 331 GLN B C     
2968 O O     . GLN B 171 ? 0.5182 0.4330 0.2070 -0.0258 0.0409  -0.0548 331 GLN B O     
2969 C CB    . GLN B 171 ? 0.5794 0.5331 0.2286 -0.0242 0.0804  -0.0376 331 GLN B CB    
2970 C CG    . GLN B 171 ? 0.6284 0.5906 0.2317 -0.0367 0.0869  -0.0286 331 GLN B CG    
2971 C CD    . GLN B 171 ? 0.7244 0.7035 0.3242 -0.0288 0.1164  -0.0429 331 GLN B CD    
2972 O OE1   . GLN B 171 ? 0.7637 0.7323 0.3593 -0.0188 0.1282  -0.0686 331 GLN B OE1   
2973 N NE2   . GLN B 171 ? 0.7352 0.7380 0.3381 -0.0332 0.1296  -0.0267 331 GLN B NE2   
2974 N N     . LEU B 172 ? 0.4620 0.4026 0.2055 -0.0113 0.0527  -0.0280 332 LEU B N     
2975 C CA    . LEU B 172 ? 0.4634 0.3906 0.2360 -0.0062 0.0504  -0.0324 332 LEU B CA    
2976 C C     . LEU B 172 ? 0.4837 0.4073 0.2650 -0.0173 0.0301  -0.0303 332 LEU B C     
2977 O O     . LEU B 172 ? 0.4551 0.3626 0.2398 -0.0236 0.0256  -0.0427 332 LEU B O     
2978 C CB    . LEU B 172 ? 0.4003 0.3377 0.2048 0.0038  0.0566  -0.0192 332 LEU B CB    
2979 C CG    . LEU B 172 ? 0.4844 0.4050 0.3107 0.0080  0.0568  -0.0191 332 LEU B CG    
2980 C CD1   . LEU B 172 ? 0.5414 0.4364 0.3619 0.0149  0.0662  -0.0342 332 LEU B CD1   
2981 C CD2   . LEU B 172 ? 0.4907 0.4217 0.3358 0.0161  0.0600  -0.0049 332 LEU B CD2   
2982 N N     . LYS B 173 ? 0.4540 0.3928 0.2431 -0.0197 0.0181  -0.0148 333 LYS B N     
2983 C CA    . LYS B 173 ? 0.5120 0.4583 0.3234 -0.0258 -0.0006 -0.0106 333 LYS B CA    
2984 C C     . LYS B 173 ? 0.5466 0.4902 0.3358 -0.0386 -0.0189 -0.0219 333 LYS B C     
2985 O O     . LYS B 173 ? 0.5561 0.5061 0.3702 -0.0474 -0.0324 -0.0266 333 LYS B O     
2986 C CB    . LYS B 173 ? 0.5158 0.4746 0.3407 -0.0206 -0.0088 0.0075  333 LYS B CB    
2987 C CG    . LYS B 173 ? 0.4931 0.4524 0.3422 -0.0116 0.0059  0.0138  333 LYS B CG    
2988 C CD    . LYS B 173 ? 0.5210 0.4802 0.3730 -0.0066 0.0017  0.0274  333 LYS B CD    
2989 C CE    . LYS B 173 ? 0.5275 0.4956 0.4131 -0.0007 -0.0099 0.0327  333 LYS B CE    
2990 N NZ    . LYS B 173 ? 0.4472 0.4223 0.3653 0.0033  0.0039  0.0268  333 LYS B NZ    
2991 N N     . GLU B 174 ? 0.5972 0.5336 0.3382 -0.0421 -0.0186 -0.0271 334 GLU B N     
2992 C CA    . GLU B 174 ? 0.6576 0.5866 0.3616 -0.0563 -0.0354 -0.0419 334 GLU B CA    
2993 C C     . GLU B 174 ? 0.6212 0.5260 0.3224 -0.0620 -0.0255 -0.0683 334 GLU B C     
2994 O O     . GLU B 174 ? 0.6141 0.5135 0.3138 -0.0779 -0.0443 -0.0818 334 GLU B O     
2995 C CB    . GLU B 174 ? 0.7778 0.7024 0.4202 -0.0591 -0.0319 -0.0404 334 GLU B CB    
2996 C CG    . GLU B 174 ? 0.9334 0.8426 0.5191 -0.0739 -0.0412 -0.0631 334 GLU B CG    
2997 C CD    . GLU B 174 ? 1.0232 0.9441 0.6017 -0.0883 -0.0819 -0.0577 334 GLU B CD    
2998 O OE1   . GLU B 174 ? 1.1001 1.0088 0.6278 -0.1042 -0.0958 -0.0775 334 GLU B OE1   
2999 O OE2   . GLU B 174 ? 1.0140 0.9573 0.6379 -0.0830 -0.1007 -0.0348 334 GLU B OE2   
3000 N N     . HIS B 175 ? 0.5825 0.4718 0.2856 -0.0493 0.0022  -0.0752 335 HIS B N     
3001 C CA    . HIS B 175 ? 0.6202 0.4763 0.3212 -0.0498 0.0142  -0.0985 335 HIS B CA    
3002 C C     . HIS B 175 ? 0.5950 0.4432 0.3394 -0.0588 0.0055  -0.0965 335 HIS B C     
3003 O O     . HIS B 175 ? 0.6649 0.4846 0.4031 -0.0726 0.0009  -0.1162 335 HIS B O     
3004 C CB    . HIS B 175 ? 0.6183 0.4651 0.3244 -0.0284 0.0435  -0.1002 335 HIS B CB    
3005 C CG    . HIS B 175 ? 0.6478 0.4535 0.3587 -0.0227 0.0562  -0.1196 335 HIS B CG    
3006 N ND1   . HIS B 175 ? 0.7396 0.5138 0.4122 -0.0217 0.0678  -0.1490 335 HIS B ND1   
3007 C CD2   . HIS B 175 ? 0.6274 0.4121 0.3731 -0.0177 0.0600  -0.1132 335 HIS B CD2   
3008 C CE1   . HIS B 175 ? 0.7615 0.4936 0.4497 -0.0144 0.0774  -0.1604 335 HIS B CE1   
3009 N NE2   . HIS B 175 ? 0.6971 0.4346 0.4287 -0.0128 0.0720  -0.1366 335 HIS B NE2   
3010 N N     . LEU B 176 ? 0.5708 0.4424 0.3568 -0.0531 0.0052  -0.0739 336 LEU B N     
3011 C CA    . LEU B 176 ? 0.5870 0.4563 0.4150 -0.0619 0.0039  -0.0687 336 LEU B CA    
3012 C C     . LEU B 176 ? 0.6366 0.5188 0.4796 -0.0856 -0.0200 -0.0763 336 LEU B C     
3013 O O     . LEU B 176 ? 0.6342 0.5076 0.5068 -0.1006 -0.0195 -0.0794 336 LEU B O     
3014 C CB    . LEU B 176 ? 0.5269 0.4211 0.3877 -0.0506 0.0113  -0.0456 336 LEU B CB    
3015 C CG    . LEU B 176 ? 0.5266 0.4107 0.3811 -0.0315 0.0309  -0.0371 336 LEU B CG    
3016 C CD1   . LEU B 176 ? 0.4965 0.4032 0.3734 -0.0246 0.0349  -0.0185 336 LEU B CD1   
3017 C CD2   . LEU B 176 ? 0.5650 0.4115 0.4196 -0.0292 0.0437  -0.0424 336 LEU B CD2   
3018 N N     . ARG B 177 ? 0.6603 0.5648 0.4838 -0.0906 -0.0422 -0.0773 337 ARG B N     
3019 C CA    A ARG B 177 ? 0.6987 0.6245 0.5382 -0.1127 -0.0721 -0.0833 337 ARG B CA    
3020 C CA    B ARG B 177 ? 0.6969 0.6227 0.5372 -0.1127 -0.0719 -0.0832 337 ARG B CA    
3021 C C     . ARG B 177 ? 0.7603 0.6506 0.5802 -0.1358 -0.0767 -0.1112 337 ARG B C     
3022 O O     . ARG B 177 ? 0.7774 0.6808 0.6300 -0.1597 -0.0951 -0.1175 337 ARG B O     
3023 C CB    A ARG B 177 ? 0.7249 0.6738 0.5329 -0.1116 -0.0982 -0.0771 337 ARG B CB    
3024 C CB    B ARG B 177 ? 0.7249 0.6762 0.5374 -0.1112 -0.0984 -0.0757 337 ARG B CB    
3025 C CG    A ARG B 177 ? 0.7010 0.6719 0.5197 -0.0896 -0.0940 -0.0507 337 ARG B CG    
3026 C CG    B ARG B 177 ? 0.6988 0.6837 0.5446 -0.0926 -0.1009 -0.0478 337 ARG B CG    
3027 C CD    A ARG B 177 ? 0.7545 0.7444 0.5462 -0.0908 -0.1248 -0.0393 337 ARG B CD    
3028 C CD    B ARG B 177 ? 0.7520 0.7564 0.5725 -0.0919 -0.1319 -0.0359 337 ARG B CD    
3029 N NE    A ARG B 177 ? 0.7448 0.7745 0.5955 -0.0844 -0.1457 -0.0198 337 ARG B NE    
3030 N NE    B ARG B 177 ? 0.7409 0.7872 0.6226 -0.0847 -0.1519 -0.0167 337 ARG B NE    
3031 C CZ    A ARG B 177 ? 0.7205 0.7596 0.5901 -0.0639 -0.1415 0.0027  337 ARG B CZ    
3032 C CZ    B ARG B 177 ? 0.7681 0.8485 0.6787 -0.0970 -0.1870 -0.0166 337 ARG B CZ    
3033 N NH1   A ARG B 177 ? 0.7152 0.7288 0.5484 -0.0528 -0.1195 0.0093  337 ARG B NH1   
3034 N NH1   B ARG B 177 ? 0.8252 0.8985 0.7006 -0.1215 -0.2081 -0.0362 337 ARG B NH1   
3035 N NH2   A ARG B 177 ? 0.7069 0.7812 0.6352 -0.0547 -0.1588 0.0173  337 ARG B NH2   
3036 N NH2   B ARG B 177 ? 0.7417 0.8646 0.7181 -0.0846 -0.2016 0.0016  337 ARG B NH2   
3037 N N     . LYS B 178 ? 0.7810 0.6265 0.5506 -0.1290 -0.0590 -0.1294 338 LYS B N     
3038 C CA    . LYS B 178 ? 0.8630 0.6607 0.6044 -0.1478 -0.0596 -0.1607 338 LYS B CA    
3039 C C     . LYS B 178 ? 0.8505 0.6205 0.6358 -0.1590 -0.0480 -0.1612 338 LYS B C     
3040 O O     . LYS B 178 ? 0.9093 0.6439 0.6874 -0.1842 -0.0561 -0.1845 338 LYS B O     
3041 C CB    . LYS B 178 ? 0.9390 0.6959 0.6220 -0.1303 -0.0362 -0.1799 338 LYS B CB    
3042 C CG    . LYS B 178 ? 1.0069 0.7880 0.6398 -0.1223 -0.0414 -0.1776 338 LYS B CG    
3043 C CD    . LYS B 178 ? 1.0710 0.8263 0.6642 -0.1000 -0.0081 -0.1904 338 LYS B CD    
3044 C CE    . LYS B 178 ? 1.1871 0.8850 0.7384 -0.1074 0.0024  -0.2309 338 LYS B CE    
3045 N NZ    . LYS B 178 ? 1.2239 0.9042 0.7525 -0.0796 0.0391  -0.2430 338 LYS B NZ    
3046 N N     . HIS B 179 ? 0.7799 0.5618 0.6055 -0.1429 -0.0293 -0.1355 339 HIS B N     
3047 C CA    . HIS B 179 ? 0.7990 0.5512 0.6584 -0.1532 -0.0150 -0.1300 339 HIS B CA    
3048 C C     . HIS B 179 ? 0.8253 0.6223 0.7439 -0.1756 -0.0255 -0.1150 339 HIS B C     
3049 O O     . HIS B 179 ? 0.8469 0.6299 0.7967 -0.1847 -0.0096 -0.1029 339 HIS B O     
3050 C CB    . HIS B 179 ? 0.7363 0.4694 0.5970 -0.1240 0.0127  -0.1110 339 HIS B CB    
3051 C CG    . HIS B 179 ? 0.7343 0.4327 0.5524 -0.0992 0.0260  -0.1242 339 HIS B CG    
3052 N ND1   . HIS B 179 ? 0.8094 0.4451 0.6017 -0.1010 0.0337  -0.1488 339 HIS B ND1   
3053 C CD2   . HIS B 179 ? 0.7077 0.4274 0.5096 -0.0721 0.0349  -0.1173 339 HIS B CD2   
3054 C CE1   . HIS B 179 ? 0.8007 0.4252 0.5656 -0.0726 0.0487  -0.1568 339 HIS B CE1   
3055 N NE2   . HIS B 179 ? 0.6757 0.3539 0.4476 -0.0567 0.0494  -0.1371 339 HIS B NE2   
3056 N N     . TRP B 180 ? 0.8417 0.6938 0.7768 -0.1836 -0.0513 -0.1140 340 TRP B N     
3057 C CA    . TRP B 180 ? 0.8540 0.7590 0.8559 -0.2033 -0.0623 -0.1025 340 TRP B CA    
3058 C C     . TRP B 180 ? 0.8953 0.7983 0.9089 -0.2429 -0.0883 -0.1246 340 TRP B C     
3059 O O     . TRP B 180 ? 0.9089 0.8155 0.9699 -0.2703 -0.0835 -0.1233 340 TRP B O     
3060 C CB    . TRP B 180 ? 0.8452 0.8151 0.8710 -0.1858 -0.0779 -0.0862 340 TRP B CB    
3061 C CG    . TRP B 180 ? 0.8420 0.8119 0.8524 -0.1511 -0.0567 -0.0681 340 TRP B CG    
3062 C CD1   . TRP B 180 ? 0.8517 0.7854 0.8438 -0.1359 -0.0267 -0.0612 340 TRP B CD1   
3063 C CD2   . TRP B 180 ? 0.8318 0.8375 0.8435 -0.1292 -0.0669 -0.0542 340 TRP B CD2   
3064 N NE1   . TRP B 180 ? 0.8167 0.7655 0.7994 -0.1091 -0.0186 -0.0467 340 TRP B NE1   
3065 C CE2   . TRP B 180 ? 0.7967 0.7852 0.7904 -0.1050 -0.0411 -0.0426 340 TRP B CE2   
3066 C CE3   . TRP B 180 ? 0.8500 0.8979 0.8760 -0.1280 -0.0977 -0.0491 340 TRP B CE3   
3067 C CZ2   . TRP B 180 ? 0.7867 0.7940 0.7759 -0.0830 -0.0428 -0.0288 340 TRP B CZ2   
3068 C CZ3   . TRP B 180 ? 0.8247 0.8877 0.8456 -0.1023 -0.0987 -0.0321 340 TRP B CZ3   
3069 C CH2   . TRP B 180 ? 0.7916 0.8319 0.7938 -0.0817 -0.0701 -0.0235 340 TRP B CH2   
3070 O OP3   . DG  C 1   ? 0.3445 0.4294 0.3620 -0.0162 -0.0479 0.0017  1   DG  D OP3   
3071 P P     . DG  C 1   ? 0.3607 0.4434 0.3744 -0.0202 -0.0485 -0.0015 1   DG  D P     
3072 O OP1   . DG  C 1   ? 0.3547 0.4498 0.3758 -0.0276 -0.0479 -0.0018 1   DG  D OP1   
3073 O OP2   . DG  C 1   ? 0.4163 0.4798 0.4082 -0.0201 -0.0526 -0.0029 1   DG  D OP2   
3074 O "O5'" . DG  C 1   ? 0.2274 0.3153 0.2540 -0.0141 -0.0453 -0.0055 1   DG  D "O5'" 
3075 C "C5'" . DG  C 1   ? 0.1964 0.2980 0.2427 -0.0127 -0.0415 -0.0056 1   DG  D "C5'" 
3076 C "C4'" . DG  C 1   ? 0.1746 0.2777 0.2321 -0.0071 -0.0378 -0.0100 1   DG  D "C4'" 
3077 O "O4'" . DG  C 1   ? 0.1708 0.2716 0.2245 -0.0040 -0.0405 -0.0166 1   DG  D "O4'" 
3078 C "C3'" . DG  C 1   ? 0.1633 0.2608 0.2169 -0.0055 -0.0353 -0.0106 1   DG  D "C3'" 
3079 O "O3'" . DG  C 1   ? 0.1651 0.2605 0.2209 -0.0071 -0.0309 -0.0052 1   DG  D "O3'" 
3080 C "C2'" . DG  C 1   ? 0.1766 0.2800 0.2421 -0.0013 -0.0328 -0.0209 1   DG  D "C2'" 
3081 C "C1'" . DG  C 1   ? 0.1664 0.2671 0.2242 0.0015  -0.0402 -0.0236 1   DG  D "C1'" 
3082 N N9    . DG  C 1   ? 0.1161 0.2038 0.1543 0.0057  -0.0480 -0.0264 1   DG  D N9    
3083 C C8    . DG  C 1   ? 0.1336 0.2047 0.1477 0.0022  -0.0535 -0.0210 1   DG  D C8    
3084 N N7    . DG  C 1   ? 0.1480 0.2032 0.1443 0.0088  -0.0615 -0.0255 1   DG  D N7    
3085 C C5    . DG  C 1   ? 0.1546 0.2227 0.1689 0.0180  -0.0614 -0.0364 1   DG  D C5    
3086 C C6    . DG  C 1   ? 0.1618 0.2246 0.1724 0.0296  -0.0683 -0.0477 1   DG  D C6    
3087 O O6    . DG  C 1   ? 0.2047 0.2436 0.1914 0.0354  -0.0761 -0.0477 1   DG  D O6    
3088 N N1    . DG  C 1   ? 0.1468 0.2330 0.1857 0.0336  -0.0624 -0.0601 1   DG  D N1    
3089 C C2    . DG  C 1   ? 0.1283 0.2350 0.1917 0.0259  -0.0515 -0.0601 1   DG  D C2    
3090 N N2    . DG  C 1   ? 0.1303 0.2543 0.2162 0.0272  -0.0440 -0.0736 1   DG  D N2    
3091 N N3    . DG  C 1   ? 0.1046 0.2094 0.1675 0.0167  -0.0459 -0.0473 1   DG  D N3    
3092 C C4    . DG  C 1   ? 0.1313 0.2194 0.1713 0.0140  -0.0516 -0.0368 1   DG  D C4    
3093 P P     A DT  C 2   ? 0.1880 0.2734 0.2282 -0.0085 -0.0289 -0.0014 2   DT  D P     
3094 P P     B DT  C 2   ? 0.1949 0.2803 0.2350 -0.0086 -0.0291 -0.0012 2   DT  D P     
3095 O OP1   A DT  C 2   ? 0.2226 0.2993 0.2582 -0.0091 -0.0269 0.0059  2   DT  D OP1   
3096 O OP1   B DT  C 2   ? 0.2175 0.2941 0.2534 -0.0092 -0.0265 0.0058  2   DT  D OP1   
3097 O OP2   A DT  C 2   ? 0.2163 0.2984 0.2427 -0.0088 -0.0362 -0.0006 2   DT  D OP2   
3098 O OP2   B DT  C 2   ? 0.2128 0.2950 0.2390 -0.0089 -0.0365 0.0001  2   DT  D OP2   
3099 O "O5'" A DT  C 2   ? 0.1812 0.2697 0.2275 -0.0088 -0.0208 -0.0109 2   DT  D "O5'" 
3100 O "O5'" B DT  C 2   ? 0.1770 0.2652 0.2222 -0.0087 -0.0214 -0.0107 2   DT  D "O5'" 
3101 C "C5'" A DT  C 2   ? 0.1777 0.2708 0.2397 -0.0114 -0.0118 -0.0158 2   DT  D "C5'" 
3102 C "C5'" B DT  C 2   ? 0.1819 0.2725 0.2393 -0.0122 -0.0107 -0.0149 2   DT  D "C5'" 
3103 C "C4'" A DT  C 2   ? 0.1828 0.2861 0.2549 -0.0126 -0.0042 -0.0295 2   DT  D "C4'" 
3104 C "C4'" B DT  C 2   ? 0.1801 0.2825 0.2485 -0.0122 -0.0048 -0.0295 2   DT  D "C4'" 
3105 O "O4'" A DT  C 2   ? 0.1756 0.2873 0.2509 -0.0041 -0.0141 -0.0385 2   DT  D "O4'" 
3106 O "O4'" B DT  C 2   ? 0.1710 0.2819 0.2456 -0.0036 -0.0155 -0.0374 2   DT  D "O4'" 
3107 C "C3'" A DT  C 2   ? 0.1855 0.2823 0.2434 -0.0178 0.0043  -0.0293 2   DT  D "C3'" 
3108 C "C3'" B DT  C 2   ? 0.1806 0.2802 0.2359 -0.0142 -0.0003 -0.0321 2   DT  D "C3'" 
3109 O "O3'" A DT  C 2   ? 0.2287 0.3345 0.2999 -0.0253 0.0190  -0.0412 2   DT  D "O3'" 
3110 O "O3'" B DT  C 2   ? 0.2172 0.3106 0.2683 -0.0244 0.0151  -0.0314 2   DT  D "O3'" 
3111 C "C2'" A DT  C 2   ? 0.1688 0.2695 0.2200 -0.0105 -0.0051 -0.0346 2   DT  D "C2'" 
3112 C "C2'" B DT  C 2   ? 0.1621 0.2788 0.2326 -0.0072 -0.0035 -0.0499 2   DT  D "C2'" 
3113 C "C1'" A DT  C 2   ? 0.1716 0.2841 0.2394 -0.0023 -0.0135 -0.0449 2   DT  D "C1'" 
3114 C "C1'" B DT  C 2   ? 0.1587 0.2761 0.2340 0.0010  -0.0167 -0.0497 2   DT  D "C1'" 
3115 N N1    A DT  C 2   ? 0.1576 0.2615 0.2108 0.0059  -0.0279 -0.0438 2   DT  D N1    
3116 N N1    B DT  C 2   ? 0.1525 0.2580 0.2085 0.0080  -0.0301 -0.0462 2   DT  D N1    
3117 C C2    A DT  C 2   ? 0.1515 0.2597 0.2063 0.0152  -0.0343 -0.0580 2   DT  D C2    
3118 C C2    B DT  C 2   ? 0.1537 0.2612 0.2081 0.0173  -0.0369 -0.0592 2   DT  D C2    
3119 O O2    A DT  C 2   ? 0.1337 0.2593 0.2067 0.0174  -0.0285 -0.0737 2   DT  D O2    
3120 O O2    B DT  C 2   ? 0.1450 0.2699 0.2178 0.0207  -0.0325 -0.0756 2   DT  D O2    
3121 N N3    A DT  C 2   ? 0.1596 0.2503 0.1936 0.0219  -0.0479 -0.0548 2   DT  D N3    
3122 N N3    B DT  C 2   ? 0.1626 0.2509 0.1937 0.0224  -0.0492 -0.0542 2   DT  D N3    
3123 C C4    A DT  C 2   ? 0.1659 0.2393 0.1805 0.0168  -0.0527 -0.0403 2   DT  D C4    
3124 C C4    B DT  C 2   ? 0.1655 0.2373 0.1780 0.0162  -0.0529 -0.0392 2   DT  D C4    
3125 O O4    A DT  C 2   ? 0.1941 0.2484 0.1876 0.0204  -0.0630 -0.0390 2   DT  D O4    
3126 O O4    B DT  C 2   ? 0.2011 0.2536 0.1915 0.0182  -0.0622 -0.0366 2   DT  D O4    
3127 C C5    A DT  C 2   ? 0.1495 0.2279 0.1703 0.0070  -0.0450 -0.0288 2   DT  D C5    
3128 C C5    B DT  C 2   ? 0.1496 0.2279 0.1706 0.0072  -0.0453 -0.0288 2   DT  D C5    
3129 C C7    A DT  C 2   ? 0.1440 0.2127 0.1517 0.0006  -0.0488 -0.0175 2   DT  D C7    
3130 C C7    B DT  C 2   ? 0.1444 0.2139 0.1532 0.0004  -0.0484 -0.0172 2   DT  D C7    
3131 C C6    A DT  C 2   ? 0.1459 0.2369 0.1839 0.0037  -0.0344 -0.0305 2   DT  D C6    
3132 C C6    B DT  C 2   ? 0.1494 0.2417 0.1899 0.0049  -0.0355 -0.0321 2   DT  D C6    
3133 P P     A DT  C 3   ? 0.2878 0.3859 0.3427 -0.0357 0.0342  -0.0424 3   DT  D P     
3134 P P     B DT  C 3   ? 0.3008 0.3842 0.3287 -0.0299 0.0232  -0.0297 3   DT  D P     
3135 O OP1   A DT  C 3   ? 0.3695 0.4652 0.4316 -0.0495 0.0525  -0.0473 3   DT  D OP1   
3136 O OP1   B DT  C 3   ? 0.3091 0.3759 0.3245 -0.0424 0.0392  -0.0245 3   DT  D OP1   
3137 O OP2   A DT  C 3   ? 0.2951 0.3713 0.3189 -0.0339 0.0275  -0.0258 3   DT  D OP2   
3138 O OP2   B DT  C 3   ? 0.4028 0.4757 0.4109 -0.0233 0.0096  -0.0193 3   DT  D OP2   
3139 O "O5'" A DT  C 3   ? 0.2989 0.4200 0.3668 -0.0301 0.0333  -0.0614 3   DT  D "O5'" 
3140 O "O5'" B DT  C 3   ? 0.3215 0.4285 0.3671 -0.0283 0.0283  -0.0510 3   DT  D "O5'" 
3141 C "C5'" A DT  C 3   ? 0.2958 0.4439 0.3959 -0.0276 0.0355  -0.0828 3   DT  D "C5'" 
3142 C "C5'" B DT  C 3   ? 0.3078 0.4355 0.3819 -0.0328 0.0388  -0.0682 3   DT  D "C5'" 
3143 C "C4'" A DT  C 3   ? 0.2791 0.4460 0.3870 -0.0203 0.0335  -0.1017 3   DT  D "C4'" 
3144 C "C4'" B DT  C 3   ? 0.2958 0.4501 0.3897 -0.0252 0.0370  -0.0915 3   DT  D "C4'" 
3145 O "O4'" A DT  C 3   ? 0.2515 0.4103 0.3485 -0.0040 0.0121  -0.0974 3   DT  D "O4'" 
3146 O "O4'" B DT  C 3   ? 0.2523 0.4047 0.3431 -0.0083 0.0153  -0.0908 3   DT  D "O4'" 
3147 C "C3'" A DT  C 3   ? 0.3011 0.4628 0.3905 -0.0298 0.0475  -0.1018 3   DT  D "C3'" 
3148 C "C3'" B DT  C 3   ? 0.3007 0.4572 0.3822 -0.0309 0.0484  -0.0983 3   DT  D "C3'" 
3149 O "O3'" A DT  C 3   ? 0.3402 0.5332 0.4558 -0.0325 0.0594  -0.1293 3   DT  D "O3'" 
3150 O "O3'" B DT  C 3   ? 0.3328 0.5217 0.4439 -0.0331 0.0592  -0.1260 3   DT  D "O3'" 
3151 C "C2'" A DT  C 3   ? 0.2899 0.4364 0.3556 -0.0179 0.0308  -0.0919 3   DT  D "C2'" 
3152 C "C2'" B DT  C 3   ? 0.2894 0.4353 0.3527 -0.0169 0.0299  -0.0922 3   DT  D "C2'" 
3153 C "C1'" A DT  C 3   ? 0.2507 0.4044 0.3308 -0.0012 0.0108  -0.0990 3   DT  D "C1'" 
3154 C "C1'" B DT  C 3   ? 0.2516 0.4036 0.3307 -0.0023 0.0113  -0.0969 3   DT  D "C1'" 
3155 N N1    A DT  C 3   ? 0.2236 0.3541 0.2801 0.0072  -0.0071 -0.0832 3   DT  D N1    
3156 N N1    B DT  C 3   ? 0.2242 0.3542 0.2807 0.0067  -0.0069 -0.0822 3   DT  D N1    
3157 C C2    A DT  C 3   ? 0.2148 0.3426 0.2684 0.0221  -0.0237 -0.0923 3   DT  D C2    
3158 C C2    B DT  C 3   ? 0.2136 0.3415 0.2675 0.0214  -0.0230 -0.0917 3   DT  D C2    
3159 O O2    A DT  C 3   ? 0.2252 0.3703 0.2959 0.0323  -0.0272 -0.1136 3   DT  D O2    
3160 O O2    B DT  C 3   ? 0.2284 0.3740 0.2995 0.0313  -0.0259 -0.1132 3   DT  D O2    
3161 N N3    A DT  C 3   ? 0.1853 0.2881 0.2144 0.0247  -0.0366 -0.0770 3   DT  D N3    
3162 N N3    B DT  C 3   ? 0.1879 0.2910 0.2175 0.0244  -0.0362 -0.0768 3   DT  D N3    
3163 C C4    A DT  C 3   ? 0.2025 0.2908 0.2165 0.0151  -0.0351 -0.0569 3   DT  D C4    
3164 C C4    B DT  C 3   ? 0.2006 0.2890 0.2151 0.0151  -0.0352 -0.0567 3   DT  D C4    
3165 O O4    A DT  C 3   ? 0.2267 0.2971 0.2226 0.0159  -0.0455 -0.0474 3   DT  D O4    
3166 O O4    B DT  C 3   ? 0.2214 0.2919 0.2178 0.0160  -0.0457 -0.0474 3   DT  D O4    
3167 C C5    A DT  C 3   ? 0.2002 0.2944 0.2202 0.0040  -0.0208 -0.0496 3   DT  D C5    
3168 C C5    B DT  C 3   ? 0.1997 0.2939 0.2204 0.0040  -0.0212 -0.0491 3   DT  D C5    
3169 C C7    A DT  C 3   ? 0.1996 0.2802 0.2054 -0.0027 -0.0219 -0.0311 3   DT  D C7    
3170 C C7    B DT  C 3   ? 0.1956 0.2765 0.2028 -0.0026 -0.0223 -0.0307 3   DT  D C7    
3171 C C6    A DT  C 3   ? 0.1983 0.3092 0.2359 0.0000  -0.0074 -0.0615 3   DT  D C6    
3172 C C6    B DT  C 3   ? 0.1980 0.3085 0.2359 -0.0001 -0.0077 -0.0606 3   DT  D C6    
3173 P P     . DC  C 4   ? 0.4702 0.6680 0.5747 -0.0471 0.0817  -0.1384 4   DC  D P     
3174 O OP1   . DC  C 4   ? 0.4850 0.6980 0.6141 -0.0569 0.0901  -0.1568 4   DC  D OP1   
3175 O OP2   . DC  C 4   ? 0.4667 0.6275 0.5291 -0.0591 0.0899  -0.1127 4   DC  D OP2   
3176 O "O5'" . DC  C 4   ? 0.4217 0.6287 0.5236 -0.0297 0.0673  -0.1496 4   DC  D "O5'" 
3177 C "C5'" . DC  C 4   ? 0.3652 0.5900 0.4925 -0.0107 0.0468  -0.1663 4   DC  D "C5'" 
3178 C "C4'" . DC  C 4   ? 0.3307 0.5496 0.4431 0.0074  0.0309  -0.1700 4   DC  D "C4'" 
3179 O "O4'" . DC  C 4   ? 0.2991 0.4826 0.3818 0.0118  0.0148  -0.1421 4   DC  D "O4'" 
3180 C "C3'" . DC  C 4   ? 0.3150 0.5330 0.4102 0.0000  0.0434  -0.1735 4   DC  D "C3'" 
3181 O "O3'" . DC  C 4   ? 0.3246 0.5615 0.4405 0.0107  0.0328  -0.1934 4   DC  D "O3'" 
3182 C "C2'" . DC  C 4   ? 0.3159 0.4972 0.3715 0.0042  0.0304  -0.1486 4   DC  D "C2'" 
3183 C "C1'" . DC  C 4   ? 0.2905 0.4582 0.3481 0.0171  0.0080  -0.1382 4   DC  D "C1'" 
3184 N N1    . DC  C 4   ? 0.2827 0.4181 0.3113 0.0138  -0.0010 -0.1098 4   DC  D N1    
3185 C C2    . DC  C 4   ? 0.2751 0.3907 0.2889 0.0260  -0.0218 -0.1040 4   DC  D C2    
3186 O O2    . DC  C 4   ? 0.2911 0.4105 0.3111 0.0411  -0.0338 -0.1207 4   DC  D O2    
3187 N N3    . DC  C 4   ? 0.2386 0.3306 0.2310 0.0209  -0.0283 -0.0819 4   DC  D N3    
3188 C C4    . DC  C 4   ? 0.2407 0.3290 0.2273 0.0083  -0.0181 -0.0665 4   DC  D C4    
3189 N N4    . DC  C 4   ? 0.2376 0.3082 0.2081 0.0054  -0.0263 -0.0490 4   DC  D N4    
3190 C C5    . DC  C 4   ? 0.2783 0.3794 0.2742 -0.0020 0.0010  -0.0699 4   DC  D C5    
3191 C C6    . DC  C 4   ? 0.3018 0.4259 0.3182 -0.0008 0.0104  -0.0914 4   DC  D C6    
3192 P P     . DT  C 5   ? 0.3748 0.6211 0.4855 0.0041  0.0452  -0.2043 5   DT  D P     
3193 O OP1   . DT  C 5   ? 0.3744 0.6514 0.5204 0.0105  0.0371  -0.2289 5   DT  D OP1   
3194 O OP2   . DT  C 5   ? 0.4057 0.6417 0.4945 -0.0197 0.0723  -0.1933 5   DT  D OP2   
3195 O "O5'" . DT  C 5   ? 0.3416 0.5642 0.4222 0.0204  0.0293  -0.1971 5   DT  D "O5'" 
3196 C "C5'" . DT  C 5   ? 0.3447 0.5594 0.4296 0.0433  0.0018  -0.2000 5   DT  D "C5'" 
3197 C "C4'" . DT  C 5   ? 0.3925 0.5737 0.4394 0.0506  -0.0093 -0.1877 5   DT  D "C4'" 
3198 O "O4'" . DT  C 5   ? 0.3753 0.5302 0.3959 0.0424  -0.0105 -0.1647 5   DT  D "O4'" 
3199 C "C3'" . DT  C 5   ? 0.4470 0.6284 0.4765 0.0417  0.0048  -0.1905 5   DT  D "C3'" 
3200 O "O3'" . DT  C 5   ? 0.5080 0.6714 0.5237 0.0569  -0.0133 -0.1918 5   DT  D "O3'" 
3201 C "C2'" . DT  C 5   ? 0.4469 0.6060 0.4418 0.0258  0.0151  -0.1690 5   DT  D "C2'" 
3202 C "C1'" . DT  C 5   ? 0.3998 0.5343 0.3887 0.0345  -0.0071 -0.1507 5   DT  D "C1'" 
3203 N N1    . DT  C 5   ? 0.3894 0.5030 0.3602 0.0213  -0.0047 -0.1221 5   DT  D N1    
3204 C C2    . DT  C 5   ? 0.3613 0.4492 0.3164 0.0260  -0.0230 -0.1055 5   DT  D C2    
3205 O O2    . DT  C 5   ? 0.3517 0.4273 0.3020 0.0387  -0.0399 -0.1114 5   DT  D O2    
3206 N N3    . DT  C 5   ? 0.3285 0.4040 0.2725 0.0149  -0.0204 -0.0834 5   DT  D N3    
3207 C C4    . DT  C 5   ? 0.3421 0.4216 0.2842 0.0020  -0.0042 -0.0748 5   DT  D C4    
3208 O O4    . DT  C 5   ? 0.3658 0.4321 0.2973 -0.0039 -0.0061 -0.0565 5   DT  D O4    
3209 C C5    . DT  C 5   ? 0.3928 0.4921 0.3454 -0.0041 0.0154  -0.0905 5   DT  D C5    
3210 C C7    . DT  C 5   ? 0.4073 0.5032 0.3508 -0.0204 0.0353  -0.0817 5   DT  D C7    
3211 C C6    . DT  C 5   ? 0.3736 0.4922 0.3424 0.0047  0.0153  -0.1141 5   DT  D C6    
3212 P P     . DA  C 6   ? 0.5434 0.7288 0.5808 0.0679  -0.0165 -0.2137 6   DA  D P     
3213 O OP1   . DA  C 6   ? 0.5408 0.7577 0.6189 0.0744  -0.0213 -0.2295 6   DA  D OP1   
3214 O OP2   . DA  C 6   ? 0.5523 0.7455 0.5774 0.0534  0.0047  -0.2178 6   DA  D OP2   
3215 O "O5'" . DA  C 6   ? 0.5506 0.7019 0.5667 0.0869  -0.0421 -0.2079 6   DA  D "O5'" 
3216 C "C5'" . DA  C 6   ? 0.5250 0.6523 0.5359 0.0989  -0.0625 -0.1972 6   DA  D "C5'" 
3217 C "C4'" . DA  C 6   ? 0.5267 0.6074 0.4999 0.1019  -0.0765 -0.1800 6   DA  D "C4'" 
3218 O "O4'" . DA  C 6   ? 0.5194 0.5829 0.4686 0.0846  -0.0694 -0.1604 6   DA  D "O4'" 
3219 C "C3'" . DA  C 6   ? 0.5698 0.6414 0.5291 0.1055  -0.0782 -0.1862 6   DA  D "C3'" 
3220 O "O3'" . DA  C 6   ? 0.6149 0.6465 0.5530 0.1168  -0.0985 -0.1772 6   DA  D "O3'" 
3221 C "C2'" . DA  C 6   ? 0.5507 0.6178 0.4870 0.0857  -0.0626 -0.1756 6   DA  D "C2'" 
3222 C "C1'" . DA  C 6   ? 0.4936 0.5454 0.4188 0.0760  -0.0644 -0.1558 6   DA  D "C1'" 
3223 N N9    . DA  C 6   ? 0.4569 0.5224 0.3759 0.0589  -0.0474 -0.1491 6   DA  D N9    
3224 C C8    . DA  C 6   ? 0.4058 0.4999 0.3344 0.0497  -0.0260 -0.1598 6   DA  D C8    
3225 N N7    . DA  C 6   ? 0.4131 0.5053 0.3294 0.0338  -0.0138 -0.1434 6   DA  D N7    
3226 C C5    . DA  C 6   ? 0.3958 0.4619 0.2993 0.0335  -0.0294 -0.1222 6   DA  D C5    
3227 C C6    . DA  C 6   ? 0.3663 0.4195 0.2583 0.0219  -0.0284 -0.0981 6   DA  D C6    
3228 N N6    . DA  C 6   ? 0.3352 0.3932 0.2214 0.0093  -0.0126 -0.0885 6   DA  D N6    
3229 N N1    . DA  C 6   ? 0.3704 0.4036 0.2553 0.0236  -0.0445 -0.0853 6   DA  D N1    
3230 C C2    . DA  C 6   ? 0.4031 0.4227 0.2861 0.0347  -0.0600 -0.0934 6   DA  D C2    
3231 N N3    . DA  C 6   ? 0.4356 0.4584 0.3248 0.0480  -0.0645 -0.1129 6   DA  D N3    
3232 C C4    . DA  C 6   ? 0.4237 0.4740 0.3254 0.0479  -0.0493 -0.1287 6   DA  D C4    
3233 P P     . DG  C 7   ? 0.7116 0.7259 0.6354 0.1261  -0.1074 -0.1843 7   DG  D P     
3234 O OP1   . DG  C 7   ? 0.7578 0.7420 0.6736 0.1451  -0.1301 -0.1832 7   DG  D OP1   
3235 O OP2   . DG  C 7   ? 0.6919 0.7449 0.6365 0.1261  -0.0943 -0.2047 7   DG  D OP2   
3236 O "O5'" . DG  C 7   ? 0.6829 0.6670 0.5729 0.1086  -0.1035 -0.1658 7   DG  D "O5'" 
3237 C "C5'" . DG  C 7   ? 0.6823 0.6382 0.5553 0.0997  -0.1089 -0.1454 7   DG  D "C5'" 
3238 C "C4'" . DG  C 7   ? 0.6607 0.6054 0.5124 0.0804  -0.1024 -0.1311 7   DG  D "C4'" 
3239 O "O4'" . DG  C 7   ? 0.6102 0.5819 0.4682 0.0677  -0.0874 -0.1280 7   DG  D "O4'" 
3240 C "C3'" . DG  C 7   ? 0.6962 0.6329 0.5336 0.0796  -0.1028 -0.1371 7   DG  D "C3'" 
3241 O "O3'" . DG  C 7   ? 0.7548 0.6689 0.5724 0.0653  -0.1055 -0.1211 7   DG  D "O3'" 
3242 C "C2'" . DG  C 7   ? 0.6206 0.5889 0.4626 0.0713  -0.0861 -0.1432 7   DG  D "C2'" 
3243 C "C1'" . DG  C 7   ? 0.5671 0.5431 0.4112 0.0596  -0.0800 -0.1292 7   DG  D "C1'" 
3244 N N9    . DG  C 7   ? 0.5287 0.5331 0.3782 0.0524  -0.0634 -0.1329 7   DG  D N9    
3245 C C8    . DG  C 7   ? 0.5030 0.5350 0.3648 0.0545  -0.0488 -0.1503 7   DG  D C8    
3246 N N7    . DG  C 7   ? 0.4740 0.5221 0.3319 0.0426  -0.0325 -0.1469 7   DG  D N7    
3247 C C5    . DG  C 7   ? 0.4603 0.4916 0.3032 0.0352  -0.0400 -0.1264 7   DG  D C5    
3248 C C6    . DG  C 7   ? 0.4296 0.4626 0.2654 0.0220  -0.0299 -0.1087 7   DG  D C6    
3249 O O6    . DG  C 7   ? 0.4511 0.4966 0.2856 0.0128  -0.0112 -0.1082 7   DG  D O6    
3250 N N1    . DG  C 7   ? 0.4259 0.4410 0.2554 0.0187  -0.0430 -0.0899 7   DG  D N1    
3251 C C2    . DG  C 7   ? 0.4309 0.4278 0.2574 0.0240  -0.0609 -0.0888 7   DG  D C2    
3252 N N2    . DG  C 7   ? 0.4146 0.4005 0.2386 0.0164  -0.0682 -0.0719 7   DG  D N2    
3253 N N3    . DG  C 7   ? 0.4607 0.4493 0.2929 0.0330  -0.0673 -0.0998 7   DG  D N3    
3254 C C4    . DG  C 7   ? 0.4858 0.4922 0.3260 0.0400  -0.0580 -0.1181 7   DG  D C4    
3255 P P     . DA  C 8   ? 0.7640 0.6439 0.5615 0.0658  -0.1166 -0.1201 8   DA  D P     
3256 O OP1   . DA  C 8   ? 0.8044 0.6560 0.5977 0.0793  -0.1298 -0.1211 8   DA  D OP1   
3257 O OP2   . DA  C 8   ? 0.8301 0.7200 0.6236 0.0678  -0.1130 -0.1320 8   DA  D OP2   
3258 O "O5'" . DA  C 8   ? 0.6993 0.5688 0.4859 0.0457  -0.1151 -0.1028 8   DA  D "O5'" 
3259 C "C5'" . DA  C 8   ? 0.6534 0.5259 0.4470 0.0390  -0.1129 -0.0910 8   DA  D "C5'" 
3260 C "C4'" . DA  C 8   ? 0.6484 0.5373 0.4443 0.0222  -0.1061 -0.0798 8   DA  D "C4'" 
3261 O "O4'" . DA  C 8   ? 0.6346 0.5536 0.4399 0.0225  -0.0967 -0.0811 8   DA  D "O4'" 
3262 C "C3'" . DA  C 8   ? 0.6569 0.5404 0.4420 0.0125  -0.1081 -0.0791 8   DA  D "C3'" 
3263 O "O3'" . DA  C 8   ? 0.6714 0.5579 0.4602 -0.0014 -0.1074 -0.0683 8   DA  D "O3'" 
3264 C "C2'" . DA  C 8   ? 0.5996 0.5070 0.3847 0.0145  -0.1014 -0.0847 8   DA  D "C2'" 
3265 C "C1'" . DA  C 8   ? 0.5904 0.5186 0.3870 0.0155  -0.0936 -0.0803 8   DA  D "C1'" 
3266 N N9    . DA  C 8   ? 0.5167 0.4622 0.3114 0.0214  -0.0850 -0.0897 8   DA  D N9    
3267 C C8    . DA  C 8   ? 0.5077 0.4554 0.3035 0.0324  -0.0830 -0.1057 8   DA  D C8    
3268 N N7    . DA  C 8   ? 0.5144 0.4819 0.3087 0.0331  -0.0709 -0.1135 8   DA  D N7    
3269 C C5    . DA  C 8   ? 0.4728 0.4463 0.2599 0.0229  -0.0662 -0.0998 8   DA  D C5    
3270 C C6    . DA  C 8   ? 0.4808 0.4677 0.2567 0.0181  -0.0528 -0.0982 8   DA  D C6    
3271 N N6    . DA  C 8   ? 0.5347 0.5361 0.3074 0.0197  -0.0377 -0.1123 8   DA  D N6    
3272 N N1    . DA  C 8   ? 0.4751 0.4598 0.2435 0.0106  -0.0539 -0.0815 8   DA  D N1    
3273 C C2    . DA  C 8   ? 0.4275 0.4042 0.2060 0.0073  -0.0659 -0.0699 8   DA  D C2    
3274 N N3    . DA  C 8   ? 0.3854 0.3522 0.1751 0.0084  -0.0755 -0.0712 8   DA  D N3    
3275 C C4    . DA  C 8   ? 0.4485 0.4107 0.2390 0.0167  -0.0758 -0.0854 8   DA  D C4    
3276 P P     . DA  C 9   ? 0.7593 0.6411 0.5416 -0.0139 -0.1111 -0.0685 9   DA  D P     
3277 O OP1   . DA  C 9   ? 0.7325 0.6037 0.5164 -0.0265 -0.1122 -0.0617 9   DA  D OP1   
3278 O OP2   . DA  C 9   ? 0.8021 0.6656 0.5704 -0.0087 -0.1162 -0.0785 9   DA  D OP2   
3279 O "O5'" . DA  C 9   ? 0.6707 0.5848 0.4612 -0.0160 -0.1068 -0.0662 9   DA  D "O5'" 
3280 C "C5'" . DA  C 9   ? 0.6155 0.5493 0.4183 -0.0163 -0.1017 -0.0578 9   DA  D "C5'" 
3281 C "C4'" . DA  C 9   ? 0.5814 0.5360 0.3833 -0.0162 -0.1002 -0.0557 9   DA  D "C4'" 
3282 O "O4'" . DA  C 9   ? 0.5634 0.5218 0.3552 -0.0085 -0.0943 -0.0580 9   DA  D "O4'" 
3283 C "C3'" . DA  C 9   ? 0.5750 0.5304 0.3704 -0.0203 -0.1064 -0.0614 9   DA  D "C3'" 
3284 O "O3'" . DA  C 9   ? 0.5721 0.5462 0.3765 -0.0236 -0.1089 -0.0568 9   DA  D "O3'" 
3285 C "C2'" . DA  C 9   ? 0.5364 0.4900 0.3148 -0.0134 -0.1041 -0.0670 9   DA  D "C2'" 
3286 C "C1'" . DA  C 9   ? 0.5160 0.4766 0.2931 -0.0079 -0.0955 -0.0622 9   DA  D "C1'" 
3287 N N9    . DA  C 9   ? 0.5289 0.4845 0.2936 -0.0014 -0.0897 -0.0714 9   DA  D N9    
3288 C C8    . DA  C 9   ? 0.5277 0.4707 0.2911 0.0035  -0.0919 -0.0823 9   DA  D C8    
3289 N N7    . DA  C 9   ? 0.4778 0.4238 0.2333 0.0103  -0.0850 -0.0925 9   DA  D N7    
3290 C C5    . DA  C 9   ? 0.4462 0.4047 0.1931 0.0075  -0.0761 -0.0869 9   DA  D C5    
3291 C C6    . DA  C 9   ? 0.4599 0.4260 0.1930 0.0093  -0.0629 -0.0940 9   DA  D C6    
3292 N N6    . DA  C 9   ? 0.4751 0.4438 0.2082 0.0157  -0.0565 -0.1106 9   DA  D N6    
3293 N N1    . DA  C 9   ? 0.4628 0.4337 0.1825 0.0043  -0.0552 -0.0841 9   DA  D N1    
3294 C C2    . DA  C 9   ? 0.4695 0.4401 0.1946 0.0009  -0.0631 -0.0689 9   DA  D C2    
3295 N N3    . DA  C 9   ? 0.4661 0.4356 0.2093 -0.0006 -0.0753 -0.0636 9   DA  D N3    
3296 C C4    . DA  C 9   ? 0.4630 0.4255 0.2146 0.0015  -0.0802 -0.0729 9   DA  D C4    
3297 P P     . DC  C 10  ? 0.5775 0.5613 0.3805 -0.0277 -0.1171 -0.0635 10  DC  D P     
3298 O OP1   . DC  C 10  ? 0.5358 0.5385 0.3571 -0.0321 -0.1207 -0.0618 10  DC  D OP1   
3299 O OP2   . DC  C 10  ? 0.5820 0.5497 0.3780 -0.0325 -0.1206 -0.0734 10  DC  D OP2   
3300 O "O5'" . DC  C 10  ? 0.5503 0.5382 0.3353 -0.0197 -0.1164 -0.0609 10  DC  D "O5'" 
3301 C "C5'" . DC  C 10  ? 0.5411 0.5359 0.3244 -0.0145 -0.1127 -0.0508 10  DC  D "C5'" 
3302 C "C4'" . DC  C 10  ? 0.5600 0.5483 0.3173 -0.0085 -0.1096 -0.0493 10  DC  D "C4'" 
3303 O "O4'" . DC  C 10  ? 0.5580 0.5363 0.3055 -0.0068 -0.1001 -0.0529 10  DC  D "O4'" 
3304 C "C3'" . DC  C 10  ? 0.5821 0.5687 0.3247 -0.0084 -0.1167 -0.0566 10  DC  D "C3'" 
3305 O "O3'" . DC  C 10  ? 0.6407 0.6353 0.3821 -0.0064 -0.1259 -0.0532 10  DC  D "O3'" 
3306 C "C2'" . DC  C 10  ? 0.5780 0.5538 0.2935 -0.0041 -0.1083 -0.0579 10  DC  D "C2'" 
3307 C "C1'" . DC  C 10  ? 0.5202 0.4932 0.2415 -0.0038 -0.0970 -0.0560 10  DC  D "C1'" 
3308 N N1    . DC  C 10  ? 0.5156 0.4816 0.2305 -0.0030 -0.0913 -0.0674 10  DC  D N1    
3309 C C2    . DC  C 10  ? 0.5121 0.4759 0.2064 -0.0009 -0.0792 -0.0713 10  DC  D C2    
3310 O O2    . DC  C 10  ? 0.4844 0.4485 0.1631 -0.0007 -0.0728 -0.0632 10  DC  D O2    
3311 N N3    . DC  C 10  ? 0.5208 0.4810 0.2122 0.0010  -0.0741 -0.0851 10  DC  D N3    
3312 C C4    . DC  C 10  ? 0.5067 0.4609 0.2125 0.0024  -0.0823 -0.0922 10  DC  D C4    
3313 N N4    . DC  C 10  ? 0.4799 0.4292 0.1835 0.0074  -0.0785 -0.1062 10  DC  D N4    
3314 C C5    . DC  C 10  ? 0.5036 0.4558 0.2258 -0.0011 -0.0937 -0.0864 10  DC  D C5    
3315 C C6    . DC  C 10  ? 0.4843 0.4451 0.2118 -0.0045 -0.0970 -0.0752 10  DC  D C6    
3316 O OP3   . DG  D 1   ? 1.1465 1.2856 0.9226 -0.0154 0.0299  -0.2003 1   DG  E OP3   
3317 P P     . DG  D 1   ? 0.9186 1.0298 0.6905 -0.0157 0.0189  -0.1999 1   DG  E P     
3318 O OP1   . DG  D 1   ? 0.9247 1.0367 0.6864 -0.0117 0.0147  -0.2108 1   DG  E OP1   
3319 O OP2   . DG  D 1   ? 0.9015 0.9977 0.6879 -0.0130 0.0131  -0.2034 1   DG  E OP2   
3320 O "O5'" . DG  D 1   ? 0.6993 0.8019 0.4626 -0.0246 0.0192  -0.1814 1   DG  E "O5'" 
3321 C "C5'" . DG  D 1   ? 0.6705 0.7762 0.4180 -0.0282 0.0197  -0.1760 1   DG  E "C5'" 
3322 C "C4'" . DG  D 1   ? 0.6507 0.7449 0.3941 -0.0347 0.0173  -0.1596 1   DG  E "C4'" 
3323 O "O4'" . DG  D 1   ? 0.6370 0.7114 0.3836 -0.0339 0.0081  -0.1595 1   DG  E "O4'" 
3324 C "C3'" . DG  D 1   ? 0.6149 0.7130 0.3665 -0.0387 0.0217  -0.1483 1   DG  E "C3'" 
3325 O "O3'" . DG  D 1   ? 0.6489 0.7452 0.3907 -0.0445 0.0208  -0.1350 1   DG  E "O3'" 
3326 C "C2'" . DG  D 1   ? 0.5515 0.6347 0.3156 -0.0366 0.0163  -0.1484 1   DG  E "C2'" 
3327 C "C1'" . DG  D 1   ? 0.5738 0.6426 0.3319 -0.0357 0.0074  -0.1514 1   DG  E "C1'" 
3328 N N9    . DG  D 1   ? 0.5597 0.6173 0.3272 -0.0331 0.0004  -0.1598 1   DG  E N9    
3329 C C8    . DG  D 1   ? 0.5904 0.6487 0.3663 -0.0284 -0.0003 -0.1730 1   DG  E C8    
3330 N N7    . DG  D 1   ? 0.5744 0.6188 0.3572 -0.0283 -0.0096 -0.1779 1   DG  E N7    
3331 C C5    . DG  D 1   ? 0.5337 0.5710 0.3125 -0.0335 -0.0144 -0.1671 1   DG  E C5    
3332 C C6    . DG  D 1   ? 0.4799 0.5055 0.2634 -0.0373 -0.0249 -0.1658 1   DG  E C6    
3333 O O6    . DG  D 1   ? 0.4684 0.4848 0.2602 -0.0378 -0.0334 -0.1737 1   DG  E O6    
3334 N N1    . DG  D 1   ? 0.4419 0.4679 0.2206 -0.0412 -0.0264 -0.1539 1   DG  E N1    
3335 C C2    . DG  D 1   ? 0.4730 0.5055 0.2430 -0.0409 -0.0200 -0.1448 1   DG  E C2    
3336 N N2    . DG  D 1   ? 0.4484 0.4791 0.2159 -0.0433 -0.0239 -0.1350 1   DG  E N2    
3337 N N3    . DG  D 1   ? 0.4881 0.5290 0.2529 -0.0388 -0.0114 -0.1453 1   DG  E N3    
3338 C C4    . DG  D 1   ? 0.5287 0.5732 0.2984 -0.0354 -0.0084 -0.1564 1   DG  E C4    
3339 P P     . DT  D 2   ? 0.8114 0.9077 0.5576 -0.0495 0.0224  -0.1212 2   DT  E P     
3340 O OP1   . DT  D 2   ? 0.8195 0.9217 0.5521 -0.0559 0.0229  -0.1121 2   DT  E OP1   
3341 O OP2   . DT  D 2   ? 0.8016 0.9069 0.5607 -0.0483 0.0280  -0.1246 2   DT  E OP2   
3342 O "O5'" . DT  D 2   ? 0.6139 0.6915 0.3646 -0.0477 0.0141  -0.1152 2   DT  E "O5'" 
3343 C "C5'" . DT  D 2   ? 0.6001 0.6682 0.3410 -0.0477 0.0075  -0.1123 2   DT  E "C5'" 
3344 C "C4'" . DT  D 2   ? 0.5897 0.6452 0.3375 -0.0458 0.0003  -0.1072 2   DT  E "C4'" 
3345 O "O4'" . DT  D 2   ? 0.5595 0.6117 0.3172 -0.0433 -0.0015 -0.1154 2   DT  E "O4'" 
3346 C "C3'" . DT  D 2   ? 0.5655 0.6198 0.3200 -0.0465 -0.0001 -0.0972 2   DT  E "C3'" 
3347 O "O3'" . DT  D 2   ? 0.6171 0.6628 0.3666 -0.0453 -0.0077 -0.0899 2   DT  E "O3'" 
3348 C "C2'" . DT  D 2   ? 0.5348 0.5883 0.3039 -0.0443 0.0004  -0.1010 2   DT  E "C2'" 
3349 C "C1'" . DT  D 2   ? 0.5238 0.5730 0.2929 -0.0430 -0.0036 -0.1098 2   DT  E "C1'" 
3350 N N1    . DT  D 2   ? 0.5123 0.5619 0.2918 -0.0419 -0.0030 -0.1191 2   DT  E N1    
3351 C C2    . DT  D 2   ? 0.4858 0.5300 0.2720 -0.0426 -0.0099 -0.1206 2   DT  E C2    
3352 O O2    . DT  D 2   ? 0.4722 0.5136 0.2568 -0.0438 -0.0154 -0.1145 2   DT  E O2    
3353 N N3    . DT  D 2   ? 0.4696 0.5124 0.2646 -0.0422 -0.0109 -0.1298 2   DT  E N3    
3354 C C4    . DT  D 2   ? 0.4861 0.5323 0.2848 -0.0393 -0.0055 -0.1385 2   DT  E C4    
3355 O O4    . DT  D 2   ? 0.5176 0.5600 0.3251 -0.0381 -0.0086 -0.1474 2   DT  E O4    
3356 C C5    . DT  D 2   ? 0.5111 0.5665 0.3034 -0.0382 0.0028  -0.1364 2   DT  E C5    
3357 C C7    . DT  D 2   ? 0.5156 0.5799 0.3127 -0.0349 0.0094  -0.1455 2   DT  E C7    
3358 C C6    . DT  D 2   ? 0.5202 0.5768 0.3029 -0.0405 0.0035  -0.1266 2   DT  E C6    
3359 P P     . DT  D 3   ? 0.6848 0.7256 0.4396 -0.0432 -0.0122 -0.0803 3   DT  E P     
3360 O OP1   . DT  D 3   ? 0.6834 0.7184 0.4269 -0.0425 -0.0187 -0.0746 3   DT  E OP1   
3361 O OP2   . DT  D 3   ? 0.6423 0.6886 0.4040 -0.0447 -0.0068 -0.0786 3   DT  E OP2   
3362 O "O5'" . DT  D 3   ? 0.6041 0.6415 0.3693 -0.0397 -0.0167 -0.0816 3   DT  E "O5'" 
3363 C "C5'" . DT  D 3   ? 0.5676 0.6020 0.3295 -0.0393 -0.0211 -0.0854 3   DT  E "C5'" 
3364 C "C4'" . DT  D 3   ? 0.5241 0.5600 0.2973 -0.0387 -0.0249 -0.0855 3   DT  E "C4'" 
3365 O "O4'" . DT  D 3   ? 0.4629 0.5035 0.2452 -0.0411 -0.0209 -0.0916 3   DT  E "O4'" 
3366 C "C3'" . DT  D 3   ? 0.4990 0.5352 0.2787 -0.0353 -0.0283 -0.0778 3   DT  E "C3'" 
3367 O "O3'" . DT  D 3   ? 0.5204 0.5590 0.3038 -0.0352 -0.0340 -0.0773 3   DT  E "O3'" 
3368 C "C2'" . DT  D 3   ? 0.4521 0.4939 0.2426 -0.0364 -0.0231 -0.0784 3   DT  E "C2'" 
3369 C "C1'" . DT  D 3   ? 0.4447 0.4895 0.2384 -0.0404 -0.0211 -0.0873 3   DT  E "C1'" 
3370 N N1    . DT  D 3   ? 0.4373 0.4848 0.2372 -0.0418 -0.0151 -0.0931 3   DT  E N1    
3371 C C2    . DT  D 3   ? 0.4107 0.4606 0.2194 -0.0444 -0.0171 -0.0987 3   DT  E C2    
3372 O O2    . DT  D 3   ? 0.4220 0.4742 0.2340 -0.0470 -0.0232 -0.0979 3   DT  E O2    
3373 N N3    . DT  D 3   ? 0.4122 0.4625 0.2262 -0.0443 -0.0124 -0.1054 3   DT  E N3    
3374 C C4    . DT  D 3   ? 0.4561 0.5076 0.2683 -0.0422 -0.0051 -0.1066 3   DT  E C4    
3375 O O4    . DT  D 3   ? 0.4882 0.5412 0.3067 -0.0413 -0.0013 -0.1136 3   DT  E O4    
3376 C C5    . DT  D 3   ? 0.4691 0.5206 0.2717 -0.0414 -0.0032 -0.0995 3   DT  E C5    
3377 C C7    . DT  D 3   ? 0.5007 0.5568 0.3007 -0.0415 0.0039  -0.0994 3   DT  E C7    
3378 C C6    . DT  D 3   ? 0.4388 0.4868 0.2354 -0.0411 -0.0088 -0.0934 3   DT  E C6    
3379 P P     . DC  D 4   ? 0.5241 0.5640 0.3117 -0.0307 -0.0398 -0.0704 4   DC  E P     
3380 O OP1   . DC  D 4   ? 0.4564 0.4972 0.2414 -0.0310 -0.0458 -0.0710 4   DC  E OP1   
3381 O OP2   . DC  D 4   ? 0.5550 0.5860 0.3365 -0.0260 -0.0409 -0.0659 4   DC  E OP2   
3382 O "O5'" . DC  D 4   ? 0.3941 0.4468 0.1967 -0.0327 -0.0376 -0.0695 4   DC  E "O5'" 
3383 C "C5'" . DC  D 4   ? 0.4026 0.4648 0.2119 -0.0386 -0.0383 -0.0735 4   DC  E "C5'" 
3384 C "C4'" . DC  D 4   ? 0.3794 0.4525 0.2011 -0.0411 -0.0361 -0.0727 4   DC  E "C4'" 
3385 O "O4'" . DC  D 4   ? 0.3515 0.4184 0.1726 -0.0423 -0.0303 -0.0777 4   DC  E "O4'" 
3386 C "C3'" . DC  D 4   ? 0.3593 0.4396 0.1884 -0.0358 -0.0364 -0.0656 4   DC  E "C3'" 
3387 O "O3'" . DC  D 4   ? 0.3483 0.4456 0.1861 -0.0375 -0.0407 -0.0622 4   DC  E "O3'" 
3388 C "C2'" . DC  D 4   ? 0.3301 0.4117 0.1655 -0.0367 -0.0313 -0.0668 4   DC  E "C2'" 
3389 C "C1'" . DC  D 4   ? 0.3186 0.3935 0.1501 -0.0423 -0.0286 -0.0752 4   DC  E "C1'" 
3390 N N1    . DC  D 4   ? 0.3667 0.4339 0.1964 -0.0407 -0.0221 -0.0786 4   DC  E N1    
3391 C C2    . DC  D 4   ? 0.3335 0.4020 0.1698 -0.0439 -0.0194 -0.0847 4   DC  E C2    
3392 O O2    . DC  D 4   ? 0.3268 0.4012 0.1694 -0.0490 -0.0238 -0.0867 4   DC  E O2    
3393 N N3    . DC  D 4   ? 0.3340 0.3973 0.1696 -0.0418 -0.0130 -0.0883 4   DC  E N3    
3394 C C4    . DC  D 4   ? 0.3963 0.4551 0.2245 -0.0386 -0.0098 -0.0848 4   DC  E C4    
3395 N N4    . DC  D 4   ? 0.3731 0.4308 0.2015 -0.0380 -0.0035 -0.0879 4   DC  E N4    
3396 C C5    . DC  D 4   ? 0.4001 0.4558 0.2203 -0.0364 -0.0139 -0.0784 4   DC  E C5    
3397 C C6    . DC  D 4   ? 0.3951 0.4541 0.2166 -0.0367 -0.0197 -0.0761 4   DC  E C6    
3398 P P     . DT  D 5   ? 0.3706 0.4845 0.2206 -0.0332 -0.0411 -0.0557 5   DT  E P     
3399 O OP1   . DT  D 5   ? 0.3662 0.4966 0.2213 -0.0337 -0.0457 -0.0527 5   DT  E OP1   
3400 O OP2   . DT  D 5   ? 0.4044 0.5067 0.2514 -0.0253 -0.0395 -0.0539 5   DT  E OP2   
3401 O "O5'" . DT  D 5   ? 0.3276 0.4524 0.1868 -0.0398 -0.0391 -0.0559 5   DT  E "O5'" 
3402 C "C5'" . DT  D 5   ? 0.3336 0.4636 0.1940 -0.0504 -0.0424 -0.0584 5   DT  E "C5'" 
3403 C "C4'" . DT  D 5   ? 0.3668 0.5011 0.2341 -0.0571 -0.0424 -0.0589 5   DT  E "C4'" 
3404 O "O4'" . DT  D 5   ? 0.3383 0.4553 0.2006 -0.0539 -0.0368 -0.0656 5   DT  E "O4'" 
3405 C "C3'" . DT  D 5   ? 0.3595 0.5140 0.2387 -0.0556 -0.0425 -0.0503 5   DT  E "C3'" 
3406 O "O3'" . DT  D 5   ? 0.4448 0.6078 0.3306 -0.0683 -0.0486 -0.0477 5   DT  E "O3'" 
3407 C "C2'" . DT  D 5   ? 0.3117 0.4559 0.1902 -0.0475 -0.0365 -0.0524 5   DT  E "C2'" 
3408 C "C1'" . DT  D 5   ? 0.3154 0.4387 0.1853 -0.0513 -0.0342 -0.0625 5   DT  E "C1'" 
3409 N N1    . DT  D 5   ? 0.3532 0.4611 0.2179 -0.0439 -0.0274 -0.0662 5   DT  E N1    
3410 C C2    . DT  D 5   ? 0.3250 0.4245 0.1905 -0.0458 -0.0237 -0.0731 5   DT  E C2    
3411 O O2    . DT  D 5   ? 0.3211 0.4222 0.1915 -0.0528 -0.0267 -0.0773 5   DT  E O2    
3412 N N3    . DT  D 5   ? 0.3070 0.3956 0.1683 -0.0398 -0.0175 -0.0748 5   DT  E N3    
3413 C C4    . DT  D 5   ? 0.3466 0.4295 0.2015 -0.0339 -0.0167 -0.0699 5   DT  E C4    
3414 O O4    . DT  D 5   ? 0.3550 0.4292 0.2059 -0.0312 -0.0126 -0.0707 5   DT  E O4    
3415 C C5    . DT  D 5   ? 0.3371 0.4250 0.1903 -0.0319 -0.0221 -0.0643 5   DT  E C5    
3416 C C7    . DT  D 5   ? 0.3788 0.4571 0.2239 -0.0260 -0.0241 -0.0602 5   DT  E C7    
3417 C C6    . DT  D 5   ? 0.3273 0.4284 0.1861 -0.0362 -0.0262 -0.0630 5   DT  E C6    
3418 P P     A DA  D 6   ? 0.4674 0.6582 0.3673 -0.0726 -0.0518 -0.0348 6   DA  E P     
3419 P P     B DA  D 6   ? 0.4487 0.6392 0.3487 -0.0727 -0.0518 -0.0348 6   DA  E P     
3420 O OP1   A DA  D 6   ? 0.4722 0.6693 0.3776 -0.0884 -0.0614 -0.0293 6   DA  E OP1   
3421 O OP1   B DA  D 6   ? 0.4792 0.6751 0.3846 -0.0887 -0.0616 -0.0296 6   DA  E OP1   
3422 O OP2   A DA  D 6   ? 0.4579 0.6640 0.3613 -0.0603 -0.0470 -0.0306 6   DA  E OP2   
3423 O OP2   B DA  D 6   ? 0.4804 0.6871 0.3840 -0.0608 -0.0472 -0.0303 6   DA  E OP2   
3424 O "O5'" A DA  D 6   ? 0.4047 0.5914 0.3088 -0.0725 -0.0504 -0.0347 6   DA  E "O5'" 
3425 O "O5'" B DA  D 6   ? 0.3940 0.5802 0.2979 -0.0722 -0.0501 -0.0350 6   DA  E "O5'" 
3426 C "C5'" A DA  D 6   ? 0.4220 0.5903 0.3253 -0.0823 -0.0553 -0.0415 6   DA  E "C5'" 
3427 C "C5'" B DA  D 6   ? 0.4192 0.5877 0.3228 -0.0823 -0.0553 -0.0413 6   DA  E "C5'" 
3428 C "C4'" A DA  D 6   ? 0.4227 0.5814 0.3337 -0.0761 -0.0501 -0.0413 6   DA  E "C4'" 
3429 C "C4'" B DA  D 6   ? 0.4336 0.5929 0.3449 -0.0760 -0.0500 -0.0409 6   DA  E "C4'" 
3430 O "O4'" A DA  D 6   ? 0.4122 0.5595 0.3123 -0.0647 -0.0413 -0.0516 6   DA  E "O4'" 
3431 O "O4'" B DA  D 6   ? 0.4166 0.5646 0.3167 -0.0647 -0.0413 -0.0513 6   DA  E "O4'" 
3432 C "C3'" A DA  D 6   ? 0.4244 0.6086 0.3448 -0.0738 -0.0501 -0.0289 6   DA  E "C3'" 
3433 C "C3'" B DA  D 6   ? 0.4380 0.6234 0.3580 -0.0731 -0.0498 -0.0288 6   DA  E "C3'" 
3434 O "O3'" A DA  D 6   ? 0.4332 0.6037 0.3657 -0.0754 -0.0504 -0.0260 6   DA  E "O3'" 
3435 O "O3'" B DA  D 6   ? 0.4339 0.6059 0.3654 -0.0736 -0.0493 -0.0264 6   DA  E "O3'" 
3436 C "C2'" A DA  D 6   ? 0.4010 0.5889 0.3136 -0.0579 -0.0418 -0.0332 6   DA  E "C2'" 
3437 C "C2'" B DA  D 6   ? 0.4157 0.6040 0.3279 -0.0572 -0.0414 -0.0331 6   DA  E "C2'" 
3438 C "C1'" A DA  D 6   ? 0.3799 0.5407 0.2826 -0.0557 -0.0374 -0.0466 6   DA  E "C1'" 
3439 C "C1'" B DA  D 6   ? 0.3848 0.5466 0.2871 -0.0555 -0.0375 -0.0465 6   DA  E "C1'" 
3440 N N9    A DA  D 6   ? 0.3444 0.4948 0.2397 -0.0436 -0.0306 -0.0503 6   DA  E N9    
3441 N N9    B DA  D 6   ? 0.3394 0.4898 0.2345 -0.0434 -0.0306 -0.0502 6   DA  E N9    
3442 C C8    A DA  D 6   ? 0.3370 0.4925 0.2316 -0.0361 -0.0303 -0.0459 6   DA  E C8    
3443 C C8    B DA  D 6   ? 0.3272 0.4820 0.2213 -0.0361 -0.0303 -0.0461 6   DA  E C8    
3444 N N7    A DA  D 6   ? 0.3349 0.4741 0.2229 -0.0283 -0.0270 -0.0491 6   DA  E N7    
3445 N N7    B DA  D 6   ? 0.3497 0.4880 0.2370 -0.0285 -0.0270 -0.0494 6   DA  E N7    
3446 C C5    A DA  D 6   ? 0.3288 0.4544 0.2136 -0.0303 -0.0229 -0.0555 6   DA  E C5    
3447 C C5    B DA  D 6   ? 0.3377 0.4629 0.2222 -0.0305 -0.0229 -0.0557 6   DA  E C5    
3448 C C6    A DA  D 6   ? 0.3229 0.4312 0.2015 -0.0263 -0.0181 -0.0596 6   DA  E C6    
3449 C C6    B DA  D 6   ? 0.3125 0.4206 0.1910 -0.0266 -0.0181 -0.0598 6   DA  E C6    
3450 N N6    A DA  D 6   ? 0.3209 0.4200 0.1932 -0.0207 -0.0187 -0.0568 6   DA  E N6    
3451 N N6    B DA  D 6   ? 0.3223 0.4208 0.1942 -0.0211 -0.0185 -0.0572 6   DA  E N6    
3452 N N1    A DA  D 6   ? 0.3214 0.4223 0.2006 -0.0293 -0.0137 -0.0666 6   DA  E N1    
3453 N N1    B DA  D 6   ? 0.3233 0.4245 0.2028 -0.0295 -0.0138 -0.0667 6   DA  E N1    
3454 C C2    A DA  D 6   ? 0.3253 0.4317 0.2099 -0.0358 -0.0156 -0.0707 6   DA  E C2    
3455 C C2    B DA  D 6   ? 0.3199 0.4270 0.2050 -0.0359 -0.0157 -0.0705 6   DA  E C2    
3456 N N3    A DA  D 6   ? 0.3260 0.4465 0.2153 -0.0421 -0.0222 -0.0664 6   DA  E N3    
3457 N N3    B DA  D 6   ? 0.3312 0.4525 0.2208 -0.0421 -0.0224 -0.0660 6   DA  E N3    
3458 C C4    A DA  D 6   ? 0.3315 0.4630 0.2209 -0.0388 -0.0247 -0.0579 6   DA  E C4    
3459 C C4    B DA  D 6   ? 0.3156 0.4472 0.2050 -0.0387 -0.0248 -0.0578 6   DA  E C4    
3460 P P     A DG  D 7   ? 0.5329 0.6994 0.4796 -0.0906 -0.0611 -0.0155 7   DG  E P     
3461 P P     B DG  D 7   ? 0.5141 0.7041 0.4608 -0.0821 -0.0556 -0.0102 7   DG  E P     
3462 O OP1   A DG  D 7   ? 0.5402 0.6837 0.4843 -0.0984 -0.0677 -0.0231 7   DG  E OP1   
3463 O OP1   B DG  D 7   ? 0.5332 0.7149 0.4865 -0.0982 -0.0664 -0.0046 7   DG  E OP1   
3464 O OP2   A DG  D 7   ? 0.5247 0.7278 0.4775 -0.0965 -0.0650 0.0007  7   DG  E OP2   
3465 O OP2   B DG  D 7   ? 0.4913 0.7191 0.4367 -0.0758 -0.0535 -0.0023 7   DG  E OP2   
3466 O "O5'" A DG  D 7   ? 0.4259 0.5728 0.3823 -0.0867 -0.0595 -0.0166 7   DG  E "O5'" 
3467 O "O5'" B DG  D 7   ? 0.4209 0.5899 0.3757 -0.0769 -0.0525 -0.0126 7   DG  E "O5'" 
3468 C "C5'" A DG  D 7   ? 0.4086 0.5689 0.3659 -0.0757 -0.0519 -0.0142 7   DG  E "C5'" 
3469 C "C5'" B DG  D 7   ? 0.4062 0.5405 0.3621 -0.0775 -0.0531 -0.0240 7   DG  E "C5'" 
3470 C "C4'" A DG  D 7   ? 0.3991 0.5334 0.3569 -0.0662 -0.0456 -0.0256 7   DG  E "C4'" 
3471 C "C4'" B DG  D 7   ? 0.3944 0.5156 0.3520 -0.0658 -0.0451 -0.0313 7   DG  E "C4'" 
3472 O "O4'" A DG  D 7   ? 0.3770 0.5070 0.3215 -0.0566 -0.0372 -0.0375 7   DG  E "O4'" 
3473 O "O4'" B DG  D 7   ? 0.3697 0.4925 0.3143 -0.0552 -0.0358 -0.0407 7   DG  E "O4'" 
3474 C "C3'" A DG  D 7   ? 0.3953 0.5379 0.3606 -0.0590 -0.0422 -0.0197 7   DG  E "C3'" 
3475 C "C3'" B DG  D 7   ? 0.3974 0.5339 0.3635 -0.0618 -0.0440 -0.0207 7   DG  E "C3'" 
3476 O "O3'" A DG  D 7   ? 0.4129 0.5291 0.3846 -0.0556 -0.0407 -0.0273 7   DG  E "O3'" 
3477 O "O3'" B DG  D 7   ? 0.4240 0.5385 0.3958 -0.0556 -0.0407 -0.0280 7   DG  E "O3'" 
3478 C "C2'" A DG  D 7   ? 0.3603 0.5176 0.3147 -0.0463 -0.0345 -0.0237 7   DG  E "C2'" 
3479 C "C2'" B DG  D 7   ? 0.3784 0.5370 0.3345 -0.0508 -0.0371 -0.0213 7   DG  E "C2'" 
3480 C "C1'" A DG  D 7   ? 0.3388 0.4758 0.2824 -0.0451 -0.0306 -0.0373 7   DG  E "C1'" 
3481 C "C1'" B DG  D 7   ? 0.3476 0.4855 0.2928 -0.0456 -0.0312 -0.0360 7   DG  E "C1'" 
3482 N N9    A DG  D 7   ? 0.2927 0.4410 0.2224 -0.0381 -0.0272 -0.0407 7   DG  E N9    
3483 N N9    B DG  D 7   ? 0.3051 0.4554 0.2365 -0.0387 -0.0279 -0.0391 7   DG  E N9    
3484 C C8    A DG  D 7   ? 0.2848 0.4573 0.2085 -0.0383 -0.0309 -0.0354 7   DG  E C8    
3485 C C8    B DG  D 7   ? 0.2811 0.4561 0.2067 -0.0390 -0.0315 -0.0337 7   DG  E C8    
3486 N N7    A DG  D 7   ? 0.2764 0.4468 0.1903 -0.0297 -0.0278 -0.0398 7   DG  E N7    
3487 N N7    B DG  D 7   ? 0.2757 0.4491 0.1910 -0.0303 -0.0284 -0.0385 7   DG  E N7    
3488 C C5    A DG  D 7   ? 0.2693 0.4200 0.1778 -0.0261 -0.0228 -0.0486 7   DG  E C5    
3489 C C5    B DG  D 7   ? 0.2731 0.4264 0.1827 -0.0269 -0.0235 -0.0477 7   DG  E C5    
3490 C C6    A DG  D 7   ? 0.2663 0.4010 0.1688 -0.0185 -0.0185 -0.0518 7   DG  E C6    
3491 C C6    B DG  D 7   ? 0.2627 0.3996 0.1660 -0.0192 -0.0189 -0.0514 7   DG  E C6    
3492 O O6    A DG  D 7   ? 0.2740 0.4063 0.1734 -0.0133 -0.0198 -0.0486 7   DG  E O6    
3493 O O6    B DG  D 7   ? 0.2738 0.4083 0.1742 -0.0138 -0.0200 -0.0483 7   DG  E O6    
3494 N N1    A DG  D 7   ? 0.2687 0.3890 0.1691 -0.0184 -0.0134 -0.0594 7   DG  E N1    
3495 N N1    B DG  D 7   ? 0.2690 0.3912 0.1702 -0.0191 -0.0139 -0.0592 7   DG  E N1    
3496 C C2    A DG  D 7   ? 0.2708 0.3839 0.1812 -0.0220 -0.0115 -0.0625 7   DG  E C2    
3497 C C2    B DG  D 7   ? 0.2690 0.3829 0.1812 -0.0228 -0.0121 -0.0618 7   DG  E C2    
3498 N N2    A DG  D 7   ? 0.2814 0.3799 0.1927 -0.0198 -0.0055 -0.0696 7   DG  E N2    
3499 N N2    B DG  D 7   ? 0.2794 0.3782 0.1929 -0.0206 -0.0062 -0.0690 7   DG  E N2    
3500 N N3    A DG  D 7   ? 0.2664 0.3836 0.1882 -0.0275 -0.0158 -0.0571 7   DG  E N3    
3501 N N3    B DG  D 7   ? 0.2660 0.3844 0.1896 -0.0283 -0.0166 -0.0560 7   DG  E N3    
3502 C C4    A DG  D 7   ? 0.2639 0.4009 0.1837 -0.0302 -0.0213 -0.0496 7   DG  E C4    
3503 C C4    B DG  D 7   ? 0.2581 0.3967 0.1795 -0.0309 -0.0220 -0.0483 7   DG  E C4    
3504 P P     . DA  D 8   ? 0.4132 0.5282 0.3985 -0.0554 -0.0437 -0.0187 8   DA  E P     
3505 O OP1   . DA  D 8   ? 0.4806 0.5752 0.4754 -0.0667 -0.0547 -0.0166 8   DA  E OP1   
3506 O OP2   . DA  D 8   ? 0.4011 0.5491 0.3864 -0.0534 -0.0430 -0.0058 8   DA  E OP2   
3507 O "O5'" . DA  D 8   ? 0.3347 0.4337 0.3202 -0.0424 -0.0349 -0.0304 8   DA  E "O5'" 
3508 C "C5'" . DA  D 8   ? 0.2896 0.3653 0.2725 -0.0398 -0.0318 -0.0457 8   DA  E "C5'" 
3509 C "C4'" . DA  D 8   ? 0.3081 0.3806 0.2895 -0.0278 -0.0221 -0.0531 8   DA  E "C4'" 
3510 O "O4'" . DA  D 8   ? 0.2726 0.3582 0.2406 -0.0229 -0.0159 -0.0544 8   DA  E "O4'" 
3511 C "C3'" . DA  D 8   ? 0.2458 0.3240 0.2365 -0.0221 -0.0218 -0.0454 8   DA  E "C3'" 
3512 O "O3'" . DA  D 8   ? 0.2506 0.3133 0.2459 -0.0145 -0.0164 -0.0555 8   DA  E "O3'" 
3513 C "C2'" . DA  D 8   ? 0.2315 0.3334 0.2137 -0.0161 -0.0186 -0.0388 8   DA  E "C2'" 
3514 C "C1'" . DA  D 8   ? 0.2125 0.3119 0.1810 -0.0147 -0.0138 -0.0478 8   DA  E "C1'" 
3515 N N9    . DA  D 8   ? 0.2316 0.3513 0.1892 -0.0141 -0.0154 -0.0428 8   DA  E N9    
3516 C C8    . DA  D 8   ? 0.2138 0.3536 0.1720 -0.0197 -0.0212 -0.0333 8   DA  E C8    
3517 N N7    . DA  D 8   ? 0.2175 0.3742 0.1648 -0.0162 -0.0218 -0.0326 8   DA  E N7    
3518 C C5    . DA  D 8   ? 0.2197 0.3638 0.1581 -0.0087 -0.0171 -0.0413 8   DA  E C5    
3519 C C6    . DA  D 8   ? 0.2096 0.3585 0.1341 -0.0026 -0.0175 -0.0447 8   DA  E C6    
3520 N N6    . DA  D 8   ? 0.1718 0.3332 0.0960 -0.0009 -0.0208 -0.0390 8   DA  E N6    
3521 N N1    . DA  D 8   ? 0.2197 0.3522 0.1380 0.0014  -0.0137 -0.0511 8   DA  E N1    
3522 C C2    . DA  D 8   ? 0.2459 0.3618 0.1720 0.0003  -0.0084 -0.0551 8   DA  E C2    
3523 N N3    . DA  D 8   ? 0.2407 0.3508 0.1802 -0.0034 -0.0074 -0.0545 8   DA  E N3    
3524 C C4    . DA  D 8   ? 0.2141 0.3372 0.1589 -0.0081 -0.0126 -0.0470 8   DA  E C4    
3525 P P     . DA  D 9   ? 0.2597 0.3221 0.2656 -0.0070 -0.0157 -0.0511 9   DA  E P     
3526 O OP1   . DA  D 9   ? 0.2453 0.2879 0.2589 -0.0030 -0.0132 -0.0632 9   DA  E OP1   
3527 O OP2   . DA  D 9   ? 0.2579 0.3303 0.2704 -0.0123 -0.0236 -0.0370 9   DA  E OP2   
3528 O "O5'" . DA  D 9   ? 0.2134 0.2898 0.2110 0.0025  -0.0094 -0.0498 9   DA  E "O5'" 
3529 C "C5'" . DA  D 9   ? 0.2282 0.2972 0.2197 0.0067  -0.0024 -0.0598 9   DA  E "C5'" 
3530 C "C4'" . DA  D 9   ? 0.2720 0.3526 0.2547 0.0142  -0.0007 -0.0563 9   DA  E "C4'" 
3531 O "O4'" . DA  D 9   ? 0.2697 0.3647 0.2411 0.0115  -0.0039 -0.0517 9   DA  E "O4'" 
3532 C "C3'" . DA  D 9   ? 0.2599 0.3476 0.2494 0.0232  -0.0033 -0.0495 9   DA  E "C3'" 
3533 O "O3'" . DA  D 9   ? 0.3376 0.4196 0.3255 0.0307  -0.0005 -0.0531 9   DA  E "O3'" 
3534 C "C2'" . DA  D 9   ? 0.2415 0.3510 0.2230 0.0255  -0.0083 -0.0416 9   DA  E "C2'" 
3535 C "C1'" . DA  D 9   ? 0.2159 0.3249 0.1841 0.0205  -0.0070 -0.0460 9   DA  E "C1'" 
3536 N N9    . DA  D 9   ? 0.2254 0.3544 0.1872 0.0184  -0.0118 -0.0402 9   DA  E N9    
3537 C C8    . DA  D 9   ? 0.2401 0.3828 0.2080 0.0124  -0.0154 -0.0325 9   DA  E C8    
3538 N N7    . DA  D 9   ? 0.2228 0.3867 0.1834 0.0115  -0.0191 -0.0284 9   DA  E N7    
3539 C C5    . DA  D 9   ? 0.2066 0.3674 0.1550 0.0183  -0.0187 -0.0347 9   DA  E C5    
3540 C C6    . DA  D 9   ? 0.2052 0.3744 0.1472 0.0213  -0.0210 -0.0336 9   DA  E C6    
3541 N N6    . DA  D 9   ? 0.1574 0.3447 0.1036 0.0182  -0.0228 -0.0274 9   DA  E N6    
3542 N N1    . DA  D 9   ? 0.2018 0.3543 0.1384 0.0260  -0.0206 -0.0375 9   DA  E N1    
3543 C C2    . DA  D 9   ? 0.2239 0.3604 0.1571 0.0277  -0.0182 -0.0427 9   DA  E C2    
3544 N N3    . DA  D 9   ? 0.2043 0.3346 0.1426 0.0263  -0.0144 -0.0458 9   DA  E N3    
3545 C C4    . DA  D 9   ? 0.2283 0.3674 0.1769 0.0217  -0.0145 -0.0409 9   DA  E C4    
3546 P P     . DC  D 10  ? 0.3124 0.3788 0.3114 0.0326  0.0043  -0.0599 10  DC  E P     
3547 O OP1   . DC  D 10  ? 0.3728 0.4375 0.3666 0.0378  0.0056  -0.0611 10  DC  E OP1   
3548 O OP2   . DC  D 10  ? 0.2661 0.3227 0.2686 0.0251  0.0076  -0.0680 10  DC  E OP2   
3549 O "O5'" . DC  D 10  ? 0.2070 0.2740 0.2192 0.0381  0.0006  -0.0545 10  DC  E "O5'" 
3550 C "C5'" . DC  D 10  ? 0.2009 0.2767 0.2134 0.0479  -0.0033 -0.0486 10  DC  E "C5'" 
3551 C "C4'" . DC  D 10  ? 0.2237 0.2950 0.2502 0.0515  -0.0049 -0.0462 10  DC  E "C4'" 
3552 O "O4'" . DC  D 10  ? 0.2336 0.3113 0.2636 0.0448  -0.0087 -0.0396 10  DC  E "O4'" 
3553 C "C3'" . DC  D 10  ? 0.2554 0.3082 0.2923 0.0502  -0.0005 -0.0549 10  DC  E "C3'" 
3554 O "O3'" . DC  D 10  ? 0.2907 0.3399 0.3369 0.0589  -0.0020 -0.0537 10  DC  E "O3'" 
3555 C "C2'" . DC  D 10  ? 0.2131 0.2588 0.2560 0.0417  -0.0025 -0.0560 10  DC  E "C2'" 
3556 C "C1'" . DC  D 10  ? 0.1911 0.2516 0.2320 0.0398  -0.0088 -0.0436 10  DC  E "C1'" 
3557 N N1    . DC  D 10  ? 0.1850 0.2452 0.2244 0.0282  -0.0125 -0.0410 10  DC  E N1    
3558 C C2    . DC  D 10  ? 0.1715 0.2186 0.2213 0.0225  -0.0183 -0.0397 10  DC  E C2    
3559 O O2    . DC  D 10  ? 0.2019 0.2386 0.2616 0.0279  -0.0193 -0.0414 10  DC  E O2    
3560 N N3    . DC  D 10  ? 0.1667 0.2110 0.2154 0.0113  -0.0241 -0.0367 10  DC  E N3    
3561 C C4    . DC  D 10  ? 0.1816 0.2374 0.2199 0.0059  -0.0231 -0.0352 10  DC  E C4    
3562 N N4    . DC  D 10  ? 0.1811 0.2326 0.2196 -0.0057 -0.0302 -0.0319 10  DC  E N4    
3563 C C5    . DC  D 10  ? 0.1775 0.2475 0.2048 0.0120  -0.0163 -0.0371 10  DC  E C5    
3564 C C6    . DC  D 10  ? 0.1789 0.2498 0.2070 0.0229  -0.0118 -0.0398 10  DC  E C6    
3565 O OP3   . DG  E 1   ? 0.4107 0.3158 0.3323 0.0054  -0.0727 -0.0168 1   DG  G OP3   
3566 P P     . DG  E 1   ? 0.3995 0.3178 0.3435 0.0138  -0.0761 -0.0187 1   DG  G P     
3567 O OP1   . DG  E 1   ? 0.4538 0.3566 0.3926 0.0229  -0.0886 -0.0217 1   DG  G OP1   
3568 O OP2   . DG  E 1   ? 0.3536 0.2955 0.3147 0.0166  -0.0622 -0.0311 1   DG  G OP2   
3569 O "O5'" . DG  E 1   ? 0.3404 0.2623 0.2911 0.0073  -0.0803 -0.0013 1   DG  G "O5'" 
3570 C "C5'" . DG  E 1   ? 0.3208 0.2294 0.2631 0.0021  -0.0884 0.0119  1   DG  G "C5'" 
3571 C "C4'" . DG  E 1   ? 0.2783 0.1984 0.2273 -0.0071 -0.0776 0.0237  1   DG  G "C4'" 
3572 O "O4'" . DG  E 1   ? 0.3219 0.2580 0.2892 -0.0047 -0.0721 0.0244  1   DG  G "O4'" 
3573 C "C3'" . DG  E 1   ? 0.2929 0.2109 0.2293 -0.0113 -0.0738 0.0290  1   DG  G "C3'" 
3574 O "O3'" . DG  E 1   ? 0.2965 0.2090 0.2185 -0.0173 -0.0731 0.0329  1   DG  G "O3'" 
3575 C "C2'" . DG  E 1   ? 0.2575 0.1899 0.2098 -0.0140 -0.0621 0.0374  1   DG  G "C2'" 
3576 C "C1'" . DG  E 1   ? 0.2819 0.2228 0.2509 -0.0085 -0.0657 0.0311  1   DG  G "C1'" 
3577 N N9    . DG  E 1   ? 0.2495 0.2010 0.2306 -0.0052 -0.0599 0.0182  1   DG  G N9    
3578 C C8    . DG  E 1   ? 0.2515 0.2125 0.2409 0.0024  -0.0625 0.0022  1   DG  G C8    
3579 N N7    . DG  E 1   ? 0.2616 0.2409 0.2663 0.0017  -0.0497 -0.0110 1   DG  G N7    
3580 C C5    . DG  E 1   ? 0.2405 0.2174 0.2462 -0.0074 -0.0368 -0.0034 1   DG  G C5    
3581 C C6    . DG  E 1   ? 0.2276 0.2156 0.2466 -0.0139 -0.0186 -0.0118 1   DG  G C6    
3582 O O6    . DG  E 1   ? 0.2252 0.2321 0.2590 -0.0145 -0.0110 -0.0290 1   DG  G O6    
3583 N N1    . DG  E 1   ? 0.1946 0.1703 0.2089 -0.0206 -0.0082 0.0021  1   DG  G N1    
3584 C C2    . DG  E 1   ? 0.2102 0.1707 0.2096 -0.0202 -0.0157 0.0222  1   DG  G C2    
3585 N N2    . DG  E 1   ? 0.1924 0.1449 0.1899 -0.0245 -0.0029 0.0351  1   DG  G N2    
3586 N N3    . DG  E 1   ? 0.2266 0.1806 0.2142 -0.0160 -0.0337 0.0294  1   DG  G N3    
3587 C C4    . DG  E 1   ? 0.1960 0.1564 0.1873 -0.0102 -0.0429 0.0154  1   DG  G C4    
3588 P P     . DT  E 2   ? 0.3053 0.2125 0.2064 -0.0197 -0.0682 0.0295  2   DT  G P     
3589 O OP1   . DT  E 2   ? 0.3462 0.2470 0.2289 -0.0258 -0.0750 0.0341  2   DT  G OP1   
3590 O OP2   . DT  E 2   ? 0.3022 0.2127 0.2116 -0.0126 -0.0614 0.0092  2   DT  G OP2   
3591 O "O5'" . DT  E 2   ? 0.2713 0.1896 0.1793 -0.0229 -0.0521 0.0409  2   DT  G "O5'" 
3592 C "C5'" . DT  E 2   ? 0.2907 0.2209 0.2068 -0.0243 -0.0476 0.0533  2   DT  G "C5'" 
3593 C "C4'" . DT  E 2   ? 0.3057 0.2422 0.2307 -0.0229 -0.0304 0.0609  2   DT  G "C4'" 
3594 O "O4'" . DT  E 2   ? 0.3168 0.2493 0.2541 -0.0233 -0.0292 0.0579  2   DT  G "O4'" 
3595 C "C3'" . DT  E 2   ? 0.2874 0.2167 0.1961 -0.0278 -0.0183 0.0652  2   DT  G "C3'" 
3596 O "O3'" . DT  E 2   ? 0.2816 0.2220 0.1865 -0.0239 -0.0129 0.0720  2   DT  G "O3'" 
3597 C "C2'" . DT  E 2   ? 0.2636 0.1942 0.1904 -0.0280 -0.0002 0.0659  2   DT  G "C2'" 
3598 C "C1'" . DT  E 2   ? 0.2613 0.1942 0.2049 -0.0258 -0.0095 0.0565  2   DT  G "C1'" 
3599 N N1    . DT  E 2   ? 0.2684 0.2084 0.2254 -0.0245 -0.0053 0.0338  2   DT  G N1    
3600 C C2    . DT  E 2   ? 0.2404 0.1861 0.2126 -0.0278 0.0134  0.0262  2   DT  G C2    
3601 O O2    . DT  E 2   ? 0.2656 0.2058 0.2394 -0.0312 0.0275  0.0377  2   DT  G O2    
3602 N N3    . DT  E 2   ? 0.2105 0.1687 0.1960 -0.0270 0.0157  0.0051  2   DT  G N3    
3603 C C4    . DT  E 2   ? 0.2040 0.1682 0.1886 -0.0206 0.0018  -0.0072 2   DT  G C4    
3604 O O4    . DT  E 2   ? 0.2443 0.2238 0.2423 -0.0186 0.0051  -0.0246 2   DT  G O4    
3605 C C5    . DT  E 2   ? 0.2144 0.1663 0.1817 -0.0165 -0.0163 0.0020  2   DT  G C5    
3606 C C7    . DT  E 2   ? 0.2478 0.1994 0.2120 -0.0087 -0.0300 -0.0098 2   DT  G C7    
3607 C C6    . DT  E 2   ? 0.2284 0.1697 0.1830 -0.0199 -0.0192 0.0211  2   DT  G C6    
3608 P P     . DT  E 3   ? 0.3734 0.3130 0.2585 -0.0275 -0.0022 0.0760  3   DT  G P     
3609 O OP1   . DT  E 3   ? 0.3875 0.3380 0.2686 -0.0215 -0.0036 0.0820  3   DT  G OP1   
3610 O OP2   . DT  E 3   ? 0.3763 0.3094 0.2514 -0.0305 -0.0055 0.0575  3   DT  G OP2   
3611 O "O5'" . DT  E 3   ? 0.3323 0.2718 0.2321 -0.0255 0.0213  0.0812  3   DT  G "O5'" 
3612 C "C5'" . DT  E 3   ? 0.3486 0.2786 0.2533 -0.0206 0.0271  0.0800  3   DT  G "C5'" 
3613 C "C4'" . DT  E 3   ? 0.3100 0.2505 0.2315 -0.0325 0.0360  0.0825  3   DT  G "C4'" 
3614 O "O4'" . DT  E 3   ? 0.2948 0.2330 0.2332 -0.0315 0.0443  0.0742  3   DT  G "O4'" 
3615 C "C3'" . DT  E 3   ? 0.3360 0.2828 0.2528 -0.0325 0.0501  0.0855  3   DT  G "C3'" 
3616 O "O3'" . DT  E 3   ? 0.4495 0.3967 0.3720 -0.0320 0.0583  0.0890  3   DT  G "O3'" 
3617 C "C2'" . DT  E 3   ? 0.3649 0.3045 0.2877 -0.0331 0.0671  0.0726  3   DT  G "C2'" 
3618 C "C1'" . DT  E 3   ? 0.3237 0.2581 0.2642 -0.0341 0.0650  0.0649  3   DT  G "C1'" 
3619 N N1    . DT  E 3   ? 0.3023 0.2386 0.2474 -0.0360 0.0609  0.0436  3   DT  G N1    
3620 C C2    . DT  E 3   ? 0.3328 0.2748 0.2983 -0.0402 0.0731  0.0264  3   DT  G C2    
3621 O O2    . DT  E 3   ? 0.3080 0.2450 0.2845 -0.0454 0.0922  0.0288  3   DT  G O2    
3622 N N3    . DT  E 3   ? 0.2751 0.2295 0.2482 -0.0381 0.0626  0.0059  3   DT  G N3    
3623 C C4    . DT  E 3   ? 0.2755 0.2315 0.2372 -0.0317 0.0430  0.0012  3   DT  G C4    
3624 O O4    . DT  E 3   ? 0.2800 0.2466 0.2501 -0.0280 0.0366  -0.0163 3   DT  G O4    
3625 C C5    . DT  E 3   ? 0.2997 0.2452 0.2394 -0.0297 0.0318  0.0180  3   DT  G C5    
3626 C C7    . DT  E 3   ? 0.3186 0.2612 0.2439 -0.0252 0.0119  0.0127  3   DT  G C7    
3627 C C6    . DT  E 3   ? 0.2697 0.2088 0.2025 -0.0322 0.0405  0.0381  3   DT  G C6    
3628 P P     . DC  E 4   ? 0.5699 0.5216 0.4828 -0.0320 0.0695  0.0947  4   DC  G P     
3629 O OP1   . DC  E 4   ? 0.6142 0.5632 0.5277 -0.0294 0.0700  0.1021  4   DC  G OP1   
3630 O OP2   . DC  E 4   ? 0.5699 0.5267 0.4617 -0.0336 0.0637  0.0962  4   DC  G OP2   
3631 O "O5'" . DC  E 4   ? 0.5136 0.4626 0.4408 -0.0324 0.0896  0.0854  4   DC  G "O5'" 
3632 C "C5'" . DC  E 4   ? 0.4998 0.4407 0.4452 -0.0320 0.0977  0.0800  4   DC  G "C5'" 
3633 C "C4'" . DC  E 4   ? 0.4705 0.4075 0.4261 -0.0362 0.1150  0.0662  4   DC  G "C4'" 
3634 O "O4'" . DC  E 4   ? 0.4175 0.3556 0.3761 -0.0400 0.1133  0.0524  4   DC  G "O4'" 
3635 C "C3'" . DC  E 4   ? 0.5117 0.4541 0.4584 -0.0376 0.1258  0.0680  4   DC  G "C3'" 
3636 O "O3'" . DC  E 4   ? 0.5797 0.5150 0.5364 -0.0390 0.1399  0.0669  4   DC  G "O3'" 
3637 C "C2'" . DC  E 4   ? 0.4742 0.4213 0.4197 -0.0421 0.1309  0.0518  4   DC  G "C2'" 
3638 C "C1'" . DC  E 4   ? 0.4074 0.3501 0.3669 -0.0450 0.1265  0.0394  4   DC  G "C1'" 
3639 N N1    . DC  E 4   ? 0.3596 0.3066 0.3122 -0.0479 0.1229  0.0271  4   DC  G N1    
3640 C C2    . DC  E 4   ? 0.3498 0.3081 0.3205 -0.0530 0.1268  0.0037  4   DC  G C2    
3641 O O2    . DC  E 4   ? 0.3888 0.3489 0.3773 -0.0579 0.1373  -0.0038 4   DC  G O2    
3642 N N3    . DC  E 4   ? 0.3122 0.2819 0.2820 -0.0472 0.1071  -0.0109 4   DC  G N3    
3643 C C4    . DC  E 4   ? 0.2954 0.2601 0.2456 -0.0401 0.0885  -0.0037 4   DC  G C4    
3644 N N4    . DC  E 4   ? 0.3276 0.2990 0.2773 -0.0341 0.0714  -0.0181 4   DC  G N4    
3645 C C5    . DC  E 4   ? 0.3348 0.2882 0.2651 -0.0388 0.0870  0.0190  4   DC  G C5    
3646 C C6    . DC  E 4   ? 0.3539 0.3000 0.2857 -0.0425 0.1059  0.0349  4   DC  G C6    
3647 P P     . DT  E 5   ? 0.7234 0.6635 0.6735 -0.0403 0.1527  0.0712  5   DT  G P     
3648 O OP1   . DT  E 5   ? 0.7844 0.7120 0.7412 -0.0388 0.1627  0.0780  5   DT  G OP1   
3649 O OP2   . DT  E 5   ? 0.6747 0.6281 0.6047 -0.0377 0.1446  0.0809  5   DT  G OP2   
3650 O "O5'" . DT  E 5   ? 0.5973 0.5415 0.5572 -0.0477 0.1637  0.0514  5   DT  G "O5'" 
3651 C "C5'" . DT  E 5   ? 0.6078 0.5439 0.5863 -0.0535 0.1701  0.0364  5   DT  G "C5'" 
3652 C "C4'" . DT  E 5   ? 0.5968 0.5452 0.5838 -0.0612 0.1771  0.0167  5   DT  G "C4'" 
3653 O "O4'" . DT  E 5   ? 0.5262 0.4857 0.5110 -0.0607 0.1672  0.0064  5   DT  G "O4'" 
3654 C "C3'" . DT  E 5   ? 0.6228 0.5818 0.6021 -0.0618 0.1866  0.0195  5   DT  G "C3'" 
3655 O "O3'" . DT  E 5   ? 0.6678 0.6244 0.6613 -0.0696 0.1999  0.0103  5   DT  G "O3'" 
3656 C "C2'" . DT  E 5   ? 0.5891 0.5661 0.5618 -0.0610 0.1818  0.0073  5   DT  G "C2'" 
3657 C "C1'" . DT  E 5   ? 0.5329 0.5097 0.5152 -0.0625 0.1718  -0.0054 5   DT  G "C1'" 
3658 N N1    . DT  E 5   ? 0.4802 0.4630 0.4479 -0.0577 0.1616  -0.0083 5   DT  G N1    
3659 C C2    . DT  E 5   ? 0.4738 0.4723 0.4502 -0.0587 0.1577  -0.0304 5   DT  G C2    
3660 O O2    . DT  E 5   ? 0.5434 0.5551 0.5408 -0.0632 0.1603  -0.0463 5   DT  G O2    
3661 N N3    . DT  E 5   ? 0.4177 0.4164 0.3781 -0.0504 0.1401  -0.0322 5   DT  G N3    
3662 C C4    . DT  E 5   ? 0.4083 0.3939 0.3444 -0.0449 0.1287  -0.0149 5   DT  G C4    
3663 O O4    . DT  E 5   ? 0.3878 0.3723 0.3118 -0.0379 0.1084  -0.0186 5   DT  G O4    
3664 C C5    . DT  E 5   ? 0.4211 0.3951 0.3473 -0.0480 0.1433  0.0082  5   DT  G C5    
3665 C C7    . DT  E 5   ? 0.4302 0.3967 0.3309 -0.0425 0.1321  0.0287  5   DT  G C7    
3666 C C6    . DT  E 5   ? 0.4329 0.4068 0.3779 -0.0517 0.1548  0.0103  5   DT  G C6    
3667 P P     . DA  E 6   ? 0.7171 0.6833 0.7070 -0.0719 0.2129  0.0136  6   DA  G P     
3668 O OP1   . DA  E 6   ? 0.7381 0.6902 0.7401 -0.0791 0.2264  0.0117  6   DA  G OP1   
3669 O OP2   . DA  E 6   ? 0.7257 0.6969 0.6949 -0.0635 0.2095  0.0323  6   DA  G OP2   
3670 O "O5'" . DA  E 6   ? 0.6651 0.6548 0.6617 -0.0759 0.2125  -0.0072 6   DA  G "O5'" 
3671 C "C5'" . DA  E 6   ? 0.6525 0.6471 0.6679 -0.0833 0.2102  -0.0275 6   DA  G "C5'" 
3672 C "C4'" . DA  E 6   ? 0.6622 0.6847 0.6837 -0.0844 0.2087  -0.0455 6   DA  G "C4'" 
3673 O "O4'" . DA  E 6   ? 0.6365 0.6681 0.6489 -0.0761 0.1960  -0.0498 6   DA  G "O4'" 
3674 C "C3'" . DA  E 6   ? 0.6950 0.7302 0.7097 -0.0834 0.2190  -0.0417 6   DA  G "C3'" 
3675 O "O3'" . DA  E 6   ? 0.7325 0.7889 0.7639 -0.0899 0.2227  -0.0601 6   DA  G "O3'" 
3676 C "C2'" . DA  E 6   ? 0.6610 0.7048 0.6553 -0.0722 0.2116  -0.0376 6   DA  G "C2'" 
3677 C "C1'" . DA  E 6   ? 0.6064 0.6520 0.6045 -0.0693 0.1974  -0.0498 6   DA  G "C1'" 
3678 N N9    . DA  E 6   ? 0.5708 0.6075 0.5470 -0.0611 0.1888  -0.0406 6   DA  G N9    
3679 C C8    . DA  E 6   ? 0.5972 0.6192 0.5547 -0.0578 0.1898  -0.0189 6   DA  G C8    
3680 N N7    . DA  E 6   ? 0.5857 0.6029 0.5234 -0.0519 0.1799  -0.0153 6   DA  G N7    
3681 C C5    . DA  E 6   ? 0.5133 0.5406 0.4571 -0.0506 0.1725  -0.0371 6   DA  G C5    
3682 C C6    . DA  E 6   ? 0.4994 0.5248 0.4294 -0.0437 0.1561  -0.0452 6   DA  G C6    
3683 N N6    . DA  E 6   ? 0.5383 0.5500 0.4447 -0.0388 0.1423  -0.0310 6   DA  G N6    
3684 N N1    . DA  E 6   ? 0.4831 0.5215 0.4279 -0.0394 0.1458  -0.0660 6   DA  G N1    
3685 C C2    . DA  E 6   ? 0.4468 0.5040 0.4165 -0.0444 0.1569  -0.0793 6   DA  G C2    
3686 N N3    . DA  E 6   ? 0.4813 0.5404 0.4647 -0.0527 0.1692  -0.0728 6   DA  G N3    
3687 C C4    . DA  E 6   ? 0.5076 0.5496 0.4768 -0.0550 0.1768  -0.0521 6   DA  G C4    
3688 P P     . DG  E 7   ? 0.8213 0.8938 0.8525 -0.0918 0.2359  -0.0594 7   DG  G P     
3689 O OP1   . DG  E 7   ? 0.8414 0.9203 0.8937 -0.1048 0.2435  -0.0723 7   DG  G OP1   
3690 O OP2   . DG  E 7   ? 0.8357 0.8952 0.8486 -0.0872 0.2435  -0.0373 7   DG  G OP2   
3691 O "O5'" . DG  E 7   ? 0.6624 0.7619 0.6885 -0.0819 0.2281  -0.0716 7   DG  G "O5'" 
3692 C "C5'" . DG  E 7   ? 0.6289 0.7451 0.6697 -0.0815 0.2172  -0.0908 7   DG  G "C5'" 
3693 C "C4'" . DG  E 7   ? 0.6255 0.7532 0.6534 -0.0671 0.2059  -0.0971 7   DG  G "C4'" 
3694 O "O4'" . DG  E 7   ? 0.6177 0.7238 0.6249 -0.0612 0.2004  -0.0848 7   DG  G "O4'" 
3695 C "C3'" . DG  E 7   ? 0.6393 0.7846 0.6570 -0.0591 0.2115  -0.0995 7   DG  G "C3'" 
3696 O "O3'" . DG  E 7   ? 0.6655 0.8352 0.6962 -0.0533 0.2034  -0.1176 7   DG  G "O3'" 
3697 C "C2'" . DG  E 7   ? 0.6073 0.7390 0.5961 -0.0486 0.2074  -0.0903 7   DG  G "C2'" 
3698 C "C1'" . DG  E 7   ? 0.5775 0.6918 0.5658 -0.0489 0.1955  -0.0891 7   DG  G "C1'" 
3699 N N9    . DG  E 7   ? 0.5204 0.6145 0.4832 -0.0452 0.1929  -0.0750 7   DG  G N9    
3700 C C8    . DG  E 7   ? 0.5027 0.5829 0.4532 -0.0485 0.2013  -0.0540 7   DG  G C8    
3701 N N7    . DG  E 7   ? 0.5049 0.5721 0.4322 -0.0439 0.1945  -0.0443 7   DG  G N7    
3702 C C5    . DG  E 7   ? 0.4719 0.5414 0.3948 -0.0381 0.1815  -0.0615 7   DG  G C5    
3703 C C6    . DG  E 7   ? 0.4512 0.5087 0.3496 -0.0330 0.1691  -0.0624 7   DG  G C6    
3704 O O6    . DG  E 7   ? 0.4381 0.4820 0.3137 -0.0330 0.1656  -0.0458 7   DG  G O6    
3705 N N1    . DG  E 7   ? 0.4518 0.5140 0.3562 -0.0256 0.1542  -0.0823 7   DG  G N1    
3706 C C2    . DG  E 7   ? 0.4378 0.5187 0.3673 -0.0233 0.1552  -0.0990 7   DG  G C2    
3707 N N2    . DG  E 7   ? 0.4336 0.5173 0.3655 -0.0132 0.1400  -0.1146 7   DG  G N2    
3708 N N3    . DG  E 7   ? 0.4487 0.5436 0.3999 -0.0295 0.1669  -0.0978 7   DG  G N3    
3709 C C4    . DG  E 7   ? 0.4737 0.5603 0.4196 -0.0373 0.1799  -0.0798 7   DG  G C4    
3710 P P     . DA  E 8   ? 0.6999 0.8906 0.7225 -0.0409 0.2049  -0.1255 8   DA  G P     
3711 O OP1   . DA  E 8   ? 0.7357 0.9544 0.7825 -0.0436 0.2049  -0.1389 8   DA  G OP1   
3712 O OP2   . DA  E 8   ? 0.7232 0.9080 0.7271 -0.0403 0.2177  -0.1130 8   DA  G OP2   
3713 O "O5'" . DA  E 8   ? 0.6771 0.8608 0.6840 -0.0250 0.1888  -0.1324 8   DA  G "O5'" 
3714 C "C5'" . DA  E 8   ? 0.6311 0.8116 0.6487 -0.0238 0.1749  -0.1384 8   DA  G "C5'" 
3715 C "C4'" . DA  E 8   ? 0.6086 0.7826 0.6106 -0.0068 0.1603  -0.1457 8   DA  G "C4'" 
3716 O "O4'" . DA  E 8   ? 0.5989 0.7463 0.5752 -0.0055 0.1569  -0.1373 8   DA  G "O4'" 
3717 C "C3'" . DA  E 8   ? 0.6054 0.7905 0.5976 0.0068  0.1612  -0.1538 8   DA  G "C3'" 
3718 O "O3'" . DA  E 8   ? 0.6135 0.7972 0.6058 0.0211  0.1461  -0.1631 8   DA  G "O3'" 
3719 C "C2'" . DA  E 8   ? 0.5734 0.7398 0.5348 0.0085  0.1665  -0.1462 8   DA  G "C2'" 
3720 C "C1'" . DA  E 8   ? 0.5494 0.6919 0.5001 0.0040  0.1582  -0.1389 8   DA  G "C1'" 
3721 N N9    . DA  E 8   ? 0.4972 0.6257 0.4287 -0.0042 0.1670  -0.1241 8   DA  G N9    
3722 C C8    . DA  E 8   ? 0.4928 0.6259 0.4295 -0.0147 0.1828  -0.1113 8   DA  G C8    
3723 N N7    . DA  E 8   ? 0.4692 0.5875 0.3850 -0.0183 0.1869  -0.0960 8   DA  G N7    
3724 C C5    . DA  E 8   ? 0.4391 0.5432 0.3334 -0.0118 0.1727  -0.1008 8   DA  G C5    
3725 C C6    . DA  E 8   ? 0.4381 0.5254 0.3030 -0.0128 0.1680  -0.0902 8   DA  G C6    
3726 N N6    . DA  E 8   ? 0.4160 0.4994 0.2694 -0.0187 0.1777  -0.0694 8   DA  G N6    
3727 N N1    . DA  E 8   ? 0.4398 0.5147 0.2877 -0.0071 0.1513  -0.1002 8   DA  G N1    
3728 C C2    . DA  E 8   ? 0.4076 0.4849 0.2689 0.0017  0.1406  -0.1179 8   DA  G C2    
3729 N N3    . DA  E 8   ? 0.4345 0.5284 0.3236 0.0054  0.1439  -0.1269 8   DA  G N3    
3730 C C4    . DA  E 8   ? 0.4636 0.5716 0.3676 -0.0029 0.1602  -0.1184 8   DA  G C4    
3731 P P     . DA  E 9   ? 0.8064 1.0001 0.7935 0.0381  0.1445  -0.1733 9   DA  G P     
3732 O OP1   . DA  E 9   ? 0.8088 1.0139 0.8136 0.0476  0.1326  -0.1802 9   DA  G OP1   
3733 O OP2   . DA  E 9   ? 0.7958 1.0094 0.7867 0.0340  0.1601  -0.1731 9   DA  G OP2   
3734 O "O5'" . DA  E 9   ? 0.6441 0.8064 0.5966 0.0475  0.1385  -0.1734 9   DA  G "O5'" 
3735 C "C5'" . DA  E 9   ? 0.6117 0.7485 0.5529 0.0476  0.1254  -0.1707 9   DA  G "C5'" 
3736 C "C4'" . DA  E 9   ? 0.6226 0.7323 0.5289 0.0527  0.1215  -0.1716 9   DA  G "C4'" 
3737 O "O4'" . DA  E 9   ? 0.6046 0.7085 0.4954 0.0402  0.1288  -0.1614 9   DA  G "O4'" 
3738 C "C3'" . DA  E 9   ? 0.6416 0.7538 0.5348 0.0633  0.1274  -0.1797 9   DA  G "C3'" 
3739 O "O3'" . DA  E 9   ? 0.6700 0.7538 0.5409 0.0730  0.1161  -0.1862 9   DA  G "O3'" 
3740 C "C2'" . DA  E 9   ? 0.6263 0.7430 0.5035 0.0543  0.1405  -0.1729 9   DA  G "C2'" 
3741 C "C1'" . DA  E 9   ? 0.5945 0.6949 0.4603 0.0435  0.1350  -0.1630 9   DA  G "C1'" 
3742 N N9    . DA  E 9   ? 0.5267 0.6358 0.3874 0.0314  0.1486  -0.1502 9   DA  G N9    
3743 C C8    . DA  E 9   ? 0.4900 0.6208 0.3696 0.0248  0.1642  -0.1442 9   DA  G C8    
3744 N N7    . DA  E 9   ? 0.4997 0.6300 0.3692 0.0153  0.1747  -0.1297 9   DA  G N7    
3745 C C5    . DA  E 9   ? 0.5118 0.6224 0.3536 0.0153  0.1649  -0.1262 9   DA  G C5    
3746 C C6    . DA  E 9   ? 0.5009 0.6040 0.3201 0.0081  0.1681  -0.1102 9   DA  G C6    
3747 N N6    . DA  E 9   ? 0.4670 0.5792 0.2895 0.0012  0.1837  -0.0930 9   DA  G N6    
3748 N N1    . DA  E 9   ? 0.4677 0.5538 0.2610 0.0086  0.1540  -0.1110 9   DA  G N1    
3749 C C2    . DA  E 9   ? 0.4820 0.5553 0.2730 0.0161  0.1380  -0.1270 9   DA  G C2    
3750 N N3    . DA  E 9   ? 0.4923 0.5677 0.3035 0.0252  0.1343  -0.1412 9   DA  G N3    
3751 C C4    . DA  E 9   ? 0.5167 0.6133 0.3527 0.0243  0.1482  -0.1398 9   DA  G C4    
3752 P P     . DC  E 10  ? 0.7941 0.8740 0.6553 0.0876  0.1192  -0.1976 10  DC  G P     
3753 O OP1   . DC  E 10  ? 0.7967 0.8575 0.6606 0.0984  0.1065  -0.2028 10  DC  G OP1   
3754 O OP2   . DC  E 10  ? 0.7613 0.8740 0.6404 0.0898  0.1331  -0.1991 10  DC  G OP2   
3755 O "O5'" . DC  E 10  ? 0.7870 0.8454 0.6110 0.0838  0.1208  -0.1993 10  DC  G "O5'" 
3756 C "C5'" . DC  E 10  ? 0.7633 0.7952 0.5668 0.0765  0.1089  -0.1959 10  DC  G "C5'" 
3757 C "C4'" . DC  E 10  ? 0.7625 0.7914 0.5369 0.0677  0.1133  -0.1921 10  DC  G "C4'" 
3758 O "O4'" . DC  E 10  ? 0.7152 0.7684 0.4993 0.0579  0.1238  -0.1797 10  DC  G "O4'" 
3759 C "C3'" . DC  E 10  ? 0.8027 0.8337 0.5588 0.0734  0.1230  -0.2005 10  DC  G "C3'" 
3760 O "O3'" . DC  E 10  ? 0.8830 0.8835 0.6109 0.0746  0.1140  -0.2098 10  DC  G "O3'" 
3761 C "C2'" . DC  E 10  ? 0.7620 0.8127 0.5080 0.0642  0.1341  -0.1900 10  DC  G "C2'" 
3762 C "C1'" . DC  E 10  ? 0.6886 0.7455 0.4475 0.0534  0.1311  -0.1760 10  DC  G "C1'" 
3763 N N1    . DC  E 10  ? 0.6060 0.6900 0.3799 0.0465  0.1473  -0.1636 10  DC  G N1    
3764 C C2    . DC  E 10  ? 0.5827 0.6694 0.3422 0.0358  0.1509  -0.1484 10  DC  G C2    
3765 O O2    . DC  E 10  ? 0.5405 0.6112 0.2765 0.0323  0.1391  -0.1464 10  DC  G O2    
3766 N N3    . DC  E 10  ? 0.5267 0.6331 0.2992 0.0293  0.1672  -0.1347 10  DC  G N3    
3767 C C4    . DC  E 10  ? 0.5208 0.6447 0.3193 0.0316  0.1783  -0.1377 10  DC  G C4    
3768 N N4    . DC  E 10  ? 0.5176 0.6571 0.3283 0.0240  0.1940  -0.1234 10  DC  G N4    
3769 C C5    . DC  E 10  ? 0.5388 0.6649 0.3520 0.0419  0.1737  -0.1539 10  DC  G C5    
3770 C C6    . DC  E 10  ? 0.5717 0.6771 0.3718 0.0499  0.1587  -0.1656 10  DC  G C6    
3771 O OP3   . DG  F 1   ? 0.9425 0.7647 0.4358 -0.1029 0.1506  -0.0227 1   DG  H OP3   
3772 P P     . DG  F 1   ? 0.9282 0.7957 0.4628 -0.1146 0.1641  -0.0352 1   DG  H P     
3773 O OP1   . DG  F 1   ? 0.9379 0.8077 0.4664 -0.1242 0.1825  -0.0468 1   DG  H OP1   
3774 O OP2   . DG  F 1   ? 0.9031 0.7777 0.4552 -0.1243 0.1676  -0.0333 1   DG  H OP2   
3775 O "O5'" . DG  F 1   ? 0.8129 0.7132 0.3733 -0.1014 0.1493  -0.0376 1   DG  H "O5'" 
3776 C "C5'" . DG  F 1   ? 0.7858 0.6818 0.3330 -0.0895 0.1409  -0.0389 1   DG  H "C5'" 
3777 C "C4'" . DG  F 1   ? 0.7124 0.6284 0.2784 -0.0782 0.1238  -0.0389 1   DG  H "C4'" 
3778 O "O4'" . DG  F 1   ? 0.6530 0.6051 0.2489 -0.0805 0.1309  -0.0514 1   DG  H "O4'" 
3779 C "C3'" . DG  F 1   ? 0.6850 0.5980 0.2588 -0.0755 0.1101  -0.0289 1   DG  H "C3'" 
3780 O "O3'" . DG  F 1   ? 0.7249 0.6361 0.2962 -0.0639 0.0916  -0.0267 1   DG  H "O3'" 
3781 C "C2'" . DG  F 1   ? 0.6368 0.5804 0.2437 -0.0829 0.1169  -0.0346 1   DG  H "C2'" 
3782 C "C1'" . DG  F 1   ? 0.6362 0.6052 0.2560 -0.0818 0.1252  -0.0496 1   DG  H "C1'" 
3783 N N9    . DG  F 1   ? 0.6219 0.6203 0.2674 -0.0919 0.1412  -0.0618 1   DG  H N9    
3784 C C8    . DG  F 1   ? 0.6463 0.6419 0.2932 -0.1066 0.1567  -0.0630 1   DG  H C8    
3785 N N7    . DG  F 1   ? 0.6258 0.6576 0.3033 -0.1139 0.1681  -0.0785 1   DG  H N7    
3786 C C5    . DG  F 1   ? 0.5656 0.6253 0.2613 -0.1002 0.1586  -0.0880 1   DG  H C5    
3787 C C6    . DG  F 1   ? 0.5457 0.6514 0.2766 -0.0958 0.1613  -0.1080 1   DG  H C6    
3788 O O6    . DG  F 1   ? 0.5438 0.6803 0.3020 -0.1054 0.1734  -0.1224 1   DG  H O6    
3789 N N1    . DG  F 1   ? 0.5304 0.6447 0.2629 -0.0771 0.1466  -0.1127 1   DG  H N1    
3790 C C2    . DG  F 1   ? 0.5337 0.6163 0.2387 -0.0682 0.1325  -0.0995 1   DG  H C2    
3791 N N2    . DG  F 1   ? 0.5238 0.6140 0.2306 -0.0517 0.1194  -0.1069 1   DG  H N2    
3792 N N3    . DG  F 1   ? 0.5489 0.5941 0.2262 -0.0736 0.1298  -0.0819 1   DG  H N3    
3793 C C4    . DG  F 1   ? 0.5641 0.6002 0.2380 -0.0878 0.1427  -0.0772 1   DG  H C4    
3794 P P     . DT  F 2   ? 0.7779 0.6931 0.3626 -0.0603 0.0754  -0.0199 2   DT  H P     
3795 O OP1   . DT  F 2   ? 0.8091 0.7119 0.3790 -0.0501 0.0586  -0.0186 2   DT  H OP1   
3796 O OP2   . DT  F 2   ? 0.7643 0.6750 0.3534 -0.0665 0.0800  -0.0128 2   DT  H OP2   
3797 O "O5'" . DT  F 2   ? 0.6928 0.6340 0.3035 -0.0612 0.0748  -0.0274 2   DT  H "O5'" 
3798 C "C5'" . DT  F 2   ? 0.6580 0.6041 0.2658 -0.0556 0.0728  -0.0363 2   DT  H "C5'" 
3799 C "C4'" . DT  F 2   ? 0.6028 0.5675 0.2303 -0.0539 0.0700  -0.0434 2   DT  H "C4'" 
3800 O "O4'" . DT  F 2   ? 0.5666 0.5551 0.2116 -0.0583 0.0842  -0.0516 2   DT  H "O4'" 
3801 C "C3'" . DT  F 2   ? 0.5859 0.5493 0.2246 -0.0547 0.0580  -0.0371 2   DT  H "C3'" 
3802 O "O3'" . DT  F 2   ? 0.5808 0.5430 0.2271 -0.0467 0.0480  -0.0425 2   DT  H "O3'" 
3803 C "C2'" . DT  F 2   ? 0.5466 0.5286 0.2082 -0.0598 0.0663  -0.0368 2   DT  H "C2'" 
3804 C "C1'" . DT  F 2   ? 0.5201 0.5218 0.1890 -0.0580 0.0790  -0.0502 2   DT  H "C1'" 
3805 N N1    . DT  F 2   ? 0.5217 0.5448 0.2048 -0.0676 0.0949  -0.0556 2   DT  H N1    
3806 C C2    . DT  F 2   ? 0.4928 0.5472 0.2047 -0.0616 0.0977  -0.0698 2   DT  H C2    
3807 O O2    . DT  F 2   ? 0.5217 0.5811 0.2426 -0.0467 0.0867  -0.0764 2   DT  H O2    
3808 N N3    . DT  F 2   ? 0.4831 0.5611 0.2098 -0.0731 0.1137  -0.0778 2   DT  H N3    
3809 C C4    . DT  F 2   ? 0.5223 0.5865 0.2419 -0.0878 0.1246  -0.0690 2   DT  H C4    
3810 O O4    . DT  F 2   ? 0.4957 0.5790 0.2338 -0.0981 0.1373  -0.0768 2   DT  H O4    
3811 C C5    . DT  F 2   ? 0.5397 0.5644 0.2296 -0.0882 0.1178  -0.0516 2   DT  H C5    
3812 C C7    . DT  F 2   ? 0.5859 0.5872 0.2619 -0.0986 0.1257  -0.0420 2   DT  H C7    
3813 C C6    . DT  F 2   ? 0.5317 0.5416 0.2071 -0.0778 0.1033  -0.0468 2   DT  H C6    
3814 P P     . DT  F 3   ? 0.6735 0.6287 0.3312 -0.0469 0.0351  -0.0383 3   DT  H P     
3815 O OP1   . DT  F 3   ? 0.7001 0.6403 0.3446 -0.0440 0.0272  -0.0436 3   DT  H OP1   
3816 O OP2   . DT  F 3   ? 0.6773 0.6325 0.3382 -0.0537 0.0326  -0.0288 3   DT  H OP2   
3817 O "O5'" . DT  F 3   ? 0.5778 0.5436 0.2561 -0.0415 0.0365  -0.0423 3   DT  H "O5'" 
3818 C "C5'" . DT  F 3   ? 0.5526 0.5213 0.2287 -0.0308 0.0384  -0.0532 3   DT  H "C5'" 
3819 C "C4'" . DT  F 3   ? 0.5338 0.5175 0.2299 -0.0234 0.0392  -0.0582 3   DT  H "C4'" 
3820 O "O4'" . DT  F 3   ? 0.4638 0.4739 0.1759 -0.0297 0.0503  -0.0593 3   DT  H "O4'" 
3821 C "C3'" . DT  F 3   ? 0.4949 0.4668 0.1987 -0.0243 0.0313  -0.0516 3   DT  H "C3'" 
3822 O "O3'" . DT  F 3   ? 0.5005 0.4583 0.1963 -0.0097 0.0253  -0.0601 3   DT  H "O3'" 
3823 C "C2'" . DT  F 3   ? 0.4402 0.4354 0.1668 -0.0295 0.0370  -0.0481 3   DT  H "C2'" 
3824 C "C1'" . DT  F 3   ? 0.4456 0.4666 0.1783 -0.0278 0.0481  -0.0589 3   DT  H "C1'" 
3825 N N1    . DT  F 3   ? 0.4361 0.4771 0.1811 -0.0406 0.0601  -0.0566 3   DT  H N1    
3826 C C2    . DT  F 3   ? 0.4665 0.5387 0.2332 -0.0386 0.0682  -0.0696 3   DT  H C2    
3827 O O2    . DT  F 3   ? 0.4647 0.5512 0.2421 -0.0234 0.0635  -0.0835 3   DT  H O2    
3828 N N3    . DT  F 3   ? 0.4266 0.5118 0.1997 -0.0546 0.0818  -0.0677 3   DT  H N3    
3829 C C4    . DT  F 3   ? 0.4479 0.5122 0.2019 -0.0690 0.0868  -0.0530 3   DT  H C4    
3830 O O4    . DT  F 3   ? 0.4381 0.5082 0.1915 -0.0831 0.1005  -0.0524 3   DT  H O4    
3831 C C5    . DT  F 3   ? 0.4434 0.4777 0.1758 -0.0659 0.0750  -0.0406 3   DT  H C5    
3832 C C7    . DT  F 3   ? 0.4689 0.4799 0.1775 -0.0755 0.0760  -0.0270 3   DT  H C7    
3833 C C6    . DT  F 3   ? 0.4387 0.4656 0.1702 -0.0535 0.0632  -0.0437 3   DT  H C6    
3834 P P     . DC  F 4   ? 0.5597 0.4996 0.2566 -0.0047 0.0183  -0.0578 4   DC  H P     
3835 O OP1   . DC  F 4   ? 0.5980 0.5030 0.2657 0.0072  0.0124  -0.0649 4   DC  H OP1   
3836 O OP2   . DC  F 4   ? 0.5613 0.4981 0.2674 -0.0202 0.0180  -0.0453 4   DC  H OP2   
3837 O "O5'" . DC  F 4   ? 0.5291 0.4985 0.2485 0.0066  0.0196  -0.0658 4   DC  H "O5'" 
3838 C "C5'" . DC  F 4   ? 0.5318 0.5201 0.2526 0.0221  0.0208  -0.0816 4   DC  H "C5'" 
3839 C "C4'" . DC  F 4   ? 0.5643 0.5827 0.3100 0.0325  0.0200  -0.0919 4   DC  H "C4'" 
3840 O "O4'" . DC  F 4   ? 0.5302 0.5825 0.3024 0.0151  0.0316  -0.0885 4   DC  H "O4'" 
3841 C "C3'" . DC  F 4   ? 0.5846 0.5807 0.3267 0.0401  0.0104  -0.0876 4   DC  H "C3'" 
3842 O "O3'" . DC  F 4   ? 0.6393 0.6418 0.3796 0.0663  0.0019  -0.1054 4   DC  H "O3'" 
3843 C "C2'" . DC  F 4   ? 0.5311 0.5498 0.3007 0.0231  0.0164  -0.0778 4   DC  H "C2'" 
3844 C "C1'" . DC  F 4   ? 0.4971 0.5573 0.2872 0.0134  0.0292  -0.0851 4   DC  H "C1'" 
3845 N N1    . DC  F 4   ? 0.4498 0.5182 0.2492 -0.0100 0.0397  -0.0717 4   DC  H N1    
3846 C C2    . DC  F 4   ? 0.4266 0.5284 0.2501 -0.0189 0.0498  -0.0774 4   DC  H C2    
3847 O O2    . DC  F 4   ? 0.3831 0.5142 0.2262 -0.0074 0.0491  -0.0952 4   DC  H O2    
3848 N N3    . DC  F 4   ? 0.4241 0.5240 0.2464 -0.0391 0.0597  -0.0650 4   DC  H N3    
3849 C C4    . DC  F 4   ? 0.4209 0.4917 0.2218 -0.0471 0.0575  -0.0489 4   DC  H C4    
3850 N N4    . DC  F 4   ? 0.4370 0.5027 0.2315 -0.0630 0.0656  -0.0381 4   DC  H N4    
3851 C C5    . DC  F 4   ? 0.4222 0.4670 0.2052 -0.0387 0.0468  -0.0452 4   DC  H C5    
3852 C C6    . DC  F 4   ? 0.4482 0.4907 0.2298 -0.0220 0.0395  -0.0562 4   DC  H C6    
3853 P P     . DT  F 5   ? 0.6935 0.6694 0.4225 0.0831  -0.0103 -0.1064 5   DT  H P     
3854 O OP1   . DT  F 5   ? 0.7125 0.6715 0.4151 0.1142  -0.0215 -0.1242 5   DT  H OP1   
3855 O OP2   . DT  F 5   ? 0.6571 0.5925 0.3701 0.0663  -0.0096 -0.0868 5   DT  H OP2   
3856 O "O5'" . DT  F 5   ? 0.7230 0.7482 0.4939 0.0812  -0.0079 -0.1128 5   DT  H "O5'" 
3857 C "C5'" . DT  F 5   ? 0.6995 0.7791 0.4996 0.0880  -0.0037 -0.1334 5   DT  H "C5'" 
3858 C "C4'" . DT  F 5   ? 0.6820 0.8002 0.5183 0.0820  -0.0008 -0.1382 5   DT  H "C4'" 
3859 O "O4'" . DT  F 5   ? 0.6325 0.7612 0.4841 0.0503  0.0142  -0.1217 5   DT  H "O4'" 
3860 C "C3'" . DT  F 5   ? 0.7038 0.7948 0.5309 0.0951  -0.0138 -0.1336 5   DT  H "C3'" 
3861 O "O3'" . DT  F 5   ? 0.7469 0.8770 0.5969 0.1165  -0.0216 -0.1581 5   DT  H "O3'" 
3862 C "C2'" . DT  F 5   ? 0.6375 0.7222 0.4758 0.0673  -0.0053 -0.1111 5   DT  H "C2'" 
3863 C "C1'" . DT  F 5   ? 0.5892 0.7127 0.4510 0.0434  0.0119  -0.1112 5   DT  H "C1'" 
3864 N N1    . DT  F 5   ? 0.5142 0.6191 0.3693 0.0168  0.0215  -0.0878 5   DT  H N1    
3865 C C2    . DT  F 5   ? 0.4522 0.5824 0.3272 -0.0042 0.0343  -0.0840 5   DT  H C2    
3866 O O2    . DT  F 5   ? 0.4112 0.5799 0.3117 -0.0054 0.0402  -0.0992 5   DT  H O2    
3867 N N3    . DT  F 5   ? 0.4293 0.5371 0.2910 -0.0233 0.0401  -0.0636 5   DT  H N3    
3868 C C4    . DT  F 5   ? 0.4612 0.5325 0.2986 -0.0243 0.0342  -0.0494 5   DT  H C4    
3869 O O4    . DT  F 5   ? 0.4982 0.5558 0.3264 -0.0389 0.0379  -0.0348 5   DT  H O4    
3870 C C5    . DT  F 5   ? 0.4936 0.5427 0.3147 -0.0062 0.0233  -0.0551 5   DT  H C5    
3871 C C7    . DT  F 5   ? 0.5255 0.5365 0.3209 -0.0098 0.0188  -0.0437 5   DT  H C7    
3872 C C6    . DT  F 5   ? 0.5344 0.5972 0.3615 0.0137  0.0175  -0.0727 5   DT  H C6    
3873 P P     . DA  F 6   ? 1.0121 1.1199 0.8520 0.1394  -0.0383 -0.1615 6   DA  H P     
3874 O OP1   . DA  F 6   ? 1.0050 1.1393 0.8484 0.1752  -0.0523 -0.1928 6   DA  H OP1   
3875 O OP2   . DA  F 6   ? 1.0388 1.0753 0.8351 0.1373  -0.0429 -0.1386 6   DA  H OP2   
3876 O "O5'" . DA  F 6   ? 0.6961 0.8409 0.5760 0.1176  -0.0297 -0.1568 6   DA  H "O5'" 
3877 C "C5'" . DA  F 6   ? 0.6476 0.8591 0.5704 0.1062  -0.0180 -0.1753 6   DA  H "C5'" 
3878 C "C4'" . DA  F 6   ? 0.6037 0.8354 0.5539 0.0817  -0.0080 -0.1664 6   DA  H "C4'" 
3879 O "O4'" . DA  F 6   ? 0.5741 0.7804 0.5133 0.0510  0.0059  -0.1387 6   DA  H "O4'" 
3880 C "C3'" . DA  F 6   ? 0.6002 0.8102 0.5458 0.0946  -0.0219 -0.1613 6   DA  H "C3'" 
3881 O "O3'" . DA  F 6   ? 0.5801 0.8432 0.5660 0.0872  -0.0168 -0.1777 6   DA  H "O3'" 
3882 C "C2'" . DA  F 6   ? 0.5918 0.7515 0.5148 0.0732  -0.0168 -0.1274 6   DA  H "C2'" 
3883 C "C1'" . DA  F 6   ? 0.5522 0.7310 0.4863 0.0427  0.0028  -0.1188 6   DA  H "C1'" 
3884 N N9    . DA  F 6   ? 0.5028 0.6384 0.4103 0.0274  0.0070  -0.0930 6   DA  H N9    
3885 C C8    . DA  F 6   ? 0.5061 0.5958 0.3808 0.0376  -0.0016 -0.0837 6   DA  H C8    
3886 N N7    . DA  F 6   ? 0.4956 0.5613 0.3567 0.0187  0.0048  -0.0641 6   DA  H N7    
3887 C C5    . DA  F 6   ? 0.4327 0.5254 0.3141 -0.0026 0.0172  -0.0589 6   DA  H C5    
3888 C C6    . DA  F 6   ? 0.4136 0.4970 0.2890 -0.0247 0.0264  -0.0416 6   DA  H C6    
3889 N N6    . DA  F 6   ? 0.4177 0.4695 0.2716 -0.0293 0.0238  -0.0279 6   DA  H N6    
3890 N N1    . DA  F 6   ? 0.3929 0.4995 0.2825 -0.0412 0.0383  -0.0411 6   DA  H N1    
3891 C C2    . DA  F 6   ? 0.3720 0.5142 0.2859 -0.0393 0.0425  -0.0580 6   DA  H C2    
3892 N N3    . DA  F 6   ? 0.3789 0.5413 0.3073 -0.0193 0.0338  -0.0774 6   DA  H N3    
3893 C C4    . DA  F 6   ? 0.4137 0.5473 0.3224 0.0003  0.0202  -0.0761 6   DA  H C4    
3894 P P     . DG  F 7   ? 0.7236 0.9823 0.7163 0.1001  -0.0301 -0.1795 7   DG  H P     
3895 O OP1   . DG  F 7   ? 0.7000 1.0247 0.7317 0.1133  -0.0336 -0.2157 7   DG  H OP1   
3896 O OP2   . DG  F 7   ? 0.7396 0.9329 0.6886 0.1235  -0.0474 -0.1656 7   DG  H OP2   
3897 O "O5'" . DG  F 7   ? 0.5132 0.7663 0.5159 0.0638  -0.0143 -0.1550 7   DG  H "O5'" 
3898 C "C5'" . DG  F 7   ? 0.4905 0.7837 0.5182 0.0336  0.0074  -0.1595 7   DG  H "C5'" 
3899 C "C4'" . DG  F 7   ? 0.4723 0.7437 0.4953 0.0043  0.0192  -0.1331 7   DG  H "C4'" 
3900 O "O4'" . DG  F 7   ? 0.4694 0.6938 0.4606 -0.0055 0.0222  -0.1059 7   DG  H "O4'" 
3901 C "C3'" . DG  F 7   ? 0.4529 0.7061 0.4759 0.0117  0.0076  -0.1241 7   DG  H "C3'" 
3902 O "O3'" . DG  F 7   ? 0.4218 0.6969 0.4640 -0.0146 0.0222  -0.1225 7   DG  H "O3'" 
3903 C "C2'" . DG  F 7   ? 0.4645 0.6555 0.4513 0.0131  0.0010  -0.0940 7   DG  H "C2'" 
3904 C "C1'" . DG  F 7   ? 0.4446 0.6292 0.4203 -0.0082 0.0159  -0.0822 7   DG  H "C1'" 
3905 N N9    . DG  F 7   ? 0.4002 0.5400 0.3448 -0.0037 0.0105  -0.0650 7   DG  H N9    
3906 C C8    . DG  F 7   ? 0.3914 0.5051 0.3155 0.0192  -0.0025 -0.0690 7   DG  H C8    
3907 N N7    . DG  F 7   ? 0.3970 0.4738 0.2957 0.0134  -0.0019 -0.0526 7   DG  H N7    
3908 C C5    . DG  F 7   ? 0.3663 0.4474 0.2700 -0.0118 0.0100  -0.0374 7   DG  H C5    
3909 C C6    . DG  F 7   ? 0.3240 0.3799 0.2099 -0.0258 0.0141  -0.0196 7   DG  H C6    
3910 O O6    . DG  F 7   ? 0.3657 0.3929 0.2310 -0.0222 0.0096  -0.0140 7   DG  H O6    
3911 N N1    . DG  F 7   ? 0.3248 0.3906 0.2164 -0.0455 0.0244  -0.0098 7   DG  H N1    
3912 C C2    . DG  F 7   ? 0.3586 0.4517 0.2686 -0.0544 0.0326  -0.0157 7   DG  H C2    
3913 N N2    . DG  F 7   ? 0.3658 0.4549 0.2689 -0.0733 0.0430  -0.0042 7   DG  H N2    
3914 N N3    . DG  F 7   ? 0.3459 0.4670 0.2770 -0.0451 0.0308  -0.0335 7   DG  H N3    
3915 C C4    . DG  F 7   ? 0.3526 0.4678 0.2805 -0.0222 0.0181  -0.0438 7   DG  H C4    
3916 P P     . DA  F 8   ? 0.4070 0.6716 0.4547 -0.0142 0.0150  -0.1140 8   DA  H P     
3917 O OP1   . DA  F 8   ? 0.4208 0.7285 0.4968 -0.0374 0.0310  -0.1286 8   DA  H OP1   
3918 O OP2   . DA  F 8   ? 0.4179 0.6690 0.4600 0.0200  -0.0080 -0.1219 8   DA  H OP2   
3919 O "O5'" . DA  F 8   ? 0.3182 0.5283 0.3354 -0.0293 0.0182  -0.0776 8   DA  H "O5'" 
3920 C "C5'" . DA  F 8   ? 0.2794 0.4841 0.2872 -0.0570 0.0364  -0.0646 8   DA  H "C5'" 
3921 C "C4'" . DA  F 8   ? 0.2782 0.4342 0.2588 -0.0623 0.0331  -0.0343 8   DA  H "C4'" 
3922 O "O4'" . DA  F 8   ? 0.2983 0.4280 0.2588 -0.0514 0.0259  -0.0264 8   DA  H "O4'" 
3923 C "C3'" . DA  F 8   ? 0.2694 0.4059 0.2499 -0.0524 0.0206  -0.0249 8   DA  H "C3'" 
3924 O "O3'" . DA  F 8   ? 0.2188 0.3452 0.1944 -0.0725 0.0297  -0.0095 8   DA  H "O3'" 
3925 C "C2'" . DA  F 8   ? 0.2825 0.3778 0.2392 -0.0382 0.0088  -0.0109 8   DA  H "C2'" 
3926 C "C1'" . DA  F 8   ? 0.2884 0.3798 0.2322 -0.0470 0.0167  -0.0070 8   DA  H "C1'" 
3927 N N9    . DA  F 8   ? 0.3031 0.3703 0.2292 -0.0326 0.0080  -0.0061 8   DA  H N9    
3928 C C8    . DA  F 8   ? 0.2998 0.3630 0.2225 -0.0101 -0.0029 -0.0200 8   DA  H C8    
3929 N N7    . DA  F 8   ? 0.2868 0.3193 0.1858 -0.0038 -0.0069 -0.0152 8   DA  H N7    
3930 C C5    . DA  F 8   ? 0.2724 0.2945 0.1643 -0.0231 0.0010  0.0013  8   DA  H C5    
3931 C C6    . DA  F 8   ? 0.2977 0.2940 0.1697 -0.0282 0.0015  0.0105  8   DA  H C6    
3932 N N6    . DA  F 8   ? 0.2983 0.2691 0.1502 -0.0167 -0.0040 0.0056  8   DA  H N6    
3933 N N1    . DA  F 8   ? 0.3106 0.3068 0.1811 -0.0450 0.0077  0.0233  8   DA  H N1    
3934 C C2    . DA  F 8   ? 0.3165 0.3296 0.1984 -0.0560 0.0137  0.0285  8   DA  H C2    
3935 N N3    . DA  F 8   ? 0.2938 0.3279 0.1925 -0.0557 0.0161  0.0219  8   DA  H N3    
3936 C C4    . DA  F 8   ? 0.2775 0.3187 0.1836 -0.0390 0.0092  0.0074  8   DA  H C4    
3937 P P     . DA  F 9   ? 0.2352 0.3400 0.2089 -0.0686 0.0208  0.0039  9   DA  H P     
3938 O OP1   . DA  F 9   ? 0.2779 0.3906 0.2543 -0.0901 0.0336  0.0075  9   DA  H OP1   
3939 O OP2   . DA  F 9   ? 0.2104 0.3190 0.1944 -0.0445 0.0054  -0.0087 9   DA  H OP2   
3940 O "O5'" . DA  F 9   ? 0.2141 0.2764 0.1618 -0.0671 0.0155  0.0272  9   DA  H "O5'" 
3941 C "C5'" . DA  F 9   ? 0.2319 0.2818 0.1621 -0.0821 0.0244  0.0402  9   DA  H "C5'" 
3942 C "C4'" . DA  F 9   ? 0.2535 0.2716 0.1668 -0.0766 0.0161  0.0557  9   DA  H "C4'" 
3943 O "O4'" . DA  F 9   ? 0.2640 0.2783 0.1738 -0.0652 0.0109  0.0480  9   DA  H "O4'" 
3944 C "C3'" . DA  F 9   ? 0.2194 0.2183 0.1331 -0.0691 0.0071  0.0639  9   DA  H "C3'" 
3945 O "O3'" . DA  F 9   ? 0.2862 0.2695 0.2061 -0.0615 0.0063  0.0651  9   DA  H "O3'" 
3946 C "C2'" . DA  F 9   ? 0.2350 0.2181 0.1431 -0.0533 -0.0018 0.0581  9   DA  H "C2'" 
3947 C "C1'" . DA  F 9   ? 0.2430 0.2294 0.1432 -0.0569 0.0023  0.0553  9   DA  H "C1'" 
3948 N N9    . DA  F 9   ? 0.2832 0.2598 0.1762 -0.0428 -0.0034 0.0447  9   DA  H N9    
3949 C C8    . DA  F 9   ? 0.2665 0.2459 0.1628 -0.0258 -0.0101 0.0309  9   DA  H C8    
3950 N N7    . DA  F 9   ? 0.3132 0.2739 0.1927 -0.0139 -0.0146 0.0241  9   DA  H N7    
3951 C C5    . DA  F 9   ? 0.3102 0.2583 0.1785 -0.0266 -0.0093 0.0337  9   DA  H C5    
3952 C C6    . DA  F 9   ? 0.2842 0.2100 0.1325 -0.0250 -0.0094 0.0318  9   DA  H C6    
3953 N N6    . DA  F 9   ? 0.3095 0.2151 0.1397 -0.0084 -0.0150 0.0208  9   DA  H N6    
3954 N N1    . DA  F 9   ? 0.3095 0.2329 0.1543 -0.0397 -0.0044 0.0401  9   DA  H N1    
3955 C C2    . DA  F 9   ? 0.2874 0.2267 0.1441 -0.0522 -0.0008 0.0500  9   DA  H C2    
3956 N N3    . DA  F 9   ? 0.2851 0.2398 0.1556 -0.0547 0.0002  0.0544  9   DA  H N3    
3957 C C4    . DA  F 9   ? 0.2865 0.2459 0.1638 -0.0429 -0.0035 0.0457  9   DA  H C4    
3958 P P     . DC  F 10  ? 0.3174 0.3018 0.2453 -0.0609 0.0101  0.0637  10  DC  H P     
3959 O OP1   . DC  F 10  ? 0.3429 0.3174 0.2707 -0.0527 0.0088  0.0633  10  DC  H OP1   
3960 O OP2   . DC  F 10  ? 0.3090 0.3079 0.2342 -0.0738 0.0183  0.0611  10  DC  H OP2   
3961 O "O5'" . DC  F 10  ? 0.2892 0.2709 0.2241 -0.0574 0.0059  0.0649  10  DC  H "O5'" 
3962 C "C5'" . DC  F 10  ? 0.3090 0.2773 0.2481 -0.0452 0.0024  0.0637  10  DC  H "C5'" 
3963 C "C4'" . DC  F 10  ? 0.3461 0.3147 0.2909 -0.0441 0.0016  0.0635  10  DC  H "C4'" 
3964 O "O4'" . DC  F 10  ? 0.3593 0.3340 0.3021 -0.0509 -0.0038 0.0682  10  DC  H "O4'" 
3965 C "C3'" . DC  F 10  ? 0.4002 0.3754 0.3450 -0.0520 0.0051  0.0636  10  DC  H "C3'" 
3966 O "O3'" . DC  F 10  ? 0.4749 0.4462 0.4220 -0.0502 0.0004  0.0642  10  DC  H "O3'" 
3967 C "C2'" . DC  F 10  ? 0.3385 0.3294 0.2847 -0.0652 0.0097  0.0636  10  DC  H "C2'" 
3968 C "C1'" . DC  F 10  ? 0.2813 0.2752 0.2289 -0.0650 0.0010  0.0681  10  DC  H "C1'" 
3969 N N1    . DC  F 10  ? 0.2278 0.2504 0.1826 -0.0709 0.0021  0.0591  10  DC  H N1    
3970 C C2    . DC  F 10  ? 0.2437 0.2970 0.2193 -0.0739 0.0049  0.0424  10  DC  H C2    
3971 O O2    . DC  F 10  ? 0.2727 0.3236 0.2498 -0.0829 0.0077  0.0477  10  DC  H O2    
3972 N N3    . DC  F 10  ? 0.2099 0.2967 0.2041 -0.0669 0.0046  0.0190  10  DC  H N3    
3973 C C4    . DC  F 10  ? 0.1933 0.2785 0.1822 -0.0566 0.0015  0.0145  10  DC  H C4    
3974 N N4    . DC  F 10  ? 0.1968 0.3166 0.2038 -0.0479 0.0005  -0.0099 10  DC  H N4    
3975 C C5    . DC  F 10  ? 0.1963 0.2464 0.1616 -0.0550 -0.0007 0.0329  10  DC  H C5    
3976 C C6    . DC  F 10  ? 0.2378 0.2599 0.1885 -0.0626 -0.0003 0.0536  10  DC  H C6    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   161 161 GLY GLY A . n 
A 1 2   SER 2   162 162 SER SER A . n 
A 1 3   HIS 3   163 163 HIS HIS A . n 
A 1 4   MET 4   164 164 MET MET A . n 
A 1 5   GLY 5   165 165 GLY GLY A . n 
A 1 6   HIS 6   166 166 HIS HIS A . n 
A 1 7   TRP 7   167 167 TRP TRP A . n 
A 1 8   SER 8   168 168 SER SER A . n 
A 1 9   GLN 9   169 169 GLN GLN A . n 
A 1 10  GLY 10  170 170 GLY GLY A . n 
A 1 11  LEU 11  171 171 LEU LEU A . n 
A 1 12  LYS 12  172 172 LYS LYS A . n 
A 1 13  ILE 13  173 173 ILE ILE A . n 
A 1 14  SER 14  174 174 SER SER A . n 
A 1 15  MET 15  175 175 MET MET A . n 
A 1 16  GLN 16  176 176 GLN GLN A . n 
A 1 17  ASP 17  177 177 ASP ASP A . n 
A 1 18  PRO 18  178 178 PRO PRO A . n 
A 1 19  LYS 19  179 179 LYS LYS A . n 
A 1 20  MET 20  180 180 MET MET A . n 
A 1 21  GLN 21  181 181 GLN GLN A . n 
A 1 22  VAL 22  182 182 VAL VAL A . n 
A 1 23  TYR 23  183 183 TYR TYR A . n 
A 1 24  LYS 24  184 184 LYS LYS A . n 
A 1 25  ASP 25  185 185 ASP ASP A . n 
A 1 26  GLU 26  186 186 GLU GLU A . n 
A 1 27  GLN 27  187 187 GLN GLN A . n 
A 1 28  VAL 28  188 188 VAL VAL A . n 
A 1 29  VAL 29  189 189 VAL VAL A . n 
A 1 30  VAL 30  190 190 VAL VAL A . n 
A 1 31  ILE 31  191 191 ILE ILE A . n 
A 1 32  LYS 32  192 192 LYS LYS A . n 
A 1 33  ASP 33  193 193 ASP ASP A . n 
A 1 34  LYS 34  194 194 LYS LYS A . n 
A 1 35  TYR 35  195 195 TYR TYR A . n 
A 1 36  PRO 36  196 196 PRO PRO A . n 
A 1 37  LYS 37  197 197 LYS LYS A . n 
A 1 38  ALA 38  198 198 ALA ALA A . n 
A 1 39  ARG 39  199 199 ARG ARG A . n 
A 1 40  TYR 40  200 200 TYR TYR A . n 
A 1 41  HIS 41  201 201 HIS HIS A . n 
A 1 42  TRP 42  202 202 TRP TRP A . n 
A 1 43  LEU 43  203 203 LEU LEU A . n 
A 1 44  VAL 44  204 204 VAL VAL A . n 
A 1 45  LEU 45  205 205 LEU LEU A . n 
A 1 46  PRO 46  206 206 PRO PRO A . n 
A 1 47  TRP 47  207 207 TRP TRP A . n 
A 1 48  THR 48  208 208 THR THR A . n 
A 1 49  SER 49  209 209 SER SER A . n 
A 1 50  ILE 50  210 210 ILE ILE A . n 
A 1 51  SER 51  211 211 SER SER A . n 
A 1 52  SER 52  212 212 SER SER A . n 
A 1 53  LEU 53  213 213 LEU LEU A . n 
A 1 54  LYS 54  214 214 LYS LYS A . n 
A 1 55  ALA 55  215 215 ALA ALA A . n 
A 1 56  VAL 56  216 216 VAL VAL A . n 
A 1 57  ALA 57  217 217 ALA ALA A . n 
A 1 58  ARG 58  218 218 ARG ARG A . n 
A 1 59  GLU 59  219 219 GLU GLU A . n 
A 1 60  HIS 60  220 220 HIS HIS A . n 
A 1 61  LEU 61  221 221 LEU LEU A . n 
A 1 62  GLU 62  222 222 GLU GLU A . n 
A 1 63  LEU 63  223 223 LEU LEU A . n 
A 1 64  LEU 64  224 224 LEU LEU A . n 
A 1 65  LYS 65  225 225 LYS LYS A . n 
A 1 66  HIS 66  226 226 HIS HIS A . n 
A 1 67  MET 67  227 227 MET MET A . n 
A 1 68  HIS 68  228 228 HIS HIS A . n 
A 1 69  THR 69  229 229 THR THR A . n 
A 1 70  VAL 70  230 230 VAL VAL A . n 
A 1 71  GLY 71  231 231 GLY GLY A . n 
A 1 72  GLU 72  232 232 GLU GLU A . n 
A 1 73  LYS 73  233 233 LYS LYS A . n 
A 1 74  VAL 74  234 234 VAL VAL A . n 
A 1 75  ILE 75  235 235 ILE ILE A . n 
A 1 76  VAL 76  236 236 VAL VAL A . n 
A 1 77  ASP 77  237 237 ASP ASP A . n 
A 1 78  PHE 78  238 238 PHE PHE A . n 
A 1 79  ALA 79  239 239 ALA ALA A . n 
A 1 80  GLY 80  240 240 GLY GLY A . n 
A 1 81  SER 81  241 241 SER SER A . n 
A 1 82  SER 82  242 242 SER SER A . n 
A 1 83  LYS 83  243 243 LYS LYS A . n 
A 1 84  LEU 84  244 244 LEU LEU A . n 
A 1 85  ARG 85  245 245 ARG ARG A . n 
A 1 86  PHE 86  246 246 PHE PHE A . n 
A 1 87  ARG 87  247 247 ARG ARG A . n 
A 1 88  LEU 88  248 248 LEU LEU A . n 
A 1 89  GLY 89  249 249 GLY GLY A . n 
A 1 90  TYR 90  250 250 TYR TYR A . n 
A 1 91  HIS 91  251 251 HIS HIS A . n 
A 1 92  ALA 92  252 252 ALA ALA A . n 
A 1 93  ILE 93  253 253 ILE ILE A . n 
A 1 94  PRO 94  254 254 PRO PRO A . n 
A 1 95  SER 95  255 255 SER SER A . n 
A 1 96  MET 96  256 256 MET MET A . n 
A 1 97  SER 97  257 257 SER SER A . n 
A 1 98  HIS 98  258 258 HIS HIS A . n 
A 1 99  VAL 99  259 259 VAL VAL A . n 
A 1 100 HIS 100 260 260 HIS HIS A . n 
A 1 101 LEU 101 261 261 LEU LEU A . n 
A 1 102 HIS 102 262 262 HIS HIS A . n 
A 1 103 VAL 103 263 263 VAL VAL A . n 
A 1 104 ILE 104 264 264 ILE ILE A . n 
A 1 105 SER 105 265 265 SER SER A . n 
A 1 106 GLN 106 266 266 GLN GLN A . n 
A 1 107 ASP 107 267 267 ASP ASP A . n 
A 1 108 PHE 108 268 268 PHE PHE A . n 
A 1 109 ASP 109 269 269 ASP ASP A . n 
A 1 110 SER 110 270 270 SER SER A . n 
A 1 111 PRO 111 271 271 PRO PRO A . n 
A 1 112 CYS 112 272 272 CYS CYS A . n 
A 1 113 LEU 113 273 273 LEU LEU A . n 
A 1 114 LYS 114 274 274 LYS LYS A . n 
A 1 115 ASN 115 275 275 ASN ASN A . n 
A 1 116 LYS 116 276 276 LYS LYS A . n 
A 1 117 LYS 117 277 277 LYS LYS A . n 
A 1 118 HIS 118 278 278 HIS HIS A . n 
A 1 119 TRP 119 279 279 TRP TRP A . n 
A 1 120 ASN 120 280 280 ASN ASN A . n 
A 1 121 SER 121 281 281 SER SER A . n 
A 1 122 PHE 122 282 282 PHE PHE A . n 
A 1 123 ASN 123 283 283 ASN ASN A . n 
A 1 124 THR 124 284 284 THR THR A . n 
A 1 125 GLU 125 285 285 GLU GLU A . n 
A 1 126 TYR 126 286 286 TYR TYR A . n 
A 1 127 PHE 127 287 287 PHE PHE A . n 
A 1 128 LEU 128 288 288 LEU LEU A . n 
A 1 129 GLU 129 289 289 GLU GLU A . n 
A 1 130 SER 130 290 290 SER SER A . n 
A 1 131 GLN 131 291 291 GLN GLN A . n 
A 1 132 ALA 132 292 292 ALA ALA A . n 
A 1 133 VAL 133 293 293 VAL VAL A . n 
A 1 134 ILE 134 294 294 ILE ILE A . n 
A 1 135 GLU 135 295 295 GLU GLU A . n 
A 1 136 MET 136 296 296 MET MET A . n 
A 1 137 VAL 137 297 297 VAL VAL A . n 
A 1 138 GLN 138 298 298 GLN GLN A . n 
A 1 139 GLU 139 299 299 GLU GLU A . n 
A 1 140 ALA 140 300 300 ALA ALA A . n 
A 1 141 GLY 141 301 301 GLY GLY A . n 
A 1 142 ARG 142 302 302 ARG ARG A . n 
A 1 143 VAL 143 303 303 VAL VAL A . n 
A 1 144 THR 144 304 304 THR THR A . n 
A 1 145 VAL 145 305 305 VAL VAL A . n 
A 1 146 ARG 146 306 306 ARG ARG A . n 
A 1 147 ASP 147 307 307 ASP ASP A . n 
A 1 148 GLY 148 308 308 GLY GLY A . n 
A 1 149 MET 149 309 309 MET MET A . n 
A 1 150 PRO 150 310 310 PRO PRO A . n 
A 1 151 GLU 151 311 311 GLU GLU A . n 
A 1 152 LEU 152 312 312 LEU LEU A . n 
A 1 153 LEU 153 313 313 LEU LEU A . n 
A 1 154 LYS 154 314 314 LYS LYS A . n 
A 1 155 LEU 155 315 315 LEU LEU A . n 
A 1 156 PRO 156 316 316 PRO PRO A . n 
A 1 157 LEU 157 317 317 LEU LEU A . n 
A 1 158 ARG 158 318 318 ARG ARG A . n 
A 1 159 CYS 159 319 319 CYS CYS A . n 
A 1 160 HIS 160 320 320 HIS HIS A . n 
A 1 161 GLU 161 321 321 GLU GLU A . n 
A 1 162 CYS 162 322 322 CYS CYS A . n 
A 1 163 GLN 163 323 323 GLN GLN A . n 
A 1 164 GLN 164 324 324 GLN GLN A . n 
A 1 165 LEU 165 325 325 LEU LEU A . n 
A 1 166 LEU 166 326 326 LEU LEU A . n 
A 1 167 PRO 167 327 327 PRO PRO A . n 
A 1 168 SER 168 328 328 SER SER A . n 
A 1 169 ILE 169 329 329 ILE ILE A . n 
A 1 170 PRO 170 330 330 PRO PRO A . n 
A 1 171 GLN 171 331 331 GLN GLN A . n 
A 1 172 LEU 172 332 332 LEU LEU A . n 
A 1 173 LYS 173 333 333 LYS LYS A . n 
A 1 174 GLU 174 334 334 GLU GLU A . n 
A 1 175 HIS 175 335 335 HIS HIS A . n 
A 1 176 LEU 176 336 336 LEU LEU A . n 
A 1 177 ARG 177 337 337 ARG ARG A . n 
A 1 178 LYS 178 338 338 LYS LYS A . n 
A 1 179 HIS 179 339 339 HIS HIS A . n 
A 1 180 TRP 180 340 340 TRP TRP A . n 
A 1 181 THR 181 341 ?   ?   ?   A . n 
A 1 182 GLN 182 342 ?   ?   ?   A . n 
B 1 1   GLY 1   161 ?   ?   ?   B . n 
B 1 2   SER 2   162 ?   ?   ?   B . n 
B 1 3   HIS 3   163 163 HIS HIS B . n 
B 1 4   MET 4   164 164 MET MET B . n 
B 1 5   GLY 5   165 165 GLY GLY B . n 
B 1 6   HIS 6   166 166 HIS HIS B . n 
B 1 7   TRP 7   167 167 TRP TRP B . n 
B 1 8   SER 8   168 168 SER SER B . n 
B 1 9   GLN 9   169 169 GLN GLN B . n 
B 1 10  GLY 10  170 170 GLY GLY B . n 
B 1 11  LEU 11  171 171 LEU LEU B . n 
B 1 12  LYS 12  172 172 LYS LYS B . n 
B 1 13  ILE 13  173 173 ILE ILE B . n 
B 1 14  SER 14  174 174 SER SER B . n 
B 1 15  MET 15  175 175 MET MET B . n 
B 1 16  GLN 16  176 176 GLN GLN B . n 
B 1 17  ASP 17  177 177 ASP ASP B . n 
B 1 18  PRO 18  178 178 PRO PRO B . n 
B 1 19  LYS 19  179 179 LYS LYS B . n 
B 1 20  MET 20  180 180 MET MET B . n 
B 1 21  GLN 21  181 181 GLN GLN B . n 
B 1 22  VAL 22  182 182 VAL VAL B . n 
B 1 23  TYR 23  183 183 TYR TYR B . n 
B 1 24  LYS 24  184 184 LYS LYS B . n 
B 1 25  ASP 25  185 185 ASP ASP B . n 
B 1 26  GLU 26  186 186 GLU GLU B . n 
B 1 27  GLN 27  187 187 GLN GLN B . n 
B 1 28  VAL 28  188 188 VAL VAL B . n 
B 1 29  VAL 29  189 189 VAL VAL B . n 
B 1 30  VAL 30  190 190 VAL VAL B . n 
B 1 31  ILE 31  191 191 ILE ILE B . n 
B 1 32  LYS 32  192 192 LYS LYS B . n 
B 1 33  ASP 33  193 193 ASP ASP B . n 
B 1 34  LYS 34  194 194 LYS LYS B . n 
B 1 35  TYR 35  195 195 TYR TYR B . n 
B 1 36  PRO 36  196 196 PRO PRO B . n 
B 1 37  LYS 37  197 197 LYS LYS B . n 
B 1 38  ALA 38  198 198 ALA ALA B . n 
B 1 39  ARG 39  199 199 ARG ARG B . n 
B 1 40  TYR 40  200 200 TYR TYR B . n 
B 1 41  HIS 41  201 201 HIS HIS B . n 
B 1 42  TRP 42  202 202 TRP TRP B . n 
B 1 43  LEU 43  203 203 LEU LEU B . n 
B 1 44  VAL 44  204 204 VAL VAL B . n 
B 1 45  LEU 45  205 205 LEU LEU B . n 
B 1 46  PRO 46  206 206 PRO PRO B . n 
B 1 47  TRP 47  207 207 TRP TRP B . n 
B 1 48  THR 48  208 208 THR THR B . n 
B 1 49  SER 49  209 209 SER SER B . n 
B 1 50  ILE 50  210 210 ILE ILE B . n 
B 1 51  SER 51  211 211 SER SER B . n 
B 1 52  SER 52  212 212 SER SER B . n 
B 1 53  LEU 53  213 213 LEU LEU B . n 
B 1 54  LYS 54  214 214 LYS LYS B . n 
B 1 55  ALA 55  215 215 ALA ALA B . n 
B 1 56  VAL 56  216 216 VAL VAL B . n 
B 1 57  ALA 57  217 217 ALA ALA B . n 
B 1 58  ARG 58  218 218 ARG ARG B . n 
B 1 59  GLU 59  219 219 GLU GLU B . n 
B 1 60  HIS 60  220 220 HIS HIS B . n 
B 1 61  LEU 61  221 221 LEU LEU B . n 
B 1 62  GLU 62  222 222 GLU GLU B . n 
B 1 63  LEU 63  223 223 LEU LEU B . n 
B 1 64  LEU 64  224 224 LEU LEU B . n 
B 1 65  LYS 65  225 225 LYS LYS B . n 
B 1 66  HIS 66  226 226 HIS HIS B . n 
B 1 67  MET 67  227 227 MET MET B . n 
B 1 68  HIS 68  228 228 HIS HIS B . n 
B 1 69  THR 69  229 229 THR THR B . n 
B 1 70  VAL 70  230 230 VAL VAL B . n 
B 1 71  GLY 71  231 231 GLY GLY B . n 
B 1 72  GLU 72  232 232 GLU GLU B . n 
B 1 73  LYS 73  233 233 LYS LYS B . n 
B 1 74  VAL 74  234 234 VAL VAL B . n 
B 1 75  ILE 75  235 235 ILE ILE B . n 
B 1 76  VAL 76  236 236 VAL VAL B . n 
B 1 77  ASP 77  237 237 ASP ASP B . n 
B 1 78  PHE 78  238 238 PHE PHE B . n 
B 1 79  ALA 79  239 239 ALA ALA B . n 
B 1 80  GLY 80  240 240 GLY GLY B . n 
B 1 81  SER 81  241 241 SER SER B . n 
B 1 82  SER 82  242 242 SER SER B . n 
B 1 83  LYS 83  243 243 LYS LYS B . n 
B 1 84  LEU 84  244 244 LEU LEU B . n 
B 1 85  ARG 85  245 245 ARG ARG B . n 
B 1 86  PHE 86  246 246 PHE PHE B . n 
B 1 87  ARG 87  247 247 ARG ARG B . n 
B 1 88  LEU 88  248 248 LEU LEU B . n 
B 1 89  GLY 89  249 249 GLY GLY B . n 
B 1 90  TYR 90  250 250 TYR TYR B . n 
B 1 91  HIS 91  251 251 HIS HIS B . n 
B 1 92  ALA 92  252 252 ALA ALA B . n 
B 1 93  ILE 93  253 253 ILE ILE B . n 
B 1 94  PRO 94  254 254 PRO PRO B . n 
B 1 95  SER 95  255 255 SER SER B . n 
B 1 96  MET 96  256 256 MET MET B . n 
B 1 97  SER 97  257 257 SER SER B . n 
B 1 98  HIS 98  258 258 HIS HIS B . n 
B 1 99  VAL 99  259 259 VAL VAL B . n 
B 1 100 HIS 100 260 260 HIS HIS B . n 
B 1 101 LEU 101 261 261 LEU LEU B . n 
B 1 102 HIS 102 262 262 HIS HIS B . n 
B 1 103 VAL 103 263 263 VAL VAL B . n 
B 1 104 ILE 104 264 264 ILE ILE B . n 
B 1 105 SER 105 265 265 SER SER B . n 
B 1 106 GLN 106 266 266 GLN GLN B . n 
B 1 107 ASP 107 267 267 ASP ASP B . n 
B 1 108 PHE 108 268 268 PHE PHE B . n 
B 1 109 ASP 109 269 269 ASP ASP B . n 
B 1 110 SER 110 270 270 SER SER B . n 
B 1 111 PRO 111 271 271 PRO PRO B . n 
B 1 112 CYS 112 272 272 CYS CYS B . n 
B 1 113 LEU 113 273 273 LEU LEU B . n 
B 1 114 LYS 114 274 274 LYS LYS B . n 
B 1 115 ASN 115 275 275 ASN ASN B . n 
B 1 116 LYS 116 276 276 LYS LYS B . n 
B 1 117 LYS 117 277 277 LYS LYS B . n 
B 1 118 HIS 118 278 278 HIS HIS B . n 
B 1 119 TRP 119 279 279 TRP TRP B . n 
B 1 120 ASN 120 280 280 ASN ASN B . n 
B 1 121 SER 121 281 281 SER SER B . n 
B 1 122 PHE 122 282 282 PHE PHE B . n 
B 1 123 ASN 123 283 283 ASN ASN B . n 
B 1 124 THR 124 284 284 THR THR B . n 
B 1 125 GLU 125 285 285 GLU GLU B . n 
B 1 126 TYR 126 286 286 TYR TYR B . n 
B 1 127 PHE 127 287 287 PHE PHE B . n 
B 1 128 LEU 128 288 288 LEU LEU B . n 
B 1 129 GLU 129 289 289 GLU GLU B . n 
B 1 130 SER 130 290 290 SER SER B . n 
B 1 131 GLN 131 291 291 GLN GLN B . n 
B 1 132 ALA 132 292 292 ALA ALA B . n 
B 1 133 VAL 133 293 293 VAL VAL B . n 
B 1 134 ILE 134 294 294 ILE ILE B . n 
B 1 135 GLU 135 295 295 GLU GLU B . n 
B 1 136 MET 136 296 296 MET MET B . n 
B 1 137 VAL 137 297 297 VAL VAL B . n 
B 1 138 GLN 138 298 298 GLN GLN B . n 
B 1 139 GLU 139 299 299 GLU GLU B . n 
B 1 140 ALA 140 300 300 ALA ALA B . n 
B 1 141 GLY 141 301 301 GLY GLY B . n 
B 1 142 ARG 142 302 302 ARG ARG B . n 
B 1 143 VAL 143 303 303 VAL VAL B . n 
B 1 144 THR 144 304 304 THR THR B . n 
B 1 145 VAL 145 305 305 VAL VAL B . n 
B 1 146 ARG 146 306 306 ARG ARG B . n 
B 1 147 ASP 147 307 307 ASP ASP B . n 
B 1 148 GLY 148 308 308 GLY GLY B . n 
B 1 149 MET 149 309 309 MET MET B . n 
B 1 150 PRO 150 310 310 PRO PRO B . n 
B 1 151 GLU 151 311 311 GLU GLU B . n 
B 1 152 LEU 152 312 312 LEU LEU B . n 
B 1 153 LEU 153 313 313 LEU LEU B . n 
B 1 154 LYS 154 314 314 LYS LYS B . n 
B 1 155 LEU 155 315 315 LEU LEU B . n 
B 1 156 PRO 156 316 316 PRO PRO B . n 
B 1 157 LEU 157 317 317 LEU LEU B . n 
B 1 158 ARG 158 318 318 ARG ARG B . n 
B 1 159 CYS 159 319 319 CYS CYS B . n 
B 1 160 HIS 160 320 320 HIS HIS B . n 
B 1 161 GLU 161 321 321 GLU GLU B . n 
B 1 162 CYS 162 322 322 CYS CYS B . n 
B 1 163 GLN 163 323 323 GLN GLN B . n 
B 1 164 GLN 164 324 324 GLN GLN B . n 
B 1 165 LEU 165 325 325 LEU LEU B . n 
B 1 166 LEU 166 326 326 LEU LEU B . n 
B 1 167 PRO 167 327 327 PRO PRO B . n 
B 1 168 SER 168 328 328 SER SER B . n 
B 1 169 ILE 169 329 329 ILE ILE B . n 
B 1 170 PRO 170 330 330 PRO PRO B . n 
B 1 171 GLN 171 331 331 GLN GLN B . n 
B 1 172 LEU 172 332 332 LEU LEU B . n 
B 1 173 LYS 173 333 333 LYS LYS B . n 
B 1 174 GLU 174 334 334 GLU GLU B . n 
B 1 175 HIS 175 335 335 HIS HIS B . n 
B 1 176 LEU 176 336 336 LEU LEU B . n 
B 1 177 ARG 177 337 337 ARG ARG B . n 
B 1 178 LYS 178 338 338 LYS LYS B . n 
B 1 179 HIS 179 339 339 HIS HIS B . n 
B 1 180 TRP 180 340 340 TRP TRP B . n 
B 1 181 THR 181 341 ?   ?   ?   B . n 
B 1 182 GLN 182 342 ?   ?   ?   B . n 
C 2 1   DG  1   1   1   DG  DG  D . n 
C 2 2   DT  2   2   2   DT  DT  D . n 
C 2 3   DT  3   3   3   DT  DT  D . n 
C 2 4   DC  4   4   4   DC  DC  D . n 
C 2 5   DT  5   5   5   DT  DT  D . n 
C 2 6   DA  6   6   6   DA  DA  D . n 
C 2 7   DG  7   7   7   DG  DG  D . n 
C 2 8   DA  8   8   8   DA  DA  D . n 
C 2 9   DA  9   9   9   DA  DA  D . n 
C 2 10  DC  10  10  10  DC  DC  D . n 
D 2 1   DG  1   1   1   DG  DG  E . n 
D 2 2   DT  2   2   2   DT  DT  E . n 
D 2 3   DT  3   3   3   DT  DT  E . n 
D 2 4   DC  4   4   4   DC  DC  E . n 
D 2 5   DT  5   5   5   DT  DT  E . n 
D 2 6   DA  6   6   6   DA  DA  E . n 
D 2 7   DG  7   7   7   DG  DG  E . n 
D 2 8   DA  8   8   8   DA  DA  E . n 
D 2 9   DA  9   9   9   DA  DA  E . n 
D 2 10  DC  10  10  10  DC  DC  E . n 
E 2 1   DG  1   1   1   DG  DG  G . n 
E 2 2   DT  2   2   2   DT  DT  G . n 
E 2 3   DT  3   3   3   DT  DT  G . n 
E 2 4   DC  4   4   4   DC  DC  G . n 
E 2 5   DT  5   5   5   DT  DT  G . n 
E 2 6   DA  6   6   6   DA  DA  G . n 
E 2 7   DG  7   7   7   DG  DG  G . n 
E 2 8   DA  8   8   8   DA  DA  G . n 
E 2 9   DA  9   9   9   DA  DA  G . n 
E 2 10  DC  10  10  10  DC  DC  G . n 
F 2 1   DG  1   1   1   DG  DG  H . n 
F 2 2   DT  2   2   2   DT  DT  H . n 
F 2 3   DT  3   3   3   DT  DT  H . n 
F 2 4   DC  4   4   4   DC  DC  H . n 
F 2 5   DT  5   5   5   DT  DT  H . n 
F 2 6   DA  6   6   6   DA  DA  H . n 
F 2 7   DG  7   7   7   DG  DG  H . n 
F 2 8   DA  8   8   8   DA  DA  H . n 
F 2 9   DA  9   9   9   DA  DA  H . n 
F 2 10  DC  10  10  10  DC  DC  H . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA trimeric 3 
2 author_and_software_defined_assembly PISA trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,G,H,K,M,N 
2 1 B,E,F,I,J,L,O,P 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2530  ? 
1 MORE         -25   ? 
1 'SSA (A^2)'  13090 ? 
2 'ABSA (A^2)' 2640  ? 
2 MORE         -20   ? 
2 'SSA (A^2)'  13060 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? B HIS 179 ? B HIS 339 ? 1_555 ZN ? J ZN . ? B ZN 402 ? 1_555 NE2 ? B HIS 175 ? B HIS 335 ? 1_555 99.6  ? 
2  NE2 ? B HIS 179 ? B HIS 339 ? 1_555 ZN ? J ZN . ? B ZN 402 ? 1_555 SG  ? B CYS 162 ? B CYS 322 ? 1_555 120.5 ? 
3  NE2 ? B HIS 175 ? B HIS 335 ? 1_555 ZN ? J ZN . ? B ZN 402 ? 1_555 SG  ? B CYS 162 ? B CYS 322 ? 1_555 104.3 ? 
4  NE2 ? B HIS 179 ? B HIS 339 ? 1_555 ZN ? J ZN . ? B ZN 402 ? 1_555 SG  ? B CYS 159 ? B CYS 319 ? 1_555 103.3 ? 
5  NE2 ? B HIS 175 ? B HIS 335 ? 1_555 ZN ? J ZN . ? B ZN 402 ? 1_555 SG  ? B CYS 159 ? B CYS 319 ? 1_555 105.8 ? 
6  SG  ? B CYS 162 ? B CYS 322 ? 1_555 ZN ? J ZN . ? B ZN 402 ? 1_555 SG  ? B CYS 159 ? B CYS 319 ? 1_555 120.5 ? 
7  NE2 ? A HIS 179 ? A HIS 339 ? 1_555 ZN ? H ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 175 ? A HIS 335 ? 1_555 107.9 ? 
8  NE2 ? A HIS 179 ? A HIS 339 ? 1_555 ZN ? H ZN . ? A ZN 402 ? 1_555 SG  ? A CYS 162 ? A CYS 322 ? 1_555 114.2 ? 
9  NE2 ? A HIS 175 ? A HIS 335 ? 1_555 ZN ? H ZN . ? A ZN 402 ? 1_555 SG  ? A CYS 162 ? A CYS 322 ? 1_555 102.8 ? 
10 NE2 ? A HIS 179 ? A HIS 339 ? 1_555 ZN ? H ZN . ? A ZN 402 ? 1_555 SG  ? A CYS 159 ? A CYS 319 ? 1_555 106.0 ? 
11 NE2 ? A HIS 175 ? A HIS 335 ? 1_555 ZN ? H ZN . ? A ZN 402 ? 1_555 SG  ? A CYS 159 ? A CYS 319 ? 1_555 107.8 ? 
12 SG  ? A CYS 162 ? A CYS 322 ? 1_555 ZN ? H ZN . ? A ZN 402 ? 1_555 SG  ? A CYS 159 ? A CYS 319 ? 1_555 117.6 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-12-18 
2 'Structure model' 1 1 2014-01-15 
3 'Structure model' 1 2 2014-02-05 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1  ? refined 14.4194 22.8319 -9.6916  0.1280 0.1552 0.1772 -0.0032 -0.0123 -0.0520 1.2187  2.6808 1.6688 
-1.4128 0.0777  0.6254  -0.0003 0.1332  -0.1010 -0.0603 0.2428  -0.5374 0.2484  -0.0817 0.1108  
'X-RAY DIFFRACTION' 2  ? refined 3.4194  30.5411 -12.9497 0.0699 0.0893 0.1423 0.0118  -0.0046 -0.0036 1.2595  1.7203 2.3958 
0.4688  -0.1444 0.2951  -0.0087 -0.0090 0.0141  0.0472  0.1044  -0.0835 -0.0593 -0.2050 0.1284  
'X-RAY DIFFRACTION' 3  ? refined -6.7792 33.2567 -11.1627 0.1435 0.1067 0.1803 0.0334  0.0072  -0.0167 2.1875  3.9248 6.5888 
1.8731  -2.2835 -4.1927 0.1052  -0.1218 -0.2340 0.1991  0.2360  0.0531  0.1392  -0.5795 0.1466  
'X-RAY DIFFRACTION' 4  ? refined -7.6062 26.9094 -20.9513 0.0911 0.1355 0.1743 -0.0074 -0.0391 0.0328  2.5322  2.9647 4.8394 
-1.6210 1.1263  -2.1517 0.1093  0.0786  0.0860  0.3461  0.1304  0.5695  -0.0670 -0.1400 -0.3131 
'X-RAY DIFFRACTION' 5  ? refined 1.2596  22.4192 -20.5166 0.1027 0.0912 0.1492 -0.0245 0.0017  -0.0132 1.8946  1.5687 2.7989 
-0.6014 0.3459  0.8804  -0.0558 0.0410  0.0103  0.1223  0.0102  -0.0076 -0.1591 -0.1085 0.0031  
'X-RAY DIFFRACTION' 6  ? refined -7.8559 18.1005 -15.5276 0.1357 0.1090 0.1713 -0.0024 -0.0090 -0.0125 3.8183  0.7981 7.1428 
-1.3110 -4.5695 2.4464  -0.0757 -0.1642 0.2708  0.1677  -0.1427 0.2354  -0.0691 0.0414  -0.3280 
'X-RAY DIFFRACTION' 7  ? refined -5.5046 9.1295  -13.1882 0.3814 0.1880 0.3214 -0.0479 0.0303  -0.0468 0.8263  1.6875 4.0120 
-0.6613 -1.6770 2.1247  -0.3055 0.0723  0.0453  0.0032  -0.1477 0.2785  0.6388  1.5829  -0.0627 
'X-RAY DIFFRACTION' 8  ? refined -8.8313 13.3120 -32.8104 0.3066 0.3322 0.3118 -0.0732 -0.0481 -0.0746 4.0566  3.9439 4.3293 
-2.8596 1.8308  -0.8877 0.0101  -0.0639 0.0737  0.1524  -0.0974 0.7211  -0.3213 0.0666  -0.5362 
'X-RAY DIFFRACTION' 9  ? refined -3.8817 20.5930 -37.7506 0.3963 0.3095 0.2802 -0.0357 -0.0054 -0.0032 5.3605  7.9643 4.2889 
-5.0759 -0.9374 0.7507  0.2454  -0.2069 0.0014  0.8117  0.6414  0.1599  -0.7842 -0.9064 -0.1223 
'X-RAY DIFFRACTION' 10 ? refined 9.5969  58.8978 -35.4898 0.2578 0.2103 0.2239 0.0124  0.0469  0.0304  5.0219  5.8769 5.1357 
2.2340  -1.5604 -0.3958 -0.0872 -0.1036 0.2049  -0.4344 0.2422  0.1866  0.2127  0.0994  0.2948  
'X-RAY DIFFRACTION' 11 ? refined 3.9992  46.9258 -39.0880 0.1027 0.1218 0.1603 -0.0166 0.0106  0.0260  2.2198  3.1207 3.3137 
0.2990  -0.7826 -0.9391 0.0498  0.1135  -0.0855 -0.1959 0.1175  0.1988  0.1777  -0.1106 -0.2181 
'X-RAY DIFFRACTION' 12 ? refined 3.8380  36.3280 -35.1315 0.1687 0.1598 0.2275 -0.0243 0.0099  0.0608  6.6706  3.0315 4.5334 
-1.2442 4.0477  -1.8613 0.0466  0.0591  -0.1441 -0.1898 -0.3610 0.1651  0.1073  0.3051  -0.1441 
'X-RAY DIFFRACTION' 13 ? refined 3.3960  36.6327 -50.2274 0.2146 0.1274 0.2625 -0.0432 -0.0055 -0.0051 4.8954  2.8977 6.7790 
1.2652  2.2022  1.7604  0.1411  -0.2028 0.1580  -0.1317 -0.3748 0.2614  -0.0174 0.8540  -0.4908 
'X-RAY DIFFRACTION' 14 ? refined 13.7227 45.3902 -48.9398 0.1530 0.1253 0.1689 0.0051  0.0023  0.0089  2.5823  2.5260 6.2823 
0.3204  -0.9309 -1.2982 -0.0562 -0.0564 0.0773  -0.0462 0.0086  -0.1318 -0.1120 0.0138  0.2920  
'X-RAY DIFFRACTION' 15 ? refined 14.9565 31.8171 -37.1942 0.2609 0.2168 0.3272 0.0584  0.0287  0.0860  2.6986  6.8241 5.3984 
-1.4136 2.4781  -4.1692 -0.1863 0.0189  -0.1601 -0.1716 -0.7606 -0.1539 -0.3335 0.9216  -0.0260 
'X-RAY DIFFRACTION' 16 ? refined 25.4379 40.1349 -42.0002 0.2000 0.4665 0.3781 0.0823  0.0503  0.1126  0.1119  1.9907 1.9539 
-0.0649 0.2722  -1.7655 -0.2871 -0.4912 0.7034  -0.1283 -0.6357 -0.8321 -0.3400 0.4088  1.2118  
'X-RAY DIFFRACTION' 17 ? refined 15.1381 40.4671 -63.2520 0.4760 0.3310 0.2654 0.0012  0.0626  -0.0651 5.1230  6.0873 5.6341 
0.9489  -0.1451 -0.1484 -0.1987 0.1061  0.0804  0.6251  -0.7307 0.0721  -0.6860 0.7580  0.1217  
'X-RAY DIFFRACTION' 18 ? refined 12.9311 10.0084 -29.9759 0.2057 0.2561 0.1387 0.0130  -0.0383 -0.0585 1.3602  2.9203 3.4514 
0.0022  0.3551  2.3488  0.1089  0.3037  -0.2551 0.2875  -0.0167 -0.3254 -0.2875 0.2418  0.3416  
'X-RAY DIFFRACTION' 19 ? refined 12.6322 7.1891  -31.1701 0.2501 0.3479 0.1203 -0.0438 -0.0152 -0.0847 1.7245  0.4827 1.8040 
-0.1120 1.7354  0.1663  0.0034  0.1163  0.0143  0.1130  -0.3687 -0.0746 -0.2704 0.1473  -0.2309 
'X-RAY DIFFRACTION' 20 ? refined 22.9957 60.4074 -57.2405 0.2887 0.2990 0.2194 -0.0312 0.1085  -0.0533 2.3384  0.6468 2.5916 
-0.1417 -1.0771 -0.2344 0.2745  0.2451  -0.0440 0.4288  0.2140  -0.3179 -0.4292 0.0045  0.3934  
'X-RAY DIFFRACTION' 21 ? refined 23.7324 60.5291 -56.9714 0.3237 0.4191 0.1880 -0.0459 0.0451  -0.0406 -0.0537 2.2602 3.9054 
-0.4771 -0.3649 2.3637  0.0096  0.3886  -0.0844 0.2881  -0.0382 -0.4032 -0.2256 0.1951  0.7104  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1  1  A 0 A 0 
;chain 'A' and (resid 161 through 176 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 2  2  A 0 A 0 
;chain 'A' and (resid 177 through 217 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 3  3  A 0 A 0 
;chain 'A' and (resid 218 through 242 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 4  4  A 0 A 0 
;chain 'A' and (resid 243 through 251 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 5  5  A 0 A 0 
;chain 'A' and (resid 252 through 275 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 6  6  A 0 A 0 
;chain 'A' and (resid 276 through 300 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 7  7  A 0 A 0 
;chain 'A' and (resid 301 through 314 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 8  8  A 0 A 0 
;chain 'A' and (resid 315 through 328 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 9  9  A 0 A 0 
;chain 'A' and (resid 329 through 340 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 10 10 B 0 B 0 
;chain 'B' and (resid 163 through 176 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 11 11 B 0 B 0 
;chain 'B' and (resid 177 through 217 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 12 12 B 0 B 0 
;chain 'B' and (resid 218 through 238 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 13 13 B 0 B 0 
;chain 'B' and (resid 239 through 251 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 14 14 B 0 B 0 
;chain 'B' and (resid 252 through 286 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 15 15 B 0 B 0 
;chain 'B' and (resid 287 through 300 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 16 16 B 0 B 0 
;chain 'B' and (resid 301 through 314 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 17 17 B 0 B 0 
;chain 'B' and (resid 315 through 340 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 18 18 D 0 D 0 
;chain 'D' and (resid 1 through 10 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 19 19 E 0 E 0 
;chain 'E' and (resid 1 through 10 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 20 20 G 0 G 0 
;chain 'G' and (resid 1 through 10 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 21 21 H 0 H 0 
;chain 'H' and (resid 1 through 10 )
;
? ? ? ? ? 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .          ?                program 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data reduction'  
http://www.hkl-xray.com/                  ?   ? 
2 SCALEPACK   .          ?                program 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data scaling'    
http://www.hkl-xray.com/                  ?   ? 
3 PHENIX      1.8.2_1309 ?                package 'Paul D. Adams'      PDAdams@lbl.gov          refinement        
http://www.phenix-online.org/             C++ ? 
4 PDB_EXTRACT 3.11       'April 22, 2011' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 
5 SERGUI      .          ?                ?       ?                    ?                        'data collection' ? ?   ? 
6 PHASER      .          ?                ?       ?                    ?                        phasing           ? ?   ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 239 ? ? -141.29 16.42  
2 1 HIS A 258 ? ? 83.60   114.34 
3 1 ALA B 239 ? ? -141.81 40.45  
4 1 LYS B 243 ? B 78.44   -9.45  
5 1 MET B 256 ? ? -116.26 -87.86 
6 1 HIS B 258 ? ? 71.59   157.41 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 341 ? A THR 181 
2 1 Y 1 A GLN 342 ? A GLN 182 
3 1 Y 1 B GLY 161 ? B GLY 1   
4 1 Y 1 B SER 162 ? B SER 2   
5 1 Y 1 B THR 341 ? B THR 181 
6 1 Y 1 B GLN 342 ? B GLN 182 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4NDH 'double helix'        
4NDH 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DT 2  1_555 D DA 9 1_555 -0.268 -0.061 0.153  -13.555 -6.299  -2.335 1  D_DT2:DA9_E  D 2  ? E 9 ? 20 1 
1 C DT 3  1_555 D DA 8 1_555 -0.108 -0.150 -0.070 -4.349  -12.021 0.935  2  D_DT3:DA8_E  D 3  ? E 8 ? 20 1 
1 C DC 4  1_555 D DG 7 1_555 0.099  -0.313 0.138  -6.810  -4.906  0.701  3  D_DC4:DG7_E  D 4  ? E 7 ? 19 1 
1 C DT 5  1_555 D DA 6 1_555 -0.162 -0.274 -0.055 1.894   -0.005  2.270  4  D_DT5:DA6_E  D 5  ? E 6 ? 20 1 
1 C DA 6  1_555 D DT 5 1_555 0.161  -0.078 0.290  13.776  -14.803 2.387  5  D_DA6:DT5_E  D 6  ? E 5 ? 20 1 
1 C DG 7  1_555 D DC 4 1_555 -0.181 -0.068 0.376  19.522  -9.173  2.561  6  D_DG7:DC4_E  D 7  ? E 4 ? 19 1 
1 C DA 8  1_555 D DT 3 1_555 0.106  -0.265 0.227  3.923   -23.313 1.206  7  D_DA8:DT3_E  D 8  ? E 3 ? 20 1 
1 C DA 9  1_555 D DT 2 1_555 0.260  -0.126 0.187  0.884   -13.337 1.594  8  D_DA9:DT2_E  D 9  ? E 2 ? 20 1 
1 C DC 10 1_555 D DG 1 1_555 0.220  -0.094 0.035  -2.735  -4.928  1.863  9  D_DC10:DG1_E D 10 ? E 1 ? 19 1 
1 E DT 2  1_555 F DA 9 1_555 -0.090 -0.144 0.327  -14.718 -12.014 -1.268 10 G_DT2:DA9_H  G 2  ? H 9 ? 20 1 
1 E DT 3  1_555 F DA 8 1_555 -0.044 -0.220 -0.139 0.514   -12.191 -0.171 11 G_DT3:DA8_H  G 3  ? H 8 ? 20 1 
1 E DC 4  1_555 F DG 7 1_555 0.322  -0.175 -0.032 -0.062  -10.793 0.682  12 G_DC4:DG7_H  G 4  ? H 7 ? 19 1 
1 E DT 5  1_555 F DA 6 1_555 0.095  -0.242 0.121  -2.519  -10.801 3.505  13 G_DT5:DA6_H  G 5  ? H 6 ? 20 1 
1 E DA 6  1_555 F DT 5 1_555 0.272  0.015  0.272  9.662   -9.860  6.237  14 G_DA6:DT5_H  G 6  ? H 5 ? 20 1 
1 E DG 7  1_555 F DC 4 1_555 -0.098 -0.201 0.351  13.084  -8.067  -1.382 15 G_DG7:DC4_H  G 7  ? H 4 ? 19 1 
1 E DA 8  1_555 F DT 3 1_555 0.041  -0.127 -0.061 -0.750  -13.914 2.186  16 G_DA8:DT3_H  G 8  ? H 3 ? 20 1 
1 E DA 9  1_555 F DT 2 1_555 0.212  -0.081 0.233  2.560   -9.770  -0.729 17 G_DA9:DT2_H  G 9  ? H 2 ? 20 1 
1 E DC 10 1_555 F DG 1 1_555 0.446  -0.057 -0.306 8.691   -3.752  4.717  18 G_DC10:DG1_H G 10 ? H 1 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DT 2 1_555 D DA 9 1_555 C DT 3  1_555 D DA 8 1_555 -0.418 -0.355 3.075 2.317  -0.054 34.408 -0.590 1.042  3.042 -0.091 -3.911 
34.484 1  DD_DT2DT3:DA8DA9_EE  D 2 ? E 9 ? D 3  ? E 8 ? 
1 C DT 3 1_555 D DA 8 1_555 C DC 4  1_555 D DG 7 1_555 1.042  0.431  3.416 0.937  3.470  38.058 0.197  -1.466 3.465 5.307  -1.434 
38.221 2  DD_DT3DC4:DG7DA8_EE  D 3 ? E 8 ? D 4  ? E 7 ? 
1 C DC 4 1_555 D DG 7 1_555 C DT 5  1_555 D DA 6 1_555 0.987  0.451  3.143 4.919  7.945  29.146 -0.727 -0.893 3.269 15.300 -9.473 
30.576 3  DD_DC4DT5:DA6DG7_EE  D 4 ? E 7 ? D 5  ? E 6 ? 
1 C DT 5 1_555 D DA 6 1_555 C DA 6  1_555 D DT 5 1_555 -0.739 1.495  3.112 -1.858 -1.561 42.205 2.224  0.844  3.086 -2.166 2.578  
42.272 4  DD_DT5DA6:DT5DA6_EE  D 5 ? E 6 ? D 6  ? E 5 ? 
1 C DA 6 1_555 D DT 5 1_555 C DG 7  1_555 D DC 4 1_555 0.657  0.282  3.229 -0.433 0.765  28.237 0.401  -1.445 3.225 1.568  0.887  
28.250 5  DD_DA6DG7:DC4DT5_EE  D 6 ? E 5 ? D 7  ? E 4 ? 
1 C DG 7 1_555 D DC 4 1_555 C DA 8  1_555 D DT 3 1_555 -0.711 0.139  3.544 -1.707 -2.042 43.218 0.405  0.782  3.559 -2.770 2.314  
43.296 6  DD_DG7DA8:DT3DC4_EE  D 7 ? E 4 ? D 8  ? E 3 ? 
1 C DA 8 1_555 D DT 3 1_555 C DA 9  1_555 D DT 2 1_555 0.156  -0.105 3.251 0.059  -4.678 40.127 0.371  -0.220 3.243 -6.789 -0.085 
40.388 7  DD_DA8DA9:DT2DT3_EE  D 8 ? E 3 ? D 9  ? E 2 ? 
1 C DA 9 1_555 D DT 2 1_555 C DC 10 1_555 D DG 1 1_555 0.454  -0.551 3.377 0.645  -3.916 32.272 -0.269 -0.693 3.426 -7.012 -1.155 
32.509 8  DD_DA9DC10:DG1DT2_EE D 9 ? E 2 ? D 10 ? E 1 ? 
1 E DT 2 1_555 F DA 9 1_555 E DT 3  1_555 F DA 8 1_555 -0.457 -0.518 2.983 1.908  4.633  31.009 -1.738 1.165  2.845 8.596  -3.539 
31.401 9  GG_DT2DT3:DA8DA9_HH  G 2 ? H 9 ? G 3  ? H 8 ? 
1 E DT 3 1_555 F DA 8 1_555 E DC 4  1_555 F DG 7 1_555 -0.175 -0.610 3.321 -0.541 7.260  31.947 -2.329 0.217  3.113 12.981 0.967  
32.745 10 GG_DT3DC4:DG7DA8_HH  G 3 ? H 8 ? G 4  ? H 7 ? 
1 E DC 4 1_555 F DG 7 1_555 E DT 5  1_555 F DA 6 1_555 0.184  -0.257 3.372 1.508  6.400  33.085 -1.510 -0.067 3.271 11.102 -2.617 
33.714 11 GG_DC4DT5:DA6DG7_HH  G 4 ? H 7 ? G 5  ? H 6 ? 
1 E DT 5 1_555 F DA 6 1_555 E DA 6  1_555 F DT 5 1_555 0.137  0.773  3.054 0.883  4.416  35.870 0.654  -0.103 3.127 7.135  -1.426 
36.142 12 GG_DT5DA6:DT5DA6_HH  G 5 ? H 6 ? G 6  ? H 5 ? 
1 E DA 6 1_555 F DT 5 1_555 E DG 7  1_555 F DC 4 1_555 0.251  -0.122 3.282 -0.764 -0.163 29.177 -0.207 -0.665 3.276 -0.323 1.516  
29.187 13 GG_DA6DG7:DC4DT5_HH  G 6 ? H 5 ? G 7  ? H 4 ? 
1 E DG 7 1_555 F DC 4 1_555 E DA 8  1_555 F DT 3 1_555 -0.167 -0.426 3.556 2.274  -1.085 42.193 -0.470 0.485  3.552 -1.505 -3.155 
42.265 14 GG_DG7DA8:DT3DC4_HH  G 7 ? H 4 ? G 8  ? H 3 ? 
1 E DA 8 1_555 F DT 3 1_555 E DA 9  1_555 F DT 2 1_555 -0.029 -0.304 3.105 -2.288 -2.443 33.957 -0.149 -0.296 3.114 -4.171 3.906  
34.116 15 GG_DA8DA9:DT2DT3_HH  G 8 ? H 3 ? G 9  ? H 2 ? 
1 E DA 9 1_555 F DT 2 1_555 E DC 10 1_555 F DG 1 1_555 0.870  -0.388 3.138 4.910  -0.288 30.700 -0.669 -0.700 3.238 -0.540 -9.200 
31.082 16 GG_DA9DC10:DG1DT2_HH G 9 ? H 2 ? G 10 ? H 1 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'ADENOSINE MONOPHOSPHATE' AMP 
4 'ZINC ION'                ZN  
5 water                     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 3 AMP 1   401 1   AMP AMP A . 
H 4 ZN  1   402 1   ZN  ZN  A . 
I 3 AMP 1   401 1   AMP AMP B . 
J 4 ZN  1   402 1   ZN  ZN  B . 
K 5 HOH 1   501 1   HOH HOH A . 
K 5 HOH 2   502 3   HOH HOH A . 
K 5 HOH 3   503 4   HOH HOH A . 
K 5 HOH 4   504 7   HOH HOH A . 
K 5 HOH 5   505 10  HOH HOH A . 
K 5 HOH 6   506 13  HOH HOH A . 
K 5 HOH 7   507 14  HOH HOH A . 
K 5 HOH 8   508 16  HOH HOH A . 
K 5 HOH 9   509 18  HOH HOH A . 
K 5 HOH 10  510 19  HOH HOH A . 
K 5 HOH 11  511 21  HOH HOH A . 
K 5 HOH 12  512 22  HOH HOH A . 
K 5 HOH 13  513 23  HOH HOH A . 
K 5 HOH 14  514 27  HOH HOH A . 
K 5 HOH 15  515 30  HOH HOH A . 
K 5 HOH 16  516 31  HOH HOH A . 
K 5 HOH 17  517 32  HOH HOH A . 
K 5 HOH 18  518 33  HOH HOH A . 
K 5 HOH 19  519 36  HOH HOH A . 
K 5 HOH 20  520 39  HOH HOH A . 
K 5 HOH 21  521 41  HOH HOH A . 
K 5 HOH 22  522 45  HOH HOH A . 
K 5 HOH 23  523 48  HOH HOH A . 
K 5 HOH 24  524 50  HOH HOH A . 
K 5 HOH 25  525 53  HOH HOH A . 
K 5 HOH 26  526 57  HOH HOH A . 
K 5 HOH 27  527 60  HOH HOH A . 
K 5 HOH 28  528 63  HOH HOH A . 
K 5 HOH 29  529 65  HOH HOH A . 
K 5 HOH 30  530 66  HOH HOH A . 
K 5 HOH 31  531 67  HOH HOH A . 
K 5 HOH 32  532 68  HOH HOH A . 
K 5 HOH 33  533 76  HOH HOH A . 
K 5 HOH 34  534 77  HOH HOH A . 
K 5 HOH 35  535 79  HOH HOH A . 
K 5 HOH 36  536 87  HOH HOH A . 
K 5 HOH 37  537 89  HOH HOH A . 
K 5 HOH 38  538 93  HOH HOH A . 
K 5 HOH 39  539 94  HOH HOH A . 
K 5 HOH 40  540 100 HOH HOH A . 
K 5 HOH 41  541 105 HOH HOH A . 
K 5 HOH 42  542 106 HOH HOH A . 
K 5 HOH 43  543 110 HOH HOH A . 
K 5 HOH 44  544 112 HOH HOH A . 
K 5 HOH 45  545 116 HOH HOH A . 
K 5 HOH 46  546 117 HOH HOH A . 
K 5 HOH 47  547 120 HOH HOH A . 
K 5 HOH 48  548 121 HOH HOH A . 
K 5 HOH 49  549 125 HOH HOH A . 
K 5 HOH 50  550 126 HOH HOH A . 
K 5 HOH 51  551 128 HOH HOH A . 
K 5 HOH 52  552 133 HOH HOH A . 
K 5 HOH 53  553 135 HOH HOH A . 
K 5 HOH 54  554 136 HOH HOH A . 
K 5 HOH 55  555 137 HOH HOH A . 
K 5 HOH 56  556 138 HOH HOH A . 
K 5 HOH 57  557 140 HOH HOH A . 
K 5 HOH 58  558 141 HOH HOH A . 
K 5 HOH 59  559 142 HOH HOH A . 
K 5 HOH 60  560 145 HOH HOH A . 
K 5 HOH 61  561 147 HOH HOH A . 
K 5 HOH 62  562 148 HOH HOH A . 
K 5 HOH 63  563 150 HOH HOH A . 
K 5 HOH 64  564 152 HOH HOH A . 
K 5 HOH 65  565 153 HOH HOH A . 
K 5 HOH 66  566 154 HOH HOH A . 
K 5 HOH 67  567 155 HOH HOH A . 
K 5 HOH 68  568 156 HOH HOH A . 
K 5 HOH 69  569 157 HOH HOH A . 
K 5 HOH 70  570 158 HOH HOH A . 
K 5 HOH 71  571 160 HOH HOH A . 
K 5 HOH 72  572 161 HOH HOH A . 
K 5 HOH 73  573 162 HOH HOH A . 
K 5 HOH 74  574 163 HOH HOH A . 
K 5 HOH 75  575 164 HOH HOH A . 
K 5 HOH 76  576 165 HOH HOH A . 
K 5 HOH 77  577 166 HOH HOH A . 
K 5 HOH 78  578 167 HOH HOH A . 
K 5 HOH 79  579 168 HOH HOH A . 
K 5 HOH 80  580 169 HOH HOH A . 
K 5 HOH 81  581 170 HOH HOH A . 
K 5 HOH 82  582 171 HOH HOH A . 
K 5 HOH 83  583 172 HOH HOH A . 
K 5 HOH 84  584 173 HOH HOH A . 
K 5 HOH 85  585 174 HOH HOH A . 
K 5 HOH 86  586 175 HOH HOH A . 
K 5 HOH 87  587 176 HOH HOH A . 
K 5 HOH 88  588 179 HOH HOH A . 
K 5 HOH 89  589 181 HOH HOH A . 
K 5 HOH 90  590 182 HOH HOH A . 
K 5 HOH 91  591 183 HOH HOH A . 
K 5 HOH 92  592 184 HOH HOH A . 
K 5 HOH 93  593 185 HOH HOH A . 
K 5 HOH 94  594 186 HOH HOH A . 
K 5 HOH 95  595 187 HOH HOH A . 
K 5 HOH 96  596 190 HOH HOH A . 
K 5 HOH 97  597 191 HOH HOH A . 
K 5 HOH 98  598 192 HOH HOH A . 
K 5 HOH 99  599 195 HOH HOH A . 
K 5 HOH 100 600 198 HOH HOH A . 
K 5 HOH 101 601 200 HOH HOH A . 
K 5 HOH 102 602 201 HOH HOH A . 
K 5 HOH 103 603 207 HOH HOH A . 
K 5 HOH 104 604 210 HOH HOH A . 
K 5 HOH 105 605 211 HOH HOH A . 
K 5 HOH 106 606 218 HOH HOH A . 
K 5 HOH 107 607 219 HOH HOH A . 
K 5 HOH 108 608 220 HOH HOH A . 
K 5 HOH 109 609 224 HOH HOH A . 
K 5 HOH 110 610 228 HOH HOH A . 
K 5 HOH 111 611 230 HOH HOH A . 
K 5 HOH 112 612 233 HOH HOH A . 
K 5 HOH 113 613 234 HOH HOH A . 
K 5 HOH 114 614 235 HOH HOH A . 
K 5 HOH 115 615 238 HOH HOH A . 
K 5 HOH 116 616 240 HOH HOH A . 
K 5 HOH 117 617 244 HOH HOH A . 
K 5 HOH 118 618 250 HOH HOH A . 
K 5 HOH 119 619 251 HOH HOH A . 
K 5 HOH 120 620 252 HOH HOH A . 
K 5 HOH 121 621 254 HOH HOH A . 
K 5 HOH 122 622 261 HOH HOH A . 
K 5 HOH 123 623 263 HOH HOH A . 
K 5 HOH 124 624 264 HOH HOH A . 
K 5 HOH 125 625 266 HOH HOH A . 
K 5 HOH 126 626 268 HOH HOH A . 
K 5 HOH 127 627 271 HOH HOH A . 
K 5 HOH 128 628 278 HOH HOH A . 
K 5 HOH 129 629 279 HOH HOH A . 
K 5 HOH 130 630 280 HOH HOH A . 
K 5 HOH 131 631 283 HOH HOH A . 
K 5 HOH 132 632 284 HOH HOH A . 
K 5 HOH 133 633 304 HOH HOH A . 
K 5 HOH 134 634 310 HOH HOH A . 
K 5 HOH 135 635 311 HOH HOH A . 
K 5 HOH 136 636 317 HOH HOH A . 
K 5 HOH 137 637 318 HOH HOH A . 
K 5 HOH 138 638 322 HOH HOH A . 
K 5 HOH 139 639 324 HOH HOH A . 
K 5 HOH 140 640 328 HOH HOH A . 
K 5 HOH 141 641 329 HOH HOH A . 
K 5 HOH 142 642 330 HOH HOH A . 
K 5 HOH 143 643 331 HOH HOH A . 
K 5 HOH 144 644 336 HOH HOH A . 
K 5 HOH 145 645 337 HOH HOH A . 
K 5 HOH 146 646 340 HOH HOH A . 
K 5 HOH 147 647 342 HOH HOH A . 
K 5 HOH 148 648 349 HOH HOH A . 
K 5 HOH 149 649 351 HOH HOH A . 
K 5 HOH 150 650 352 HOH HOH A . 
K 5 HOH 151 651 353 HOH HOH A . 
K 5 HOH 152 652 354 HOH HOH A . 
K 5 HOH 153 653 356 HOH HOH A . 
K 5 HOH 154 654 357 HOH HOH A . 
K 5 HOH 155 655 359 HOH HOH A . 
K 5 HOH 156 656 360 HOH HOH A . 
K 5 HOH 157 657 362 HOH HOH A . 
K 5 HOH 158 658 367 HOH HOH A . 
K 5 HOH 159 659 368 HOH HOH A . 
K 5 HOH 160 660 369 HOH HOH A . 
K 5 HOH 161 661 371 HOH HOH A . 
K 5 HOH 162 662 372 HOH HOH A . 
K 5 HOH 163 663 373 HOH HOH A . 
K 5 HOH 164 664 375 HOH HOH A . 
K 5 HOH 165 665 377 HOH HOH A . 
K 5 HOH 166 666 378 HOH HOH A . 
K 5 HOH 167 667 380 HOH HOH A . 
K 5 HOH 168 668 381 HOH HOH A . 
K 5 HOH 169 669 385 HOH HOH A . 
K 5 HOH 170 670 388 HOH HOH A . 
K 5 HOH 171 671 389 HOH HOH A . 
K 5 HOH 172 672 390 HOH HOH A . 
K 5 HOH 173 673 391 HOH HOH A . 
K 5 HOH 174 674 392 HOH HOH A . 
K 5 HOH 175 675 393 HOH HOH A . 
K 5 HOH 176 676 395 HOH HOH A . 
K 5 HOH 177 677 396 HOH HOH A . 
K 5 HOH 178 678 397 HOH HOH A . 
K 5 HOH 179 679 398 HOH HOH A . 
K 5 HOH 180 680 405 HOH HOH A . 
K 5 HOH 181 681 406 HOH HOH A . 
K 5 HOH 182 682 414 HOH HOH A . 
K 5 HOH 183 683 417 HOH HOH A . 
K 5 HOH 184 684 423 HOH HOH A . 
K 5 HOH 185 685 426 HOH HOH A . 
K 5 HOH 186 686 431 HOH HOH A . 
K 5 HOH 187 687 432 HOH HOH A . 
K 5 HOH 188 688 433 HOH HOH A . 
K 5 HOH 189 689 434 HOH HOH A . 
K 5 HOH 190 690 435 HOH HOH A . 
K 5 HOH 191 691 446 HOH HOH A . 
K 5 HOH 192 692 450 HOH HOH A . 
K 5 HOH 193 693 451 HOH HOH A . 
K 5 HOH 194 694 453 HOH HOH A . 
K 5 HOH 195 695 455 HOH HOH A . 
K 5 HOH 196 696 457 HOH HOH A . 
K 5 HOH 197 697 459 HOH HOH A . 
K 5 HOH 198 698 469 HOH HOH A . 
K 5 HOH 199 699 470 HOH HOH A . 
K 5 HOH 200 700 479 HOH HOH A . 
K 5 HOH 201 701 481 HOH HOH A . 
K 5 HOH 202 702 482 HOH HOH A . 
K 5 HOH 203 703 489 HOH HOH A . 
K 5 HOH 204 704 490 HOH HOH A . 
K 5 HOH 205 705 499 HOH HOH A . 
K 5 HOH 206 706 500 HOH HOH A . 
K 5 HOH 207 707 502 HOH HOH A . 
K 5 HOH 208 708 503 HOH HOH A . 
K 5 HOH 209 709 504 HOH HOH A . 
K 5 HOH 210 710 505 HOH HOH A . 
K 5 HOH 211 711 507 HOH HOH A . 
K 5 HOH 212 712 508 HOH HOH A . 
K 5 HOH 213 713 509 HOH HOH A . 
K 5 HOH 214 714 510 HOH HOH A . 
L 5 HOH 1   501 5   HOH HOH B . 
L 5 HOH 2   502 8   HOH HOH B . 
L 5 HOH 3   503 17  HOH HOH B . 
L 5 HOH 4   504 20  HOH HOH B . 
L 5 HOH 5   505 25  HOH HOH B . 
L 5 HOH 6   506 26  HOH HOH B . 
L 5 HOH 7   507 29  HOH HOH B . 
L 5 HOH 8   508 37  HOH HOH B . 
L 5 HOH 9   509 44  HOH HOH B . 
L 5 HOH 10  510 47  HOH HOH B . 
L 5 HOH 11  511 49  HOH HOH B . 
L 5 HOH 12  512 54  HOH HOH B . 
L 5 HOH 13  513 55  HOH HOH B . 
L 5 HOH 14  514 56  HOH HOH B . 
L 5 HOH 15  515 58  HOH HOH B . 
L 5 HOH 16  516 59  HOH HOH B . 
L 5 HOH 17  517 64  HOH HOH B . 
L 5 HOH 18  518 70  HOH HOH B . 
L 5 HOH 19  519 71  HOH HOH B . 
L 5 HOH 20  520 80  HOH HOH B . 
L 5 HOH 21  521 82  HOH HOH B . 
L 5 HOH 22  522 83  HOH HOH B . 
L 5 HOH 23  523 86  HOH HOH B . 
L 5 HOH 24  524 88  HOH HOH B . 
L 5 HOH 25  525 91  HOH HOH B . 
L 5 HOH 26  526 92  HOH HOH B . 
L 5 HOH 27  527 95  HOH HOH B . 
L 5 HOH 28  528 101 HOH HOH B . 
L 5 HOH 29  529 104 HOH HOH B . 
L 5 HOH 30  530 107 HOH HOH B . 
L 5 HOH 31  531 108 HOH HOH B . 
L 5 HOH 32  532 111 HOH HOH B . 
L 5 HOH 33  533 119 HOH HOH B . 
L 5 HOH 34  534 122 HOH HOH B . 
L 5 HOH 35  535 123 HOH HOH B . 
L 5 HOH 36  536 127 HOH HOH B . 
L 5 HOH 37  537 129 HOH HOH B . 
L 5 HOH 38  538 130 HOH HOH B . 
L 5 HOH 39  539 131 HOH HOH B . 
L 5 HOH 40  540 132 HOH HOH B . 
L 5 HOH 41  541 139 HOH HOH B . 
L 5 HOH 42  542 143 HOH HOH B . 
L 5 HOH 43  543 144 HOH HOH B . 
L 5 HOH 44  544 151 HOH HOH B . 
L 5 HOH 45  545 159 HOH HOH B . 
L 5 HOH 46  546 177 HOH HOH B . 
L 5 HOH 47  547 178 HOH HOH B . 
L 5 HOH 48  548 180 HOH HOH B . 
L 5 HOH 49  549 188 HOH HOH B . 
L 5 HOH 50  550 189 HOH HOH B . 
L 5 HOH 51  551 193 HOH HOH B . 
L 5 HOH 52  552 196 HOH HOH B . 
L 5 HOH 53  553 197 HOH HOH B . 
L 5 HOH 54  554 199 HOH HOH B . 
L 5 HOH 55  555 203 HOH HOH B . 
L 5 HOH 56  556 204 HOH HOH B . 
L 5 HOH 57  557 208 HOH HOH B . 
L 5 HOH 58  558 209 HOH HOH B . 
L 5 HOH 59  559 214 HOH HOH B . 
L 5 HOH 60  560 215 HOH HOH B . 
L 5 HOH 61  561 216 HOH HOH B . 
L 5 HOH 62  562 217 HOH HOH B . 
L 5 HOH 63  563 221 HOH HOH B . 
L 5 HOH 64  564 223 HOH HOH B . 
L 5 HOH 65  565 227 HOH HOH B . 
L 5 HOH 66  566 229 HOH HOH B . 
L 5 HOH 67  567 231 HOH HOH B . 
L 5 HOH 68  568 232 HOH HOH B . 
L 5 HOH 69  569 236 HOH HOH B . 
L 5 HOH 70  570 239 HOH HOH B . 
L 5 HOH 71  571 241 HOH HOH B . 
L 5 HOH 72  572 242 HOH HOH B . 
L 5 HOH 73  573 243 HOH HOH B . 
L 5 HOH 74  574 245 HOH HOH B . 
L 5 HOH 75  575 246 HOH HOH B . 
L 5 HOH 76  576 248 HOH HOH B . 
L 5 HOH 77  577 256 HOH HOH B . 
L 5 HOH 78  578 258 HOH HOH B . 
L 5 HOH 79  579 259 HOH HOH B . 
L 5 HOH 80  580 260 HOH HOH B . 
L 5 HOH 81  581 265 HOH HOH B . 
L 5 HOH 82  582 274 HOH HOH B . 
L 5 HOH 83  583 276 HOH HOH B . 
L 5 HOH 84  584 285 HOH HOH B . 
L 5 HOH 85  585 289 HOH HOH B . 
L 5 HOH 86  586 290 HOH HOH B . 
L 5 HOH 87  587 291 HOH HOH B . 
L 5 HOH 88  588 293 HOH HOH B . 
L 5 HOH 89  589 294 HOH HOH B . 
L 5 HOH 90  590 302 HOH HOH B . 
L 5 HOH 91  591 303 HOH HOH B . 
L 5 HOH 92  592 306 HOH HOH B . 
L 5 HOH 93  593 308 HOH HOH B . 
L 5 HOH 94  594 312 HOH HOH B . 
L 5 HOH 95  595 313 HOH HOH B . 
L 5 HOH 96  596 314 HOH HOH B . 
L 5 HOH 97  597 316 HOH HOH B . 
L 5 HOH 98  598 319 HOH HOH B . 
L 5 HOH 99  599 320 HOH HOH B . 
L 5 HOH 100 600 325 HOH HOH B . 
L 5 HOH 101 601 326 HOH HOH B . 
L 5 HOH 102 602 345 HOH HOH B . 
L 5 HOH 103 603 348 HOH HOH B . 
L 5 HOH 104 604 355 HOH HOH B . 
L 5 HOH 105 605 361 HOH HOH B . 
L 5 HOH 106 606 363 HOH HOH B . 
L 5 HOH 107 607 365 HOH HOH B . 
L 5 HOH 108 608 376 HOH HOH B . 
L 5 HOH 109 609 379 HOH HOH B . 
L 5 HOH 110 610 383 HOH HOH B . 
L 5 HOH 111 611 384 HOH HOH B . 
L 5 HOH 112 612 386 HOH HOH B . 
L 5 HOH 113 613 394 HOH HOH B . 
L 5 HOH 114 614 403 HOH HOH B . 
L 5 HOH 115 615 404 HOH HOH B . 
L 5 HOH 116 616 407 HOH HOH B . 
L 5 HOH 117 617 410 HOH HOH B . 
L 5 HOH 118 618 416 HOH HOH B . 
L 5 HOH 119 619 418 HOH HOH B . 
L 5 HOH 120 620 421 HOH HOH B . 
L 5 HOH 121 621 425 HOH HOH B . 
L 5 HOH 122 622 427 HOH HOH B . 
L 5 HOH 123 623 429 HOH HOH B . 
L 5 HOH 124 624 430 HOH HOH B . 
L 5 HOH 125 625 445 HOH HOH B . 
L 5 HOH 126 626 447 HOH HOH B . 
L 5 HOH 127 627 448 HOH HOH B . 
L 5 HOH 128 628 458 HOH HOH B . 
L 5 HOH 129 629 464 HOH HOH B . 
L 5 HOH 130 630 465 HOH HOH B . 
L 5 HOH 131 631 466 HOH HOH B . 
L 5 HOH 132 632 468 HOH HOH B . 
L 5 HOH 133 633 472 HOH HOH B . 
L 5 HOH 134 634 475 HOH HOH B . 
L 5 HOH 135 635 477 HOH HOH B . 
L 5 HOH 136 636 478 HOH HOH B . 
L 5 HOH 137 637 480 HOH HOH B . 
L 5 HOH 138 638 484 HOH HOH B . 
L 5 HOH 139 639 485 HOH HOH B . 
L 5 HOH 140 640 492 HOH HOH B . 
L 5 HOH 141 641 494 HOH HOH B . 
L 5 HOH 142 642 495 HOH HOH B . 
L 5 HOH 143 643 501 HOH HOH B . 
L 5 HOH 144 644 506 HOH HOH B . 
M 5 HOH 1   101 12  HOH HOH D . 
M 5 HOH 2   102 24  HOH HOH D . 
M 5 HOH 3   103 43  HOH HOH D . 
M 5 HOH 4   104 46  HOH HOH D . 
M 5 HOH 5   105 51  HOH HOH D . 
M 5 HOH 6   106 62  HOH HOH D . 
M 5 HOH 7   107 74  HOH HOH D . 
M 5 HOH 8   108 115 HOH HOH D . 
M 5 HOH 9   109 149 HOH HOH D . 
M 5 HOH 10  110 273 HOH HOH D . 
M 5 HOH 11  111 282 HOH HOH D . 
M 5 HOH 12  112 286 HOH HOH D . 
M 5 HOH 13  113 299 HOH HOH D . 
M 5 HOH 14  114 305 HOH HOH D . 
M 5 HOH 15  115 327 HOH HOH D . 
M 5 HOH 16  116 332 HOH HOH D . 
M 5 HOH 17  117 334 HOH HOH D . 
M 5 HOH 18  118 343 HOH HOH D . 
M 5 HOH 19  119 350 HOH HOH D . 
M 5 HOH 20  120 370 HOH HOH D . 
M 5 HOH 21  121 409 HOH HOH D . 
M 5 HOH 22  122 411 HOH HOH D . 
M 5 HOH 23  123 413 HOH HOH D . 
M 5 HOH 24  124 419 HOH HOH D . 
M 5 HOH 25  125 428 HOH HOH D . 
M 5 HOH 26  126 437 HOH HOH D . 
M 5 HOH 27  127 439 HOH HOH D . 
M 5 HOH 28  128 441 HOH HOH D . 
M 5 HOH 29  129 442 HOH HOH D . 
M 5 HOH 30  130 449 HOH HOH D . 
M 5 HOH 31  131 462 HOH HOH D . 
M 5 HOH 32  132 463 HOH HOH D . 
M 5 HOH 33  133 487 HOH HOH D . 
M 5 HOH 34  134 488 HOH HOH D . 
M 5 HOH 35  135 493 HOH HOH D . 
M 5 HOH 36  136 255 HOH HOH D . 
N 5 HOH 1   101 2   HOH HOH E . 
N 5 HOH 2   102 6   HOH HOH E . 
N 5 HOH 3   103 15  HOH HOH E . 
N 5 HOH 4   104 28  HOH HOH E . 
N 5 HOH 5   105 34  HOH HOH E . 
N 5 HOH 6   106 38  HOH HOH E . 
N 5 HOH 7   107 61  HOH HOH E . 
N 5 HOH 8   108 69  HOH HOH E . 
N 5 HOH 9   109 72  HOH HOH E . 
N 5 HOH 10  110 73  HOH HOH E . 
N 5 HOH 11  111 78  HOH HOH E . 
N 5 HOH 12  112 81  HOH HOH E . 
N 5 HOH 13  113 85  HOH HOH E . 
N 5 HOH 14  114 96  HOH HOH E . 
N 5 HOH 15  115 102 HOH HOH E . 
N 5 HOH 16  116 114 HOH HOH E . 
N 5 HOH 17  117 202 HOH HOH E . 
N 5 HOH 18  118 205 HOH HOH E . 
N 5 HOH 19  119 206 HOH HOH E . 
N 5 HOH 20  120 225 HOH HOH E . 
N 5 HOH 21  121 226 HOH HOH E . 
N 5 HOH 22  122 249 HOH HOH E . 
N 5 HOH 23  123 253 HOH HOH E . 
N 5 HOH 24  124 267 HOH HOH E . 
N 5 HOH 25  125 275 HOH HOH E . 
N 5 HOH 26  126 281 HOH HOH E . 
N 5 HOH 27  127 287 HOH HOH E . 
N 5 HOH 28  128 296 HOH HOH E . 
N 5 HOH 29  129 298 HOH HOH E . 
N 5 HOH 30  130 315 HOH HOH E . 
N 5 HOH 31  131 321 HOH HOH E . 
N 5 HOH 32  132 333 HOH HOH E . 
N 5 HOH 33  133 339 HOH HOH E . 
N 5 HOH 34  134 364 HOH HOH E . 
N 5 HOH 35  135 374 HOH HOH E . 
N 5 HOH 36  136 399 HOH HOH E . 
N 5 HOH 37  137 436 HOH HOH E . 
N 5 HOH 38  138 440 HOH HOH E . 
N 5 HOH 39  139 452 HOH HOH E . 
N 5 HOH 40  140 491 HOH HOH E . 
O 5 HOH 1   101 9   HOH HOH G . 
O 5 HOH 2   102 11  HOH HOH G . 
O 5 HOH 3   103 35  HOH HOH G . 
O 5 HOH 4   104 40  HOH HOH G . 
O 5 HOH 5   105 42  HOH HOH G . 
O 5 HOH 6   106 52  HOH HOH G . 
O 5 HOH 7   107 84  HOH HOH G . 
O 5 HOH 8   108 90  HOH HOH G . 
O 5 HOH 9   109 103 HOH HOH G . 
O 5 HOH 10  110 109 HOH HOH G . 
O 5 HOH 11  111 118 HOH HOH G . 
O 5 HOH 12  112 213 HOH HOH G . 
O 5 HOH 13  113 222 HOH HOH G . 
O 5 HOH 14  114 247 HOH HOH G . 
O 5 HOH 15  115 262 HOH HOH G . 
O 5 HOH 16  116 292 HOH HOH G . 
O 5 HOH 17  117 300 HOH HOH G . 
O 5 HOH 18  118 323 HOH HOH G . 
O 5 HOH 19  119 335 HOH HOH G . 
O 5 HOH 20  120 344 HOH HOH G . 
O 5 HOH 21  121 346 HOH HOH G . 
O 5 HOH 22  122 366 HOH HOH G . 
O 5 HOH 23  123 400 HOH HOH G . 
O 5 HOH 24  124 408 HOH HOH G . 
O 5 HOH 25  125 420 HOH HOH G . 
O 5 HOH 26  126 424 HOH HOH G . 
O 5 HOH 27  127 461 HOH HOH G . 
O 5 HOH 28  128 496 HOH HOH G . 
O 5 HOH 29  129 497 HOH HOH G . 
P 5 HOH 1   101 75  HOH HOH H . 
P 5 HOH 2   102 97  HOH HOH H . 
P 5 HOH 3   103 98  HOH HOH H . 
P 5 HOH 4   104 99  HOH HOH H . 
P 5 HOH 5   105 113 HOH HOH H . 
P 5 HOH 6   106 124 HOH HOH H . 
P 5 HOH 7   107 134 HOH HOH H . 
P 5 HOH 8   108 146 HOH HOH H . 
P 5 HOH 9   109 194 HOH HOH H . 
P 5 HOH 10  110 212 HOH HOH H . 
P 5 HOH 11  111 237 HOH HOH H . 
P 5 HOH 12  112 257 HOH HOH H . 
P 5 HOH 13  113 269 HOH HOH H . 
P 5 HOH 14  114 270 HOH HOH H . 
P 5 HOH 15  115 272 HOH HOH H . 
P 5 HOH 16  116 277 HOH HOH H . 
P 5 HOH 17  117 288 HOH HOH H . 
P 5 HOH 18  118 295 HOH HOH H . 
P 5 HOH 19  119 297 HOH HOH H . 
P 5 HOH 20  120 301 HOH HOH H . 
P 5 HOH 21  121 309 HOH HOH H . 
P 5 HOH 22  122 338 HOH HOH H . 
P 5 HOH 23  123 358 HOH HOH H . 
P 5 HOH 24  124 382 HOH HOH H . 
P 5 HOH 25  125 387 HOH HOH H . 
P 5 HOH 26  126 401 HOH HOH H . 
P 5 HOH 27  127 402 HOH HOH H . 
P 5 HOH 28  128 412 HOH HOH H . 
P 5 HOH 29  129 415 HOH HOH H . 
P 5 HOH 30  130 422 HOH HOH H . 
P 5 HOH 31  131 438 HOH HOH H . 
P 5 HOH 32  132 443 HOH HOH H . 
P 5 HOH 33  133 444 HOH HOH H . 
P 5 HOH 34  134 454 HOH HOH H . 
P 5 HOH 35  135 456 HOH HOH H . 
P 5 HOH 36  136 460 HOH HOH H . 
P 5 HOH 37  137 473 HOH HOH H . 
P 5 HOH 38  138 498 HOH HOH H . 
#