data_4NE1
# 
_entry.id   4NE1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4NE1         
NDB   NA2776       
RCSB  RCSB083084   
WWPDB D_1000083084 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4NDY 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        4NE1 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-10-28 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhao, Q.'         1 
'Saro, D.'         2 
'Sachpatzidis, A.' 3 
'Sung, P.'         4 
'Xiong, Y.'        5 
# 
_citation.id                        primary 
_citation.title                     'The MHF complex senses branched DNA by binding a pair of crossover DNA duplexes.' 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_volume            5 
_citation.page_first                2987 
_citation.page_last                 2987 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24390579 
_citation.pdbx_database_id_DOI      10.1038/ncomms3987 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zhao, Q.'         1  ? 
primary 'Saro, D.'         2  ? 
primary 'Sachpatzidis, A.' 3  ? 
primary 'Singh, T.R.'      4  ? 
primary 'Schlingman, D.'   5  ? 
primary 'Zheng, X.F.'      6  ? 
primary 'Mack, A.'         7  ? 
primary 'Tsai, M.S.'       8  ? 
primary 'Mochrie, S.'      9  ? 
primary 'Regan, L.'        10 ? 
primary 'Meetei, A.R.'     11 ? 
primary 'Sung, P.'         12 ? 
primary 'Xiong, Y.'        13 ? 
# 
_cell.length_a           252.390 
_cell.length_b           252.390 
_cell.length_c           131.360 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           4NE1 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              60 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 3' 
_symmetry.entry_id                         4NE1 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                143 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 'DNA (26-MER)'         8098.421  4  ? ? ? ? 
2 polymer syn 'DNA (26-MER)'         7864.056  4  ? ? ? ? 
3 polymer man 'Centromere protein S' 12091.949 20 ? ? ? ? 
4 polymer man 'Centromere protein X' 8398.796  20 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3 
;CENP-S, Apoptosis-inducing TAF9-like domain-containing protein 1, FANCM-interacting histone fold protein 1, Fanconi anemia-associated polypeptide of 16 kDa
;
4 
;CENP-X, FANCM-interacting histone fold protein 2, Fanconi anemia-associated polypeptide of 10 kDa, Retinoic acid-inducible gene D9 protein homolog, Stimulated by retinoic acid gene 13 protein homolog
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DA)(DA)(DA)(DA)(DA)(DA)(DA)(DA)(DA)(DA)(DA)(DA)(DA)(DA)(DA)(DA)(DA)(DA)(DA)(DA)
(DA)(DA)(DA)(DA)(DA)(DA)
;
AAAAAAAAAAAAAAAAAAAAAAAAAA                                                                                   E,O,s,u ? 
2 polydeoxyribonucleotide no no 
;(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)
(DT)(DT)(DT)(DT)(DT)(DT)
;
TTTTTTTTTTTTTTTTTTTTTTTTTT                                                                                   F,P,t,v ? 
3 'polypeptide(L)'        no no 
;SYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLL
KYITDKSEEIAQANLERKAQKKKKS
;
;SYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLL
KYITDKSEEIAQANLERKAQKKKKS
;
C,G,A,I,J,K,Q,R,S,T,Y,a,c,e,f,g,k,l,m,n ? 
4 'polypeptide(L)'        no no SGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF 
SGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF                                   
D,H,B,L,M,N,U,V,W,X,Z,b,d,h,i,j,o,p,q,r ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DA  n 
1 3   DA  n 
1 4   DA  n 
1 5   DA  n 
1 6   DA  n 
1 7   DA  n 
1 8   DA  n 
1 9   DA  n 
1 10  DA  n 
1 11  DA  n 
1 12  DA  n 
1 13  DA  n 
1 14  DA  n 
1 15  DA  n 
1 16  DA  n 
1 17  DA  n 
1 18  DA  n 
1 19  DA  n 
1 20  DA  n 
1 21  DA  n 
1 22  DA  n 
1 23  DA  n 
1 24  DA  n 
1 25  DA  n 
1 26  DA  n 
2 1   DT  n 
2 2   DT  n 
2 3   DT  n 
2 4   DT  n 
2 5   DT  n 
2 6   DT  n 
2 7   DT  n 
2 8   DT  n 
2 9   DT  n 
2 10  DT  n 
2 11  DT  n 
2 12  DT  n 
2 13  DT  n 
2 14  DT  n 
2 15  DT  n 
2 16  DT  n 
2 17  DT  n 
2 18  DT  n 
2 19  DT  n 
2 20  DT  n 
2 21  DT  n 
2 22  DT  n 
2 23  DT  n 
2 24  DT  n 
2 25  DT  n 
2 26  DT  n 
3 1   SER n 
3 2   TYR n 
3 3   GLN n 
3 4   GLN n 
3 5   ARG n 
3 6   LEU n 
3 7   LYS n 
3 8   ALA n 
3 9   ALA n 
3 10  VAL n 
3 11  HIS n 
3 12  TYR n 
3 13  THR n 
3 14  VAL n 
3 15  GLY n 
3 16  CYS n 
3 17  LEU n 
3 18  CYS n 
3 19  GLU n 
3 20  GLU n 
3 21  VAL n 
3 22  ALA n 
3 23  LEU n 
3 24  ASP n 
3 25  LYS n 
3 26  ALA n 
3 27  MET n 
3 28  GLN n 
3 29  PHE n 
3 30  SER n 
3 31  LYS n 
3 32  GLN n 
3 33  THR n 
3 34  ILE n 
3 35  ALA n 
3 36  ALA n 
3 37  ILE n 
3 38  SER n 
3 39  GLU n 
3 40  LEU n 
3 41  THR n 
3 42  PHE n 
3 43  ARG n 
3 44  GLN n 
3 45  CYS n 
3 46  GLU n 
3 47  ASN n 
3 48  PHE n 
3 49  ALA n 
3 50  LYS n 
3 51  ASP n 
3 52  LEU n 
3 53  GLU n 
3 54  MET n 
3 55  PHE n 
3 56  ALA n 
3 57  ARG n 
3 58  HIS n 
3 59  ALA n 
3 60  LYS n 
3 61  ARG n 
3 62  THR n 
3 63  THR n 
3 64  ILE n 
3 65  ASN n 
3 66  THR n 
3 67  GLU n 
3 68  ASP n 
3 69  VAL n 
3 70  LYS n 
3 71  LEU n 
3 72  LEU n 
3 73  ALA n 
3 74  ARG n 
3 75  ARG n 
3 76  SER n 
3 77  ASN n 
3 78  SER n 
3 79  LEU n 
3 80  LEU n 
3 81  LYS n 
3 82  TYR n 
3 83  ILE n 
3 84  THR n 
3 85  ASP n 
3 86  LYS n 
3 87  SER n 
3 88  GLU n 
3 89  GLU n 
3 90  ILE n 
3 91  ALA n 
3 92  GLN n 
3 93  ALA n 
3 94  ASN n 
3 95  LEU n 
3 96  GLU n 
3 97  ARG n 
3 98  LYS n 
3 99  ALA n 
3 100 GLN n 
3 101 LYS n 
3 102 LYS n 
3 103 LYS n 
3 104 LYS n 
3 105 SER n 
4 1   SER n 
4 2   GLY n 
4 3   PHE n 
4 4   ARG n 
4 5   LYS n 
4 6   GLU n 
4 7   LEU n 
4 8   VAL n 
4 9   SER n 
4 10  ARG n 
4 11  LEU n 
4 12  LEU n 
4 13  HIS n 
4 14  LEU n 
4 15  HIS n 
4 16  PHE n 
4 17  LYS n 
4 18  ASP n 
4 19  ASP n 
4 20  LYS n 
4 21  THR n 
4 22  LYS n 
4 23  VAL n 
4 24  SER n 
4 25  GLY n 
4 26  ASP n 
4 27  ALA n 
4 28  LEU n 
4 29  GLN n 
4 30  LEU n 
4 31  MET n 
4 32  VAL n 
4 33  GLU n 
4 34  LEU n 
4 35  LEU n 
4 36  LYS n 
4 37  VAL n 
4 38  PHE n 
4 39  VAL n 
4 40  VAL n 
4 41  GLU n 
4 42  ALA n 
4 43  ALA n 
4 44  VAL n 
4 45  ARG n 
4 46  GLY n 
4 47  VAL n 
4 48  ARG n 
4 49  GLN n 
4 50  ALA n 
4 51  GLN n 
4 52  ALA n 
4 53  GLU n 
4 54  ASP n 
4 55  ALA n 
4 56  LEU n 
4 57  ARG n 
4 58  VAL n 
4 59  ASP n 
4 60  VAL n 
4 61  ASP n 
4 62  GLN n 
4 63  LEU n 
4 64  GLU n 
4 65  LYS n 
4 66  VAL n 
4 67  LEU n 
4 68  PRO n 
4 69  GLN n 
4 70  LEU n 
4 71  LEU n 
4 72  LEU n 
4 73  ASP n 
4 74  PHE n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
3 1 sample ? ? ? human ? 'APITD1, CENPS, FAAP16, MHF1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? 
? ? ? ? ? 'BL21 Rossetta 2' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? human ? 'STRA13, CENPX, FAAP10, MHF2' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? 
? ? ? ? ? 'BL21 Rossetta 2' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample ? ? 'Synthetic DNA' ? 32630 ? 
2 1 sample ? ? 'Synthetic DNA' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP CENPS_HUMAN Q8N2Z9 3 
;SYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLL
KYITDKSEEIAQINLERKAQKKKKS
;
14 ? 
2 UNP CENPX_HUMAN A8MT69 4 SGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF 8  ? 
3 PDB 4NE1        4NE1   1 ? ?  ? 
4 PDB 4NE1        4NE1   2 ? ?  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4NE1 C 1 ? 105 ? Q8N2Z9 14 ? 118 ? 14 118 
2  2 4NE1 D 1 ? 74  ? A8MT69 8  ? 81  ? 8  81  
3  1 4NE1 G 1 ? 105 ? Q8N2Z9 14 ? 118 ? 14 118 
4  2 4NE1 H 1 ? 74  ? A8MT69 8  ? 81  ? 8  81  
5  1 4NE1 A 1 ? 105 ? Q8N2Z9 14 ? 118 ? 14 118 
6  2 4NE1 B 1 ? 74  ? A8MT69 8  ? 81  ? 8  81  
7  1 4NE1 I 1 ? 105 ? Q8N2Z9 14 ? 118 ? 14 118 
8  1 4NE1 J 1 ? 105 ? Q8N2Z9 14 ? 118 ? 14 118 
9  1 4NE1 K 1 ? 105 ? Q8N2Z9 14 ? 118 ? 14 118 
10 2 4NE1 L 1 ? 74  ? A8MT69 8  ? 81  ? 8  81  
11 2 4NE1 M 1 ? 74  ? A8MT69 8  ? 81  ? 8  81  
12 2 4NE1 N 1 ? 74  ? A8MT69 8  ? 81  ? 8  81  
13 1 4NE1 Q 1 ? 105 ? Q8N2Z9 14 ? 118 ? 14 118 
14 1 4NE1 R 1 ? 105 ? Q8N2Z9 14 ? 118 ? 14 118 
15 1 4NE1 S 1 ? 105 ? Q8N2Z9 14 ? 118 ? 14 118 
16 1 4NE1 T 1 ? 105 ? Q8N2Z9 14 ? 118 ? 14 118 
17 2 4NE1 U 1 ? 74  ? A8MT69 8  ? 81  ? 8  81  
18 2 4NE1 V 1 ? 74  ? A8MT69 8  ? 81  ? 8  81  
19 2 4NE1 W 1 ? 74  ? A8MT69 8  ? 81  ? 8  81  
20 2 4NE1 X 1 ? 74  ? A8MT69 8  ? 81  ? 8  81  
21 1 4NE1 Y 1 ? 105 ? Q8N2Z9 14 ? 118 ? 14 118 
22 2 4NE1 Z 1 ? 74  ? A8MT69 8  ? 81  ? 8  81  
23 1 4NE1 a 1 ? 105 ? Q8N2Z9 14 ? 118 ? 14 118 
24 2 4NE1 b 1 ? 74  ? A8MT69 8  ? 81  ? 8  81  
25 1 4NE1 c 1 ? 105 ? Q8N2Z9 14 ? 118 ? 14 118 
26 2 4NE1 d 1 ? 74  ? A8MT69 8  ? 81  ? 8  81  
27 1 4NE1 e 1 ? 105 ? Q8N2Z9 14 ? 118 ? 14 118 
28 1 4NE1 f 1 ? 105 ? Q8N2Z9 14 ? 118 ? 14 118 
29 1 4NE1 g 1 ? 105 ? Q8N2Z9 14 ? 118 ? 14 118 
30 2 4NE1 h 1 ? 74  ? A8MT69 8  ? 81  ? 8  81  
31 2 4NE1 i 1 ? 74  ? A8MT69 8  ? 81  ? 8  81  
32 2 4NE1 j 1 ? 74  ? A8MT69 8  ? 81  ? 8  81  
33 1 4NE1 k 1 ? 105 ? Q8N2Z9 14 ? 118 ? 14 118 
34 1 4NE1 l 1 ? 105 ? Q8N2Z9 14 ? 118 ? 14 118 
35 1 4NE1 m 1 ? 105 ? Q8N2Z9 14 ? 118 ? 14 118 
36 1 4NE1 n 1 ? 105 ? Q8N2Z9 14 ? 118 ? 14 118 
37 2 4NE1 o 1 ? 74  ? A8MT69 8  ? 81  ? 8  81  
38 2 4NE1 p 1 ? 74  ? A8MT69 8  ? 81  ? 8  81  
39 2 4NE1 q 1 ? 74  ? A8MT69 8  ? 81  ? 8  81  
40 2 4NE1 r 1 ? 74  ? A8MT69 8  ? 81  ? 8  81  
41 3 4NE1 E 1 ? 26  ? 4NE1   1  ? 26  ? 1  26  
42 3 4NE1 O 1 ? 26  ? 4NE1   1  ? 26  ? 1  26  
43 3 4NE1 s 1 ? 26  ? 4NE1   1  ? 26  ? 1  26  
44 3 4NE1 u 1 ? 26  ? 4NE1   1  ? 26  ? 1  26  
45 4 4NE1 F 1 ? 26  ? 4NE1   1  ? 26  ? 1  26  
46 4 4NE1 P 1 ? 26  ? 4NE1   1  ? 26  ? 1  26  
47 4 4NE1 t 1 ? 26  ? 4NE1   1  ? 26  ? 1  26  
48 4 4NE1 v 1 ? 26  ? 4NE1   1  ? 26  ? 1  26  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  4NE1 ALA C 26 ? UNP Q8N2Z9 GLU 39  conflict 39  1  
1  4NE1 ALA C 93 ? UNP Q8N2Z9 ILE 106 conflict 106 2  
3  4NE1 ALA G 26 ? UNP Q8N2Z9 GLU 39  conflict 39  3  
3  4NE1 ALA G 93 ? UNP Q8N2Z9 ILE 106 conflict 106 4  
5  4NE1 ALA A 26 ? UNP Q8N2Z9 GLU 39  conflict 39  5  
5  4NE1 ALA A 93 ? UNP Q8N2Z9 ILE 106 conflict 106 6  
7  4NE1 ALA I 26 ? UNP Q8N2Z9 GLU 39  conflict 39  7  
7  4NE1 ALA I 93 ? UNP Q8N2Z9 ILE 106 conflict 106 8  
8  4NE1 ALA J 26 ? UNP Q8N2Z9 GLU 39  conflict 39  9  
8  4NE1 ALA J 93 ? UNP Q8N2Z9 ILE 106 conflict 106 10 
9  4NE1 ALA K 26 ? UNP Q8N2Z9 GLU 39  conflict 39  11 
9  4NE1 ALA K 93 ? UNP Q8N2Z9 ILE 106 conflict 106 12 
13 4NE1 ALA Q 26 ? UNP Q8N2Z9 GLU 39  conflict 39  13 
13 4NE1 ALA Q 93 ? UNP Q8N2Z9 ILE 106 conflict 106 14 
14 4NE1 ALA R 26 ? UNP Q8N2Z9 GLU 39  conflict 39  15 
14 4NE1 ALA R 93 ? UNP Q8N2Z9 ILE 106 conflict 106 16 
15 4NE1 ALA S 26 ? UNP Q8N2Z9 GLU 39  conflict 39  17 
15 4NE1 ALA S 93 ? UNP Q8N2Z9 ILE 106 conflict 106 18 
16 4NE1 ALA T 26 ? UNP Q8N2Z9 GLU 39  conflict 39  19 
16 4NE1 ALA T 93 ? UNP Q8N2Z9 ILE 106 conflict 106 20 
21 4NE1 ALA Y 26 ? UNP Q8N2Z9 GLU 39  conflict 39  21 
21 4NE1 ALA Y 93 ? UNP Q8N2Z9 ILE 106 conflict 106 22 
23 4NE1 ALA a 26 ? UNP Q8N2Z9 GLU 39  conflict 39  23 
23 4NE1 ALA a 93 ? UNP Q8N2Z9 ILE 106 conflict 106 24 
25 4NE1 ALA c 26 ? UNP Q8N2Z9 GLU 39  conflict 39  25 
25 4NE1 ALA c 93 ? UNP Q8N2Z9 ILE 106 conflict 106 26 
27 4NE1 ALA e 26 ? UNP Q8N2Z9 GLU 39  conflict 39  27 
27 4NE1 ALA e 93 ? UNP Q8N2Z9 ILE 106 conflict 106 28 
28 4NE1 ALA f 26 ? UNP Q8N2Z9 GLU 39  conflict 39  29 
28 4NE1 ALA f 93 ? UNP Q8N2Z9 ILE 106 conflict 106 30 
29 4NE1 ALA g 26 ? UNP Q8N2Z9 GLU 39  conflict 39  31 
29 4NE1 ALA g 93 ? UNP Q8N2Z9 ILE 106 conflict 106 32 
33 4NE1 ALA k 26 ? UNP Q8N2Z9 GLU 39  conflict 39  33 
33 4NE1 ALA k 93 ? UNP Q8N2Z9 ILE 106 conflict 106 34 
34 4NE1 ALA l 26 ? UNP Q8N2Z9 GLU 39  conflict 39  35 
34 4NE1 ALA l 93 ? UNP Q8N2Z9 ILE 106 conflict 106 36 
35 4NE1 ALA m 26 ? UNP Q8N2Z9 GLU 39  conflict 39  37 
35 4NE1 ALA m 93 ? UNP Q8N2Z9 ILE 106 conflict 106 38 
36 4NE1 ALA n 26 ? UNP Q8N2Z9 GLU 39  conflict 39  39 
36 4NE1 ALA n 93 ? UNP Q8N2Z9 ILE 106 conflict 106 40 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4NE1 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      5.10 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   75.88 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'Micro-batch under oil' 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.temp            300 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    '0.1-0.3M ammonium phosphate, Micro-batch under oil, temperature 300K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-E' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-E 
# 
_reflns.entry_id                     4NE1 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            6.4990 
_reflns.d_resolution_low             112.5900 
_reflns.number_all                   18393 
_reflns.number_obs                   18329 
_reflns.percent_possible_obs         99.6500 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 4NE1 
_refine.ls_d_res_high                            6.4990 
_refine.ls_d_res_low                             112.5900 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.6500 
_refine.ls_number_reflns_obs                     18329 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'U VALUES      : WITH TLS ADDED' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2673 
_refine.ls_R_factor_R_work                       0.2661 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2951 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 4.5000 
_refine.ls_number_reflns_R_free                  824 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               363.3821 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -49.0500 
_refine.aniso_B[2][2]                            -49.0500 
_refine.aniso_B[3][3]                            98.1100 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9320 
_refine.correlation_coeff_Fo_to_Fc_free          0.9210 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.5580 
_refine.overall_SU_ML                            1.5970 
_refine.overall_SU_B                             385.4960 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.3000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             1.1100 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                601.050 
_refine.B_iso_min                                185.500 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.500 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        27467 
_refine_hist.pdbx_number_atoms_nucleic_acid   4264 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               31731 
_refine_hist.d_res_high                       6.4990 
_refine_hist.d_res_low                        112.5900 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       32635 0.010  0.018  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    44727 1.461  1.845  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 3428  6.321  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 1328  36.788 24.307 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 5600  20.846 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 228   18.563 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         5024  0.096  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   22332 0.005  0.020  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       6.4990 
_refine_ls_shell.d_res_low                        6.6650 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               99.3900 
_refine_ls_shell.number_reflns_R_work             1247 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2090 
_refine_ls_shell.R_factor_R_free                  0.3450 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             62 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1309 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4NE1 
_struct.title                     'Human MHF1 MHF2 DNA complexes' 
_struct.pdbx_descriptor           'PROTEIN/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4NE1 
_struct_keywords.pdbx_keywords   'DNA binding protein/DNA' 
_struct_keywords.text            
'histone fold, DNA repair, genome maintenance, Fanconi Anemia, FancM, nucleus, DNA binding protein-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 1 ? 
D  N N 2 ? 
E  N N 1 ? 
F  N N 2 ? 
G  N N 1 ? 
H  N N 2 ? 
I  N N 3 ? 
J  N N 4 ? 
K  N N 3 ? 
L  N N 4 ? 
M  N N 3 ? 
N  N N 4 ? 
O  N N 3 ? 
P  N N 3 ? 
Q  N N 3 ? 
R  N N 4 ? 
S  N N 4 ? 
T  N N 4 ? 
U  N N 3 ? 
V  N N 3 ? 
W  N N 3 ? 
X  N N 3 ? 
Y  N N 4 ? 
Z  N N 4 ? 
AA N N 4 ? 
BA N N 4 ? 
CA N N 3 ? 
DA N N 4 ? 
EA N N 3 ? 
FA N N 4 ? 
GA N N 3 ? 
HA N N 4 ? 
IA N N 3 ? 
JA N N 3 ? 
KA N N 3 ? 
LA N N 4 ? 
MA N N 4 ? 
NA N N 4 ? 
OA N N 3 ? 
PA N N 3 ? 
QA N N 3 ? 
RA N N 3 ? 
SA N N 4 ? 
TA N N 4 ? 
UA N N 4 ? 
VA N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   SER I  1  ? LYS I  25  ? SER C 14 LYS C 38  1 ? 25 
HELX_P HELX_P2   2   SER I  30 ? ALA I  59  ? SER C 43 ALA C 72  1 ? 30 
HELX_P HELX_P3   3   ASN I  65 ? LEU I  72  ? ASN C 78 LEU C 85  1 ? 8  
HELX_P HELX_P4   4   SER I  76 ? ALA I  93  ? SER C 89 ALA C 106 1 ? 18 
HELX_P HELX_P5   5   ARG J  4  ? HIS J  15  ? ARG D 11 HIS D 22  1 ? 12 
HELX_P HELX_P6   6   SER J  24 ? GLU J  53  ? SER D 31 GLU D 60  1 ? 30 
HELX_P HELX_P7   7   ASP J  59 ? PHE J  74  ? ASP D 66 PHE D 81  1 ? 16 
HELX_P HELX_P8   8   TYR K  2  ? LYS K  25  ? TYR G 15 LYS G 38  1 ? 24 
HELX_P HELX_P9   9   SER K  30 ? ALA K  59  ? SER G 43 ALA G 72  1 ? 30 
HELX_P HELX_P10  10  ASN K  65 ? ALA K  73  ? ASN G 78 ALA G 86  1 ? 9  
HELX_P HELX_P11  11  SER K  76 ? GLN K  92  ? SER G 89 GLN G 105 1 ? 17 
HELX_P HELX_P12  12  ARG L  4  ? PHE L  16  ? ARG H 11 PHE H 23  1 ? 13 
HELX_P HELX_P13  13  SER L  24 ? GLU L  53  ? SER H 31 GLU H 60  1 ? 30 
HELX_P HELX_P14  14  ASP L  59 ? VAL L  66  ? ASP H 66 VAL H 73  1 ? 8  
HELX_P HELX_P15  15  VAL L  66 ? PHE L  74  ? VAL H 73 PHE H 81  1 ? 9  
HELX_P HELX_P16  16  TYR M  2  ? LYS M  25  ? TYR A 15 LYS A 38  1 ? 24 
HELX_P HELX_P17  17  SER M  30 ? ALA M  59  ? SER A 43 ALA A 72  1 ? 30 
HELX_P HELX_P18  18  ASN M  65 ? ALA M  73  ? ASN A 78 ALA A 86  1 ? 9  
HELX_P HELX_P19  19  SER M  76 ? GLN M  92  ? SER A 89 GLN A 105 1 ? 17 
HELX_P HELX_P20  20  ARG N  4  ? LEU N  14  ? ARG B 11 LEU B 21  1 ? 11 
HELX_P HELX_P21  21  SER N  24 ? GLU N  53  ? SER B 31 GLU B 60  1 ? 30 
HELX_P HELX_P22  22  ASP N  59 ? ASP N  73  ? ASP B 66 ASP B 80  1 ? 15 
HELX_P HELX_P23  23  TYR O  2  ? ALA O  26  ? TYR I 15 ALA I 39  1 ? 25 
HELX_P HELX_P24  24  SER O  30 ? ALA O  59  ? SER I 43 ALA I 72  1 ? 30 
HELX_P HELX_P25  25  ASN O  65 ? LEU O  71  ? ASN I 78 LEU I 84  1 ? 7  
HELX_P HELX_P26  26  SER O  76 ? LYS O  101 ? SER I 89 LYS I 114 1 ? 26 
HELX_P HELX_P27  27  TYR P  2  ? LYS P  25  ? TYR J 15 LYS J 38  1 ? 24 
HELX_P HELX_P28  28  SER P  30 ? HIS P  58  ? SER J 43 HIS J 71  1 ? 29 
HELX_P HELX_P29  29  ASN P  65 ? ALA P  73  ? ASN J 78 ALA J 86  1 ? 9  
HELX_P HELX_P30  30  SER P  76 ? ALA P  91  ? SER J 89 ALA J 104 1 ? 16 
HELX_P HELX_P31  31  TYR Q  2  ? LYS Q  25  ? TYR K 15 LYS K 38  1 ? 24 
HELX_P HELX_P32  32  SER Q  30 ? ALA Q  59  ? SER K 43 ALA K 72  1 ? 30 
HELX_P HELX_P33  33  ASN Q  65 ? ALA Q  73  ? ASN K 78 ALA K 86  1 ? 9  
HELX_P HELX_P34  34  SER Q  76 ? LYS Q  101 ? SER K 89 LYS K 114 1 ? 26 
HELX_P HELX_P35  35  ARG R  4  ? HIS R  13  ? ARG L 11 HIS L 20  1 ? 10 
HELX_P HELX_P36  36  SER R  24 ? GLU R  53  ? SER L 31 GLU L 60  1 ? 30 
HELX_P HELX_P37  37  ASP R  59 ? VAL R  66  ? ASP L 66 VAL L 73  1 ? 8  
HELX_P HELX_P38  38  VAL R  66 ? PHE R  74  ? VAL L 73 PHE L 81  1 ? 9  
HELX_P HELX_P39  39  ARG S  4  ? HIS S  13  ? ARG M 11 HIS M 20  1 ? 10 
HELX_P HELX_P40  40  SER S  24 ? GLU S  53  ? SER M 31 GLU M 60  1 ? 30 
HELX_P HELX_P41  41  ASP S  59 ? PHE S  74  ? ASP M 66 PHE M 81  1 ? 16 
HELX_P HELX_P42  42  ARG T  4  ? PHE T  16  ? ARG N 11 PHE N 23  1 ? 13 
HELX_P HELX_P43  43  SER T  24 ? GLU T  53  ? SER N 31 GLU N 60  1 ? 30 
HELX_P HELX_P44  44  ASP T  59 ? PHE T  74  ? ASP N 66 PHE N 81  1 ? 16 
HELX_P HELX_P45  45  TYR U  2  ? ALA U  26  ? TYR Q 15 ALA Q 39  1 ? 25 
HELX_P HELX_P46  46  SER U  30 ? HIS U  58  ? SER Q 43 HIS Q 71  1 ? 29 
HELX_P HELX_P47  47  ASN U  65 ? ALA U  73  ? ASN Q 78 ALA Q 86  1 ? 9  
HELX_P HELX_P48  48  SER U  76 ? LYS U  101 ? SER Q 89 LYS Q 114 1 ? 26 
HELX_P HELX_P49  49  TYR V  2  ? ALA V  26  ? TYR R 15 ALA R 39  1 ? 25 
HELX_P HELX_P50  50  SER V  30 ? ALA V  59  ? SER R 43 ALA R 72  1 ? 30 
HELX_P HELX_P51  51  ASN V  65 ? ALA V  73  ? ASN R 78 ALA R 86  1 ? 9  
HELX_P HELX_P52  52  SER V  76 ? GLN V  92  ? SER R 89 GLN R 105 1 ? 17 
HELX_P HELX_P53  53  TYR W  2  ? ALA W  26  ? TYR S 15 ALA S 39  1 ? 25 
HELX_P HELX_P54  54  SER W  30 ? ALA W  59  ? SER S 43 ALA S 72  1 ? 30 
HELX_P HELX_P55  55  ASN W  65 ? ALA W  73  ? ASN S 78 ALA S 86  1 ? 9  
HELX_P HELX_P56  56  SER W  76 ? ALA W  93  ? SER S 89 ALA S 106 1 ? 18 
HELX_P HELX_P57  57  TYR X  2  ? ALA X  26  ? TYR T 15 ALA T 39  1 ? 25 
HELX_P HELX_P58  58  SER X  30 ? ALA X  59  ? SER T 43 ALA T 72  1 ? 30 
HELX_P HELX_P59  59  ASN X  65 ? ALA X  73  ? ASN T 78 ALA T 86  1 ? 9  
HELX_P HELX_P60  60  SER X  76 ? LYS X  101 ? SER T 89 LYS T 114 1 ? 26 
HELX_P HELX_P61  61  ARG Y  4  ? LEU Y  14  ? ARG U 11 LEU U 21  1 ? 11 
HELX_P HELX_P62  62  SER Y  24 ? GLU Y  53  ? SER U 31 GLU U 60  1 ? 30 
HELX_P HELX_P63  63  ASP Y  59 ? PHE Y  74  ? ASP U 66 PHE U 81  1 ? 16 
HELX_P HELX_P64  64  ARG Z  4  ? LEU Z  14  ? ARG V 11 LEU V 21  1 ? 11 
HELX_P HELX_P65  65  SER Z  24 ? GLU Z  53  ? SER V 31 GLU V 60  1 ? 30 
HELX_P HELX_P66  66  ASP Z  59 ? PHE Z  74  ? ASP V 66 PHE V 81  1 ? 16 
HELX_P HELX_P67  67  ARG AA 4  ? LEU AA 14  ? ARG W 11 LEU W 21  1 ? 11 
HELX_P HELX_P68  68  SER AA 24 ? GLU AA 53  ? SER W 31 GLU W 60  1 ? 30 
HELX_P HELX_P69  69  ASP AA 59 ? PHE AA 74  ? ASP W 66 PHE W 81  1 ? 16 
HELX_P HELX_P70  70  ARG BA 4  ? LEU BA 14  ? ARG X 11 LEU X 21  1 ? 11 
HELX_P HELX_P71  71  SER BA 24 ? GLU BA 53  ? SER X 31 GLU X 60  1 ? 30 
HELX_P HELX_P72  72  ASP BA 59 ? PHE BA 74  ? ASP X 66 PHE X 81  1 ? 16 
HELX_P HELX_P73  73  TYR CA 2  ? ALA CA 26  ? TYR Y 15 ALA Y 39  1 ? 25 
HELX_P HELX_P74  74  SER CA 30 ? ALA CA 59  ? SER Y 43 ALA Y 72  1 ? 30 
HELX_P HELX_P75  75  ASN CA 65 ? ALA CA 73  ? ASN Y 78 ALA Y 86  1 ? 9  
HELX_P HELX_P76  76  SER CA 76 ? ALA CA 93  ? SER Y 89 ALA Y 106 1 ? 18 
HELX_P HELX_P77  77  ARG DA 4  ? LEU DA 14  ? ARG Z 11 LEU Z 21  1 ? 11 
HELX_P HELX_P78  78  SER DA 24 ? GLU DA 53  ? SER Z 31 GLU Z 60  1 ? 30 
HELX_P HELX_P79  79  ASP DA 59 ? PHE DA 74  ? ASP Z 66 PHE Z 81  1 ? 16 
HELX_P HELX_P80  80  TYR EA 2  ? ALA EA 26  ? TYR a 15 ALA a 39  1 ? 25 
HELX_P HELX_P81  81  SER EA 30 ? ALA EA 59  ? SER a 43 ALA a 72  1 ? 30 
HELX_P HELX_P82  82  ASN EA 65 ? ALA EA 73  ? ASN a 78 ALA a 86  1 ? 9  
HELX_P HELX_P83  83  SER EA 76 ? ALA EA 93  ? SER a 89 ALA a 106 1 ? 18 
HELX_P HELX_P84  84  ARG FA 4  ? LEU FA 14  ? ARG b 11 LEU b 21  1 ? 11 
HELX_P HELX_P85  85  SER FA 24 ? GLU FA 53  ? SER b 31 GLU b 60  1 ? 30 
HELX_P HELX_P86  86  ASP FA 59 ? PHE FA 74  ? ASP b 66 PHE b 81  1 ? 16 
HELX_P HELX_P87  87  TYR GA 2  ? ALA GA 26  ? TYR c 15 ALA c 39  1 ? 25 
HELX_P HELX_P88  88  SER GA 30 ? ALA GA 59  ? SER c 43 ALA c 72  1 ? 30 
HELX_P HELX_P89  89  ASN GA 65 ? ALA GA 73  ? ASN c 78 ALA c 86  1 ? 9  
HELX_P HELX_P90  90  SER GA 76 ? GLN GA 92  ? SER c 89 GLN c 105 1 ? 17 
HELX_P HELX_P91  91  ARG HA 4  ? LEU HA 14  ? ARG d 11 LEU d 21  1 ? 11 
HELX_P HELX_P92  92  SER HA 24 ? ASP HA 54  ? SER d 31 ASP d 61  1 ? 31 
HELX_P HELX_P93  93  ASP HA 59 ? PHE HA 74  ? ASP d 66 PHE d 81  1 ? 16 
HELX_P HELX_P94  94  TYR IA 2  ? ALA IA 26  ? TYR e 15 ALA e 39  1 ? 25 
HELX_P HELX_P95  95  SER IA 30 ? ALA IA 59  ? SER e 43 ALA e 72  1 ? 30 
HELX_P HELX_P96  96  ASN IA 65 ? ALA IA 73  ? ASN e 78 ALA e 86  1 ? 9  
HELX_P HELX_P97  97  SER IA 76 ? LYS IA 101 ? SER e 89 LYS e 114 1 ? 26 
HELX_P HELX_P98  98  TYR JA 2  ? ALA JA 26  ? TYR f 15 ALA f 39  1 ? 25 
HELX_P HELX_P99  99  SER JA 30 ? ALA JA 59  ? SER f 43 ALA f 72  1 ? 30 
HELX_P HELX_P100 100 ASN JA 65 ? ALA JA 73  ? ASN f 78 ALA f 86  1 ? 9  
HELX_P HELX_P101 101 SER JA 76 ? GLN JA 92  ? SER f 89 GLN f 105 1 ? 17 
HELX_P HELX_P102 102 TYR KA 2  ? ALA KA 26  ? TYR g 15 ALA g 39  1 ? 25 
HELX_P HELX_P103 103 SER KA 30 ? ALA KA 59  ? SER g 43 ALA g 72  1 ? 30 
HELX_P HELX_P104 104 ASN KA 65 ? ALA KA 73  ? ASN g 78 ALA g 86  1 ? 9  
HELX_P HELX_P105 105 SER KA 76 ? LYS KA 101 ? SER g 89 LYS g 114 1 ? 26 
HELX_P HELX_P106 106 ARG LA 4  ? LEU LA 14  ? ARG h 11 LEU h 21  1 ? 11 
HELX_P HELX_P107 107 SER LA 24 ? GLU LA 53  ? SER h 31 GLU h 60  1 ? 30 
HELX_P HELX_P108 108 ASP LA 59 ? PHE LA 74  ? ASP h 66 PHE h 81  1 ? 16 
HELX_P HELX_P109 109 ARG MA 4  ? PHE MA 16  ? ARG i 11 PHE i 23  1 ? 13 
HELX_P HELX_P110 110 SER MA 24 ? GLU MA 53  ? SER i 31 GLU i 60  1 ? 30 
HELX_P HELX_P111 111 ASP MA 59 ? PHE MA 74  ? ASP i 66 PHE i 81  1 ? 16 
HELX_P HELX_P112 112 ARG NA 4  ? PHE NA 16  ? ARG j 11 PHE j 23  1 ? 13 
HELX_P HELX_P113 113 SER NA 24 ? GLU NA 53  ? SER j 31 GLU j 60  1 ? 30 
HELX_P HELX_P114 114 ASP NA 59 ? PHE NA 74  ? ASP j 66 PHE j 81  1 ? 16 
HELX_P HELX_P115 115 TYR OA 2  ? ALA OA 26  ? TYR k 15 ALA k 39  1 ? 25 
HELX_P HELX_P116 116 SER OA 30 ? ALA OA 59  ? SER k 43 ALA k 72  1 ? 30 
HELX_P HELX_P117 117 ASN OA 65 ? ALA OA 73  ? ASN k 78 ALA k 86  1 ? 9  
HELX_P HELX_P118 118 SER OA 76 ? LYS OA 101 ? SER k 89 LYS k 114 1 ? 26 
HELX_P HELX_P119 119 TYR PA 2  ? ALA PA 26  ? TYR l 15 ALA l 39  1 ? 25 
HELX_P HELX_P120 120 SER PA 30 ? ALA PA 59  ? SER l 43 ALA l 72  1 ? 30 
HELX_P HELX_P121 121 ASN PA 65 ? ALA PA 73  ? ASN l 78 ALA l 86  1 ? 9  
HELX_P HELX_P122 122 SER PA 76 ? GLN PA 92  ? SER l 89 GLN l 105 1 ? 17 
HELX_P HELX_P123 123 TYR QA 2  ? ALA QA 26  ? TYR m 15 ALA m 39  1 ? 25 
HELX_P HELX_P124 124 SER QA 30 ? ALA QA 59  ? SER m 43 ALA m 72  1 ? 30 
HELX_P HELX_P125 125 ASN QA 65 ? ALA QA 73  ? ASN m 78 ALA m 86  1 ? 9  
HELX_P HELX_P126 126 SER QA 76 ? ALA QA 93  ? SER m 89 ALA m 106 1 ? 18 
HELX_P HELX_P127 127 TYR RA 2  ? ALA RA 26  ? TYR n 15 ALA n 39  1 ? 25 
HELX_P HELX_P128 128 SER RA 30 ? ALA RA 59  ? SER n 43 ALA n 72  1 ? 30 
HELX_P HELX_P129 129 ASN RA 65 ? ALA RA 73  ? ASN n 78 ALA n 86  1 ? 9  
HELX_P HELX_P130 130 SER RA 76 ? LYS RA 101 ? SER n 89 LYS n 114 1 ? 26 
HELX_P HELX_P131 131 ARG SA 4  ? LEU SA 14  ? ARG o 11 LEU o 21  1 ? 11 
HELX_P HELX_P132 132 SER SA 24 ? GLU SA 53  ? SER o 31 GLU o 60  1 ? 30 
HELX_P HELX_P133 133 ASP SA 59 ? PHE SA 74  ? ASP o 66 PHE o 81  1 ? 16 
HELX_P HELX_P134 134 ARG TA 4  ? LEU TA 14  ? ARG p 11 LEU p 21  1 ? 11 
HELX_P HELX_P135 135 SER TA 24 ? GLU TA 53  ? SER p 31 GLU p 60  1 ? 30 
HELX_P HELX_P136 136 ASP TA 59 ? PHE TA 74  ? ASP p 66 PHE p 81  1 ? 16 
HELX_P HELX_P137 137 ARG UA 4  ? LEU UA 14  ? ARG q 11 LEU q 21  1 ? 11 
HELX_P HELX_P138 138 SER UA 24 ? GLU UA 53  ? SER q 31 GLU q 60  1 ? 30 
HELX_P HELX_P139 139 ASP UA 59 ? PHE UA 74  ? ASP q 66 PHE q 81  1 ? 16 
HELX_P HELX_P140 140 ARG VA 4  ? LEU VA 14  ? ARG r 11 LEU r 21  1 ? 11 
HELX_P HELX_P141 141 SER VA 24 ? GLU VA 53  ? SER r 31 GLU r 60  1 ? 30 
HELX_P HELX_P142 142 ASP VA 59 ? PHE VA 74  ? ASP r 66 PHE r 81  1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? A DA 1  N1 ? ? ? 1_555 B DT 26 N3 ? ? E DA 1  F DT 26 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog2   hydrog ? ? A DA 1  N6 ? ? ? 1_555 B DT 26 O4 ? ? E DA 1  F DT 26 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog3   hydrog ? ? A DA 2  N1 ? ? ? 1_555 B DT 25 N3 ? ? E DA 2  F DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog4   hydrog ? ? A DA 2  N6 ? ? ? 1_555 B DT 25 O4 ? ? E DA 2  F DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog5   hydrog ? ? A DA 3  N1 ? ? ? 1_555 B DT 24 N3 ? ? E DA 3  F DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog6   hydrog ? ? A DA 3  N6 ? ? ? 1_555 B DT 24 O4 ? ? E DA 3  F DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog7   hydrog ? ? A DA 4  N6 ? ? ? 1_555 B DT 23 O4 ? ? E DA 4  F DT 23 1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog8   hydrog ? ? A DA 4  N1 ? ? ? 1_555 B DT 24 N3 ? ? E DA 4  F DT 24 1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog9   hydrog ? ? A DA 5  N1 ? ? ? 1_555 B DT 22 N3 ? ? E DA 5  F DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog10  hydrog ? ? A DA 5  N6 ? ? ? 1_555 B DT 22 O4 ? ? E DA 5  F DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog11  hydrog ? ? A DA 6  N1 ? ? ? 1_555 B DT 21 N3 ? ? E DA 6  F DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog12  hydrog ? ? A DA 6  N6 ? ? ? 1_555 B DT 21 O4 ? ? E DA 6  F DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog13  hydrog ? ? A DA 7  N1 ? ? ? 1_555 B DT 20 N3 ? ? E DA 7  F DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog14  hydrog ? ? A DA 7  N6 ? ? ? 1_555 B DT 20 O4 ? ? E DA 7  F DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog15  hydrog ? ? A DA 8  N1 ? ? ? 1_555 B DT 19 N3 ? ? E DA 8  F DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog16  hydrog ? ? A DA 8  N6 ? ? ? 1_555 B DT 19 O4 ? ? E DA 8  F DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog17  hydrog ? ? A DA 9  N1 ? ? ? 1_555 B DT 18 N3 ? ? E DA 9  F DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog18  hydrog ? ? A DA 9  N6 ? ? ? 1_555 B DT 18 O4 ? ? E DA 9  F DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog19  hydrog ? ? A DA 10 N1 ? ? ? 1_555 B DT 17 N3 ? ? E DA 10 F DT 17 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog20  hydrog ? ? A DA 10 N6 ? ? ? 1_555 B DT 17 O4 ? ? E DA 10 F DT 17 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog21  hydrog ? ? A DA 11 N1 ? ? ? 1_555 B DT 16 N3 ? ? E DA 11 F DT 16 1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog22  hydrog ? ? A DA 11 N1 ? ? ? 1_555 B DT 17 N3 ? ? E DA 11 F DT 17 1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog23  hydrog ? ? A DA 12 N1 ? ? ? 1_555 B DT 15 N3 ? ? E DA 12 F DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog24  hydrog ? ? A DA 12 N6 ? ? ? 1_555 B DT 15 O4 ? ? E DA 12 F DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog25  hydrog ? ? A DA 13 N1 ? ? ? 1_555 B DT 14 N3 ? ? E DA 13 F DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog26  hydrog ? ? A DA 13 N6 ? ? ? 1_555 B DT 14 O4 ? ? E DA 13 F DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog27  hydrog ? ? A DA 14 N1 ? ? ? 1_555 B DT 13 N3 ? ? E DA 14 F DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog28  hydrog ? ? A DA 14 N6 ? ? ? 1_555 B DT 13 O4 ? ? E DA 14 F DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog29  hydrog ? ? A DA 15 N1 ? ? ? 1_555 B DT 12 N3 ? ? E DA 15 F DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog30  hydrog ? ? A DA 15 N6 ? ? ? 1_555 B DT 12 O4 ? ? E DA 15 F DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog31  hydrog ? ? A DA 16 N1 ? ? ? 1_555 B DT 11 N3 ? ? E DA 16 F DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog32  hydrog ? ? A DA 16 N6 ? ? ? 1_555 B DT 11 O4 ? ? E DA 16 F DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog33  hydrog ? ? A DA 17 N1 ? ? ? 1_555 B DT 10 N3 ? ? E DA 17 F DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog34  hydrog ? ? A DA 17 N6 ? ? ? 1_555 B DT 10 O4 ? ? E DA 17 F DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog35  hydrog ? ? A DA 18 N1 ? ? ? 1_555 B DT 9  N3 ? ? E DA 18 F DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog36  hydrog ? ? A DA 18 N6 ? ? ? 1_555 B DT 9  O4 ? ? E DA 18 F DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog37  hydrog ? ? A DA 19 N6 ? ? ? 1_555 B DT 8  O4 ? ? E DA 19 F DT 8  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog38  hydrog ? ? A DA 19 N1 ? ? ? 1_555 B DT 9  N3 ? ? E DA 19 F DT 9  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog39  hydrog ? ? A DA 20 N1 ? ? ? 1_555 B DT 7  N3 ? ? E DA 20 F DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog40  hydrog ? ? A DA 20 N6 ? ? ? 1_555 B DT 7  O4 ? ? E DA 20 F DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog41  hydrog ? ? A DA 21 N1 ? ? ? 1_555 B DT 6  N3 ? ? E DA 21 F DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog42  hydrog ? ? A DA 21 N6 ? ? ? 1_555 B DT 6  O4 ? ? E DA 21 F DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog43  hydrog ? ? A DA 22 N1 ? ? ? 1_555 B DT 5  N3 ? ? E DA 22 F DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog44  hydrog ? ? A DA 22 N6 ? ? ? 1_555 B DT 5  O4 ? ? E DA 22 F DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog45  hydrog ? ? A DA 23 N1 ? ? ? 1_555 B DT 4  N3 ? ? E DA 23 F DT 4  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog46  hydrog ? ? A DA 23 N1 ? ? ? 1_555 B DT 5  N3 ? ? E DA 23 F DT 5  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog47  hydrog ? ? A DA 24 N1 ? ? ? 1_555 B DT 3  N3 ? ? E DA 24 F DT 3  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog48  hydrog ? ? A DA 24 N1 ? ? ? 1_555 B DT 4  N3 ? ? E DA 24 F DT 4  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog49  hydrog ? ? A DA 25 N1 ? ? ? 1_555 B DT 2  N3 ? ? E DA 25 F DT 2  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog50  hydrog ? ? A DA 26 N1 ? ? ? 1_555 B DT 1  N3 ? ? E DA 26 F DT 1  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog51  hydrog ? ? A DA 26 N6 ? ? ? 1_555 B DT 1  O2 ? ? E DA 26 F DT 1  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog52  hydrog ? ? C DA 1  N1 ? ? ? 1_555 D DT 26 N3 ? ? O DA 1  P DT 26 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog53  hydrog ? ? C DA 1  N6 ? ? ? 1_555 D DT 26 O4 ? ? O DA 1  P DT 26 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog54  hydrog ? ? C DA 2  N1 ? ? ? 1_555 D DT 25 N3 ? ? O DA 2  P DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog55  hydrog ? ? C DA 2  N6 ? ? ? 1_555 D DT 25 O4 ? ? O DA 2  P DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog56  hydrog ? ? C DA 3  N1 ? ? ? 1_555 D DT 24 N3 ? ? O DA 3  P DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog57  hydrog ? ? C DA 3  N6 ? ? ? 1_555 D DT 24 O4 ? ? O DA 3  P DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog58  hydrog ? ? C DA 3  N1 ? ? ? 1_555 D DT 25 N3 ? ? O DA 3  P DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog59  hydrog ? ? C DA 3  N6 ? ? ? 1_555 D DT 25 O4 ? ? O DA 3  P DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog60  hydrog ? ? C DA 4  N1 ? ? ? 1_555 D DT 23 N3 ? ? O DA 4  P DT 23 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog61  hydrog ? ? C DA 4  N6 ? ? ? 1_555 D DT 23 O4 ? ? O DA 4  P DT 23 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog62  hydrog ? ? C DA 4  N1 ? ? ? 1_555 D DT 24 N3 ? ? O DA 4  P DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog63  hydrog ? ? C DA 4  N6 ? ? ? 1_555 D DT 24 O4 ? ? O DA 4  P DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog64  hydrog ? ? C DA 5  N1 ? ? ? 1_555 D DT 22 N3 ? ? O DA 5  P DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog65  hydrog ? ? C DA 5  N6 ? ? ? 1_555 D DT 22 O4 ? ? O DA 5  P DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog66  hydrog ? ? C DA 6  N1 ? ? ? 1_555 D DT 21 N3 ? ? O DA 6  P DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog67  hydrog ? ? C DA 6  N6 ? ? ? 1_555 D DT 21 O4 ? ? O DA 6  P DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog68  hydrog ? ? C DA 7  N1 ? ? ? 1_555 D DT 20 N3 ? ? O DA 7  P DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog69  hydrog ? ? C DA 7  N6 ? ? ? 1_555 D DT 20 O4 ? ? O DA 7  P DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog70  hydrog ? ? C DA 8  N1 ? ? ? 1_555 D DT 19 N3 ? ? O DA 8  P DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog71  hydrog ? ? C DA 8  N6 ? ? ? 1_555 D DT 19 O4 ? ? O DA 8  P DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog72  hydrog ? ? C DA 9  N1 ? ? ? 1_555 D DT 18 N3 ? ? O DA 9  P DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog73  hydrog ? ? C DA 9  N6 ? ? ? 1_555 D DT 18 O4 ? ? O DA 9  P DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog74  hydrog ? ? C DA 10 N1 ? ? ? 1_555 D DT 17 N3 ? ? O DA 10 P DT 17 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog75  hydrog ? ? C DA 10 N6 ? ? ? 1_555 D DT 17 O4 ? ? O DA 10 P DT 17 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog76  hydrog ? ? C DA 11 N1 ? ? ? 1_555 D DT 16 N3 ? ? O DA 11 P DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog77  hydrog ? ? C DA 11 N6 ? ? ? 1_555 D DT 16 O4 ? ? O DA 11 P DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog78  hydrog ? ? C DA 12 N1 ? ? ? 1_555 D DT 15 N3 ? ? O DA 12 P DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog79  hydrog ? ? C DA 12 N6 ? ? ? 1_555 D DT 15 O4 ? ? O DA 12 P DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog80  hydrog ? ? C DA 13 N1 ? ? ? 1_555 D DT 14 N3 ? ? O DA 13 P DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog81  hydrog ? ? C DA 13 N6 ? ? ? 1_555 D DT 14 O4 ? ? O DA 13 P DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog82  hydrog ? ? C DA 14 N1 ? ? ? 1_555 D DT 13 N3 ? ? O DA 14 P DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog83  hydrog ? ? C DA 14 N6 ? ? ? 1_555 D DT 13 O4 ? ? O DA 14 P DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog84  hydrog ? ? C DA 15 N1 ? ? ? 1_555 D DT 12 N3 ? ? O DA 15 P DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog85  hydrog ? ? C DA 15 N6 ? ? ? 1_555 D DT 12 O4 ? ? O DA 15 P DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog86  hydrog ? ? C DA 16 N1 ? ? ? 1_555 D DT 11 N3 ? ? O DA 16 P DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog87  hydrog ? ? C DA 16 N6 ? ? ? 1_555 D DT 11 O4 ? ? O DA 16 P DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog88  hydrog ? ? C DA 17 N1 ? ? ? 1_555 D DT 10 N3 ? ? O DA 17 P DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog89  hydrog ? ? C DA 17 N6 ? ? ? 1_555 D DT 10 O4 ? ? O DA 17 P DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog90  hydrog ? ? C DA 18 N1 ? ? ? 1_555 D DT 9  N3 ? ? O DA 18 P DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog91  hydrog ? ? C DA 18 N6 ? ? ? 1_555 D DT 9  O4 ? ? O DA 18 P DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog92  hydrog ? ? C DA 19 N1 ? ? ? 1_555 D DT 8  N3 ? ? O DA 19 P DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog93  hydrog ? ? C DA 19 N6 ? ? ? 1_555 D DT 8  O4 ? ? O DA 19 P DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog94  hydrog ? ? C DA 20 N1 ? ? ? 1_555 D DT 7  N3 ? ? O DA 20 P DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog95  hydrog ? ? C DA 20 N6 ? ? ? 1_555 D DT 7  O4 ? ? O DA 20 P DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog96  hydrog ? ? C DA 21 N1 ? ? ? 1_555 D DT 6  N3 ? ? O DA 21 P DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog97  hydrog ? ? C DA 21 N6 ? ? ? 1_555 D DT 6  O4 ? ? O DA 21 P DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog98  hydrog ? ? C DA 22 N1 ? ? ? 1_555 D DT 5  N3 ? ? O DA 22 P DT 5  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog99  hydrog ? ? C DA 22 N1 ? ? ? 1_555 D DT 6  N3 ? ? O DA 22 P DT 6  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog100 hydrog ? ? C DA 23 N1 ? ? ? 1_555 D DT 4  N3 ? ? O DA 23 P DT 4  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog101 hydrog ? ? C DA 23 N1 ? ? ? 1_555 D DT 5  N3 ? ? O DA 23 P DT 5  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog102 hydrog ? ? C DA 24 N1 ? ? ? 1_555 D DT 3  N3 ? ? O DA 24 P DT 3  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog103 hydrog ? ? C DA 24 N1 ? ? ? 1_555 D DT 4  N3 ? ? O DA 24 P DT 4  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog104 hydrog ? ? C DA 25 N1 ? ? ? 1_555 D DT 2  N3 ? ? O DA 25 P DT 2  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog105 hydrog ? ? C DA 26 N1 ? ? ? 1_555 D DT 1  N3 ? ? O DA 26 P DT 1  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog106 hydrog ? ? E DA 1  N1 ? ? ? 1_555 F DT 26 N3 ? ? s DA 1  t DT 26 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog107 hydrog ? ? E DA 1  N6 ? ? ? 1_555 F DT 26 O4 ? ? s DA 1  t DT 26 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog108 hydrog ? ? E DA 2  N1 ? ? ? 1_555 F DT 25 N3 ? ? s DA 2  t DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog109 hydrog ? ? E DA 2  N6 ? ? ? 1_555 F DT 25 O4 ? ? s DA 2  t DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog110 hydrog ? ? E DA 3  N1 ? ? ? 1_555 F DT 24 N3 ? ? s DA 3  t DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog111 hydrog ? ? E DA 3  N6 ? ? ? 1_555 F DT 24 O4 ? ? s DA 3  t DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog112 hydrog ? ? E DA 4  N1 ? ? ? 1_555 F DT 23 N3 ? ? s DA 4  t DT 23 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog113 hydrog ? ? E DA 4  N6 ? ? ? 1_555 F DT 23 O4 ? ? s DA 4  t DT 23 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog114 hydrog ? ? E DA 5  N1 ? ? ? 1_555 F DT 22 N3 ? ? s DA 5  t DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog115 hydrog ? ? E DA 5  N6 ? ? ? 1_555 F DT 22 O4 ? ? s DA 5  t DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog116 hydrog ? ? E DA 6  N1 ? ? ? 1_555 F DT 21 N3 ? ? s DA 6  t DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog117 hydrog ? ? E DA 6  N6 ? ? ? 1_555 F DT 21 O4 ? ? s DA 6  t DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog118 hydrog ? ? E DA 7  N1 ? ? ? 1_555 F DT 20 N3 ? ? s DA 7  t DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog119 hydrog ? ? E DA 7  N6 ? ? ? 1_555 F DT 20 O4 ? ? s DA 7  t DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog120 hydrog ? ? E DA 8  N1 ? ? ? 1_555 F DT 19 N3 ? ? s DA 8  t DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog121 hydrog ? ? E DA 8  N6 ? ? ? 1_555 F DT 19 O4 ? ? s DA 8  t DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog122 hydrog ? ? E DA 9  N1 ? ? ? 1_555 F DT 18 N3 ? ? s DA 9  t DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog123 hydrog ? ? E DA 9  N6 ? ? ? 1_555 F DT 18 O4 ? ? s DA 9  t DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog124 hydrog ? ? E DA 10 N1 ? ? ? 1_555 F DT 17 N3 ? ? s DA 10 t DT 17 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog125 hydrog ? ? E DA 10 N6 ? ? ? 1_555 F DT 17 O4 ? ? s DA 10 t DT 17 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog126 hydrog ? ? E DA 11 N1 ? ? ? 1_555 F DT 16 N3 ? ? s DA 11 t DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog127 hydrog ? ? E DA 11 N6 ? ? ? 1_555 F DT 16 O4 ? ? s DA 11 t DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog128 hydrog ? ? E DA 12 N1 ? ? ? 1_555 F DT 15 N3 ? ? s DA 12 t DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog129 hydrog ? ? E DA 12 N6 ? ? ? 1_555 F DT 15 O4 ? ? s DA 12 t DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog130 hydrog ? ? E DA 13 N1 ? ? ? 1_555 F DT 14 N3 ? ? s DA 13 t DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog131 hydrog ? ? E DA 13 N6 ? ? ? 1_555 F DT 14 O4 ? ? s DA 13 t DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog132 hydrog ? ? E DA 14 N1 ? ? ? 1_555 F DT 13 N3 ? ? s DA 14 t DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog133 hydrog ? ? E DA 14 N6 ? ? ? 1_555 F DT 13 O4 ? ? s DA 14 t DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog134 hydrog ? ? E DA 15 N1 ? ? ? 1_555 F DT 12 N3 ? ? s DA 15 t DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog135 hydrog ? ? E DA 15 N6 ? ? ? 1_555 F DT 12 O4 ? ? s DA 15 t DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog136 hydrog ? ? E DA 16 N1 ? ? ? 1_555 F DT 11 N3 ? ? s DA 16 t DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog137 hydrog ? ? E DA 16 N6 ? ? ? 1_555 F DT 11 O4 ? ? s DA 16 t DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog138 hydrog ? ? E DA 17 N1 ? ? ? 1_555 F DT 10 N3 ? ? s DA 17 t DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog139 hydrog ? ? E DA 17 N6 ? ? ? 1_555 F DT 10 O4 ? ? s DA 17 t DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog140 hydrog ? ? E DA 18 N1 ? ? ? 1_555 F DT 9  N3 ? ? s DA 18 t DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog141 hydrog ? ? E DA 18 N6 ? ? ? 1_555 F DT 9  O4 ? ? s DA 18 t DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog142 hydrog ? ? E DA 19 N1 ? ? ? 1_555 F DT 8  N3 ? ? s DA 19 t DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog143 hydrog ? ? E DA 19 N6 ? ? ? 1_555 F DT 8  O4 ? ? s DA 19 t DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog144 hydrog ? ? E DA 20 N1 ? ? ? 1_555 F DT 7  N3 ? ? s DA 20 t DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog145 hydrog ? ? E DA 20 N6 ? ? ? 1_555 F DT 7  O4 ? ? s DA 20 t DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog146 hydrog ? ? E DA 21 N1 ? ? ? 1_555 F DT 6  N3 ? ? s DA 21 t DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog147 hydrog ? ? E DA 21 N6 ? ? ? 1_555 F DT 6  O4 ? ? s DA 21 t DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog148 hydrog ? ? E DA 22 N1 ? ? ? 1_555 F DT 5  N3 ? ? s DA 22 t DT 5  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog149 hydrog ? ? E DA 22 N1 ? ? ? 1_555 F DT 6  N3 ? ? s DA 22 t DT 6  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog150 hydrog ? ? E DA 23 N1 ? ? ? 1_555 F DT 4  N3 ? ? s DA 23 t DT 4  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog151 hydrog ? ? E DA 23 N1 ? ? ? 1_555 F DT 5  N3 ? ? s DA 23 t DT 5  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog152 hydrog ? ? E DA 25 N1 ? ? ? 1_555 F DT 2  N3 ? ? s DA 25 t DT 2  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog153 hydrog ? ? G DA 1  N1 ? ? ? 1_555 H DT 26 N3 ? ? u DA 1  v DT 26 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog154 hydrog ? ? G DA 1  N6 ? ? ? 1_555 H DT 26 O4 ? ? u DA 1  v DT 26 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog155 hydrog ? ? G DA 2  N1 ? ? ? 1_555 H DT 25 N3 ? ? u DA 2  v DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog156 hydrog ? ? G DA 2  N6 ? ? ? 1_555 H DT 25 O4 ? ? u DA 2  v DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog157 hydrog ? ? G DA 2  N1 ? ? ? 1_555 H DT 26 N3 ? ? u DA 2  v DT 26 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog158 hydrog ? ? G DA 2  N6 ? ? ? 1_555 H DT 26 O4 ? ? u DA 2  v DT 26 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog159 hydrog ? ? G DA 3  N1 ? ? ? 1_555 H DT 25 N3 ? ? u DA 3  v DT 25 1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog160 hydrog ? ? G DA 4  N6 ? ? ? 1_555 H DT 23 O4 ? ? u DA 4  v DT 23 1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog161 hydrog ? ? G DA 4  N1 ? ? ? 1_555 H DT 24 N3 ? ? u DA 4  v DT 24 1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog162 hydrog ? ? G DA 5  N1 ? ? ? 1_555 H DT 22 N3 ? ? u DA 5  v DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog163 hydrog ? ? G DA 5  N6 ? ? ? 1_555 H DT 22 O4 ? ? u DA 5  v DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog164 hydrog ? ? G DA 6  N1 ? ? ? 1_555 H DT 21 N3 ? ? u DA 6  v DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog165 hydrog ? ? G DA 6  N6 ? ? ? 1_555 H DT 21 O4 ? ? u DA 6  v DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog166 hydrog ? ? G DA 7  N1 ? ? ? 1_555 H DT 20 N3 ? ? u DA 7  v DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog167 hydrog ? ? G DA 7  N6 ? ? ? 1_555 H DT 20 O4 ? ? u DA 7  v DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog168 hydrog ? ? G DA 8  N1 ? ? ? 1_555 H DT 19 N3 ? ? u DA 8  v DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog169 hydrog ? ? G DA 8  N6 ? ? ? 1_555 H DT 19 O4 ? ? u DA 8  v DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog170 hydrog ? ? G DA 9  N1 ? ? ? 1_555 H DT 18 N3 ? ? u DA 9  v DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog171 hydrog ? ? G DA 9  N6 ? ? ? 1_555 H DT 18 O4 ? ? u DA 9  v DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog172 hydrog ? ? G DA 10 N1 ? ? ? 1_555 H DT 17 N3 ? ? u DA 10 v DT 17 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog173 hydrog ? ? G DA 10 N6 ? ? ? 1_555 H DT 17 O4 ? ? u DA 10 v DT 17 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog174 hydrog ? ? G DA 11 N1 ? ? ? 1_555 H DT 16 N3 ? ? u DA 11 v DT 16 1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog175 hydrog ? ? G DA 11 N1 ? ? ? 1_555 H DT 17 N3 ? ? u DA 11 v DT 17 1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog176 hydrog ? ? G DA 12 N1 ? ? ? 1_555 H DT 15 N3 ? ? u DA 12 v DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog177 hydrog ? ? G DA 12 N6 ? ? ? 1_555 H DT 15 O4 ? ? u DA 12 v DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog178 hydrog ? ? G DA 13 N1 ? ? ? 1_555 H DT 14 N3 ? ? u DA 13 v DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog179 hydrog ? ? G DA 13 N6 ? ? ? 1_555 H DT 14 O4 ? ? u DA 13 v DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog180 hydrog ? ? G DA 14 N1 ? ? ? 1_555 H DT 13 N3 ? ? u DA 14 v DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog181 hydrog ? ? G DA 14 N6 ? ? ? 1_555 H DT 13 O4 ? ? u DA 14 v DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog182 hydrog ? ? G DA 15 N1 ? ? ? 1_555 H DT 12 N3 ? ? u DA 15 v DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog183 hydrog ? ? G DA 15 N6 ? ? ? 1_555 H DT 12 O4 ? ? u DA 15 v DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog184 hydrog ? ? G DA 16 N1 ? ? ? 1_555 H DT 11 N3 ? ? u DA 16 v DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog185 hydrog ? ? G DA 16 N6 ? ? ? 1_555 H DT 11 O4 ? ? u DA 16 v DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog186 hydrog ? ? G DA 17 N1 ? ? ? 1_555 H DT 10 N3 ? ? u DA 17 v DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog187 hydrog ? ? G DA 17 N6 ? ? ? 1_555 H DT 10 O4 ? ? u DA 17 v DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog188 hydrog ? ? G DA 18 N1 ? ? ? 1_555 H DT 9  N3 ? ? u DA 18 v DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog189 hydrog ? ? G DA 18 N6 ? ? ? 1_555 H DT 9  O4 ? ? u DA 18 v DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog190 hydrog ? ? G DA 19 N1 ? ? ? 1_555 H DT 9  N3 ? ? u DA 19 v DT 9  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog191 hydrog ? ? G DA 20 N1 ? ? ? 1_555 H DT 8  N3 ? ? u DA 20 v DT 8  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog192 hydrog ? ? G DA 21 N1 ? ? ? 1_555 H DT 7  N3 ? ? u DA 21 v DT 7  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog193 hydrog ? ? G DA 22 N1 ? ? ? 1_555 H DT 5  N3 ? ? u DA 22 v DT 5  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog194 hydrog ? ? G DA 23 N1 ? ? ? 1_555 H DT 4  N3 ? ? u DA 23 v DT 4  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog195 hydrog ? ? G DA 23 N1 ? ? ? 1_555 H DT 5  N3 ? ? u DA 23 v DT 5  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog196 hydrog ? ? G DA 24 N1 ? ? ? 1_555 H DT 3  N3 ? ? u DA 24 v DT 3  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog197 hydrog ? ? G DA 25 N1 ? ? ? 1_555 H DT 2  N3 ? ? u DA 25 v DT 2  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog198 hydrog ? ? G DA 26 N1 ? ? ? 1_555 H DT 1  N3 ? ? u DA 26 v DT 1  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
K ? 2 ? 
L ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
B 1 2 ? parallel 
C 1 2 ? parallel 
D 1 2 ? parallel 
E 1 2 ? parallel 
F 1 2 ? parallel 
G 1 2 ? parallel 
H 1 2 ? parallel 
I 1 2 ? parallel 
J 1 2 ? parallel 
K 1 2 ? parallel 
L 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR I  63 ? ILE I  64 ? THR C 76 ILE C 77 
A 2 LYS J  22 ? VAL J  23 ? LYS D 29 VAL D 30 
B 1 THR M  63 ? ILE M  64 ? THR A 76 ILE A 77 
B 2 LYS N  22 ? VAL N  23 ? LYS B 29 VAL B 30 
C 1 THR U  63 ? ILE U  64 ? THR Q 76 ILE Q 77 
C 2 LYS Z  22 ? VAL Z  23 ? LYS V 29 VAL V 30 
D 1 THR V  63 ? ILE V  64 ? THR R 76 ILE R 77 
D 2 LYS AA 22 ? VAL AA 23 ? LYS W 29 VAL W 30 
E 1 THR CA 63 ? ILE CA 64 ? THR Y 76 ILE Y 77 
E 2 LYS DA 22 ? VAL DA 23 ? LYS Z 29 VAL Z 30 
F 1 THR EA 63 ? ILE EA 64 ? THR a 76 ILE a 77 
F 2 LYS FA 22 ? VAL FA 23 ? LYS b 29 VAL b 30 
G 1 THR IA 63 ? ILE IA 64 ? THR e 76 ILE e 77 
G 2 LYS MA 22 ? VAL MA 23 ? LYS i 29 VAL i 30 
H 1 THR KA 63 ? ILE KA 64 ? THR g 76 ILE g 77 
H 2 LYS LA 22 ? VAL LA 23 ? LYS h 29 VAL h 30 
I 1 THR OA 63 ? ILE OA 64 ? THR k 76 ILE k 77 
I 2 LYS TA 22 ? VAL TA 23 ? LYS p 29 VAL p 30 
J 1 THR PA 63 ? ILE PA 64 ? THR l 76 ILE l 77 
J 2 LYS UA 22 ? VAL UA 23 ? LYS q 29 VAL q 30 
K 1 THR QA 63 ? ILE QA 64 ? THR m 76 ILE m 77 
K 2 LYS VA 22 ? VAL VA 23 ? LYS r 29 VAL r 30 
L 1 THR RA 63 ? ILE RA 64 ? THR n 76 ILE n 77 
L 2 LYS SA 22 ? VAL SA 23 ? LYS o 29 VAL o 30 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE I  64 ? N ILE C 77 O LYS J  22 ? O LYS D 29 
B 1 2 N ILE M  64 ? N ILE A 77 O LYS N  22 ? O LYS B 29 
C 1 2 N ILE U  64 ? N ILE Q 77 O LYS Z  22 ? O LYS V 29 
D 1 2 N ILE V  64 ? N ILE R 77 O LYS AA 22 ? O LYS W 29 
E 1 2 N ILE CA 64 ? N ILE Y 77 O LYS DA 22 ? O LYS Z 29 
F 1 2 N ILE EA 64 ? N ILE a 77 O LYS FA 22 ? O LYS b 29 
G 1 2 N ILE IA 64 ? N ILE e 77 O LYS MA 22 ? O LYS i 29 
H 1 2 N ILE KA 64 ? N ILE g 77 O LYS LA 22 ? O LYS h 29 
I 1 2 N ILE OA 64 ? N ILE k 77 O LYS TA 22 ? O LYS p 29 
J 1 2 N ILE PA 64 ? N ILE l 77 O LYS UA 22 ? O LYS q 29 
K 1 2 N ILE QA 64 ? N ILE m 77 O LYS VA 22 ? O LYS r 29 
L 1 2 N ILE RA 64 ? N ILE n 77 O LYS SA 22 ? O LYS o 29 
# 
_atom_sites.entry_id                    4NE1 
_atom_sites.fract_transf_matrix[1][1]   0.003962 
_atom_sites.fract_transf_matrix[1][2]   0.002288 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004575 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007613 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     P P     . DA  A  1 1   ? 77.249  49.111   58.552  1.00 354.23 ? 1   DA  E P     1 
ATOM 2     O OP1   . DA  A  1 1   ? 76.643  49.422   57.230  1.00 353.60 ? 1   DA  E OP1   1 
ATOM 3     O OP2   . DA  A  1 1   ? 76.969  47.789   59.181  1.00 362.29 ? 1   DA  E OP2   1 
ATOM 4     O "O5'" . DA  A  1 1   ? 78.823  49.363   58.464  1.00 347.12 ? 1   DA  E "O5'" 1 
ATOM 5     C "C5'" . DA  A  1 1   ? 79.464  50.433   59.199  1.00 338.81 ? 1   DA  E "C5'" 1 
ATOM 6     C "C4'" . DA  A  1 1   ? 80.776  49.985   59.805  1.00 332.78 ? 1   DA  E "C4'" 1 
ATOM 7     O "O4'" . DA  A  1 1   ? 80.664  48.662   60.383  1.00 334.48 ? 1   DA  E "O4'" 1 
ATOM 8     C "C3'" . DA  A  1 1   ? 81.974  49.916   58.856  1.00 325.11 ? 1   DA  E "C3'" 1 
ATOM 9     O "O3'" . DA  A  1 1   ? 83.140  50.268   59.617  1.00 321.17 ? 1   DA  E "O3'" 1 
ATOM 10    C "C2'" . DA  A  1 1   ? 82.030  48.444   58.483  1.00 324.17 ? 1   DA  E "C2'" 1 
ATOM 11    C "C1'" . DA  A  1 1   ? 81.633  47.794   59.800  1.00 330.16 ? 1   DA  E "C1'" 1 
ATOM 12    N N9    . DA  A  1 1   ? 81.051  46.448   59.752  1.00 332.11 ? 1   DA  E N9    1 
ATOM 13    C C8    . DA  A  1 1   ? 80.257  45.874   58.789  1.00 327.78 ? 1   DA  E C8    1 
ATOM 14    N N7    . DA  A  1 1   ? 79.867  44.656   59.081  1.00 327.24 ? 1   DA  E N7    1 
ATOM 15    C C5    . DA  A  1 1   ? 80.426  44.418   60.330  1.00 335.52 ? 1   DA  E C5    1 
ATOM 16    C C6    . DA  A  1 1   ? 80.387  43.304   61.189  1.00 341.15 ? 1   DA  E C6    1 
ATOM 17    N N6    . DA  A  1 1   ? 79.730  42.177   60.907  1.00 343.42 ? 1   DA  E N6    1 
ATOM 18    N N1    . DA  A  1 1   ? 81.053  43.391   62.363  1.00 349.11 ? 1   DA  E N1    1 
ATOM 19    C C2    . DA  A  1 1   ? 81.712  44.524   62.644  1.00 349.35 ? 1   DA  E C2    1 
ATOM 20    N N3    . DA  A  1 1   ? 81.826  45.635   61.918  1.00 346.01 ? 1   DA  E N3    1 
ATOM 21    C C4    . DA  A  1 1   ? 81.150  45.517   60.760  1.00 337.62 ? 1   DA  E C4    1 
ATOM 22    P P     . DA  A  1 2   ? 84.353  51.039   58.923  1.00 316.10 ? 2   DA  E P     1 
ATOM 23    O OP1   . DA  A  1 2   ? 84.296  52.468   59.337  1.00 317.68 ? 2   DA  E OP1   1 
ATOM 24    O OP2   . DA  A  1 2   ? 84.349  50.676   57.490  1.00 322.33 ? 2   DA  E OP2   1 
ATOM 25    O "O5'" . DA  A  1 2   ? 85.647  50.368   59.563  1.00 302.48 ? 2   DA  E "O5'" 1 
ATOM 26    C "C5'" . DA  A  1 2   ? 85.689  50.018   60.951  1.00 284.99 ? 2   DA  E "C5'" 1 
ATOM 27    C "C4'" . DA  A  1 2   ? 86.528  48.777   61.148  1.00 270.20 ? 2   DA  E "C4'" 1 
ATOM 28    O "O4'" . DA  A  1 2   ? 85.703  47.593   61.066  1.00 258.21 ? 2   DA  E "O4'" 1 
ATOM 29    C "C3'" . DA  A  1 2   ? 87.661  48.573   60.138  1.00 265.84 ? 2   DA  E "C3'" 1 
ATOM 30    O "O3'" . DA  A  1 2   ? 88.787  48.125   60.888  1.00 273.59 ? 2   DA  E "O3'" 1 
ATOM 31    C "C2'" . DA  A  1 2   ? 87.192  47.390   59.313  1.00 253.76 ? 2   DA  E "C2'" 1 
ATOM 32    C "C1'" . DA  A  1 2   ? 86.429  46.616   60.357  1.00 246.56 ? 2   DA  E "C1'" 1 
ATOM 33    N N9    . DA  A  1 2   ? 85.478  45.664   59.807  1.00 233.49 ? 2   DA  E N9    1 
ATOM 34    C C8    . DA  A  1 2   ? 84.830  45.724   58.599  1.00 227.31 ? 2   DA  E C8    1 
ATOM 35    N N7    . DA  A  1 2   ? 84.043  44.703   58.371  1.00 224.55 ? 2   DA  E N7    1 
ATOM 36    C C5    . DA  A  1 2   ? 84.180  43.916   59.507  1.00 225.12 ? 2   DA  E C5    1 
ATOM 37    C C6    . DA  A  1 2   ? 83.608  42.687   59.883  1.00 223.92 ? 2   DA  E C6    1 
ATOM 38    N N6    . DA  A  1 2   ? 82.744  42.008   59.124  1.00 222.45 ? 2   DA  E N6    1 
ATOM 39    N N1    . DA  A  1 2   ? 83.954  42.175   61.086  1.00 225.13 ? 2   DA  E N1    1 
ATOM 40    C C2    . DA  A  1 2   ? 84.828  42.852   61.843  1.00 226.85 ? 2   DA  E C2    1 
ATOM 41    N N3    . DA  A  1 2   ? 85.438  44.010   61.595  1.00 228.27 ? 2   DA  E N3    1 
ATOM 42    C C4    . DA  A  1 2   ? 85.061  44.498   60.400  1.00 228.60 ? 2   DA  E C4    1 
ATOM 43    P P     . DA  A  1 3   ? 90.277  48.411   60.385  1.00 276.19 ? 3   DA  E P     1 
ATOM 44    O OP1   . DA  A  1 3   ? 90.660  49.781   60.834  1.00 276.96 ? 3   DA  E OP1   1 
ATOM 45    O OP2   . DA  A  1 3   ? 90.356  48.065   58.947  1.00 272.53 ? 3   DA  E OP2   1 
ATOM 46    O "O5'" . DA  A  1 3   ? 91.118  47.304   61.167  1.00 276.62 ? 3   DA  E "O5'" 1 
ATOM 47    C "C5'" . DA  A  1 3   ? 90.580  46.673   62.350  1.00 274.69 ? 3   DA  E "C5'" 1 
ATOM 48    C "C4'" . DA  A  1 3   ? 90.850  45.186   62.355  1.00 269.52 ? 3   DA  E "C4'" 1 
ATOM 49    O "O4'" . DA  A  1 3   ? 89.698  44.479   61.837  1.00 269.48 ? 3   DA  E "O4'" 1 
ATOM 50    C "C3'" . DA  A  1 3   ? 92.041  44.749   61.497  1.00 265.83 ? 3   DA  E "C3'" 1 
ATOM 51    O "O3'" . DA  A  1 3   ? 92.800  43.745   62.173  1.00 263.82 ? 3   DA  E "O3'" 1 
ATOM 52    C "C2'" . DA  A  1 3   ? 91.387  44.112   60.290  1.00 265.00 ? 3   DA  E "C2'" 1 
ATOM 53    C "C1'" . DA  A  1 3   ? 90.154  43.511   60.921  1.00 269.47 ? 3   DA  E "C1'" 1 
ATOM 54    N N9    . DA  A  1 3   ? 89.094  43.256   59.957  1.00 269.26 ? 3   DA  E N9    1 
ATOM 55    C C8    . DA  A  1 3   ? 88.825  43.958   58.810  1.00 266.43 ? 3   DA  E C8    1 
ATOM 56    N N7    . DA  A  1 3   ? 87.848  43.453   58.098  1.00 268.47 ? 3   DA  E N7    1 
ATOM 57    C C5    . DA  A  1 3   ? 87.457  42.331   58.816  1.00 273.11 ? 3   DA  E C5    1 
ATOM 58    C C6    . DA  A  1 3   ? 86.463  41.358   58.590  1.00 276.28 ? 3   DA  E C6    1 
ATOM 59    N N6    . DA  A  1 3   ? 85.643  41.364   57.536  1.00 278.88 ? 3   DA  E N6    1 
ATOM 60    N N1    . DA  A  1 3   ? 86.339  40.364   59.499  1.00 276.18 ? 3   DA  E N1    1 
ATOM 61    C C2    . DA  A  1 3   ? 87.159  40.359   60.559  1.00 275.18 ? 3   DA  E C2    1 
ATOM 62    N N3    . DA  A  1 3   ? 88.130  41.214   60.878  1.00 274.16 ? 3   DA  E N3    1 
ATOM 63    C C4    . DA  A  1 3   ? 88.226  42.190   59.957  1.00 272.13 ? 3   DA  E C4    1 
ATOM 64    P P     . DA  A  1 4   ? 94.343  43.510   61.796  1.00 263.98 ? 4   DA  E P     1 
ATOM 65    O OP1   . DA  A  1 4   ? 95.160  44.460   62.592  1.00 267.11 ? 4   DA  E OP1   1 
ATOM 66    O OP2   . DA  A  1 4   ? 94.466  43.490   60.316  1.00 261.13 ? 4   DA  E OP2   1 
ATOM 67    O "O5'" . DA  A  1 4   ? 94.637  42.046   62.348  1.00 270.15 ? 4   DA  E "O5'" 1 
ATOM 68    C "C5'" . DA  A  1 4   ? 93.685  41.359   63.183  1.00 280.18 ? 4   DA  E "C5'" 1 
ATOM 69    C "C4'" . DA  A  1 4   ? 93.365  40.002   62.601  1.00 287.94 ? 4   DA  E "C4'" 1 
ATOM 70    O "O4'" . DA  A  1 4   ? 92.268  40.106   61.658  1.00 283.83 ? 4   DA  E "O4'" 1 
ATOM 71    C "C3'" . DA  A  1 4   ? 94.514  39.338   61.831  1.00 297.03 ? 4   DA  E "C3'" 1 
ATOM 72    O "O3'" . DA  A  1 4   ? 94.518  37.932   62.110  1.00 316.44 ? 4   DA  E "O3'" 1 
ATOM 73    C "C2'" . DA  A  1 4   ? 94.110  39.525   60.379  1.00 290.64 ? 4   DA  E "C2'" 1 
ATOM 74    C "C1'" . DA  A  1 4   ? 92.615  39.343   60.512  1.00 284.45 ? 4   DA  E "C1'" 1 
ATOM 75    N N9    . DA  A  1 4   ? 91.784  39.779   59.384  1.00 281.16 ? 4   DA  E N9    1 
ATOM 76    C C8    . DA  A  1 4   ? 91.987  40.840   58.533  1.00 278.37 ? 4   DA  E C8    1 
ATOM 77    N N7    . DA  A  1 4   ? 91.070  40.954   57.602  1.00 280.02 ? 4   DA  E N7    1 
ATOM 78    C C5    . DA  A  1 4   ? 90.214  39.887   57.844  1.00 282.80 ? 4   DA  E C5    1 
ATOM 79    C C6    . DA  A  1 4   ? 89.037  39.451   57.204  1.00 284.26 ? 4   DA  E C6    1 
ATOM 80    N N6    . DA  A  1 4   ? 88.499  40.063   56.147  1.00 284.35 ? 4   DA  E N6    1 
ATOM 81    N N1    . DA  A  1 4   ? 88.429  38.344   57.688  1.00 281.88 ? 4   DA  E N1    1 
ATOM 82    C C2    . DA  A  1 4   ? 88.970  37.728   58.747  1.00 278.93 ? 4   DA  E C2    1 
ATOM 83    N N3    . DA  A  1 4   ? 90.065  38.044   59.438  1.00 278.98 ? 4   DA  E N3    1 
ATOM 84    C C4    . DA  A  1 4   ? 90.649  39.146   58.929  1.00 281.41 ? 4   DA  E C4    1 
ATOM 85    P P     . DA  A  1 5   ? 95.881  37.092   62.036  1.00 330.87 ? 5   DA  E P     1 
ATOM 86    O OP1   . DA  A  1 5   ? 96.513  37.143   63.377  1.00 336.01 ? 5   DA  E OP1   1 
ATOM 87    O OP2   . DA  A  1 5   ? 96.648  37.542   60.840  1.00 336.44 ? 5   DA  E OP2   1 
ATOM 88    O "O5'" . DA  A  1 5   ? 95.389  35.600   61.770  1.00 325.21 ? 5   DA  E "O5'" 1 
ATOM 89    C "C5'" . DA  A  1 5   ? 94.229  35.056   62.430  1.00 321.66 ? 5   DA  E "C5'" 1 
ATOM 90    C "C4'" . DA  A  1 5   ? 93.390  34.259   61.457  1.00 323.47 ? 5   DA  E "C4'" 1 
ATOM 91    O "O4'" . DA  A  1 5   ? 92.798  35.141   60.475  1.00 322.42 ? 5   DA  E "O4'" 1 
ATOM 92    C "C3'" . DA  A  1 5   ? 94.138  33.205   60.642  1.00 324.32 ? 5   DA  E "C3'" 1 
ATOM 93    O "O3'" . DA  A  1 5   ? 93.152  32.252   60.248  1.00 328.79 ? 5   DA  E "O3'" 1 
ATOM 94    C "C2'" . DA  A  1 5   ? 94.466  33.950   59.364  1.00 323.63 ? 5   DA  E "C2'" 1 
ATOM 95    C "C1'" . DA  A  1 5   ? 93.140  34.655   59.183  1.00 328.44 ? 5   DA  E "C1'" 1 
ATOM 96    N N9    . DA  A  1 5   ? 93.089  35.773   58.244  1.00 339.97 ? 5   DA  E N9    1 
ATOM 97    C C8    . DA  A  1 5   ? 93.948  36.834   58.078  1.00 345.77 ? 5   DA  E C8    1 
ATOM 98    N N7    . DA  A  1 5   ? 93.577  37.672   57.140  1.00 348.63 ? 5   DA  E N7    1 
ATOM 99    C C5    . DA  A  1 5   ? 92.395  37.127   56.655  1.00 350.58 ? 5   DA  E C5    1 
ATOM 100   C C6    . DA  A  1 5   ? 91.502  37.542   55.649  1.00 353.14 ? 5   DA  E C6    1 
ATOM 101   N N6    . DA  A  1 5   ? 91.668  38.651   54.921  1.00 350.24 ? 5   DA  E N6    1 
ATOM 102   N N1    . DA  A  1 5   ? 90.418  36.768   55.413  1.00 354.64 ? 5   DA  E N1    1 
ATOM 103   C C2    . DA  A  1 5   ? 90.254  35.653   56.140  1.00 347.97 ? 5   DA  E C2    1 
ATOM 104   N N3    . DA  A  1 5   ? 91.013  35.168   57.121  1.00 344.22 ? 5   DA  E N3    1 
ATOM 105   C C4    . DA  A  1 5   ? 92.082  35.959   57.328  1.00 346.18 ? 5   DA  E C4    1 
ATOM 106   P P     . DA  A  1 6   ? 93.427  30.698   60.410  1.00 335.83 ? 6   DA  E P     1 
ATOM 107   O OP1   . DA  A  1 6   ? 92.536  30.186   61.480  1.00 343.84 ? 6   DA  E OP1   1 
ATOM 108   O OP2   . DA  A  1 6   ? 94.895  30.497   60.502  1.00 336.59 ? 6   DA  E OP2   1 
ATOM 109   O "O5'" . DA  A  1 6   ? 92.926  30.096   59.024  1.00 341.86 ? 6   DA  E "O5'" 1 
ATOM 110   C "C5'" . DA  A  1 6   ? 91.536  30.120   58.659  1.00 353.49 ? 6   DA  E "C5'" 1 
ATOM 111   C "C4'" . DA  A  1 6   ? 91.408  30.003   57.158  1.00 366.00 ? 6   DA  E "C4'" 1 
ATOM 112   O "O4'" . DA  A  1 6   ? 91.648  31.293   56.544  1.00 364.89 ? 6   DA  E "O4'" 1 
ATOM 113   C "C3'" . DA  A  1 6   ? 92.397  29.039   56.495  1.00 377.73 ? 6   DA  E "C3'" 1 
ATOM 114   O "O3'" . DA  A  1 6   ? 91.728  28.394   55.401  1.00 388.10 ? 6   DA  E "O3'" 1 
ATOM 115   C "C2'" . DA  A  1 6   ? 93.470  29.967   55.954  1.00 378.20 ? 6   DA  E "C2'" 1 
ATOM 116   C "C1'" . DA  A  1 6   ? 92.618  31.139   55.518  1.00 369.08 ? 6   DA  E "C1'" 1 
ATOM 117   N N9    . DA  A  1 6   ? 93.308  32.417   55.354  1.00 364.98 ? 6   DA  E N9    1 
ATOM 118   C C8    . DA  A  1 6   ? 94.359  32.935   56.073  1.00 362.26 ? 6   DA  E C8    1 
ATOM 119   N N7    . DA  A  1 6   ? 94.734  34.128   55.677  1.00 356.99 ? 6   DA  E N7    1 
ATOM 120   C C5    . DA  A  1 6   ? 93.862  34.422   54.636  1.00 353.92 ? 6   DA  E C5    1 
ATOM 121   C C6    . DA  A  1 6   ? 93.729  35.547   53.802  1.00 347.66 ? 6   DA  E C6    1 
ATOM 122   N N6    . DA  A  1 6   ? 94.509  36.629   53.887  1.00 343.38 ? 6   DA  E N6    1 
ATOM 123   N N1    . DA  A  1 6   ? 92.762  35.517   52.856  1.00 344.11 ? 6   DA  E N1    1 
ATOM 124   C C2    . DA  A  1 6   ? 91.983  34.430   52.769  1.00 345.44 ? 6   DA  E C2    1 
ATOM 125   N N3    . DA  A  1 6   ? 92.005  33.317   53.500  1.00 350.97 ? 6   DA  E N3    1 
ATOM 126   C C4    . DA  A  1 6   ? 92.977  33.378   54.428  1.00 357.60 ? 6   DA  E C4    1 
ATOM 127   P P     . DA  A  1 7   ? 92.163  26.914   54.890  1.00 389.22 ? 7   DA  E P     1 
ATOM 128   O OP1   . DA  A  1 7   ? 91.211  25.920   55.462  1.00 386.48 ? 7   DA  E OP1   1 
ATOM 129   O OP2   . DA  A  1 7   ? 93.626  26.744   55.107  1.00 398.54 ? 7   DA  E OP2   1 
ATOM 130   O "O5'" . DA  A  1 7   ? 91.922  26.974   53.314  1.00 376.41 ? 7   DA  E "O5'" 1 
ATOM 131   C "C5'" . DA  A  1 7   ? 91.127  28.009   52.692  1.00 368.73 ? 7   DA  E "C5'" 1 
ATOM 132   C "C4'" . DA  A  1 7   ? 91.774  28.423   51.392  1.00 364.43 ? 7   DA  E "C4'" 1 
ATOM 133   O "O4'" . DA  A  1 7   ? 92.369  29.739   51.528  1.00 354.40 ? 7   DA  E "O4'" 1 
ATOM 134   C "C3'" . DA  A  1 7   ? 92.906  27.496   50.935  1.00 362.12 ? 7   DA  E "C3'" 1 
ATOM 135   O "O3'" . DA  A  1 7   ? 92.841  27.382   49.506  1.00 374.38 ? 7   DA  E "O3'" 1 
ATOM 136   C "C2'" . DA  A  1 7   ? 94.153  28.266   51.324  1.00 351.42 ? 7   DA  E "C2'" 1 
ATOM 137   C "C1'" . DA  A  1 7   ? 93.687  29.672   51.014  1.00 342.67 ? 7   DA  E "C1'" 1 
ATOM 138   N N9    . DA  A  1 7   ? 94.483  30.731   51.629  1.00 325.03 ? 7   DA  E N9    1 
ATOM 139   C C8    . DA  A  1 7   ? 95.284  30.624   52.740  1.00 320.93 ? 7   DA  E C8    1 
ATOM 140   N N7    . DA  A  1 7   ? 95.917  31.730   53.044  1.00 313.67 ? 7   DA  E N7    1 
ATOM 141   C C5    . DA  A  1 7   ? 95.539  32.616   52.043  1.00 309.43 ? 7   DA  E C5    1 
ATOM 142   C C6    . DA  A  1 7   ? 95.877  33.958   51.791  1.00 304.65 ? 7   DA  E C6    1 
ATOM 143   N N6    . DA  A  1 7   ? 96.705  34.668   52.560  1.00 306.58 ? 7   DA  E N6    1 
ATOM 144   N N1    . DA  A  1 7   ? 95.323  34.553   50.710  1.00 298.62 ? 7   DA  E N1    1 
ATOM 145   C C2    . DA  A  1 7   ? 94.491  33.838   49.941  1.00 295.62 ? 7   DA  E C2    1 
ATOM 146   N N3    . DA  A  1 7   ? 94.089  32.577   50.081  1.00 301.99 ? 7   DA  E N3    1 
ATOM 147   C C4    . DA  A  1 7   ? 94.662  32.012   51.160  1.00 311.77 ? 7   DA  E C4    1 
ATOM 148   P P     . DA  A  1 8   ? 93.689  26.267   48.697  1.00 386.02 ? 8   DA  E P     1 
ATOM 149   O OP1   . DA  A  1 8   ? 92.789  25.109   48.443  1.00 384.50 ? 8   DA  E OP1   1 
ATOM 150   O OP2   . DA  A  1 8   ? 94.999  26.050   49.403  1.00 385.02 ? 8   DA  E OP2   1 
ATOM 151   O "O5'" . DA  A  1 8   ? 93.923  26.969   47.281  1.00 388.38 ? 8   DA  E "O5'" 1 
ATOM 152   C "C5'" . DA  A  1 8   ? 93.311  28.251   46.952  1.00 380.92 ? 8   DA  E "C5'" 1 
ATOM 153   C "C4'" . DA  A  1 8   ? 94.307  29.145   46.251  1.00 375.51 ? 8   DA  E "C4'" 1 
ATOM 154   O "O4'" . DA  A  1 8   ? 94.950  30.054   47.187  1.00 374.62 ? 8   DA  E "O4'" 1 
ATOM 155   C "C3'" . DA  A  1 8   ? 95.442  28.388   45.564  1.00 374.70 ? 8   DA  E "C3'" 1 
ATOM 156   O "O3'" . DA  A  1 8   ? 95.766  29.056   44.351  1.00 369.62 ? 8   DA  E "O3'" 1 
ATOM 157   C "C2'" . DA  A  1 8   ? 96.603  28.547   46.526  1.00 375.32 ? 8   DA  E "C2'" 1 
ATOM 158   C "C1'" . DA  A  1 8   ? 96.363  29.959   47.022  1.00 365.51 ? 8   DA  E "C1'" 1 
ATOM 159   N N9    . DA  A  1 8   ? 97.013  30.320   48.289  1.00 354.78 ? 8   DA  E N9    1 
ATOM 160   C C8    . DA  A  1 8   ? 97.311  29.517   49.365  1.00 352.07 ? 8   DA  E C8    1 
ATOM 161   N N7    . DA  A  1 8   ? 97.921  30.147   50.342  1.00 341.96 ? 8   DA  E N7    1 
ATOM 162   C C5    . DA  A  1 8   ? 98.049  31.446   49.871  1.00 335.01 ? 8   DA  E C5    1 
ATOM 163   C C6    . DA  A  1 8   ? 98.613  32.606   50.434  1.00 326.69 ? 8   DA  E C6    1 
ATOM 164   N N6    . DA  A  1 8   ? 99.174  32.644   51.645  1.00 322.14 ? 8   DA  E N6    1 
ATOM 165   N N1    . DA  A  1 8   ? 98.575  33.743   49.703  1.00 321.12 ? 8   DA  E N1    1 
ATOM 166   C C2    . DA  A  1 8   ? 98.008  33.705   48.490  1.00 316.88 ? 8   DA  E C2    1 
ATOM 167   N N3    . DA  A  1 8   ? 97.441  32.681   47.855  1.00 323.88 ? 8   DA  E N3    1 
ATOM 168   C C4    . DA  A  1 8   ? 97.500  31.566   48.606  1.00 338.74 ? 8   DA  E C4    1 
ATOM 169   P P     . DA  A  1 9   ? 96.330  28.216   43.132  1.00 368.04 ? 9   DA  E P     1 
ATOM 170   O OP1   . DA  A  1 9   ? 95.179  27.856   42.271  1.00 370.21 ? 9   DA  E OP1   1 
ATOM 171   O OP2   . DA  A  1 9   ? 97.206  27.141   43.673  1.00 362.87 ? 9   DA  E OP2   1 
ATOM 172   O "O5'" . DA  A  1 9   ? 97.255  29.257   42.361  1.00 371.80 ? 9   DA  E "O5'" 1 
ATOM 173   C "C5'" . DA  A  1 9   ? 96.968  30.666   42.360  1.00 372.88 ? 9   DA  E "C5'" 1 
ATOM 174   C "C4'" . DA  A  1 9   ? 98.260  31.439   42.487  1.00 363.44 ? 9   DA  E "C4'" 1 
ATOM 175   O "O4'" . DA  A  1 9   ? 98.627  31.551   43.883  1.00 351.16 ? 9   DA  E "O4'" 1 
ATOM 176   C "C3'" . DA  A  1 9   ? 99.472  30.812   41.791  1.00 362.52 ? 9   DA  E "C3'" 1 
ATOM 177   O "O3'" . DA  A  1 9   ? 100.225 31.892   41.239  1.00 369.16 ? 9   DA  E "O3'" 1 
ATOM 178   C "C2'" . DA  A  1 9   ? 100.262 30.210   42.939  1.00 349.99 ? 9   DA  E "C2'" 1 
ATOM 179   C "C1'" . DA  A  1 9   ? 100.009 31.264   43.994  1.00 337.26 ? 9   DA  E "C1'" 1 
ATOM 180   N N9    . DA  A  1 9   ? 100.297 30.908   45.383  1.00 320.09 ? 9   DA  E N9    1 
ATOM 181   C C8    . DA  A  1 9   ? 100.185 29.691   46.009  1.00 312.98 ? 9   DA  E C8    1 
ATOM 182   N N7    . DA  A  1 9   ? 100.530 29.714   47.274  1.00 309.28 ? 9   DA  E N7    1 
ATOM 183   C C5    . DA  A  1 9   ? 100.902 31.033   47.494  1.00 310.52 ? 9   DA  E C5    1 
ATOM 184   C C6    . DA  A  1 9   ? 101.382 31.705   48.634  1.00 310.36 ? 9   DA  E C6    1 
ATOM 185   N N6    . DA  A  1 9   ? 101.564 31.117   49.818  1.00 308.83 ? 9   DA  E N6    1 
ATOM 186   N N1    . DA  A  1 9   ? 101.663 33.021   48.515  1.00 311.90 ? 9   DA  E N1    1 
ATOM 187   C C2    . DA  A  1 9   ? 101.484 33.611   47.326  1.00 312.48 ? 9   DA  E C2    1 
ATOM 188   N N3    . DA  A  1 9   ? 101.044 33.086   46.183  1.00 312.86 ? 9   DA  E N3    1 
ATOM 189   C C4    . DA  A  1 9   ? 100.771 31.778   46.336  1.00 313.83 ? 9   DA  E C4    1 
ATOM 190   P P     . DA  A  1 10  ? 101.182 31.667   39.981  1.00 366.68 ? 10  DA  E P     1 
ATOM 191   O OP1   . DA  A  1 10  ? 100.353 31.737   38.751  1.00 376.24 ? 10  DA  E OP1   1 
ATOM 192   O OP2   . DA  A  1 10  ? 102.025 30.456   40.231  1.00 363.99 ? 10  DA  E OP2   1 
ATOM 193   O "O5'" . DA  A  1 10  ? 102.088 32.980   39.996  1.00 351.79 ? 10  DA  E "O5'" 1 
ATOM 194   C "C5'" . DA  A  1 10  ? 101.770 34.114   40.836  1.00 332.75 ? 10  DA  E "C5'" 1 
ATOM 195   C "C4'" . DA  A  1 10  ? 103.018 34.605   41.533  1.00 324.80 ? 10  DA  E "C4'" 1 
ATOM 196   O "O4'" . DA  A  1 10  ? 103.088 34.035   42.863  1.00 324.37 ? 10  DA  E "O4'" 1 
ATOM 197   C "C3'" . DA  A  1 10  ? 104.329 34.215   40.848  1.00 325.67 ? 10  DA  E "C3'" 1 
ATOM 198   O "O3'" . DA  A  1 10  ? 105.310 35.209   41.121  1.00 332.60 ? 10  DA  E "O3'" 1 
ATOM 199   C "C2'" . DA  A  1 10  ? 104.765 32.987   41.620  1.00 322.26 ? 10  DA  E "C2'" 1 
ATOM 200   C "C1'" . DA  A  1 10  ? 104.336 33.378   43.016  1.00 325.70 ? 10  DA  E "C1'" 1 
ATOM 201   N N9    . DA  A  1 10  ? 104.155 32.247   43.925  1.00 335.47 ? 10  DA  E N9    1 
ATOM 202   C C8    . DA  A  1 10  ? 103.752 30.969   43.617  1.00 337.89 ? 10  DA  E C8    1 
ATOM 203   N N7    . DA  A  1 10  ? 103.729 30.159   44.647  1.00 346.38 ? 10  DA  E N7    1 
ATOM 204   C C5    . DA  A  1 10  ? 104.169 30.948   45.702  1.00 350.35 ? 10  DA  E C5    1 
ATOM 205   C C6    . DA  A  1 10  ? 104.375 30.675   47.068  1.00 354.76 ? 10  DA  E C6    1 
ATOM 206   N N6    . DA  A  1 10  ? 104.149 29.482   47.626  1.00 359.64 ? 10  DA  E N6    1 
ATOM 207   N N1    . DA  A  1 10  ? 104.821 31.684   47.850  1.00 352.07 ? 10  DA  E N1    1 
ATOM 208   C C2    . DA  A  1 10  ? 105.049 32.879   47.287  1.00 348.42 ? 10  DA  E C2    1 
ATOM 209   N N3    . DA  A  1 10  ? 104.886 33.260   46.020  1.00 347.00 ? 10  DA  E N3    1 
ATOM 210   C C4    . DA  A  1 10  ? 104.445 32.234   45.269  1.00 344.66 ? 10  DA  E C4    1 
ATOM 211   P P     . DA  A  1 11  ? 106.474 35.512   40.076  1.00 343.83 ? 11  DA  E P     1 
ATOM 212   O OP1   . DA  A  1 11  ? 105.923 36.413   39.034  1.00 344.36 ? 11  DA  E OP1   1 
ATOM 213   O OP2   . DA  A  1 11  ? 107.120 34.226   39.686  1.00 351.84 ? 11  DA  E OP2   1 
ATOM 214   O "O5'" . DA  A  1 11  ? 107.483 36.370   40.951  1.00 336.78 ? 11  DA  E "O5'" 1 
ATOM 215   C "C5'" . DA  A  1 11  ? 107.109 36.739   42.288  1.00 319.91 ? 11  DA  E "C5'" 1 
ATOM 216   C "C4'" . DA  A  1 11  ? 108.152 36.253   43.263  1.00 309.92 ? 11  DA  E "C4'" 1 
ATOM 217   O "O4'" . DA  A  1 11  ? 107.739 35.010   43.875  1.00 301.45 ? 11  DA  E "O4'" 1 
ATOM 218   C "C3'" . DA  A  1 11  ? 109.519 35.968   42.638  1.00 311.62 ? 11  DA  E "C3'" 1 
ATOM 219   O "O3'" . DA  A  1 11  ? 110.493 36.293   43.624  1.00 324.38 ? 11  DA  E "O3'" 1 
ATOM 220   C "C2'" . DA  A  1 11  ? 109.528 34.459   42.503  1.00 304.66 ? 11  DA  E "C2'" 1 
ATOM 221   C "C1'" . DA  A  1 11  ? 108.834 34.113   43.797  1.00 302.97 ? 11  DA  E "C1'" 1 
ATOM 222   N N9    . DA  A  1 11  ? 108.326 32.750   43.913  1.00 307.80 ? 11  DA  E N9    1 
ATOM 223   C C8    . DA  A  1 11  ? 107.895 31.893   42.929  1.00 307.81 ? 11  DA  E C8    1 
ATOM 224   N N7    . DA  A  1 11  ? 107.524 30.718   43.377  1.00 317.11 ? 11  DA  E N7    1 
ATOM 225   C C5    . DA  A  1 11  ? 107.747 30.799   44.745  1.00 330.11 ? 11  DA  E C5    1 
ATOM 226   C C6    . DA  A  1 11  ? 107.557 29.879   45.790  1.00 347.91 ? 11  DA  E C6    1 
ATOM 227   N N6    . DA  A  1 11  ? 107.081 28.646   45.610  1.00 368.04 ? 11  DA  E N6    1 
ATOM 228   N N1    . DA  A  1 11  ? 107.880 30.273   47.043  1.00 349.95 ? 11  DA  E N1    1 
ATOM 229   C C2    . DA  A  1 11  ? 108.359 31.511   47.221  1.00 336.56 ? 11  DA  E C2    1 
ATOM 230   N N3    . DA  A  1 11  ? 108.571 32.470   46.322  1.00 324.33 ? 11  DA  E N3    1 
ATOM 231   C C4    . DA  A  1 11  ? 108.246 32.043   45.088  1.00 319.51 ? 11  DA  E C4    1 
ATOM 232   P P     . DA  A  1 12  ? 111.915 36.861   43.193  1.00 325.62 ? 12  DA  E P     1 
ATOM 233   O OP1   . DA  A  1 12  ? 111.721 38.250   42.693  1.00 328.99 ? 12  DA  E OP1   1 
ATOM 234   O OP2   . DA  A  1 12  ? 112.569 35.850   42.311  1.00 325.55 ? 12  DA  E OP2   1 
ATOM 235   O "O5'" . DA  A  1 12  ? 112.668 37.000   44.589  1.00 316.22 ? 12  DA  E "O5'" 1 
ATOM 236   C "C5'" . DA  A  1 12  ? 111.955 36.925   45.846  1.00 300.95 ? 12  DA  E "C5'" 1 
ATOM 237   C "C4'" . DA  A  1 12  ? 112.662 35.948   46.755  1.00 291.26 ? 12  DA  E "C4'" 1 
ATOM 238   O "O4'" . DA  A  1 12  ? 112.053 34.643   46.607  1.00 283.55 ? 12  DA  E "O4'" 1 
ATOM 239   C "C3'" . DA  A  1 12  ? 114.144 35.758   46.423  1.00 290.44 ? 12  DA  E "C3'" 1 
ATOM 240   O "O3'" . DA  A  1 12  ? 114.941 35.632   47.603  1.00 300.20 ? 12  DA  E "O3'" 1 
ATOM 241   C "C2'" . DA  A  1 12  ? 114.175 34.451   45.656  1.00 282.71 ? 12  DA  E "C2'" 1 
ATOM 242   C "C1'" . DA  A  1 12  ? 113.063 33.684   46.336  1.00 275.46 ? 12  DA  E "C1'" 1 
ATOM 243   N N9    . DA  A  1 12  ? 112.470 32.622   45.527  1.00 264.66 ? 12  DA  E N9    1 
ATOM 244   C C8    . DA  A  1 12  ? 112.252 32.596   44.170  1.00 259.72 ? 12  DA  E C8    1 
ATOM 245   N N7    . DA  A  1 12  ? 111.683 31.494   43.747  1.00 256.15 ? 12  DA  E N7    1 
ATOM 246   C C5    . DA  A  1 12  ? 111.516 30.741   44.902  1.00 257.49 ? 12  DA  E C5    1 
ATOM 247   C C6    . DA  A  1 12  ? 110.971 29.464   45.130  1.00 258.35 ? 12  DA  E C6    1 
ATOM 248   N N6    . DA  A  1 12  ? 110.464 28.693   44.165  1.00 260.14 ? 12  DA  E N6    1 
ATOM 249   N N1    . DA  A  1 12  ? 110.960 29.002   46.401  1.00 258.28 ? 12  DA  E N1    1 
ATOM 250   C C2    . DA  A  1 12  ? 111.469 29.777   47.368  1.00 256.89 ? 12  DA  E C2    1 
ATOM 251   N N3    . DA  A  1 12  ? 112.004 30.993   47.280  1.00 256.90 ? 12  DA  E N3    1 
ATOM 252   C C4    . DA  A  1 12  ? 112.000 31.422   46.005  1.00 259.08 ? 12  DA  E C4    1 
ATOM 253   P P     . DA  A  1 13  ? 116.489 36.102   47.595  1.00 308.71 ? 13  DA  E P     1 
ATOM 254   O OP1   . DA  A  1 13  ? 116.562 37.477   48.158  1.00 312.26 ? 13  DA  E OP1   1 
ATOM 255   O OP2   . DA  A  1 13  ? 117.060 35.835   46.240  1.00 302.47 ? 13  DA  E OP2   1 
ATOM 256   O "O5'" . DA  A  1 13  ? 117.180 35.113   48.640  1.00 321.05 ? 13  DA  E "O5'" 1 
ATOM 257   C "C5'" . DA  A  1 13  ? 116.433 34.404   49.659  1.00 342.64 ? 13  DA  E "C5'" 1 
ATOM 258   C "C4'" . DA  A  1 13  ? 116.821 32.941   49.678  1.00 355.85 ? 13  DA  E "C4'" 1 
ATOM 259   O "O4'" . DA  A  1 13  ? 116.075 32.213   48.673  1.00 351.06 ? 13  DA  E "O4'" 1 
ATOM 260   C "C3'" . DA  A  1 13  ? 118.295 32.627   49.402  1.00 360.44 ? 13  DA  E "C3'" 1 
ATOM 261   O "O3'" . DA  A  1 13  ? 118.625 31.506   50.230  1.00 368.95 ? 13  DA  E "O3'" 1 
ATOM 262   C "C2'" . DA  A  1 13  ? 118.286 32.149   47.960  1.00 351.42 ? 13  DA  E "C2'" 1 
ATOM 263   C "C1'" . DA  A  1 13  ? 116.985 31.380   47.975  1.00 344.83 ? 13  DA  E "C1'" 1 
ATOM 264   N N9    . DA  A  1 13  ? 116.389 31.036   46.690  1.00 335.76 ? 13  DA  E N9    1 
ATOM 265   C C8    . DA  A  1 13  ? 116.438 31.698   45.487  1.00 330.77 ? 13  DA  E C8    1 
ATOM 266   N N7    . DA  A  1 13  ? 115.761 31.107   44.532  1.00 331.20 ? 13  DA  E N7    1 
ATOM 267   C C5    . DA  A  1 13  ? 115.230 29.981   45.147  1.00 329.44 ? 13  DA  E C5    1 
ATOM 268   C C6    . DA  A  1 13  ? 114.416 28.933   44.671  1.00 325.00 ? 13  DA  E C6    1 
ATOM 269   N N6    . DA  A  1 13  ? 113.980 28.846   43.413  1.00 323.82 ? 13  DA  E N6    1 
ATOM 270   N N1    . DA  A  1 13  ? 114.070 27.959   45.544  1.00 320.04 ? 13  DA  E N1    1 
ATOM 271   C C2    . DA  A  1 13  ? 114.502 28.050   46.808  1.00 322.58 ? 13  DA  E C2    1 
ATOM 272   N N3    . DA  A  1 13  ? 115.265 28.984   47.373  1.00 329.29 ? 13  DA  E N3    1 
ATOM 273   C C4    . DA  A  1 13  ? 115.603 29.929   46.477  1.00 331.75 ? 13  DA  E C4    1 
ATOM 274   P P     . DA  A  1 14  ? 120.075 31.374   50.906  1.00 373.02 ? 14  DA  E P     1 
ATOM 275   O OP1   . DA  A  1 14  ? 120.085 32.202   52.141  1.00 377.11 ? 14  DA  E OP1   1 
ATOM 276   O OP2   . DA  A  1 14  ? 121.097 31.595   49.845  1.00 377.93 ? 14  DA  E OP2   1 
ATOM 277   O "O5'" . DA  A  1 14  ? 120.160 29.833   51.318  1.00 364.59 ? 14  DA  E "O5'" 1 
ATOM 278   C "C5'" . DA  A  1 14  ? 119.046 29.117   51.908  1.00 357.79 ? 14  DA  E "C5'" 1 
ATOM 279   C "C4'" . DA  A  1 14  ? 118.871 27.746   51.284  1.00 358.14 ? 14  DA  E "C4'" 1 
ATOM 280   O "O4'" . DA  A  1 14  ? 118.330 27.847   49.941  1.00 352.30 ? 14  DA  E "O4'" 1 
ATOM 281   C "C3'" . DA  A  1 14  ? 120.125 26.879   51.143  1.00 364.84 ? 14  DA  E "C3'" 1 
ATOM 282   O "O3'" . DA  A  1 14  ? 119.687 25.511   51.209  1.00 388.19 ? 14  DA  E "O3'" 1 
ATOM 283   C "C2'" . DA  A  1 14  ? 120.549 27.145   49.706  1.00 354.96 ? 14  DA  E "C2'" 1 
ATOM 284   C "C1'" . DA  A  1 14  ? 119.178 27.121   49.053  1.00 342.18 ? 14  DA  E "C1'" 1 
ATOM 285   N N9    . DA  A  1 14  ? 119.017 27.676   47.706  1.00 326.74 ? 14  DA  E N9    1 
ATOM 286   C C8    . DA  A  1 14  ? 119.541 28.818   47.148  1.00 319.73 ? 14  DA  E C8    1 
ATOM 287   N N7    . DA  A  1 14  ? 119.158 29.024   45.910  1.00 316.07 ? 14  DA  E N7    1 
ATOM 288   C C5    . DA  A  1 14  ? 118.325 27.946   45.636  1.00 318.73 ? 14  DA  E C5    1 
ATOM 289   C C6    . DA  A  1 14  ? 117.601 27.577   44.490  1.00 320.12 ? 14  DA  E C6    1 
ATOM 290   N N6    . DA  A  1 14  ? 117.601 28.282   43.358  1.00 326.46 ? 14  DA  E N6    1 
ATOM 291   N N1    . DA  A  1 14  ? 116.864 26.444   44.547  1.00 316.00 ? 14  DA  E N1    1 
ATOM 292   C C2    . DA  A  1 14  ? 116.867 25.735   45.683  1.00 310.53 ? 14  DA  E C2    1 
ATOM 293   N N3    . DA  A  1 14  ? 117.500 25.982   46.827  1.00 312.33 ? 14  DA  E N3    1 
ATOM 294   C C4    . DA  A  1 14  ? 118.225 27.112   46.735  1.00 318.59 ? 14  DA  E C4    1 
ATOM 295   P P     . DA  A  1 15  ? 120.649 24.355   51.762  1.00 407.54 ? 15  DA  E P     1 
ATOM 296   O OP1   . DA  A  1 15  ? 120.216 24.030   53.149  1.00 410.48 ? 15  DA  E OP1   1 
ATOM 297   O OP2   . DA  A  1 15  ? 122.054 24.771   51.515  1.00 418.52 ? 15  DA  E OP2   1 
ATOM 298   O "O5'" . DA  A  1 15  ? 120.340 23.116   50.800  1.00 403.44 ? 15  DA  E "O5'" 1 
ATOM 299   C "C5'" . DA  A  1 15  ? 118.988 22.706   50.501  1.00 386.06 ? 15  DA  E "C5'" 1 
ATOM 300   C "C4'" . DA  A  1 15  ? 118.934 21.829   49.268  1.00 371.67 ? 15  DA  E "C4'" 1 
ATOM 301   O "O4'" . DA  A  1 15  ? 118.916 22.656   48.083  1.00 354.72 ? 15  DA  E "O4'" 1 
ATOM 302   C "C3'" . DA  A  1 15  ? 120.101 20.860   49.058  1.00 371.55 ? 15  DA  E "C3'" 1 
ATOM 303   O "O3'" . DA  A  1 15  ? 119.672 19.771   48.224  1.00 378.13 ? 15  DA  E "O3'" 1 
ATOM 304   C "C2'" . DA  A  1 15  ? 121.048 21.683   48.214  1.00 360.31 ? 15  DA  E "C2'" 1 
ATOM 305   C "C1'" . DA  A  1 15  ? 120.045 22.340   47.286  1.00 348.29 ? 15  DA  E "C1'" 1 
ATOM 306   N N9    . DA  A  1 15  ? 120.495 23.569   46.659  1.00 338.89 ? 15  DA  E N9    1 
ATOM 307   C C8    . DA  A  1 15  ? 121.284 24.580   47.150  1.00 337.11 ? 15  DA  E C8    1 
ATOM 308   N N7    . DA  A  1 15  ? 121.472 25.563   46.302  1.00 332.52 ? 15  DA  E N7    1 
ATOM 309   C C5    . DA  A  1 15  ? 120.749 25.177   45.181  1.00 332.66 ? 15  DA  E C5    1 
ATOM 310   C C6    . DA  A  1 15  ? 120.541 25.787   43.931  1.00 332.56 ? 15  DA  E C6    1 
ATOM 311   N N6    . DA  A  1 15  ? 121.071 26.963   43.582  1.00 327.77 ? 15  DA  E N6    1 
ATOM 312   N N1    . DA  A  1 15  ? 119.767 25.133   43.035  1.00 335.43 ? 15  DA  E N1    1 
ATOM 313   C C2    . DA  A  1 15  ? 119.241 23.949   43.384  1.00 334.20 ? 15  DA  E C2    1 
ATOM 314   N N3    . DA  A  1 15  ? 119.362 23.278   44.527  1.00 330.58 ? 15  DA  E N3    1 
ATOM 315   C C4    . DA  A  1 15  ? 120.134 23.956   45.393  1.00 333.63 ? 15  DA  E C4    1 
ATOM 316   P P     . DA  A  1 16  ? 120.416 18.320   48.271  1.00 383.99 ? 16  DA  E P     1 
ATOM 317   O OP1   . DA  A  1 16  ? 119.522 17.337   48.955  1.00 398.09 ? 16  DA  E OP1   1 
ATOM 318   O OP2   . DA  A  1 16  ? 121.814 18.513   48.747  1.00 386.91 ? 16  DA  E OP2   1 
ATOM 319   O "O5'" . DA  A  1 16  ? 120.481 17.868   46.748  1.00 357.07 ? 16  DA  E "O5'" 1 
ATOM 320   C "C5'" . DA  A  1 16  ? 119.494 18.256   45.782  1.00 328.38 ? 16  DA  E "C5'" 1 
ATOM 321   C "C4'" . DA  A  1 16  ? 120.127 18.132   44.423  1.00 311.52 ? 16  DA  E "C4'" 1 
ATOM 322   O "O4'" . DA  A  1 16  ? 120.501 19.452   43.976  1.00 299.15 ? 16  DA  E "O4'" 1 
ATOM 323   C "C3'" . DA  A  1 16  ? 121.421 17.310   44.457  1.00 309.20 ? 16  DA  E "C3'" 1 
ATOM 324   O "O3'" . DA  A  1 16  ? 121.520 16.470   43.300  1.00 320.52 ? 16  DA  E "O3'" 1 
ATOM 325   C "C2'" . DA  A  1 16  ? 122.510 18.365   44.453  1.00 301.24 ? 16  DA  E "C2'" 1 
ATOM 326   C "C1'" . DA  A  1 16  ? 121.868 19.449   43.617  1.00 296.54 ? 16  DA  E "C1'" 1 
ATOM 327   N N9    . DA  A  1 16  ? 122.404 20.780   43.878  1.00 292.97 ? 16  DA  E N9    1 
ATOM 328   C C8    . DA  A  1 16  ? 123.028 21.210   45.021  1.00 293.55 ? 16  DA  E C8    1 
ATOM 329   N N7    . DA  A  1 16  ? 123.446 22.452   44.960  1.00 295.97 ? 16  DA  E N7    1 
ATOM 330   C C5    . DA  A  1 16  ? 123.090 22.861   43.683  1.00 293.90 ? 16  DA  E C5    1 
ATOM 331   C C6    . DA  A  1 16  ? 123.259 24.079   42.996  1.00 293.19 ? 16  DA  E C6    1 
ATOM 332   N N6    . DA  A  1 16  ? 123.852 25.154   43.524  1.00 291.81 ? 16  DA  E N6    1 
ATOM 333   N N1    . DA  A  1 16  ? 122.790 24.156   41.731  1.00 290.40 ? 16  DA  E N1    1 
ATOM 334   C C2    . DA  A  1 16  ? 122.202 23.075   41.198  1.00 286.78 ? 16  DA  E C2    1 
ATOM 335   N N3    . DA  A  1 16  ? 121.983 21.879   41.742  1.00 286.33 ? 16  DA  E N3    1 
ATOM 336   C C4    . DA  A  1 16  ? 122.452 21.838   43.002  1.00 291.35 ? 16  DA  E C4    1 
ATOM 337   P P     . DA  A  1 17  ? 122.584 15.257   43.213  1.00 331.09 ? 17  DA  E P     1 
ATOM 338   O OP1   . DA  A  1 17  ? 121.861 13.987   43.522  1.00 324.63 ? 17  DA  E OP1   1 
ATOM 339   O OP2   . DA  A  1 17  ? 123.808 15.630   43.983  1.00 330.19 ? 17  DA  E OP2   1 
ATOM 340   O "O5'" . DA  A  1 17  ? 122.945 15.257   41.662  1.00 348.31 ? 17  DA  E "O5'" 1 
ATOM 341   C "C5'" . DA  A  1 17  ? 122.232 16.142   40.762  1.00 369.54 ? 17  DA  E "C5'" 1 
ATOM 342   C "C4'" . DA  A  1 17  ? 123.187 16.873   39.849  1.00 381.17 ? 17  DA  E "C4'" 1 
ATOM 343   O "O4'" . DA  A  1 17  ? 123.480 18.208   40.343  1.00 387.34 ? 17  DA  E "O4'" 1 
ATOM 344   C "C3'" . DA  A  1 17  ? 124.545 16.184   39.671  1.00 385.46 ? 17  DA  E "C3'" 1 
ATOM 345   O "O3'" . DA  A  1 17  ? 124.961 16.288   38.302  1.00 386.47 ? 17  DA  E "O3'" 1 
ATOM 346   C "C2'" . DA  A  1 17  ? 125.474 17.049   40.499  1.00 390.29 ? 17  DA  E "C2'" 1 
ATOM 347   C "C1'" . DA  A  1 17  ? 124.879 18.405   40.209  1.00 391.95 ? 17  DA  E "C1'" 1 
ATOM 348   N N9    . DA  A  1 17  ? 125.305 19.453   41.134  1.00 389.81 ? 17  DA  E N9    1 
ATOM 349   C C8    . DA  A  1 17  ? 125.741 19.297   42.427  1.00 392.93 ? 17  DA  E C8    1 
ATOM 350   N N7    . DA  A  1 17  ? 126.118 20.417   42.997  1.00 389.95 ? 17  DA  E N7    1 
ATOM 351   C C5    . DA  A  1 17  ? 125.945 21.371   42.003  1.00 383.48 ? 17  DA  E C5    1 
ATOM 352   C C6    . DA  A  1 17  ? 126.164 22.762   41.976  1.00 378.63 ? 17  DA  E C6    1 
ATOM 353   N N6    . DA  A  1 17  ? 126.620 23.463   43.019  1.00 374.41 ? 17  DA  E N6    1 
ATOM 354   N N1    . DA  A  1 17  ? 125.892 23.418   40.825  1.00 376.20 ? 17  DA  E N1    1 
ATOM 355   C C2    . DA  A  1 17  ? 125.439 22.714   39.777  1.00 373.29 ? 17  DA  E C2    1 
ATOM 356   N N3    . DA  A  1 17  ? 125.187 21.410   39.682  1.00 375.09 ? 17  DA  E N3    1 
ATOM 357   C C4    . DA  A  1 17  ? 125.464 20.787   40.842  1.00 383.20 ? 17  DA  E C4    1 
ATOM 358   P P     . DA  A  1 18  ? 126.067 15.281   37.695  1.00 393.55 ? 18  DA  E P     1 
ATOM 359   O OP1   . DA  A  1 18  ? 125.354 14.072   37.195  1.00 407.83 ? 18  DA  E OP1   1 
ATOM 360   O OP2   . DA  A  1 18  ? 127.161 15.114   38.698  1.00 390.68 ? 18  DA  E OP2   1 
ATOM 361   O "O5'" . DA  A  1 18  ? 126.666 16.108   36.467  1.00 390.68 ? 18  DA  E "O5'" 1 
ATOM 362   C "C5'" . DA  A  1 18  ? 125.843 16.964   35.627  1.00 378.82 ? 18  DA  E "C5'" 1 
ATOM 363   C "C4'" . DA  A  1 18  ? 126.593 18.199   35.176  1.00 372.48 ? 18  DA  E "C4'" 1 
ATOM 364   O "O4'" . DA  A  1 18  ? 126.800 19.094   36.295  1.00 372.52 ? 18  DA  E "O4'" 1 
ATOM 365   C "C3'" . DA  A  1 18  ? 127.981 17.970   34.563  1.00 369.68 ? 18  DA  E "C3'" 1 
ATOM 366   O "O3'" . DA  A  1 18  ? 128.225 18.908   33.500  1.00 356.53 ? 18  DA  E "O3'" 1 
ATOM 367   C "C2'" . DA  A  1 18  ? 128.915 18.277   35.719  1.00 372.49 ? 18  DA  E "C2'" 1 
ATOM 368   C "C1'" . DA  A  1 18  ? 128.175 19.430   36.369  1.00 373.48 ? 18  DA  E "C1'" 1 
ATOM 369   N N9    . DA  A  1 18  ? 128.495 19.696   37.768  1.00 376.57 ? 18  DA  E N9    1 
ATOM 370   C C8    . DA  A  1 18  ? 128.691 18.809   38.798  1.00 381.03 ? 18  DA  E C8    1 
ATOM 371   N N7    . DA  A  1 18  ? 128.946 19.384   39.949  1.00 385.44 ? 18  DA  E N7    1 
ATOM 372   C C5    . DA  A  1 18  ? 128.911 20.742   39.658  1.00 380.80 ? 18  DA  E C5    1 
ATOM 373   C C6    . DA  A  1 18  ? 129.108 21.889   40.452  1.00 380.09 ? 18  DA  E C6    1 
ATOM 374   N N6    . DA  A  1 18  ? 129.385 21.849   41.759  1.00 379.62 ? 18  DA  E N6    1 
ATOM 375   N N1    . DA  A  1 18  ? 129.011 23.095   39.848  1.00 377.91 ? 18  DA  E N1    1 
ATOM 376   C C2    . DA  A  1 18  ? 128.735 23.136   38.537  1.00 372.81 ? 18  DA  E C2    1 
ATOM 377   N N3    . DA  A  1 18  ? 128.522 22.131   37.689  1.00 370.80 ? 18  DA  E N3    1 
ATOM 378   C C4    . DA  A  1 18  ? 128.629 20.947   38.319  1.00 376.28 ? 18  DA  E C4    1 
ATOM 379   P P     . DA  A  1 19  ? 128.923 18.423   32.127  1.00 348.79 ? 19  DA  E P     1 
ATOM 380   O OP1   . DA  A  1 19  ? 127.857 17.971   31.196  1.00 347.26 ? 19  DA  E OP1   1 
ATOM 381   O OP2   . DA  A  1 19  ? 130.035 17.509   32.476  1.00 354.99 ? 19  DA  E OP2   1 
ATOM 382   O "O5'" . DA  A  1 19  ? 129.619 19.730   31.536  1.00 345.38 ? 19  DA  E "O5'" 1 
ATOM 383   C "C5'" . DA  A  1 19  ? 129.198 21.062   31.874  1.00 348.29 ? 19  DA  E "C5'" 1 
ATOM 384   C "C4'" . DA  A  1 19  ? 130.380 21.899   32.311  1.00 356.34 ? 19  DA  E "C4'" 1 
ATOM 385   O "O4'" . DA  A  1 19  ? 130.519 21.849   33.752  1.00 361.45 ? 19  DA  E "O4'" 1 
ATOM 386   C "C3'" . DA  A  1 19  ? 131.749 21.498   31.749  1.00 357.19 ? 19  DA  E "C3'" 1 
ATOM 387   O "O3'" . DA  A  1 19  ? 132.442 22.716   31.444  1.00 351.18 ? 19  DA  E "O3'" 1 
ATOM 388   C "C2'" . DA  A  1 19  ? 132.429 20.824   32.931  1.00 365.16 ? 19  DA  E "C2'" 1 
ATOM 389   C "C1'" . DA  A  1 19  ? 131.896 21.690   34.052  1.00 370.30 ? 19  DA  E "C1'" 1 
ATOM 390   N N9    . DA  A  1 19  ? 132.009 21.201   35.428  1.00 375.99 ? 19  DA  E N9    1 
ATOM 391   C C8    . DA  A  1 19  ? 132.017 19.916   35.916  1.00 375.56 ? 19  DA  E C8    1 
ATOM 392   N N7    . DA  A  1 19  ? 132.114 19.847   37.222  1.00 379.54 ? 19  DA  E N7    1 
ATOM 393   C C5    . DA  A  1 19  ? 132.165 21.176   37.623  1.00 386.26 ? 19  DA  E C5    1 
ATOM 394   C C6    . DA  A  1 19  ? 132.266 21.783   38.889  1.00 394.17 ? 19  DA  E C6    1 
ATOM 395   N N6    . DA  A  1 19  ? 132.341 21.101   40.035  1.00 406.30 ? 19  DA  E N6    1 
ATOM 396   N N1    . DA  A  1 19  ? 132.300 23.135   38.938  1.00 393.17 ? 19  DA  E N1    1 
ATOM 397   C C2    . DA  A  1 19  ? 132.231 23.820   37.789  1.00 383.26 ? 19  DA  E C2    1 
ATOM 398   N N3    . DA  A  1 19  ? 132.131 23.365   36.542  1.00 381.35 ? 19  DA  E N3    1 
ATOM 399   C C4    . DA  A  1 19  ? 132.101 22.020   36.528  1.00 381.32 ? 19  DA  E C4    1 
ATOM 400   P P     . DA  A  1 20  ? 133.638 22.740   30.374  1.00 340.74 ? 20  DA  E P     1 
ATOM 401   O OP1   . DA  A  1 20  ? 133.051 22.983   29.032  1.00 332.71 ? 20  DA  E OP1   1 
ATOM 402   O OP2   . DA  A  1 20  ? 134.487 21.538   30.594  1.00 341.22 ? 20  DA  E OP2   1 
ATOM 403   O "O5'" . DA  A  1 20  ? 134.490 24.021   30.802  1.00 342.59 ? 20  DA  E "O5'" 1 
ATOM 404   C "C5'" . DA  A  1 20  ? 133.891 25.205   31.385  1.00 344.49 ? 20  DA  E "C5'" 1 
ATOM 405   C "C4'" . DA  A  1 20  ? 134.848 25.876   32.348  1.00 347.82 ? 20  DA  E "C4'" 1 
ATOM 406   O "O4'" . DA  A  1 20  ? 134.725 25.281   33.661  1.00 348.36 ? 20  DA  E "O4'" 1 
ATOM 407   C "C3'" . DA  A  1 20  ? 136.336 25.770   32.001  1.00 353.58 ? 20  DA  E "C3'" 1 
ATOM 408   O "O3'" . DA  A  1 20  ? 137.098 26.857   32.543  1.00 361.01 ? 20  DA  E "O3'" 1 
ATOM 409   C "C2'" . DA  A  1 20  ? 136.784 24.573   32.812  1.00 354.00 ? 20  DA  E "C2'" 1 
ATOM 410   C "C1'" . DA  A  1 20  ? 136.006 24.828   34.080  1.00 356.08 ? 20  DA  E "C1'" 1 
ATOM 411   N N9    . DA  A  1 20  ? 135.814 23.640   34.894  1.00 365.33 ? 20  DA  E N9    1 
ATOM 412   C C8    . DA  A  1 20  ? 135.570 22.350   34.489  1.00 371.79 ? 20  DA  E C8    1 
ATOM 413   N N7    . DA  A  1 20  ? 135.439 21.502   35.480  1.00 377.34 ? 20  DA  E N7    1 
ATOM 414   C C5    . DA  A  1 20  ? 135.610 22.286   36.613  1.00 379.12 ? 20  DA  E C5    1 
ATOM 415   C C6    . DA  A  1 20  ? 135.585 21.983   37.986  1.00 385.41 ? 20  DA  E C6    1 
ATOM 416   N N6    . DA  A  1 20  ? 135.371 20.756   38.469  1.00 391.22 ? 20  DA  E N6    1 
ATOM 417   N N1    . DA  A  1 20  ? 135.792 22.998   38.856  1.00 385.03 ? 20  DA  E N1    1 
ATOM 418   C C2    . DA  A  1 20  ? 136.006 24.229   38.369  1.00 376.02 ? 20  DA  E C2    1 
ATOM 419   N N3    . DA  A  1 20  ? 136.043 24.639   37.103  1.00 369.52 ? 20  DA  E N3    1 
ATOM 420   C C4    . DA  A  1 20  ? 135.842 23.605   36.265  1.00 371.32 ? 20  DA  E C4    1 
ATOM 421   P P     . DA  A  1 21  ? 138.497 27.246   31.864  1.00 372.87 ? 21  DA  E P     1 
ATOM 422   O OP1   . DA  A  1 21  ? 138.299 28.486   31.067  1.00 374.95 ? 21  DA  E OP1   1 
ATOM 423   O OP2   . DA  A  1 21  ? 139.049 26.019   31.221  1.00 383.58 ? 21  DA  E OP2   1 
ATOM 424   O "O5'" . DA  A  1 21  ? 139.474 27.549   33.084  1.00 365.63 ? 21  DA  E "O5'" 1 
ATOM 425   C "C5'" . DA  A  1 21  ? 139.147 28.433   34.168  1.00 347.69 ? 21  DA  E "C5'" 1 
ATOM 426   C "C4'" . DA  A  1 21  ? 139.998 28.049   35.355  1.00 337.11 ? 21  DA  E "C4'" 1 
ATOM 427   O "O4'" . DA  A  1 21  ? 139.520 26.777   35.857  1.00 334.00 ? 21  DA  E "O4'" 1 
ATOM 428   C "C3'" . DA  A  1 21  ? 141.483 27.832   35.039  1.00 328.64 ? 21  DA  E "C3'" 1 
ATOM 429   O "O3'" . DA  A  1 21  ? 142.281 28.155   36.190  1.00 313.22 ? 21  DA  E "O3'" 1 
ATOM 430   C "C2'" . DA  A  1 21  ? 141.560 26.334   34.817  1.00 330.36 ? 21  DA  E "C2'" 1 
ATOM 431   C "C1'" . DA  A  1 21  ? 140.609 25.872   35.897  1.00 332.03 ? 21  DA  E "C1'" 1 
ATOM 432   N N9    . DA  A  1 21  ? 140.079 24.523   35.763  1.00 330.51 ? 21  DA  E N9    1 
ATOM 433   C C8    . DA  A  1 21  ? 139.729 23.814   34.639  1.00 328.58 ? 21  DA  E C8    1 
ATOM 434   N N7    . DA  A  1 21  ? 139.280 22.609   34.895  1.00 329.26 ? 21  DA  E N7    1 
ATOM 435   C C5    . DA  A  1 21  ? 139.334 22.520   36.280  1.00 333.95 ? 21  DA  E C5    1 
ATOM 436   C C6    . DA  A  1 21  ? 138.990 21.493   37.180  1.00 338.83 ? 21  DA  E C6    1 
ATOM 437   N N6    . DA  A  1 21  ? 138.507 20.306   36.801  1.00 343.51 ? 21  DA  E N6    1 
ATOM 438   N N1    . DA  A  1 21  ? 139.169 21.728   38.500  1.00 340.10 ? 21  DA  E N1    1 
ATOM 439   C C2    . DA  A  1 21  ? 139.654 22.920   38.880  1.00 335.84 ? 21  DA  E C2    1 
ATOM 440   N N3    . DA  A  1 21  ? 140.008 23.963   38.131  1.00 333.93 ? 21  DA  E N3    1 
ATOM 441   C C4    . DA  A  1 21  ? 139.820 23.695   36.826  1.00 332.54 ? 21  DA  E C4    1 
ATOM 442   P P     . DA  A  1 22  ? 143.836 28.582   36.042  1.00 298.48 ? 22  DA  E P     1 
ATOM 443   O OP1   . DA  A  1 22  ? 143.946 30.038   36.307  1.00 296.62 ? 22  DA  E OP1   1 
ATOM 444   O OP2   . DA  A  1 22  ? 144.359 28.022   34.767  1.00 295.84 ? 22  DA  E OP2   1 
ATOM 445   O "O5'" . DA  A  1 22  ? 144.563 27.825   37.245  1.00 298.25 ? 22  DA  E "O5'" 1 
ATOM 446   C "C5'" . DA  A  1 22  ? 144.114 27.921   38.615  1.00 301.35 ? 22  DA  E "C5'" 1 
ATOM 447   C "C4'" . DA  A  1 22  ? 144.492 26.670   39.380  1.00 300.90 ? 22  DA  E "C4'" 1 
ATOM 448   O "O4'" . DA  A  1 22  ? 143.708 25.536   38.926  1.00 294.55 ? 22  DA  E "O4'" 1 
ATOM 449   C "C3'" . DA  A  1 22  ? 145.954 26.237   39.246  1.00 302.81 ? 22  DA  E "C3'" 1 
ATOM 450   O "O3'" . DA  A  1 22  ? 146.379 25.614   40.468  1.00 311.28 ? 22  DA  E "O3'" 1 
ATOM 451   C "C2'" . DA  A  1 22  ? 145.885 25.151   38.191  1.00 295.34 ? 22  DA  E "C2'" 1 
ATOM 452   C "C1'" . DA  A  1 22  ? 144.599 24.474   38.618  1.00 287.47 ? 22  DA  E "C1'" 1 
ATOM 453   N N9    . DA  A  1 22  ? 143.973 23.623   37.607  1.00 275.91 ? 22  DA  E N9    1 
ATOM 454   C C8    . DA  A  1 22  ? 143.876 23.828   36.252  1.00 270.85 ? 22  DA  E C8    1 
ATOM 455   N N7    . DA  A  1 22  ? 143.270 22.857   35.613  1.00 268.53 ? 22  DA  E N7    1 
ATOM 456   C C5    . DA  A  1 22  ? 142.965 21.941   36.610  1.00 269.89 ? 22  DA  E C5    1 
ATOM 457   C C6    . DA  A  1 22  ? 142.326 20.685   36.582  1.00 270.08 ? 22  DA  E C6    1 
ATOM 458   N N6    . DA  A  1 22  ? 141.859 20.116   35.468  1.00 271.47 ? 22  DA  E N6    1 
ATOM 459   N N1    . DA  A  1 22  ? 142.186 20.026   37.754  1.00 267.77 ? 22  DA  E N1    1 
ATOM 460   C C2    . DA  A  1 22  ? 142.657 20.597   38.872  1.00 265.32 ? 22  DA  E C2    1 
ATOM 461   N N3    . DA  A  1 22  ? 143.268 21.771   39.027  1.00 266.41 ? 22  DA  E N3    1 
ATOM 462   C C4    . DA  A  1 22  ? 143.398 22.398   37.844  1.00 270.75 ? 22  DA  E C4    1 
ATOM 463   P P     . DA  A  1 23  ? 147.951 25.475   40.826  1.00 314.23 ? 23  DA  E P     1 
ATOM 464   O OP1   . DA  A  1 23  ? 148.246 26.351   41.997  1.00 311.87 ? 23  DA  E OP1   1 
ATOM 465   O OP2   . DA  A  1 23  ? 148.736 25.633   39.566  1.00 314.23 ? 23  DA  E OP2   1 
ATOM 466   O "O5'" . DA  A  1 23  ? 148.106 23.959   41.303  1.00 318.80 ? 23  DA  E "O5'" 1 
ATOM 467   C "C5'" . DA  A  1 23  ? 147.303 23.383   42.357  1.00 325.23 ? 23  DA  E "C5'" 1 
ATOM 468   C "C4'" . DA  A  1 23  ? 147.447 21.879   42.331  1.00 332.55 ? 23  DA  E "C4'" 1 
ATOM 469   O "O4'" . DA  A  1 23  ? 146.710 21.342   41.203  1.00 327.58 ? 23  DA  E "O4'" 1 
ATOM 470   C "C3'" . DA  A  1 23  ? 148.887 21.384   42.160  1.00 341.28 ? 23  DA  E "C3'" 1 
ATOM 471   O "O3'" . DA  A  1 23  ? 149.092 20.134   42.842  1.00 358.59 ? 23  DA  E "O3'" 1 
ATOM 472   C "C2'" . DA  A  1 23  ? 148.977 21.145   40.665  1.00 334.67 ? 23  DA  E "C2'" 1 
ATOM 473   C "C1'" . DA  A  1 23  ? 147.596 20.583   40.393  1.00 323.41 ? 23  DA  E "C1'" 1 
ATOM 474   N N9    . DA  A  1 23  ? 147.147 20.677   39.004  1.00 308.46 ? 23  DA  E N9    1 
ATOM 475   C C8    . DA  A  1 23  ? 147.404 21.658   38.078  1.00 304.40 ? 23  DA  E C8    1 
ATOM 476   N N7    . DA  A  1 23  ? 146.867 21.432   36.904  1.00 298.72 ? 23  DA  E N7    1 
ATOM 477   C C5    . DA  A  1 23  ? 146.225 20.211   37.061  1.00 294.87 ? 23  DA  E C5    1 
ATOM 478   C C6    . DA  A  1 23  ? 145.476 19.412   36.177  1.00 290.22 ? 23  DA  E C6    1 
ATOM 479   N N6    . DA  A  1 23  ? 145.231 19.740   34.905  1.00 290.11 ? 23  DA  E N6    1 
ATOM 480   N N1    . DA  A  1 23  ? 144.981 18.247   36.650  1.00 284.88 ? 23  DA  E N1    1 
ATOM 481   C C2    . DA  A  1 23  ? 145.238 17.910   37.921  1.00 282.33 ? 23  DA  E C2    1 
ATOM 482   N N3    . DA  A  1 23  ? 145.920 18.578   38.849  1.00 287.24 ? 23  DA  E N3    1 
ATOM 483   C C4    . DA  A  1 23  ? 146.397 19.731   38.348  1.00 296.88 ? 23  DA  E C4    1 
ATOM 484   P P     . DA  A  1 24  ? 150.556 19.717   43.410  1.00 366.43 ? 24  DA  E P     1 
ATOM 485   O OP1   . DA  A  1 24  ? 150.447 19.562   44.886  1.00 369.24 ? 24  DA  E OP1   1 
ATOM 486   O OP2   . DA  A  1 24  ? 151.564 20.669   42.856  1.00 369.16 ? 24  DA  E OP2   1 
ATOM 487   O "O5'" . DA  A  1 24  ? 150.810 18.270   42.775  1.00 362.78 ? 24  DA  E "O5'" 1 
ATOM 488   C "C5'" . DA  A  1 24  ? 150.005 17.100   43.117  1.00 357.85 ? 24  DA  E "C5'" 1 
ATOM 489   C "C4'" . DA  A  1 24  ? 150.131 15.976   42.106  1.00 355.80 ? 24  DA  E "C4'" 1 
ATOM 490   O "O4'" . DA  A  1 24  ? 149.492 16.346   40.859  1.00 363.10 ? 24  DA  E "O4'" 1 
ATOM 491   C "C3'" . DA  A  1 24  ? 151.550 15.529   41.725  1.00 351.68 ? 24  DA  E "C3'" 1 
ATOM 492   O "O3'" . DA  A  1 24  ? 151.591 14.130   41.372  1.00 344.01 ? 24  DA  E "O3'" 1 
ATOM 493   C "C2'" . DA  A  1 24  ? 151.792 16.285   40.435  1.00 356.17 ? 24  DA  E "C2'" 1 
ATOM 494   C "C1'" . DA  A  1 24  ? 150.422 16.143   39.805  1.00 365.88 ? 24  DA  E "C1'" 1 
ATOM 495   N N9    . DA  A  1 24  ? 150.118 17.080   38.729  1.00 375.89 ? 24  DA  E N9    1 
ATOM 496   C C8    . DA  A  1 24  ? 150.597 18.346   38.492  1.00 381.73 ? 24  DA  E C8    1 
ATOM 497   N N7    . DA  A  1 24  ? 150.118 18.898   37.403  1.00 387.21 ? 24  DA  E N7    1 
ATOM 498   C C5    . DA  A  1 24  ? 149.290 17.918   36.871  1.00 384.11 ? 24  DA  E C5    1 
ATOM 499   C C6    . DA  A  1 24  ? 148.512 17.865   35.698  1.00 383.00 ? 24  DA  E C6    1 
ATOM 500   N N6    . DA  A  1 24  ? 148.421 18.868   34.819  1.00 385.38 ? 24  DA  E N6    1 
ATOM 501   N N1    . DA  A  1 24  ? 147.803 16.739   35.467  1.00 378.06 ? 24  DA  E N1    1 
ATOM 502   C C2    . DA  A  1 24  ? 147.891 15.732   36.348  1.00 375.27 ? 24  DA  E C2    1 
ATOM 503   N N3    . DA  A  1 24  ? 148.596 15.655   37.472  1.00 378.12 ? 24  DA  E N3    1 
ATOM 504   C C4    . DA  A  1 24  ? 149.285 16.792   37.676  1.00 380.08 ? 24  DA  E C4    1 
ATOM 505   P P     . DA  A  1 25  ? 153.004 13.383   41.114  1.00 338.84 ? 25  DA  E P     1 
ATOM 506   O OP1   . DA  A  1 25  ? 153.350 12.642   42.336  1.00 336.77 ? 25  DA  E OP1   1 
ATOM 507   O OP2   . DA  A  1 25  ? 153.953 14.346   40.505  1.00 332.22 ? 25  DA  E OP2   1 
ATOM 508   O "O5'" . DA  A  1 25  ? 152.682 12.251   40.046  1.00 347.28 ? 25  DA  E "O5'" 1 
ATOM 509   C "C5'" . DA  A  1 25  ? 151.377 11.667   39.992  1.00 360.50 ? 25  DA  E "C5'" 1 
ATOM 510   C "C4'" . DA  A  1 25  ? 151.094 10.986   38.669  1.00 368.63 ? 25  DA  E "C4'" 1 
ATOM 511   O "O4'" . DA  A  1 25  ? 150.733 11.959   37.673  1.00 369.47 ? 25  DA  E "O4'" 1 
ATOM 512   C "C3'" . DA  A  1 25  ? 152.196 10.156   38.023  1.00 375.60 ? 25  DA  E "C3'" 1 
ATOM 513   O "O3'" . DA  A  1 25  ? 151.563 9.248    37.113  1.00 386.40 ? 25  DA  E "O3'" 1 
ATOM 514   C "C2'" . DA  A  1 25  ? 152.921 11.193   37.203  1.00 373.74 ? 25  DA  E "C2'" 1 
ATOM 515   C "C1'" . DA  A  1 25  ? 151.741 11.997   36.680  1.00 371.45 ? 25  DA  E "C1'" 1 
ATOM 516   N N9    . DA  A  1 25  ? 152.013 13.394   36.388  1.00 373.29 ? 25  DA  E N9    1 
ATOM 517   C C8    . DA  A  1 25  ? 152.835 14.320   36.982  1.00 370.58 ? 25  DA  E C8    1 
ATOM 518   N N7    . DA  A  1 25  ? 152.780 15.507   36.428  1.00 373.87 ? 25  DA  E N7    1 
ATOM 519   C C5    . DA  A  1 25  ? 151.858 15.350   35.402  1.00 383.52 ? 25  DA  E C5    1 
ATOM 520   C C6    . DA  A  1 25  ? 151.365 16.233   34.426  1.00 394.59 ? 25  DA  E C6    1 
ATOM 521   N N6    . DA  A  1 25  ? 151.736 17.511   34.327  1.00 407.01 ? 25  DA  E N6    1 
ATOM 522   N N1    . DA  A  1 25  ? 150.457 15.753   33.549  1.00 400.47 ? 25  DA  E N1    1 
ATOM 523   C C2    . DA  A  1 25  ? 150.074 14.472   33.657  1.00 397.74 ? 25  DA  E C2    1 
ATOM 524   N N3    . DA  A  1 25  ? 150.460 13.549   34.529  1.00 387.04 ? 25  DA  E N3    1 
ATOM 525   C C4    . DA  A  1 25  ? 151.366 14.058   35.381  1.00 379.85 ? 25  DA  E C4    1 
ATOM 526   P P     . DA  A  1 26  ? 152.140 7.767    36.926  1.00 385.59 ? 26  DA  E P     1 
ATOM 527   O OP1   . DA  A  1 26  ? 151.584 6.917    38.011  1.00 384.56 ? 26  DA  E OP1   1 
ATOM 528   O OP2   . DA  A  1 26  ? 153.612 7.871    36.762  1.00 383.98 ? 26  DA  E OP2   1 
ATOM 529   O "O5'" . DA  A  1 26  ? 151.557 7.297    35.514  1.00 387.86 ? 26  DA  E "O5'" 1 
ATOM 530   C "C5'" . DA  A  1 26  ? 150.598 8.074    34.755  1.00 386.86 ? 26  DA  E "C5'" 1 
ATOM 531   C "C4'" . DA  A  1 26  ? 150.932 8.059    33.276  1.00 389.17 ? 26  DA  E "C4'" 1 
ATOM 532   O "O4'" . DA  A  1 26  ? 151.289 9.395    32.844  1.00 388.37 ? 26  DA  E "O4'" 1 
ATOM 533   C "C3'" . DA  A  1 26  ? 152.088 7.152    32.840  1.00 392.53 ? 26  DA  E "C3'" 1 
ATOM 534   O "O3'" . DA  A  1 26  ? 151.833 6.497    31.592  1.00 394.32 ? 26  DA  E "O3'" 1 
ATOM 535   C "C2'" . DA  A  1 26  ? 153.258 8.110    32.702  1.00 392.37 ? 26  DA  E "C2'" 1 
ATOM 536   C "C1'" . DA  A  1 26  ? 152.598 9.423    32.294  1.00 392.09 ? 26  DA  E "C1'" 1 
ATOM 537   N N9    . DA  A  1 26  ? 153.258 10.642   32.776  1.00 399.41 ? 26  DA  E N9    1 
ATOM 538   C C8    . DA  A  1 26  ? 154.127 10.803   33.830  1.00 402.05 ? 26  DA  E C8    1 
ATOM 539   N N7    . DA  A  1 26  ? 154.527 12.040   34.003  1.00 404.16 ? 26  DA  E N7    1 
ATOM 540   C C5    . DA  A  1 26  ? 153.860 12.748   33.011  1.00 403.10 ? 26  DA  E C5    1 
ATOM 541   C C6    . DA  A  1 26  ? 153.852 14.115   32.659  1.00 399.58 ? 26  DA  E C6    1 
ATOM 542   N N6    . DA  A  1 26  ? 154.562 15.054   33.293  1.00 386.05 ? 26  DA  E N6    1 
ATOM 543   N N1    . DA  A  1 26  ? 153.082 14.486   31.614  1.00 406.31 ? 26  DA  E N1    1 
ATOM 544   C C2    . DA  A  1 26  ? 152.380 13.545   30.967  1.00 415.74 ? 26  DA  E C2    1 
ATOM 545   N N3    . DA  A  1 26  ? 152.294 12.238   31.209  1.00 411.76 ? 26  DA  E N3    1 
ATOM 546   C C4    . DA  A  1 26  ? 153.067 11.900   32.255  1.00 405.05 ? 26  DA  E C4    1 
ATOM 547   P P     . DT  B  2 1   ? 152.572 19.258   23.322  1.00 481.24 ? 1   DT  F P     1 
ATOM 548   O OP1   . DT  B  2 1   ? 153.098 19.441   21.945  1.00 475.16 ? 1   DT  F OP1   1 
ATOM 549   O OP2   . DT  B  2 1   ? 151.392 20.054   23.762  1.00 478.90 ? 1   DT  F OP2   1 
ATOM 550   O "O5'" . DT  B  2 1   ? 152.307 17.709   23.606  1.00 496.21 ? 1   DT  F "O5'" 1 
ATOM 551   C "C5'" . DT  B  2 1   ? 153.382 16.781   23.918  1.00 500.02 ? 1   DT  F "C5'" 1 
ATOM 552   C "C4'" . DT  B  2 1   ? 153.001 15.820   25.024  1.00 498.11 ? 1   DT  F "C4'" 1 
ATOM 553   O "O4'" . DT  B  2 1   ? 153.465 16.327   26.305  1.00 496.78 ? 1   DT  F "O4'" 1 
ATOM 554   C "C3'" . DT  B  2 1   ? 151.502 15.537   25.194  1.00 495.33 ? 1   DT  F "C3'" 1 
ATOM 555   O "O3'" . DT  B  2 1   ? 151.253 14.130   25.373  1.00 495.95 ? 1   DT  F "O3'" 1 
ATOM 556   C "C2'" . DT  B  2 1   ? 151.138 16.317   26.448  1.00 492.14 ? 1   DT  F "C2'" 1 
ATOM 557   C "C1'" . DT  B  2 1   ? 152.419 16.202   27.261  1.00 493.52 ? 1   DT  F "C1'" 1 
ATOM 558   N N1    . DT  B  2 1   ? 152.661 17.176   28.390  1.00 491.43 ? 1   DT  F N1    1 
ATOM 559   C C2    . DT  B  2 1   ? 153.074 16.641   29.592  1.00 475.63 ? 1   DT  F C2    1 
ATOM 560   O O2    . DT  B  2 1   ? 153.253 15.447   29.760  1.00 479.56 ? 1   DT  F O2    1 
ATOM 561   N N3    . DT  B  2 1   ? 153.270 17.562   30.594  1.00 454.15 ? 1   DT  F N3    1 
ATOM 562   C C4    . DT  B  2 1   ? 153.092 18.931   30.518  1.00 446.34 ? 1   DT  F C4    1 
ATOM 563   O O4    . DT  B  2 1   ? 153.311 19.632   31.501  1.00 436.96 ? 1   DT  F O4    1 
ATOM 564   C C5    . DT  B  2 1   ? 152.652 19.426   29.232  1.00 452.38 ? 1   DT  F C5    1 
ATOM 565   C C7    . DT  B  2 1   ? 152.434 20.896   29.056  1.00 443.42 ? 1   DT  F C7    1 
ATOM 566   C C6    . DT  B  2 1   ? 152.458 18.535   28.246  1.00 474.24 ? 1   DT  F C6    1 
ATOM 567   P P     . DT  B  2 2   ? 149.887 13.447   24.833  1.00 495.40 ? 2   DT  F P     1 
ATOM 568   O OP1   . DT  B  2 2   ? 150.235 12.563   23.689  1.00 499.16 ? 2   DT  F OP1   1 
ATOM 569   O OP2   . DT  B  2 2   ? 148.860 14.509   24.652  1.00 492.97 ? 2   DT  F OP2   1 
ATOM 570   O "O5'" . DT  B  2 2   ? 149.405 12.541   26.056  1.00 490.64 ? 2   DT  F "O5'" 1 
ATOM 571   C "C5'" . DT  B  2 2   ? 150.314 11.700   26.804  1.00 493.11 ? 2   DT  F "C5'" 1 
ATOM 572   C "C4'" . DT  B  2 2   ? 149.878 11.582   28.249  1.00 489.27 ? 2   DT  F "C4'" 1 
ATOM 573   O "O4'" . DT  B  2 2   ? 150.185 12.805   28.963  1.00 489.48 ? 2   DT  F "O4'" 1 
ATOM 574   C "C3'" . DT  B  2 2   ? 148.389 11.311   28.501  1.00 485.94 ? 2   DT  F "C3'" 1 
ATOM 575   O "O3'" . DT  B  2 2   ? 148.305 10.378   29.595  1.00 484.59 ? 2   DT  F "O3'" 1 
ATOM 576   C "C2'" . DT  B  2 2   ? 147.845 12.675   28.912  1.00 486.39 ? 2   DT  F "C2'" 1 
ATOM 577   C "C1'" . DT  B  2 2   ? 149.032 13.228   29.683  1.00 487.34 ? 2   DT  F "C1'" 1 
ATOM 578   N N1    . DT  B  2 2   ? 149.132 14.695   29.897  1.00 485.53 ? 2   DT  F N1    1 
ATOM 579   C C2    . DT  B  2 2   ? 149.742 15.092   31.062  1.00 485.13 ? 2   DT  F C2    1 
ATOM 580   O O2    . DT  B  2 2   ? 150.144 14.301   31.900  1.00 486.11 ? 2   DT  F O2    1 
ATOM 581   N N3    . DT  B  2 2   ? 149.834 16.454   31.229  1.00 483.74 ? 2   DT  F N3    1 
ATOM 582   C C4    . DT  B  2 2   ? 149.386 17.434   30.363  1.00 467.50 ? 2   DT  F C4    1 
ATOM 583   O O4    . DT  B  2 2   ? 149.528 18.622   30.655  1.00 446.72 ? 2   DT  F O4    1 
ATOM 584   C C5    . DT  B  2 2   ? 148.756 16.944   29.153  1.00 470.68 ? 2   DT  F C5    1 
ATOM 585   C C7    . DT  B  2 2   ? 148.233 17.929   28.156  1.00 464.14 ? 2   DT  F C7    1 
ATOM 586   C C6    . DT  B  2 2   ? 148.665 15.617   28.983  1.00 483.57 ? 2   DT  F C6    1 
ATOM 587   P P     . DT  B  2 3   ? 147.164 9.231    29.665  1.00 485.04 ? 3   DT  F P     1 
ATOM 588   O OP1   . DT  B  2 3   ? 147.788 7.936    29.257  1.00 484.31 ? 3   DT  F OP1   1 
ATOM 589   O OP2   . DT  B  2 3   ? 145.962 9.714    28.915  1.00 482.90 ? 3   DT  F OP2   1 
ATOM 590   O "O5'" . DT  B  2 3   ? 146.842 9.190    31.235  1.00 484.61 ? 3   DT  F "O5'" 1 
ATOM 591   C "C5'" . DT  B  2 3   ? 147.891 9.408    32.235  1.00 451.11 ? 3   DT  F "C5'" 1 
ATOM 592   C "C4'" . DT  B  2 3   ? 147.386 9.993    33.540  1.00 417.83 ? 3   DT  F "C4'" 1 
ATOM 593   O "O4'" . DT  B  2 3   ? 147.632 11.421   33.580  1.00 405.02 ? 3   DT  F "O4'" 1 
ATOM 594   C "C3'" . DT  B  2 3   ? 145.897 9.804    33.859  1.00 405.13 ? 3   DT  F "C3'" 1 
ATOM 595   O "O3'" . DT  B  2 3   ? 145.640 9.387    35.206  1.00 387.98 ? 3   DT  F "O3'" 1 
ATOM 596   C "C2'" . DT  B  2 3   ? 145.294 11.189   33.686  1.00 401.30 ? 3   DT  F "C2'" 1 
ATOM 597   C "C1'" . DT  B  2 3   ? 146.460 12.104   34.008  1.00 402.41 ? 3   DT  F "C1'" 1 
ATOM 598   N N1    . DT  B  2 3   ? 146.410 13.427   33.327  1.00 411.80 ? 3   DT  F N1    1 
ATOM 599   C C2    . DT  B  2 3   ? 147.003 14.481   33.978  1.00 409.27 ? 3   DT  F C2    1 
ATOM 600   O O2    . DT  B  2 3   ? 147.562 14.360   35.056  1.00 394.50 ? 3   DT  F O2    1 
ATOM 601   N N3    . DT  B  2 3   ? 146.916 15.688   33.318  1.00 420.09 ? 3   DT  F N3    1 
ATOM 602   C C4    . DT  B  2 3   ? 146.289 15.938   32.107  1.00 434.25 ? 3   DT  F C4    1 
ATOM 603   O O4    . DT  B  2 3   ? 146.269 17.081   31.647  1.00 435.86 ? 3   DT  F O4    1 
ATOM 604   C C5    . DT  B  2 3   ? 145.684 14.782   31.479  1.00 441.39 ? 3   DT  F C5    1 
ATOM 605   C C7    . DT  B  2 3   ? 144.985 14.948   30.166  1.00 453.94 ? 3   DT  F C7    1 
ATOM 606   C C6    . DT  B  2 3   ? 145.776 13.602   32.112  1.00 432.57 ? 3   DT  F C6    1 
ATOM 607   P P     . DT  B  2 4   ? 144.261 8.619    35.557  1.00 384.09 ? 4   DT  F P     1 
ATOM 608   O OP1   . DT  B  2 4   ? 144.534 7.154    35.553  1.00 393.66 ? 4   DT  F OP1   1 
ATOM 609   O OP2   . DT  B  2 4   ? 143.177 9.171    34.707  1.00 386.98 ? 4   DT  F OP2   1 
ATOM 610   O "O5'" . DT  B  2 4   ? 143.916 9.103    37.033  1.00 370.58 ? 4   DT  F "O5'" 1 
ATOM 611   C "C5'" . DT  B  2 4   ? 144.958 9.356    37.973  1.00 362.11 ? 4   DT  F "C5'" 1 
ATOM 612   C "C4'" . DT  B  2 4   ? 144.626 10.616   38.729  1.00 354.40 ? 4   DT  F "C4'" 1 
ATOM 613   O "O4'" . DT  B  2 4   ? 144.891 11.753   37.873  1.00 338.01 ? 4   DT  F "O4'" 1 
ATOM 614   C "C3'" . DT  B  2 4   ? 143.160 10.731   39.172  1.00 345.24 ? 4   DT  F "C3'" 1 
ATOM 615   O "O3'" . DT  B  2 4   ? 143.110 11.010   40.581  1.00 343.86 ? 4   DT  F "O3'" 1 
ATOM 616   C "C2'" . DT  B  2 4   ? 142.634 11.920   38.385  1.00 331.84 ? 4   DT  F "C2'" 1 
ATOM 617   C "C1'" . DT  B  2 4   ? 143.900 12.716   38.126  1.00 322.84 ? 4   DT  F "C1'" 1 
ATOM 618   N N1    . DT  B  2 4   ? 143.814 13.601   36.963  1.00 306.44 ? 4   DT  F N1    1 
ATOM 619   C C2    . DT  B  2 4   ? 144.484 14.804   36.986  1.00 299.79 ? 4   DT  F C2    1 
ATOM 620   O O2    . DT  B  2 4   ? 145.189 15.158   37.916  1.00 295.31 ? 4   DT  F O2    1 
ATOM 621   N N3    . DT  B  2 4   ? 144.284 15.589   35.878  1.00 298.78 ? 4   DT  F N3    1 
ATOM 622   C C4    . DT  B  2 4   ? 143.502 15.293   34.775  1.00 300.25 ? 4   DT  F C4    1 
ATOM 623   O O4    . DT  B  2 4   ? 143.413 16.101   33.854  1.00 306.94 ? 4   DT  F O4    1 
ATOM 624   C C5    . DT  B  2 4   ? 142.835 14.009   34.819  1.00 299.76 ? 4   DT  F C5    1 
ATOM 625   C C7    . DT  B  2 4   ? 141.967 13.599   33.671  1.00 298.88 ? 4   DT  F C7    1 
ATOM 626   C C6    . DT  B  2 4   ? 143.012 13.246   35.902  1.00 301.43 ? 4   DT  F C6    1 
ATOM 627   P P     . DT  B  2 5   ? 141.827 10.622   41.495  1.00 331.76 ? 5   DT  F P     1 
ATOM 628   O OP1   . DT  B  2 5   ? 142.049 9.267    42.059  1.00 336.62 ? 5   DT  F OP1   1 
ATOM 629   O OP2   . DT  B  2 5   ? 140.578 10.924   40.737  1.00 326.18 ? 5   DT  F OP2   1 
ATOM 630   O "O5'" . DT  B  2 5   ? 141.951 11.631   42.723  1.00 319.33 ? 5   DT  F "O5'" 1 
ATOM 631   C "C5'" . DT  B  2 5   ? 143.227 12.192   43.113  1.00 314.64 ? 5   DT  F "C5'" 1 
ATOM 632   C "C4'" . DT  B  2 5   ? 143.064 13.661   43.427  1.00 306.98 ? 5   DT  F "C4'" 1 
ATOM 633   O "O4'" . DT  B  2 5   ? 143.305 14.458   42.238  1.00 295.50 ? 5   DT  F "O4'" 1 
ATOM 634   C "C3'" . DT  B  2 5   ? 141.658 14.032   43.905  1.00 309.33 ? 5   DT  F "C3'" 1 
ATOM 635   O "O3'" . DT  B  2 5   ? 141.701 14.986   44.964  1.00 335.07 ? 5   DT  F "O3'" 1 
ATOM 636   C "C2'" . DT  B  2 5   ? 141.049 14.730   42.708  1.00 293.99 ? 5   DT  F "C2'" 1 
ATOM 637   C "C1'" . DT  B  2 5   ? 142.264 15.410   42.121  1.00 281.54 ? 5   DT  F "C1'" 1 
ATOM 638   N N1    . DT  B  2 5   ? 142.077 15.735   40.700  1.00 264.82 ? 5   DT  F N1    1 
ATOM 639   C C2    . DT  B  2 5   ? 142.726 16.823   40.156  1.00 256.07 ? 5   DT  F C2    1 
ATOM 640   O O2    . DT  B  2 5   ? 143.526 17.504   40.776  1.00 250.88 ? 5   DT  F O2    1 
ATOM 641   N N3    . DT  B  2 5   ? 142.422 17.067   38.839  1.00 252.53 ? 5   DT  F N3    1 
ATOM 642   C C4    . DT  B  2 5   ? 141.544 16.361   38.039  1.00 254.26 ? 5   DT  F C4    1 
ATOM 643   O O4    . DT  B  2 5   ? 141.379 16.695   36.868  1.00 256.13 ? 5   DT  F O4    1 
ATOM 644   C C5    . DT  B  2 5   ? 140.877 15.252   38.686  1.00 255.36 ? 5   DT  F C5    1 
ATOM 645   C C7    . DT  B  2 5   ? 139.908 14.427   37.900  1.00 254.58 ? 5   DT  F C7    1 
ATOM 646   C C6    . DT  B  2 5   ? 141.162 15.009   39.970  1.00 259.01 ? 5   DT  F C6    1 
ATOM 647   P P     . DT  B  2 6   ? 140.561 14.983   46.085  1.00 353.86 ? 6   DT  F P     1 
ATOM 648   O OP1   . DT  B  2 6   ? 141.055 14.195   47.228  1.00 365.33 ? 6   DT  F OP1   1 
ATOM 649   O OP2   . DT  B  2 6   ? 139.258 14.656   45.442  1.00 349.27 ? 6   DT  F OP2   1 
ATOM 650   O "O5'" . DT  B  2 6   ? 140.555 16.477   46.626  1.00 357.34 ? 6   DT  F "O5'" 1 
ATOM 651   C "C5'" . DT  B  2 6   ? 141.780 17.179   46.893  1.00 367.72 ? 6   DT  F "C5'" 1 
ATOM 652   C "C4'" . DT  B  2 6   ? 141.567 18.637   46.579  1.00 360.90 ? 6   DT  F "C4'" 1 
ATOM 653   O "O4'" . DT  B  2 6   ? 141.677 18.825   45.148  1.00 350.47 ? 6   DT  F "O4'" 1 
ATOM 654   C "C3'" . DT  B  2 6   ? 140.172 19.129   46.972  1.00 361.93 ? 6   DT  F "C3'" 1 
ATOM 655   O "O3'" . DT  B  2 6   ? 140.283 20.342   47.715  1.00 387.35 ? 6   DT  F "O3'" 1 
ATOM 656   C "C2'" . DT  B  2 6   ? 139.456 19.315   45.645  1.00 346.54 ? 6   DT  F "C2'" 1 
ATOM 657   C "C1'" . DT  B  2 6   ? 140.590 19.609   44.688  1.00 334.39 ? 6   DT  F "C1'" 1 
ATOM 658   N N1    . DT  B  2 6   ? 140.288 19.216   43.292  1.00 314.10 ? 6   DT  F N1    1 
ATOM 659   C C2    . DT  B  2 6   ? 140.788 19.973   42.252  1.00 304.49 ? 6   DT  F C2    1 
ATOM 660   O O2    . DT  B  2 6   ? 141.511 20.944   42.416  1.00 299.01 ? 6   DT  F O2    1 
ATOM 661   N N3    . DT  B  2 6   ? 140.411 19.542   41.003  1.00 300.40 ? 6   DT  F N3    1 
ATOM 662   C C4    . DT  B  2 6   ? 139.597 18.466   40.698  1.00 299.99 ? 6   DT  F C4    1 
ATOM 663   O O4    . DT  B  2 6   ? 139.354 18.195   39.526  1.00 302.15 ? 6   DT  F O4    1 
ATOM 664   C C5    . DT  B  2 6   ? 139.091 17.734   41.837  1.00 299.49 ? 6   DT  F C5    1 
ATOM 665   C C7    . DT  B  2 6   ? 138.203 16.553   41.606  1.00 295.44 ? 6   DT  F C7    1 
ATOM 666   C C6    . DT  B  2 6   ? 139.454 18.143   43.060  1.00 304.58 ? 6   DT  F C6    1 
ATOM 667   P P     . DT  B  2 7   ? 139.007 20.962   48.487  1.00 404.32 ? 7   DT  F P     1 
ATOM 668   O OP1   . DT  B  2 7   ? 139.265 20.864   49.949  1.00 405.81 ? 7   DT  F OP1   1 
ATOM 669   O OP2   . DT  B  2 7   ? 137.762 20.346   47.923  1.00 401.07 ? 7   DT  F OP2   1 
ATOM 670   O "O5'" . DT  B  2 7   ? 139.078 22.511   48.098  1.00 407.55 ? 7   DT  F "O5'" 1 
ATOM 671   C "C5'" . DT  B  2 7   ? 140.321 23.151   47.672  1.00 399.69 ? 7   DT  F "C5'" 1 
ATOM 672   C "C4'" . DT  B  2 7   ? 140.040 24.370   46.819  1.00 380.90 ? 7   DT  F "C4'" 1 
ATOM 673   O "O4'" . DT  B  2 7   ? 140.043 24.017   45.408  1.00 372.94 ? 7   DT  F "O4'" 1 
ATOM 674   C "C3'" . DT  B  2 7   ? 138.686 25.027   47.094  1.00 367.06 ? 7   DT  F "C3'" 1 
ATOM 675   O "O3'" . DT  B  2 7   ? 138.760 26.455   47.180  1.00 356.79 ? 7   DT  F "O3'" 1 
ATOM 676   C "C2'" . DT  B  2 7   ? 137.832 24.589   45.919  1.00 361.10 ? 7   DT  F "C2'" 1 
ATOM 677   C "C1'" . DT  B  2 7   ? 138.834 24.438   44.786  1.00 352.72 ? 7   DT  F "C1'" 1 
ATOM 678   N N1    . DT  B  2 7   ? 138.427 23.403   43.802  1.00 332.39 ? 7   DT  F N1    1 
ATOM 679   C C2    . DT  B  2 7   ? 138.637 23.619   42.457  1.00 320.01 ? 7   DT  F C2    1 
ATOM 680   O O2    . DT  B  2 7   ? 139.186 24.617   42.017  1.00 310.89 ? 7   DT  F O2    1 
ATOM 681   N N3    . DT  B  2 7   ? 138.190 22.605   41.641  1.00 314.48 ? 7   DT  F N3    1 
ATOM 682   C C4    . DT  B  2 7   ? 137.549 21.440   42.026  1.00 311.80 ? 7   DT  F C4    1 
ATOM 683   O O4    . DT  B  2 7   ? 137.202 20.621   41.178  1.00 308.33 ? 7   DT  F O4    1 
ATOM 684   C C5    . DT  B  2 7   ? 137.344 21.293   43.449  1.00 313.54 ? 7   DT  F C5    1 
ATOM 685   C C7    . DT  B  2 7   ? 136.648 20.070   43.961  1.00 304.53 ? 7   DT  F C7    1 
ATOM 686   C C6    . DT  B  2 7   ? 137.782 22.271   44.252  1.00 324.83 ? 7   DT  F C6    1 
ATOM 687   P P     . DT  B  2 8   ? 137.492 27.299   47.713  1.00 347.35 ? 8   DT  F P     1 
ATOM 688   O OP1   . DT  B  2 8   ? 137.976 28.225   48.774  1.00 354.69 ? 8   DT  F OP1   1 
ATOM 689   O OP2   . DT  B  2 8   ? 136.408 26.335   48.052  1.00 338.66 ? 8   DT  F OP2   1 
ATOM 690   O "O5'" . DT  B  2 8   ? 137.024 28.111   46.416  1.00 337.40 ? 8   DT  F "O5'" 1 
ATOM 691   C "C5'" . DT  B  2 8   ? 137.971 28.729   45.493  1.00 324.25 ? 8   DT  F "C5'" 1 
ATOM 692   C "C4'" . DT  B  2 8   ? 137.353 29.000   44.135  1.00 312.67 ? 8   DT  F "C4'" 1 
ATOM 693   O "O4'" . DT  B  2 8   ? 137.168 27.766   43.398  1.00 298.66 ? 8   DT  F "O4'" 1 
ATOM 694   C "C3'" . DT  B  2 8   ? 135.989 29.695   44.131  1.00 308.31 ? 8   DT  F "C3'" 1 
ATOM 695   O "O3'" . DT  B  2 8   ? 135.927 30.576   43.009  1.00 317.51 ? 8   DT  F "O3'" 1 
ATOM 696   C "C2'" . DT  B  2 8   ? 135.029 28.554   43.871  1.00 295.86 ? 8   DT  F "C2'" 1 
ATOM 697   C "C1'" . DT  B  2 8   ? 135.841 27.732   42.895  1.00 292.14 ? 8   DT  F "C1'" 1 
ATOM 698   N N1    . DT  B  2 8   ? 135.435 26.330   42.799  1.00 287.76 ? 8   DT  F N1    1 
ATOM 699   C C2    . DT  B  2 8   ? 135.346 25.749   41.553  1.00 288.17 ? 8   DT  F C2    1 
ATOM 700   O O2    . DT  B  2 8   ? 135.580 26.350   40.518  1.00 285.74 ? 8   DT  F O2    1 
ATOM 701   N N3    . DT  B  2 8   ? 134.966 24.430   41.565  1.00 291.16 ? 8   DT  F N3    1 
ATOM 702   C C4    . DT  B  2 8   ? 134.657 23.660   42.670  1.00 290.71 ? 8   DT  F C4    1 
ATOM 703   O O4    . DT  B  2 8   ? 134.323 22.487   42.524  1.00 293.08 ? 8   DT  F O4    1 
ATOM 704   C C5    . DT  B  2 8   ? 134.763 24.338   43.944  1.00 288.39 ? 8   DT  F C5    1 
ATOM 705   C C7    . DT  B  2 8   ? 134.451 23.585   45.199  1.00 285.90 ? 8   DT  F C7    1 
ATOM 706   C C6    . DT  B  2 8   ? 135.138 25.622   43.942  1.00 286.73 ? 8   DT  F C6    1 
ATOM 707   P P     . DT  B  2 9   ? 134.897 31.805   43.017  1.00 326.46 ? 9   DT  F P     1 
ATOM 708   O OP1   . DT  B  2 9   ? 135.670 33.065   42.867  1.00 332.07 ? 9   DT  F OP1   1 
ATOM 709   O OP2   . DT  B  2 9   ? 134.003 31.633   44.188  1.00 327.88 ? 9   DT  F OP2   1 
ATOM 710   O "O5'" . DT  B  2 9   ? 133.991 31.576   41.721  1.00 321.72 ? 9   DT  F "O5'" 1 
ATOM 711   C "C5'" . DT  B  2 9   ? 134.510 31.123   40.446  1.00 309.01 ? 9   DT  F "C5'" 1 
ATOM 712   C "C4'" . DT  B  2 9   ? 133.394 30.708   39.508  1.00 291.72 ? 9   DT  F "C4'" 1 
ATOM 713   O "O4'" . DT  B  2 9   ? 133.207 29.269   39.546  1.00 275.67 ? 9   DT  F "O4'" 1 
ATOM 714   C "C3'" . DT  B  2 9   ? 132.015 31.319   39.781  1.00 286.14 ? 9   DT  F "C3'" 1 
ATOM 715   O "O3'" . DT  B  2 9   ? 131.330 31.628   38.564  1.00 294.40 ? 9   DT  F "O3'" 1 
ATOM 716   C "C2'" . DT  B  2 9   ? 131.243 30.182   40.424  1.00 270.48 ? 9   DT  F "C2'" 1 
ATOM 717   C "C1'" . DT  B  2 9   ? 131.829 28.970   39.725  1.00 267.56 ? 9   DT  F "C1'" 1 
ATOM 718   N N1    . DT  B  2 9   ? 131.732 27.750   40.540  1.00 265.27 ? 9   DT  F N1    1 
ATOM 719   C C2    . DT  B  2 9   ? 131.533 26.536   39.918  1.00 267.43 ? 9   DT  F C2    1 
ATOM 720   O O2    . DT  B  2 9   ? 131.436 26.412   38.706  1.00 262.41 ? 9   DT  F O2    1 
ATOM 721   N N3    . DT  B  2 9   ? 131.445 25.464   40.775  1.00 274.73 ? 9   DT  F N3    1 
ATOM 722   C C4    . DT  B  2 9   ? 131.521 25.490   42.159  1.00 276.99 ? 9   DT  F C4    1 
ATOM 723   O O4    . DT  B  2 9   ? 131.408 24.445   42.798  1.00 283.89 ? 9   DT  F O4    1 
ATOM 724   C C5    . DT  B  2 9   ? 131.727 26.801   42.742  1.00 272.94 ? 9   DT  F C5    1 
ATOM 725   C C7    . DT  B  2 9   ? 131.815 26.932   44.231  1.00 270.68 ? 9   DT  F C7    1 
ATOM 726   C C6    . DT  B  2 9   ? 131.822 27.847   41.913  1.00 267.74 ? 9   DT  F C6    1 
ATOM 727   P P     . DT  B  2 10  ? 130.046 32.579   38.594  1.00 300.40 ? 10  DT  F P     1 
ATOM 728   O OP1   . DT  B  2 10  ? 130.406 33.846   37.908  1.00 305.44 ? 10  DT  F OP1   1 
ATOM 729   O OP2   . DT  B  2 10  ? 129.531 32.618   39.988  1.00 299.93 ? 10  DT  F OP2   1 
ATOM 730   O "O5'" . DT  B  2 10  ? 128.970 31.797   37.716  1.00 300.52 ? 10  DT  F "O5'" 1 
ATOM 731   C "C5'" . DT  B  2 10  ? 129.346 31.052   36.539  1.00 306.61 ? 10  DT  F "C5'" 1 
ATOM 732   C "C4'" . DT  B  2 10  ? 128.349 29.952   36.247  1.00 301.62 ? 10  DT  F "C4'" 1 
ATOM 733   O "O4'" . DT  B  2 10  ? 128.556 28.838   37.152  1.00 287.65 ? 10  DT  F "O4'" 1 
ATOM 734   C "C3'" . DT  B  2 10  ? 126.868 30.332   36.375  1.00 299.58 ? 10  DT  F "C3'" 1 
ATOM 735   O "O3'" . DT  B  2 10  ? 126.086 29.698   35.349  1.00 307.32 ? 10  DT  F "O3'" 1 
ATOM 736   C "C2'" . DT  B  2 10  ? 126.473 29.717   37.703  1.00 287.50 ? 10  DT  F "C2'" 1 
ATOM 737   C "C1'" . DT  B  2 10  ? 127.305 28.452   37.687  1.00 278.85 ? 10  DT  F "C1'" 1 
ATOM 738   N N1    . DT  B  2 10  ? 127.544 27.870   39.008  1.00 271.61 ? 10  DT  F N1    1 
ATOM 739   C C2    . DT  B  2 10  ? 127.500 26.501   39.131  1.00 269.83 ? 10  DT  F C2    1 
ATOM 740   O O2    . DT  B  2 10  ? 127.270 25.753   38.193  1.00 268.80 ? 10  DT  F O2    1 
ATOM 741   N N3    . DT  B  2 10  ? 127.728 26.035   40.403  1.00 270.46 ? 10  DT  F N3    1 
ATOM 742   C C4    . DT  B  2 10  ? 127.988 26.786   41.535  1.00 269.85 ? 10  DT  F C4    1 
ATOM 743   O O4    . DT  B  2 10  ? 128.168 26.223   42.614  1.00 273.70 ? 10  DT  F O4    1 
ATOM 744   C C5    . DT  B  2 10  ? 128.014 28.220   41.330  1.00 268.07 ? 10  DT  F C5    1 
ATOM 745   C C7    . DT  B  2 10  ? 128.290 29.119   42.494  1.00 265.23 ? 10  DT  F C7    1 
ATOM 746   C C6    . DT  B  2 10  ? 127.793 28.682   40.093  1.00 268.88 ? 10  DT  F C6    1 
ATOM 747   P P     . DT  B  2 11  ? 124.642 30.291   34.905  1.00 307.92 ? 11  DT  F P     1 
ATOM 748   O OP1   . DT  B  2 11  ? 124.843 31.112   33.683  1.00 317.60 ? 11  DT  F OP1   1 
ATOM 749   O OP2   . DT  B  2 11  ? 123.985 30.901   36.099  1.00 301.28 ? 11  DT  F OP2   1 
ATOM 750   O "O5'" . DT  B  2 11  ? 123.811 28.999   34.462  1.00 300.33 ? 11  DT  F "O5'" 1 
ATOM 751   C "C5'" . DT  B  2 11  ? 124.433 27.735   34.096  1.00 289.34 ? 11  DT  F "C5'" 1 
ATOM 752   C "C4'" . DT  B  2 11  ? 123.576 26.564   34.531  1.00 277.66 ? 11  DT  F "C4'" 1 
ATOM 753   O "O4'" . DT  B  2 11  ? 123.997 26.116   35.850  1.00 265.32 ? 11  DT  F "O4'" 1 
ATOM 754   C "C3'" . DT  B  2 11  ? 122.074 26.865   34.647  1.00 276.68 ? 11  DT  F "C3'" 1 
ATOM 755   O "O3'" . DT  B  2 11  ? 121.185 25.810   34.210  1.00 283.90 ? 11  DT  F "O3'" 1 
ATOM 756   C "C2'" . DT  B  2 11  ? 121.883 27.079   36.138  1.00 266.58 ? 11  DT  F "C2'" 1 
ATOM 757   C "C1'" . DT  B  2 11  ? 122.876 26.092   36.728  1.00 254.54 ? 11  DT  F "C1'" 1 
ATOM 758   N N1    . DT  B  2 11  ? 123.347 26.399   38.104  1.00 237.67 ? 11  DT  F N1    1 
ATOM 759   C C2    . DT  B  2 11  ? 123.557 25.346   38.968  1.00 229.69 ? 11  DT  F C2    1 
ATOM 760   O O2    . DT  B  2 11  ? 123.391 24.178   38.650  1.00 226.68 ? 11  DT  F O2    1 
ATOM 761   N N3    . DT  B  2 11  ? 123.980 25.711   40.223  1.00 224.10 ? 11  DT  F N3    1 
ATOM 762   C C4    . DT  B  2 11  ? 124.200 26.993   40.693  1.00 221.44 ? 11  DT  F C4    1 
ATOM 763   O O4    . DT  B  2 11  ? 124.581 27.165   41.849  1.00 219.08 ? 11  DT  F O4    1 
ATOM 764   C C5    . DT  B  2 11  ? 123.949 28.049   39.737  1.00 222.86 ? 11  DT  F C5    1 
ATOM 765   C C7    . DT  B  2 11  ? 124.154 29.471   40.156  1.00 221.21 ? 11  DT  F C7    1 
ATOM 766   C C6    . DT  B  2 11  ? 123.530 27.704   38.512  1.00 229.20 ? 11  DT  F C6    1 
ATOM 767   P P     . DT  B  2 12  ? 119.765 26.169   33.494  1.00 289.03 ? 12  DT  F P     1 
ATOM 768   O OP1   . DT  B  2 12  ? 119.983 26.144   32.025  1.00 289.31 ? 12  DT  F OP1   1 
ATOM 769   O OP2   . DT  B  2 12  ? 119.236 27.417   34.115  1.00 287.36 ? 12  DT  F OP2   1 
ATOM 770   O "O5'" . DT  B  2 12  ? 118.772 24.994   33.946  1.00 291.49 ? 12  DT  F "O5'" 1 
ATOM 771   C "C5'" . DT  B  2 12  ? 119.193 23.627   34.220  1.00 295.14 ? 12  DT  F "C5'" 1 
ATOM 772   C "C4'" . DT  B  2 12  ? 118.445 23.037   35.400  1.00 298.61 ? 12  DT  F "C4'" 1 
ATOM 773   O "O4'" . DT  B  2 12  ? 119.101 23.409   36.641  1.00 294.32 ? 12  DT  F "O4'" 1 
ATOM 774   C "C3'" . DT  B  2 12  ? 116.981 23.461   35.562  1.00 294.18 ? 12  DT  F "C3'" 1 
ATOM 775   O "O3'" . DT  B  2 12  ? 116.175 22.406   36.110  1.00 286.00 ? 12  DT  F "O3'" 1 
ATOM 776   C "C2'" . DT  B  2 12  ? 117.066 24.561   36.603  1.00 293.88 ? 12  DT  F "C2'" 1 
ATOM 777   C "C1'" . DT  B  2 12  ? 118.157 24.023   37.511  1.00 293.02 ? 12  DT  F "C1'" 1 
ATOM 778   N N1    . DT  B  2 12  ? 118.875 25.013   38.355  1.00 296.22 ? 12  DT  F N1    1 
ATOM 779   C C2    . DT  B  2 12  ? 119.434 24.547   39.523  1.00 294.41 ? 12  DT  F C2    1 
ATOM 780   O O2    . DT  B  2 12  ? 119.359 23.382   39.878  1.00 289.17 ? 12  DT  F O2    1 
ATOM 781   N N3    . DT  B  2 12  ? 120.091 25.501   40.264  1.00 296.83 ? 12  DT  F N3    1 
ATOM 782   C C4    . DT  B  2 12  ? 120.233 26.843   39.963  1.00 296.97 ? 12  DT  F C4    1 
ATOM 783   O O4    . DT  B  2 12  ? 120.846 27.581   40.732  1.00 294.70 ? 12  DT  F O4    1 
ATOM 784   C C5    . DT  B  2 12  ? 119.620 27.265   38.724  1.00 298.18 ? 12  DT  F C5    1 
ATOM 785   C C7    . DT  B  2 12  ? 119.721 28.701   38.315  1.00 293.73 ? 12  DT  F C7    1 
ATOM 786   C C6    . DT  B  2 12  ? 118.979 26.341   37.992  1.00 300.13 ? 12  DT  F C6    1 
ATOM 787   P P     . DT  B  2 13  ? 114.575 22.426   35.917  1.00 281.76 ? 13  DT  F P     1 
ATOM 788   O OP1   . DT  B  2 13  ? 114.270 21.814   34.603  1.00 286.13 ? 13  DT  F OP1   1 
ATOM 789   O OP2   . DT  B  2 13  ? 114.089 23.795   36.198  1.00 274.05 ? 13  DT  F OP2   1 
ATOM 790   O "O5'" . DT  B  2 13  ? 114.014 21.514   37.103  1.00 287.61 ? 13  DT  F "O5'" 1 
ATOM 791   C "C5'" . DT  B  2 13  ? 114.774 20.452   37.728  1.00 305.00 ? 13  DT  F "C5'" 1 
ATOM 792   C "C4'" . DT  B  2 13  ? 114.500 20.367   39.217  1.00 315.85 ? 13  DT  F "C4'" 1 
ATOM 793   O "O4'" . DT  B  2 13  ? 115.354 21.300   39.924  1.00 313.47 ? 13  DT  F "O4'" 1 
ATOM 794   C "C3'" . DT  B  2 13  ? 113.073 20.676   39.687  1.00 325.57 ? 13  DT  F "C3'" 1 
ATOM 795   O "O3'" . DT  B  2 13  ? 112.695 19.918   40.851  1.00 339.33 ? 13  DT  F "O3'" 1 
ATOM 796   C "C2'" . DT  B  2 13  ? 113.178 22.109   40.168  1.00 319.71 ? 13  DT  F "C2'" 1 
ATOM 797   C "C1'" . DT  B  2 13  ? 114.561 22.105   40.784  1.00 309.20 ? 13  DT  F "C1'" 1 
ATOM 798   N N1    . DT  B  2 13  ? 115.172 23.437   40.841  1.00 301.21 ? 13  DT  F N1    1 
ATOM 799   C C2    . DT  B  2 13  ? 115.960 23.759   41.925  1.00 297.86 ? 13  DT  F C2    1 
ATOM 800   O O2    . DT  B  2 13  ? 116.178 22.988   42.848  1.00 296.59 ? 13  DT  F O2    1 
ATOM 801   N N3    . DT  B  2 13  ? 116.487 25.027   41.888  1.00 296.08 ? 13  DT  F N3    1 
ATOM 802   C C4    . DT  B  2 13  ? 116.307 25.980   40.901  1.00 292.86 ? 13  DT  F C4    1 
ATOM 803   O O4    . DT  B  2 13  ? 116.843 27.080   41.007  1.00 298.42 ? 13  DT  F O4    1 
ATOM 804   C C5    . DT  B  2 13  ? 115.464 25.575   39.799  1.00 289.68 ? 13  DT  F C5    1 
ATOM 805   C C7    . DT  B  2 13  ? 115.203 26.545   38.690  1.00 282.05 ? 13  DT  F C7    1 
ATOM 806   C C6    . DT  B  2 13  ? 114.946 24.341   39.825  1.00 293.78 ? 13  DT  F C6    1 
ATOM 807   P P     . DT  B  2 14  ? 111.126 19.674   41.207  1.00 349.47 ? 14  DT  F P     1 
ATOM 808   O OP1   . DT  B  2 14  ? 110.712 18.379   40.613  1.00 354.47 ? 14  DT  F OP1   1 
ATOM 809   O OP2   . DT  B  2 14  ? 110.357 20.919   40.902  1.00 353.85 ? 14  DT  F OP2   1 
ATOM 810   O "O5'" . DT  B  2 14  ? 111.094 19.448   42.786  1.00 338.96 ? 14  DT  F "O5'" 1 
ATOM 811   C "C5'" . DT  B  2 14  ? 112.260 19.081   43.538  1.00 329.04 ? 14  DT  F "C5'" 1 
ATOM 812   C "C4'" . DT  B  2 14  ? 112.254 19.808   44.861  1.00 318.77 ? 14  DT  F "C4'" 1 
ATOM 813   O "O4'" . DT  B  2 14  ? 112.931 21.080   44.710  1.00 307.17 ? 14  DT  F "O4'" 1 
ATOM 814   C "C3'" . DT  B  2 14  ? 110.855 20.128   45.398  1.00 314.43 ? 14  DT  F "C3'" 1 
ATOM 815   O "O3'" . DT  B  2 14  ? 110.784 19.919   46.814  1.00 315.61 ? 14  DT  F "O3'" 1 
ATOM 816   C "C2'" . DT  B  2 14  ? 110.680 21.601   45.078  1.00 307.83 ? 14  DT  F "C2'" 1 
ATOM 817   C "C1'" . DT  B  2 14  ? 112.102 22.122   45.208  1.00 297.06 ? 14  DT  F "C1'" 1 
ATOM 818   N N1    . DT  B  2 14  ? 112.374 23.335   44.416  1.00 282.93 ? 14  DT  F N1    1 
ATOM 819   C C2    . DT  B  2 14  ? 113.245 24.285   44.911  1.00 271.78 ? 14  DT  F C2    1 
ATOM 820   O O2    . DT  B  2 14  ? 113.814 24.177   45.986  1.00 260.04 ? 14  DT  F O2    1 
ATOM 821   N N3    . DT  B  2 14  ? 113.416 25.379   44.098  1.00 271.48 ? 14  DT  F N3    1 
ATOM 822   C C4    . DT  B  2 14  ? 112.825 25.609   42.868  1.00 278.73 ? 14  DT  F C4    1 
ATOM 823   O O4    . DT  B  2 14  ? 113.084 26.638   42.247  1.00 280.39 ? 14  DT  F O4    1 
ATOM 824   C C5    . DT  B  2 14  ? 111.924 24.573   42.412  1.00 283.75 ? 14  DT  F C5    1 
ATOM 825   C C7    . DT  B  2 14  ? 111.230 24.738   41.097  1.00 289.99 ? 14  DT  F C7    1 
ATOM 826   C C6    . DT  B  2 14  ? 111.744 23.506   43.201  1.00 284.40 ? 14  DT  F C6    1 
ATOM 827   P P     . DT  B  2 15  ? 109.363 19.699   47.530  1.00 319.63 ? 15  DT  F P     1 
ATOM 828   O OP1   . DT  B  2 15  ? 109.265 18.267   47.913  1.00 311.43 ? 15  DT  F OP1   1 
ATOM 829   O OP2   . DT  B  2 15  ? 108.307 20.325   46.678  1.00 320.79 ? 15  DT  F OP2   1 
ATOM 830   O "O5'" . DT  B  2 15  ? 109.483 20.551   48.874  1.00 326.02 ? 15  DT  F "O5'" 1 
ATOM 831   C "C5'" . DT  B  2 15  ? 110.750 20.711   49.552  1.00 327.51 ? 15  DT  F "C5'" 1 
ATOM 832   C "C4'" . DT  B  2 15  ? 110.896 22.102   50.131  1.00 323.23 ? 15  DT  F "C4'" 1 
ATOM 833   O "O4'" . DT  B  2 15  ? 111.217 23.065   49.091  1.00 316.25 ? 15  DT  F "O4'" 1 
ATOM 834   C "C3'" . DT  B  2 15  ? 109.670 22.658   50.867  1.00 327.07 ? 15  DT  F "C3'" 1 
ATOM 835   O "O3'" . DT  B  2 15  ? 110.079 23.350   52.061  1.00 344.06 ? 15  DT  F "O3'" 1 
ATOM 836   C "C2'" . DT  B  2 15  ? 109.110 23.671   49.886  1.00 314.68 ? 15  DT  F "C2'" 1 
ATOM 837   C "C1'" . DT  B  2 15  ? 110.373 24.198   49.232  1.00 303.85 ? 15  DT  F "C1'" 1 
ATOM 838   N N1    . DT  B  2 15  ? 110.173 24.791   47.895  1.00 288.60 ? 15  DT  F N1    1 
ATOM 839   C C2    . DT  B  2 15  ? 110.841 25.957   47.592  1.00 281.36 ? 15  DT  F C2    1 
ATOM 840   O O2    . DT  B  2 15  ? 111.602 26.514   48.368  1.00 275.97 ? 15  DT  F O2    1 
ATOM 841   N N3    . DT  B  2 15  ? 110.582 26.453   46.338  1.00 279.37 ? 15  DT  F N3    1 
ATOM 842   C C4    . DT  B  2 15  ? 109.747 25.908   45.378  1.00 277.21 ? 15  DT  F C4    1 
ATOM 843   O O4    . DT  B  2 15  ? 109.619 26.466   44.291  1.00 281.38 ? 15  DT  F O4    1 
ATOM 844   C C5    . DT  B  2 15  ? 109.077 24.686   45.766  1.00 273.92 ? 15  DT  F C5    1 
ATOM 845   C C7    . DT  B  2 15  ? 108.153 24.021   44.794  1.00 266.01 ? 15  DT  F C7    1 
ATOM 846   C C6    . DT  B  2 15  ? 109.315 24.200   46.991  1.00 279.22 ? 15  DT  F C6    1 
ATOM 847   P P     . DT  B  2 16  ? 109.065 23.570   53.310  1.00 357.05 ? 16  DT  F P     1 
ATOM 848   O OP1   . DT  B  2 16  ? 109.362 22.538   54.341  1.00 360.10 ? 16  DT  F OP1   1 
ATOM 849   O OP2   . DT  B  2 16  ? 107.677 23.721   52.789  1.00 356.58 ? 16  DT  F OP2   1 
ATOM 850   O "O5'" . DT  B  2 16  ? 109.539 24.965   53.918  1.00 356.29 ? 16  DT  F "O5'" 1 
ATOM 851   C "C5'" . DT  B  2 16  ? 110.792 25.558   53.515  1.00 355.36 ? 16  DT  F "C5'" 1 
ATOM 852   C "C4'" . DT  B  2 16  ? 110.598 27.020   53.191  1.00 347.56 ? 16  DT  F "C4'" 1 
ATOM 853   O "O4'" . DT  B  2 16  ? 110.298 27.190   51.781  1.00 336.10 ? 16  DT  F "O4'" 1 
ATOM 854   C "C3'" . DT  B  2 16  ? 109.441 27.674   53.946  1.00 347.86 ? 16  DT  F "C3'" 1 
ATOM 855   O "O3'" . DT  B  2 16  ? 109.796 29.026   54.229  1.00 358.05 ? 16  DT  F "O3'" 1 
ATOM 856   C "C2'" . DT  B  2 16  ? 108.326 27.683   52.920  1.00 340.20 ? 16  DT  F "C2'" 1 
ATOM 857   C "C1'" . DT  B  2 16  ? 109.130 27.995   51.673  1.00 332.12 ? 16  DT  F "C1'" 1 
ATOM 858   N N1    . DT  B  2 16  ? 108.474 27.700   50.381  1.00 326.34 ? 16  DT  F N1    1 
ATOM 859   C C2    . DT  B  2 16  ? 108.738 28.542   49.322  1.00 329.48 ? 16  DT  F C2    1 
ATOM 860   O O2    . DT  B  2 16  ? 109.502 29.494   49.397  1.00 329.45 ? 16  DT  F O2    1 
ATOM 861   N N3    . DT  B  2 16  ? 108.075 28.221   48.162  1.00 333.53 ? 16  DT  F N3    1 
ATOM 862   C C4    . DT  B  2 16  ? 107.185 27.177   47.965  1.00 324.55 ? 16  DT  F C4    1 
ATOM 863   O O4    . DT  B  2 16  ? 106.672 27.009   46.863  1.00 338.20 ? 16  DT  F O4    1 
ATOM 864   C C5    . DT  B  2 16  ? 106.938 26.352   49.124  1.00 311.59 ? 16  DT  F C5    1 
ATOM 865   C C7    . DT  B  2 16  ? 105.988 25.201   49.007  1.00 294.13 ? 16  DT  F C7    1 
ATOM 866   C C6    . DT  B  2 16  ? 107.576 26.658   50.261  1.00 314.64 ? 16  DT  F C6    1 
ATOM 867   P P     . DT  B  2 17  ? 109.187 29.761   55.507  1.00 366.98 ? 17  DT  F P     1 
ATOM 868   O OP1   . DT  B  2 17  ? 110.000 29.370   56.679  1.00 376.96 ? 17  DT  F OP1   1 
ATOM 869   O OP2   . DT  B  2 17  ? 107.717 29.523   55.527  1.00 362.46 ? 17  DT  F OP2   1 
ATOM 870   O "O5'" . DT  B  2 17  ? 109.493 31.302   55.236  1.00 363.09 ? 17  DT  F "O5'" 1 
ATOM 871   C "C5'" . DT  B  2 17  ? 110.511 31.720   54.307  1.00 350.48 ? 17  DT  F "C5'" 1 
ATOM 872   C "C4'" . DT  B  2 17  ? 109.948 32.783   53.396  1.00 338.71 ? 17  DT  F "C4'" 1 
ATOM 873   O "O4'" . DT  B  2 17  ? 109.277 32.164   52.270  1.00 324.96 ? 17  DT  F "O4'" 1 
ATOM 874   C "C3'" . DT  B  2 17  ? 108.908 33.690   54.058  1.00 335.78 ? 17  DT  F "C3'" 1 
ATOM 875   O "O3'" . DT  B  2 17  ? 109.048 34.996   53.495  1.00 343.84 ? 17  DT  F "O3'" 1 
ATOM 876   C "C2'" . DT  B  2 17  ? 107.590 33.094   53.599  1.00 321.36 ? 17  DT  F "C2'" 1 
ATOM 877   C "C1'" . DT  B  2 17  ? 107.949 32.662   52.190  1.00 308.58 ? 17  DT  F "C1'" 1 
ATOM 878   N N1    . DT  B  2 17  ? 107.090 31.614   51.602  1.00 287.21 ? 17  DT  F N1    1 
ATOM 879   C C2    . DT  B  2 17  ? 106.841 31.681   50.249  1.00 279.08 ? 17  DT  F C2    1 
ATOM 880   O O2    . DT  B  2 17  ? 107.320 32.541   49.525  1.00 272.43 ? 17  DT  F O2    1 
ATOM 881   N N3    . DT  B  2 17  ? 106.007 30.699   49.773  1.00 277.60 ? 17  DT  F N3    1 
ATOM 882   C C4    . DT  B  2 17  ? 105.406 29.684   50.499  1.00 275.37 ? 17  DT  F C4    1 
ATOM 883   O O4    . DT  B  2 17  ? 104.676 28.873   49.931  1.00 275.58 ? 17  DT  F O4    1 
ATOM 884   C C5    . DT  B  2 17  ? 105.695 29.687   51.916  1.00 273.76 ? 17  DT  F C5    1 
ATOM 885   C C7    . DT  B  2 17  ? 105.085 28.631   52.785  1.00 268.51 ? 17  DT  F C7    1 
ATOM 886   C C6    . DT  B  2 17  ? 106.504 30.644   52.391  1.00 278.17 ? 17  DT  F C6    1 
ATOM 887   P P     . DT  B  2 18  ? 108.720 36.314   54.348  1.00 345.94 ? 18  DT  F P     1 
ATOM 888   O OP1   . DT  B  2 18  ? 109.942 36.669   55.120  1.00 352.42 ? 18  DT  F OP1   1 
ATOM 889   O OP2   . DT  B  2 18  ? 107.426 36.110   55.064  1.00 346.68 ? 18  DT  F OP2   1 
ATOM 890   O "O5'" . DT  B  2 18  ? 108.506 37.413   53.211  1.00 333.14 ? 18  DT  F "O5'" 1 
ATOM 891   C "C5'" . DT  B  2 18  ? 108.757 37.108   51.815  1.00 316.89 ? 18  DT  F "C5'" 1 
ATOM 892   C "C4'" . DT  B  2 18  ? 107.510 37.343   50.996  1.00 310.93 ? 18  DT  F "C4'" 1 
ATOM 893   O "O4'" . DT  B  2 18  ? 106.804 36.095   50.761  1.00 300.37 ? 18  DT  F "O4'" 1 
ATOM 894   C "C3'" . DT  B  2 18  ? 106.506 38.280   51.672  1.00 310.02 ? 18  DT  F "C3'" 1 
ATOM 895   O "O3'" . DT  B  2 18  ? 106.012 39.218   50.721  1.00 315.37 ? 18  DT  F "O3'" 1 
ATOM 896   C "C2'" . DT  B  2 18  ? 105.393 37.352   52.123  1.00 301.52 ? 18  DT  F "C2'" 1 
ATOM 897   C "C1'" . DT  B  2 18  ? 105.425 36.308   51.026  1.00 298.00 ? 18  DT  F "C1'" 1 
ATOM 898   N N1    . DT  B  2 18  ? 104.796 35.012   51.379  1.00 292.31 ? 18  DT  F N1    1 
ATOM 899   C C2    . DT  B  2 18  ? 104.184 34.294   50.375  1.00 293.75 ? 18  DT  F C2    1 
ATOM 900   O O2    . DT  B  2 18  ? 104.178 34.652   49.206  1.00 301.88 ? 18  DT  F O2    1 
ATOM 901   N N3    . DT  B  2 18  ? 103.576 33.132   50.793  1.00 289.19 ? 18  DT  F N3    1 
ATOM 902   C C4    . DT  B  2 18  ? 103.508 32.640   52.085  1.00 283.24 ? 18  DT  F C4    1 
ATOM 903   O O4    . DT  B  2 18  ? 102.926 31.582   52.309  1.00 278.91 ? 18  DT  F O4    1 
ATOM 904   C C5    . DT  B  2 18  ? 104.155 33.457   53.090  1.00 283.12 ? 18  DT  F C5    1 
ATOM 905   C C7    . DT  B  2 18  ? 104.135 33.004   54.516  1.00 280.17 ? 18  DT  F C7    1 
ATOM 906   C C6    . DT  B  2 18  ? 104.744 34.593   52.694  1.00 286.67 ? 18  DT  F C6    1 
ATOM 907   P P     . DT  B  2 19  ? 105.305 40.567   51.211  1.00 321.35 ? 19  DT  F P     1 
ATOM 908   O OP1   . DT  B  2 19  ? 106.348 41.624   51.281  1.00 328.79 ? 19  DT  F OP1   1 
ATOM 909   O OP2   . DT  B  2 19  ? 104.498 40.261   52.433  1.00 312.64 ? 19  DT  F OP2   1 
ATOM 910   O "O5'" . DT  B  2 19  ? 104.339 40.911   49.988  1.00 325.85 ? 19  DT  F "O5'" 1 
ATOM 911   C "C5'" . DT  B  2 19  ? 104.581 40.368   48.662  1.00 317.35 ? 19  DT  F "C5'" 1 
ATOM 912   C "C4'" . DT  B  2 19  ? 103.287 39.933   48.010  1.00 306.24 ? 19  DT  F "C4'" 1 
ATOM 913   O "O4'" . DT  B  2 19  ? 102.939 38.584   48.418  1.00 296.13 ? 19  DT  F "O4'" 1 
ATOM 914   C "C3'" . DT  B  2 19  ? 102.072 40.803   48.336  1.00 303.96 ? 19  DT  F "C3'" 1 
ATOM 915   O "O3'" . DT  B  2 19  ? 101.300 41.014   47.154  1.00 304.44 ? 19  DT  F "O3'" 1 
ATOM 916   C "C2'" . DT  B  2 19  ? 101.268 39.946   49.296  1.00 294.05 ? 19  DT  F "C2'" 1 
ATOM 917   C "C1'" . DT  B  2 19  ? 101.567 38.552   48.785  1.00 289.29 ? 19  DT  F "C1'" 1 
ATOM 918   N N1    . DT  B  2 19  ? 101.378 37.475   49.783  1.00 285.12 ? 19  DT  F N1    1 
ATOM 919   C C2    . DT  B  2 19  ? 100.836 36.279   49.364  1.00 284.63 ? 19  DT  F C2    1 
ATOM 920   O O2    . DT  B  2 19  ? 100.513 36.061   48.206  1.00 279.84 ? 19  DT  F O2    1 
ATOM 921   N N3    . DT  B  2 19  ? 100.685 35.339   50.358  1.00 288.53 ? 19  DT  F N3    1 
ATOM 922   C C4    . DT  B  2 19  ? 101.008 35.480   51.699  1.00 288.27 ? 19  DT  F C4    1 
ATOM 923   O O4    . DT  B  2 19  ? 100.808 34.548   52.478  1.00 289.54 ? 19  DT  F O4    1 
ATOM 924   C C5    . DT  B  2 19  ? 101.564 36.767   52.068  1.00 286.09 ? 19  DT  F C5    1 
ATOM 925   C C7    . DT  B  2 19  ? 101.943 37.018   53.495  1.00 281.21 ? 19  DT  F C7    1 
ATOM 926   C C6    . DT  B  2 19  ? 101.718 37.685   51.104  1.00 284.53 ? 19  DT  F C6    1 
ATOM 927   P P     . DT  B  2 20  ? 100.321 42.279   47.046  1.00 309.78 ? 20  DT  F P     1 
ATOM 928   O OP1   . DT  B  2 20  ? 101.017 43.336   46.276  1.00 316.74 ? 20  DT  F OP1   1 
ATOM 929   O OP2   . DT  B  2 20  ? 99.784  42.578   48.395  1.00 311.50 ? 20  DT  F OP2   1 
ATOM 930   O "O5'" . DT  B  2 20  ? 99.093  41.740   46.188  1.00 307.79 ? 20  DT  F "O5'" 1 
ATOM 931   C "C5'" . DT  B  2 20  ? 99.191  40.568   45.356  1.00 310.57 ? 20  DT  F "C5'" 1 
ATOM 932   C "C4'" . DT  B  2 20  ? 97.916  39.754   45.407  1.00 315.95 ? 20  DT  F "C4'" 1 
ATOM 933   O "O4'" . DT  B  2 20  ? 98.057  38.714   46.408  1.00 307.17 ? 20  DT  F "O4'" 1 
ATOM 934   C "C3'" . DT  B  2 20  ? 96.645  40.538   45.771  1.00 321.33 ? 20  DT  F "C3'" 1 
ATOM 935   O "O3'" . DT  B  2 20  ? 95.498  40.205   44.962  1.00 327.25 ? 20  DT  F "O3'" 1 
ATOM 936   C "C2'" . DT  B  2 20  ? 96.372  40.110   47.197  1.00 316.42 ? 20  DT  F "C2'" 1 
ATOM 937   C "C1'" . DT  B  2 20  ? 96.891  38.688   47.205  1.00 308.99 ? 20  DT  F "C1'" 1 
ATOM 938   N N1    . DT  B  2 20  ? 97.264  38.243   48.551  1.00 304.44 ? 20  DT  F N1    1 
ATOM 939   C C2    . DT  B  2 20  ? 97.010  36.939   48.913  1.00 302.52 ? 20  DT  F C2    1 
ATOM 940   O O2    . DT  B  2 20  ? 96.536  36.114   48.148  1.00 293.89 ? 20  DT  F O2    1 
ATOM 941   N N3    . DT  B  2 20  ? 97.344  36.633   50.210  1.00 309.73 ? 20  DT  F N3    1 
ATOM 942   C C4    . DT  B  2 20  ? 97.868  37.489   51.165  1.00 315.40 ? 20  DT  F C4    1 
ATOM 943   O O4    . DT  B  2 20  ? 98.112  37.072   52.294  1.00 326.44 ? 20  DT  F O4    1 
ATOM 944   C C5    . DT  B  2 20  ? 98.091  38.848   50.719  1.00 312.44 ? 20  DT  F C5    1 
ATOM 945   C C7    . DT  B  2 20  ? 98.658  39.846   51.679  1.00 308.66 ? 20  DT  F C7    1 
ATOM 946   C C6    . DT  B  2 20  ? 97.770  39.153   49.455  1.00 307.83 ? 20  DT  F C6    1 
ATOM 947   P P     . DT  B  2 21  ? 94.204  41.208   44.851  1.00 321.15 ? 21  DT  F P     1 
ATOM 948   O OP1   . DT  B  2 21  ? 94.286  41.934   43.554  1.00 324.61 ? 21  DT  F OP1   1 
ATOM 949   O OP2   . DT  B  2 21  ? 94.074  41.976   46.123  1.00 315.69 ? 21  DT  F OP2   1 
ATOM 950   O "O5'" . DT  B  2 21  ? 92.957  40.218   44.731  1.00 319.21 ? 21  DT  F "O5'" 1 
ATOM 951   C "C5'" . DT  B  2 21  ? 93.081  38.911   44.129  1.00 323.09 ? 21  DT  F "C5'" 1 
ATOM 952   C "C4'" . DT  B  2 21  ? 92.244  37.893   44.872  1.00 322.02 ? 21  DT  F "C4'" 1 
ATOM 953   O "O4'" . DT  B  2 21  ? 92.919  37.449   46.083  1.00 317.42 ? 21  DT  F "O4'" 1 
ATOM 954   C "C3'" . DT  B  2 21  ? 90.858  38.386   45.305  1.00 325.32 ? 21  DT  F "C3'" 1 
ATOM 955   O "O3'" . DT  B  2 21  ? 89.852  37.377   45.065  1.00 336.99 ? 21  DT  F "O3'" 1 
ATOM 956   C "C2'" . DT  B  2 21  ? 91.023  38.619   46.799  1.00 317.51 ? 21  DT  F "C2'" 1 
ATOM 957   C "C1'" . DT  B  2 21  ? 92.012  37.519   47.178  1.00 309.54 ? 21  DT  F "C1'" 1 
ATOM 958   N N1    . DT  B  2 21  ? 92.791  37.771   48.419  1.00 301.53 ? 21  DT  F N1    1 
ATOM 959   C C2    . DT  B  2 21  ? 93.021  36.739   49.310  1.00 292.98 ? 21  DT  F C2    1 
ATOM 960   O O2    . DT  B  2 21  ? 92.645  35.592   49.123  1.00 283.11 ? 21  DT  F O2    1 
ATOM 961   N N3    . DT  B  2 21  ? 93.732  37.102   50.429  1.00 294.12 ? 21  DT  F N3    1 
ATOM 962   C C4    . DT  B  2 21  ? 94.209  38.362   50.747  1.00 302.65 ? 21  DT  F C4    1 
ATOM 963   O O4    . DT  B  2 21  ? 94.823  38.537   51.797  1.00 305.63 ? 21  DT  F O4    1 
ATOM 964   C C5    . DT  B  2 21  ? 93.915  39.396   49.776  1.00 307.95 ? 21  DT  F C5    1 
ATOM 965   C C7    . DT  B  2 21  ? 94.387  40.793   50.032  1.00 313.77 ? 21  DT  F C7    1 
ATOM 966   C C6    . DT  B  2 21  ? 93.224  39.053   48.681  1.00 306.71 ? 21  DT  F C6    1 
ATOM 967   P P     . DT  B  2 22  ? 88.309  37.782   44.830  1.00 351.49 ? 22  DT  F P     1 
ATOM 968   O OP1   . DT  B  2 22  ? 87.971  37.447   43.425  1.00 359.19 ? 22  DT  F OP1   1 
ATOM 969   O OP2   . DT  B  2 22  ? 88.121  39.169   45.319  1.00 358.35 ? 22  DT  F OP2   1 
ATOM 970   O "O5'" . DT  B  2 22  ? 87.496  36.813   45.807  1.00 352.01 ? 22  DT  F "O5'" 1 
ATOM 971   C "C5'" . DT  B  2 22  ? 87.864  35.425   45.974  1.00 359.12 ? 22  DT  F "C5'" 1 
ATOM 972   C "C4'" . DT  B  2 22  ? 87.526  34.912   47.358  1.00 361.03 ? 22  DT  F "C4'" 1 
ATOM 973   O "O4'" . DT  B  2 22  ? 88.523  35.315   48.328  1.00 352.52 ? 22  DT  F "O4'" 1 
ATOM 974   C "C3'" . DT  B  2 22  ? 86.177  35.348   47.933  1.00 373.36 ? 22  DT  F "C3'" 1 
ATOM 975   O "O3'" . DT  B  2 22  ? 85.569  34.245   48.616  1.00 392.52 ? 22  DT  F "O3'" 1 
ATOM 976   C "C2'" . DT  B  2 22  ? 86.560  36.419   48.934  1.00 363.26 ? 22  DT  F "C2'" 1 
ATOM 977   C "C1'" . DT  B  2 22  ? 87.867  35.859   49.458  1.00 350.19 ? 22  DT  F "C1'" 1 
ATOM 978   N N1    . DT  B  2 22  ? 88.767  36.838   50.079  1.00 343.27 ? 22  DT  F N1    1 
ATOM 979   C C2    . DT  B  2 22  ? 89.529  36.407   51.139  1.00 341.56 ? 22  DT  F C2    1 
ATOM 980   O O2    . DT  B  2 22  ? 89.493  35.263   51.565  1.00 346.30 ? 22  DT  F O2    1 
ATOM 981   N N3    . DT  B  2 22  ? 90.346  37.368   51.683  1.00 336.61 ? 22  DT  F N3    1 
ATOM 982   C C4    . DT  B  2 22  ? 90.468  38.687   51.283  1.00 329.18 ? 22  DT  F C4    1 
ATOM 983   O O4    . DT  B  2 22  ? 91.243  39.435   51.872  1.00 325.54 ? 22  DT  F O4    1 
ATOM 984   C C5    . DT  B  2 22  ? 89.643  39.068   50.157  1.00 329.95 ? 22  DT  F C5    1 
ATOM 985   C C7    . DT  B  2 22  ? 89.707  40.476   49.653  1.00 325.61 ? 22  DT  F C7    1 
ATOM 986   C C6    . DT  B  2 22  ? 88.840  38.138   49.623  1.00 336.07 ? 22  DT  F C6    1 
ATOM 987   P P     . DT  B  2 23  ? 83.966  34.131   48.668  1.00 413.45 ? 23  DT  F P     1 
ATOM 988   O OP1   . DT  B  2 23  ? 83.510  33.378   47.476  1.00 427.67 ? 23  DT  F OP1   1 
ATOM 989   O OP2   . DT  B  2 23  ? 83.429  35.488   48.942  1.00 425.26 ? 23  DT  F OP2   1 
ATOM 990   O "O5'" . DT  B  2 23  ? 83.650  33.159   49.893  1.00 406.93 ? 23  DT  F "O5'" 1 
ATOM 991   C "C5'" . DT  B  2 23  ? 84.671  32.431   50.587  1.00 398.01 ? 23  DT  F "C5'" 1 
ATOM 992   C "C4'" . DT  B  2 23  ? 84.594  32.769   52.056  1.00 394.87 ? 23  DT  F "C4'" 1 
ATOM 993   O "O4'" . DT  B  2 23  ? 85.582  33.769   52.390  1.00 387.28 ? 23  DT  F "O4'" 1 
ATOM 994   C "C3'" . DT  B  2 23  ? 83.245  33.328   52.528  1.00 397.82 ? 23  DT  F "C3'" 1 
ATOM 995   O "O3'" . DT  B  2 23  ? 82.872  32.522   53.639  1.00 400.32 ? 23  DT  F "O3'" 1 
ATOM 996   C "C2'" . DT  B  2 23  ? 83.568  34.734   53.013  1.00 390.29 ? 23  DT  F "C2'" 1 
ATOM 997   C "C1'" . DT  B  2 23  ? 85.030  34.611   53.385  1.00 374.62 ? 23  DT  F "C1'" 1 
ATOM 998   N N1    . DT  B  2 23  ? 85.768  35.881   53.362  1.00 355.15 ? 23  DT  F N1    1 
ATOM 999   C C2    . DT  B  2 23  ? 86.827  36.062   54.227  1.00 343.92 ? 23  DT  F C2    1 
ATOM 1000  O O2    . DT  B  2 23  ? 87.192  35.215   55.030  1.00 336.43 ? 23  DT  F O2    1 
ATOM 1001  N N3    . DT  B  2 23  ? 87.449  37.282   54.116  1.00 338.12 ? 23  DT  F N3    1 
ATOM 1002  C C4    . DT  B  2 23  ? 87.127  38.310   53.248  1.00 331.51 ? 23  DT  F C4    1 
ATOM 1003  O O4    . DT  B  2 23  ? 87.783  39.348   53.262  1.00 325.72 ? 23  DT  F O4    1 
ATOM 1004  C C5    . DT  B  2 23  ? 86.002  38.050   52.373  1.00 333.27 ? 23  DT  F C5    1 
ATOM 1005  C C7    . DT  B  2 23  ? 85.576  39.105   51.401  1.00 328.23 ? 23  DT  F C7    1 
ATOM 1006  C C6    . DT  B  2 23  ? 85.389  36.865   52.474  1.00 344.07 ? 23  DT  F C6    1 
ATOM 1007  P P     . DT  B  2 24  ? 81.397  32.570   54.238  1.00 390.74 ? 24  DT  F P     1 
ATOM 1008  O OP1   . DT  B  2 24  ? 80.615  31.505   53.559  1.00 398.42 ? 24  DT  F OP1   1 
ATOM 1009  O OP2   . DT  B  2 24  ? 80.906  33.977   54.189  1.00 383.37 ? 24  DT  F OP2   1 
ATOM 1010  O "O5'" . DT  B  2 24  ? 81.663  32.167   55.760  1.00 377.71 ? 24  DT  F "O5'" 1 
ATOM 1011  C "C5'" . DT  B  2 24  ? 82.919  31.550   56.142  1.00 356.68 ? 24  DT  F "C5'" 1 
ATOM 1012  C "C4'" . DT  B  2 24  ? 83.437  32.142   57.431  1.00 334.35 ? 24  DT  F "C4'" 1 
ATOM 1013  O "O4'" . DT  B  2 24  ? 84.253  33.313   57.165  1.00 330.13 ? 24  DT  F "O4'" 1 
ATOM 1014  C "C3'" . DT  B  2 24  ? 82.333  32.596   58.384  1.00 325.07 ? 24  DT  F "C3'" 1 
ATOM 1015  O "O3'" . DT  B  2 24  ? 82.683  32.196   59.702  1.00 309.54 ? 24  DT  F "O3'" 1 
ATOM 1016  C "C2'" . DT  B  2 24  ? 82.380  34.108   58.287  1.00 328.84 ? 24  DT  F "C2'" 1 
ATOM 1017  C "C1'" . DT  B  2 24  ? 83.857  34.354   58.045  1.00 322.63 ? 24  DT  F "C1'" 1 
ATOM 1018  N N1    . DT  B  2 24  ? 84.146  35.665   57.403  1.00 307.73 ? 24  DT  F N1    1 
ATOM 1019  C C2    . DT  B  2 24  ? 85.246  36.402   57.801  1.00 295.55 ? 24  DT  F C2    1 
ATOM 1020  O O2    . DT  B  2 24  ? 86.060  36.005   58.622  1.00 291.99 ? 24  DT  F O2    1 
ATOM 1021  N N3    . DT  B  2 24  ? 85.371  37.620   57.178  1.00 284.59 ? 24  DT  F N3    1 
ATOM 1022  C C4    . DT  B  2 24  ? 84.521  38.170   56.236  1.00 282.07 ? 24  DT  F C4    1 
ATOM 1023  O O4    . DT  B  2 24  ? 84.770  39.272   55.758  1.00 273.93 ? 24  DT  F O4    1 
ATOM 1024  C C5    . DT  B  2 24  ? 83.385  37.351   55.878  1.00 288.00 ? 24  DT  F C5    1 
ATOM 1025  C C7    . DT  B  2 24  ? 82.410  37.864   54.866  1.00 289.19 ? 24  DT  F C7    1 
ATOM 1026  C C6    . DT  B  2 24  ? 83.248  36.164   56.484  1.00 298.85 ? 24  DT  F C6    1 
ATOM 1027  P P     . DT  B  2 25  ? 81.548  32.015   60.791  1.00 301.62 ? 25  DT  F P     1 
ATOM 1028  O OP1   . DT  B  2 25  ? 81.376  30.558   61.000  1.00 297.87 ? 25  DT  F OP1   1 
ATOM 1029  O OP2   . DT  B  2 25  ? 80.368  32.832   60.381  1.00 299.87 ? 25  DT  F OP2   1 
ATOM 1030  O "O5'" . DT  B  2 25  ? 82.194  32.679   62.093  1.00 308.91 ? 25  DT  F "O5'" 1 
ATOM 1031  C "C5'" . DT  B  2 25  ? 83.601  32.505   62.433  1.00 318.87 ? 25  DT  F "C5'" 1 
ATOM 1032  C "C4'" . DT  B  2 25  ? 84.200  33.708   63.139  1.00 324.51 ? 25  DT  F "C4'" 1 
ATOM 1033  O "O4'" . DT  B  2 25  ? 84.349  34.842   62.241  1.00 334.05 ? 25  DT  F "O4'" 1 
ATOM 1034  C "C3'" . DT  B  2 25  ? 83.466  34.257   64.361  1.00 322.68 ? 25  DT  F "C3'" 1 
ATOM 1035  O "O3'" . DT  B  2 25  ? 84.426  34.810   65.263  1.00 315.63 ? 25  DT  F "O3'" 1 
ATOM 1036  C "C2'" . DT  B  2 25  ? 82.690  35.421   63.782  1.00 326.01 ? 25  DT  F "C2'" 1 
ATOM 1037  C "C1'" . DT  B  2 25  ? 83.713  35.982   62.809  1.00 329.09 ? 25  DT  F "C1'" 1 
ATOM 1038  N N1    . DT  B  2 25  ? 83.202  36.812   61.700  1.00 326.54 ? 25  DT  F N1    1 
ATOM 1039  C C2    . DT  B  2 25  ? 83.918  37.942   61.362  1.00 322.52 ? 25  DT  F C2    1 
ATOM 1040  O O2    . DT  B  2 25  ? 84.912  38.310   61.968  1.00 318.08 ? 25  DT  F O2    1 
ATOM 1041  N N3    . DT  B  2 25  ? 83.409  38.642   60.296  1.00 321.20 ? 25  DT  F N3    1 
ATOM 1042  C C4    . DT  B  2 25  ? 82.298  38.322   59.537  1.00 322.42 ? 25  DT  F C4    1 
ATOM 1043  O O4    . DT  B  2 25  ? 81.966  39.049   58.604  1.00 321.57 ? 25  DT  F O4    1 
ATOM 1044  C C5    . DT  B  2 25  ? 81.609  37.111   59.934  1.00 322.62 ? 25  DT  F C5    1 
ATOM 1045  C C7    . DT  B  2 25  ? 80.392  36.683   59.175  1.00 322.16 ? 25  DT  F C7    1 
ATOM 1046  C C6    . DT  B  2 25  ? 82.093  36.425   60.977  1.00 323.54 ? 25  DT  F C6    1 
ATOM 1047  P P     . DT  B  2 26  ? 84.298  34.517   66.825  1.00 308.97 ? 26  DT  F P     1 
ATOM 1048  O OP1   . DT  B  2 26  ? 85.475  33.716   67.237  1.00 298.59 ? 26  DT  F OP1   1 
ATOM 1049  O OP2   . DT  B  2 26  ? 82.937  33.978   67.063  1.00 314.26 ? 26  DT  F OP2   1 
ATOM 1050  O "O5'" . DT  B  2 26  ? 84.334  35.971   67.485  1.00 311.88 ? 26  DT  F "O5'" 1 
ATOM 1051  C "C5'" . DT  B  2 26  ? 85.503  36.820   67.441  1.00 305.71 ? 26  DT  F "C5'" 1 
ATOM 1052  C "C4'" . DT  B  2 26  ? 85.109  38.276   67.569  1.00 304.77 ? 26  DT  F "C4'" 1 
ATOM 1053  O "O4'" . DT  B  2 26  ? 84.521  38.739   66.328  1.00 307.42 ? 26  DT  F "O4'" 1 
ATOM 1054  C "C3'" . DT  B  2 26  ? 84.093  38.594   68.673  1.00 303.73 ? 26  DT  F "C3'" 1 
ATOM 1055  O "O3'" . DT  B  2 26  ? 84.490  39.740   69.428  1.00 298.79 ? 26  DT  F "O3'" 1 
ATOM 1056  C "C2'" . DT  B  2 26  ? 82.822  38.948   67.916  1.00 308.06 ? 26  DT  F "C2'" 1 
ATOM 1057  C "C1'" . DT  B  2 26  ? 83.356  39.500   66.606  1.00 310.86 ? 26  DT  F "C1'" 1 
ATOM 1058  N N1    . DT  B  2 26  ? 82.440  39.376   65.445  1.00 316.43 ? 26  DT  F N1    1 
ATOM 1059  C C2    . DT  B  2 26  ? 82.603  40.255   64.396  1.00 320.43 ? 26  DT  F C2    1 
ATOM 1060  O O2    . DT  B  2 26  ? 83.458  41.127   64.380  1.00 317.44 ? 26  DT  F O2    1 
ATOM 1061  N N3    . DT  B  2 26  ? 81.716  40.079   63.362  1.00 326.02 ? 26  DT  F N3    1 
ATOM 1062  C C4    . DT  B  2 26  ? 80.711  39.133   63.272  1.00 323.52 ? 26  DT  F C4    1 
ATOM 1063  O O4    . DT  B  2 26  ? 79.993  39.096   62.277  1.00 330.22 ? 26  DT  F O4    1 
ATOM 1064  C C5    . DT  B  2 26  ? 80.598  38.244   64.405  1.00 316.39 ? 26  DT  F C5    1 
ATOM 1065  C C7    . DT  B  2 26  ? 79.535  37.190   64.399  1.00 305.27 ? 26  DT  F C7    1 
ATOM 1066  C C6    . DT  B  2 26  ? 81.455  38.408   65.421  1.00 316.03 ? 26  DT  F C6    1 
ATOM 1067  P P     . DA  C  1 1   ? 75.149  -52.191  69.166  1.00 537.35 ? 1   DA  O P     1 
ATOM 1068  O OP1   . DA  C  1 1   ? 74.587  -51.807  70.487  1.00 526.58 ? 1   DA  O OP1   1 
ATOM 1069  O OP2   . DA  C  1 1   ? 75.045  -51.244  68.027  1.00 543.90 ? 1   DA  O OP2   1 
ATOM 1070  O "O5'" . DA  C  1 1   ? 76.678  -52.564  69.386  1.00 536.11 ? 1   DA  O "O5'" 1 
ATOM 1071  C "C5'" . DA  C  1 1   ? 77.180  -53.871  69.031  1.00 550.41 ? 1   DA  O "C5'" 1 
ATOM 1072  C "C4'" . DA  C  1 1   ? 78.580  -53.786  68.464  1.00 556.84 ? 1   DA  O "C4'" 1 
ATOM 1073  O "O4'" . DA  C  1 1   ? 78.656  -52.819  67.386  1.00 562.13 ? 1   DA  O "O4'" 1 
ATOM 1074  C "C3'" . DA  C  1 1   ? 79.674  -53.392  69.454  1.00 548.59 ? 1   DA  O "C3'" 1 
ATOM 1075  O "O3'" . DA  C  1 1   ? 80.852  -54.116  69.103  1.00 559.37 ? 1   DA  O "O3'" 1 
ATOM 1076  C "C2'" . DA  C  1 1   ? 79.883  -51.920  69.158  1.00 542.77 ? 1   DA  O "C2'" 1 
ATOM 1077  C "C1'" . DA  C  1 1   ? 79.687  -51.884  67.653  1.00 553.02 ? 1   DA  O "C1'" 1 
ATOM 1078  N N9    . DA  C  1 1   ? 79.284  -50.601  67.075  1.00 554.24 ? 1   DA  O N9    1 
ATOM 1079  C C8    . DA  C  1 1   ? 78.324  -49.725  67.520  1.00 550.34 ? 1   DA  O C8    1 
ATOM 1080  N N7    . DA  C  1 1   ? 78.174  -48.671  66.754  1.00 555.63 ? 1   DA  O N7    1 
ATOM 1081  C C5    . DA  C  1 1   ? 79.088  -48.871  65.729  1.00 566.01 ? 1   DA  O C5    1 
ATOM 1082  C C6    . DA  C  1 1   ? 79.421  -48.108  64.593  1.00 579.32 ? 1   DA  O C6    1 
ATOM 1083  N N6    . DA  C  1 1   ? 78.849  -46.939  64.293  1.00 584.00 ? 1   DA  O N6    1 
ATOM 1084  N N1    . DA  C  1 1   ? 80.373  -48.595  63.766  1.00 590.25 ? 1   DA  O N1    1 
ATOM 1085  C C2    . DA  C  1 1   ? 80.950  -49.765  64.072  1.00 588.29 ? 1   DA  O C2    1 
ATOM 1086  N N3    . DA  C  1 1   ? 80.723  -50.573  65.107  1.00 575.98 ? 1   DA  O N3    1 
ATOM 1087  C C4    . DA  C  1 1   ? 79.770  -50.062  65.907  1.00 564.40 ? 1   DA  O C4    1 
ATOM 1088  P P     . DA  C  1 2   ? 81.855  -54.607  70.240  1.00 556.93 ? 2   DA  O P     1 
ATOM 1089  O OP1   . DA  C  1 2   ? 81.732  -56.083  70.369  1.00 567.14 ? 2   DA  O OP1   1 
ATOM 1090  O OP2   . DA  C  1 2   ? 81.641  -53.754  71.434  1.00 542.32 ? 2   DA  O OP2   1 
ATOM 1091  O "O5'" . DA  C  1 2   ? 83.280  -54.264  69.610  1.00 555.31 ? 2   DA  O "O5'" 1 
ATOM 1092  C "C5'" . DA  C  1 2   ? 83.519  -54.346  68.186  1.00 553.81 ? 2   DA  O "C5'" 1 
ATOM 1093  C "C4'" . DA  C  1 2   ? 84.626  -53.402  67.768  1.00 541.74 ? 2   DA  O "C4'" 1 
ATOM 1094  O "O4'" . DA  C  1 2   ? 84.046  -52.173  67.270  1.00 536.87 ? 2   DA  O "O4'" 1 
ATOM 1095  C "C3'" . DA  C  1 2   ? 85.617  -52.991  68.865  1.00 529.61 ? 2   DA  O "C3'" 1 
ATOM 1096  O "O3'" . DA  C  1 2   ? 86.939  -52.945  68.319  1.00 532.15 ? 2   DA  O "O3'" 1 
ATOM 1097  C "C2'" . DA  C  1 2   ? 85.183  -51.579  69.213  1.00 517.68 ? 2   DA  O "C2'" 1 
ATOM 1098  C "C1'" . DA  C  1 2   ? 84.690  -51.070  67.875  1.00 523.18 ? 2   DA  O "C1'" 1 
ATOM 1099  N N9    . DA  C  1 2   ? 83.725  -49.978  67.963  1.00 516.35 ? 2   DA  O N9    1 
ATOM 1100  C C8    . DA  C  1 2   ? 82.811  -49.726  68.956  1.00 505.86 ? 2   DA  O C8    1 
ATOM 1101  N N7    . DA  C  1 2   ? 82.092  -48.649  68.752  1.00 505.49 ? 2   DA  O N7    1 
ATOM 1102  C C5    . DA  C  1 2   ? 82.555  -48.165  67.537  1.00 517.78 ? 2   DA  O C5    1 
ATOM 1103  C C6    . DA  C  1 2   ? 82.195  -47.045  66.763  1.00 527.62 ? 2   DA  O C6    1 
ATOM 1104  N N6    . DA  C  1 2   ? 81.244  -46.174  67.113  1.00 525.06 ? 2   DA  O N6    1 
ATOM 1105  N N1    . DA  C  1 2   ? 82.862  -46.842  65.605  1.00 544.45 ? 2   DA  O N1    1 
ATOM 1106  C C2    . DA  C  1 2   ? 83.823  -47.710  65.257  1.00 549.39 ? 2   DA  O C2    1 
ATOM 1107  N N3    . DA  C  1 2   ? 84.249  -48.797  65.899  1.00 540.13 ? 2   DA  O N3    1 
ATOM 1108  C C4    . DA  C  1 2   ? 83.563  -48.973  67.041  1.00 523.74 ? 2   DA  O C4    1 
ATOM 1109  P P     . DA  C  1 3   ? 88.257  -53.093  69.250  1.00 527.57 ? 3   DA  O P     1 
ATOM 1110  O OP1   . DA  C  1 3   ? 88.642  -54.527  69.288  1.00 538.35 ? 3   DA  O OP1   1 
ATOM 1111  O OP2   . DA  C  1 3   ? 88.055  -52.348  70.522  1.00 513.62 ? 3   DA  O OP2   1 
ATOM 1112  O "O5'" . DA  C  1 3   ? 89.346  -52.286  68.411  1.00 523.57 ? 3   DA  O "O5'" 1 
ATOM 1113  C "C5'" . DA  C  1 3   ? 89.094  -51.943  67.030  1.00 521.39 ? 3   DA  O "C5'" 1 
ATOM 1114  C "C4'" . DA  C  1 3   ? 89.558  -50.537  66.730  1.00 509.94 ? 3   DA  O "C4'" 1 
ATOM 1115  O "O4'" . DA  C  1 3   ? 88.440  -49.617  66.759  1.00 499.78 ? 3   DA  O "O4'" 1 
ATOM 1116  C "C3'" . DA  C  1 3   ? 90.593  -49.970  67.703  1.00 498.55 ? 3   DA  O "C3'" 1 
ATOM 1117  O "O3'" . DA  C  1 3   ? 91.527  -49.204  66.950  1.00 507.31 ? 3   DA  O "O3'" 1 
ATOM 1118  C "C2'" . DA  C  1 3   ? 89.784  -49.000  68.539  1.00 480.82 ? 3   DA  O "C2'" 1 
ATOM 1119  C "C1'" . DA  C  1 3   ? 88.831  -48.477  67.493  1.00 481.63 ? 3   DA  O "C1'" 1 
ATOM 1120  N N9    . DA  C  1 3   ? 87.637  -47.887  68.072  1.00 466.24 ? 3   DA  O N9    1 
ATOM 1121  C C8    . DA  C  1 3   ? 87.034  -48.243  69.250  1.00 455.20 ? 3   DA  O C8    1 
ATOM 1122  N N7    . DA  C  1 3   ? 85.986  -47.516  69.549  1.00 451.13 ? 3   DA  O N7    1 
ATOM 1123  C C5    . DA  C  1 3   ? 85.903  -46.606  68.504  1.00 457.07 ? 3   DA  O C5    1 
ATOM 1124  C C6    . DA  C  1 3   ? 85.010  -45.553  68.234  1.00 458.64 ? 3   DA  O C6    1 
ATOM 1125  N N6    . DA  C  1 3   ? 83.983  -45.230  69.024  1.00 453.74 ? 3   DA  O N6    1 
ATOM 1126  N N1    . DA  C  1 3   ? 85.206  -44.838  67.104  1.00 467.43 ? 3   DA  O N1    1 
ATOM 1127  C C2    . DA  C  1 3   ? 86.243  -45.156  66.317  1.00 473.02 ? 3   DA  O C2    1 
ATOM 1128  N N3    . DA  C  1 3   ? 87.145  -46.126  66.460  1.00 470.98 ? 3   DA  O N3    1 
ATOM 1129  C C4    . DA  C  1 3   ? 86.918  -46.820  67.590  1.00 464.35 ? 3   DA  O C4    1 
ATOM 1130  P P     . DA  C  1 4   ? 92.997  -48.943  67.519  1.00 506.96 ? 4   DA  O P     1 
ATOM 1131  O OP1   . DA  C  1 4   ? 93.855  -50.093  67.129  1.00 517.32 ? 4   DA  O OP1   1 
ATOM 1132  O OP2   . DA  C  1 4   ? 92.886  -48.574  68.954  1.00 489.29 ? 4   DA  O OP2   1 
ATOM 1133  O "O5'" . DA  C  1 4   ? 93.456  -47.659  66.692  1.00 516.86 ? 4   DA  O "O5'" 1 
ATOM 1134  C "C5'" . DA  C  1 4   ? 92.793  -47.291  65.461  1.00 539.82 ? 4   DA  O "C5'" 1 
ATOM 1135  C "C4'" . DA  C  1 4   ? 92.514  -45.806  65.420  1.00 544.25 ? 4   DA  O "C4'" 1 
ATOM 1136  O "O4'" . DA  C  1 4   ? 91.286  -45.519  66.131  1.00 539.56 ? 4   DA  O "O4'" 1 
ATOM 1137  C "C3'" . DA  C  1 4   ? 93.581  -44.919  66.068  1.00 539.21 ? 4   DA  O "C3'" 1 
ATOM 1138  O "O3'" . DA  C  1 4   ? 93.632  -43.656  65.389  1.00 547.11 ? 4   DA  O "O3'" 1 
ATOM 1139  C "C2'" . DA  C  1 4   ? 93.001  -44.655  67.442  1.00 526.08 ? 4   DA  O "C2'" 1 
ATOM 1140  C "C1'" . DA  C  1 4   ? 91.552  -44.481  67.058  1.00 531.55 ? 4   DA  O "C1'" 1 
ATOM 1141  N N9    . DA  C  1 4   ? 90.591  -44.591  68.146  1.00 528.18 ? 4   DA  O N9    1 
ATOM 1142  C C8    . DA  C  1 4   ? 90.578  -45.451  69.216  1.00 523.50 ? 4   DA  O C8    1 
ATOM 1143  N N7    . DA  C  1 4   ? 89.556  -45.279  70.019  1.00 525.81 ? 4   DA  O N7    1 
ATOM 1144  C C5    . DA  C  1 4   ? 88.854  -44.227  69.445  1.00 533.43 ? 4   DA  O C5    1 
ATOM 1145  C C6    . DA  C  1 4   ? 87.666  -43.567  69.811  1.00 541.07 ? 4   DA  O C6    1 
ATOM 1146  N N6    . DA  C  1 4   ? 86.950  -43.873  70.894  1.00 547.50 ? 4   DA  O N6    1 
ATOM 1147  N N1    . DA  C  1 4   ? 87.237  -42.559  69.018  1.00 547.51 ? 4   DA  O N1    1 
ATOM 1148  C C2    . DA  C  1 4   ? 87.961  -42.243  67.937  1.00 547.92 ? 4   DA  O C2    1 
ATOM 1149  N N3    . DA  C  1 4   ? 89.082  -42.799  67.480  1.00 543.42 ? 4   DA  O N3    1 
ATOM 1150  C C4    . DA  C  1 4   ? 89.484  -43.791  68.294  1.00 534.07 ? 4   DA  O C4    1 
ATOM 1151  P P     . DA  C  1 5   ? 94.977  -42.771  65.399  1.00 546.12 ? 5   DA  O P     1 
ATOM 1152  O OP1   . DA  C  1 5   ? 95.780  -43.152  64.208  1.00 558.31 ? 5   DA  O OP1   1 
ATOM 1153  O OP2   . DA  C  1 5   ? 95.598  -42.866  66.756  1.00 534.24 ? 5   DA  O OP2   1 
ATOM 1154  O "O5'" . DA  C  1 5   ? 94.444  -41.284  65.160  1.00 546.81 ? 5   DA  O "O5'" 1 
ATOM 1155  C "C5'" . DA  C  1 5   ? 93.346  -40.986  64.254  1.00 557.73 ? 5   DA  O "C5'" 1 
ATOM 1156  C "C4'" . DA  C  1 5   ? 92.449  -39.899  64.810  1.00 555.05 ? 5   DA  O "C4'" 1 
ATOM 1157  O "O4'" . DA  C  1 5   ? 91.755  -40.370  65.996  1.00 547.90 ? 5   DA  O "O4'" 1 
ATOM 1158  C "C3'" . DA  C  1 5   ? 93.140  -38.599  65.234  1.00 549.02 ? 5   DA  O "C3'" 1 
ATOM 1159  O "O3'" . DA  C  1 5   ? 92.215  -37.519  65.008  1.00 548.62 ? 5   DA  O "O3'" 1 
ATOM 1160  C "C2'" . DA  C  1 5   ? 93.355  -38.820  66.724  1.00 537.08 ? 5   DA  O "C2'" 1 
ATOM 1161  C "C1'" . DA  C  1 5   ? 92.047  -39.508  67.099  1.00 535.84 ? 5   DA  O "C1'" 1 
ATOM 1162  N N9    . DA  C  1 5   ? 91.958  -40.303  68.336  1.00 521.76 ? 5   DA  O N9    1 
ATOM 1163  C C8    . DA  C  1 5   ? 92.769  -41.327  68.764  1.00 515.33 ? 5   DA  O C8    1 
ATOM 1164  N N7    . DA  C  1 5   ? 92.362  -41.897  69.873  1.00 505.85 ? 5   DA  O N7    1 
ATOM 1165  C C5    . DA  C  1 5   ? 91.191  -41.220  70.184  1.00 505.12 ? 5   DA  O C5    1 
ATOM 1166  C C6    . DA  C  1 5   ? 90.271  -41.358  71.237  1.00 499.70 ? 5   DA  O C6    1 
ATOM 1167  N N6    . DA  C  1 5   ? 90.408  -42.242  72.227  1.00 496.97 ? 5   DA  O N6    1 
ATOM 1168  N N1    . DA  C  1 5   ? 89.210  -40.521  71.258  1.00 500.33 ? 5   DA  O N1    1 
ATOM 1169  C C2    . DA  C  1 5   ? 89.089  -39.617  70.279  1.00 508.11 ? 5   DA  O C2    1 
ATOM 1170  N N3    . DA  C  1 5   ? 89.874  -39.404  69.227  1.00 516.13 ? 5   DA  O N3    1 
ATOM 1171  C C4    . DA  C  1 5   ? 90.925  -40.243  69.241  1.00 513.88 ? 5   DA  O C4    1 
ATOM 1172  P P     . DA  C  1 6   ? 92.700  -36.072  64.446  1.00 548.42 ? 6   DA  O P     1 
ATOM 1173  O OP1   . DA  C  1 6   ? 91.869  -35.738  63.260  1.00 559.68 ? 6   DA  O OP1   1 
ATOM 1174  O OP2   . DA  C  1 6   ? 94.181  -36.093  64.315  1.00 547.98 ? 6   DA  O OP2   1 
ATOM 1175  O "O5'" . DA  C  1 6   ? 92.297  -35.060  65.616  1.00 534.01 ? 6   DA  O "O5'" 1 
ATOM 1176  C "C5'" . DA  C  1 6   ? 90.914  -34.852  66.001  1.00 522.46 ? 6   DA  O "C5'" 1 
ATOM 1177  C "C4'" . DA  C  1 6   ? 90.779  -34.151  67.337  1.00 502.17 ? 6   DA  O "C4'" 1 
ATOM 1178  O "O4'" . DA  C  1 6   ? 90.799  -35.081  68.450  1.00 482.46 ? 6   DA  O "O4'" 1 
ATOM 1179  C "C3'" . DA  C  1 6   ? 91.803  -33.068  67.673  1.00 496.18 ? 6   DA  O "C3'" 1 
ATOM 1180  O "O3'" . DA  C  1 6   ? 90.985  -32.064  68.287  1.00 500.27 ? 6   DA  O "O3'" 1 
ATOM 1181  C "C2'" . DA  C  1 6   ? 92.732  -33.761  68.662  1.00 476.19 ? 6   DA  O "C2'" 1 
ATOM 1182  C "C1'" . DA  C  1 6   ? 91.785  -34.691  69.404  1.00 463.66 ? 6   DA  O "C1'" 1 
ATOM 1183  N N9    . DA  C  1 6   ? 92.365  -35.914  69.970  1.00 444.47 ? 6   DA  O N9    1 
ATOM 1184  C C8    . DA  C  1 6   ? 93.437  -36.653  69.529  1.00 440.21 ? 6   DA  O C8    1 
ATOM 1185  N N7    . DA  C  1 6   ? 93.662  -37.734  70.236  1.00 430.06 ? 6   DA  O N7    1 
ATOM 1186  C C5    . DA  C  1 6   ? 92.660  -37.718  71.196  1.00 426.28 ? 6   DA  O C5    1 
ATOM 1187  C C6    . DA  C  1 6   ? 92.352  -38.588  72.257  1.00 420.14 ? 6   DA  O C6    1 
ATOM 1188  N N6    . DA  C  1 6   ? 93.051  -39.691  72.539  1.00 418.34 ? 6   DA  O N6    1 
ATOM 1189  N N1    . DA  C  1 6   ? 91.290  -38.278  73.034  1.00 418.31 ? 6   DA  O N1    1 
ATOM 1190  C C2    . DA  C  1 6   ? 90.598  -37.164  72.760  1.00 422.04 ? 6   DA  O C2    1 
ATOM 1191  N N3    . DA  C  1 6   ? 90.784  -36.273  71.788  1.00 428.15 ? 6   DA  O N3    1 
ATOM 1192  C C4    . DA  C  1 6   ? 91.847  -36.608  71.037  1.00 431.80 ? 6   DA  O C4    1 
ATOM 1193  P P     . DA  C  1 7   ? 91.409  -30.511  68.302  1.00 507.03 ? 7   DA  O P     1 
ATOM 1194  O OP1   . DA  C  1 7   ? 90.369  -29.738  67.559  1.00 519.28 ? 7   DA  O OP1   1 
ATOM 1195  O OP2   . DA  C  1 7   ? 92.826  -30.409  67.874  1.00 506.41 ? 7   DA  O OP2   1 
ATOM 1196  O "O5'" . DA  C  1 7   ? 91.330  -30.168  69.860  1.00 498.09 ? 7   DA  O "O5'" 1 
ATOM 1197  C "C5'" . DA  C  1 7   ? 90.387  -30.872  70.715  1.00 491.90 ? 7   DA  O "C5'" 1 
ATOM 1198  C "C4'" . DA  C  1 7   ? 90.724  -30.840  72.193  1.00 476.22 ? 7   DA  O "C4'" 1 
ATOM 1199  O "O4'" . DA  C  1 7   ? 91.197  -32.138  72.620  1.00 476.69 ? 7   DA  O "O4'" 1 
ATOM 1200  C "C3'" . DA  C  1 7   ? 91.761  -29.834  72.701  1.00 461.84 ? 7   DA  O "C3'" 1 
ATOM 1201  O "O3'" . DA  C  1 7   ? 91.360  -29.452  74.027  1.00 433.86 ? 7   DA  O "O3'" 1 
ATOM 1202  C "C2'" . DA  C  1 7   ? 93.016  -30.678  72.825  1.00 465.17 ? 7   DA  O "C2'" 1 
ATOM 1203  C "C1'" . DA  C  1 7   ? 92.410  -31.965  73.337  1.00 477.69 ? 7   DA  O "C1'" 1 
ATOM 1204  N N9    . DA  C  1 7   ? 93.216  -33.164  73.149  1.00 495.29 ? 7   DA  O N9    1 
ATOM 1205  C C8    . DA  C  1 7   ? 94.148  -33.446  72.180  1.00 502.77 ? 7   DA  O C8    1 
ATOM 1206  N N7    . DA  C  1 7   ? 94.710  -34.624  72.314  1.00 506.47 ? 7   DA  O N7    1 
ATOM 1207  C C5    . DA  C  1 7   ? 94.101  -35.155  73.443  1.00 511.29 ? 7   DA  O C5    1 
ATOM 1208  C C6    . DA  C  1 7   ? 94.258  -36.379  74.117  1.00 515.18 ? 7   DA  O C6    1 
ATOM 1209  N N6    . DA  C  1 7   ? 95.109  -37.332  73.727  1.00 521.51 ? 7   DA  O N6    1 
ATOM 1210  N N1    . DA  C  1 7   ? 93.501  -36.594  75.218  1.00 516.14 ? 7   DA  O N1    1 
ATOM 1211  C C2    . DA  C  1 7   ? 92.649  -35.635  75.608  1.00 514.25 ? 7   DA  O C2    1 
ATOM 1212  N N3    . DA  C  1 7   ? 92.403  -34.451  75.053  1.00 513.61 ? 7   DA  O N3    1 
ATOM 1213  C C4    . DA  C  1 7   ? 93.177  -34.268  73.966  1.00 506.50 ? 7   DA  O C4    1 
ATOM 1214  P P     . DA  C  1 8   ? 91.912  -28.117  74.700  1.00 418.37 ? 8   DA  O P     1 
ATOM 1215  O OP1   . DA  C  1 8   ? 90.927  -27.035  74.437  1.00 429.25 ? 8   DA  O OP1   1 
ATOM 1216  O OP2   . DA  C  1 8   ? 93.331  -27.938  74.285  1.00 413.26 ? 8   DA  O OP2   1 
ATOM 1217  O "O5'" . DA  C  1 8   ? 91.894  -28.462  76.257  1.00 404.21 ? 8   DA  O "O5'" 1 
ATOM 1218  C "C5'" . DA  C  1 8   ? 91.117  -29.559  76.795  1.00 393.41 ? 8   DA  O "C5'" 1 
ATOM 1219  C "C4'" . DA  C  1 8   ? 91.804  -30.164  77.999  1.00 378.76 ? 8   DA  O "C4'" 1 
ATOM 1220  O "O4'" . DA  C  1 8   ? 92.527  -31.357  77.599  1.00 374.19 ? 8   DA  O "O4'" 1 
ATOM 1221  C "C3'" . DA  C  1 8   ? 92.836  -29.263  78.692  1.00 371.37 ? 8   DA  O "C3'" 1 
ATOM 1222  O "O3'" . DA  C  1 8   ? 92.870  -29.437  80.121  1.00 359.49 ? 8   DA  O "O3'" 1 
ATOM 1223  C "C2'" . DA  C  1 8   ? 94.152  -29.765  78.129  1.00 369.27 ? 8   DA  O "C2'" 1 
ATOM 1224  C "C1'" . DA  C  1 8   ? 93.872  -31.252  78.050  1.00 370.28 ? 8   DA  O "C1'" 1 
ATOM 1225  N N9    . DA  C  1 8   ? 94.734  -31.997  77.126  1.00 375.57 ? 8   DA  O N9    1 
ATOM 1226  C C8    . DA  C  1 8   ? 95.297  -31.568  75.946  1.00 383.85 ? 8   DA  O C8    1 
ATOM 1227  N N7    . DA  C  1 8   ? 96.038  -32.474  75.355  1.00 385.29 ? 8   DA  O N7    1 
ATOM 1228  C C5    . DA  C  1 8   ? 95.973  -33.569  76.208  1.00 379.79 ? 8   DA  O C5    1 
ATOM 1229  C C6    . DA  C  1 8   ? 96.539  -34.858  76.144  1.00 379.37 ? 8   DA  O C6    1 
ATOM 1230  N N6    . DA  C  1 8   ? 97.325  -35.273  75.146  1.00 387.12 ? 8   DA  O N6    1 
ATOM 1231  N N1    . DA  C  1 8   ? 96.274  -35.711  77.160  1.00 371.69 ? 8   DA  O N1    1 
ATOM 1232  C C2    . DA  C  1 8   ? 95.490  -35.291  78.165  1.00 364.49 ? 8   DA  O C2    1 
ATOM 1233  N N3    . DA  C  1 8   ? 94.882  -34.117  78.325  1.00 365.71 ? 8   DA  O N3    1 
ATOM 1234  C C4    . DA  C  1 8   ? 95.177  -33.287  77.307  1.00 373.50 ? 8   DA  O C4    1 
ATOM 1235  P P     . DA  C  1 9   ? 93.380  -28.249  81.106  1.00 356.13 ? 9   DA  O P     1 
ATOM 1236  O OP1   . DA  C  1 9   ? 92.189  -27.639  81.745  1.00 362.27 ? 9   DA  O OP1   1 
ATOM 1237  O OP2   . DA  C  1 9   ? 94.354  -27.395  80.384  1.00 356.67 ? 9   DA  O OP2   1 
ATOM 1238  O "O5'" . DA  C  1 9   ? 94.226  -29.012  82.215  1.00 351.31 ? 9   DA  O "O5'" 1 
ATOM 1239  C "C5'" . DA  C  1 9   ? 93.879  -30.339  82.615  1.00 356.16 ? 9   DA  O "C5'" 1 
ATOM 1240  C "C4'" . DA  C  1 9   ? 95.131  -31.145  82.860  1.00 357.18 ? 9   DA  O "C4'" 1 
ATOM 1241  O "O4'" . DA  C  1 9   ? 95.649  -31.679  81.617  1.00 357.52 ? 9   DA  O "O4'" 1 
ATOM 1242  C "C3'" . DA  C  1 9   ? 96.292  -30.377  83.500  1.00 359.19 ? 9   DA  O "C3'" 1 
ATOM 1243  O "O3'" . DA  C  1 9   ? 96.848  -31.251  84.486  1.00 361.64 ? 9   DA  O "O3'" 1 
ATOM 1244  C "C2'" . DA  C  1 9   ? 97.290  -30.241  82.364  1.00 357.86 ? 9   DA  O "C2'" 1 
ATOM 1245  C "C1'" . DA  C  1 9   ? 97.059  -31.573  81.686  1.00 359.96 ? 9   DA  O "C1'" 1 
ATOM 1246  N N9    . DA  C  1 9   ? 97.615  -31.755  80.341  1.00 368.24 ? 9   DA  O N9    1 
ATOM 1247  C C8    . DA  C  1 9   ? 97.732  -30.829  79.333  1.00 376.15 ? 9   DA  O C8    1 
ATOM 1248  N N7    . DA  C  1 9   ? 98.304  -31.296  78.249  1.00 381.43 ? 9   DA  O N7    1 
ATOM 1249  C C5    . DA  C  1 9   ? 98.590  -32.618  78.565  1.00 377.94 ? 9   DA  O C5    1 
ATOM 1250  C C6    . DA  C  1 9   ? 99.198  -33.657  77.835  1.00 379.55 ? 9   DA  O C6    1 
ATOM 1251  N N6    . DA  C  1 9   ? 99.636  -33.521  76.582  1.00 385.00 ? 9   DA  O N6    1 
ATOM 1252  N N1    . DA  C  1 9   ? 99.334  -34.857  78.443  1.00 374.61 ? 9   DA  O N1    1 
ATOM 1253  C C2    . DA  C  1 9   ? 98.889  -34.993  79.699  1.00 368.27 ? 9   DA  O C2    1 
ATOM 1254  N N3    . DA  C  1 9   ? 98.297  -34.096  80.486  1.00 367.58 ? 9   DA  O N3    1 
ATOM 1255  C C4    . DA  C  1 9   ? 98.180  -32.913  79.854  1.00 371.22 ? 9   DA  O C4    1 
ATOM 1256  P P     . DA  C  1 10  ? 97.655  -30.665  85.736  1.00 364.69 ? 10  DA  O P     1 
ATOM 1257  O OP1   . DA  C  1 10  ? 96.669  -30.263  86.770  1.00 370.50 ? 10  DA  O OP1   1 
ATOM 1258  O OP2   . DA  C  1 10  ? 98.651  -29.684  85.229  1.00 363.08 ? 10  DA  O OP2   1 
ATOM 1259  O "O5'" . DA  C  1 10  ? 98.409  -31.939  86.321  1.00 362.46 ? 10  DA  O "O5'" 1 
ATOM 1260  C "C5'" . DA  C  1 10  ? 98.175  -33.257  85.796  1.00 363.91 ? 10  DA  O "C5'" 1 
ATOM 1261  C "C4'" . DA  C  1 10  ? 99.499  -33.902  85.469  1.00 363.37 ? 10  DA  O "C4'" 1 
ATOM 1262  O "O4'" . DA  C  1 10  ? 99.815  -33.731  84.067  1.00 363.37 ? 10  DA  O "O4'" 1 
ATOM 1263  C "C3'" . DA  C  1 10  ? 100.688 -33.319  86.228  1.00 364.41 ? 10  DA  O "C3'" 1 
ATOM 1264  O "O3'" . DA  C  1 10  ? 101.544 -34.427  86.455  1.00 369.13 ? 10  DA  O "O3'" 1 
ATOM 1265  C "C2'" . DA  C  1 10  ? 101.345 -32.404  85.210  1.00 361.83 ? 10  DA  O "C2'" 1 
ATOM 1266  C "C1'" . DA  C  1 10  ? 101.143 -33.234  83.961  1.00 366.03 ? 10  DA  O "C1'" 1 
ATOM 1267  N N9    . DA  C  1 10  ? 101.271 -32.530  82.683  1.00 376.11 ? 10  DA  O N9    1 
ATOM 1268  C C8    . DA  C  1 10  ? 100.932 -31.231  82.390  1.00 382.25 ? 10  DA  O C8    1 
ATOM 1269  N N7    . DA  C  1 10  ? 101.157 -30.895  81.143  1.00 390.75 ? 10  DA  O N7    1 
ATOM 1270  C C5    . DA  C  1 10  ? 101.685 -32.047  80.576  1.00 391.69 ? 10  DA  O C5    1 
ATOM 1271  C C6    . DA  C  1 10  ? 102.133 -32.342  79.277  1.00 397.11 ? 10  DA  O C6    1 
ATOM 1272  N N6    . DA  C  1 10  ? 102.117 -31.463  78.273  1.00 402.52 ? 10  DA  O N6    1 
ATOM 1273  N N1    . DA  C  1 10  ? 102.605 -33.587  79.041  1.00 396.54 ? 10  DA  O N1    1 
ATOM 1274  C C2    . DA  C  1 10  ? 102.622 -34.466  80.050  1.00 391.04 ? 10  DA  O C2    1 
ATOM 1275  N N3    . DA  C  1 10  ? 102.220 -34.311  81.311  1.00 386.56 ? 10  DA  O N3    1 
ATOM 1276  C C4    . DA  C  1 10  ? 101.763 -33.062  81.513  1.00 384.59 ? 10  DA  O C4    1 
ATOM 1277  P P     . DA  C  1 11  ? 102.448 -34.463  87.743  1.00 376.83 ? 11  DA  O P     1 
ATOM 1278  O OP1   . DA  C  1 11  ? 101.641 -35.055  88.837  1.00 382.04 ? 11  DA  O OP1   1 
ATOM 1279  O OP2   . DA  C  1 11  ? 103.060 -33.122  87.906  1.00 379.18 ? 11  DA  O OP2   1 
ATOM 1280  O "O5'" . DA  C  1 11  ? 103.611 -35.470  87.335  1.00 375.97 ? 11  DA  O "O5'" 1 
ATOM 1281  C "C5'" . DA  C  1 11  ? 103.460 -36.340  86.201  1.00 376.14 ? 11  DA  O "C5'" 1 
ATOM 1282  C "C4'" . DA  C  1 11  ? 104.680 -36.296  85.306  1.00 375.88 ? 11  DA  O "C4'" 1 
ATOM 1283  O "O4'" . DA  C  1 11  ? 104.524 -35.317  84.249  1.00 368.78 ? 11  DA  O "O4'" 1 
ATOM 1284  C "C3'" . DA  C  1 11  ? 106.014 -35.965  85.973  1.00 377.77 ? 11  DA  O "C3'" 1 
ATOM 1285  O "O3'" . DA  C  1 11  ? 106.963 -36.707  85.211  1.00 390.36 ? 11  DA  O "O3'" 1 
ATOM 1286  C "C2'" . DA  C  1 11  ? 106.202 -34.498  85.638  1.00 367.61 ? 11  DA  O "C2'" 1 
ATOM 1287  C "C1'" . DA  C  1 11  ? 105.701 -34.528  84.210  1.00 361.53 ? 11  DA  O "C1'" 1 
ATOM 1288  N N9    . DA  C  1 11  ? 105.370 -33.264  83.567  1.00 351.46 ? 11  DA  O N9    1 
ATOM 1289  C C8    . DA  C  1 11  ? 104.815 -32.119  84.085  1.00 347.03 ? 11  DA  O C8    1 
ATOM 1290  N N7    . DA  C  1 11  ? 104.614 -31.181  83.192  1.00 346.64 ? 11  DA  O N7    1 
ATOM 1291  C C5    . DA  C  1 11  ? 105.062 -31.748  82.006  1.00 348.08 ? 11  DA  O C5    1 
ATOM 1292  C C6    . DA  C  1 11  ? 105.123 -31.263  80.688  1.00 349.87 ? 11  DA  O C6    1 
ATOM 1293  N N6    . DA  C  1 11  ? 104.721 -30.044  80.331  1.00 352.67 ? 11  DA  O N6    1 
ATOM 1294  N N1    . DA  C  1 11  ? 105.618 -32.087  79.737  1.00 349.99 ? 11  DA  O N1    1 
ATOM 1295  C C2    . DA  C  1 11  ? 106.027 -33.309  80.099  1.00 348.99 ? 11  DA  O C2    1 
ATOM 1296  N N3    . DA  C  1 11  ? 106.003 -33.884  81.298  1.00 348.18 ? 11  DA  O N3    1 
ATOM 1297  C C4    . DA  C  1 11  ? 105.514 -33.036  82.221  1.00 348.79 ? 11  DA  O C4    1 
ATOM 1298  P P     . DA  C  1 12  ? 108.141 -37.446  85.949  1.00 400.96 ? 12  DA  O P     1 
ATOM 1299  O OP1   . DA  C  1 12  ? 107.618 -38.730  86.482  1.00 402.49 ? 12  DA  O OP1   1 
ATOM 1300  O OP2   . DA  C  1 12  ? 108.751 -36.463  86.878  1.00 398.77 ? 12  DA  O OP2   1 
ATOM 1301  O "O5'" . DA  C  1 12  ? 109.173 -37.781  84.778  1.00 410.19 ? 12  DA  O "O5'" 1 
ATOM 1302  C "C5'" . DA  C  1 12  ? 108.795 -37.895  83.388  1.00 410.21 ? 12  DA  O "C5'" 1 
ATOM 1303  C "C4'" . DA  C  1 12  ? 109.814 -37.205  82.504  1.00 405.60 ? 12  DA  O "C4'" 1 
ATOM 1304  O "O4'" . DA  C  1 12  ? 109.355 -35.868  82.194  1.00 395.14 ? 12  DA  O "O4'" 1 
ATOM 1305  C "C3'" . DA  C  1 12  ? 111.226 -37.038  83.085  1.00 406.78 ? 12  DA  O "C3'" 1 
ATOM 1306  O "O3'" . DA  C  1 12  ? 112.222 -37.222  82.064  1.00 406.54 ? 12  DA  O "O3'" 1 
ATOM 1307  C "C2'" . DA  C  1 12  ? 111.248 -35.589  83.544  1.00 397.43 ? 12  DA  O "C2'" 1 
ATOM 1308  C "C1'" . DA  C  1 12  ? 110.386 -34.933  82.485  1.00 386.83 ? 12  DA  O "C1'" 1 
ATOM 1309  N N9    . DA  C  1 12  ? 109.750 -33.667  82.847  1.00 371.67 ? 12  DA  O N9    1 
ATOM 1310  C C8    . DA  C  1 12  ? 109.306 -33.217  84.067  1.00 365.51 ? 12  DA  O C8    1 
ATOM 1311  N N7    . DA  C  1 12  ? 108.746 -32.033  84.021  1.00 360.71 ? 12  DA  O N7    1 
ATOM 1312  C C5    . DA  C  1 12  ? 108.809 -31.687  82.678  1.00 361.72 ? 12  DA  O C5    1 
ATOM 1313  C C6    . DA  C  1 12  ? 108.379 -30.549  81.970  1.00 361.66 ? 12  DA  O C6    1 
ATOM 1314  N N6    . DA  C  1 12  ? 107.783 -29.502  82.544  1.00 364.58 ? 12  DA  O N6    1 
ATOM 1315  N N1    . DA  C  1 12  ? 108.599 -30.518  80.637  1.00 361.60 ? 12  DA  O N1    1 
ATOM 1316  C C2    . DA  C  1 12  ? 109.206 -31.565  80.063  1.00 361.84 ? 12  DA  O C2    1 
ATOM 1317  N N3    . DA  C  1 12  ? 109.647 -32.692  80.619  1.00 363.20 ? 12  DA  O N3    1 
ATOM 1318  C C4    . DA  C  1 12  ? 109.423 -32.686  81.944  1.00 364.70 ? 12  DA  O C4    1 
ATOM 1319  P P     . DA  C  1 13  ? 113.722 -37.722  82.433  1.00 407.98 ? 13  DA  O P     1 
ATOM 1320  O OP1   . DA  C  1 13  ? 113.756 -39.208  82.345  1.00 412.90 ? 13  DA  O OP1   1 
ATOM 1321  O OP2   . DA  C  1 13  ? 114.157 -37.037  83.682  1.00 408.30 ? 13  DA  O OP2   1 
ATOM 1322  O "O5'" . DA  C  1 13  ? 114.608 -37.125  81.251  1.00 405.15 ? 13  DA  O "O5'" 1 
ATOM 1323  C "C5'" . DA  C  1 13  ? 114.042 -36.845  79.955  1.00 402.27 ? 13  DA  O "C5'" 1 
ATOM 1324  C "C4'" . DA  C  1 13  ? 114.405 -35.449  79.508  1.00 398.30 ? 13  DA  O "C4'" 1 
ATOM 1325  O "O4'" . DA  C  1 13  ? 113.601 -34.462  80.204  1.00 385.27 ? 13  DA  O "O4'" 1 
ATOM 1326  C "C3'" . DA  C  1 13  ? 115.863 -35.039  79.741  1.00 404.53 ? 13  DA  O "C3'" 1 
ATOM 1327  O "O3'" . DA  C  1 13  ? 116.227 -34.257  78.594  1.00 419.99 ? 13  DA  O "O3'" 1 
ATOM 1328  C "C2'" . DA  C  1 13  ? 115.773 -34.146  80.969  1.00 390.44 ? 13  DA  O "C2'" 1 
ATOM 1329  C "C1'" . DA  C  1 13  ? 114.468 -33.438  80.662  1.00 377.83 ? 13  DA  O "C1'" 1 
ATOM 1330  N N9    . DA  C  1 13  ? 113.787 -32.691  81.724  1.00 363.32 ? 13  DA  O N9    1 
ATOM 1331  C C8    . DA  C  1 13  ? 113.687 -32.958  83.067  1.00 358.56 ? 13  DA  O C8    1 
ATOM 1332  N N7    . DA  C  1 13  ? 112.977 -32.076  83.729  1.00 352.21 ? 13  DA  O N7    1 
ATOM 1333  C C5    . DA  C  1 13  ? 112.586 -31.164  82.758  1.00 352.20 ? 13  DA  O C5    1 
ATOM 1334  C C6    . DA  C  1 13  ? 111.802 -29.994  82.813  1.00 350.84 ? 13  DA  O C6    1 
ATOM 1335  N N6    . DA  C  1 13  ? 111.267 -29.513  83.936  1.00 352.00 ? 13  DA  O N6    1 
ATOM 1336  N N1    . DA  C  1 13  ? 111.602 -29.316  81.661  1.00 350.98 ? 13  DA  O N1    1 
ATOM 1337  C C2    . DA  C  1 13  ? 112.135 -29.801  80.533  1.00 353.21 ? 13  DA  O C2    1 
ATOM 1338  N N3    . DA  C  1 13  ? 112.877 -30.893  80.352  1.00 355.95 ? 13  DA  O N3    1 
ATOM 1339  C C4    . DA  C  1 13  ? 113.070 -31.536  81.517  1.00 356.10 ? 13  DA  O C4    1 
ATOM 1340  P P     . DA  C  1 14  ? 117.685 -34.370  77.927  1.00 437.99 ? 14  DA  O P     1 
ATOM 1341  O OP1   . DA  C  1 14  ? 117.641 -35.465  76.920  1.00 445.09 ? 14  DA  O OP1   1 
ATOM 1342  O OP2   . DA  C  1 14  ? 118.681 -34.432  79.027  1.00 442.05 ? 14  DA  O OP2   1 
ATOM 1343  O "O5'" . DA  C  1 14  ? 117.864 -32.951  77.211  1.00 439.06 ? 14  DA  O "O5'" 1 
ATOM 1344  C "C5'" . DA  C  1 14  ? 116.891 -32.431  76.267  1.00 441.61 ? 14  DA  O "C5'" 1 
ATOM 1345  C "C4'" . DA  C  1 14  ? 116.766 -30.923  76.354  1.00 438.52 ? 14  DA  O "C4'" 1 
ATOM 1346  O "O4'" . DA  C  1 14  ? 116.119 -30.512  77.587  1.00 430.90 ? 14  DA  O "O4'" 1 
ATOM 1347  C "C3'" . DA  C  1 14  ? 118.071 -30.130  76.312  1.00 440.73 ? 14  DA  O "C3'" 1 
ATOM 1348  O "O3'" . DA  C  1 14  ? 117.749 -28.841  75.777  1.00 442.16 ? 14  DA  O "O3'" 1 
ATOM 1349  C "C2'" . DA  C  1 14  ? 118.374 -29.924  77.783  1.00 432.49 ? 14  DA  O "C2'" 1 
ATOM 1350  C "C1'" . DA  C  1 14  ? 116.973 -29.598  78.272  1.00 423.07 ? 14  DA  O "C1'" 1 
ATOM 1351  N N9    . DA  C  1 14  ? 116.695 -29.702  79.708  1.00 411.66 ? 14  DA  O N9    1 
ATOM 1352  C C8    . DA  C  1 14  ? 117.132 -30.639  80.614  1.00 410.08 ? 14  DA  O C8    1 
ATOM 1353  N N7    . DA  C  1 14  ? 116.657 -30.465  81.824  1.00 403.40 ? 14  DA  O N7    1 
ATOM 1354  C C5    . DA  C  1 14  ? 115.852 -29.340  81.708  1.00 399.22 ? 14  DA  O C5    1 
ATOM 1355  C C6    . DA  C  1 14  ? 115.066 -28.639  82.638  1.00 394.61 ? 14  DA  O C6    1 
ATOM 1356  N N6    . DA  C  1 14  ? 114.962 -28.980  83.923  1.00 393.61 ? 14  DA  O N6    1 
ATOM 1357  N N1    . DA  C  1 14  ? 114.381 -27.560  82.197  1.00 392.43 ? 14  DA  O N1    1 
ATOM 1358  C C2    . DA  C  1 14  ? 114.484 -27.220  80.905  1.00 394.16 ? 14  DA  O C2    1 
ATOM 1359  N N3    . DA  C  1 14  ? 115.186 -27.801  79.935  1.00 398.61 ? 14  DA  O N3    1 
ATOM 1360  C C4    . DA  C  1 14  ? 115.857 -28.866  80.408  1.00 402.41 ? 14  DA  O C4    1 
ATOM 1361  P P     . DA  C  1 15  ? 118.817 -28.056  74.897  1.00 449.09 ? 15  DA  O P     1 
ATOM 1362  O OP1   . DA  C  1 15  ? 118.471 -28.269  73.469  1.00 457.77 ? 15  DA  O OP1   1 
ATOM 1363  O OP2   . DA  C  1 15  ? 120.159 -28.454  75.380  1.00 453.98 ? 15  DA  O OP2   1 
ATOM 1364  O "O5'" . DA  C  1 15  ? 118.642 -26.529  75.336  1.00 439.04 ? 15  DA  O "O5'" 1 
ATOM 1365  C "C5'" . DA  C  1 15  ? 117.433 -25.773  75.107  1.00 429.04 ? 15  DA  O "C5'" 1 
ATOM 1366  C "C4'" . DA  C  1 15  ? 117.320 -24.620  76.081  1.00 416.65 ? 15  DA  O "C4'" 1 
ATOM 1367  O "O4'" . DA  C  1 15  ? 117.137 -25.107  77.433  1.00 405.65 ? 15  DA  O "O4'" 1 
ATOM 1368  C "C3'" . DA  C  1 15  ? 118.512 -23.665  76.153  1.00 415.26 ? 15  DA  O "C3'" 1 
ATOM 1369  O "O3'" . DA  C  1 15  ? 117.957 -22.396  76.532  1.00 411.85 ? 15  DA  O "O3'" 1 
ATOM 1370  C "C2'" . DA  C  1 15  ? 119.298 -24.216  77.331  1.00 408.14 ? 15  DA  O "C2'" 1 
ATOM 1371  C "C1'" . DA  C  1 15  ? 118.151 -24.558  78.265  1.00 401.91 ? 15  DA  O "C1'" 1 
ATOM 1372  N N9    . DA  C  1 15  ? 118.423 -25.518  79.332  1.00 399.07 ? 15  DA  O N9    1 
ATOM 1373  C C8    . DA  C  1 15  ? 119.201 -26.650  79.302  1.00 401.06 ? 15  DA  O C8    1 
ATOM 1374  N N7    . DA  C  1 15  ? 119.212 -27.312  80.433  1.00 402.03 ? 15  DA  O N7    1 
ATOM 1375  C C5    . DA  C  1 15  ? 118.378 -26.573  81.260  1.00 400.83 ? 15  DA  O C5    1 
ATOM 1376  C C6    . DA  C  1 15  ? 117.977 -26.745  82.597  1.00 401.93 ? 15  DA  O C6    1 
ATOM 1377  N N6    . DA  C  1 15  ? 118.380 -27.758  83.366  1.00 406.14 ? 15  DA  O N6    1 
ATOM 1378  N N1    . DA  C  1 15  ? 117.138 -25.825  83.123  1.00 400.10 ? 15  DA  O N1    1 
ATOM 1379  C C2    . DA  C  1 15  ? 116.742 -24.802  82.354  1.00 398.36 ? 15  DA  O C2    1 
ATOM 1380  N N3    . DA  C  1 15  ? 117.042 -24.538  81.084  1.00 397.36 ? 15  DA  O N3    1 
ATOM 1381  C C4    . DA  C  1 15  ? 117.877 -25.471  80.592  1.00 398.17 ? 15  DA  O C4    1 
ATOM 1382  P P     . DA  C  1 16  ? 118.698 -21.021  76.169  1.00 413.27 ? 16  DA  O P     1 
ATOM 1383  O OP1   . DA  C  1 16  ? 117.868 -20.297  75.168  1.00 419.88 ? 16  DA  O OP1   1 
ATOM 1384  O OP2   . DA  C  1 16  ? 120.113 -21.328  75.861  1.00 417.09 ? 16  DA  O OP2   1 
ATOM 1385  O "O5'" . DA  C  1 16  ? 118.683 -20.220  77.550  1.00 400.92 ? 16  DA  O "O5'" 1 
ATOM 1386  C "C5'" . DA  C  1 16  ? 117.546 -20.263  78.440  1.00 385.10 ? 16  DA  O "C5'" 1 
ATOM 1387  C "C4'" . DA  C  1 16  ? 117.906 -19.758  79.821  1.00 373.52 ? 16  DA  O "C4'" 1 
ATOM 1388  O "O4'" . DA  C  1 16  ? 118.217 -20.871  80.692  1.00 363.38 ? 16  DA  O "O4'" 1 
ATOM 1389  C "C3'" . DA  C  1 16  ? 119.116 -18.828  79.912  1.00 375.37 ? 16  DA  O "C3'" 1 
ATOM 1390  O "O3'" . DA  C  1 16  ? 118.915 -17.970  81.044  1.00 377.57 ? 16  DA  O "O3'" 1 
ATOM 1391  C "C2'" . DA  C  1 16  ? 120.241 -19.785  80.245  1.00 369.22 ? 16  DA  O "C2'" 1 
ATOM 1392  C "C1'" . DA  C  1 16  ? 119.523 -20.694  81.218  1.00 361.62 ? 16  DA  O "C1'" 1 
ATOM 1393  N N9    . DA  C  1 16  ? 120.115 -22.013  81.392  1.00 357.88 ? 16  DA  O N9    1 
ATOM 1394  C C8    . DA  C  1 16  ? 120.875 -22.750  80.517  1.00 359.64 ? 16  DA  O C8    1 
ATOM 1395  N N7    . DA  C  1 16  ? 121.245 -23.915  80.991  1.00 359.97 ? 16  DA  O N7    1 
ATOM 1396  C C5    . DA  C  1 16  ? 120.683 -23.952  82.261  1.00 358.28 ? 16  DA  O C5    1 
ATOM 1397  C C6    . DA  C  1 16  ? 120.706 -24.923  83.283  1.00 359.96 ? 16  DA  O C6    1 
ATOM 1398  N N6    . DA  C  1 16  ? 121.344 -26.093  83.181  1.00 365.67 ? 16  DA  O N6    1 
ATOM 1399  N N1    . DA  C  1 16  ? 120.048 -24.643  84.430  1.00 357.98 ? 16  DA  O N1    1 
ATOM 1400  C C2    . DA  C  1 16  ? 119.412 -23.466  84.534  1.00 354.38 ? 16  DA  O C2    1 
ATOM 1401  N N3    . DA  C  1 16  ? 119.314 -22.479  83.645  1.00 353.11 ? 16  DA  O N3    1 
ATOM 1402  C C4    . DA  C  1 16  ? 119.981 -22.787  82.518  1.00 355.48 ? 16  DA  O C4    1 
ATOM 1403  P P     . DA  C  1 17  ? 119.643 -16.537  81.113  1.00 384.01 ? 17  DA  O P     1 
ATOM 1404  O OP1   . DA  C  1 17  ? 118.746 -15.527  80.499  1.00 390.12 ? 17  DA  O OP1   1 
ATOM 1405  O OP2   . DA  C  1 17  ? 121.027 -16.703  80.602  1.00 387.58 ? 17  DA  O OP2   1 
ATOM 1406  O "O5'" . DA  C  1 17  ? 119.689 -16.192  82.669  1.00 377.33 ? 17  DA  O "O5'" 1 
ATOM 1407  C "C5'" . DA  C  1 17  ? 119.052 -17.026  83.652  1.00 366.88 ? 17  DA  O "C5'" 1 
ATOM 1408  C "C4'" . DA  C  1 17  ? 120.039 -17.364  84.745  1.00 359.36 ? 17  DA  O "C4'" 1 
ATOM 1409  O "O4'" . DA  C  1 17  ? 120.484 -18.738  84.620  1.00 352.20 ? 17  DA  O "O4'" 1 
ATOM 1410  C "C3'" . DA  C  1 17  ? 121.310 -16.510  84.752  1.00 359.47 ? 17  DA  O "C3'" 1 
ATOM 1411  O "O3'" . DA  C  1 17  ? 121.595 -16.209  86.113  1.00 361.17 ? 17  DA  O "O3'" 1 
ATOM 1412  C "C2'" . DA  C  1 17  ? 122.382 -17.471  84.277  1.00 354.07 ? 17  DA  O "C2'" 1 
ATOM 1413  C "C1'" . DA  C  1 17  ? 121.869 -18.749  84.891  1.00 346.85 ? 17  DA  O "C1'" 1 
ATOM 1414  N N9    . DA  C  1 17  ? 122.442 -19.968  84.334  1.00 338.27 ? 17  DA  O N9    1 
ATOM 1415  C C8    . DA  C  1 17  ? 123.085 -20.123  83.132  1.00 337.17 ? 17  DA  O C8    1 
ATOM 1416  N N7    . DA  C  1 17  ? 123.540 -21.335  82.928  1.00 335.61 ? 17  DA  O N7    1 
ATOM 1417  C C5    . DA  C  1 17  ? 123.190 -22.021  84.084  1.00 333.09 ? 17  DA  O C5    1 
ATOM 1418  C C6    . DA  C  1 17  ? 123.389 -23.354  84.493  1.00 333.13 ? 17  DA  O C6    1 
ATOM 1419  N N6    . DA  C  1 17  ? 124.013 -24.274  83.751  1.00 335.61 ? 17  DA  O N6    1 
ATOM 1420  N N1    . DA  C  1 17  ? 122.919 -23.714  85.708  1.00 331.99 ? 17  DA  O N1    1 
ATOM 1421  C C2    . DA  C  1 17  ? 122.295 -22.791  86.454  1.00 331.58 ? 17  DA  O C2    1 
ATOM 1422  N N3    . DA  C  1 17  ? 122.048 -21.511  86.179  1.00 330.79 ? 17  DA  O N3    1 
ATOM 1423  C C4    . DA  C  1 17  ? 122.524 -21.187  84.964  1.00 333.18 ? 17  DA  O C4    1 
ATOM 1424  P P     . DA  C  1 18  ? 122.636 -15.067  86.498  1.00 364.58 ? 18  DA  O P     1 
ATOM 1425  O OP1   . DA  C  1 18  ? 121.945 -13.764  86.339  1.00 366.50 ? 18  DA  O OP1   1 
ATOM 1426  O OP2   . DA  C  1 18  ? 123.910 -15.315  85.766  1.00 363.16 ? 18  DA  O OP2   1 
ATOM 1427  O "O5'" . DA  C  1 18  ? 122.880 -15.360  88.046  1.00 366.51 ? 18  DA  O "O5'" 1 
ATOM 1428  C "C5'" . DA  C  1 18  ? 121.931 -16.174  88.775  1.00 362.25 ? 18  DA  O "C5'" 1 
ATOM 1429  C "C4'" . DA  C  1 18  ? 122.627 -17.205  89.636  1.00 357.20 ? 18  DA  O "C4'" 1 
ATOM 1430  O "O4'" . DA  C  1 18  ? 123.017 -18.364  88.856  1.00 352.89 ? 18  DA  O "O4'" 1 
ATOM 1431  C "C3'" . DA  C  1 18  ? 123.898 -16.724  90.337  1.00 356.98 ? 18  DA  O "C3'" 1 
ATOM 1432  O "O3'" . DA  C  1 18  ? 123.948 -17.303  91.648  1.00 353.38 ? 18  DA  O "O3'" 1 
ATOM 1433  C "C2'" . DA  C  1 18  ? 125.003 -17.322  89.487  1.00 355.72 ? 18  DA  O "C2'" 1 
ATOM 1434  C "C1'" . DA  C  1 18  ? 124.381 -18.655  89.123  1.00 351.50 ? 18  DA  O "C1'" 1 
ATOM 1435  N N9    . DA  C  1 18  ? 124.940 -19.327  87.951  1.00 346.06 ? 18  DA  O N9    1 
ATOM 1436  C C8    . DA  C  1 18  ? 125.365 -18.793  86.759  1.00 343.55 ? 18  DA  O C8    1 
ATOM 1437  N N7    . DA  C  1 18  ? 125.817 -19.684  85.911  1.00 341.54 ? 18  DA  O N7    1 
ATOM 1438  C C5    . DA  C  1 18  ? 125.690 -20.887  86.594  1.00 341.57 ? 18  DA  O C5    1 
ATOM 1439  C C6    . DA  C  1 18  ? 125.991 -22.216  86.239  1.00 341.55 ? 18  DA  O C6    1 
ATOM 1440  N N6    . DA  C  1 18  ? 126.507 -22.572  85.060  1.00 341.41 ? 18  DA  O N6    1 
ATOM 1441  N N1    . DA  C  1 18  ? 125.743 -23.180  87.154  1.00 342.83 ? 18  DA  O N1    1 
ATOM 1442  C C2    . DA  C  1 18  ? 125.224 -22.823  88.337  1.00 343.59 ? 18  DA  O C2    1 
ATOM 1443  N N3    . DA  C  1 18  ? 124.889 -21.615  88.781  1.00 343.01 ? 18  DA  O N3    1 
ATOM 1444  C C4    . DA  C  1 18  ? 125.154 -20.680  87.853  1.00 343.32 ? 18  DA  O C4    1 
ATOM 1445  P P     . DA  C  1 19  ? 124.521 -16.465  92.897  1.00 355.03 ? 19  DA  O P     1 
ATOM 1446  O OP1   . DA  C  1 19  ? 123.385 -15.738  93.527  1.00 355.60 ? 19  DA  O OP1   1 
ATOM 1447  O OP2   . DA  C  1 19  ? 125.710 -15.696  92.433  1.00 356.19 ? 19  DA  O OP2   1 
ATOM 1448  O "O5'" . DA  C  1 19  ? 125.008 -17.603  93.906  1.00 359.49 ? 19  DA  O "O5'" 1 
ATOM 1449  C "C5'" . DA  C  1 19  ? 124.545 -18.971  93.804  1.00 359.74 ? 19  DA  O "C5'" 1 
ATOM 1450  C "C4'" . DA  C  1 19  ? 125.711 -19.930  93.894  1.00 366.16 ? 19  DA  O "C4'" 1 
ATOM 1451  O "O4'" . DA  C  1 19  ? 126.103 -20.352  92.568  1.00 361.46 ? 19  DA  O "O4'" 1 
ATOM 1452  C "C3'" . DA  C  1 19  ? 126.983 -19.360  94.527  1.00 375.68 ? 19  DA  O "C3'" 1 
ATOM 1453  O "O3'" . DA  C  1 19  ? 127.685 -20.418  95.182  1.00 388.31 ? 19  DA  O "O3'" 1 
ATOM 1454  C "C2'" . DA  C  1 19  ? 127.836 -19.015  93.323  1.00 371.57 ? 19  DA  O "C2'" 1 
ATOM 1455  C "C1'" . DA  C  1 19  ? 127.513 -20.223  92.487  1.00 369.00 ? 19  DA  O "C1'" 1 
ATOM 1456  N N9    . DA  C  1 19  ? 127.886 -20.155  91.083  1.00 370.13 ? 19  DA  O N9    1 
ATOM 1457  C C8    . DA  C  1 19  ? 128.058 -19.062  90.270  1.00 369.94 ? 19  DA  O C8    1 
ATOM 1458  N N7    . DA  C  1 19  ? 128.410 -19.367  89.045  1.00 371.10 ? 19  DA  O N7    1 
ATOM 1459  C C5    . DA  C  1 19  ? 128.489 -20.753  89.056  1.00 373.13 ? 19  DA  O C5    1 
ATOM 1460  C C6    . DA  C  1 19  ? 128.815 -21.692  88.062  1.00 374.73 ? 19  DA  O C6    1 
ATOM 1461  N N6    . DA  C  1 19  ? 129.132 -21.363  86.808  1.00 373.15 ? 19  DA  O N6    1 
ATOM 1462  N N1    . DA  C  1 19  ? 128.806 -22.998  88.405  1.00 378.81 ? 19  DA  O N1    1 
ATOM 1463  C C2    . DA  C  1 19  ? 128.490 -23.327  89.664  1.00 381.25 ? 19  DA  O C2    1 
ATOM 1464  N N3    . DA  C  1 19  ? 128.151 -22.540  90.680  1.00 378.99 ? 19  DA  O N3    1 
ATOM 1465  C C4    . DA  C  1 19  ? 128.177 -21.249  90.308  1.00 374.04 ? 19  DA  O C4    1 
ATOM 1466  P P     . DA  C  1 20  ? 128.795 -20.075  96.280  1.00 403.69 ? 20  DA  O P     1 
ATOM 1467  O OP1   . DA  C  1 20  ? 128.089 -19.779  97.551  1.00 410.97 ? 20  DA  O OP1   1 
ATOM 1468  O OP2   . DA  C  1 20  ? 129.732 -19.062  95.709  1.00 401.35 ? 20  DA  O OP2   1 
ATOM 1469  O "O5'" . DA  C  1 20  ? 129.576 -21.450  96.485  1.00 415.94 ? 20  DA  O "O5'" 1 
ATOM 1470  C "C5'" . DA  C  1 20  ? 128.954 -22.749  96.334  1.00 424.23 ? 20  DA  O "C5'" 1 
ATOM 1471  C "C4'" . DA  C  1 20  ? 129.982 -23.752  95.862  1.00 435.47 ? 20  DA  O "C4'" 1 
ATOM 1472  O "O4'" . DA  C  1 20  ? 130.174 -23.603  94.436  1.00 426.08 ? 20  DA  O "O4'" 1 
ATOM 1473  C "C3'" . DA  C  1 20  ? 131.374 -23.585  96.464  1.00 452.70 ? 20  DA  O "C3'" 1 
ATOM 1474  O "O3'" . DA  C  1 20  ? 132.055 -24.835  96.387  1.00 474.50 ? 20  DA  O "O3'" 1 
ATOM 1475  C "C2'" . DA  C  1 20  ? 132.056 -22.661  95.474  1.00 442.83 ? 20  DA  O "C2'" 1 
ATOM 1476  C "C1'" . DA  C  1 20  ? 131.522 -23.224  94.171  1.00 430.38 ? 20  DA  O "C1'" 1 
ATOM 1477  N N9    . DA  C  1 20  ? 131.517 -22.296  93.037  1.00 420.10 ? 20  DA  O N9    1 
ATOM 1478  C C8    . DA  C  1 20  ? 131.223 -20.952  93.026  1.00 414.45 ? 20  DA  O C8    1 
ATOM 1479  N N7    . DA  C  1 20  ? 131.294 -20.405  91.837  1.00 409.79 ? 20  DA  O N7    1 
ATOM 1480  C C5    . DA  C  1 20  ? 131.655 -21.458  91.007  1.00 412.10 ? 20  DA  O C5    1 
ATOM 1481  C C6    . DA  C  1 20  ? 131.891 -21.534  89.624  1.00 410.85 ? 20  DA  O C6    1 
ATOM 1482  N N6    . DA  C  1 20  ? 131.806 -20.486  88.800  1.00 408.46 ? 20  DA  O N6    1 
ATOM 1483  N N1    . DA  C  1 20  ? 132.229 -22.738  89.109  1.00 413.65 ? 20  DA  O N1    1 
ATOM 1484  C C2    . DA  C  1 20  ? 132.326 -23.787  89.939  1.00 417.78 ? 20  DA  O C2    1 
ATOM 1485  N N3    . DA  C  1 20  ? 132.125 -23.842  91.254  1.00 420.30 ? 20  DA  O N3    1 
ATOM 1486  C C4    . DA  C  1 20  ? 131.791 -22.630  91.733  1.00 417.23 ? 20  DA  O C4    1 
ATOM 1487  P P     . DA  C  1 21  ? 133.253 -25.140  97.395  1.00 501.27 ? 21  DA  O P     1 
ATOM 1488  O OP1   . DA  C  1 21  ? 132.812 -26.215  98.315  1.00 508.16 ? 21  DA  O OP1   1 
ATOM 1489  O OP2   . DA  C  1 21  ? 133.711 -23.844  97.964  1.00 506.36 ? 21  DA  O OP2   1 
ATOM 1490  O "O5'" . DA  C  1 21  ? 134.426 -25.668  96.447  1.00 510.21 ? 21  DA  O "O5'" 1 
ATOM 1491  C "C5'" . DA  C  1 21  ? 134.266 -26.782  95.531  1.00 513.08 ? 21  DA  O "C5'" 1 
ATOM 1492  C "C4'" . DA  C  1 21  ? 135.326 -26.765  94.448  1.00 513.88 ? 21  DA  O "C4'" 1 
ATOM 1493  O "O4'" . DA  C  1 21  ? 135.069 -25.682  93.519  1.00 497.34 ? 21  DA  O "O4'" 1 
ATOM 1494  C "C3'" . DA  C  1 21  ? 136.771 -26.561  94.916  1.00 526.35 ? 21  DA  O "C3'" 1 
ATOM 1495  O "O3'" . DA  C  1 21  ? 137.698 -27.169  93.998  1.00 533.48 ? 21  DA  O "O3'" 1 
ATOM 1496  C "C2'" . DA  C  1 21  ? 136.937 -25.061  94.789  1.00 514.45 ? 21  DA  O "C2'" 1 
ATOM 1497  C "C1'" . DA  C  1 21  ? 136.208 -24.838  93.478  1.00 495.35 ? 21  DA  O "C1'" 1 
ATOM 1498  N N9    . DA  C  1 21  ? 135.749 -23.477  93.221  1.00 477.07 ? 21  DA  O N9    1 
ATOM 1499  C C8    . DA  C  1 21  ? 135.276 -22.523  94.089  1.00 471.31 ? 21  DA  O C8    1 
ATOM 1500  N N7    . DA  C  1 21  ? 134.938 -21.399  93.505  1.00 460.15 ? 21  DA  O N7    1 
ATOM 1501  C C5    . DA  C  1 21  ? 135.207 -21.628  92.163  1.00 458.74 ? 21  DA  O C5    1 
ATOM 1502  C C6    . DA  C  1 21  ? 135.066 -20.824  91.018  1.00 453.39 ? 21  DA  O C6    1 
ATOM 1503  N N6    . DA  C  1 21  ? 134.603 -19.571  91.044  1.00 449.36 ? 21  DA  O N6    1 
ATOM 1504  N N1    . DA  C  1 21  ? 135.425 -21.357  89.829  1.00 454.72 ? 21  DA  O N1    1 
ATOM 1505  C C2    . DA  C  1 21  ? 135.889 -22.615  89.803  1.00 459.51 ? 21  DA  O C2    1 
ATOM 1506  N N3    . DA  C  1 21  ? 136.060 -23.471  90.808  1.00 465.04 ? 21  DA  O N3    1 
ATOM 1507  C C4    . DA  C  1 21  ? 135.700 -22.907  91.974  1.00 466.03 ? 21  DA  O C4    1 
ATOM 1508  P P     . DA  C  1 22  ? 139.209 -27.551  94.464  1.00 549.82 ? 22  DA  O P     1 
ATOM 1509  O OP1   . DA  C  1 22  ? 139.296 -29.025  94.637  1.00 564.31 ? 22  DA  O OP1   1 
ATOM 1510  O OP2   . DA  C  1 22  ? 139.606 -26.643  95.577  1.00 555.79 ? 22  DA  O OP2   1 
ATOM 1511  O "O5'" . DA  C  1 22  ? 140.116 -27.196  93.200  1.00 538.44 ? 22  DA  O "O5'" 1 
ATOM 1512  C "C5'" . DA  C  1 22  ? 139.778 -27.580  91.851  1.00 519.04 ? 22  DA  O "C5'" 1 
ATOM 1513  C "C4'" . DA  C  1 22  ? 140.365 -26.570  90.892  1.00 505.32 ? 22  DA  O "C4'" 1 
ATOM 1514  O "O4'" . DA  C  1 22  ? 139.640 -25.315  91.012  1.00 489.18 ? 22  DA  O "O4'" 1 
ATOM 1515  C "C3'" . DA  C  1 22  ? 141.838 -26.231  91.156  1.00 513.26 ? 22  DA  O "C3'" 1 
ATOM 1516  O "O3'" . DA  C  1 22  ? 142.562 -26.090  89.917  1.00 511.77 ? 22  DA  O "O3'" 1 
ATOM 1517  C "C2'" . DA  C  1 22  ? 141.754 -24.926  91.933  1.00 507.11 ? 22  DA  O "C2'" 1 
ATOM 1518  C "C1'" . DA  C  1 22  ? 140.567 -24.264  91.258  1.00 491.50 ? 22  DA  O "C1'" 1 
ATOM 1519  N N9    . DA  C  1 22  ? 139.887 -23.199  92.011  1.00 483.75 ? 22  DA  O N9    1 
ATOM 1520  C C8    . DA  C  1 22  ? 139.627 -23.110  93.358  1.00 486.83 ? 22  DA  O C8    1 
ATOM 1521  N N7    . DA  C  1 22  ? 139.015 -22.004  93.707  1.00 477.72 ? 22  DA  O N7    1 
ATOM 1522  C C5    . DA  C  1 22  ? 138.881 -21.306  92.514  1.00 468.84 ? 22  DA  O C5    1 
ATOM 1523  C C6    . DA  C  1 22  ? 138.315 -20.053  92.206  1.00 458.73 ? 22  DA  O C6    1 
ATOM 1524  N N6    . DA  C  1 22  ? 137.761 -19.245  93.113  1.00 452.48 ? 22  DA  O N6    1 
ATOM 1525  N N1    . DA  C  1 22  ? 138.342 -19.652  90.915  1.00 455.64 ? 22  DA  O N1    1 
ATOM 1526  C C2    . DA  C  1 22  ? 138.908 -20.458  90.006  1.00 460.70 ? 22  DA  O C2    1 
ATOM 1527  N N3    . DA  C  1 22  ? 139.464 -21.658  90.170  1.00 468.78 ? 22  DA  O N3    1 
ATOM 1528  C C4    . DA  C  1 22  ? 139.421 -22.028  91.463  1.00 473.07 ? 22  DA  O C4    1 
ATOM 1529  P P     . DA  C  1 23  ? 144.194 -26.077  89.866  1.00 524.62 ? 23  DA  O P     1 
ATOM 1530  O OP1   . DA  C  1 23  ? 144.635 -27.219  89.016  1.00 533.08 ? 23  DA  O OP1   1 
ATOM 1531  O OP2   . DA  C  1 23  ? 144.715 -25.983  91.261  1.00 531.54 ? 23  DA  O OP2   1 
ATOM 1532  O "O5'" . DA  C  1 23  ? 144.530 -24.694  89.131  1.00 520.92 ? 23  DA  O "O5'" 1 
ATOM 1533  C "C5'" . DA  C  1 23  ? 143.956 -24.324  87.840  1.00 518.86 ? 23  DA  O "C5'" 1 
ATOM 1534  C "C4'" . DA  C  1 23  ? 144.151 -22.858  87.495  1.00 517.60 ? 23  DA  O "C4'" 1 
ATOM 1535  O "O4'" . DA  C  1 23  ? 143.270 -22.011  88.278  1.00 508.24 ? 23  DA  O "O4'" 1 
ATOM 1536  C "C3'" . DA  C  1 23  ? 145.554 -22.271  87.672  1.00 531.75 ? 23  DA  O "C3'" 1 
ATOM 1537  O "O3'" . DA  C  1 23  ? 145.787 -21.293  86.648  1.00 536.35 ? 23  DA  O "O3'" 1 
ATOM 1538  C "C2'" . DA  C  1 23  ? 145.441 -21.529  88.989  1.00 528.37 ? 23  DA  O "C2'" 1 
ATOM 1539  C "C1'" . DA  C  1 23  ? 144.034 -20.974  88.882  1.00 514.41 ? 23  DA  O "C1'" 1 
ATOM 1540  N N9    . DA  C  1 23  ? 143.404 -20.629  90.158  1.00 516.20 ? 23  DA  O N9    1 
ATOM 1541  C C8    . DA  C  1 23  ? 143.454 -21.324  91.341  1.00 526.34 ? 23  DA  O C8    1 
ATOM 1542  N N7    . DA  C  1 23  ? 142.781 -20.760  92.315  1.00 524.32 ? 23  DA  O N7    1 
ATOM 1543  C C5    . DA  C  1 23  ? 142.256 -19.612  91.738  1.00 512.32 ? 23  DA  O C5    1 
ATOM 1544  C C6    . DA  C  1 23  ? 141.443 -18.580  92.247  1.00 504.42 ? 23  DA  O C6    1 
ATOM 1545  N N6    . DA  C  1 23  ? 141.010 -18.530  93.510  1.00 505.80 ? 23  DA  O N6    1 
ATOM 1546  N N1    . DA  C  1 23  ? 141.093 -17.584  91.404  1.00 496.01 ? 23  DA  O N1    1 
ATOM 1547  C C2    . DA  C  1 23  ? 141.553 -17.618  90.145  1.00 495.48 ? 23  DA  O C2    1 
ATOM 1548  N N3    . DA  C  1 23  ? 142.310 -18.537  89.547  1.00 500.61 ? 23  DA  O N3    1 
ATOM 1549  C C4    . DA  C  1 23  ? 142.634 -19.518  90.409  1.00 508.92 ? 23  DA  O C4    1 
ATOM 1550  P P     . DA  C  1 24  ? 147.272 -21.033  86.077  1.00 556.41 ? 24  DA  O P     1 
ATOM 1551  O OP1   . DA  C  1 24  ? 147.246 -21.283  84.612  1.00 558.49 ? 24  DA  O OP1   1 
ATOM 1552  O OP2   . DA  C  1 24  ? 148.224 -21.813  86.908  1.00 570.21 ? 24  DA  O OP2   1 
ATOM 1553  O "O5'" . DA  C  1 24  ? 147.533 -19.489  86.413  1.00 557.91 ? 24  DA  O "O5'" 1 
ATOM 1554  C "C5'" . DA  C  1 24  ? 146.787 -18.395  85.787  1.00 555.12 ? 24  DA  O "C5'" 1 
ATOM 1555  C "C4'" . DA  C  1 24  ? 146.912 -17.050  86.487  1.00 556.73 ? 24  DA  O "C4'" 1 
ATOM 1556  O "O4'" . DA  C  1 24  ? 146.007 -16.965  87.623  1.00 547.39 ? 24  DA  O "O4'" 1 
ATOM 1557  C "C3'" . DA  C  1 24  ? 148.291 -16.598  87.008  1.00 571.40 ? 24  DA  O "C3'" 1 
ATOM 1558  O "O3'" . DA  C  1 24  ? 148.558 -15.177  86.825  1.00 575.30 ? 24  DA  O "O3'" 1 
ATOM 1559  C "C2'" . DA  C  1 24  ? 148.156 -16.807  88.503  1.00 569.24 ? 24  DA  O "C2'" 1 
ATOM 1560  C "C1'" . DA  C  1 24  ? 146.714 -16.387  88.707  1.00 547.48 ? 24  DA  O "C1'" 1 
ATOM 1561  N N9    . DA  C  1 24  ? 146.136 -16.879  89.955  1.00 534.27 ? 24  DA  O N9    1 
ATOM 1562  C C8    . DA  C  1 24  ? 146.472 -18.025  90.634  1.00 539.21 ? 24  DA  O C8    1 
ATOM 1563  N N7    . DA  C  1 24  ? 145.823 -18.181  91.760  1.00 533.07 ? 24  DA  O N7    1 
ATOM 1564  C C5    . DA  C  1 24  ? 145.024 -17.049  91.845  1.00 520.49 ? 24  DA  O C5    1 
ATOM 1565  C C6    . DA  C  1 24  ? 144.096 -16.615  92.808  1.00 513.26 ? 24  DA  O C6    1 
ATOM 1566  N N6    . DA  C  1 24  ? 143.809 -17.295  93.922  1.00 517.82 ? 24  DA  O N6    1 
ATOM 1567  N N1    . DA  C  1 24  ? 143.464 -15.442  92.586  1.00 502.97 ? 24  DA  O N1    1 
ATOM 1568  C C2    . DA  C  1 24  ? 143.763 -14.753  91.475  1.00 498.87 ? 24  DA  O C2    1 
ATOM 1569  N N3    . DA  C  1 24  ? 144.602 -15.063  90.490  1.00 503.66 ? 24  DA  O N3    1 
ATOM 1570  C C4    . DA  C  1 24  ? 145.215 -16.233  90.743  1.00 518.07 ? 24  DA  O C4    1 
ATOM 1571  P P     . DA  C  1 25  ? 149.992 -14.458  87.282  1.00 584.20 ? 25  DA  O P     1 
ATOM 1572  O OP1   . DA  C  1 25  ? 150.719 -14.056  86.049  1.00 586.82 ? 25  DA  O OP1   1 
ATOM 1573  O OP2   . DA  C  1 25  ? 150.662 -15.308  88.297  1.00 593.72 ? 25  DA  O OP2   1 
ATOM 1574  O "O5'" . DA  C  1 25  ? 149.560 -13.137  88.078  1.00 572.53 ? 25  DA  O "O5'" 1 
ATOM 1575  C "C5'" . DA  C  1 25  ? 148.275 -12.531  87.841  1.00 552.60 ? 25  DA  O "C5'" 1 
ATOM 1576  C "C4'" . DA  C  1 25  ? 147.913 -11.374  88.757  1.00 538.86 ? 25  DA  O "C4'" 1 
ATOM 1577  O "O4'" . DA  C  1 25  ? 147.208 -11.870  89.904  1.00 534.50 ? 25  DA  O "O4'" 1 
ATOM 1578  C "C3'" . DA  C  1 25  ? 149.000 -10.466  89.331  1.00 538.86 ? 25  DA  O "C3'" 1 
ATOM 1579  O "O3'" . DA  C  1 25  ? 148.435 -9.192   89.716  1.00 523.75 ? 25  DA  O "O3'" 1 
ATOM 1580  C "C2'" . DA  C  1 25  ? 149.379 -11.200  90.593  1.00 545.92 ? 25  DA  O "C2'" 1 
ATOM 1581  C "C1'" . DA  C  1 25  ? 148.008 -11.667  91.056  1.00 540.34 ? 25  DA  O "C1'" 1 
ATOM 1582  N N9    . DA  C  1 25  ? 148.002 -12.908  91.800  1.00 545.74 ? 25  DA  O N9    1 
ATOM 1583  C C8    . DA  C  1 25  ? 148.724 -14.068  91.659  1.00 554.75 ? 25  DA  O C8    1 
ATOM 1584  N N7    . DA  C  1 25  ? 148.392 -15.003  92.516  1.00 559.19 ? 25  DA  O N7    1 
ATOM 1585  C C5    . DA  C  1 25  ? 147.377 -14.421  93.263  1.00 552.70 ? 25  DA  O C5    1 
ATOM 1586  C C6    . DA  C  1 25  ? 146.605 -14.888  94.340  1.00 554.72 ? 25  DA  O C6    1 
ATOM 1587  N N6    . DA  C  1 25  ? 146.731 -16.106  94.871  1.00 564.14 ? 25  DA  O N6    1 
ATOM 1588  N N1    . DA  C  1 25  ? 145.674 -14.052  94.853  1.00 548.91 ? 25  DA  O N1    1 
ATOM 1589  C C2    . DA  C  1 25  ? 145.532 -12.836  94.308  1.00 541.76 ? 25  DA  O C2    1 
ATOM 1590  N N3    . DA  C  1 25  ? 146.189 -12.288  93.292  1.00 537.86 ? 25  DA  O N3    1 
ATOM 1591  C C4    . DA  C  1 25  ? 147.109 -13.142  92.811  1.00 544.17 ? 25  DA  O C4    1 
ATOM 1592  P P     . DA  C  1 26  ? 149.243 -7.831   89.425  1.00 519.41 ? 26  DA  O P     1 
ATOM 1593  O OP1   . DA  C  1 26  ? 148.897 -7.349   88.063  1.00 516.59 ? 26  DA  O OP1   1 
ATOM 1594  O OP2   . DA  C  1 26  ? 150.652 -8.061   89.799  1.00 530.39 ? 26  DA  O OP2   1 
ATOM 1595  O "O5'" . DA  C  1 26  ? 148.648 -6.739   90.424  1.00 508.08 ? 26  DA  O "O5'" 1 
ATOM 1596  C "C5'" . DA  C  1 26  ? 147.562 -6.975   91.326  1.00 490.78 ? 26  DA  O "C5'" 1 
ATOM 1597  C "C4'" . DA  C  1 26  ? 148.002 -6.694   92.745  1.00 489.39 ? 26  DA  O "C4'" 1 
ATOM 1598  O "O4'" . DA  C  1 26  ? 148.106 -7.960   93.422  1.00 488.45 ? 26  DA  O "O4'" 1 
ATOM 1599  C "C3'" . DA  C  1 26  ? 149.360 -5.999   92.930  1.00 495.27 ? 26  DA  O "C3'" 1 
ATOM 1600  O "O3'" . DA  C  1 26  ? 149.248 -4.925   93.873  1.00 497.11 ? 26  DA  O "O3'" 1 
ATOM 1601  C "C2'" . DA  C  1 26  ? 150.269 -7.090   93.480  1.00 500.53 ? 26  DA  O "C2'" 1 
ATOM 1602  C "C1'" . DA  C  1 26  ? 149.283 -7.980   94.207  1.00 496.42 ? 26  DA  O "C1'" 1 
ATOM 1603  N N9    . DA  C  1 26  ? 149.658 -9.380   94.376  1.00 499.13 ? 26  DA  O N9    1 
ATOM 1604  C C8    . DA  C  1 26  ? 150.599 -10.134  93.718  1.00 503.34 ? 26  DA  O C8    1 
ATOM 1605  N N7    . DA  C  1 26  ? 150.622 -11.392  94.090  1.00 508.48 ? 26  DA  O N7    1 
ATOM 1606  C C5    . DA  C  1 26  ? 149.612 -11.476  95.040  1.00 507.54 ? 26  DA  O C5    1 
ATOM 1607  C C6    . DA  C  1 26  ? 149.125 -12.546  95.818  1.00 513.44 ? 26  DA  O C6    1 
ATOM 1608  N N6    . DA  C  1 26  ? 149.603 -13.791  95.754  1.00 523.61 ? 26  DA  O N6    1 
ATOM 1609  N N1    . DA  C  1 26  ? 148.115 -12.286  96.678  1.00 512.23 ? 26  DA  O N1    1 
ATOM 1610  C C2    . DA  C  1 26  ? 147.630 -11.039  96.740  1.00 505.80 ? 26  DA  O C2    1 
ATOM 1611  N N3    . DA  C  1 26  ? 147.995 -9.957   96.057  1.00 499.41 ? 26  DA  O N3    1 
ATOM 1612  C C4    . DA  C  1 26  ? 149.006 -10.246  95.218  1.00 500.77 ? 26  DA  O C4    1 
ATOM 1613  P P     . DT  D  2 1   ? 145.764 -14.140  106.121 1.00 547.01 ? 1   DT  P P     1 
ATOM 1614  O OP1   . DT  D  2 1   ? 146.081 -13.995  107.572 1.00 553.37 ? 1   DT  P OP1   1 
ATOM 1615  O OP2   . DT  D  2 1   ? 144.720 -15.122  105.715 1.00 539.71 ? 1   DT  P OP2   1 
ATOM 1616  O "O5'" . DT  D  2 1   ? 145.431 -12.732  105.448 1.00 545.72 ? 1   DT  P "O5'" 1 
ATOM 1617  C "C5'" . DT  D  2 1   ? 146.421 -11.662  105.352 1.00 547.82 ? 1   DT  P "C5'" 1 
ATOM 1618  C "C4'" . DT  D  2 1   ? 146.425 -10.961  104.007 1.00 544.23 ? 1   DT  P "C4'" 1 
ATOM 1619  O "O4'" . DT  D  2 1   ? 147.153 -11.733  103.016 1.00 540.64 ? 1   DT  P "O4'" 1 
ATOM 1620  C "C3'" . DT  D  2 1   ? 145.069 -10.631  103.373 1.00 541.45 ? 1   DT  P "C3'" 1 
ATOM 1621  O "O3'" . DT  D  2 1   ? 145.128 -9.360   102.695 1.00 541.88 ? 1   DT  P "O3'" 1 
ATOM 1622  C "C2'" . DT  D  2 1   ? 144.894 -11.750  102.359 1.00 536.14 ? 1   DT  P "C2'" 1 
ATOM 1623  C "C1'" . DT  D  2 1   ? 146.328 -11.948  101.875 1.00 535.95 ? 1   DT  P "C1'" 1 
ATOM 1624  N N1    . DT  D  2 1   ? 146.668 -13.276  101.308 1.00 533.00 ? 1   DT  P N1    1 
ATOM 1625  C C2    . DT  D  2 1   ? 147.400 -13.305  100.140 1.00 530.95 ? 1   DT  P C2    1 
ATOM 1626  O O2    . DT  D  2 1   ? 147.762 -12.297  99.554  1.00 531.36 ? 1   DT  P O2    1 
ATOM 1627  N N3    . DT  D  2 1   ? 147.677 -14.568  99.671  1.00 528.97 ? 1   DT  P N3    1 
ATOM 1628  C C4    . DT  D  2 1   ? 147.318 -15.774  100.248 1.00 528.90 ? 1   DT  P C4    1 
ATOM 1629  O O4    . DT  D  2 1   ? 147.649 -16.832  99.714  1.00 527.62 ? 1   DT  P O4    1 
ATOM 1630  C C5    . DT  D  2 1   ? 146.570 -15.667  101.484 1.00 531.13 ? 1   DT  P C5    1 
ATOM 1631  C C7    . DT  D  2 1   ? 146.136 -16.917  102.183 1.00 531.85 ? 1   DT  P C7    1 
ATOM 1632  C C6    . DT  D  2 1   ? 146.278 -14.440  101.938 1.00 533.02 ? 1   DT  P C6    1 
ATOM 1633  P P     . DT  D  2 2   ? 143.834 -8.396   102.627 1.00 542.92 ? 2   DT  P P     1 
ATOM 1634  O OP1   . DT  D  2 2   ? 144.157 -7.138   103.354 1.00 548.62 ? 2   DT  P OP1   1 
ATOM 1635  O OP2   . DT  D  2 2   ? 142.647 -9.191   103.034 1.00 541.62 ? 2   DT  P OP2   1 
ATOM 1636  O "O5'" . DT  D  2 2   ? 143.678 -8.088   101.068 1.00 539.00 ? 2   DT  P "O5'" 1 
ATOM 1637  C "C5'" . DT  D  2 2   ? 144.799 -7.670   100.252 1.00 538.75 ? 2   DT  P "C5'" 1 
ATOM 1638  C "C4'" . DT  D  2 2   ? 144.646 -8.076   98.798  1.00 534.17 ? 2   DT  P "C4'" 1 
ATOM 1639  O "O4'" . DT  D  2 2   ? 144.956 -9.479   98.615  1.00 530.77 ? 2   DT  P "O4'" 1 
ATOM 1640  C "C3'" . DT  D  2 2   ? 143.281 -7.855   98.128  1.00 532.15 ? 2   DT  P "C3'" 1 
ATOM 1641  O "O3'" . DT  D  2 2   ? 143.475 -7.401   96.769  1.00 530.90 ? 2   DT  P "O3'" 1 
ATOM 1642  C "C2'" . DT  D  2 2   ? 142.680 -9.252   98.103  1.00 528.06 ? 2   DT  P "C2'" 1 
ATOM 1643  C "C1'" . DT  D  2 2   ? 143.925 -10.083  97.849  1.00 526.78 ? 2   DT  P "C1'" 1 
ATOM 1644  N N1    . DT  D  2 2   ? 143.872 -11.508  98.211  1.00 524.65 ? 2   DT  P N1    1 
ATOM 1645  C C2    . DT  D  2 2   ? 144.609 -12.354  97.418  1.00 522.42 ? 2   DT  P C2    1 
ATOM 1646  O O2    . DT  D  2 2   ? 145.254 -11.968  96.458  1.00 522.14 ? 2   DT  P O2    1 
ATOM 1647  N N3    . DT  D  2 2   ? 144.552 -13.678  97.781  1.00 521.14 ? 2   DT  P N3    1 
ATOM 1648  C C4    . DT  D  2 2   ? 143.861 -14.223  98.847  1.00 521.91 ? 2   DT  P C4    1 
ATOM 1649  O O4    . DT  D  2 2   ? 143.902 -15.436  99.046  1.00 521.10 ? 2   DT  P O4    1 
ATOM 1650  C C5    . DT  D  2 2   ? 143.117 -13.272  99.650  1.00 524.31 ? 2   DT  P C5    1 
ATOM 1651  C C7    . DT  D  2 2   ? 142.330 -13.767  100.823 1.00 525.99 ? 2   DT  P C7    1 
ATOM 1652  C C6    . DT  D  2 2   ? 143.158 -11.980  99.294  1.00 525.55 ? 2   DT  P C6    1 
ATOM 1653  P P     . DT  D  2 3   ? 142.473 -6.316   96.070  1.00 532.11 ? 3   DT  P P     1 
ATOM 1654  O OP1   . DT  D  2 3   ? 143.026 -4.945   96.284  1.00 537.27 ? 3   DT  P OP1   1 
ATOM 1655  O OP2   . DT  D  2 3   ? 141.076 -6.625   96.475  1.00 530.97 ? 3   DT  P OP2   1 
ATOM 1656  O "O5'" . DT  D  2 3   ? 142.611 -6.627   94.514  1.00 528.94 ? 3   DT  P "O5'" 1 
ATOM 1657  C "C5'" . DT  D  2 3   ? 143.745 -7.349   94.002  1.00 527.23 ? 3   DT  P "C5'" 1 
ATOM 1658  C "C4'" . DT  D  2 3   ? 143.298 -8.441   93.058  1.00 522.76 ? 3   DT  P "C4'" 1 
ATOM 1659  O "O4'" . DT  D  2 3   ? 143.206 -9.702   93.763  1.00 520.26 ? 3   DT  P "O4'" 1 
ATOM 1660  C "C3'" . DT  D  2 3   ? 141.941 -8.228   92.373  1.00 521.28 ? 3   DT  P "C3'" 1 
ATOM 1661  O "O3'" . DT  D  2 3   ? 142.114 -8.479   90.967  1.00 497.36 ? 3   DT  P "O3'" 1 
ATOM 1662  C "C2'" . DT  D  2 3   ? 141.035 -9.263   93.028  1.00 518.26 ? 3   DT  P "C2'" 1 
ATOM 1663  C "C1'" . DT  D  2 3   ? 142.025 -10.370  93.352  1.00 516.90 ? 3   DT  P "C1'" 1 
ATOM 1664  N N1    . DT  D  2 3   ? 141.656 -11.333  94.415  1.00 515.74 ? 3   DT  P N1    1 
ATOM 1665  C C2    . DT  D  2 3   ? 142.246 -12.577  94.363  1.00 512.69 ? 3   DT  P C2    1 
ATOM 1666  O O2    . DT  D  2 3   ? 143.024 -12.911  93.480  1.00 504.58 ? 3   DT  P O2    1 
ATOM 1667  N N3    . DT  D  2 3   ? 141.879 -13.427  95.380  1.00 509.38 ? 3   DT  P N3    1 
ATOM 1668  C C4    . DT  D  2 3   ? 141.006 -13.159  96.422  1.00 501.61 ? 3   DT  P C4    1 
ATOM 1669  O O4    . DT  D  2 3   ? 140.772 -14.026  97.262  1.00 499.82 ? 3   DT  P O4    1 
ATOM 1670  C C5    . DT  D  2 3   ? 140.430 -11.830  96.416  1.00 499.78 ? 3   DT  P C5    1 
ATOM 1671  C C7    . DT  D  2 3   ? 139.481 -11.444  97.507  1.00 487.52 ? 3   DT  P C7    1 
ATOM 1672  C C6    . DT  D  2 3   ? 140.786 -10.993  95.431  1.00 510.35 ? 3   DT  P C6    1 
ATOM 1673  P P     . DT  D  2 4   ? 141.123 -7.822   89.863  1.00 478.82 ? 4   DT  P P     1 
ATOM 1674  O OP1   . DT  D  2 4   ? 141.820 -6.666   89.232  1.00 474.82 ? 4   DT  P OP1   1 
ATOM 1675  O OP2   . DT  D  2 4   ? 139.795 -7.610   90.507  1.00 481.34 ? 4   DT  P OP2   1 
ATOM 1676  O "O5'" . DT  D  2 4   ? 140.994 -8.976   88.763  1.00 469.92 ? 4   DT  P "O5'" 1 
ATOM 1677  C "C5'" . DT  D  2 4   ? 142.157 -9.672   88.243  1.00 459.97 ? 4   DT  P "C5'" 1 
ATOM 1678  C "C4'" . DT  D  2 4   ? 141.824 -11.107  87.899  1.00 455.05 ? 4   DT  P "C4'" 1 
ATOM 1679  O "O4'" . DT  D  2 4   ? 141.717 -11.900  89.105  1.00 456.44 ? 4   DT  P "O4'" 1 
ATOM 1680  C "C3'" . DT  D  2 4   ? 140.520 -11.314  87.123  1.00 453.28 ? 4   DT  P "C3'" 1 
ATOM 1681  O "O3'" . DT  D  2 4   ? 140.758 -12.129  85.977  1.00 442.60 ? 4   DT  P "O3'" 1 
ATOM 1682  C "C2'" . DT  D  2 4   ? 139.618 -12.065  88.088  1.00 459.00 ? 4   DT  P "C2'" 1 
ATOM 1683  C "C1'" . DT  D  2 4   ? 140.605 -12.771  88.995  1.00 463.43 ? 4   DT  P "C1'" 1 
ATOM 1684  N N1    . DT  D  2 4   ? 140.086 -13.040  90.357  1.00 475.27 ? 4   DT  P N1    1 
ATOM 1685  C C2    . DT  D  2 4   ? 140.522 -14.178  91.001  1.00 475.53 ? 4   DT  P C2    1 
ATOM 1686  O O2    . DT  D  2 4   ? 141.326 -14.956  90.506  1.00 462.55 ? 4   DT  P O2    1 
ATOM 1687  N N3    . DT  D  2 4   ? 139.966 -14.381  92.244  1.00 486.76 ? 4   DT  P N3    1 
ATOM 1688  C C4    . DT  D  2 4   ? 139.043 -13.574  92.893  1.00 496.98 ? 4   DT  P C4    1 
ATOM 1689  O O4    . DT  D  2 4   ? 138.628 -13.890  94.008  1.00 505.46 ? 4   DT  P O4    1 
ATOM 1690  C C5    . DT  D  2 4   ? 138.632 -12.395  92.158  1.00 497.64 ? 4   DT  P C5    1 
ATOM 1691  C C7    . DT  D  2 4   ? 137.635 -11.463  92.773  1.00 501.35 ? 4   DT  P C7    1 
ATOM 1692  C C6    . DT  D  2 4   ? 139.160 -12.197  90.941  1.00 489.89 ? 4   DT  P C6    1 
ATOM 1693  P P     . DT  D  2 5   ? 139.910 -11.891  84.631  1.00 435.14 ? 5   DT  P P     1 
ATOM 1694  O OP1   . DT  D  2 5   ? 140.667 -10.963  83.761  1.00 434.19 ? 5   DT  P OP1   1 
ATOM 1695  O OP2   . DT  D  2 5   ? 138.508 -11.574  85.017  1.00 436.83 ? 5   DT  P OP2   1 
ATOM 1696  O "O5'" . DT  D  2 5   ? 139.902 -13.315  83.914  1.00 427.66 ? 5   DT  P "O5'" 1 
ATOM 1697  C "C5'" . DT  D  2 5   ? 141.088 -14.117  83.774  1.00 421.15 ? 5   DT  P "C5'" 1 
ATOM 1698  C "C4'" . DT  D  2 5   ? 140.717 -15.565  83.980  1.00 412.29 ? 5   DT  P "C4'" 1 
ATOM 1699  O "O4'" . DT  D  2 5   ? 140.542 -15.815  85.398  1.00 415.16 ? 5   DT  P "O4'" 1 
ATOM 1700  C "C3'" . DT  D  2 5   ? 139.399 -15.957  83.304  1.00 397.81 ? 5   DT  P "C3'" 1 
ATOM 1701  O "O3'" . DT  D  2 5   ? 139.550 -17.180  82.583  1.00 375.48 ? 5   DT  P "O3'" 1 
ATOM 1702  C "C2'" . DT  D  2 5   ? 138.423 -16.124  84.457  1.00 401.77 ? 5   DT  P "C2'" 1 
ATOM 1703  C "C1'" . DT  D  2 5   ? 139.334 -16.533  85.597  1.00 412.12 ? 5   DT  P "C1'" 1 
ATOM 1704  N N1    . DT  D  2 5   ? 138.808 -16.229  86.956  1.00 420.25 ? 5   DT  P N1    1 
ATOM 1705  C C2    . DT  D  2 5   ? 139.240 -17.004  88.010  1.00 426.17 ? 5   DT  P C2    1 
ATOM 1706  O O2    . DT  D  2 5   ? 140.082 -17.882  87.893  1.00 427.55 ? 5   DT  P O2    1 
ATOM 1707  N N3    . DT  D  2 5   ? 138.656 -16.702  89.219  1.00 430.78 ? 5   DT  P N3    1 
ATOM 1708  C C4    . DT  D  2 5   ? 137.695 -15.737  89.467  1.00 428.48 ? 5   DT  P C4    1 
ATOM 1709  O O4    . DT  D  2 5   ? 137.254 -15.591  90.606  1.00 430.45 ? 5   DT  P O4    1 
ATOM 1710  C C5    . DT  D  2 5   ? 137.280 -14.968  88.312  1.00 423.78 ? 5   DT  P C5    1 
ATOM 1711  C C7    . DT  D  2 5   ? 136.247 -13.898  88.482  1.00 418.96 ? 5   DT  P C7    1 
ATOM 1712  C C6    . DT  D  2 5   ? 137.837 -15.262  87.129  1.00 421.40 ? 5   DT  P C6    1 
ATOM 1713  P P     . DT  D  2 6   ? 138.612 -17.501  81.324  1.00 358.38 ? 6   DT  P P     1 
ATOM 1714  O OP1   . DT  D  2 6   ? 139.333 -17.075  80.102  1.00 356.51 ? 6   DT  P OP1   1 
ATOM 1715  O OP2   . DT  D  2 6   ? 137.242 -16.979  81.599  1.00 352.83 ? 6   DT  P OP2   1 
ATOM 1716  O "O5'" . DT  D  2 6   ? 138.588 -19.092  81.302  1.00 363.83 ? 6   DT  P "O5'" 1 
ATOM 1717  C "C5'" . DT  D  2 6   ? 139.816 -19.825  81.470  1.00 379.55 ? 6   DT  P "C5'" 1 
ATOM 1718  C "C4'" . DT  D  2 6   ? 139.561 -21.098  82.241  1.00 388.40 ? 6   DT  P "C4'" 1 
ATOM 1719  O "O4'" . DT  D  2 6   ? 139.418 -20.803  83.655  1.00 388.17 ? 6   DT  P "O4'" 1 
ATOM 1720  C "C3'" . DT  D  2 6   ? 138.279 -21.818  81.816  1.00 387.87 ? 6   DT  P "C3'" 1 
ATOM 1721  O "O3'" . DT  D  2 6   ? 138.479 -23.223  81.630  1.00 386.13 ? 6   DT  P "O3'" 1 
ATOM 1722  C "C2'" . DT  D  2 6   ? 137.328 -21.567  82.972  1.00 386.45 ? 6   DT  P "C2'" 1 
ATOM 1723  C "C1'" . DT  D  2 6   ? 138.268 -21.467  84.156  1.00 382.01 ? 6   DT  P "C1'" 1 
ATOM 1724  N N1    . DT  D  2 6   ? 137.714 -20.665  85.270  1.00 372.19 ? 6   DT  P N1    1 
ATOM 1725  C C2    . DT  D  2 6   ? 137.966 -21.051  86.569  1.00 366.73 ? 6   DT  P C2    1 
ATOM 1726  O O2    . DT  D  2 6   ? 138.667 -22.009  86.860  1.00 357.17 ? 6   DT  P O2    1 
ATOM 1727  N N3    . DT  D  2 6   ? 137.377 -20.254  87.525  1.00 370.31 ? 6   DT  P N3    1 
ATOM 1728  C C4    . DT  D  2 6   ? 136.571 -19.147  87.313  1.00 373.60 ? 6   DT  P C4    1 
ATOM 1729  O O4    . DT  D  2 6   ? 136.121 -18.521  88.274  1.00 382.81 ? 6   DT  P O4    1 
ATOM 1730  C C5    . DT  D  2 6   ? 136.331 -18.817  85.925  1.00 370.49 ? 6   DT  P C5    1 
ATOM 1731  C C7    . DT  D  2 6   ? 135.463 -17.643  85.596  1.00 368.01 ? 6   DT  P C7    1 
ATOM 1732  C C6    . DT  D  2 6   ? 136.904 -19.584  84.989  1.00 370.30 ? 6   DT  P C6    1 
ATOM 1733  P P     . DT  D  2 7   ? 137.403 -24.088  80.800  1.00 376.81 ? 7   DT  P P     1 
ATOM 1734  O OP1   . DT  D  2 7   ? 138.030 -24.493  79.515  1.00 375.18 ? 7   DT  P OP1   1 
ATOM 1735  O OP2   . DT  D  2 7   ? 136.118 -23.335  80.777  1.00 380.87 ? 7   DT  P OP2   1 
ATOM 1736  O "O5'" . DT  D  2 7   ? 137.165 -25.381  81.708  1.00 367.12 ? 7   DT  P "O5'" 1 
ATOM 1737  C "C5'" . DT  D  2 7   ? 138.211 -25.995  82.503  1.00 360.03 ? 7   DT  P "C5'" 1 
ATOM 1738  C "C4'" . DT  D  2 7   ? 137.606 -26.850  83.595  1.00 354.29 ? 7   DT  P "C4'" 1 
ATOM 1739  O "O4'" . DT  D  2 7   ? 137.385 -26.035  84.776  1.00 346.83 ? 7   DT  P "O4'" 1 
ATOM 1740  C "C3'" . DT  D  2 7   ? 136.248 -27.464  83.238  1.00 350.07 ? 7   DT  P "C3'" 1 
ATOM 1741  O "O3'" . DT  D  2 7   ? 136.055 -28.809  83.702  1.00 350.49 ? 7   DT  P "O3'" 1 
ATOM 1742  C "C2'" . DT  D  2 7   ? 135.259 -26.580  83.972  1.00 341.36 ? 7   DT  P "C2'" 1 
ATOM 1743  C "C1'" . DT  D  2 7   ? 136.041 -26.182  85.210  1.00 336.33 ? 7   DT  P "C1'" 1 
ATOM 1744  N N1    . DT  D  2 7   ? 135.585 -24.888  85.732  1.00 325.04 ? 7   DT  P N1    1 
ATOM 1745  C C2    . DT  D  2 7   ? 135.534 -24.665  87.091  1.00 319.15 ? 7   DT  P C2    1 
ATOM 1746  O O2    . DT  D  2 7   ? 135.906 -25.481  87.920  1.00 314.76 ? 7   DT  P O2    1 
ATOM 1747  N N3    . DT  D  2 7   ? 135.060 -23.426  87.447  1.00 318.12 ? 7   DT  P N3    1 
ATOM 1748  C C4    . DT  D  2 7   ? 134.622 -22.423  86.600  1.00 320.28 ? 7   DT  P C4    1 
ATOM 1749  O O4    . DT  D  2 7   ? 134.229 -21.357  87.067  1.00 323.64 ? 7   DT  P O4    1 
ATOM 1750  C C5    . DT  D  2 7   ? 134.674 -22.740  85.190  1.00 321.70 ? 7   DT  P C5    1 
ATOM 1751  C C7    . DT  D  2 7   ? 134.201 -21.725  84.197  1.00 324.46 ? 7   DT  P C7    1 
ATOM 1752  C C6    . DT  D  2 7   ? 135.142 -23.942  84.834  1.00 323.33 ? 7   DT  P C6    1 
ATOM 1753  P P     . DT  D  2 8   ? 134.827 -29.695  83.141  1.00 347.31 ? 8   DT  P P     1 
ATOM 1754  O OP1   . DT  D  2 8   ? 135.392 -30.950  82.592  1.00 355.34 ? 8   DT  P OP1   1 
ATOM 1755  O OP2   . DT  D  2 8   ? 133.963 -28.832  82.290  1.00 341.29 ? 8   DT  P OP2   1 
ATOM 1756  O "O5'" . DT  D  2 8   ? 133.989 -30.069  84.445  1.00 343.12 ? 8   DT  P "O5'" 1 
ATOM 1757  C "C5'" . DT  D  2 8   ? 134.634 -30.574  85.631  1.00 344.48 ? 8   DT  P "C5'" 1 
ATOM 1758  C "C4'" . DT  D  2 8   ? 133.776 -30.327  86.852  1.00 341.92 ? 8   DT  P "C4'" 1 
ATOM 1759  O "O4'" . DT  D  2 8   ? 133.681 -28.908  87.148  1.00 335.34 ? 8   DT  P "O4'" 1 
ATOM 1760  C "C3'" . DT  D  2 8   ? 132.338 -30.841  86.754  1.00 340.66 ? 8   DT  P "C3'" 1 
ATOM 1761  O "O3'" . DT  D  2 8   ? 132.025 -31.473  87.997  1.00 351.59 ? 8   DT  P "O3'" 1 
ATOM 1762  C "C2'" . DT  D  2 8   ? 131.515 -29.573  86.603  1.00 330.89 ? 8   DT  P "C2'" 1 
ATOM 1763  C "C1'" . DT  D  2 8   ? 132.324 -28.579  87.418  1.00 324.81 ? 8   DT  P "C1'" 1 
ATOM 1764  N N1    . DT  D  2 8   ? 132.106 -27.165  87.039  1.00 312.15 ? 8   DT  P N1    1 
ATOM 1765  C C2    . DT  D  2 8   ? 131.892 -26.224  88.025  1.00 304.80 ? 8   DT  P C2    1 
ATOM 1766  O O2    . DT  D  2 8   ? 131.885 -26.490  89.218  1.00 300.05 ? 8   DT  P O2    1 
ATOM 1767  N N3    . DT  D  2 8   ? 131.690 -24.947  87.558  1.00 302.25 ? 8   DT  P N3    1 
ATOM 1768  C C4    . DT  D  2 8   ? 131.671 -24.529  86.239  1.00 302.65 ? 8   DT  P C4    1 
ATOM 1769  O O4    . DT  D  2 8   ? 131.472 -23.347  85.974  1.00 300.56 ? 8   DT  P O4    1 
ATOM 1770  C C5    . DT  D  2 8   ? 131.891 -25.572  85.259  1.00 304.67 ? 8   DT  P C5    1 
ATOM 1771  C C7    . DT  D  2 8   ? 131.882 -25.219  83.804  1.00 305.47 ? 8   DT  P C7    1 
ATOM 1772  C C6    . DT  D  2 8   ? 132.092 -26.819  85.704  1.00 308.53 ? 8   DT  P C6    1 
ATOM 1773  P P     . DT  D  2 9   ? 130.798 -32.497  88.108  1.00 354.89 ? 9   DT  P P     1 
ATOM 1774  O OP1   . DT  D  2 9   ? 131.302 -33.725  88.771  1.00 365.11 ? 9   DT  P OP1   1 
ATOM 1775  O OP2   . DT  D  2 9   ? 130.160 -32.607  86.765  1.00 347.93 ? 9   DT  P OP2   1 
ATOM 1776  O "O5'" . DT  D  2 9   ? 129.796 -31.767  89.119  1.00 348.05 ? 9   DT  P "O5'" 1 
ATOM 1777  C "C5'" . DT  D  2 9   ? 130.266 -30.954  90.236  1.00 339.41 ? 9   DT  P "C5'" 1 
ATOM 1778  C "C4'" . DT  D  2 9   ? 129.151 -30.145  90.869  1.00 330.96 ? 9   DT  P "C4'" 1 
ATOM 1779  O "O4'" . DT  D  2 9   ? 129.178 -28.776  90.385  1.00 328.52 ? 9   DT  P "O4'" 1 
ATOM 1780  C "C3'" . DT  D  2 9   ? 127.727 -30.657  90.630  1.00 326.34 ? 9   DT  P "C3'" 1 
ATOM 1781  O "O3'" . DT  D  2 9   ? 126.947 -30.580  91.829  1.00 322.58 ? 9   DT  P "O3'" 1 
ATOM 1782  C "C2'" . DT  D  2 9   ? 127.174 -29.694  89.596  1.00 325.15 ? 9   DT  P "C2'" 1 
ATOM 1783  C "C1'" . DT  D  2 9   ? 127.880 -28.399  89.948  1.00 325.88 ? 9   DT  P "C1'" 1 
ATOM 1784  N N1    . DT  D  2 9   ? 128.028 -27.479  88.804  1.00 322.58 ? 9   DT  P N1    1 
ATOM 1785  C C2    . DT  D  2 9   ? 127.835 -26.136  89.027  1.00 322.24 ? 9   DT  P C2    1 
ATOM 1786  O O2    . DT  D  2 9   ? 127.587 -25.672  90.127  1.00 324.38 ? 9   DT  P O2    1 
ATOM 1787  N N3    . DT  D  2 9   ? 127.961 -25.347  87.909  1.00 321.85 ? 9   DT  P N3    1 
ATOM 1788  C C4    . DT  D  2 9   ? 128.243 -25.761  86.620  1.00 322.56 ? 9   DT  P C4    1 
ATOM 1789  O O4    . DT  D  2 9   ? 128.320 -24.934  85.716  1.00 323.42 ? 9   DT  P O4    1 
ATOM 1790  C C5    . DT  D  2 9   ? 128.410 -27.189  86.456  1.00 323.25 ? 9   DT  P C5    1 
ATOM 1791  C C7    . DT  D  2 9   ? 128.703 -27.735  85.094  1.00 325.25 ? 9   DT  P C7    1 
ATOM 1792  C C6    . DT  D  2 9   ? 128.291 -27.965  87.542  1.00 322.36 ? 9   DT  P C6    1 
ATOM 1793  P P     . DT  D  2 10  ? 125.614 -31.467  91.992  1.00 317.21 ? 10  DT  P P     1 
ATOM 1794  O OP1   . DT  D  2 10  ? 125.826 -32.414  93.114  1.00 322.07 ? 10  DT  P OP1   1 
ATOM 1795  O OP2   . DT  D  2 10  ? 125.224 -31.985  90.659  1.00 311.01 ? 10  DT  P OP2   1 
ATOM 1796  O "O5'" . DT  D  2 10  ? 124.515 -30.397  92.416  1.00 317.81 ? 10  DT  P "O5'" 1 
ATOM 1797  C "C5'" . DT  D  2 10  ? 124.898 -29.170  93.062  1.00 324.14 ? 10  DT  P "C5'" 1 
ATOM 1798  C "C4'" . DT  D  2 10  ? 123.930 -28.060  92.720  1.00 323.63 ? 10  DT  P "C4'" 1 
ATOM 1799  O "O4'" . DT  D  2 10  ? 124.372 -27.370  91.527  1.00 317.36 ? 10  DT  P "O4'" 1 
ATOM 1800  C "C3'" . DT  D  2 10  ? 122.488 -28.493  92.441  1.00 325.50 ? 10  DT  P "C3'" 1 
ATOM 1801  O "O3'" . DT  D  2 10  ? 121.589 -27.520  92.993  1.00 339.07 ? 10  DT  P "O3'" 1 
ATOM 1802  C "C2'" . DT  D  2 10  ? 122.397 -28.428  90.929  1.00 315.16 ? 10  DT  P "C2'" 1 
ATOM 1803  C "C1'" . DT  D  2 10  ? 123.256 -27.208  90.671  1.00 307.69 ? 10  DT  P "C1'" 1 
ATOM 1804  N N1    . DT  D  2 10  ? 123.755 -27.024  89.293  1.00 295.36 ? 10  DT  P N1    1 
ATOM 1805  C C2    . DT  D  2 10  ? 123.803 -25.741  88.789  1.00 289.66 ? 10  DT  P C2    1 
ATOM 1806  O O2    . DT  D  2 10  ? 123.456 -24.759  89.427  1.00 287.32 ? 10  DT  P O2    1 
ATOM 1807  N N3    . DT  D  2 10  ? 124.268 -25.651  87.498  1.00 285.73 ? 10  DT  P N3    1 
ATOM 1808  C C4    . DT  D  2 10  ? 124.678 -26.689  86.682  1.00 285.04 ? 10  DT  P C4    1 
ATOM 1809  O O4    . DT  D  2 10  ? 125.073 -26.452  85.543  1.00 286.69 ? 10  DT  P O4    1 
ATOM 1810  C C5    . DT  D  2 10  ? 124.594 -28.008  87.274  1.00 284.86 ? 10  DT  P C5    1 
ATOM 1811  C C7    . DT  D  2 10  ? 125.014 -29.195  86.465  1.00 281.73 ? 10  DT  P C7    1 
ATOM 1812  C C6    . DT  D  2 10  ? 124.139 -28.107  88.531  1.00 288.80 ? 10  DT  P C6    1 
ATOM 1813  P P     . DT  D  2 11  ? 120.120 -27.960  93.443  1.00 351.61 ? 11  DT  P P     1 
ATOM 1814  O OP1   . DT  D  2 11  ? 120.172 -28.325  94.879  1.00 355.79 ? 11  DT  P OP1   1 
ATOM 1815  O OP2   . DT  D  2 11  ? 119.612 -28.935  92.444  1.00 348.16 ? 11  DT  P OP2   1 
ATOM 1816  O "O5'" . DT  D  2 11  ? 119.234 -26.641  93.293  1.00 358.50 ? 11  DT  P "O5'" 1 
ATOM 1817  C "C5'" . DT  D  2 11  ? 119.779 -25.308  93.356  1.00 365.31 ? 11  DT  P "C5'" 1 
ATOM 1818  C "C4'" . DT  D  2 11  ? 119.056 -24.408  92.377  1.00 364.82 ? 11  DT  P "C4'" 1 
ATOM 1819  O "O4'" . DT  D  2 11  ? 119.748 -24.452  91.101  1.00 363.46 ? 11  DT  P "O4'" 1 
ATOM 1820  C "C3'" . DT  D  2 11  ? 117.597 -24.794  92.084  1.00 356.15 ? 11  DT  P "C3'" 1 
ATOM 1821  O "O3'" . DT  D  2 11  ? 116.718 -23.655  91.932  1.00 342.68 ? 11  DT  P "O3'" 1 
ATOM 1822  C "C2'" . DT  D  2 11  ? 117.707 -25.555  90.773  1.00 354.15 ? 11  DT  P "C2'" 1 
ATOM 1823  C "C1'" . DT  D  2 11  ? 118.823 -24.790  90.078  1.00 353.61 ? 11  DT  P "C1'" 1 
ATOM 1824  N N1    . DT  D  2 11  ? 119.550 -25.523  89.016  1.00 341.42 ? 11  DT  P N1    1 
ATOM 1825  C C2    . DT  D  2 11  ? 119.992 -24.810  87.922  1.00 336.26 ? 11  DT  P C2    1 
ATOM 1826  O O2    . DT  D  2 11  ? 119.843 -23.604  87.805  1.00 339.30 ? 11  DT  P O2    1 
ATOM 1827  N N3    . DT  D  2 11  ? 120.626 -25.565  86.966  1.00 328.49 ? 11  DT  P N3    1 
ATOM 1828  C C4    . DT  D  2 11  ? 120.856 -26.927  86.994  1.00 322.13 ? 11  DT  P C4    1 
ATOM 1829  O O4    . DT  D  2 11  ? 121.448 -27.466  86.063  1.00 319.50 ? 11  DT  P O4    1 
ATOM 1830  C C5    . DT  D  2 11  ? 120.358 -27.613  88.166  1.00 321.72 ? 11  DT  P C5    1 
ATOM 1831  C C7    . DT  D  2 11  ? 120.560 -29.091  88.283  1.00 314.78 ? 11  DT  P C7    1 
ATOM 1832  C C6    . DT  D  2 11  ? 119.727 -26.888  89.099  1.00 330.50 ? 11  DT  P C6    1 
ATOM 1833  P P     . DT  D  2 12  ? 115.158 -23.732  92.377  1.00 326.45 ? 12  DT  P P     1 
ATOM 1834  O OP1   . DT  D  2 12  ? 115.048 -23.203  93.762  1.00 330.72 ? 12  DT  P OP1   1 
ATOM 1835  O OP2   . DT  D  2 12  ? 114.639 -25.089  92.059  1.00 318.27 ? 12  DT  P OP2   1 
ATOM 1836  O "O5'" . DT  D  2 12  ? 114.422 -22.744  91.364  1.00 321.97 ? 12  DT  P "O5'" 1 
ATOM 1837  C "C5'" . DT  D  2 12  ? 115.083 -21.602  90.775  1.00 314.58 ? 12  DT  P "C5'" 1 
ATOM 1838  C "C4'" . DT  D  2 12  ? 114.526 -21.291  89.403  1.00 305.10 ? 12  DT  P "C4'" 1 
ATOM 1839  O "O4'" . DT  D  2 12  ? 115.322 -21.982  88.417  1.00 289.79 ? 12  DT  P "O4'" 1 
ATOM 1840  C "C3'" . DT  D  2 12  ? 113.082 -21.720  89.132  1.00 308.88 ? 12  DT  P "C3'" 1 
ATOM 1841  O "O3'" . DT  D  2 12  ? 112.516 -20.852  88.144  1.00 325.88 ? 12  DT  P "O3'" 1 
ATOM 1842  C "C2'" . DT  D  2 12  ? 113.258 -23.095  88.526  1.00 292.65 ? 12  DT  P "C2'" 1 
ATOM 1843  C "C1'" . DT  D  2 12  ? 114.505 -22.887  87.692  1.00 278.45 ? 12  DT  P "C1'" 1 
ATOM 1844  N N1    . DT  D  2 12  ? 115.280 -24.110  87.457  1.00 260.79 ? 12  DT  P N1    1 
ATOM 1845  C C2    . DT  D  2 12  ? 116.141 -24.119  86.384  1.00 252.79 ? 12  DT  P C2    1 
ATOM 1846  O O2    . DT  D  2 12  ? 116.293 -23.159  85.642  1.00 251.98 ? 12  DT  P O2    1 
ATOM 1847  N N3    . DT  D  2 12  ? 116.815 -25.301  86.204  1.00 246.06 ? 12  DT  P N3    1 
ATOM 1848  C C4    . DT  D  2 12  ? 116.718 -26.446  86.974  1.00 242.39 ? 12  DT  P C4    1 
ATOM 1849  O O4    . DT  D  2 12  ? 117.391 -27.432  86.691  1.00 238.48 ? 12  DT  P O4    1 
ATOM 1850  C C5    . DT  D  2 12  ? 115.793 -26.366  88.084  1.00 244.71 ? 12  DT  P C5    1 
ATOM 1851  C C7    . DT  D  2 12  ? 115.617 -27.557  88.972  1.00 241.79 ? 12  DT  P C7    1 
ATOM 1852  C C6    . DT  D  2 12  ? 115.131 -25.217  88.267  1.00 251.88 ? 12  DT  P C6    1 
ATOM 1853  P P     . DT  D  2 13  ? 110.916 -20.834  87.844  1.00 339.56 ? 13  DT  P P     1 
ATOM 1854  O OP1   . DT  D  2 13  ? 110.255 -19.862  88.754  1.00 340.71 ? 13  DT  P OP1   1 
ATOM 1855  O OP2   . DT  D  2 13  ? 110.409 -22.231  87.782  1.00 335.63 ? 13  DT  P OP2   1 
ATOM 1856  O "O5'" . DT  D  2 13  ? 110.837 -20.189  86.390  1.00 349.59 ? 13  DT  P "O5'" 1 
ATOM 1857  C "C5'" . DT  D  2 13  ? 111.981 -19.551  85.780  1.00 364.29 ? 13  DT  P "C5'" 1 
ATOM 1858  C "C4'" . DT  D  2 13  ? 112.039 -19.880  84.306  1.00 371.19 ? 13  DT  P "C4'" 1 
ATOM 1859  O "O4'" . DT  D  2 13  ? 112.901 -21.034  84.125  1.00 361.31 ? 13  DT  P "O4'" 1 
ATOM 1860  C "C3'" . DT  D  2 13  ? 110.682 -20.261  83.698  1.00 372.62 ? 13  DT  P "C3'" 1 
ATOM 1861  O "O3'" . DT  D  2 13  ? 110.464 -19.781  82.360  1.00 376.12 ? 13  DT  P "O3'" 1 
ATOM 1862  C "C2'" . DT  D  2 13  ? 110.720 -21.775  83.689  1.00 361.96 ? 13  DT  P "C2'" 1 
ATOM 1863  C "C1'" . DT  D  2 13  ? 112.191 -22.052  83.436  1.00 350.02 ? 13  DT  P "C1'" 1 
ATOM 1864  N N1    . DT  D  2 13  ? 112.630 -23.368  83.954  1.00 332.05 ? 13  DT  P N1    1 
ATOM 1865  C C2    . DT  D  2 13  ? 113.546 -24.092  83.221  1.00 322.89 ? 13  DT  P C2    1 
ATOM 1866  O O2    . DT  D  2 13  ? 114.060 -23.675  82.193  1.00 320.57 ? 13  DT  P O2    1 
ATOM 1867  N N3    . DT  D  2 13  ? 113.848 -25.328  83.747  1.00 316.46 ? 13  DT  P N3    1 
ATOM 1868  C C4    . DT  D  2 13  ? 113.331 -25.898  84.900  1.00 314.54 ? 13  DT  P C4    1 
ATOM 1869  O O4    . DT  D  2 13  ? 113.706 -27.015  85.255  1.00 312.13 ? 13  DT  P O4    1 
ATOM 1870  C C5    . DT  D  2 13  ? 112.361 -25.089  85.605  1.00 316.85 ? 13  DT  P C5    1 
ATOM 1871  C C7    . DT  D  2 13  ? 111.743 -25.623  86.860  1.00 315.44 ? 13  DT  P C7    1 
ATOM 1872  C C6    . DT  D  2 13  ? 112.051 -23.890  85.093  1.00 323.84 ? 13  DT  P C6    1 
ATOM 1873  P P     . DT  D  2 14  ? 108.969 -19.714  81.724  1.00 378.16 ? 14  DT  P P     1 
ATOM 1874  O OP1   . DT  D  2 14  ? 108.515 -18.302  81.761  1.00 382.80 ? 14  DT  P OP1   1 
ATOM 1875  O OP2   . DT  D  2 14  ? 108.121 -20.781  82.339  1.00 377.09 ? 14  DT  P OP2   1 
ATOM 1876  O "O5'" . DT  D  2 14  ? 109.212 -20.047  80.185  1.00 374.72 ? 14  DT  P "O5'" 1 
ATOM 1877  C "C5'" . DT  D  2 14  ? 110.535 -20.009  79.604  1.00 371.24 ? 14  DT  P "C5'" 1 
ATOM 1878  C "C4'" . DT  D  2 14  ? 110.746 -21.206  78.704  1.00 360.80 ? 14  DT  P "C4'" 1 
ATOM 1879  O "O4'" . DT  D  2 14  ? 111.191 -22.339  79.497  1.00 354.53 ? 14  DT  P "O4'" 1 
ATOM 1880  C "C3'" . DT  D  2 14  ? 109.488 -21.670  77.956  1.00 357.61 ? 14  DT  P "C3'" 1 
ATOM 1881  O "O3'" . DT  D  2 14  ? 109.747 -21.989  76.576  1.00 356.78 ? 14  DT  P "O3'" 1 
ATOM 1882  C "C2'" . DT  D  2 14  ? 109.055 -22.902  78.731  1.00 351.94 ? 14  DT  P "C2'" 1 
ATOM 1883  C "C1'" . DT  D  2 14  ? 110.385 -23.469  79.194  1.00 344.76 ? 14  DT  P "C1'" 1 
ATOM 1884  N N1    . DT  D  2 14  ? 110.312 -24.338  80.396  1.00 330.30 ? 14  DT  P N1    1 
ATOM 1885  C C2    . DT  D  2 14  ? 111.104 -25.466  80.433  1.00 325.88 ? 14  DT  P C2    1 
ATOM 1886  O O2    . DT  D  2 14  ? 111.887 -25.762  79.543  1.00 329.70 ? 14  DT  P O2    1 
ATOM 1887  N N3    . DT  D  2 14  ? 110.950 -26.235  81.561  1.00 320.74 ? 14  DT  P N3    1 
ATOM 1888  C C4    . DT  D  2 14  ? 110.101 -25.997  82.627  1.00 315.34 ? 14  DT  P C4    1 
ATOM 1889  O O4    . DT  D  2 14  ? 110.078 -26.777  83.575  1.00 318.52 ? 14  DT  P O4    1 
ATOM 1890  C C5    . DT  D  2 14  ? 109.287 -24.807  82.514  1.00 313.14 ? 14  DT  P C5    1 
ATOM 1891  C C7    . DT  D  2 14  ? 108.338 -24.466  83.620  1.00 303.65 ? 14  DT  P C7    1 
ATOM 1892  C C6    . DT  D  2 14  ? 109.423 -24.055  81.413  1.00 320.93 ? 14  DT  P C6    1 
ATOM 1893  P P     . DT  D  2 15  ? 108.547 -22.020  75.472  1.00 357.18 ? 15  DT  P P     1 
ATOM 1894  O OP1   . DT  D  2 15  ? 108.644 -20.784  74.654  1.00 364.67 ? 15  DT  P OP1   1 
ATOM 1895  O OP2   . DT  D  2 15  ? 107.264 -22.347  76.162  1.00 350.34 ? 15  DT  P OP2   1 
ATOM 1896  O "O5'" . DT  D  2 15  ? 108.943 -23.244  74.526  1.00 360.59 ? 15  DT  P "O5'" 1 
ATOM 1897  C "C5'" . DT  D  2 15  ? 110.285 -23.787  74.516  1.00 377.58 ? 15  DT  P "C5'" 1 
ATOM 1898  C "C4'" . DT  D  2 15  ? 110.252 -25.299  74.485  1.00 388.61 ? 15  DT  P "C4'" 1 
ATOM 1899  O "O4'" . DT  D  2 15  ? 110.220 -25.839  75.834  1.00 387.83 ? 15  DT  P "O4'" 1 
ATOM 1900  C "C3'" . DT  D  2 15  ? 109.053 -25.909  73.749  1.00 395.69 ? 15  DT  P "C3'" 1 
ATOM 1901  O "O3'" . DT  D  2 15  ? 109.502 -26.922  72.834  1.00 406.78 ? 15  DT  P "O3'" 1 
ATOM 1902  C "C2'" . DT  D  2 15  ? 108.213 -26.508  74.866  1.00 391.53 ? 15  DT  P "C2'" 1 
ATOM 1903  C "C1'" . DT  D  2 15  ? 109.269 -26.891  75.888  1.00 386.21 ? 15  DT  P "C1'" 1 
ATOM 1904  N N1    . DT  D  2 15  ? 108.792 -27.028  77.293  1.00 380.34 ? 15  DT  P N1    1 
ATOM 1905  C C2    . DT  D  2 15  ? 109.289 -28.064  78.056  1.00 379.58 ? 15  DT  P C2    1 
ATOM 1906  O O2    . DT  D  2 15  ? 110.112 -28.865  77.643  1.00 386.52 ? 15  DT  P O2    1 
ATOM 1907  N N3    . DT  D  2 15  ? 108.788 -28.123  79.335  1.00 373.60 ? 15  DT  P N3    1 
ATOM 1908  C C4    . DT  D  2 15  ? 107.858 -27.276  79.908  1.00 367.61 ? 15  DT  P C4    1 
ATOM 1909  O O4    . DT  D  2 15  ? 107.505 -27.452  81.071  1.00 365.72 ? 15  DT  P O4    1 
ATOM 1910  C C5    . DT  D  2 15  ? 107.371 -26.221  79.048  1.00 366.66 ? 15  DT  P C5    1 
ATOM 1911  C C7    . DT  D  2 15  ? 106.359 -25.258  79.582  1.00 363.89 ? 15  DT  P C7    1 
ATOM 1912  C C6    . DT  D  2 15  ? 107.852 -26.154  77.799  1.00 371.69 ? 15  DT  P C6    1 
ATOM 1913  P P     . DT  D  2 16  ? 108.577 -27.412  71.597  1.00 413.00 ? 16  DT  P P     1 
ATOM 1914  O OP1   . DT  D  2 16  ? 109.187 -26.907  70.335  1.00 421.66 ? 16  DT  P OP1   1 
ATOM 1915  O OP2   . DT  D  2 16  ? 107.158 -27.092  71.906  1.00 417.72 ? 16  DT  P OP2   1 
ATOM 1916  O "O5'" . DT  D  2 16  ? 108.714 -29.002  71.649  1.00 400.99 ? 16  DT  P "O5'" 1 
ATOM 1917  C "C5'" . DT  D  2 16  ? 109.905 -29.640  72.163  1.00 385.98 ? 16  DT  P "C5'" 1 
ATOM 1918  C "C4'" . DT  D  2 16  ? 109.573 -30.891  72.945  1.00 374.84 ? 16  DT  P "C4'" 1 
ATOM 1919  O "O4'" . DT  D  2 16  ? 109.153 -30.552  74.290  1.00 365.28 ? 16  DT  P "O4'" 1 
ATOM 1920  C "C3'" . DT  D  2 16  ? 108.469 -31.787  72.366  1.00 374.69 ? 16  DT  P "C3'" 1 
ATOM 1921  O "O3'" . DT  D  2 16  ? 108.883 -33.155  72.529  1.00 380.83 ? 16  DT  P "O3'" 1 
ATOM 1922  C "C2'" . DT  D  2 16  ? 107.293 -31.516  73.289  1.00 365.80 ? 16  DT  P "C2'" 1 
ATOM 1923  C "C1'" . DT  D  2 16  ? 108.012 -31.326  74.610  1.00 359.07 ? 16  DT  P "C1'" 1 
ATOM 1924  N N1    . DT  D  2 16  ? 107.238 -30.611  75.643  1.00 349.31 ? 16  DT  P N1    1 
ATOM 1925  C C2    . DT  D  2 16  ? 107.315 -31.052  76.947  1.00 341.09 ? 16  DT  P C2    1 
ATOM 1926  O O2    . DT  D  2 16  ? 108.020 -31.985  77.297  1.00 333.26 ? 16  DT  P O2    1 
ATOM 1927  N N3    . DT  D  2 16  ? 106.529 -30.354  77.831  1.00 339.07 ? 16  DT  P N3    1 
ATOM 1928  C C4    . DT  D  2 16  ? 105.690 -29.292  77.546  1.00 343.66 ? 16  DT  P C4    1 
ATOM 1929  O O4    . DT  D  2 16  ? 105.047 -28.761  78.446  1.00 343.55 ? 16  DT  P O4    1 
ATOM 1930  C C5    . DT  D  2 16  ? 105.647 -28.894  76.156  1.00 348.05 ? 16  DT  P C5    1 
ATOM 1931  C C7    . DT  D  2 16  ? 104.767 -27.753  75.752  1.00 351.85 ? 16  DT  P C7    1 
ATOM 1932  C C6    . DT  D  2 16  ? 106.408 -29.570  75.285  1.00 349.94 ? 16  DT  P C6    1 
ATOM 1933  P P     . DT  D  2 17  ? 108.296 -34.371  71.617  1.00 382.63 ? 17  DT  P P     1 
ATOM 1934  O OP1   . DT  D  2 17  ? 109.211 -34.565  70.457  1.00 388.91 ? 17  DT  P OP1   1 
ATOM 1935  O OP2   . DT  D  2 17  ? 106.832 -34.156  71.379  1.00 378.96 ? 17  DT  P OP2   1 
ATOM 1936  O "O5'" . DT  D  2 17  ? 108.473 -35.625  72.589  1.00 374.50 ? 17  DT  P "O5'" 1 
ATOM 1937  C "C5'" . DT  D  2 17  ? 109.402 -35.576  73.711  1.00 360.26 ? 17  DT  P "C5'" 1 
ATOM 1938  C "C4'" . DT  D  2 17  ? 108.843 -36.278  74.930  1.00 350.40 ? 17  DT  P "C4'" 1 
ATOM 1939  O "O4'" . DT  D  2 17  ? 108.097 -35.349  75.765  1.00 347.60 ? 17  DT  P "O4'" 1 
ATOM 1940  C "C3'" . DT  D  2 17  ? 107.887 -37.430  74.622  1.00 346.66 ? 17  DT  P "C3'" 1 
ATOM 1941  O "O3'" . DT  D  2 17  ? 108.101 -38.483  75.567  1.00 341.01 ? 17  DT  P "O3'" 1 
ATOM 1942  C "C2'" . DT  D  2 17  ? 106.522 -36.794  74.806  1.00 346.65 ? 17  DT  P "C2'" 1 
ATOM 1943  C "C1'" . DT  D  2 17  ? 106.774 -35.841  75.965  1.00 343.33 ? 17  DT  P "C1'" 1 
ATOM 1944  N N1    . DT  D  2 17  ? 105.847 -34.678  76.049  1.00 336.43 ? 17  DT  P N1    1 
ATOM 1945  C C2    . DT  D  2 17  ? 105.364 -34.312  77.289  1.00 327.63 ? 17  DT  P C2    1 
ATOM 1946  O O2    . DT  D  2 17  ? 105.662 -34.893  78.321  1.00 317.60 ? 17  DT  P O2    1 
ATOM 1947  N N3    . DT  D  2 17  ? 104.510 -33.232  77.273  1.00 323.05 ? 17  DT  P N3    1 
ATOM 1948  C C4    . DT  D  2 17  ? 104.091 -32.510  76.167  1.00 320.14 ? 17  DT  P C4    1 
ATOM 1949  O O4    . DT  D  2 17  ? 103.307 -31.573  76.305  1.00 312.12 ? 17  DT  P O4    1 
ATOM 1950  C C5    . DT  D  2 17  ? 104.634 -32.954  74.900  1.00 324.18 ? 17  DT  P C5    1 
ATOM 1951  C C7    . DT  D  2 17  ? 104.232 -32.240  73.646  1.00 319.72 ? 17  DT  P C7    1 
ATOM 1952  C C6    . DT  D  2 17  ? 105.464 -34.006  74.905  1.00 333.49 ? 17  DT  P C6    1 
ATOM 1953  P P     . DT  D  2 18  ? 107.851 -40.020  75.169  1.00 339.64 ? 18  DT  P P     1 
ATOM 1954  O OP1   . DT  D  2 18  ? 109.172 -40.670  74.983  1.00 341.23 ? 18  DT  P OP1   1 
ATOM 1955  O OP2   . DT  D  2 18  ? 106.857 -40.072  74.061  1.00 340.20 ? 18  DT  P OP2   1 
ATOM 1956  O "O5'" . DT  D  2 18  ? 107.192 -40.599  76.500  1.00 340.18 ? 18  DT  P "O5'" 1 
ATOM 1957  C "C5'" . DT  D  2 18  ? 107.059 -39.777  77.686  1.00 333.49 ? 18  DT  P "C5'" 1 
ATOM 1958  C "C4'" . DT  D  2 18  ? 105.639 -39.836  78.195  1.00 330.83 ? 18  DT  P "C4'" 1 
ATOM 1959  O "O4'" . DT  D  2 18  ? 104.969 -38.567  77.985  1.00 323.47 ? 18  DT  P "O4'" 1 
ATOM 1960  C "C3'" . DT  D  2 18  ? 104.773 -40.897  77.501  1.00 336.07 ? 18  DT  P "C3'" 1 
ATOM 1961  O "O3'" . DT  D  2 18  ? 104.035 -41.683  78.443  1.00 344.11 ? 18  DT  P "O3'" 1 
ATOM 1962  C "C2'" . DT  D  2 18  ? 103.780 -40.084  76.694  1.00 331.67 ? 18  DT  P "C2'" 1 
ATOM 1963  C "C1'" . DT  D  2 18  ? 103.653 -38.836  77.538  1.00 326.69 ? 18  DT  P "C1'" 1 
ATOM 1964  N N1    . DT  D  2 18  ? 103.171 -37.678  76.768  1.00 329.01 ? 18  DT  P N1    1 
ATOM 1965  C C2    . DT  D  2 18  ? 102.432 -36.708  77.411  1.00 327.64 ? 18  DT  P C2    1 
ATOM 1966  O O2    . DT  D  2 18  ? 102.203 -36.728  78.610  1.00 318.66 ? 18  DT  P O2    1 
ATOM 1967  N N3    . DT  D  2 18  ? 101.992 -35.693  76.596  1.00 333.90 ? 18  DT  P N3    1 
ATOM 1968  C C4    . DT  D  2 18  ? 102.190 -35.569  75.230  1.00 337.89 ? 18  DT  P C4    1 
ATOM 1969  O O4    . DT  D  2 18  ? 101.726 -34.602  74.627  1.00 335.56 ? 18  DT  P O4    1 
ATOM 1970  C C5    . DT  D  2 18  ? 102.953 -36.636  74.619  1.00 339.37 ? 18  DT  P C5    1 
ATOM 1971  C C7    . DT  D  2 18  ? 103.221 -36.589  73.147  1.00 338.66 ? 18  DT  P C7    1 
ATOM 1972  C C6    . DT  D  2 18  ? 103.382 -37.632  75.406  1.00 336.31 ? 18  DT  P C6    1 
ATOM 1973  P P     . DT  D  2 19  ? 103.266 -43.024  77.979  1.00 351.71 ? 19  DT  P P     1 
ATOM 1974  O OP1   . DT  D  2 19  ? 104.112 -44.183  78.366  1.00 354.69 ? 19  DT  P OP1   1 
ATOM 1975  O OP2   . DT  D  2 19  ? 102.828 -42.866  76.563  1.00 354.63 ? 19  DT  P OP2   1 
ATOM 1976  O "O5'" . DT  D  2 19  ? 101.952 -43.012  78.883  1.00 345.36 ? 19  DT  P "O5'" 1 
ATOM 1977  C "C5'" . DT  D  2 19  ? 101.956 -42.363  80.176  1.00 339.70 ? 19  DT  P "C5'" 1 
ATOM 1978  C "C4'" . DT  D  2 19  ? 100.646 -41.662  80.459  1.00 336.98 ? 19  DT  P "C4'" 1 
ATOM 1979  O "O4'" . DT  D  2 19  ? 100.543 -40.404  79.744  1.00 328.96 ? 19  DT  P "O4'" 1 
ATOM 1980  C "C3'" . DT  D  2 19  ? 99.379  -42.446  80.114  1.00 340.57 ? 19  DT  P "C3'" 1 
ATOM 1981  O "O3'" . DT  D  2 19  ? 98.442  -42.230  81.166  1.00 349.38 ? 19  DT  P "O3'" 1 
ATOM 1982  C "C2'" . DT  D  2 19  ? 98.841  -41.725  78.894  1.00 335.17 ? 19  DT  P "C2'" 1 
ATOM 1983  C "C1'" . DT  D  2 19  ? 99.239  -40.297  79.199  1.00 331.20 ? 19  DT  P "C1'" 1 
ATOM 1984  N N1    . DT  D  2 19  ? 99.317  -39.463  77.994  1.00 330.85 ? 19  DT  P N1    1 
ATOM 1985  C C2    . DT  D  2 19  ? 98.798  -38.186  78.005  1.00 327.70 ? 19  DT  P C2    1 
ATOM 1986  O O2    . DT  D  2 19  ? 98.281  -37.680  78.990  1.00 308.19 ? 19  DT  P O2    1 
ATOM 1987  N N3    . DT  D  2 19  ? 98.908  -37.516  76.810  1.00 343.52 ? 19  DT  P N3    1 
ATOM 1988  C C4    . DT  D  2 19  ? 99.459  -37.992  75.632  1.00 360.73 ? 19  DT  P C4    1 
ATOM 1989  O O4    . DT  D  2 19  ? 99.479  -37.277  74.632  1.00 380.79 ? 19  DT  P O4    1 
ATOM 1990  C C5    . DT  D  2 19  ? 99.972  -39.345  75.693  1.00 357.88 ? 19  DT  P C5    1 
ATOM 1991  C C7    . DT  D  2 19  ? 100.584 -39.948  74.467  1.00 363.64 ? 19  DT  P C7    1 
ATOM 1992  C C6    . DT  D  2 19  ? 99.873  -40.002  76.854  1.00 343.60 ? 19  DT  P C6    1 
ATOM 1993  P P     . DT  D  2 20  ? 97.274  -43.283  81.423  1.00 354.33 ? 20  DT  P P     1 
ATOM 1994  O OP1   . DT  D  2 20  ? 97.689  -44.148  82.554  1.00 355.26 ? 20  DT  P OP1   1 
ATOM 1995  O OP2   . DT  D  2 20  ? 96.907  -43.895  80.119  1.00 360.60 ? 20  DT  P OP2   1 
ATOM 1996  O "O5'" . DT  D  2 20  ? 96.057  -42.366  81.887  1.00 348.89 ? 20  DT  P "O5'" 1 
ATOM 1997  C "C5'" . DT  D  2 20  ? 96.287  -41.033  82.400  1.00 351.03 ? 20  DT  P "C5'" 1 
ATOM 1998  C "C4'" . DT  D  2 20  ? 95.139  -40.100  82.079  1.00 350.92 ? 20  DT  P "C4'" 1 
ATOM 1999  O "O4'" . DT  D  2 20  ? 95.437  -39.347  80.876  1.00 345.55 ? 20  DT  P "O4'" 1 
ATOM 2000  C "C3'" . DT  D  2 20  ? 93.785  -40.766  81.825  1.00 353.20 ? 20  DT  P "C3'" 1 
ATOM 2001  O "O3'" . DT  D  2 20  ? 92.687  -39.907  82.175  1.00 364.26 ? 20  DT  P "O3'" 1 
ATOM 2002  C "C2'" . DT  D  2 20  ? 93.744  -40.861  80.315  1.00 348.52 ? 20  DT  P "C2'" 1 
ATOM 2003  C "C1'" . DT  D  2 20  ? 94.393  -39.545  79.940  1.00 343.60 ? 20  DT  P "C1'" 1 
ATOM 2004  N N1    . DT  D  2 20  ? 94.988  -39.583  78.619  1.00 339.46 ? 20  DT  P N1    1 
ATOM 2005  C C2    . DT  D  2 20  ? 94.944  -38.442  77.857  1.00 332.52 ? 20  DT  P C2    1 
ATOM 2006  O O2    . DT  D  2 20  ? 94.438  -37.400  78.245  1.00 314.35 ? 20  DT  P O2    1 
ATOM 2007  N N3    . DT  D  2 20  ? 95.522  -38.564  76.616  1.00 342.93 ? 20  DT  P N3    1 
ATOM 2008  C C4    . DT  D  2 20  ? 96.110  -39.696  76.075  1.00 352.64 ? 20  DT  P C4    1 
ATOM 2009  O O4    . DT  D  2 20  ? 96.582  -39.660  74.940  1.00 364.89 ? 20  DT  P O4    1 
ATOM 2010  C C5    . DT  D  2 20  ? 96.112  -40.861  76.935  1.00 351.66 ? 20  DT  P C5    1 
ATOM 2011  C C7    . DT  D  2 20  ? 96.725  -42.133  76.440  1.00 349.54 ? 20  DT  P C7    1 
ATOM 2012  C C6    . DT  D  2 20  ? 95.554  -40.746  78.145  1.00 347.43 ? 20  DT  P C6    1 
ATOM 2013  P P     . DT  D  2 21  ? 91.242  -40.536  82.468  1.00 373.68 ? 21  DT  P P     1 
ATOM 2014  O OP1   . DT  D  2 21  ? 91.079  -40.600  83.938  1.00 377.91 ? 21  DT  P OP1   1 
ATOM 2015  O OP2   . DT  D  2 21  ? 91.111  -41.767  81.647  1.00 380.15 ? 21  DT  P OP2   1 
ATOM 2016  O "O5'" . DT  D  2 21  ? 90.204  -39.487  81.860  1.00 365.94 ? 21  DT  P "O5'" 1 
ATOM 2017  C "C5'" . DT  D  2 21  ? 90.475  -38.067  81.811  1.00 354.56 ? 21  DT  P "C5'" 1 
ATOM 2018  C "C4'" . DT  D  2 21  ? 89.780  -37.399  80.641  1.00 347.01 ? 21  DT  P "C4'" 1 
ATOM 2019  O "O4'" . DT  D  2 21  ? 90.581  -37.529  79.435  1.00 341.05 ? 21  DT  P "O4'" 1 
ATOM 2020  C "C3'" . DT  D  2 21  ? 88.385  -37.921  80.280  1.00 348.07 ? 21  DT  P "C3'" 1 
ATOM 2021  O "O3'" . DT  D  2 21  ? 87.561  -36.848  79.794  1.00 351.31 ? 21  DT  P "O3'" 1 
ATOM 2022  C "C2'" . DT  D  2 21  ? 88.685  -38.874  79.141  1.00 349.68 ? 21  DT  P "C2'" 1 
ATOM 2023  C "C1'" . DT  D  2 21  ? 89.796  -38.132  78.419  1.00 350.26 ? 21  DT  P "C1'" 1 
ATOM 2024  N N1    . DT  D  2 21  ? 90.680  -38.973  77.602  1.00 356.18 ? 21  DT  P N1    1 
ATOM 2025  C C2    . DT  D  2 21  ? 91.176  -38.428  76.442  1.00 359.71 ? 21  DT  P C2    1 
ATOM 2026  O O2    . DT  D  2 21  ? 90.920  -37.291  76.079  1.00 360.96 ? 21  DT  P O2    1 
ATOM 2027  N N3    . DT  D  2 21  ? 91.992  -39.264  75.720  1.00 363.25 ? 21  DT  P N3    1 
ATOM 2028  C C4    . DT  D  2 21  ? 92.346  -40.564  76.035  1.00 363.81 ? 21  DT  P C4    1 
ATOM 2029  O O4    . DT  D  2 21  ? 93.086  -41.195  75.286  1.00 370.22 ? 21  DT  P O4    1 
ATOM 2030  C C5    . DT  D  2 21  ? 91.780  -41.075  77.265  1.00 361.30 ? 21  DT  P C5    1 
ATOM 2031  C C7    . DT  D  2 21  ? 92.104  -42.472  77.691  1.00 360.24 ? 21  DT  P C7    1 
ATOM 2032  C C6    . DT  D  2 21  ? 90.983  -40.265  77.974  1.00 359.04 ? 21  DT  P C6    1 
ATOM 2033  P P     . DT  D  2 22  ? 85.945  -36.916  79.928  1.00 357.93 ? 22  DT  P P     1 
ATOM 2034  O OP1   . DT  D  2 22  ? 85.522  -35.952  80.970  1.00 366.40 ? 22  DT  P OP1   1 
ATOM 2035  O OP2   . DT  D  2 22  ? 85.569  -38.344  80.074  1.00 361.24 ? 22  DT  P OP2   1 
ATOM 2036  O "O5'" . DT  D  2 22  ? 85.397  -36.401  78.514  1.00 359.21 ? 22  DT  P "O5'" 1 
ATOM 2037  C "C5'" . DT  D  2 22  ? 86.005  -35.323  77.748  1.00 358.02 ? 22  DT  P "C5'" 1 
ATOM 2038  C "C4'" . DT  D  2 22  ? 85.726  -35.458  76.264  1.00 361.01 ? 22  DT  P "C4'" 1 
ATOM 2039  O "O4'" . DT  D  2 22  ? 86.768  -36.226  75.608  1.00 361.47 ? 22  DT  P "O4'" 1 
ATOM 2040  C "C3'" . DT  D  2 22  ? 84.400  -36.123  75.872  1.00 365.28 ? 22  DT  P "C3'" 1 
ATOM 2041  O "O3'" . DT  D  2 22  ? 83.782  -35.423  74.781  1.00 366.54 ? 22  DT  P "O3'" 1 
ATOM 2042  C "C2'" . DT  D  2 22  ? 84.822  -37.499  75.385  1.00 366.76 ? 22  DT  P "C2'" 1 
ATOM 2043  C "C1'" . DT  D  2 22  ? 86.180  -37.213  74.767  1.00 359.50 ? 22  DT  P "C1'" 1 
ATOM 2044  N N1    . DT  D  2 22  ? 87.105  -38.376  74.689  1.00 348.29 ? 22  DT  P N1    1 
ATOM 2045  C C2    . DT  D  2 22  ? 88.027  -38.403  73.664  1.00 336.94 ? 22  DT  P C2    1 
ATOM 2046  O O2    . DT  D  2 22  ? 88.116  -37.520  72.825  1.00 332.94 ? 22  DT  P O2    1 
ATOM 2047  N N3    . DT  D  2 22  ? 88.845  -39.509  73.658  1.00 327.30 ? 22  DT  P N3    1 
ATOM 2048  C C4    . DT  D  2 22  ? 88.831  -40.567  74.550  1.00 323.51 ? 22  DT  P C4    1 
ATOM 2049  O O4    . DT  D  2 22  ? 89.627  -41.494  74.413  1.00 317.02 ? 22  DT  P O4    1 
ATOM 2050  C C5    . DT  D  2 22  ? 87.834  -40.477  75.595  1.00 328.32 ? 22  DT  P C5    1 
ATOM 2051  C C7    . DT  D  2 22  ? 87.732  -41.582  76.600  1.00 321.81 ? 22  DT  P C7    1 
ATOM 2052  C C6    . DT  D  2 22  ? 87.033  -39.402  75.611  1.00 341.61 ? 22  DT  P C6    1 
ATOM 2053  P P     . DT  D  2 23  ? 82.243  -35.721  74.367  1.00 367.00 ? 23  DT  P P     1 
ATOM 2054  O OP1   . DT  D  2 23  ? 81.381  -34.692  75.012  1.00 369.34 ? 23  DT  P OP1   1 
ATOM 2055  O OP2   . DT  D  2 23  ? 81.963  -37.167  74.587  1.00 369.67 ? 23  DT  P OP2   1 
ATOM 2056  O "O5'" . DT  D  2 23  ? 82.222  -35.491  72.788  1.00 359.53 ? 23  DT  P "O5'" 1 
ATOM 2057  C "C5'" . DT  D  2 23  ? 83.125  -34.564  72.148  1.00 344.59 ? 23  DT  P "C5'" 1 
ATOM 2058  C "C4'" . DT  D  2 23  ? 83.556  -35.071  70.790  1.00 330.17 ? 23  DT  P "C4'" 1 
ATOM 2059  O "O4'" . DT  D  2 23  ? 84.581  -36.086  70.933  1.00 321.54 ? 23  DT  P "O4'" 1 
ATOM 2060  C "C3'" . DT  D  2 23  ? 82.453  -35.687  69.922  1.00 327.61 ? 23  DT  P "C3'" 1 
ATOM 2061  O "O3'" . DT  D  2 23  ? 82.571  -35.177  68.586  1.00 330.83 ? 23  DT  P "O3'" 1 
ATOM 2062  C "C2'" . DT  D  2 23  ? 82.751  -37.177  69.975  1.00 320.95 ? 23  DT  P "C2'" 1 
ATOM 2063  C "C1'" . DT  D  2 23  ? 84.262  -37.194  70.109  1.00 317.95 ? 23  DT  P "C1'" 1 
ATOM 2064  N N1    . DT  D  2 23  ? 84.824  -38.404  70.737  1.00 313.26 ? 23  DT  P N1    1 
ATOM 2065  C C2    . DT  D  2 23  ? 85.980  -38.929  70.207  1.00 314.00 ? 23  DT  P C2    1 
ATOM 2066  O O2    . DT  D  2 23  ? 86.556  -38.442  69.246  1.00 322.13 ? 23  DT  P O2    1 
ATOM 2067  N N3    . DT  D  2 23  ? 86.439  -40.056  70.843  1.00 308.77 ? 23  DT  P N3    1 
ATOM 2068  C C4    . DT  D  2 23  ? 85.874  -40.689  71.933  1.00 303.39 ? 23  DT  P C4    1 
ATOM 2069  O O4    . DT  D  2 23  ? 86.408  -41.690  72.402  1.00 299.44 ? 23  DT  P O4    1 
ATOM 2070  C C5    . DT  D  2 23  ? 84.660  -40.087  72.434  1.00 303.25 ? 23  DT  P C5    1 
ATOM 2071  C C7    . DT  D  2 23  ? 83.978  -40.700  73.616  1.00 299.07 ? 23  DT  P C7    1 
ATOM 2072  C C6    . DT  D  2 23  ? 84.203  -38.989  71.820  1.00 307.44 ? 23  DT  P C6    1 
ATOM 2073  P P     . DT  D  2 24  ? 81.318  -35.183  67.580  1.00 339.99 ? 24  DT  P P     1 
ATOM 2074  O OP1   . DT  D  2 24  ? 80.765  -33.807  67.533  1.00 342.00 ? 24  DT  P OP1   1 
ATOM 2075  O OP2   . DT  D  2 24  ? 80.419  -36.316  67.952  1.00 341.34 ? 24  DT  P OP2   1 
ATOM 2076  O "O5'" . DT  D  2 24  ? 82.004  -35.476  66.170  1.00 347.75 ? 24  DT  P "O5'" 1 
ATOM 2077  C "C5'" . DT  D  2 24  ? 83.419  -35.235  65.939  1.00 355.14 ? 24  DT  P "C5'" 1 
ATOM 2078  C "C4'" . DT  D  2 24  ? 84.022  -36.317  65.071  1.00 363.83 ? 24  DT  P "C4'" 1 
ATOM 2079  O "O4'" . DT  D  2 24  ? 84.572  -37.376  65.900  1.00 367.30 ? 24  DT  P "O4'" 1 
ATOM 2080  C "C3'" . DT  D  2 24  ? 83.038  -36.996  64.108  1.00 371.92 ? 24  DT  P "C3'" 1 
ATOM 2081  O "O3'" . DT  D  2 24  ? 83.601  -37.161  62.795  1.00 377.72 ? 24  DT  P "O3'" 1 
ATOM 2082  C "C2'" . DT  D  2 24  ? 82.818  -38.360  64.736  1.00 374.44 ? 24  DT  P "C2'" 1 
ATOM 2083  C "C1'" . DT  D  2 24  ? 84.164  -38.630  65.374  1.00 376.79 ? 24  DT  P "C1'" 1 
ATOM 2084  N N1    . DT  D  2 24  ? 84.119  -39.622  66.479  1.00 389.80 ? 24  DT  P N1    1 
ATOM 2085  C C2    . DT  D  2 24  ? 85.136  -40.546  66.579  1.00 392.96 ? 24  DT  P C2    1 
ATOM 2086  O O2    . DT  D  2 24  ? 86.100  -40.564  65.831  1.00 383.84 ? 24  DT  P O2    1 
ATOM 2087  N N3    . DT  D  2 24  ? 84.992  -41.446  67.608  1.00 402.62 ? 24  DT  P N3    1 
ATOM 2088  C C4    . DT  D  2 24  ? 83.952  -41.518  68.517  1.00 408.53 ? 24  DT  P C4    1 
ATOM 2089  O O4    . DT  D  2 24  ? 83.962  -42.382  69.391  1.00 420.13 ? 24  DT  P O4    1 
ATOM 2090  C C5    . DT  D  2 24  ? 82.911  -40.531  68.342  1.00 404.35 ? 24  DT  P C5    1 
ATOM 2091  C C7    . DT  D  2 24  ? 81.741  -40.535  69.274  1.00 394.83 ? 24  DT  P C7    1 
ATOM 2092  C C6    . DT  D  2 24  ? 83.038  -39.654  67.337  1.00 399.59 ? 24  DT  P C6    1 
ATOM 2093  P P     . DT  D  2 25  ? 82.658  -37.473  61.498  1.00 391.22 ? 25  DT  P P     1 
ATOM 2094  O OP1   . DT  D  2 25  ? 82.728  -36.303  60.584  1.00 401.78 ? 25  DT  P OP1   1 
ATOM 2095  O OP2   . DT  D  2 25  ? 81.322  -37.946  61.973  1.00 387.75 ? 25  DT  P OP2   1 
ATOM 2096  O "O5'" . DT  D  2 25  ? 83.417  -38.664  60.750  1.00 394.21 ? 25  DT  P "O5'" 1 
ATOM 2097  C "C5'" . DT  D  2 25  ? 84.850  -38.879  60.891  1.00 393.67 ? 25  DT  P "C5'" 1 
ATOM 2098  C "C4'" . DT  D  2 25  ? 85.224  -40.342  60.759  1.00 393.66 ? 25  DT  P "C4'" 1 
ATOM 2099  O "O4'" . DT  D  2 25  ? 85.158  -41.022  62.037  1.00 387.45 ? 25  DT  P "O4'" 1 
ATOM 2100  C "C3'" . DT  D  2 25  ? 84.378  -41.177  59.790  1.00 394.13 ? 25  DT  P "C3'" 1 
ATOM 2101  O "O3'" . DT  D  2 25  ? 85.183  -42.075  59.006  1.00 384.39 ? 25  DT  P "O3'" 1 
ATOM 2102  C "C2'" . DT  D  2 25  ? 83.544  -42.057  60.703  1.00 394.41 ? 25  DT  P "C2'" 1 
ATOM 2103  C "C1'" . DT  D  2 25  ? 84.486  -42.264  61.877  1.00 394.46 ? 25  DT  P "C1'" 1 
ATOM 2104  N N1    . DT  D  2 25  ? 83.800  -42.582  63.144  1.00 397.19 ? 25  DT  P N1    1 
ATOM 2105  C C2    . DT  D  2 25  ? 84.308  -43.584  63.939  1.00 393.09 ? 25  DT  P C2    1 
ATOM 2106  O O2    . DT  D  2 25  ? 85.317  -44.213  63.659  1.00 374.73 ? 25  DT  P O2    1 
ATOM 2107  N N3    . DT  D  2 25  ? 83.591  -43.820  65.086  1.00 407.00 ? 25  DT  P N3    1 
ATOM 2108  C C4    . DT  D  2 25  ? 82.446  -43.168  65.505  1.00 422.19 ? 25  DT  P C4    1 
ATOM 2109  O O4    . DT  D  2 25  ? 81.915  -43.485  66.564  1.00 435.48 ? 25  DT  P O4    1 
ATOM 2110  C C5    . DT  D  2 25  ? 81.966  -42.133  64.618  1.00 421.59 ? 25  DT  P C5    1 
ATOM 2111  C C7    . DT  D  2 25  ? 80.727  -41.377  64.983  1.00 427.21 ? 25  DT  P C7    1 
ATOM 2112  C C6    . DT  D  2 25  ? 82.654  -41.901  63.493  1.00 410.86 ? 25  DT  P C6    1 
ATOM 2113  P P     . DT  D  2 26  ? 84.785  -42.393  57.493  1.00 374.72 ? 26  DT  P P     1 
ATOM 2114  O OP1   . DT  D  2 26  ? 85.848  -41.822  56.622  1.00 379.62 ? 26  DT  P OP1   1 
ATOM 2115  O OP2   . DT  D  2 26  ? 83.374  -41.978  57.296  1.00 377.53 ? 26  DT  P OP2   1 
ATOM 2116  O "O5'" . DT  D  2 26  ? 84.819  -43.986  57.420  1.00 357.49 ? 26  DT  P "O5'" 1 
ATOM 2117  C "C5'" . DT  D  2 26  ? 85.907  -44.735  57.984  1.00 332.80 ? 26  DT  P "C5'" 1 
ATOM 2118  C "C4'" . DT  D  2 26  ? 85.472  -46.150  58.287  1.00 319.88 ? 26  DT  P "C4'" 1 
ATOM 2119  O "O4'" . DT  D  2 26  ? 84.801  -46.185  59.560  1.00 308.82 ? 26  DT  P "O4'" 1 
ATOM 2120  C "C3'" . DT  D  2 26  ? 84.513  -46.796  57.283  1.00 321.72 ? 26  DT  P "C3'" 1 
ATOM 2121  O "O3'" . DT  D  2 26  ? 84.866  -48.169  57.107  1.00 325.03 ? 26  DT  P "O3'" 1 
ATOM 2122  C "C2'" . DT  D  2 26  ? 83.170  -46.752  57.982  1.00 316.30 ? 26  DT  P "C2'" 1 
ATOM 2123  C "C1'" . DT  D  2 26  ? 83.575  -46.883  59.432  1.00 310.62 ? 26  DT  P "C1'" 1 
ATOM 2124  N N1    . DT  D  2 26  ? 82.630  -46.274  60.361  1.00 312.13 ? 26  DT  P N1    1 
ATOM 2125  C C2    . DT  D  2 26  ? 82.707  -46.658  61.678  1.00 317.07 ? 26  DT  P C2    1 
ATOM 2126  O O2    . DT  D  2 26  ? 83.500  -47.493  62.082  1.00 322.84 ? 26  DT  P O2    1 
ATOM 2127  N N3    . DT  D  2 26  ? 81.813  -46.028  62.509  1.00 322.84 ? 26  DT  P N3    1 
ATOM 2128  C C4    . DT  D  2 26  ? 80.878  -45.070  62.160  1.00 322.20 ? 26  DT  P C4    1 
ATOM 2129  O O4    . DT  D  2 26  ? 80.139  -44.594  63.020  1.00 329.49 ? 26  DT  P O4    1 
ATOM 2130  C C5    . DT  D  2 26  ? 80.860  -44.710  60.759  1.00 318.53 ? 26  DT  P C5    1 
ATOM 2131  C C7    . DT  D  2 26  ? 79.884  -43.679  60.285  1.00 317.22 ? 26  DT  P C7    1 
ATOM 2132  C C6    . DT  D  2 26  ? 81.735  -45.313  59.943  1.00 314.57 ? 26  DT  P C6    1 
ATOM 2133  P P     . DA  E  1 1   ? 76.455  -51.927  2.806   1.00 396.48 ? 1   DA  s P     1 
ATOM 2134  O OP1   . DA  E  1 1   ? 75.850  -51.697  4.147   1.00 394.19 ? 1   DA  s OP1   1 
ATOM 2135  O OP2   . DA  E  1 1   ? 76.308  -50.898  1.749   1.00 396.15 ? 1   DA  s OP2   1 
ATOM 2136  O "O5'" . DA  E  1 1   ? 78.013  -52.214  2.967   1.00 398.44 ? 1   DA  s "O5'" 1 
ATOM 2137  C "C5'" . DA  E  1 1   ? 78.601  -53.433  2.459   1.00 405.57 ? 1   DA  s "C5'" 1 
ATOM 2138  C "C4'" . DA  E  1 1   ? 79.965  -53.177  1.852   1.00 408.29 ? 1   DA  s "C4'" 1 
ATOM 2139  O "O4'" . DA  E  1 1   ? 79.932  -51.999  1.012   1.00 407.10 ? 1   DA  s "O4'" 1 
ATOM 2140  C "C3'" . DA  E  1 1   ? 81.108  -52.947  2.844   1.00 407.85 ? 1   DA  s "C3'" 1 
ATOM 2141  O "O3'" . DA  E  1 1   ? 82.333  -53.475  2.319   1.00 413.61 ? 1   DA  s "O3'" 1 
ATOM 2142  C "C2'" . DA  E  1 1   ? 81.226  -51.436  2.882   1.00 403.16 ? 1   DA  s "C2'" 1 
ATOM 2143  C "C1'" . DA  E  1 1   ? 80.930  -51.080  1.436   1.00 402.97 ? 1   DA  s "C1'" 1 
ATOM 2144  N N9    . DA  E  1 1   ? 80.408  -49.735  1.213   1.00 399.44 ? 1   DA  s N9    1 
ATOM 2145  C C8    . DA  E  1 1   ? 79.526  -49.018  1.981   1.00 397.06 ? 1   DA  s C8    1 
ATOM 2146  N N7    . DA  E  1 1   ? 79.223  -47.844  1.482   1.00 396.18 ? 1   DA  s N7    1 
ATOM 2147  C C5    . DA  E  1 1   ? 79.946  -47.789  0.298   1.00 397.78 ? 1   DA  s C5    1 
ATOM 2148  C C6    . DA  E  1 1   ? 80.060  -46.803  -0.699  1.00 398.84 ? 1   DA  s C6    1 
ATOM 2149  N N6    . DA  E  1 1   ? 79.422  -45.632  -0.659  1.00 398.35 ? 1   DA  s N6    1 
ATOM 2150  N N1    . DA  E  1 1   ? 80.864  -47.065  -1.754  1.00 401.18 ? 1   DA  s N1    1 
ATOM 2151  C C2    . DA  E  1 1   ? 81.509  -48.237  -1.791  1.00 402.01 ? 1   DA  s C2    1 
ATOM 2152  N N3    . DA  E  1 1   ? 81.483  -49.242  -0.917  1.00 401.46 ? 1   DA  s N3    1 
ATOM 2153  C C4    . DA  E  1 1   ? 80.672  -48.952  0.115   1.00 399.33 ? 1   DA  s C4    1 
ATOM 2154  P P     . DA  E  1 2   ? 83.495  -53.978  3.308   1.00 415.66 ? 2   DA  s P     1 
ATOM 2155  O OP1   . DA  E  1 2   ? 83.435  -55.463  3.375   1.00 419.04 ? 2   DA  s OP1   1 
ATOM 2156  O OP2   . DA  E  1 2   ? 83.428  -53.177  4.557   1.00 412.93 ? 2   DA  s OP2   1 
ATOM 2157  O "O5'" . DA  E  1 2   ? 84.832  -53.578  2.544   1.00 416.12 ? 2   DA  s "O5'" 1 
ATOM 2158  C "C5'" . DA  E  1 2   ? 84.856  -53.392  1.121   1.00 419.55 ? 2   DA  s "C5'" 1 
ATOM 2159  C "C4'" . DA  E  1 2   ? 85.773  -52.243  0.777   1.00 419.23 ? 2   DA  s "C4'" 1 
ATOM 2160  O "O4'" . DA  E  1 2   ? 84.993  -51.030  0.661   1.00 419.19 ? 2   DA  s "O4'" 1 
ATOM 2161  C "C3'" . DA  E  1 2   ? 86.854  -51.946  1.822   1.00 417.56 ? 2   DA  s "C3'" 1 
ATOM 2162  O "O3'" . DA  E  1 2   ? 88.072  -51.598  1.159   1.00 418.40 ? 2   DA  s "O3'" 1 
ATOM 2163  C "C2'" . DA  E  1 2   ? 86.327  -50.709  2.524   1.00 415.26 ? 2   DA  s "C2'" 1 
ATOM 2164  C "C1'" . DA  E  1 2   ? 85.664  -50.005  1.363   1.00 417.10 ? 2   DA  s "C1'" 1 
ATOM 2165  N N9    . DA  E  1 2   ? 84.686  -48.983  1.724   1.00 417.16 ? 2   DA  s N9    1 
ATOM 2166  C C8    . DA  E  1 2   ? 83.904  -48.909  2.850   1.00 415.51 ? 2   DA  s C8    1 
ATOM 2167  N N7    . DA  E  1 2   ? 83.135  -47.849  2.892   1.00 415.29 ? 2   DA  s N7    1 
ATOM 2168  C C5    . DA  E  1 2   ? 83.432  -47.176  1.715   1.00 417.93 ? 2   DA  s C5    1 
ATOM 2169  C C6    . DA  E  1 2   ? 82.955  -45.973  1.167   1.00 419.87 ? 2   DA  s C6    1 
ATOM 2170  N N6    . DA  E  1 2   ? 82.038  -45.205  1.755   1.00 418.84 ? 2   DA  s N6    1 
ATOM 2171  N N1    . DA  E  1 2   ? 83.461  -45.581  -0.023  1.00 424.00 ? 2   DA  s N1    1 
ATOM 2172  C C2    . DA  E  1 2   ? 84.390  -46.347  -0.608  1.00 424.87 ? 2   DA  s C2    1 
ATOM 2173  N N3    . DA  E  1 2   ? 84.921  -47.494  -0.190  1.00 423.24 ? 2   DA  s N3    1 
ATOM 2174  C C4    . DA  E  1 2   ? 84.389  -47.861  0.989   1.00 419.23 ? 2   DA  s C4    1 
ATOM 2175  P P     . DA  E  1 3   ? 89.498  -51.858  1.864   1.00 418.93 ? 3   DA  s P     1 
ATOM 2176  O OP1   . DA  E  1 3   ? 89.876  -53.273  1.628   1.00 420.98 ? 3   DA  s OP1   1 
ATOM 2177  O OP2   . DA  E  1 3   ? 89.448  -51.324  3.252   1.00 416.79 ? 3   DA  s OP2   1 
ATOM 2178  O "O5'" . DA  E  1 3   ? 90.495  -50.947  1.022   1.00 419.38 ? 3   DA  s "O5'" 1 
ATOM 2179  C "C5'" . DA  E  1 3   ? 90.114  -50.422  -0.261  1.00 423.40 ? 3   DA  s "C5'" 1 
ATOM 2180  C "C4'" . DA  E  1 3   ? 90.479  -48.958  -0.347  1.00 424.64 ? 3   DA  s "C4'" 1 
ATOM 2181  O "O4'" . DA  E  1 3   ? 89.330  -48.139  -0.016  1.00 422.15 ? 3   DA  s "O4'" 1 
ATOM 2182  C "C3'" . DA  E  1 3   ? 91.597  -48.522  0.604   1.00 426.00 ? 3   DA  s "C3'" 1 
ATOM 2183  O "O3'" . DA  E  1 3   ? 92.440  -47.585  -0.067  1.00 434.68 ? 3   DA  s "O3'" 1 
ATOM 2184  C "C2'" . DA  E  1 3   ? 90.855  -47.776  1.693   1.00 420.21 ? 3   DA  s "C2'" 1 
ATOM 2185  C "C1'" . DA  E  1 3   ? 89.746  -47.137  0.888   1.00 417.89 ? 3   DA  s "C1'" 1 
ATOM 2186  N N9    . DA  E  1 3   ? 88.595  -46.744  1.693   1.00 412.67 ? 3   DA  s N9    1 
ATOM 2187  C C8    . DA  E  1 3   ? 88.169  -47.314  2.866   1.00 409.64 ? 3   DA  s C8    1 
ATOM 2188  N N7    . DA  E  1 3   ? 87.124  -46.724  3.391   1.00 407.57 ? 3   DA  s N7    1 
ATOM 2189  C C5    . DA  E  1 3   ? 86.855  -45.682  2.515   1.00 408.52 ? 3   DA  s C5    1 
ATOM 2190  C C6    . DA  E  1 3   ? 85.871  -44.679  2.513   1.00 408.50 ? 3   DA  s C6    1 
ATOM 2191  N N6    . DA  E  1 3   ? 84.935  -44.560  3.456   1.00 409.17 ? 3   DA  s N6    1 
ATOM 2192  N N1    . DA  E  1 3   ? 85.878  -43.793  1.493   1.00 409.38 ? 3   DA  s N1    1 
ATOM 2193  C C2    . DA  E  1 3   ? 86.817  -43.914  0.546   1.00 410.19 ? 3   DA  s C2    1 
ATOM 2194  N N3    . DA  E  1 3   ? 87.795  -44.811  0.440   1.00 410.74 ? 3   DA  s N3    1 
ATOM 2195  C C4    . DA  E  1 3   ? 87.757  -45.678  1.468   1.00 410.43 ? 3   DA  s C4    1 
ATOM 2196  P P     . DA  E  1 4   ? 93.931  -47.319  0.453   1.00 440.47 ? 4   DA  s P     1 
ATOM 2197  O OP1   . DA  E  1 4   ? 94.826  -48.310  -0.197  1.00 444.10 ? 4   DA  s OP1   1 
ATOM 2198  O OP2   . DA  E  1 4   ? 93.904  -47.226  1.936   1.00 436.79 ? 4   DA  s OP2   1 
ATOM 2199  O "O5'" . DA  E  1 4   ? 94.263  -45.881  -0.149  1.00 443.99 ? 4   DA  s "O5'" 1 
ATOM 2200  C "C5'" . DA  E  1 4   ? 93.549  -45.368  -1.296  1.00 450.03 ? 4   DA  s "C5'" 1 
ATOM 2201  C "C4'" . DA  E  1 4   ? 93.171  -43.914  -1.107  1.00 451.57 ? 4   DA  s "C4'" 1 
ATOM 2202  O "O4'" . DA  E  1 4   ? 91.979  -43.816  -0.289  1.00 447.46 ? 4   DA  s "O4'" 1 
ATOM 2203  C "C3'" . DA  E  1 4   ? 94.220  -43.033  -0.418  1.00 454.22 ? 4   DA  s "C3'" 1 
ATOM 2204  O "O3'" . DA  E  1 4   ? 94.201  -41.696  -0.946  1.00 466.83 ? 4   DA  s "O3'" 1 
ATOM 2205  C "C2'" . DA  E  1 4   ? 93.713  -42.964  1.008   1.00 445.36 ? 4   DA  s "C2'" 1 
ATOM 2206  C "C1'" . DA  E  1 4   ? 92.226  -42.881  0.748   1.00 439.40 ? 4   DA  s "C1'" 1 
ATOM 2207  N N9    . DA  E  1 4   ? 91.370  -43.221  1.879   1.00 428.78 ? 4   DA  s N9    1 
ATOM 2208  C C8    . DA  E  1 4   ? 91.526  -44.209  2.819   1.00 424.13 ? 4   DA  s C8    1 
ATOM 2209  N N7    . DA  E  1 4   ? 90.566  -44.247  3.710   1.00 419.80 ? 4   DA  s N7    1 
ATOM 2210  C C5    . DA  E  1 4   ? 89.728  -43.205  3.339   1.00 419.84 ? 4   DA  s C5    1 
ATOM 2211  C C6    . DA  E  1 4   ? 88.528  -42.717  3.882   1.00 418.41 ? 4   DA  s C6    1 
ATOM 2212  N N6    . DA  E  1 4   ? 87.938  -43.238  4.959   1.00 418.31 ? 4   DA  s N6    1 
ATOM 2213  N N1    . DA  E  1 4   ? 87.946  -41.660  3.274   1.00 418.59 ? 4   DA  s N1    1 
ATOM 2214  C C2    . DA  E  1 4   ? 88.537  -41.139  2.193   1.00 419.58 ? 4   DA  s C2    1 
ATOM 2215  N N3    . DA  E  1 4   ? 89.658  -41.514  1.583   1.00 421.42 ? 4   DA  s N3    1 
ATOM 2216  C C4    . DA  E  1 4   ? 90.214  -42.562  2.216   1.00 422.95 ? 4   DA  s C4    1 
ATOM 2217  P P     . DA  E  1 5   ? 95.532  -40.785  -0.913  1.00 476.06 ? 5   DA  s P     1 
ATOM 2218  O OP1   . DA  E  1 5   ? 96.212  -40.920  -2.225  1.00 480.64 ? 5   DA  s OP1   1 
ATOM 2219  O OP2   . DA  E  1 5   ? 96.278  -41.080  0.342   1.00 472.75 ? 5   DA  s OP2   1 
ATOM 2220  O "O5'" . DA  E  1 5   ? 94.973  -39.294  -0.820  1.00 478.64 ? 5   DA  s "O5'" 1 
ATOM 2221  C "C5'" . DA  E  1 5   ? 93.866  -38.841  -1.625  1.00 479.91 ? 5   DA  s "C5'" 1 
ATOM 2222  C "C4'" . DA  E  1 5   ? 92.949  -37.944  -0.823  1.00 474.54 ? 5   DA  s "C4'" 1 
ATOM 2223  O "O4'" . DA  E  1 5   ? 92.349  -38.687  0.269   1.00 469.97 ? 5   DA  s "O4'" 1 
ATOM 2224  C "C3'" . DA  E  1 5   ? 93.599  -36.718  -0.173  1.00 470.68 ? 5   DA  s "C3'" 1 
ATOM 2225  O "O3'" . DA  E  1 5   ? 92.614  -35.671  -0.147  1.00 466.99 ? 5   DA  s "O3'" 1 
ATOM 2226  C "C2'" . DA  E  1 5   ? 93.865  -37.202  1.243   1.00 466.09 ? 5   DA  s "C2'" 1 
ATOM 2227  C "C1'" . DA  E  1 5   ? 92.592  -37.995  1.489   1.00 462.39 ? 5   DA  s "C1'" 1 
ATOM 2228  N N9    . DA  E  1 5   ? 92.553  -38.975  2.582   1.00 453.32 ? 5   DA  s N9    1 
ATOM 2229  C C8    . DA  E  1 5   ? 93.414  -40.007  2.872   1.00 449.32 ? 5   DA  s C8    1 
ATOM 2230  N N7    . DA  E  1 5   ? 93.041  -40.736  3.895   1.00 445.02 ? 5   DA  s N7    1 
ATOM 2231  C C5    . DA  E  1 5   ? 91.842  -40.162  4.293   1.00 444.75 ? 5   DA  s C5    1 
ATOM 2232  C C6    . DA  E  1 5   ? 90.937  -40.475  5.323   1.00 442.72 ? 5   DA  s C6    1 
ATOM 2233  N N6    . DA  E  1 5   ? 91.112  -41.483  6.179   1.00 442.18 ? 5   DA  s N6    1 
ATOM 2234  N N1    . DA  E  1 5   ? 89.839  -39.699  5.452   1.00 442.77 ? 5   DA  s N1    1 
ATOM 2235  C C2    . DA  E  1 5   ? 89.671  -38.681  4.600   1.00 445.37 ? 5   DA  s C2    1 
ATOM 2236  N N3    . DA  E  1 5   ? 90.445  -38.289  3.591   1.00 447.52 ? 5   DA  s N3    1 
ATOM 2237  C C4    . DA  E  1 5   ? 91.527  -39.080  3.490   1.00 448.18 ? 5   DA  s C4    1 
ATOM 2238  P P     . DA  E  1 6   ? 92.981  -34.151  -0.555  1.00 463.31 ? 6   DA  s P     1 
ATOM 2239  O OP1   . DA  E  1 6   ? 92.131  -33.761  -1.713  1.00 464.03 ? 6   DA  s OP1   1 
ATOM 2240  O OP2   . DA  E  1 6   ? 94.459  -34.032  -0.656  1.00 464.34 ? 6   DA  s OP2   1 
ATOM 2241  O "O5'" . DA  E  1 6   ? 92.482  -33.312  0.705   1.00 458.36 ? 6   DA  s "O5'" 1 
ATOM 2242  C "C5'" . DA  E  1 6   ? 91.087  -33.280  1.066   1.00 454.04 ? 6   DA  s "C5'" 1 
ATOM 2243  C "C4'" . DA  E  1 6   ? 90.921  -32.890  2.516   1.00 448.67 ? 6   DA  s "C4'" 1 
ATOM 2244  O "O4'" . DA  E  1 6   ? 91.061  -34.051  3.370   1.00 448.35 ? 6   DA  s "O4'" 1 
ATOM 2245  C "C3'" . DA  E  1 6   ? 91.921  -31.859  3.039   1.00 443.49 ? 6   DA  s "C3'" 1 
ATOM 2246  O "O3'" . DA  E  1 6   ? 91.177  -31.019  3.918   1.00 436.63 ? 6   DA  s "O3'" 1 
ATOM 2247  C "C2'" . DA  E  1 6   ? 92.905  -32.698  3.834   1.00 442.78 ? 6   DA  s "C2'" 1 
ATOM 2248  C "C1'" . DA  E  1 6   ? 91.992  -33.767  4.400   1.00 445.37 ? 6   DA  s "C1'" 1 
ATOM 2249  N N9    . DA  E  1 6   ? 92.646  -35.020  4.772   1.00 446.08 ? 6   DA  s N9    1 
ATOM 2250  C C8    . DA  E  1 6   ? 93.756  -35.609  4.221   1.00 446.47 ? 6   DA  s C8    1 
ATOM 2251  N N7    . DA  E  1 6   ? 94.090  -36.743  4.788   1.00 446.75 ? 6   DA  s N7    1 
ATOM 2252  C C5    . DA  E  1 6   ? 93.135  -36.913  5.778   1.00 447.27 ? 6   DA  s C5    1 
ATOM 2253  C C6    . DA  E  1 6   ? 92.937  -37.920  6.736   1.00 448.20 ? 6   DA  s C6    1 
ATOM 2254  N N6    . DA  E  1 6   ? 93.724  -38.993  6.857   1.00 450.18 ? 6   DA  s N6    1 
ATOM 2255  N N1    . DA  E  1 6   ? 91.888  -37.788  7.577   1.00 448.23 ? 6   DA  s N1    1 
ATOM 2256  C C2    . DA  E  1 6   ? 91.107  -36.706  7.463   1.00 447.16 ? 6   DA  s C2    1 
ATOM 2257  N N3    . DA  E  1 6   ? 91.191  -35.694  6.604   1.00 446.51 ? 6   DA  s N3    1 
ATOM 2258  C C4    . DA  E  1 6   ? 92.238  -35.860  5.779   1.00 446.62 ? 6   DA  s C4    1 
ATOM 2259  P P     . DA  E  1 7   ? 91.592  -29.493  4.147   1.00 431.61 ? 7   DA  s P     1 
ATOM 2260  O OP1   . DA  E  1 7   ? 90.612  -28.639  3.425   1.00 434.08 ? 7   DA  s OP1   1 
ATOM 2261  O OP2   . DA  E  1 7   ? 93.042  -29.350  3.854   1.00 430.41 ? 7   DA  s OP2   1 
ATOM 2262  O "O5'" . DA  E  1 7   ? 91.369  -29.323  5.717   1.00 425.97 ? 7   DA  s "O5'" 1 
ATOM 2263  C "C5'" . DA  E  1 7   ? 90.396  -30.143  6.401   1.00 419.37 ? 7   DA  s "C5'" 1 
ATOM 2264  C "C4'" . DA  E  1 7   ? 90.755  -30.330  7.858   1.00 412.46 ? 7   DA  s "C4'" 1 
ATOM 2265  O "O4'" . DA  E  1 7   ? 91.315  -31.651  8.074   1.00 412.00 ? 7   DA  s "O4'" 1 
ATOM 2266  C "C3'" . DA  E  1 7   ? 91.785  -29.347  8.411   1.00 407.48 ? 7   DA  s "C3'" 1 
ATOM 2267  O "O3'" . DA  E  1 7   ? 91.449  -29.103  9.774   1.00 397.58 ? 7   DA  s "O3'" 1 
ATOM 2268  C "C2'" . DA  E  1 7   ? 93.068  -30.152  8.382   1.00 409.35 ? 7   DA  s "C2'" 1 
ATOM 2269  C "C1'" . DA  E  1 7   ? 92.544  -31.518  8.768   1.00 411.96 ? 7   DA  s "C1'" 1 
ATOM 2270  N N9    . DA  E  1 7   ? 93.404  -32.634  8.384   1.00 415.32 ? 7   DA  s N9    1 
ATOM 2271  C C8    . DA  E  1 7   ? 94.276  -32.709  7.326   1.00 417.41 ? 7   DA  s C8    1 
ATOM 2272  N N7    . DA  E  1 7   ? 94.918  -33.849  7.249   1.00 418.08 ? 7   DA  s N7    1 
ATOM 2273  C C5    . DA  E  1 7   ? 94.438  -34.574  8.330   1.00 417.66 ? 7   DA  s C5    1 
ATOM 2274  C C6    . DA  E  1 7   ? 94.725  -35.864  8.804   1.00 418.22 ? 7   DA  s C6    1 
ATOM 2275  N N6    . DA  E  1 7   ? 95.602  -36.686  8.223   1.00 420.93 ? 7   DA  s N6    1 
ATOM 2276  N N1    . DA  E  1 7   ? 94.070  -36.288  9.908   1.00 416.46 ? 7   DA  s N1    1 
ATOM 2277  C C2    . DA  E  1 7   ? 93.196  -35.459  10.494  1.00 414.47 ? 7   DA  s C2    1 
ATOM 2278  N N3    . DA  E  1 7   ? 92.838  -34.227  10.141  1.00 414.27 ? 7   DA  s N3    1 
ATOM 2279  C C4    . DA  E  1 7   ? 93.505  -33.838  9.039   1.00 416.05 ? 7   DA  s C4    1 
ATOM 2280  P P     . DA  E  1 8   ? 91.988  -27.800  10.502  1.00 391.22 ? 8   DA  s P     1 
ATOM 2281  O OP1   . DA  E  1 8   ? 90.928  -26.771  10.425  1.00 394.17 ? 8   DA  s OP1   1 
ATOM 2282  O OP2   . DA  E  1 8   ? 93.344  -27.500  9.979   1.00 391.98 ? 8   DA  s OP2   1 
ATOM 2283  O "O5'" . DA  E  1 8   ? 92.164  -28.269  12.014  1.00 381.58 ? 8   DA  s "O5'" 1 
ATOM 2284  C "C5'" . DA  E  1 8   ? 91.572  -29.484  12.513  1.00 370.69 ? 8   DA  s "C5'" 1 
ATOM 2285  C "C4'" . DA  E  1 8   ? 92.519  -30.177  13.466  1.00 362.85 ? 8   DA  s "C4'" 1 
ATOM 2286  O "O4'" . DA  E  1 8   ? 93.241  -31.218  12.764  1.00 360.65 ? 8   DA  s "O4'" 1 
ATOM 2287  C "C3'" . DA  E  1 8   ? 93.591  -29.277  14.093  1.00 359.84 ? 8   DA  s "C3'" 1 
ATOM 2288  O "O3'" . DA  E  1 8   ? 93.814  -29.652  15.459  1.00 356.87 ? 8   DA  s "O3'" 1 
ATOM 2289  C "C2'" . DA  E  1 8   ? 94.835  -29.610  13.289  1.00 359.42 ? 8   DA  s "C2'" 1 
ATOM 2290  C "C1'" . DA  E  1 8   ? 94.615  -31.092  13.084  1.00 360.29 ? 8   DA  s "C1'" 1 
ATOM 2291  N N9    . DA  E  1 8   ? 95.394  -31.725  12.022  1.00 363.41 ? 8   DA  s N9    1 
ATOM 2292  C C8    . DA  E  1 8   ? 95.869  -31.176  10.856  1.00 366.85 ? 8   DA  s C8    1 
ATOM 2293  N N7    . DA  E  1 8   ? 96.561  -32.013  10.122  1.00 369.20 ? 8   DA  s N7    1 
ATOM 2294  C C5    . DA  E  1 8   ? 96.551  -33.190  10.858  1.00 367.81 ? 8   DA  s C5    1 
ATOM 2295  C C6    . DA  E  1 8   ? 97.111  -34.460  10.625  1.00 368.67 ? 8   DA  s C6    1 
ATOM 2296  N N6    . DA  E  1 8   ? 97.821  -34.768  9.537   1.00 371.80 ? 8   DA  s N6    1 
ATOM 2297  N N1    . DA  E  1 8   ? 96.913  -35.416  11.560  1.00 366.28 ? 8   DA  s N1    1 
ATOM 2298  C C2    . DA  E  1 8   ? 96.203  -35.105  12.653  1.00 362.59 ? 8   DA  s C2    1 
ATOM 2299  N N3    . DA  E  1 8   ? 95.623  -33.953  12.982  1.00 361.91 ? 8   DA  s N3    1 
ATOM 2300  C C4    . DA  E  1 8   ? 95.840  -33.025  12.033  1.00 364.33 ? 8   DA  s C4    1 
ATOM 2301  P P     . DA  E  1 9   ? 94.320  -28.575  16.531  1.00 356.83 ? 9   DA  s P     1 
ATOM 2302  O OP1   . DA  E  1 9   ? 93.131  -28.080  17.268  1.00 356.75 ? 9   DA  s OP1   1 
ATOM 2303  O OP2   . DA  E  1 9   ? 95.215  -27.611  15.841  1.00 357.31 ? 9   DA  s OP2   1 
ATOM 2304  O "O5'" . DA  E  1 9   ? 95.246  -29.434  17.503  1.00 358.81 ? 9   DA  s "O5'" 1 
ATOM 2305  C "C5'" . DA  E  1 9   ? 94.846  -30.744  17.948  1.00 364.12 ? 9   DA  s "C5'" 1 
ATOM 2306  C "C4'" . DA  E  1 9   ? 96.047  -31.653  18.088  1.00 368.05 ? 9   DA  s "C4'" 1 
ATOM 2307  O "O4'" . DA  E  1 9   ? 96.492  -32.110  16.784  1.00 369.02 ? 9   DA  s "O4'" 1 
ATOM 2308  C "C3'" . DA  E  1 9   ? 97.282  -31.039  18.762  1.00 370.58 ? 9   DA  s "C3'" 1 
ATOM 2309  O "O3'" . DA  E  1 9   ? 97.875  -32.018  19.627  1.00 374.08 ? 9   DA  s "O3'" 1 
ATOM 2310  C "C2'" . DA  E  1 9   ? 98.227  -30.808  17.596  1.00 369.82 ? 9   DA  s "C2'" 1 
ATOM 2311  C "C1'" . DA  E  1 9   ? 97.906  -32.025  16.753  1.00 369.12 ? 9   DA  s "C1'" 1 
ATOM 2312  N N9    . DA  E  1 9   ? 98.340  -31.980  15.356  1.00 370.13 ? 9   DA  s N9    1 
ATOM 2313  C C8    . DA  E  1 9   ? 98.324  -30.911  14.494  1.00 372.07 ? 9   DA  s C8    1 
ATOM 2314  N N7    . DA  E  1 9   ? 98.802  -31.184  13.304  1.00 375.02 ? 9   DA  s N7    1 
ATOM 2315  C C5    . DA  E  1 9   ? 99.168  -32.521  13.390  1.00 374.34 ? 9   DA  s C5    1 
ATOM 2316  C C6    . DA  E  1 9   ? 99.742  -33.408  12.461  1.00 376.30 ? 9   DA  s C6    1 
ATOM 2317  N N6    . DA  E  1 9   ? 100.062 -33.068  11.210  1.00 380.57 ? 9   DA  s N6    1 
ATOM 2318  N N1    . DA  E  1 9   ? 99.978  -34.676  12.866  1.00 373.73 ? 9   DA  s N1    1 
ATOM 2319  C C2    . DA  E  1 9   ? 99.660  -35.017  14.121  1.00 369.60 ? 9   DA  s C2    1 
ATOM 2320  N N3    . DA  E  1 9   ? 99.116  -34.276  15.084  1.00 368.06 ? 9   DA  s N3    1 
ATOM 2321  C C4    . DA  E  1 9   ? 98.892  -33.023  14.649  1.00 370.67 ? 9   DA  s C4    1 
ATOM 2322  P P     . DA  E  1 10  ? 98.809  -31.590  20.873  1.00 376.57 ? 10  DA  s P     1 
ATOM 2323  O OP1   . DA  E  1 10  ? 97.935  -31.423  22.064  1.00 376.69 ? 10  DA  s OP1   1 
ATOM 2324  O OP2   . DA  E  1 10  ? 99.695  -30.469  20.450  1.00 378.38 ? 10  DA  s OP2   1 
ATOM 2325  O "O5'" . DA  E  1 10  ? 99.697  -32.891  21.116  1.00 374.41 ? 10  DA  s "O5'" 1 
ATOM 2326  C "C5'" . DA  E  1 10  ? 99.457  -34.115  20.390  1.00 372.16 ? 10  DA  s "C5'" 1 
ATOM 2327  C "C4'" . DA  E  1 10  ? 100.760 -34.662  19.854  1.00 371.22 ? 10  DA  s "C4'" 1 
ATOM 2328  O "O4'" . DA  E  1 10  ? 100.910 -34.299  18.461  1.00 371.92 ? 10  DA  s "O4'" 1 
ATOM 2329  C "C3'" . DA  E  1 10  ? 102.014 -34.131  20.552  1.00 370.79 ? 10  DA  s "C3'" 1 
ATOM 2330  O "O3'" . DA  E  1 10  ? 103.019 -35.144  20.528  1.00 371.10 ? 10  DA  s "O3'" 1 
ATOM 2331  C "C2'" . DA  E  1 10  ? 102.489 -33.039  19.614  1.00 371.61 ? 10  DA  s "C2'" 1 
ATOM 2332  C "C1'" . DA  E  1 10  ? 102.191 -33.716  18.297  1.00 373.95 ? 10  DA  s "C1'" 1 
ATOM 2333  N N9    . DA  E  1 10  ? 102.150 -32.839  17.133  1.00 378.57 ? 10  DA  s N9    1 
ATOM 2334  C C8    . DA  E  1 10  ? 101.759 -31.525  17.058  1.00 379.80 ? 10  DA  s C8    1 
ATOM 2335  N N7    . DA  E  1 10  ? 101.860 -31.012  15.857  1.00 384.36 ? 10  DA  s N7    1 
ATOM 2336  C C5    . DA  E  1 10  ? 102.367 -32.053  15.092  1.00 388.41 ? 10  DA  s C5    1 
ATOM 2337  C C6    . DA  E  1 10  ? 102.709 -32.148  13.732  1.00 394.42 ? 10  DA  s C6    1 
ATOM 2338  N N6    . DA  E  1 10  ? 102.584 -31.141  12.866  1.00 400.95 ? 10  DA  s N6    1 
ATOM 2339  N N1    . DA  E  1 10  ? 103.192 -33.329  13.286  1.00 395.40 ? 10  DA  s N1    1 
ATOM 2340  C C2    . DA  E  1 10  ? 103.323 -34.337  14.158  1.00 391.72 ? 10  DA  s C2    1 
ATOM 2341  N N3    . DA  E  1 10  ? 103.032 -34.371  15.456  1.00 387.27 ? 10  DA  s N3    1 
ATOM 2342  C C4    . DA  E  1 10  ? 102.556 -33.182  15.866  1.00 384.34 ? 10  DA  s C4    1 
ATOM 2343  P P     . DA  E  1 11  ? 104.048 -35.265  21.736  1.00 371.74 ? 11  DA  s P     1 
ATOM 2344  O OP1   . DA  E  1 11  ? 103.380 -36.017  22.826  1.00 369.49 ? 11  DA  s OP1   1 
ATOM 2345  O OP2   . DA  E  1 11  ? 104.615 -33.918  21.992  1.00 373.04 ? 11  DA  s OP2   1 
ATOM 2346  O "O5'" . DA  E  1 11  ? 105.195 -36.208  21.167  1.00 375.99 ? 11  DA  s "O5'" 1 
ATOM 2347  C "C5'" . DA  E  1 11  ? 104.972 -37.011  20.000  1.00 383.80 ? 11  DA  s "C5'" 1 
ATOM 2348  C "C4'" . DA  E  1 11  ? 106.091 -36.810  19.006  1.00 390.33 ? 11  DA  s "C4'" 1 
ATOM 2349  O "O4'" . DA  E  1 11  ? 105.758 -35.740  18.088  1.00 390.60 ? 11  DA  s "O4'" 1 
ATOM 2350  C "C3'" . DA  E  1 11  ? 107.439 -36.425  19.618  1.00 394.40 ? 11  DA  s "C3'" 1 
ATOM 2351  O "O3'" . DA  E  1 11  ? 108.462 -37.050  18.840  1.00 405.87 ? 11  DA  s "O3'" 1 
ATOM 2352  C "C2'" . DA  E  1 11  ? 107.505 -34.927  19.388  1.00 390.96 ? 11  DA  s "C2'" 1 
ATOM 2353  C "C1'" . DA  E  1 11  ? 106.861 -34.858  18.019  1.00 389.91 ? 11  DA  s "C1'" 1 
ATOM 2354  N N9    . DA  E  1 11  ? 106.378 -33.556  17.559  1.00 388.28 ? 11  DA  s N9    1 
ATOM 2355  C C8    . DA  E  1 11  ? 105.826 -32.518  18.269  1.00 385.61 ? 11  DA  s C8    1 
ATOM 2356  N N7    . DA  E  1 11  ? 105.498 -31.486  17.528  1.00 386.51 ? 11  DA  s N7    1 
ATOM 2357  C C5    . DA  E  1 11  ? 105.864 -31.869  16.244  1.00 390.22 ? 11  DA  s C5    1 
ATOM 2358  C C6    . DA  E  1 11  ? 105.788 -31.213  14.999  1.00 393.22 ? 11  DA  s C6    1 
ATOM 2359  N N6    . DA  E  1 11  ? 105.292 -29.985  14.839  1.00 395.33 ? 11  DA  s N6    1 
ATOM 2360  N N1    . DA  E  1 11  ? 106.246 -31.874  13.912  1.00 393.72 ? 11  DA  s N1    1 
ATOM 2361  C C2    . DA  E  1 11  ? 106.750 -33.104  14.075  1.00 392.77 ? 11  DA  s C2    1 
ATOM 2362  N N3    . DA  E  1 11  ? 106.867 -33.828  15.187  1.00 391.32 ? 11  DA  s N3    1 
ATOM 2363  C C4    . DA  E  1 11  ? 106.408 -33.141  16.249  1.00 389.99 ? 11  DA  s C4    1 
ATOM 2364  P P     . DA  E  1 12  ? 109.745 -37.657  19.557  1.00 415.66 ? 12  DA  s P     1 
ATOM 2365  O OP1   . DA  E  1 12  ? 109.387 -39.003  20.073  1.00 415.62 ? 12  DA  s OP1   1 
ATOM 2366  O OP2   . DA  E  1 12  ? 110.273 -36.627  20.483  1.00 414.78 ? 12  DA  s OP2   1 
ATOM 2367  O "O5'" . DA  E  1 12  ? 110.802 -37.834  18.377  1.00 425.09 ? 12  DA  s "O5'" 1 
ATOM 2368  C "C5'" . DA  E  1 12  ? 110.413 -38.026  17.002  1.00 434.14 ? 12  DA  s "C5'" 1 
ATOM 2369  C "C4'" . DA  E  1 12  ? 111.225 -37.134  16.088  1.00 440.81 ? 12  DA  s "C4'" 1 
ATOM 2370  O "O4'" . DA  E  1 12  ? 110.560 -35.855  15.939  1.00 448.69 ? 12  DA  s "O4'" 1 
ATOM 2371  C "C3'" . DA  E  1 12  ? 112.653 -36.818  16.553  1.00 439.05 ? 12  DA  s "C3'" 1 
ATOM 2372  O "O3'" . DA  E  1 12  ? 113.547 -36.817  15.425  1.00 429.23 ? 12  DA  s "O3'" 1 
ATOM 2373  C "C2'" . DA  E  1 12  ? 112.529 -35.412  17.116  1.00 446.47 ? 12  DA  s "C2'" 1 
ATOM 2374  C "C1'" . DA  E  1 12  ? 111.497 -34.817  16.174  1.00 454.61 ? 12  DA  s "C1'" 1 
ATOM 2375  N N9    . DA  E  1 12  ? 110.764 -33.641  16.645  1.00 463.16 ? 12  DA  s N9    1 
ATOM 2376  C C8    . DA  E  1 12  ? 110.380 -33.304  17.921  1.00 461.46 ? 12  DA  s C8    1 
ATOM 2377  N N7    . DA  E  1 12  ? 109.729 -32.168  17.994  1.00 463.93 ? 12  DA  s N7    1 
ATOM 2378  C C5    . DA  E  1 12  ? 109.674 -31.730  16.677  1.00 472.55 ? 12  DA  s C5    1 
ATOM 2379  C C6    . DA  E  1 12  ? 109.117 -30.582  16.082  1.00 478.79 ? 12  DA  s C6    1 
ATOM 2380  N N6    . DA  E  1 12  ? 108.477 -29.629  16.764  1.00 481.81 ? 12  DA  s N6    1 
ATOM 2381  N N1    . DA  E  1 12  ? 109.248 -30.442  14.744  1.00 482.09 ? 12  DA  s N1    1 
ATOM 2382  C C2    . DA  E  1 12  ? 109.891 -31.398  14.059  1.00 478.75 ? 12  DA  s C2    1 
ATOM 2383  N N3    . DA  E  1 12  ? 110.451 -32.521  14.504  1.00 476.49 ? 12  DA  s N3    1 
ATOM 2384  C C4    . DA  E  1 12  ? 110.309 -32.627  15.837  1.00 471.23 ? 12  DA  s C4    1 
ATOM 2385  P P     . DA  E  1 13  ? 115.093 -37.260  15.581  1.00 422.49 ? 13  DA  s P     1 
ATOM 2386  O OP1   . DA  E  1 13  ? 115.197 -38.702  15.234  1.00 421.86 ? 13  DA  s OP1   1 
ATOM 2387  O OP2   . DA  E  1 13  ? 115.589 -36.785  16.898  1.00 417.37 ? 13  DA  s OP2   1 
ATOM 2388  O "O5'" . DA  E  1 13  ? 115.834 -36.421  14.445  1.00 432.20 ? 13  DA  s "O5'" 1 
ATOM 2389  C "C5'" . DA  E  1 13  ? 115.203 -36.146  13.175  1.00 448.72 ? 13  DA  s "C5'" 1 
ATOM 2390  C "C4'" . DA  E  1 13  ? 115.373 -34.694  12.782  1.00 462.62 ? 13  DA  s "C4'" 1 
ATOM 2391  O "O4'" . DA  E  1 13  ? 114.498 -33.836  13.560  1.00 466.81 ? 13  DA  s "O4'" 1 
ATOM 2392  C "C3'" . DA  E  1 13  ? 116.778 -34.108  12.953  1.00 470.45 ? 13  DA  s "C3'" 1 
ATOM 2393  O "O3'" . DA  E  1 13  ? 116.973 -33.162  11.896  1.00 478.36 ? 13  DA  s "O3'" 1 
ATOM 2394  C "C2'" . DA  E  1 13  ? 116.655 -33.311  14.238  1.00 470.53 ? 13  DA  s "C2'" 1 
ATOM 2395  C "C1'" . DA  E  1 13  ? 115.267 -32.740  14.032  1.00 473.57 ? 13  DA  s "C1'" 1 
ATOM 2396  N N9    . DA  E  1 13  ? 114.585 -32.159  15.192  1.00 481.10 ? 13  DA  s N9    1 
ATOM 2397  C C8    . DA  E  1 13  ? 114.580 -32.571  16.503  1.00 483.63 ? 13  DA  s C8    1 
ATOM 2398  N N7    . DA  E  1 13  ? 113.850 -31.819  17.291  1.00 487.10 ? 13  DA  s N7    1 
ATOM 2399  C C5    . DA  E  1 13  ? 113.342 -30.844  16.443  1.00 490.62 ? 13  DA  s C5    1 
ATOM 2400  C C6    . DA  E  1 13  ? 112.487 -29.747  16.664  1.00 495.09 ? 13  DA  s C6    1 
ATOM 2401  N N6    . DA  E  1 13  ? 111.980 -29.432  17.858  1.00 496.95 ? 13  DA  s N6    1 
ATOM 2402  N N1    . DA  E  1 13  ? 112.177 -28.968  15.603  1.00 498.64 ? 13  DA  s N1    1 
ATOM 2403  C C2    . DA  E  1 13  ? 112.685 -29.286  14.405  1.00 496.01 ? 13  DA  s C2    1 
ATOM 2404  N N3    . DA  E  1 13  ? 113.492 -30.292  14.071  1.00 492.11 ? 13  DA  s N3    1 
ATOM 2405  C C4    . DA  E  1 13  ? 113.786 -31.042  15.148  1.00 487.96 ? 13  DA  s C4    1 
ATOM 2406  P P     . DA  E  1 14  ? 118.391 -33.032  11.159  1.00 484.54 ? 14  DA  s P     1 
ATOM 2407  O OP1   . DA  E  1 14  ? 118.387 -33.962  10.000  1.00 485.99 ? 14  DA  s OP1   1 
ATOM 2408  O OP2   . DA  E  1 14  ? 119.453 -33.152  12.189  1.00 486.97 ? 14  DA  s OP2   1 
ATOM 2409  O "O5'" . DA  E  1 14  ? 118.413 -31.517  10.656  1.00 481.40 ? 14  DA  s "O5'" 1 
ATOM 2410  C "C5'" . DA  E  1 14  ? 117.346 -30.953  9.866   1.00 473.33 ? 14  DA  s "C5'" 1 
ATOM 2411  C "C4'" . DA  E  1 14  ? 117.167 -29.481  10.166  1.00 467.10 ? 14  DA  s "C4'" 1 
ATOM 2412  O "O4'" . DA  E  1 14  ? 116.534 -29.302  11.458  1.00 462.01 ? 14  DA  s "O4'" 1 
ATOM 2413  C "C3'" . DA  E  1 14  ? 118.448 -28.648  10.230  1.00 465.05 ? 14  DA  s "C3'" 1 
ATOM 2414  O "O3'" . DA  E  1 14  ? 118.111 -27.300  9.875   1.00 461.37 ? 14  DA  s "O3'" 1 
ATOM 2415  C "C2'" . DA  E  1 14  ? 118.746 -28.623  11.717  1.00 461.38 ? 14  DA  s "C2'" 1 
ATOM 2416  C "C1'" . DA  E  1 14  ? 117.337 -28.427  12.236  1.00 454.49 ? 14  DA  s "C1'" 1 
ATOM 2417  N N9    . DA  E  1 14  ? 117.111 -28.741  13.642  1.00 442.29 ? 14  DA  s N9    1 
ATOM 2418  C C8    . DA  E  1 14  ? 117.627 -29.772  14.387  1.00 437.89 ? 14  DA  s C8    1 
ATOM 2419  N N7    . DA  E  1 14  ? 117.208 -29.789  15.628  1.00 433.87 ? 14  DA  s N7    1 
ATOM 2420  C C5    . DA  E  1 14  ? 116.357 -28.695  15.707  1.00 433.23 ? 14  DA  s C5    1 
ATOM 2421  C C6    . DA  E  1 14  ? 115.592 -28.165  16.761  1.00 432.28 ? 14  DA  s C6    1 
ATOM 2422  N N6    . DA  E  1 14  ? 115.562 -28.687  17.990  1.00 433.46 ? 14  DA  s N6    1 
ATOM 2423  N N1    . DA  E  1 14  ? 114.849 -27.065  16.507  1.00 431.68 ? 14  DA  s N1    1 
ATOM 2424  C C2    . DA  E  1 14  ? 114.881 -26.541  15.274  1.00 430.47 ? 14  DA  s C2    1 
ATOM 2425  N N3    . DA  E  1 14  ? 115.555 -26.951  14.202  1.00 432.07 ? 14  DA  s N3    1 
ATOM 2426  C C4    . DA  E  1 14  ? 116.283 -28.044  14.489  1.00 435.24 ? 14  DA  s C4    1 
ATOM 2427  P P     . DA  E  1 15  ? 119.210 -26.322  9.238   1.00 458.49 ? 15  DA  s P     1 
ATOM 2428  O OP1   . DA  E  1 15  ? 118.964 -26.251  7.775   1.00 456.36 ? 15  DA  s OP1   1 
ATOM 2429  O OP2   . DA  E  1 15  ? 120.544 -26.745  9.736   1.00 461.33 ? 15  DA  s OP2   1 
ATOM 2430  O "O5'" . DA  E  1 15  ? 118.904 -24.901  9.902   1.00 456.99 ? 15  DA  s "O5'" 1 
ATOM 2431  C "C5'" . DA  E  1 15  ? 117.587 -24.300  9.902   1.00 454.08 ? 15  DA  s "C5'" 1 
ATOM 2432  C "C4'" . DA  E  1 15  ? 117.450 -23.269  11.005  1.00 451.81 ? 15  DA  s "C4'" 1 
ATOM 2433  O "O4'" . DA  E  1 15  ? 117.318 -23.919  12.294  1.00 444.29 ? 15  DA  s "O4'" 1 
ATOM 2434  C "C3'" . DA  E  1 15  ? 118.616 -22.295  11.171  1.00 455.83 ? 15  DA  s "C3'" 1 
ATOM 2435  O "O3'" . DA  E  1 15  ? 118.094 -21.108  11.773  1.00 464.32 ? 15  DA  s "O3'" 1 
ATOM 2436  C "C2'" . DA  E  1 15  ? 119.456 -22.973  12.235  1.00 448.84 ? 15  DA  s "C2'" 1 
ATOM 2437  C "C1'" . DA  E  1 15  ? 118.355 -23.463  13.152  1.00 441.45 ? 15  DA  s "C1'" 1 
ATOM 2438  N N9    . DA  E  1 15  ? 118.708 -24.560  14.044  1.00 436.24 ? 15  DA  s N9    1 
ATOM 2439  C C8    . DA  E  1 15  ? 119.499 -25.658  13.809  1.00 434.67 ? 15  DA  s C8    1 
ATOM 2440  N N7    . DA  E  1 15  ? 119.585 -26.475  14.830  1.00 434.14 ? 15  DA  s N7    1 
ATOM 2441  C C5    . DA  E  1 15  ? 118.789 -25.880  15.799  1.00 436.75 ? 15  DA  s C5    1 
ATOM 2442  C C6    . DA  E  1 15  ? 118.462 -26.251  17.115  1.00 440.14 ? 15  DA  s C6    1 
ATOM 2443  N N6    . DA  E  1 15  ? 118.921 -27.355  17.710  1.00 443.58 ? 15  DA  s N6    1 
ATOM 2444  N N1    . DA  E  1 15  ? 117.642 -25.434  17.813  1.00 442.10 ? 15  DA  s N1    1 
ATOM 2445  C C2    . DA  E  1 15  ? 117.190 -24.321  17.220  1.00 441.18 ? 15  DA  s C2    1 
ATOM 2446  N N3    . DA  E  1 15  ? 117.420 -23.869  15.990  1.00 437.12 ? 15  DA  s N3    1 
ATOM 2447  C C4    . DA  E  1 15  ? 118.237 -24.704  15.324  1.00 435.76 ? 15  DA  s C4    1 
ATOM 2448  P P     . DA  E  1 16  ? 118.816 -19.700  11.554  1.00 474.62 ? 16  DA  s P     1 
ATOM 2449  O OP1   . DA  E  1 16  ? 117.945 -18.872  10.685  1.00 478.34 ? 16  DA  s OP1   1 
ATOM 2450  O OP2   . DA  E  1 16  ? 120.224 -19.951  11.156  1.00 478.68 ? 16  DA  s OP2   1 
ATOM 2451  O "O5'" . DA  E  1 16  ? 118.870 -19.072  13.017  1.00 471.94 ? 16  DA  s "O5'" 1 
ATOM 2452  C "C5'" . DA  E  1 16  ? 117.784 -19.200  13.954  1.00 466.83 ? 16  DA  s "C5'" 1 
ATOM 2453  C "C4'" . DA  E  1 16  ? 118.247 -18.866  15.356  1.00 466.18 ? 16  DA  s "C4'" 1 
ATOM 2454  O "O4'" . DA  E  1 16  ? 118.610 -20.083  16.048  1.00 462.04 ? 16  DA  s "O4'" 1 
ATOM 2455  C "C3'" . DA  E  1 16  ? 119.475 -17.960  15.464  1.00 470.37 ? 16  DA  s "C3'" 1 
ATOM 2456  O "O3'" . DA  E  1 16  ? 119.410 -17.234  16.697  1.00 475.09 ? 16  DA  s "O3'" 1 
ATOM 2457  C "C2'" . DA  E  1 16  ? 120.610 -18.956  15.592  1.00 467.37 ? 16  DA  s "C2'" 1 
ATOM 2458  C "C1'" . DA  E  1 16  ? 119.955 -19.983  16.490  1.00 463.84 ? 16  DA  s "C1'" 1 
ATOM 2459  N N9    . DA  E  1 16  ? 120.536 -21.317  16.443  1.00 463.08 ? 16  DA  s N9    1 
ATOM 2460  C C8    . DA  E  1 16  ? 121.230 -21.937  15.434  1.00 461.95 ? 16  DA  s C8    1 
ATOM 2461  N N7    . DA  E  1 16  ? 121.611 -23.157  15.727  1.00 462.77 ? 16  DA  s N7    1 
ATOM 2462  C C5    . DA  E  1 16  ? 121.124 -23.357  17.012  1.00 466.21 ? 16  DA  s C5    1 
ATOM 2463  C C6    . DA  E  1 16  ? 121.196 -24.450  17.895  1.00 469.34 ? 16  DA  s C6    1 
ATOM 2464  N N6    . DA  E  1 16  ? 121.808 -25.601  17.602  1.00 472.45 ? 16  DA  s N6    1 
ATOM 2465  N N1    . DA  E  1 16  ? 120.608 -24.320  19.105  1.00 471.19 ? 16  DA  s N1    1 
ATOM 2466  C C2    . DA  E  1 16  ? 119.996 -23.165  19.399  1.00 469.51 ? 16  DA  s C2    1 
ATOM 2467  N N3    . DA  E  1 16  ? 119.869 -22.067  18.660  1.00 467.28 ? 16  DA  s N3    1 
ATOM 2468  C C4    . DA  E  1 16  ? 120.456 -22.233  17.462  1.00 465.10 ? 16  DA  s C4    1 
ATOM 2469  P P     . DA  E  1 17  ? 120.222 -15.862  16.866  1.00 479.71 ? 17  DA  s P     1 
ATOM 2470  O OP1   . DA  E  1 17  ? 119.366 -14.756  16.372  1.00 481.33 ? 17  DA  s OP1   1 
ATOM 2471  O OP2   . DA  E  1 17  ? 121.581 -16.053  16.295  1.00 481.67 ? 17  DA  s OP2   1 
ATOM 2472  O "O5'" . DA  E  1 17  ? 120.360 -15.686  18.444  1.00 474.84 ? 17  DA  s "O5'" 1 
ATOM 2473  C "C5'" . DA  E  1 17  ? 119.662 -16.534  19.372  1.00 463.32 ? 17  DA  s "C5'" 1 
ATOM 2474  C "C4'" . DA  E  1 17  ? 120.612 -17.020  20.441  1.00 455.63 ? 17  DA  s "C4'" 1 
ATOM 2475  O "O4'" . DA  E  1 17  ? 121.047 -18.365  20.124  1.00 449.19 ? 17  DA  s "O4'" 1 
ATOM 2476  C "C3'" . DA  E  1 17  ? 121.894 -16.190  20.606  1.00 456.38 ? 17  DA  s "C3'" 1 
ATOM 2477  O "O3'" . DA  E  1 17  ? 122.210 -16.045  21.997  1.00 454.87 ? 17  DA  s "O3'" 1 
ATOM 2478  C "C2'" . DA  E  1 17  ? 122.957 -17.066  19.969  1.00 453.39 ? 17  DA  s "C2'" 1 
ATOM 2479  C "C1'" . DA  E  1 17  ? 122.442 -18.435  20.346  1.00 444.85 ? 17  DA  s "C1'" 1 
ATOM 2480  N N9    . DA  E  1 17  ? 122.982 -19.538  19.557  1.00 435.31 ? 17  DA  s N9    1 
ATOM 2481  C C8    . DA  E  1 17  ? 123.514 -19.493  18.292  1.00 433.53 ? 17  DA  s C8    1 
ATOM 2482  N N7    . DA  E  1 17  ? 123.956 -20.649  17.862  1.00 429.58 ? 17  DA  s N7    1 
ATOM 2483  C C5    . DA  E  1 17  ? 123.712 -21.513  18.921  1.00 426.53 ? 17  DA  s C5    1 
ATOM 2484  C C6    . DA  E  1 17  ? 123.950 -22.889  19.096  1.00 423.69 ? 17  DA  s C6    1 
ATOM 2485  N N6    . DA  E  1 17  ? 124.511 -23.668  18.168  1.00 425.15 ? 17  DA  s N6    1 
ATOM 2486  N N1    . DA  E  1 17  ? 123.589 -23.445  20.274  1.00 419.80 ? 17  DA  s N1    1 
ATOM 2487  C C2    . DA  E  1 17  ? 123.030 -22.662  21.207  1.00 419.03 ? 17  DA  s C2    1 
ATOM 2488  N N3    . DA  E  1 17  ? 122.755 -21.360  21.160  1.00 421.98 ? 17  DA  s N3    1 
ATOM 2489  C C4    . DA  E  1 17  ? 123.123 -20.839  19.976  1.00 427.53 ? 17  DA  s C4    1 
ATOM 2490  P P     . DA  E  1 18  ? 123.276 -14.942  22.512  1.00 456.05 ? 18  DA  s P     1 
ATOM 2491  O OP1   . DA  E  1 18  ? 122.547 -13.665  22.713  1.00 457.40 ? 18  DA  s OP1   1 
ATOM 2492  O OP2   . DA  E  1 18  ? 124.477 -14.975  21.630  1.00 458.99 ? 18  DA  s OP2   1 
ATOM 2493  O "O5'" . DA  E  1 18  ? 123.707 -15.515  23.936  1.00 451.48 ? 18  DA  s "O5'" 1 
ATOM 2494  C "C5'" . DA  E  1 18  ? 122.863 -16.458  24.640  1.00 445.52 ? 18  DA  s "C5'" 1 
ATOM 2495  C "C4'" . DA  E  1 18  ? 123.673 -17.582  25.250  1.00 442.50 ? 18  DA  s "C4'" 1 
ATOM 2496  O "O4'" . DA  E  1 18  ? 124.012 -18.579  24.255  1.00 439.26 ? 18  DA  s "O4'" 1 
ATOM 2497  C "C3'" . DA  E  1 18  ? 125.002 -17.170  25.888  1.00 445.43 ? 18  DA  s "C3'" 1 
ATOM 2498  O "O3'" . DA  E  1 18  ? 125.257 -17.977  27.042  1.00 450.88 ? 18  DA  s "O3'" 1 
ATOM 2499  C "C2'" . DA  E  1 18  ? 126.021 -17.551  24.833  1.00 442.81 ? 18  DA  s "C2'" 1 
ATOM 2500  C "C1'" . DA  E  1 18  ? 125.406 -18.842  24.336  1.00 438.47 ? 18  DA  s "C1'" 1 
ATOM 2501  N N9    . DA  E  1 18  ? 125.858 -19.312  23.027  1.00 436.56 ? 18  DA  s N9    1 
ATOM 2502  C C8    . DA  E  1 18  ? 126.173 -18.588  21.903  1.00 437.37 ? 18  DA  s C8    1 
ATOM 2503  N N7    . DA  E  1 18  ? 126.541 -19.326  20.885  1.00 436.37 ? 18  DA  s N7    1 
ATOM 2504  C C5    . DA  E  1 18  ? 126.462 -20.625  21.370  1.00 434.37 ? 18  DA  s C5    1 
ATOM 2505  C C6    . DA  E  1 18  ? 126.719 -21.875  20.778  1.00 432.73 ? 18  DA  s C6    1 
ATOM 2506  N N6    . DA  E  1 18  ? 127.127 -22.027  19.516  1.00 433.03 ? 18  DA  s N6    1 
ATOM 2507  N N1    . DA  E  1 18  ? 126.545 -22.979  21.539  1.00 430.31 ? 18  DA  s N1    1 
ATOM 2508  C C2    . DA  E  1 18  ? 126.142 -22.825  22.807  1.00 429.14 ? 18  DA  s C2    1 
ATOM 2509  N N3    . DA  E  1 18  ? 125.863 -21.707  23.474  1.00 430.17 ? 18  DA  s N3    1 
ATOM 2510  C C4    . DA  E  1 18  ? 126.044 -20.630  22.689  1.00 433.67 ? 18  DA  s C4    1 
ATOM 2511  P P     . DA  E  1 19  ? 125.948 -17.327  28.324  1.00 460.10 ? 19  DA  s P     1 
ATOM 2512  O OP1   . DA  E  1 19  ? 124.885 -16.661  29.123  1.00 459.24 ? 19  DA  s OP1   1 
ATOM 2513  O OP2   . DA  E  1 19  ? 127.124 -16.540  27.863  1.00 463.46 ? 19  DA  s OP2   1 
ATOM 2514  O "O5'" . DA  E  1 19  ? 126.505 -18.580  29.136  1.00 465.14 ? 19  DA  s "O5'" 1 
ATOM 2515  C "C5'" . DA  E  1 19  ? 125.970 -19.911  28.984  1.00 468.28 ? 19  DA  s "C5'" 1 
ATOM 2516  C "C4'" . DA  E  1 19  ? 127.091 -20.919  28.866  1.00 471.97 ? 19  DA  s "C4'" 1 
ATOM 2517  O "O4'" . DA  E  1 19  ? 127.372 -21.139  27.466  1.00 470.77 ? 19  DA  s "O4'" 1 
ATOM 2518  C "C3'" . DA  E  1 19  ? 128.432 -20.510  29.488  1.00 476.77 ? 19  DA  s "C3'" 1 
ATOM 2519  O "O3'" . DA  E  1 19  ? 129.147 -21.655  29.980  1.00 478.19 ? 19  DA  s "O3'" 1 
ATOM 2520  C "C2'" . DA  E  1 19  ? 129.212 -19.999  28.295  1.00 476.99 ? 19  DA  s "C2'" 1 
ATOM 2521  C "C1'" . DA  E  1 19  ? 128.769 -21.023  27.281  1.00 475.09 ? 19  DA  s "C1'" 1 
ATOM 2522  N N9    . DA  E  1 19  ? 129.012 -20.692  25.885  1.00 480.08 ? 19  DA  s N9    1 
ATOM 2523  C C8    . DA  E  1 19  ? 129.066 -19.467  25.266  1.00 484.06 ? 19  DA  s C8    1 
ATOM 2524  N N7    . DA  E  1 19  ? 129.313 -19.536  23.981  1.00 489.69 ? 19  DA  s N7    1 
ATOM 2525  C C5    . DA  E  1 19  ? 129.419 -20.898  23.735  1.00 490.51 ? 19  DA  s C5    1 
ATOM 2526  C C6    . DA  E  1 19  ? 129.673 -21.633  22.563  1.00 494.54 ? 19  DA  s C6    1 
ATOM 2527  N N6    . DA  E  1 19  ? 129.871 -21.074  21.367  1.00 498.78 ? 19  DA  s N6    1 
ATOM 2528  N N1    . DA  E  1 19  ? 129.719 -22.980  22.664  1.00 493.93 ? 19  DA  s N1    1 
ATOM 2529  C C2    . DA  E  1 19  ? 129.536 -23.539  23.868  1.00 490.25 ? 19  DA  s C2    1 
ATOM 2530  N N3    . DA  E  1 19  ? 129.280 -22.957  25.037  1.00 484.89 ? 19  DA  s N3    1 
ATOM 2531  C C4    . DA  E  1 19  ? 129.238 -21.620  24.900  1.00 484.81 ? 19  DA  s C4    1 
ATOM 2532  P P     . DA  E  1 20  ? 130.290 -21.469  31.095  1.00 480.85 ? 20  DA  s P     1 
ATOM 2533  O OP1   . DA  E  1 20  ? 129.641 -21.475  32.430  1.00 481.95 ? 20  DA  s OP1   1 
ATOM 2534  O OP2   . DA  E  1 20  ? 131.149 -20.319  30.697  1.00 485.28 ? 20  DA  s OP2   1 
ATOM 2535  O "O5'" . DA  E  1 20  ? 131.184 -22.783  30.970  1.00 473.98 ? 20  DA  s "O5'" 1 
ATOM 2536  C "C5'" . DA  E  1 20  ? 130.644 -24.092  30.690  1.00 464.37 ? 20  DA  s "C5'" 1 
ATOM 2537  C "C4'" . DA  E  1 20  ? 131.683 -24.929  29.976  1.00 462.56 ? 20  DA  s "C4'" 1 
ATOM 2538  O "O4'" . DA  E  1 20  ? 131.688 -24.565  28.574  1.00 463.48 ? 20  DA  s "O4'" 1 
ATOM 2539  C "C3'" . DA  E  1 20  ? 133.124 -24.723  30.455  1.00 463.79 ? 20  DA  s "C3'" 1 
ATOM 2540  O "O3'" . DA  E  1 20  ? 133.940 -25.888  30.280  1.00 461.04 ? 20  DA  s "O3'" 1 
ATOM 2541  C "C2'" . DA  E  1 20  ? 133.649 -23.678  29.494  1.00 469.32 ? 20  DA  s "C2'" 1 
ATOM 2542  C "C1'" . DA  E  1 20  ? 132.980 -24.116  28.206  1.00 471.62 ? 20  DA  s "C1'" 1 
ATOM 2543  N N9    . DA  E  1 20  ? 132.823 -23.055  27.217  1.00 478.92 ? 20  DA  s N9    1 
ATOM 2544  C C8    . DA  E  1 20  ? 132.492 -21.737  27.417  1.00 482.07 ? 20  DA  s C8    1 
ATOM 2545  N N7    . DA  E  1 20  ? 132.442 -21.032  26.313  1.00 487.37 ? 20  DA  s N7    1 
ATOM 2546  C C5    . DA  E  1 20  ? 132.751 -21.949  25.318  1.00 490.27 ? 20  DA  s C5    1 
ATOM 2547  C C6    . DA  E  1 20  ? 132.867 -21.828  23.921  1.00 496.36 ? 20  DA  s C6    1 
ATOM 2548  N N6    . DA  E  1 20  ? 132.675 -20.685  23.258  1.00 505.69 ? 20  DA  s N6    1 
ATOM 2549  N N1    . DA  E  1 20  ? 133.196 -22.936  23.221  1.00 495.28 ? 20  DA  s N1    1 
ATOM 2550  C C2    . DA  E  1 20  ? 133.405 -24.078  23.889  1.00 489.72 ? 20  DA  s C2    1 
ATOM 2551  N N3    . DA  E  1 20  ? 133.322 -24.318  25.196  1.00 485.62 ? 20  DA  s N3    1 
ATOM 2552  C C4    . DA  E  1 20  ? 132.988 -23.199  25.861  1.00 484.76 ? 20  DA  s C4    1 
ATOM 2553  P P     . DA  E  1 21  ? 135.228 -26.124  31.225  1.00 460.13 ? 21  DA  s P     1 
ATOM 2554  O OP1   . DA  E  1 21  ? 134.962 -27.305  32.079  1.00 454.84 ? 21  DA  s OP1   1 
ATOM 2555  O OP2   . DA  E  1 21  ? 135.589 -24.830  31.851  1.00 458.60 ? 21  DA  s OP2   1 
ATOM 2556  O "O5'" . DA  E  1 21  ? 136.407 -26.452  30.204  1.00 472.29 ? 21  DA  s "O5'" 1 
ATOM 2557  C "C5'" . DA  E  1 21  ? 136.353 -27.567  29.293  1.00 488.43 ? 21  DA  s "C5'" 1 
ATOM 2558  C "C4'" . DA  E  1 21  ? 137.236 -27.319  28.090  1.00 500.79 ? 21  DA  s "C4'" 1 
ATOM 2559  O "O4'" . DA  E  1 21  ? 136.715 -26.205  27.320  1.00 502.96 ? 21  DA  s "O4'" 1 
ATOM 2560  C "C3'" . DA  E  1 21  ? 138.694 -26.959  28.399  1.00 506.85 ? 21  DA  s "C3'" 1 
ATOM 2561  O "O3'" . DA  E  1 21  ? 139.574 -27.435  27.360  1.00 509.28 ? 21  DA  s "O3'" 1 
ATOM 2562  C "C2'" . DA  E  1 21  ? 138.673 -25.445  28.336  1.00 507.72 ? 21  DA  s "C2'" 1 
ATOM 2563  C "C1'" . DA  E  1 21  ? 137.756 -25.262  27.141  1.00 504.26 ? 21  DA  s "C1'" 1 
ATOM 2564  N N9    . DA  E  1 21  ? 137.154 -23.942  26.972  1.00 501.13 ? 21  DA  s N9    1 
ATOM 2565  C C8    . DA  E  1 21  ? 136.681 -23.069  27.921  1.00 500.54 ? 21  DA  s C8    1 
ATOM 2566  N N7    . DA  E  1 21  ? 136.214 -21.949  27.425  1.00 499.73 ? 21  DA  s N7    1 
ATOM 2567  C C5    . DA  E  1 21  ? 136.395 -22.091  26.056  1.00 499.29 ? 21  DA  s C5    1 
ATOM 2568  C C6    . DA  E  1 21  ? 136.116 -21.243  24.970  1.00 500.11 ? 21  DA  s C6    1 
ATOM 2569  N N6    . DA  E  1 21  ? 135.560 -20.036  25.098  1.00 504.05 ? 21  DA  s N6    1 
ATOM 2570  N N1    . DA  E  1 21  ? 136.428 -21.685  23.731  1.00 497.43 ? 21  DA  s N1    1 
ATOM 2571  C C2    . DA  E  1 21  ? 136.990 -22.895  23.604  1.00 493.83 ? 21  DA  s C2    1 
ATOM 2572  N N3    . DA  E  1 21  ? 137.298 -23.783  24.546  1.00 492.87 ? 21  DA  s N3    1 
ATOM 2573  C C4    . DA  E  1 21  ? 136.972 -23.315  25.763  1.00 497.91 ? 21  DA  s C4    1 
ATOM 2574  P P     . DA  E  1 22  ? 141.136 -27.746  27.665  1.00 510.31 ? 22  DA  s P     1 
ATOM 2575  O OP1   . DA  E  1 22  ? 141.320 -29.222  27.699  1.00 510.22 ? 22  DA  s OP1   1 
ATOM 2576  O OP2   . DA  E  1 22  ? 141.556 -26.924  28.830  1.00 511.38 ? 22  DA  s OP2   1 
ATOM 2577  O "O5'" . DA  E  1 22  ? 141.894 -27.182  26.380  1.00 511.51 ? 22  DA  s "O5'" 1 
ATOM 2578  C "C5'" . DA  E  1 22  ? 141.490 -27.540  25.043  1.00 514.97 ? 22  DA  s "C5'" 1 
ATOM 2579  C "C4'" . DA  E  1 22  ? 141.913 -26.463  24.071  1.00 521.47 ? 22  DA  s "C4'" 1 
ATOM 2580  O "O4'" . DA  E  1 22  ? 141.068 -25.297  24.247  1.00 526.06 ? 22  DA  s "O4'" 1 
ATOM 2581  C "C3'" . DA  E  1 22  ? 143.351 -25.963  24.255  1.00 524.26 ? 22  DA  s "C3'" 1 
ATOM 2582  O "O3'" . DA  E  1 22  ? 143.944 -25.584  22.999  1.00 519.75 ? 22  DA  s "O3'" 1 
ATOM 2583  C "C2'" . DA  E  1 22  ? 143.163 -24.713  25.091  1.00 531.67 ? 22  DA  s "C2'" 1 
ATOM 2584  C "C1'" . DA  E  1 22  ? 141.895 -24.165  24.465  1.00 539.52 ? 22  DA  s "C1'" 1 
ATOM 2585  N N9    . DA  E  1 22  ? 141.159 -23.207  25.290  1.00 554.74 ? 22  DA  s N9    1 
ATOM 2586  C C8    . DA  E  1 22  ? 140.951 -23.235  26.647  1.00 562.33 ? 22  DA  s C8    1 
ATOM 2587  N N7    . DA  E  1 22  ? 140.275 -22.207  27.100  1.00 567.02 ? 22  DA  s N7    1 
ATOM 2588  C C5    . DA  E  1 22  ? 140.033 -21.442  25.966  1.00 566.19 ? 22  DA  s C5    1 
ATOM 2589  C C6    . DA  E  1 22  ? 139.360 -20.219  25.773  1.00 567.55 ? 22  DA  s C6    1 
ATOM 2590  N N6    . DA  E  1 22  ? 138.781 -19.526  26.757  1.00 568.36 ? 22  DA  s N6    1 
ATOM 2591  N N1    . DA  E  1 22  ? 139.303 -19.727  24.515  1.00 567.07 ? 22  DA  s N1    1 
ATOM 2592  C C2    . DA  E  1 22  ? 139.895 -20.416  23.530  1.00 562.48 ? 22  DA  s C2    1 
ATOM 2593  N N3    . DA  E  1 22  ? 140.542 -21.579  23.584  1.00 559.95 ? 22  DA  s N3    1 
ATOM 2594  C C4    . DA  E  1 22  ? 140.581 -22.042  24.846  1.00 561.35 ? 22  DA  s C4    1 
ATOM 2595  P P     . DA  E  1 23  ? 145.550 -25.431  22.845  1.00 518.66 ? 23  DA  s P     1 
ATOM 2596  O OP1   . DA  E  1 23  ? 146.013 -26.424  21.837  1.00 521.91 ? 23  DA  s OP1   1 
ATOM 2597  O OP2   . DA  E  1 23  ? 146.154 -25.435  24.206  1.00 518.64 ? 23  DA  s OP2   1 
ATOM 2598  O "O5'" . DA  E  1 23  ? 145.740 -23.966  22.235  1.00 513.35 ? 23  DA  s "O5'" 1 
ATOM 2599  C "C5'" . DA  E  1 23  ? 145.170 -23.566  20.963  1.00 503.12 ? 23  DA  s "C5'" 1 
ATOM 2600  C "C4'" . DA  E  1 23  ? 145.240 -22.064  20.770  1.00 498.55 ? 23  DA  s "C4'" 1 
ATOM 2601  O "O4'" . DA  E  1 23  ? 144.330 -21.389  21.678  1.00 492.11 ? 23  DA  s "O4'" 1 
ATOM 2602  C "C3'" . DA  E  1 23  ? 146.607 -21.410  20.997  1.00 502.78 ? 23  DA  s "C3'" 1 
ATOM 2603  O "O3'" . DA  E  1 23  ? 146.763 -20.286  20.123  1.00 506.40 ? 23  DA  s "O3'" 1 
ATOM 2604  C "C2'" . DA  E  1 23  ? 146.483 -20.857  22.403  1.00 501.90 ? 23  DA  s "C2'" 1 
ATOM 2605  C "C1'" . DA  E  1 23  ? 145.043 -20.384  22.390  1.00 498.95 ? 23  DA  s "C1'" 1 
ATOM 2606  N N9    . DA  E  1 23  ? 144.433 -20.244  23.711  1.00 503.67 ? 23  DA  s N9    1 
ATOM 2607  C C8    . DA  E  1 23  ? 144.572 -21.074  24.797  1.00 507.78 ? 23  DA  s C8    1 
ATOM 2608  N N7    . DA  E  1 23  ? 143.899 -20.682  25.850  1.00 511.50 ? 23  DA  s N7    1 
ATOM 2609  C C5    . DA  E  1 23  ? 143.268 -19.519  25.430  1.00 511.82 ? 23  DA  s C5    1 
ATOM 2610  C C6    . DA  E  1 23  ? 142.403 -18.621  26.082  1.00 514.52 ? 23  DA  s C6    1 
ATOM 2611  N N6    . DA  E  1 23  ? 142.006 -18.763  27.350  1.00 516.18 ? 23  DA  s N6    1 
ATOM 2612  N N1    . DA  E  1 23  ? 141.962 -17.554  25.382  1.00 513.85 ? 23  DA  s N1    1 
ATOM 2613  C C2    . DA  E  1 23  ? 142.379 -17.399  24.119  1.00 510.36 ? 23  DA  s C2    1 
ATOM 2614  N N3    . DA  E  1 23  ? 143.177 -18.179  23.393  1.00 506.53 ? 23  DA  s N3    1 
ATOM 2615  C C4    . DA  E  1 23  ? 143.595 -19.233  24.116  1.00 507.37 ? 23  DA  s C4    1 
ATOM 2616  P P     . DA  E  1 24  ? 148.214 -19.876  19.576  1.00 513.88 ? 24  DA  s P     1 
ATOM 2617  O OP1   . DA  E  1 24  ? 148.148 -19.843  18.097  1.00 515.71 ? 24  DA  s OP1   1 
ATOM 2618  O OP2   . DA  E  1 24  ? 149.222 -20.746  20.232  1.00 515.08 ? 24  DA  s OP2   1 
ATOM 2619  O "O5'" . DA  E  1 24  ? 148.418 -18.389  20.125  1.00 520.20 ? 24  DA  s "O5'" 1 
ATOM 2620  C "C5'" . DA  E  1 24  ? 147.646 -17.265  19.630  1.00 525.61 ? 24  DA  s "C5'" 1 
ATOM 2621  C "C4'" . DA  E  1 24  ? 147.678 -16.074  20.569  1.00 530.19 ? 24  DA  s "C4'" 1 
ATOM 2622  O "O4'" . DA  E  1 24  ? 146.840 -16.308  21.735  1.00 525.41 ? 24  DA  s "O4'" 1 
ATOM 2623  C "C3'" . DA  E  1 24  ? 149.052 -15.643  21.114  1.00 536.52 ? 24  DA  s "C3'" 1 
ATOM 2624  O "O3'" . DA  E  1 24  ? 149.195 -14.206  21.168  1.00 541.04 ? 24  DA  s "O3'" 1 
ATOM 2625  C "C2'" . DA  E  1 24  ? 149.002 -16.112  22.555  1.00 533.68 ? 24  DA  s "C2'" 1 
ATOM 2626  C "C1'" . DA  E  1 24  ? 147.545 -15.847  22.873  1.00 525.33 ? 24  DA  s "C1'" 1 
ATOM 2627  N N9    . DA  E  1 24  ? 147.048 -16.553  24.053  1.00 516.77 ? 24  DA  s N9    1 
ATOM 2628  C C8    . DA  E  1 24  ? 147.470 -17.758  24.559  1.00 515.64 ? 24  DA  s C8    1 
ATOM 2629  N N7    . DA  E  1 24  ? 146.869 -18.105  25.670  1.00 510.68 ? 24  DA  s N7    1 
ATOM 2630  C C5    . DA  E  1 24  ? 146.005 -17.048  25.923  1.00 507.04 ? 24  DA  s C5    1 
ATOM 2631  C C6    . DA  E  1 24  ? 145.087 -16.806  26.959  1.00 502.70 ? 24  DA  s C6    1 
ATOM 2632  N N6    . DA  E  1 24  ? 144.879 -17.646  27.975  1.00 499.21 ? 24  DA  s N6    1 
ATOM 2633  N N1    . DA  E  1 24  ? 144.382 -15.654  26.916  1.00 501.38 ? 24  DA  s N1    1 
ATOM 2634  C C2    . DA  E  1 24  ? 144.598 -14.808  25.901  1.00 502.52 ? 24  DA  s C2    1 
ATOM 2635  N N3    . DA  E  1 24  ? 145.430 -14.925  24.868  1.00 504.80 ? 24  DA  s N3    1 
ATOM 2636  C C4    . DA  E  1 24  ? 146.112 -16.081  24.940  1.00 509.47 ? 24  DA  s C4    1 
ATOM 2637  P P     . DA  E  1 25  ? 150.602 -13.491  21.607  1.00 544.04 ? 25  DA  s P     1 
ATOM 2638  O OP1   . DA  E  1 25  ? 151.253 -13.000  20.371  1.00 547.09 ? 25  DA  s OP1   1 
ATOM 2639  O OP2   . DA  E  1 25  ? 151.357 -14.405  22.502  1.00 545.17 ? 25  DA  s OP2   1 
ATOM 2640  O "O5'" . DA  E  1 25  ? 150.145 -12.245  22.502  1.00 536.99 ? 25  DA  s "O5'" 1 
ATOM 2641  C "C5'" . DA  E  1 25  ? 148.834 -11.659  22.350  1.00 522.59 ? 25  DA  s "C5'" 1 
ATOM 2642  C "C4'" . DA  E  1 25  ? 148.497 -10.621  23.401  1.00 511.39 ? 25  DA  s "C4'" 1 
ATOM 2643  O "O4'" . DA  E  1 25  ? 147.864 -11.294  24.503  1.00 504.21 ? 25  DA  s "O4'" 1 
ATOM 2644  C "C3'" . DA  E  1 25  ? 149.641 -9.827   24.033  1.00 509.31 ? 25  DA  s "C3'" 1 
ATOM 2645  O "O3'" . DA  E  1 25  ? 149.193 -8.599   24.641  1.00 502.78 ? 25  DA  s "O3'" 1 
ATOM 2646  C "C2'" . DA  E  1 25  ? 150.071 -10.738  25.161  1.00 506.96 ? 25  DA  s "C2'" 1 
ATOM 2647  C "C1'" . DA  E  1 25  ? 148.722 -11.254  25.633  1.00 504.06 ? 25  DA  s "C1'" 1 
ATOM 2648  N N9    . DA  E  1 25  ? 148.742 -12.587  26.210  1.00 503.12 ? 25  DA  s N9    1 
ATOM 2649  C C8    . DA  E  1 25  ? 149.507 -13.683  25.898  1.00 503.41 ? 25  DA  s C8    1 
ATOM 2650  N N7    . DA  E  1 25  ? 149.235 -14.741  26.622  1.00 503.82 ? 25  DA  s N7    1 
ATOM 2651  C C5    . DA  E  1 25  ? 148.228 -14.309  27.474  1.00 505.52 ? 25  DA  s C5    1 
ATOM 2652  C C6    . DA  E  1 25  ? 147.513 -14.952  28.497  1.00 507.68 ? 25  DA  s C6    1 
ATOM 2653  N N6    . DA  E  1 25  ? 147.703 -16.226  28.848  1.00 510.34 ? 25  DA  s N6    1 
ATOM 2654  N N1    . DA  E  1 25  ? 146.574 -14.235  29.153  1.00 509.11 ? 25  DA  s N1    1 
ATOM 2655  C C2    . DA  E  1 25  ? 146.365 -12.965  28.786  1.00 509.31 ? 25  DA  s C2    1 
ATOM 2656  N N3    . DA  E  1 25  ? 146.973 -12.250  27.845  1.00 507.12 ? 25  DA  s N3    1 
ATOM 2657  C C4    . DA  E  1 25  ? 147.901 -12.991  27.215  1.00 504.32 ? 25  DA  s C4    1 
ATOM 2658  P P     . DA  E  1 26  ? 150.111 -7.290   24.522  1.00 503.07 ? 26  DA  s P     1 
ATOM 2659  O OP1   . DA  E  1 26  ? 149.831 -6.647   23.212  1.00 505.87 ? 26  DA  s OP1   1 
ATOM 2660  O OP2   . DA  E  1 26  ? 151.496 -7.670   24.895  1.00 505.19 ? 26  DA  s OP2   1 
ATOM 2661  O "O5'" . DA  E  1 26  ? 149.596 -6.266   25.631  1.00 497.01 ? 26  DA  s "O5'" 1 
ATOM 2662  C "C5'" . DA  E  1 26  ? 148.444 -6.465   26.451  1.00 485.05 ? 26  DA  s "C5'" 1 
ATOM 2663  C "C4'" . DA  E  1 26  ? 148.836 -6.362   27.906  1.00 480.84 ? 26  DA  s "C4'" 1 
ATOM 2664  O "O4'" . DA  E  1 26  ? 148.908 -7.701   28.429  1.00 477.01 ? 26  DA  s "O4'" 1 
ATOM 2665  C "C3'" . DA  E  1 26  ? 150.195 -5.715   28.204  1.00 483.40 ? 26  DA  s "C3'" 1 
ATOM 2666  O "O3'" . DA  E  1 26  ? 150.061 -4.803   29.299  1.00 483.48 ? 26  DA  s "O3'" 1 
ATOM 2667  C "C2'" . DA  E  1 26  ? 151.089 -6.886   28.586  1.00 482.97 ? 26  DA  s "C2'" 1 
ATOM 2668  C "C1'" . DA  E  1 26  ? 150.093 -7.858   29.185  1.00 480.35 ? 26  DA  s "C1'" 1 
ATOM 2669  N N9    . DA  E  1 26  ? 150.449 -9.274   29.141  1.00 481.41 ? 26  DA  s N9    1 
ATOM 2670  C C8    . DA  E  1 26  ? 151.375 -9.917   28.359  1.00 483.12 ? 26  DA  s C8    1 
ATOM 2671  N N7    . DA  E  1 26  ? 151.414 -11.215  28.545  1.00 483.45 ? 26  DA  s N7    1 
ATOM 2672  C C5    . DA  E  1 26  ? 150.432 -11.445  29.499  1.00 483.32 ? 26  DA  s C5    1 
ATOM 2673  C C6    . DA  E  1 26  ? 149.974 -12.619  30.129  1.00 483.93 ? 26  DA  s C6    1 
ATOM 2674  N N6    . DA  E  1 26  ? 150.463 -13.836  29.880  1.00 486.95 ? 26  DA  s N6    1 
ATOM 2675  N N1    . DA  E  1 26  ? 148.982 -12.497  31.038  1.00 483.01 ? 26  DA  s N1    1 
ATOM 2676  C C2    . DA  E  1 26  ? 148.489 -11.277  31.290  1.00 482.96 ? 26  DA  s C2    1 
ATOM 2677  N N3    . DA  E  1 26  ? 148.839 -10.104  30.770  1.00 482.37 ? 26  DA  s N3    1 
ATOM 2678  C C4    . DA  E  1 26  ? 149.826 -10.258  29.870  1.00 481.83 ? 26  DA  s C4    1 
ATOM 2679  P P     . DT  F  2 1   ? 146.191 -14.461  40.433  1.00 554.72 ? 1   DT  t P     1 
ATOM 2680  O OP1   . DT  F  2 1   ? 146.509 -14.336  41.883  1.00 560.21 ? 1   DT  t OP1   1 
ATOM 2681  O OP2   . DT  F  2 1   ? 145.164 -15.440  39.997  1.00 550.32 ? 1   DT  t OP2   1 
ATOM 2682  O "O5'" . DT  F  2 1   ? 145.856 -13.046  39.770  1.00 555.07 ? 1   DT  t "O5'" 1 
ATOM 2683  C "C5'" . DT  F  2 1   ? 146.839 -11.980  39.712  1.00 558.64 ? 1   DT  t "C5'" 1 
ATOM 2684  C "C4'" . DT  F  2 1   ? 146.811 -11.229  38.397  1.00 556.94 ? 1   DT  t "C4'" 1 
ATOM 2685  O "O4'" . DT  F  2 1   ? 147.565 -11.938  37.381  1.00 553.74 ? 1   DT  t "O4'" 1 
ATOM 2686  C "C3'" . DT  F  2 1   ? 145.435 -10.951  37.785  1.00 554.39 ? 1   DT  t "C3'" 1 
ATOM 2687  O "O3'" . DT  F  2 1   ? 145.445 -9.649   37.169  1.00 556.91 ? 1   DT  t "O3'" 1 
ATOM 2688  C "C2'" . DT  F  2 1   ? 145.304 -12.044  36.736  1.00 548.66 ? 1   DT  t "C2'" 1 
ATOM 2689  C "C1'" . DT  F  2 1   ? 146.742 -12.178  36.245  1.00 549.34 ? 1   DT  t "C1'" 1 
ATOM 2690  N N1    . DT  F  2 1   ? 147.137 -13.484  35.671  1.00 544.93 ? 1   DT  t N1    1 
ATOM 2691  C C2    . DT  F  2 1   ? 147.900 -13.477  34.524  1.00 534.55 ? 1   DT  t C2    1 
ATOM 2692  O O2    . DT  F  2 1   ? 148.229 -12.451  33.948  1.00 531.12 ? 1   DT  t O2    1 
ATOM 2693  N N3    . DT  F  2 1   ? 148.254 -14.722  34.065  1.00 524.36 ? 1   DT  t N3    1 
ATOM 2694  C C4    . DT  F  2 1   ? 147.940 -15.944  34.633  1.00 518.37 ? 1   DT  t C4    1 
ATOM 2695  O O4    . DT  F  2 1   ? 148.330 -16.983  34.104  1.00 510.33 ? 1   DT  t O4    1 
ATOM 2696  C C5    . DT  F  2 1   ? 147.152 -15.876  35.844  1.00 521.82 ? 1   DT  t C5    1 
ATOM 2697  C C7    . DT  F  2 1   ? 146.759 -17.148  36.527  1.00 517.10 ? 1   DT  t C7    1 
ATOM 2698  C C6    . DT  F  2 1   ? 146.797 -14.666  36.296  1.00 534.27 ? 1   DT  t C6    1 
ATOM 2699  P P     . DT  F  2 2   ? 144.116 -8.737   37.130  1.00 558.57 ? 2   DT  t P     1 
ATOM 2700  O OP1   . DT  F  2 2   ? 144.406 -7.476   37.867  1.00 555.04 ? 2   DT  t OP1   1 
ATOM 2701  O OP2   . DT  F  2 2   ? 142.966 -9.580   37.548  1.00 555.65 ? 2   DT  t OP2   1 
ATOM 2702  O "O5'" . DT  F  2 2   ? 143.942 -8.414   35.576  1.00 556.10 ? 2   DT  t "O5'" 1 
ATOM 2703  C "C5'" . DT  F  2 2   ? 145.051 -7.925   34.781  1.00 557.66 ? 2   DT  t "C5'" 1 
ATOM 2704  C "C4'" . DT  F  2 2   ? 144.924 -8.278   33.312  1.00 553.78 ? 2   DT  t "C4'" 1 
ATOM 2705  O "O4'" . DT  F  2 2   ? 145.334 -9.644   33.054  1.00 549.08 ? 2   DT  t "O4'" 1 
ATOM 2706  C "C3'" . DT  F  2 2   ? 143.547 -8.114   32.655  1.00 551.75 ? 2   DT  t "C3'" 1 
ATOM 2707  O "O3'" . DT  F  2 2   ? 143.735 -7.546   31.345  1.00 552.67 ? 2   DT  t "O3'" 1 
ATOM 2708  C "C2'" . DT  F  2 2   ? 143.063 -9.548   32.498  1.00 544.38 ? 2   DT  t "C2'" 1 
ATOM 2709  C "C1'" . DT  F  2 2   ? 144.374 -10.263  32.212  1.00 541.71 ? 2   DT  t "C1'" 1 
ATOM 2710  N N1    . DT  F  2 2   ? 144.422 -11.717  32.467  1.00 535.44 ? 2   DT  t N1    1 
ATOM 2711  C C2    . DT  F  2 2   ? 145.215 -12.464  31.628  1.00 532.20 ? 2   DT  t C2    1 
ATOM 2712  O O2    . DT  F  2 2   ? 145.830 -11.981  30.693  1.00 531.75 ? 2   DT  t O2    1 
ATOM 2713  N N3    . DT  F  2 2   ? 145.244 -13.808  31.911  1.00 531.04 ? 2   DT  t N3    1 
ATOM 2714  C C4    . DT  F  2 2   ? 144.586 -14.460  32.938  1.00 530.47 ? 2   DT  t C4    1 
ATOM 2715  O O4    . DT  F  2 2   ? 144.703 -15.678  33.066  1.00 528.44 ? 2   DT  t O4    1 
ATOM 2716  C C5    . DT  F  2 2   ? 143.787 -13.609  33.795  1.00 532.67 ? 2   DT  t C5    1 
ATOM 2717  C C7    . DT  F  2 2   ? 143.033 -14.225  34.931  1.00 532.36 ? 2   DT  t C7    1 
ATOM 2718  C C6    . DT  F  2 2   ? 143.747 -12.298  33.520  1.00 535.04 ? 2   DT  t C6    1 
ATOM 2719  P P     . DT  F  2 3   ? 142.714 -6.446   30.761  1.00 555.62 ? 3   DT  t P     1 
ATOM 2720  O OP1   . DT  F  2 3   ? 143.302 -5.094   30.985  1.00 562.84 ? 3   DT  t OP1   1 
ATOM 2721  O OP2   . DT  F  2 3   ? 141.358 -6.752   31.281  1.00 553.42 ? 3   DT  t OP2   1 
ATOM 2722  O "O5'" . DT  F  2 3   ? 142.720 -6.752   29.195  1.00 553.00 ? 3   DT  t "O5'" 1 
ATOM 2723  C "C5'" . DT  F  2 3   ? 143.904 -7.259   28.537  1.00 552.10 ? 3   DT  t "C5'" 1 
ATOM 2724  C "C4'" . DT  F  2 3   ? 143.564 -8.326   27.518  1.00 546.34 ? 3   DT  t "C4'" 1 
ATOM 2725  O "O4'" . DT  F  2 3   ? 143.586 -9.637   28.136  1.00 542.00 ? 3   DT  t "O4'" 1 
ATOM 2726  C "C3'" . DT  F  2 3   ? 142.202 -8.196   26.821  1.00 524.55 ? 3   DT  t "C3'" 1 
ATOM 2727  O "O3'" . DT  F  2 3   ? 142.357 -8.320   25.397  1.00 483.23 ? 3   DT  t "O3'" 1 
ATOM 2728  C "C2'" . DT  F  2 3   ? 141.397 -9.361   27.377  1.00 529.06 ? 3   DT  t "C2'" 1 
ATOM 2729  C "C1'" . DT  F  2 3   ? 142.481 -10.387  27.665  1.00 532.75 ? 3   DT  t "C1'" 1 
ATOM 2730  N N1    . DT  F  2 3   ? 142.170 -11.425  28.678  1.00 524.52 ? 3   DT  t N1    1 
ATOM 2731  C C2    . DT  F  2 3   ? 142.818 -12.635  28.559  1.00 521.86 ? 3   DT  t C2    1 
ATOM 2732  O O2    . DT  F  2 3   ? 143.600 -12.886  27.654  1.00 525.88 ? 3   DT  t O2    1 
ATOM 2733  N N3    . DT  F  2 3   ? 142.502 -13.552  29.535  1.00 511.46 ? 3   DT  t N3    1 
ATOM 2734  C C4    . DT  F  2 3   ? 141.627 -13.379  30.595  1.00 498.21 ? 3   DT  t C4    1 
ATOM 2735  O O4    . DT  F  2 3   ? 141.439 -14.298  31.390  1.00 492.78 ? 3   DT  t O4    1 
ATOM 2736  C C5    . DT  F  2 3   ? 140.988 -12.082  30.660  1.00 495.42 ? 3   DT  t C5    1 
ATOM 2737  C C7    . DT  F  2 3   ? 140.029 -11.799  31.774  1.00 478.59 ? 3   DT  t C7    1 
ATOM 2738  C C6    . DT  F  2 3   ? 141.295 -11.181  29.717  1.00 509.36 ? 3   DT  t C6    1 
ATOM 2739  P P     . DT  F  2 4   ? 141.318 -7.609   24.377  1.00 456.42 ? 4   DT  t P     1 
ATOM 2740  O OP1   . DT  F  2 4   ? 141.962 -6.385   23.832  1.00 456.49 ? 4   DT  t OP1   1 
ATOM 2741  O OP2   . DT  F  2 4   ? 139.998 -7.499   25.054  1.00 453.15 ? 4   DT  t OP2   1 
ATOM 2742  O "O5'" . DT  F  2 4   ? 141.181 -8.675   23.198  1.00 451.28 ? 4   DT  t "O5'" 1 
ATOM 2743  C "C5'" . DT  F  2 4   ? 142.340 -9.285   22.591  1.00 456.29 ? 4   DT  t "C5'" 1 
ATOM 2744  C "C4'" . DT  F  2 4   ? 142.045 -10.716  22.204  1.00 462.94 ? 4   DT  t "C4'" 1 
ATOM 2745  O "O4'" . DT  F  2 4   ? 142.026 -11.551  23.385  1.00 462.88 ? 4   DT  t "O4'" 1 
ATOM 2746  C "C3'" . DT  F  2 4   ? 140.703 -10.935  21.496  1.00 470.83 ? 4   DT  t "C3'" 1 
ATOM 2747  O "O3'" . DT  F  2 4   ? 140.895 -11.683  20.295  1.00 473.31 ? 4   DT  t "O3'" 1 
ATOM 2748  C "C2'" . DT  F  2 4   ? 139.908 -11.800  22.459  1.00 472.34 ? 4   DT  t "C2'" 1 
ATOM 2749  C "C1'" . DT  F  2 4   ? 140.995 -12.507  23.240  1.00 479.46 ? 4   DT  t "C1'" 1 
ATOM 2750  N N1    . DT  F  2 4   ? 140.572 -12.943  24.587  1.00 505.92 ? 4   DT  t N1    1 
ATOM 2751  C C2    . DT  F  2 4   ? 141.107 -14.103  25.102  1.00 518.03 ? 4   DT  t C2    1 
ATOM 2752  O O2    . DT  F  2 4   ? 141.928 -14.782  24.503  1.00 504.51 ? 4   DT  t O2    1 
ATOM 2753  N N3    . DT  F  2 4   ? 140.632 -14.448  26.346  1.00 521.29 ? 4   DT  t N3    1 
ATOM 2754  C C4    . DT  F  2 4   ? 139.697 -13.764  27.105  1.00 521.93 ? 4   DT  t C4    1 
ATOM 2755  O O4    . DT  F  2 4   ? 139.358 -14.201  28.203  1.00 521.02 ? 4   DT  t O4    1 
ATOM 2756  C C5    . DT  F  2 4   ? 139.180 -12.555  26.502  1.00 524.48 ? 4   DT  t C5    1 
ATOM 2757  C C7    . DT  F  2 4   ? 138.165 -11.746  27.248  1.00 526.27 ? 4   DT  t C7    1 
ATOM 2758  C C6    . DT  F  2 4   ? 139.634 -12.213  25.289  1.00 525.94 ? 4   DT  t C6    1 
ATOM 2759  P P     . DT  F  2 5   ? 139.902 -11.483  19.049  1.00 473.61 ? 5   DT  t P     1 
ATOM 2760  O OP1   . DT  F  2 5   ? 140.474 -10.432  18.175  1.00 483.11 ? 5   DT  t OP1   1 
ATOM 2761  O OP2   . DT  F  2 5   ? 138.509 -11.351  19.563  1.00 476.59 ? 5   DT  t OP2   1 
ATOM 2762  O "O5'" . DT  F  2 5   ? 140.017 -12.860  18.256  1.00 453.18 ? 5   DT  t "O5'" 1 
ATOM 2763  C "C5'" . DT  F  2 5   ? 141.285 -13.522  18.070  1.00 436.30 ? 5   DT  t "C5'" 1 
ATOM 2764  C "C4'" . DT  F  2 5   ? 141.081 -15.015  18.165  1.00 422.55 ? 5   DT  t "C4'" 1 
ATOM 2765  O "O4'" . DT  F  2 5   ? 141.009 -15.398  19.563  1.00 425.40 ? 5   DT  t "O4'" 1 
ATOM 2766  C "C3'" . DT  F  2 5   ? 139.778 -15.487  17.518  1.00 407.55 ? 5   DT  t "C3'" 1 
ATOM 2767  O "O3'" . DT  F  2 5   ? 139.993 -16.627  16.696  1.00 386.11 ? 5   DT  t "O3'" 1 
ATOM 2768  C "C2'" . DT  F  2 5   ? 138.896 -15.862  18.692  1.00 413.35 ? 5   DT  t "C2'" 1 
ATOM 2769  C "C1'" . DT  F  2 5   ? 139.898 -16.253  19.757  1.00 426.05 ? 5   DT  t "C1'" 1 
ATOM 2770  N N1    . DT  F  2 5   ? 139.393 -16.067  21.138  1.00 438.67 ? 5   DT  t N1    1 
ATOM 2771  C C2    . DT  F  2 5   ? 139.852 -16.911  22.125  1.00 441.61 ? 5   DT  t C2    1 
ATOM 2772  O O2    . DT  F  2 5   ? 140.692 -17.775  21.927  1.00 430.33 ? 5   DT  t O2    1 
ATOM 2773  N N3    . DT  F  2 5   ? 139.296 -16.698  23.364  1.00 453.44 ? 5   DT  t N3    1 
ATOM 2774  C C4    . DT  F  2 5   ? 138.335 -15.759  23.700  1.00 460.26 ? 5   DT  t C4    1 
ATOM 2775  O O4    . DT  F  2 5   ? 137.919 -15.694  24.856  1.00 473.46 ? 5   DT  t O4    1 
ATOM 2776  C C5    . DT  F  2 5   ? 137.893 -14.914  22.612  1.00 456.20 ? 5   DT  t C5    1 
ATOM 2777  C C7    . DT  F  2 5   ? 136.858 -13.867  22.878  1.00 451.96 ? 5   DT  t C7    1 
ATOM 2778  C C6    . DT  F  2 5   ? 138.426 -15.119  21.400  1.00 448.26 ? 5   DT  t C6    1 
ATOM 2779  P P     . DT  F  2 6   ? 139.021 -16.906  15.470  1.00 369.99 ? 6   DT  t P     1 
ATOM 2780  O OP1   . DT  F  2 6   ? 139.690 -16.422  14.244  1.00 370.00 ? 6   DT  t OP1   1 
ATOM 2781  O OP2   . DT  F  2 6   ? 137.665 -16.409  15.819  1.00 361.96 ? 6   DT  t OP2   1 
ATOM 2782  O "O5'" . DT  F  2 6   ? 138.981 -18.495  15.396  1.00 378.72 ? 6   DT  t "O5'" 1 
ATOM 2783  C "C5'" . DT  F  2 6   ? 140.184 -19.272  15.540  1.00 406.21 ? 6   DT  t "C5'" 1 
ATOM 2784  C "C4'" . DT  F  2 6   ? 139.869 -20.584  16.221  1.00 421.08 ? 6   DT  t "C4'" 1 
ATOM 2785  O "O4'" . DT  F  2 6   ? 139.736 -20.376  17.651  1.00 421.14 ? 6   DT  t "O4'" 1 
ATOM 2786  C "C3'" . DT  F  2 6   ? 138.559 -21.227  15.757  1.00 424.71 ? 6   DT  t "C3'" 1 
ATOM 2787  O "O3'" . DT  F  2 6   ? 138.702 -22.628  15.504  1.00 438.64 ? 6   DT  t "O3'" 1 
ATOM 2788  C "C2'" . DT  F  2 6   ? 137.625 -21.027  16.934  1.00 416.90 ? 6   DT  t "C2'" 1 
ATOM 2789  C "C1'" . DT  F  2 6   ? 138.575 -21.041  18.111  1.00 410.54 ? 6   DT  t "C1'" 1 
ATOM 2790  N N1    . DT  F  2 6   ? 138.057 -20.302  19.273  1.00 396.88 ? 6   DT  t N1    1 
ATOM 2791  C C2    . DT  F  2 6   ? 138.327 -20.769  20.541  1.00 386.75 ? 6   DT  t C2    1 
ATOM 2792  O O2    . DT  F  2 6   ? 139.008 -21.758  20.759  1.00 372.38 ? 6   DT  t O2    1 
ATOM 2793  N N3    . DT  F  2 6   ? 137.778 -20.018  21.552  1.00 388.52 ? 6   DT  t N3    1 
ATOM 2794  C C4    . DT  F  2 6   ? 136.999 -18.881  21.424  1.00 394.24 ? 6   DT  t C4    1 
ATOM 2795  O O4    . DT  F  2 6   ? 136.584 -18.306  22.428  1.00 404.14 ? 6   DT  t O4    1 
ATOM 2796  C C5    . DT  F  2 6   ? 136.740 -18.464  20.064  1.00 392.61 ? 6   DT  t C5    1 
ATOM 2797  C C7    . DT  F  2 6   ? 135.895 -17.252  19.824  1.00 387.82 ? 6   DT  t C7    1 
ATOM 2798  C C6    . DT  F  2 6   ? 137.274 -19.186  19.072  1.00 393.93 ? 6   DT  t C6    1 
ATOM 2799  P P     . DT  F  2 7   ? 137.609 -23.395  14.613  1.00 443.95 ? 7   DT  t P     1 
ATOM 2800  O OP1   . DT  F  2 7   ? 138.218 -23.689  13.294  1.00 450.45 ? 7   DT  t OP1   1 
ATOM 2801  O OP2   . DT  F  2 7   ? 136.331 -22.640  14.685  1.00 445.60 ? 7   DT  t OP2   1 
ATOM 2802  O "O5'" . DT  F  2 7   ? 137.374 -24.764  15.395  1.00 442.17 ? 7   DT  t "O5'" 1 
ATOM 2803  C "C5'" . DT  F  2 7   ? 138.423 -25.412  16.141  1.00 451.45 ? 7   DT  t "C5'" 1 
ATOM 2804  C "C4'" . DT  F  2 7   ? 137.824 -26.287  17.219  1.00 451.87 ? 7   DT  t "C4'" 1 
ATOM 2805  O "O4'" . DT  F  2 7   ? 137.595 -25.497  18.412  1.00 449.37 ? 7   DT  t "O4'" 1 
ATOM 2806  C "C3'" . DT  F  2 7   ? 136.470 -26.901  16.854  1.00 442.51 ? 7   DT  t "C3'" 1 
ATOM 2807  O "O3'" . DT  F  2 7   ? 136.328 -28.240  17.341  1.00 439.20 ? 7   DT  t "O3'" 1 
ATOM 2808  C "C2'" . DT  F  2 7   ? 135.476 -26.020  17.584  1.00 439.52 ? 7   DT  t "C2'" 1 
ATOM 2809  C "C1'" . DT  F  2 7   ? 136.249 -25.658  18.835  1.00 443.79 ? 7   DT  t "C1'" 1 
ATOM 2810  N N1    . DT  F  2 7   ? 135.805 -24.390  19.429  1.00 444.53 ? 7   DT  t N1    1 
ATOM 2811  C C2    . DT  F  2 7   ? 135.789 -24.255  20.800  1.00 440.83 ? 7   DT  t C2    1 
ATOM 2812  O O2    . DT  F  2 7   ? 136.161 -25.133  21.564  1.00 429.70 ? 7   DT  t O2    1 
ATOM 2813  N N3    . DT  F  2 7   ? 135.339 -23.037  21.247  1.00 445.14 ? 7   DT  t N3    1 
ATOM 2814  C C4    . DT  F  2 7   ? 134.896 -21.976  20.480  1.00 450.85 ? 7   DT  t C4    1 
ATOM 2815  O O4    . DT  F  2 7   ? 134.522 -20.941  21.025  1.00 455.33 ? 7   DT  t O4    1 
ATOM 2816  C C5    . DT  F  2 7   ? 134.919 -22.197  19.051  1.00 452.08 ? 7   DT  t C5    1 
ATOM 2817  C C7    . DT  F  2 7   ? 134.445 -21.108  18.140  1.00 453.37 ? 7   DT  t C7    1 
ATOM 2818  C C6    . DT  F  2 7   ? 135.368 -23.376  18.604  1.00 450.40 ? 7   DT  t C6    1 
ATOM 2819  P P     . DT  F  2 8   ? 135.157 -29.173  16.771  1.00 436.86 ? 8   DT  t P     1 
ATOM 2820  O OP1   . DT  F  2 8   ? 135.788 -30.378  16.175  1.00 441.85 ? 8   DT  t OP1   1 
ATOM 2821  O OP2   . DT  F  2 8   ? 134.251 -28.331  15.946  1.00 429.85 ? 8   DT  t OP2   1 
ATOM 2822  O "O5'" . DT  F  2 8   ? 134.349 -29.603  18.077  1.00 432.31 ? 8   DT  t "O5'" 1 
ATOM 2823  C "C5'" . DT  F  2 8   ? 135.023 -30.142  19.230  1.00 428.84 ? 8   DT  t "C5'" 1 
ATOM 2824  C "C4'" . DT  F  2 8   ? 134.172 -29.986  20.470  1.00 420.02 ? 8   DT  t "C4'" 1 
ATOM 2825  O "O4'" . DT  F  2 8   ? 134.025 -28.585  20.807  1.00 417.01 ? 8   DT  t "O4'" 1 
ATOM 2826  C "C3'" . DT  F  2 8   ? 132.751 -30.552  20.372  1.00 411.80 ? 8   DT  t "C3'" 1 
ATOM 2827  O "O3'" . DT  F  2 8   ? 132.402 -31.195  21.606  1.00 408.06 ? 8   DT  t "O3'" 1 
ATOM 2828  C "C2'" . DT  F  2 8   ? 131.890 -29.313  20.207  1.00 407.18 ? 8   DT  t "C2'" 1 
ATOM 2829  C "C1'" . DT  F  2 8   ? 132.653 -28.312  21.053  1.00 410.21 ? 8   DT  t "C1'" 1 
ATOM 2830  N N1    . DT  F  2 8   ? 132.403 -26.900  20.719  1.00 408.78 ? 8   DT  t N1    1 
ATOM 2831  C C2    . DT  F  2 8   ? 132.193 -26.012  21.751  1.00 407.74 ? 8   DT  t C2    1 
ATOM 2832  O O2    . DT  F  2 8   ? 132.203 -26.341  22.927  1.00 401.45 ? 8   DT  t O2    1 
ATOM 2833  N N3    . DT  F  2 8   ? 131.971 -24.716  21.353  1.00 412.51 ? 8   DT  t N3    1 
ATOM 2834  C C4    . DT  F  2 8   ? 131.928 -24.235  20.058  1.00 415.30 ? 8   DT  t C4    1 
ATOM 2835  O O4    . DT  F  2 8   ? 131.713 -23.042  19.857  1.00 422.67 ? 8   DT  t O4    1 
ATOM 2836  C C5    . DT  F  2 8   ? 132.147 -25.224  19.025  1.00 412.17 ? 8   DT  t C5    1 
ATOM 2837  C C7    . DT  F  2 8   ? 132.118 -24.797  17.591  1.00 408.69 ? 8   DT  t C7    1 
ATOM 2838  C C6    . DT  F  2 8   ? 132.374 -26.489  19.404  1.00 409.83 ? 8   DT  t C6    1 
ATOM 2839  P P     . DT  F  2 9   ? 131.232 -32.294  21.658  1.00 402.51 ? 9   DT  t P     1 
ATOM 2840  O OP1   . DT  F  2 9   ? 131.821 -33.554  22.179  1.00 407.86 ? 9   DT  t OP1   1 
ATOM 2841  O OP2   . DT  F  2 9   ? 130.534 -32.302  20.344  1.00 394.50 ? 9   DT  t OP2   1 
ATOM 2842  O "O5'" . DT  F  2 9   ? 130.236 -31.719  22.766  1.00 404.33 ? 9   DT  t "O5'" 1 
ATOM 2843  C "C5'" . DT  F  2 9   ? 130.734 -31.075  23.963  1.00 410.35 ? 9   DT  t "C5'" 1 
ATOM 2844  C "C4'" . DT  F  2 9   ? 129.657 -30.255  24.641  1.00 411.16 ? 9   DT  t "C4'" 1 
ATOM 2845  O "O4'" . DT  F  2 9   ? 129.656 -28.899  24.122  1.00 406.58 ? 9   DT  t "O4'" 1 
ATOM 2846  C "C3'" . DT  F  2 9   ? 128.222 -30.772  24.488  1.00 407.87 ? 9   DT  t "C3'" 1 
ATOM 2847  O "O3'" . DT  F  2 9   ? 127.517 -30.662  25.733  1.00 401.28 ? 9   DT  t "O3'" 1 
ATOM 2848  C "C2'" . DT  F  2 9   ? 127.622 -29.837  23.454  1.00 404.73 ? 9   DT  t "C2'" 1 
ATOM 2849  C "C1'" . DT  F  2 9   ? 128.334 -28.531  23.757  1.00 401.29 ? 9   DT  t "C1'" 1 
ATOM 2850  N N1    . DT  F  2 9   ? 128.417 -27.576  22.630  1.00 391.82 ? 9   DT  t N1    1 
ATOM 2851  C C2    . DT  F  2 9   ? 128.216 -26.240  22.897  1.00 390.50 ? 9   DT  t C2    1 
ATOM 2852  O O2    . DT  F  2 9   ? 127.976 -25.811  24.014  1.00 395.94 ? 9   DT  t O2    1 
ATOM 2853  N N3    . DT  F  2 9   ? 128.309 -25.417  21.801  1.00 385.95 ? 9   DT  t N3    1 
ATOM 2854  C C4    . DT  F  2 9   ? 128.566 -25.790  20.496  1.00 382.88 ? 9   DT  t C4    1 
ATOM 2855  O O4    . DT  F  2 9   ? 128.618 -24.936  19.615  1.00 383.72 ? 9   DT  t O4    1 
ATOM 2856  C C5    . DT  F  2 9   ? 128.757 -27.208  20.286  1.00 381.89 ? 9   DT  t C5    1 
ATOM 2857  C C7    . DT  F  2 9   ? 129.033 -27.708  18.903  1.00 383.30 ? 9   DT  t C7    1 
ATOM 2858  C C6    . DT  F  2 9   ? 128.672 -28.018  21.349  1.00 384.08 ? 9   DT  t C6    1 
ATOM 2859  P P     . DT  F  2 10  ? 126.245 -31.600  26.037  1.00 389.74 ? 10  DT  t P     1 
ATOM 2860  O OP1   . DT  F  2 10  ? 126.551 -32.410  27.238  1.00 392.42 ? 10  DT  t OP1   1 
ATOM 2861  O OP2   . DT  F  2 10  ? 125.852 -32.279  24.777  1.00 389.01 ? 10  DT  t OP2   1 
ATOM 2862  O "O5'" . DT  F  2 10  ? 125.091 -30.560  26.392  1.00 376.34 ? 10  DT  t "O5'" 1 
ATOM 2863  C "C5'" . DT  F  2 10  ? 125.354 -29.373  27.171  1.00 363.38 ? 10  DT  t "C5'" 1 
ATOM 2864  C "C4'" . DT  F  2 10  ? 124.379 -28.261  26.844  1.00 351.03 ? 10  DT  t "C4'" 1 
ATOM 2865  O "O4'" . DT  F  2 10  ? 124.794 -27.537  25.658  1.00 346.22 ? 10  DT  t "O4'" 1 
ATOM 2866  C "C3'" . DT  F  2 10  ? 122.926 -28.675  26.591  1.00 343.50 ? 10  DT  t "C3'" 1 
ATOM 2867  O "O3'" . DT  F  2 10  ? 122.049 -27.700  27.164  1.00 342.62 ? 10  DT  t "O3'" 1 
ATOM 2868  C "C2'" . DT  F  2 10  ? 122.795 -28.555  25.085  1.00 335.61 ? 10  DT  t "C2'" 1 
ATOM 2869  C "C1'" . DT  F  2 10  ? 123.652 -27.330  24.842  1.00 328.62 ? 10  DT  t "C1'" 1 
ATOM 2870  N N1    . DT  F  2 10  ? 124.108 -27.113  23.454  1.00 308.89 ? 10  DT  t N1    1 
ATOM 2871  C C2    . DT  F  2 10  ? 124.159 -25.821  22.973  1.00 298.03 ? 10  DT  t C2    1 
ATOM 2872  O O2    . DT  F  2 10  ? 123.831 -24.848  23.634  1.00 294.62 ? 10  DT  t O2    1 
ATOM 2873  N N3    . DT  F  2 10  ? 124.597 -25.712  21.676  1.00 289.87 ? 10  DT  t N3    1 
ATOM 2874  C C4    . DT  F  2 10  ? 124.975 -26.740  20.832  1.00 287.98 ? 10  DT  t C4    1 
ATOM 2875  O O4    . DT  F  2 10  ? 125.346 -26.487  19.689  1.00 288.43 ? 10  DT  t O4    1 
ATOM 2876  C C5    . DT  F  2 10  ? 124.895 -28.067  21.401  1.00 289.31 ? 10  DT  t C5    1 
ATOM 2877  C C7    . DT  F  2 10  ? 125.283 -29.242  20.561  1.00 284.81 ? 10  DT  t C7    1 
ATOM 2878  C C6    . DT  F  2 10  ? 124.471 -28.185  22.667  1.00 298.27 ? 10  DT  t C6    1 
ATOM 2879  P P     . DT  F  2 11  ? 120.565 -28.119  27.586  1.00 343.45 ? 11  DT  t P     1 
ATOM 2880  O OP1   . DT  F  2 11  ? 120.594 -28.525  29.011  1.00 350.14 ? 11  DT  t OP1   1 
ATOM 2881  O OP2   . DT  F  2 11  ? 120.050 -29.057  26.560  1.00 338.58 ? 11  DT  t OP2   1 
ATOM 2882  O "O5'" . DT  F  2 11  ? 119.707 -26.780  27.450  1.00 344.20 ? 11  DT  t "O5'" 1 
ATOM 2883  C "C5'" . DT  F  2 11  ? 120.282 -25.462  27.539  1.00 348.11 ? 11  DT  t "C5'" 1 
ATOM 2884  C "C4'" . DT  F  2 11  ? 119.506 -24.492  26.676  1.00 351.06 ? 11  DT  t "C4'" 1 
ATOM 2885  O "O4'" . DT  F  2 11  ? 120.131 -24.428  25.372  1.00 346.83 ? 11  DT  t "O4'" 1 
ATOM 2886  C "C3'" . DT  F  2 11  ? 118.044 -24.877  26.422  1.00 347.66 ? 11  DT  t "C3'" 1 
ATOM 2887  O "O3'" . DT  F  2 11  ? 117.157 -23.753  26.307  1.00 349.58 ? 11  DT  t "O3'" 1 
ATOM 2888  C "C2'" . DT  F  2 11  ? 118.105 -25.573  25.078  1.00 340.43 ? 11  DT  t "C2'" 1 
ATOM 2889  C "C1'" . DT  F  2 11  ? 119.180 -24.766  24.375  1.00 339.52 ? 11  DT  t "C1'" 1 
ATOM 2890  N N1    . DT  F  2 11  ? 119.881 -25.485  23.304  1.00 331.85 ? 11  DT  t N1    1 
ATOM 2891  C C2    . DT  F  2 11  ? 120.312 -24.755  22.221  1.00 328.58 ? 11  DT  t C2    1 
ATOM 2892  O O2    . DT  F  2 11  ? 120.161 -23.548  22.129  1.00 327.70 ? 11  DT  t O2    1 
ATOM 2893  N N3    . DT  F  2 11  ? 120.936 -25.493  21.247  1.00 325.59 ? 11  DT  t N3    1 
ATOM 2894  C C4    . DT  F  2 11  ? 121.161 -26.857  21.246  1.00 323.26 ? 11  DT  t C4    1 
ATOM 2895  O O4    . DT  F  2 11  ? 121.734 -27.381  20.294  1.00 321.40 ? 11  DT  t O4    1 
ATOM 2896  C C5    . DT  F  2 11  ? 120.679 -27.561  22.414  1.00 323.78 ? 11  DT  t C5    1 
ATOM 2897  C C7    . DT  F  2 11  ? 120.877 -29.042  22.503  1.00 320.02 ? 11  DT  t C7    1 
ATOM 2898  C C6    . DT  F  2 11  ? 120.065 -26.850  23.368  1.00 327.60 ? 11  DT  t C6    1 
ATOM 2899  P P     . DT  F  2 12  ? 115.630 -23.898  26.787  1.00 350.16 ? 12  DT  t P     1 
ATOM 2900  O OP1   . DT  F  2 12  ? 115.554 -23.451  28.202  1.00 354.58 ? 12  DT  t OP1   1 
ATOM 2901  O OP2   . DT  F  2 12  ? 115.153 -25.254  26.414  1.00 343.21 ? 12  DT  t OP2   1 
ATOM 2902  O "O5'" . DT  F  2 12  ? 114.818 -22.892  25.853  1.00 353.10 ? 12  DT  t "O5'" 1 
ATOM 2903  C "C5'" . DT  F  2 12  ? 115.391 -21.677  25.330  1.00 354.43 ? 12  DT  t "C5'" 1 
ATOM 2904  C "C4'" . DT  F  2 12  ? 114.888 -21.402  23.929  1.00 346.54 ? 12  DT  t "C4'" 1 
ATOM 2905  O "O4'" . DT  F  2 12  ? 115.723 -22.115  22.988  1.00 335.63 ? 12  DT  t "O4'" 1 
ATOM 2906  C "C3'" . DT  F  2 12  ? 113.453 -21.836  23.617  1.00 344.99 ? 12  DT  t "C3'" 1 
ATOM 2907  O "O3'" . DT  F  2 12  ? 112.857 -20.930  22.677  1.00 351.02 ? 12  DT  t "O3'" 1 
ATOM 2908  C "C2'" . DT  F  2 12  ? 113.649 -23.182  22.951  1.00 333.13 ? 12  DT  t "C2'" 1 
ATOM 2909  C "C1'" . DT  F  2 12  ? 114.909 -22.921  22.153  1.00 328.29 ? 12  DT  t "C1'" 1 
ATOM 2910  N N1    . DT  F  2 12  ? 115.679 -24.119  21.787  1.00 320.96 ? 12  DT  t N1    1 
ATOM 2911  C C2    . DT  F  2 12  ? 116.461 -24.054  20.656  1.00 322.44 ? 12  DT  t C2    1 
ATOM 2912  O O2    . DT  F  2 12  ? 116.536 -23.060  19.953  1.00 328.60 ? 12  DT  t O2    1 
ATOM 2913  N N3    . DT  F  2 12  ? 117.150 -25.207  20.372  1.00 320.54 ? 12  DT  t N3    1 
ATOM 2914  C C4    . DT  F  2 12  ? 117.134 -26.389  21.088  1.00 313.85 ? 12  DT  t C4    1 
ATOM 2915  O O4    . DT  F  2 12  ? 117.802 -27.344  20.705  1.00 316.34 ? 12  DT  t O4    1 
ATOM 2916  C C5    . DT  F  2 12  ? 116.292 -26.385  22.263  1.00 310.12 ? 12  DT  t C5    1 
ATOM 2917  C C7    . DT  F  2 12  ? 116.210 -27.622  23.102  1.00 302.56 ? 12  DT  t C7    1 
ATOM 2918  C C6    . DT  F  2 12  ? 115.617 -25.265  22.550  1.00 313.31 ? 12  DT  t C6    1 
ATOM 2919  P P     . DT  F  2 13  ? 111.258 -20.938  22.408  1.00 355.24 ? 13  DT  t P     1 
ATOM 2920  O OP1   . DT  F  2 13  ? 110.604 -19.997  23.336  1.00 359.00 ? 13  DT  t OP1   1 
ATOM 2921  O OP2   . DT  F  2 13  ? 110.779 -22.338  22.328  1.00 348.94 ? 13  DT  t OP2   1 
ATOM 2922  O "O5'" . DT  F  2 13  ? 111.114 -20.245  20.983  1.00 360.76 ? 13  DT  t "O5'" 1 
ATOM 2923  C "C5'" . DT  F  2 13  ? 112.211 -19.563  20.357  1.00 371.10 ? 13  DT  t "C5'" 1 
ATOM 2924  C "C4'" . DT  F  2 13  ? 112.229 -19.880  18.881  1.00 378.34 ? 13  DT  t "C4'" 1 
ATOM 2925  O "O4'" . DT  F  2 13  ? 113.069 -21.040  18.669  1.00 374.76 ? 13  DT  t "O4'" 1 
ATOM 2926  C "C3'" . DT  F  2 13  ? 110.857 -20.245  18.302  1.00 381.30 ? 13  DT  t "C3'" 1 
ATOM 2927  O "O3'" . DT  F  2 13  ? 110.687 -19.778  16.959  1.00 384.09 ? 13  DT  t "O3'" 1 
ATOM 2928  C "C2'" . DT  F  2 13  ? 110.880 -21.759  18.299  1.00 373.89 ? 13  DT  t "C2'" 1 
ATOM 2929  C "C1'" . DT  F  2 13  ? 112.333 -22.032  17.975  1.00 369.59 ? 13  DT  t "C1'" 1 
ATOM 2930  N N1    . DT  F  2 13  ? 112.800 -23.349  18.428  1.00 363.97 ? 13  DT  t N1    1 
ATOM 2931  C C2    . DT  F  2 13  ? 113.709 -24.021  17.643  1.00 359.63 ? 13  DT  t C2    1 
ATOM 2932  O O2    . DT  F  2 13  ? 114.169 -23.561  16.611  1.00 354.10 ? 13  DT  t O2    1 
ATOM 2933  N N3    . DT  F  2 13  ? 114.069 -25.258  18.121  1.00 358.81 ? 13  DT  t N3    1 
ATOM 2934  C C4    . DT  F  2 13  ? 113.612 -25.876  19.271  1.00 358.67 ? 13  DT  t C4    1 
ATOM 2935  O O4    . DT  F  2 13  ? 114.028 -26.992  19.573  1.00 358.34 ? 13  DT  t O4    1 
ATOM 2936  C C5    . DT  F  2 13  ? 112.651 -25.117  20.037  1.00 359.30 ? 13  DT  t C5    1 
ATOM 2937  C C7    . DT  F  2 13  ? 112.098 -25.707  21.297  1.00 355.73 ? 13  DT  t C7    1 
ATOM 2938  C C6    . DT  F  2 13  ? 112.294 -23.910  19.580  1.00 362.22 ? 13  DT  t C6    1 
ATOM 2939  P P     . DT  F  2 14  ? 109.212 -19.595  16.336  1.00 389.13 ? 14  DT  t P     1 
ATOM 2940  O OP1   . DT  F  2 14  ? 108.800 -18.184  16.534  1.00 400.12 ? 14  DT  t OP1   1 
ATOM 2941  O OP2   . DT  F  2 14  ? 108.341 -20.689  16.840  1.00 381.52 ? 14  DT  t OP2   1 
ATOM 2942  O "O5'" . DT  F  2 14  ? 109.445 -19.800  14.774  1.00 389.58 ? 14  DT  t "O5'" 1 
ATOM 2943  C "C5'" . DT  F  2 14  ? 110.769 -19.791  14.201  1.00 382.92 ? 14  DT  t "C5'" 1 
ATOM 2944  C "C4'" . DT  F  2 14  ? 110.905 -20.921  13.208  1.00 370.01 ? 14  DT  t "C4'" 1 
ATOM 2945  O "O4'" . DT  F  2 14  ? 111.377 -22.109  13.895  1.00 356.33 ? 14  DT  t "O4'" 1 
ATOM 2946  C "C3'" . DT  F  2 14  ? 109.597 -21.317  12.514  1.00 368.44 ? 14  DT  t "C3'" 1 
ATOM 2947  O "O3'" . DT  F  2 14  ? 109.799 -21.541  11.112  1.00 370.61 ? 14  DT  t "O3'" 1 
ATOM 2948  C "C2'" . DT  F  2 14  ? 109.193 -22.597  13.223  1.00 358.18 ? 14  DT  t "C2'" 1 
ATOM 2949  C "C1'" . DT  F  2 14  ? 110.539 -23.207  13.568  1.00 348.58 ? 14  DT  t "C1'" 1 
ATOM 2950  N N1    . DT  F  2 14  ? 110.541 -24.147  14.712  1.00 337.50 ? 14  DT  t N1    1 
ATOM 2951  C C2    . DT  F  2 14  ? 111.364 -25.250  14.639  1.00 334.00 ? 14  DT  t C2    1 
ATOM 2952  O O2    . DT  F  2 14  ? 112.097 -25.476  13.690  1.00 333.10 ? 14  DT  t O2    1 
ATOM 2953  N N3    . DT  F  2 14  ? 111.300 -26.083  15.730  1.00 334.86 ? 14  DT  t N3    1 
ATOM 2954  C C4    . DT  F  2 14  ? 110.514 -25.929  16.856  1.00 334.31 ? 14  DT  t C4    1 
ATOM 2955  O O4    . DT  F  2 14  ? 110.568 -26.759  17.759  1.00 342.10 ? 14  DT  t O4    1 
ATOM 2956  C C5    . DT  F  2 14  ? 109.669 -24.757  16.861  1.00 331.25 ? 14  DT  t C5    1 
ATOM 2957  C C7    . DT  F  2 14  ? 108.789 -24.504  18.044  1.00 325.67 ? 14  DT  t C7    1 
ATOM 2958  C C6    . DT  F  2 14  ? 109.718 -23.941  15.799  1.00 332.34 ? 14  DT  t C6    1 
ATOM 2959  P P     . DT  F  2 15  ? 108.555 -21.515  10.087  1.00 371.23 ? 15  DT  t P     1 
ATOM 2960  O OP1   . DT  F  2 15  ? 108.685 -20.303  9.243   1.00 375.39 ? 15  DT  t OP1   1 
ATOM 2961  O OP2   . DT  F  2 15  ? 107.304 -21.746  10.856  1.00 369.42 ? 15  DT  t OP2   1 
ATOM 2962  O "O5'" . DT  F  2 15  ? 108.809 -22.803  9.181   1.00 372.44 ? 15  DT  t "O5'" 1 
ATOM 2963  C "C5'" . DT  F  2 15  ? 110.150 -23.244  8.878   1.00 388.95 ? 15  DT  t "C5'" 1 
ATOM 2964  C "C4'" . DT  F  2 15  ? 110.246 -24.754  8.812   1.00 398.87 ? 15  DT  t "C4'" 1 
ATOM 2965  O "O4'" . DT  F  2 15  ? 110.254 -25.336  10.142  1.00 393.96 ? 15  DT  t "O4'" 1 
ATOM 2966  C "C3'" . DT  F  2 15  ? 109.141 -25.477  8.033   1.00 404.56 ? 15  DT  t "C3'" 1 
ATOM 2967  O "O3'" . DT  F  2 15  ? 109.750 -26.431  7.152   1.00 420.43 ? 15  DT  t "O3'" 1 
ATOM 2968  C "C2'" . DT  F  2 15  ? 108.349 -26.182  9.119   1.00 396.00 ? 15  DT  t "C2'" 1 
ATOM 2969  C "C1'" . DT  F  2 15  ? 109.422 -26.481  10.148  1.00 387.14 ? 15  DT  t "C1'" 1 
ATOM 2970  N N1    . DT  F  2 15  ? 108.949 -26.695  11.533  1.00 377.24 ? 15  DT  t N1    1 
ATOM 2971  C C2    . DT  F  2 15  ? 109.483 -27.746  12.246  1.00 372.93 ? 15  DT  t C2    1 
ATOM 2972  O O2    . DT  F  2 15  ? 110.312 -28.512  11.785  1.00 365.78 ? 15  DT  t O2    1 
ATOM 2973  N N3    . DT  F  2 15  ? 109.002 -27.870  13.527  1.00 376.46 ? 15  DT  t N3    1 
ATOM 2974  C C4    . DT  F  2 15  ? 108.070 -27.064  14.151  1.00 377.40 ? 15  DT  t C4    1 
ATOM 2975  O O4    . DT  F  2 15  ? 107.736 -27.299  15.309  1.00 385.77 ? 15  DT  t O4    1 
ATOM 2976  C C5    . DT  F  2 15  ? 107.554 -25.980  13.346  1.00 374.04 ? 15  DT  t C5    1 
ATOM 2977  C C7    . DT  F  2 15  ? 106.539 -25.053  13.937  1.00 372.44 ? 15  DT  t C7    1 
ATOM 2978  C C6    . DT  F  2 15  ? 108.015 -25.851  12.095  1.00 373.64 ? 15  DT  t C6    1 
ATOM 2979  P P     . DT  F  2 16  ? 108.989 -26.958  5.823   1.00 427.65 ? 16  DT  t P     1 
ATOM 2980  O OP1   . DT  F  2 16  ? 109.695 -26.420  4.631   1.00 434.32 ? 16  DT  t OP1   1 
ATOM 2981  O OP2   . DT  F  2 16  ? 107.530 -26.716  5.983   1.00 434.50 ? 16  DT  t OP2   1 
ATOM 2982  O "O5'" . DT  F  2 16  ? 109.238 -28.533  5.860   1.00 415.89 ? 16  DT  t "O5'" 1 
ATOM 2983  C "C5'" . DT  F  2 16  ? 110.350 -29.110  6.582   1.00 399.21 ? 16  DT  t "C5'" 1 
ATOM 2984  C "C4'" . DT  F  2 16  ? 109.959 -30.407  7.260   1.00 385.45 ? 16  DT  t "C4'" 1 
ATOM 2985  O "O4'" . DT  F  2 16  ? 109.472 -30.150  8.603   1.00 368.89 ? 16  DT  t "O4'" 1 
ATOM 2986  C "C3'" . DT  F  2 16  ? 108.872 -31.240  6.568   1.00 387.15 ? 16  DT  t "C3'" 1 
ATOM 2987  O "O3'" . DT  F  2 16  ? 109.234 -32.624  6.661   1.00 397.35 ? 16  DT  t "O3'" 1 
ATOM 2988  C "C2'" . DT  F  2 16  ? 107.661 -31.036  7.459   1.00 374.39 ? 16  DT  t "C2'" 1 
ATOM 2989  C "C1'" . DT  F  2 16  ? 108.325 -30.952  8.816   1.00 357.01 ? 16  DT  t "C1'" 1 
ATOM 2990  N N1    . DT  F  2 16  ? 107.520 -30.333  9.887   1.00 336.56 ? 16  DT  t N1    1 
ATOM 2991  C C2    . DT  F  2 16  ? 107.605 -30.879  11.148  1.00 320.28 ? 16  DT  t C2    1 
ATOM 2992  O O2    . DT  F  2 16  ? 108.317 -31.832  11.415  1.00 302.99 ? 16  DT  t O2    1 
ATOM 2993  N N3    . DT  F  2 16  ? 106.823 -30.259  12.092  1.00 320.09 ? 16  DT  t N3    1 
ATOM 2994  C C4    . DT  F  2 16  ? 105.978 -29.181  11.901  1.00 327.69 ? 16  DT  t C4    1 
ATOM 2995  O O4    . DT  F  2 16  ? 105.335 -28.733  12.846  1.00 329.15 ? 16  DT  t O4    1 
ATOM 2996  C C5    . DT  F  2 16  ? 105.933 -28.665  10.552  1.00 332.56 ? 16  DT  t C5    1 
ATOM 2997  C C7    . DT  F  2 16  ? 105.047 -27.498  10.250  1.00 334.31 ? 16  DT  t C7    1 
ATOM 2998  C C6    . DT  F  2 16  ? 106.693 -29.262  9.624   1.00 336.68 ? 16  DT  t C6    1 
ATOM 2999  P P     . DT  F  2 17  ? 108.688 -33.726  5.609   1.00 400.50 ? 17  DT  t P     1 
ATOM 3000  O OP1   . DT  F  2 17  ? 109.633 -33.783  4.464   1.00 410.96 ? 17  DT  t OP1   1 
ATOM 3001  O OP2   . DT  F  2 17  ? 107.238 -33.486  5.353   1.00 399.11 ? 17  DT  t OP2   1 
ATOM 3002  O "O5'" . DT  F  2 17  ? 108.851 -35.086  6.425   1.00 388.74 ? 17  DT  t "O5'" 1 
ATOM 3003  C "C5'" . DT  F  2 17  ? 109.749 -35.170  7.556   1.00 371.73 ? 17  DT  t "C5'" 1 
ATOM 3004  C "C4'" . DT  F  2 17  ? 109.113 -35.952  8.681   1.00 360.32 ? 17  DT  t "C4'" 1 
ATOM 3005  O "O4'" . DT  F  2 17  ? 108.340 -35.066  9.532   1.00 352.16 ? 17  DT  t "O4'" 1 
ATOM 3006  C "C3'" . DT  F  2 17  ? 108.146 -37.047  8.223   1.00 358.24 ? 17  DT  t "C3'" 1 
ATOM 3007  O "O3'" . DT  F  2 17  ? 108.276 -38.175  9.093   1.00 358.15 ? 17  DT  t "O3'" 1 
ATOM 3008  C "C2'" . DT  F  2 17  ? 106.787 -36.390  8.382   1.00 353.51 ? 17  DT  t "C2'" 1 
ATOM 3009  C "C1'" . DT  F  2 17  ? 107.006 -35.548  9.629   1.00 345.47 ? 17  DT  t "C1'" 1 
ATOM 3010  N N1    . DT  F  2 17  ? 106.101 -34.387  9.787   1.00 332.91 ? 17  DT  t N1    1 
ATOM 3011  C C2    . DT  F  2 17  ? 105.629 -34.103  11.050  1.00 324.76 ? 17  DT  t C2    1 
ATOM 3012  O O2    . DT  F  2 17  ? 105.936 -34.750  12.039  1.00 315.26 ? 17  DT  t O2    1 
ATOM 3013  N N3    . DT  F  2 17  ? 104.781 -33.024  11.113  1.00 324.96 ? 17  DT  t N3    1 
ATOM 3014  C C4    . DT  F  2 17  ? 104.365 -32.224  10.064  1.00 324.78 ? 17  DT  t C4    1 
ATOM 3015  O O4    . DT  F  2 17  ? 103.595 -31.291  10.273  1.00 325.64 ? 17  DT  t O4    1 
ATOM 3016  C C5    . DT  F  2 17  ? 104.890 -32.585  8.767   1.00 324.66 ? 17  DT  t C5    1 
ATOM 3017  C C7    . DT  F  2 17  ? 104.488 -31.782  7.570   1.00 320.35 ? 17  DT  t C7    1 
ATOM 3018  C C6    . DT  F  2 17  ? 105.716 -33.638  8.694   1.00 330.09 ? 17  DT  t C6    1 
ATOM 3019  P P     . DT  F  2 18  ? 107.996 -39.668  8.568   1.00 357.17 ? 18  DT  t P     1 
ATOM 3020  O OP1   . DT  F  2 18  ? 109.306 -40.303  8.276   1.00 351.22 ? 18  DT  t OP1   1 
ATOM 3021  O OP2   . DT  F  2 18  ? 106.952 -39.614  7.510   1.00 359.45 ? 18  DT  t OP2   1 
ATOM 3022  O "O5'" . DT  F  2 18  ? 107.377 -40.369  9.857   1.00 360.68 ? 18  DT  t "O5'" 1 
ATOM 3023  C "C5'" . DT  F  2 18  ? 107.339 -39.675  11.121  1.00 355.57 ? 18  DT  t "C5'" 1 
ATOM 3024  C "C4'" . DT  F  2 18  ? 105.945 -39.714  11.703  1.00 348.54 ? 18  DT  t "C4'" 1 
ATOM 3025  O "O4'" . DT  F  2 18  ? 105.278 -38.441  11.518  1.00 342.84 ? 18  DT  t "O4'" 1 
ATOM 3026  C "C3'" . DT  F  2 18  ? 105.027 -40.771  11.083  1.00 348.18 ? 18  DT  t "C3'" 1 
ATOM 3027  O "O3'" . DT  F  2 18  ? 104.352 -41.466  12.132  1.00 345.88 ? 18  DT  t "O3'" 1 
ATOM 3028  C "C2'" . DT  F  2 18  ? 104.026 -39.957  10.283  1.00 344.00 ? 18  DT  t "C2'" 1 
ATOM 3029  C "C1'" . DT  F  2 18  ? 103.945 -38.690  11.104  1.00 339.80 ? 18  DT  t "C1'" 1 
ATOM 3030  N N1    . DT  F  2 18  ? 103.456 -37.510  10.362  1.00 332.87 ? 18  DT  t N1    1 
ATOM 3031  C C2    . DT  F  2 18  ? 102.740 -36.553  11.049  1.00 329.97 ? 18  DT  t C2    1 
ATOM 3032  O O2    . DT  F  2 18  ? 102.514 -36.620  12.247  1.00 332.69 ? 18  DT  t O2    1 
ATOM 3033  N N3    . DT  F  2 18  ? 102.302 -35.505  10.276  1.00 322.63 ? 18  DT  t N3    1 
ATOM 3034  C C4    . DT  F  2 18  ? 102.496 -35.328  8.917   1.00 314.71 ? 18  DT  t C4    1 
ATOM 3035  O O4    . DT  F  2 18  ? 102.042 -34.333  8.358   1.00 303.49 ? 18  DT  t O4    1 
ATOM 3036  C C5    . DT  F  2 18  ? 103.248 -36.374  8.261   1.00 317.62 ? 18  DT  t C5    1 
ATOM 3037  C C7    . DT  F  2 18  ? 103.511 -36.267  6.792   1.00 315.16 ? 18  DT  t C7    1 
ATOM 3038  C C6    . DT  F  2 18  ? 103.675 -37.403  9.005   1.00 326.02 ? 18  DT  t C6    1 
ATOM 3039  P P     . DT  F  2 19  ? 103.671 -42.889  11.855  1.00 346.73 ? 19  DT  t P     1 
ATOM 3040  O OP1   . DT  F  2 19  ? 104.641 -43.944  12.248  1.00 349.74 ? 19  DT  t OP1   1 
ATOM 3041  O OP2   . DT  F  2 19  ? 103.106 -42.882  10.477  1.00 345.66 ? 19  DT  t OP2   1 
ATOM 3042  O "O5'" . DT  F  2 19  ? 102.461 -42.906  12.890  1.00 340.02 ? 19  DT  t "O5'" 1 
ATOM 3043  C "C5'" . DT  F  2 19  ? 102.480 -42.059  14.057  1.00 337.24 ? 19  DT  t "C5'" 1 
ATOM 3044  C "C4'" . DT  F  2 19  ? 101.130 -41.413  14.266  1.00 339.59 ? 19  DT  t "C4'" 1 
ATOM 3045  O "O4'" . DT  F  2 19  ? 100.997 -40.218  13.453  1.00 337.01 ? 19  DT  t "O4'" 1 
ATOM 3046  C "C3'" . DT  F  2 19  ? 99.925  -42.294  13.925  1.00 343.48 ? 19  DT  t "C3'" 1 
ATOM 3047  O "O3'" . DT  F  2 19  ? 98.947  -42.109  14.949  1.00 352.37 ? 19  DT  t "O3'" 1 
ATOM 3048  C "C2'" . DT  F  2 19  ? 99.402  -41.686  12.637  1.00 339.93 ? 19  DT  t "C2'" 1 
ATOM 3049  C "C1'" . DT  F  2 19  ? 99.706  -40.222  12.871  1.00 337.52 ? 19  DT  t "C1'" 1 
ATOM 3050  N N1    . DT  F  2 19  ? 99.749  -39.397  11.651  1.00 332.35 ? 19  DT  t N1    1 
ATOM 3051  C C2    . DT  F  2 19  ? 99.209  -38.129  11.689  1.00 328.69 ? 19  DT  t C2    1 
ATOM 3052  O O2    . DT  F  2 19  ? 98.711  -37.643  12.693  1.00 320.55 ? 19  DT  t O2    1 
ATOM 3053  N N3    . DT  F  2 19  ? 99.278  -37.443  10.501  1.00 330.74 ? 19  DT  t N3    1 
ATOM 3054  C C4    . DT  F  2 19  ? 99.807  -37.895  9.304   1.00 332.01 ? 19  DT  t C4    1 
ATOM 3055  O O4    . DT  F  2 19  ? 99.797  -37.163  8.317   1.00 336.32 ? 19  DT  t O4    1 
ATOM 3056  C C5    . DT  F  2 19  ? 100.345 -39.238  9.336   1.00 329.73 ? 19  DT  t C5    1 
ATOM 3057  C C7    . DT  F  2 19  ? 100.941 -39.813  8.090   1.00 325.85 ? 19  DT  t C7    1 
ATOM 3058  C C6    . DT  F  2 19  ? 100.285 -39.912  10.491  1.00 330.09 ? 19  DT  t C6    1 
ATOM 3059  P P     . DT  F  2 20  ? 97.841  -43.230  15.230  1.00 359.21 ? 20  DT  t P     1 
ATOM 3060  O OP1   . DT  F  2 20  ? 98.331  -44.092  16.333  1.00 365.62 ? 20  DT  t OP1   1 
ATOM 3061  O OP2   . DT  F  2 20  ? 97.450  -43.838  13.934  1.00 359.55 ? 20  DT  t OP2   1 
ATOM 3062  O "O5'" . DT  F  2 20  ? 96.601  -42.387  15.770  1.00 357.73 ? 20  DT  t "O5'" 1 
ATOM 3063  C "C5'" . DT  F  2 20  ? 96.772  -41.039  16.252  1.00 355.67 ? 20  DT  t "C5'" 1 
ATOM 3064  C "C4'" . DT  F  2 20  ? 95.571  -40.191  15.901  1.00 349.41 ? 20  DT  t "C4'" 1 
ATOM 3065  O "O4'" . DT  F  2 20  ? 95.833  -39.444  14.689  1.00 341.03 ? 20  DT  t "O4'" 1 
ATOM 3066  C "C3'" . DT  F  2 20  ? 94.287  -40.975  15.634  1.00 348.25 ? 20  DT  t "C3'" 1 
ATOM 3067  O "O3'" . DT  F  2 20  ? 93.148  -40.207  16.013  1.00 354.06 ? 20  DT  t "O3'" 1 
ATOM 3068  C "C2'" . DT  F  2 20  ? 94.245  -41.058  14.126  1.00 340.47 ? 20  DT  t "C2'" 1 
ATOM 3069  C "C1'" . DT  F  2 20  ? 94.799  -39.701  13.756  1.00 336.02 ? 20  DT  t "C1'" 1 
ATOM 3070  N N1    . DT  F  2 20  ? 95.382  -39.659  12.417  1.00 329.13 ? 20  DT  t N1    1 
ATOM 3071  C C2    . DT  F  2 20  ? 95.265  -38.492  11.699  1.00 324.89 ? 20  DT  t C2    1 
ATOM 3072  O O2    . DT  F  2 20  ? 94.715  -37.493  12.137  1.00 316.22 ? 20  DT  t O2    1 
ATOM 3073  N N3    . DT  F  2 20  ? 95.825  -38.535  10.445  1.00 328.13 ? 20  DT  t N3    1 
ATOM 3074  C C4    . DT  F  2 20  ? 96.457  -39.612  9.846   1.00 331.25 ? 20  DT  t C4    1 
ATOM 3075  O O4    . DT  F  2 20  ? 96.906  -39.504  8.705   1.00 338.93 ? 20  DT  t O4    1 
ATOM 3076  C C5    . DT  F  2 20  ? 96.537  -40.808  10.658  1.00 329.84 ? 20  DT  t C5    1 
ATOM 3077  C C7    . DT  F  2 20  ? 97.206  -42.024  10.098  1.00 326.02 ? 20  DT  t C7    1 
ATOM 3078  C C6    . DT  F  2 20  ? 95.999  -40.772  11.885  1.00 329.54 ? 20  DT  t C6    1 
ATOM 3079  P P     . DT  F  2 21  ? 91.769  -40.944  16.266  1.00 361.64 ? 21  DT  t P     1 
ATOM 3080  O OP1   . DT  F  2 21  ? 91.613  -41.102  17.729  1.00 369.63 ? 21  DT  t OP1   1 
ATOM 3081  O OP2   . DT  F  2 21  ? 91.712  -42.129  15.375  1.00 362.84 ? 21  DT  t OP2   1 
ATOM 3082  O "O5'" . DT  F  2 21  ? 90.684  -39.900  15.752  1.00 361.84 ? 21  DT  t "O5'" 1 
ATOM 3083  C "C5'" . DT  F  2 21  ? 90.952  -38.487  15.756  1.00 366.18 ? 21  DT  t "C5'" 1 
ATOM 3084  C "C4'" . DT  F  2 21  ? 90.144  -37.772  14.696  1.00 374.81 ? 21  DT  t "C4'" 1 
ATOM 3085  O "O4'" . DT  F  2 21  ? 90.878  -37.789  13.450  1.00 372.44 ? 21  DT  t "O4'" 1 
ATOM 3086  C "C3'" . DT  F  2 21  ? 88.770  -38.368  14.374  1.00 388.19 ? 21  DT  t "C3'" 1 
ATOM 3087  O "O3'" . DT  F  2 21  ? 87.858  -37.354  13.923  1.00 406.13 ? 21  DT  t "O3'" 1 
ATOM 3088  C "C2'" . DT  F  2 21  ? 89.071  -39.268  13.193  1.00 387.80 ? 21  DT  t "C2'" 1 
ATOM 3089  C "C1'" . DT  F  2 21  ? 90.093  -38.424  12.454  1.00 384.85 ? 21  DT  t "C1'" 1 
ATOM 3090  N N1    . DT  F  2 21  ? 90.999  -39.168  11.580  1.00 390.67 ? 21  DT  t N1    1 
ATOM 3091  C C2    . DT  F  2 21  ? 91.458  -38.521  10.458  1.00 390.60 ? 21  DT  t C2    1 
ATOM 3092  O O2    . DT  F  2 21  ? 91.145  -37.376  10.176  1.00 388.07 ? 21  DT  t O2    1 
ATOM 3093  N N3    . DT  F  2 21  ? 92.299  -39.268  9.671   1.00 394.25 ? 21  DT  t N3    1 
ATOM 3094  C C4    . DT  F  2 21  ? 92.713  -40.568  9.890   1.00 397.31 ? 21  DT  t C4    1 
ATOM 3095  O O4    . DT  F  2 21  ? 93.471  -41.111  9.089   1.00 403.54 ? 21  DT  t O4    1 
ATOM 3096  C C5    . DT  F  2 21  ? 92.192  -41.187  11.091  1.00 396.37 ? 21  DT  t C5    1 
ATOM 3097  C C7    . DT  F  2 21  ? 92.584  -42.594  11.414  1.00 395.16 ? 21  DT  t C7    1 
ATOM 3098  C C6    . DT  F  2 21  ? 91.372  -40.464  11.865  1.00 394.39 ? 21  DT  t C6    1 
ATOM 3099  P P     . DT  F  2 22  ? 86.271  -37.556  14.090  1.00 424.55 ? 22  DT  t P     1 
ATOM 3100  O OP1   . DT  F  2 22  ? 85.838  -36.792  15.284  1.00 432.70 ? 22  DT  t OP1   1 
ATOM 3101  O OP2   . DT  F  2 22  ? 85.978  -39.009  14.001  1.00 430.60 ? 22  DT  t OP2   1 
ATOM 3102  O "O5'" . DT  F  2 22  ? 85.648  -36.871  12.790  1.00 418.82 ? 22  DT  t "O5'" 1 
ATOM 3103  C "C5'" . DT  F  2 22  ? 86.216  -35.686  12.198  1.00 403.79 ? 22  DT  t "C5'" 1 
ATOM 3104  C "C4'" . DT  F  2 22  ? 85.959  -35.662  10.707  1.00 391.98 ? 22  DT  t "C4'" 1 
ATOM 3105  O "O4'" . DT  F  2 22  ? 87.012  -36.383  10.021  1.00 380.21 ? 22  DT  t "O4'" 1 
ATOM 3106  C "C3'" . DT  F  2 22  ? 84.639  -36.292  10.248  1.00 392.17 ? 22  DT  t "C3'" 1 
ATOM 3107  O "O3'" . DT  F  2 22  ? 84.033  -35.481  9.230   1.00 397.62 ? 22  DT  t "O3'" 1 
ATOM 3108  C "C2'" . DT  F  2 22  ? 85.068  -37.625  9.660   1.00 381.85 ? 22  DT  t "C2'" 1 
ATOM 3109  C "C1'" . DT  F  2 22  ? 86.436  -37.291  9.097   1.00 368.84 ? 22  DT  t "C1'" 1 
ATOM 3110  N N1    . DT  F  2 22  ? 87.354  -38.439  8.949   1.00 352.18 ? 22  DT  t N1    1 
ATOM 3111  C C2    . DT  F  2 22  ? 88.268  -38.404  7.919   1.00 342.03 ? 22  DT  t C2    1 
ATOM 3112  O O2    . DT  F  2 22  ? 88.359  -37.469  7.140   1.00 337.61 ? 22  DT  t O2    1 
ATOM 3113  N N3    . DT  F  2 22  ? 89.078  -39.510  7.835   1.00 336.27 ? 22  DT  t N3    1 
ATOM 3114  C C4    . DT  F  2 22  ? 89.061  -40.624  8.653   1.00 334.60 ? 22  DT  t C4    1 
ATOM 3115  O O4    . DT  F  2 22  ? 89.849  -41.544  8.450   1.00 336.58 ? 22  DT  t O4    1 
ATOM 3116  C C5    . DT  F  2 22  ? 88.072  -40.597  9.709   1.00 336.03 ? 22  DT  t C5    1 
ATOM 3117  C C7    . DT  F  2 22  ? 87.978  -41.759  10.646  1.00 330.03 ? 22  DT  t C7    1 
ATOM 3118  C C6    . DT  F  2 22  ? 87.278  -39.521  9.801   1.00 344.44 ? 22  DT  t C6    1 
ATOM 3119  P P     . DT  F  2 23  ? 82.488  -35.684  8.810   1.00 404.05 ? 23  DT  t P     1 
ATOM 3120  O OP1   . DT  F  2 23  ? 81.677  -34.657  9.517   1.00 409.69 ? 23  DT  t OP1   1 
ATOM 3121  O OP2   . DT  F  2 23  ? 82.140  -37.121  8.960   1.00 405.30 ? 23  DT  t OP2   1 
ATOM 3122  O "O5'" . DT  F  2 23  ? 82.489  -35.348  7.251   1.00 399.30 ? 23  DT  t "O5'" 1 
ATOM 3123  C "C5'" . DT  F  2 23  ? 83.477  -34.463  6.672   1.00 388.21 ? 23  DT  t "C5'" 1 
ATOM 3124  C "C4'" . DT  F  2 23  ? 83.852  -34.884  5.267   1.00 375.67 ? 23  DT  t "C4'" 1 
ATOM 3125  O "O4'" . DT  F  2 23  ? 84.893  -35.891  5.301   1.00 363.46 ? 23  DT  t "O4'" 1 
ATOM 3126  C "C3'" . DT  F  2 23  ? 82.715  -35.462  4.415   1.00 377.44 ? 23  DT  t "C3'" 1 
ATOM 3127  O "O3'" . DT  F  2 23  ? 82.698  -34.865  3.110   1.00 384.25 ? 23  DT  t "O3'" 1 
ATOM 3128  C "C2'" . DT  F  2 23  ? 83.050  -36.940  4.327   1.00 369.08 ? 23  DT  t "C2'" 1 
ATOM 3129  C "C1'" . DT  F  2 23  ? 84.564  -36.943  4.413   1.00 360.06 ? 23  DT  t "C1'" 1 
ATOM 3130  N N1    . DT  F  2 23  ? 85.143  -38.187  4.951   1.00 352.95 ? 23  DT  t N1    1 
ATOM 3131  C C2    . DT  F  2 23  ? 86.285  -38.675  4.356   1.00 348.37 ? 23  DT  t C2    1 
ATOM 3132  O O2    . DT  F  2 23  ? 86.833  -38.126  3.414   1.00 347.23 ? 23  DT  t O2    1 
ATOM 3133  N N3    . DT  F  2 23  ? 86.766  -39.835  4.912   1.00 344.63 ? 23  DT  t N3    1 
ATOM 3134  C C4    . DT  F  2 23  ? 86.230  -40.539  5.975   1.00 344.01 ? 23  DT  t C4    1 
ATOM 3135  O O4    . DT  F  2 23  ? 86.776  -41.565  6.366   1.00 340.46 ? 23  DT  t O4    1 
ATOM 3136  C C5    . DT  F  2 23  ? 85.030  -39.972  6.547   1.00 346.27 ? 23  DT  t C5    1 
ATOM 3137  C C7    . DT  F  2 23  ? 84.379  -40.665  7.701   1.00 344.20 ? 23  DT  t C7    1 
ATOM 3138  C C6    . DT  F  2 23  ? 84.555  -38.838  6.014   1.00 350.37 ? 23  DT  t C6    1 
ATOM 3139  P P     . DT  F  2 24  ? 81.371  -34.917  2.193   1.00 395.58 ? 24  DT  t P     1 
ATOM 3140  O OP1   . DT  F  2 24  ? 80.731  -33.575  2.227   1.00 398.83 ? 24  DT  t OP1   1 
ATOM 3141  O OP2   . DT  F  2 24  ? 80.572  -36.110  2.587   1.00 398.35 ? 24  DT  t OP2   1 
ATOM 3142  O "O5'" . DT  F  2 24  ? 81.959  -35.146  0.729   1.00 394.38 ? 24  DT  t "O5'" 1 
ATOM 3143  C "C5'" . DT  F  2 24  ? 83.335  -34.830  0.401   1.00 390.79 ? 24  DT  t "C5'" 1 
ATOM 3144  C "C4'" . DT  F  2 24  ? 83.925  -35.866  -0.528  1.00 393.89 ? 24  DT  t "C4'" 1 
ATOM 3145  O "O4'" . DT  F  2 24  ? 84.512  -36.943  0.246   1.00 390.04 ? 24  DT  t "O4'" 1 
ATOM 3146  C "C3'" . DT  F  2 24  ? 82.928  -36.526  -1.490  1.00 406.04 ? 24  DT  t "C3'" 1 
ATOM 3147  O "O3'" . DT  F  2 24  ? 83.473  -36.659  -2.810  1.00 426.00 ? 24  DT  t "O3'" 1 
ATOM 3148  C "C2'" . DT  F  2 24  ? 82.741  -37.912  -0.902  1.00 401.95 ? 24  DT  t "C2'" 1 
ATOM 3149  C "C1'" . DT  F  2 24  ? 84.112  -38.178  -0.322  1.00 396.21 ? 24  DT  t "C1'" 1 
ATOM 3150  N N1    . DT  F  2 24  ? 84.113  -39.204  0.739   1.00 399.64 ? 24  DT  t N1    1 
ATOM 3151  C C2    . DT  F  2 24  ? 85.149  -40.111  0.782   1.00 400.24 ? 24  DT  t C2    1 
ATOM 3152  O O2    . DT  F  2 24  ? 86.097  -40.080  0.014   1.00 396.79 ? 24  DT  t O2    1 
ATOM 3153  N N3    . DT  F  2 24  ? 85.046  -41.049  1.779   1.00 403.64 ? 24  DT  t N3    1 
ATOM 3154  C C4    . DT  F  2 24  ? 84.026  -41.178  2.704   1.00 405.76 ? 24  DT  t C4    1 
ATOM 3155  O O4    . DT  F  2 24  ? 84.073  -42.072  3.544   1.00 412.51 ? 24  DT  t O4    1 
ATOM 3156  C C5    . DT  F  2 24  ? 82.960  -40.207  2.585   1.00 402.77 ? 24  DT  t C5    1 
ATOM 3157  C C7    . DT  F  2 24  ? 81.810  -40.268  3.541   1.00 396.57 ? 24  DT  t C7    1 
ATOM 3158  C C6    . DT  F  2 24  ? 83.051  -39.289  1.615   1.00 402.12 ? 24  DT  t C6    1 
ATOM 3159  P P     . DT  F  2 25  ? 82.512  -36.909  -4.092  1.00 451.67 ? 25  DT  t P     1 
ATOM 3160  O OP1   . DT  F  2 25  ? 82.480  -35.657  -4.886  1.00 466.69 ? 25  DT  t OP1   1 
ATOM 3161  O OP2   . DT  F  2 25  ? 81.232  -37.516  -3.628  1.00 452.95 ? 25  DT  t OP2   1 
ATOM 3162  O "O5'" . DT  F  2 25  ? 83.302  -38.005  -4.943  1.00 452.07 ? 25  DT  t "O5'" 1 
ATOM 3163  C "C5'" . DT  F  2 25  ? 84.739  -38.148  -4.842  1.00 449.19 ? 25  DT  t "C5'" 1 
ATOM 3164  C "C4'" . DT  F  2 25  ? 85.178  -39.584  -5.043  1.00 446.70 ? 25  DT  t "C4'" 1 
ATOM 3165  O "O4'" . DT  F  2 25  ? 85.098  -40.328  -3.806  1.00 446.81 ? 25  DT  t "O4'" 1 
ATOM 3166  C "C3'" . DT  F  2 25  ? 84.393  -40.397  -6.077  1.00 443.62 ? 25  DT  t "C3'" 1 
ATOM 3167  O "O3'" . DT  F  2 25  ? 85.279  -41.212  -6.859  1.00 428.36 ? 25  DT  t "O3'" 1 
ATOM 3168  C "C2'" . DT  F  2 25  ? 83.532  -41.319  -5.231  1.00 449.60 ? 25  DT  t "C2'" 1 
ATOM 3169  C "C1'" . DT  F  2 25  ? 84.441  -41.567  -4.038  1.00 450.64 ? 25  DT  t "C1'" 1 
ATOM 3170  N N1    . DT  F  2 25  ? 83.759  -41.964  -2.786  1.00 453.92 ? 25  DT  t N1    1 
ATOM 3171  C C2    . DT  F  2 25  ? 84.299  -42.989  -2.040  1.00 449.45 ? 25  DT  t C2    1 
ATOM 3172  O O2    . DT  F  2 25  ? 85.310  -43.593  -2.364  1.00 435.38 ? 25  DT  t O2    1 
ATOM 3173  N N3    . DT  F  2 25  ? 83.605  -43.286  -0.893  1.00 455.22 ? 25  DT  t N3    1 
ATOM 3174  C C4    . DT  F  2 25  ? 82.454  -42.675  -0.430  1.00 460.67 ? 25  DT  t C4    1 
ATOM 3175  O O4    . DT  F  2 25  ? 81.944  -43.049  0.621   1.00 463.90 ? 25  DT  t O4    1 
ATOM 3176  C C5    . DT  F  2 25  ? 81.944  -41.608  -1.262  1.00 460.52 ? 25  DT  t C5    1 
ATOM 3177  C C7    . DT  F  2 25  ? 80.701  -40.889  -0.841  1.00 463.12 ? 25  DT  t C7    1 
ATOM 3178  C C6    . DT  F  2 25  ? 82.615  -41.309  -2.382  1.00 457.99 ? 25  DT  t C6    1 
ATOM 3179  P P     . DT  F  2 26  ? 85.040  -41.338  -8.421  1.00 412.99 ? 26  DT  t P     1 
ATOM 3180  O OP1   . DT  F  2 26  ? 86.192  -40.703  -9.111  1.00 411.29 ? 26  DT  t OP1   1 
ATOM 3181  O OP2   . DT  F  2 26  ? 83.673  -40.848  -8.684  1.00 413.01 ? 26  DT  t OP2   1 
ATOM 3182  O "O5'" . DT  F  2 26  ? 84.997  -42.913  -8.681  1.00 399.53 ? 26  DT  t "O5'" 1 
ATOM 3183  C "C5'" . DT  F  2 26  ? 86.079  -43.800  -8.339  1.00 371.72 ? 26  DT  t "C5'" 1 
ATOM 3184  C "C4'" . DT  F  2 26  ? 85.577  -45.217  -8.167  1.00 354.95 ? 26  DT  t "C4'" 1 
ATOM 3185  O "O4'" . DT  F  2 26  ? 85.011  -45.385  -6.850  1.00 346.74 ? 26  DT  t "O4'" 1 
ATOM 3186  C "C3'" . DT  F  2 26  ? 84.512  -45.688  -9.162  1.00 352.43 ? 26  DT  t "C3'" 1 
ATOM 3187  O "O3'" . DT  F  2 26  ? 84.885  -46.942  -9.740  1.00 347.29 ? 26  DT  t "O3'" 1 
ATOM 3188  C "C2'" . DT  F  2 26  ? 83.270  -45.908  -8.321  1.00 350.41 ? 26  DT  t "C2'" 1 
ATOM 3189  C "C1'" . DT  F  2 26  ? 83.820  -46.143  -6.929  1.00 344.38 ? 26  DT  t "C1'" 1 
ATOM 3190  N N1    . DT  F  2 26  ? 82.924  -45.665  -5.871  1.00 339.19 ? 26  DT  t N1    1 
ATOM 3191  C C2    . DT  F  2 26  ? 83.084  -46.161  -4.598  1.00 335.30 ? 26  DT  t C2    1 
ATOM 3192  O O2    . DT  F  2 26  ? 83.924  -46.997  -4.309  1.00 332.94 ? 26  DT  t O2    1 
ATOM 3193  N N3    . DT  F  2 26  ? 82.216  -45.642  -3.670  1.00 335.53 ? 26  DT  t N3    1 
ATOM 3194  C C4    . DT  F  2 26  ? 81.237  -44.690  -3.881  1.00 336.58 ? 26  DT  t C4    1 
ATOM 3195  O O4    . DT  F  2 26  ? 80.523  -44.330  -2.949  1.00 338.78 ? 26  DT  t O4    1 
ATOM 3196  C C5    . DT  F  2 26  ? 81.126  -44.212  -5.242  1.00 337.60 ? 26  DT  t C5    1 
ATOM 3197  C C7    . DT  F  2 26  ? 80.092  -43.182  -5.571  1.00 335.18 ? 26  DT  t C7    1 
ATOM 3198  C C6    . DT  F  2 26  ? 81.973  -44.709  -6.153  1.00 340.20 ? 26  DT  t C6    1 
ATOM 3199  P P     . DA  G  1 1   ? 75.998  49.522   124.544 1.00 354.13 ? 1   DA  u P     1 
ATOM 3200  O OP1   . DA  G  1 1   ? 75.452  49.628   123.172 1.00 354.17 ? 1   DA  u OP1   1 
ATOM 3201  O OP2   . DA  G  1 1   ? 75.775  48.282   125.330 1.00 357.19 ? 1   DA  u OP2   1 
ATOM 3202  O "O5'" . DA  G  1 1   ? 77.573  49.778   124.501 1.00 362.17 ? 1   DA  u "O5'" 1 
ATOM 3203  C "C5'" . DA  G  1 1   ? 78.137  50.892   125.206 1.00 381.37 ? 1   DA  u "C5'" 1 
ATOM 3204  C "C4'" . DA  G  1 1   ? 79.493  50.534   125.771 1.00 405.06 ? 1   DA  u "C4'" 1 
ATOM 3205  O "O4'" . DA  G  1 1   ? 79.432  49.256   126.447 1.00 417.83 ? 1   DA  u "O4'" 1 
ATOM 3206  C "C3'" . DA  G  1 1   ? 80.627  50.418   124.748 1.00 415.81 ? 1   DA  u "C3'" 1 
ATOM 3207  O "O3'" . DA  G  1 1   ? 81.792  51.039   125.301 1.00 427.22 ? 1   DA  u "O3'" 1 
ATOM 3208  C "C2'" . DA  G  1 1   ? 80.842  48.919   124.623 1.00 421.88 ? 1   DA  u "C2'" 1 
ATOM 3209  C "C1'" . DA  G  1 1   ? 80.528  48.456   126.034 1.00 431.36 ? 1   DA  u "C1'" 1 
ATOM 3210  N N9    . DA  G  1 1   ? 80.149  47.051   126.199 1.00 443.72 ? 1   DA  u N9    1 
ATOM 3211  C C8    . DA  G  1 1   ? 79.328  46.287   125.406 1.00 442.06 ? 1   DA  u C8    1 
ATOM 3212  N N7    . DA  G  1 1   ? 79.170  45.058   125.836 1.00 448.34 ? 1   DA  u N7    1 
ATOM 3213  C C5    . DA  G  1 1   ? 79.924  45.014   127.001 1.00 459.20 ? 1   DA  u C5    1 
ATOM 3214  C C6    . DA  G  1 1   ? 80.164  43.989   127.938 1.00 467.29 ? 1   DA  u C6    1 
ATOM 3215  N N6    . DA  G  1 1   ? 79.648  42.763   127.839 1.00 480.07 ? 1   DA  u N6    1 
ATOM 3216  N N1    . DA  G  1 1   ? 80.964  44.273   128.990 1.00 465.05 ? 1   DA  u N1    1 
ATOM 3217  C C2    . DA  G  1 1   ? 81.483  45.504   129.087 1.00 461.43 ? 1   DA  u C2    1 
ATOM 3218  N N3    . DA  G  1 1   ? 81.332  46.549   128.274 1.00 463.03 ? 1   DA  u N3    1 
ATOM 3219  C C4    . DA  G  1 1   ? 80.528  46.236   127.240 1.00 455.65 ? 1   DA  u C4    1 
ATOM 3220  P P     . DA  G  1 2   ? 82.862  51.745   124.351 1.00 430.34 ? 2   DA  u P     1 
ATOM 3221  O OP1   . DA  G  1 2   ? 82.705  53.215   124.490 1.00 433.00 ? 2   DA  u OP1   1 
ATOM 3222  O OP2   . DA  G  1 2   ? 82.766  51.116   123.015 1.00 433.08 ? 2   DA  u OP2   1 
ATOM 3223  O "O5'" . DA  G  1 2   ? 84.255  51.320   124.994 1.00 420.84 ? 2   DA  u "O5'" 1 
ATOM 3224  C "C5'" . DA  G  1 2   ? 84.377  51.065   126.403 1.00 408.48 ? 2   DA  u "C5'" 1 
ATOM 3225  C "C4'" . DA  G  1 2   ? 85.373  49.957   126.654 1.00 395.86 ? 2   DA  u "C4'" 1 
ATOM 3226  O "O4'" . DA  G  1 2   ? 84.702  48.677   126.751 1.00 395.52 ? 2   DA  u "O4'" 1 
ATOM 3227  C "C3'" . DA  G  1 2   ? 86.453  49.787   125.585 1.00 387.58 ? 2   DA  u "C3'" 1 
ATOM 3228  O "O3'" . DA  G  1 2   ? 87.664  49.544   126.295 1.00 387.70 ? 2   DA  u "O3'" 1 
ATOM 3229  C "C2'" . DA  G  1 2   ? 86.067  48.493   124.889 1.00 384.24 ? 2   DA  u "C2'" 1 
ATOM 3230  C "C1'" . DA  G  1 2   ? 85.472  47.723   126.043 1.00 388.02 ? 2   DA  u "C1'" 1 
ATOM 3231  N N9    . DA  G  1 2   ? 84.591  46.624   125.658 1.00 387.70 ? 2   DA  u N9    1 
ATOM 3232  C C8    . DA  G  1 2   ? 83.812  46.531   124.531 1.00 386.47 ? 2   DA  u C8    1 
ATOM 3233  N N7    . DA  G  1 2   ? 83.128  45.416   124.453 1.00 387.62 ? 2   DA  u N7    1 
ATOM 3234  C C5    . DA  G  1 2   ? 83.481  44.726   125.605 1.00 391.48 ? 2   DA  u C5    1 
ATOM 3235  C C6    . DA  G  1 2   ? 83.099  43.470   126.112 1.00 396.20 ? 2   DA  u C6    1 
ATOM 3236  N N6    . DA  G  1 2   ? 82.240  42.652   125.498 1.00 405.29 ? 2   DA  u N6    1 
ATOM 3237  N N1    . DA  G  1 2   ? 83.633  43.080   127.290 1.00 394.19 ? 2   DA  u N1    1 
ATOM 3238  C C2    . DA  G  1 2   ? 84.500  43.897   127.903 1.00 387.60 ? 2   DA  u C2    1 
ATOM 3239  N N3    . DA  G  1 2   ? 84.937  45.097   127.527 1.00 387.66 ? 2   DA  u N3    1 
ATOM 3240  C C4    . DA  G  1 2   ? 84.385  45.458   126.355 1.00 388.98 ? 2   DA  u C4    1 
ATOM 3241  P P     . DA  G  1 3   ? 89.070  49.932   125.660 1.00 391.17 ? 3   DA  u P     1 
ATOM 3242  O OP1   . DA  G  1 3   ? 89.303  51.377   125.915 1.00 386.38 ? 3   DA  u OP1   1 
ATOM 3243  O OP2   . DA  G  1 3   ? 89.115  49.410   124.272 1.00 388.11 ? 3   DA  u OP2   1 
ATOM 3244  O "O5'" . DA  G  1 3   ? 90.082  49.051   126.519 1.00 403.31 ? 3   DA  u "O5'" 1 
ATOM 3245  C "C5'" . DA  G  1 3   ? 89.648  48.447   127.752 1.00 411.82 ? 3   DA  u "C5'" 1 
ATOM 3246  C "C4'" . DA  G  1 3   ? 90.078  47.000   127.823 1.00 411.49 ? 3   DA  u "C4'" 1 
ATOM 3247  O "O4'" . DA  G  1 3   ? 89.016  46.124   127.371 1.00 403.56 ? 3   DA  u "O4'" 1 
ATOM 3248  C "C3'" . DA  G  1 3   ? 91.305  46.647   126.982 1.00 414.81 ? 3   DA  u "C3'" 1 
ATOM 3249  O "O3'" . DA  G  1 3   ? 92.077  45.743   127.769 1.00 426.30 ? 3   DA  u "O3'" 1 
ATOM 3250  C "C2'" . DA  G  1 3   ? 90.717  45.885   125.809 1.00 403.71 ? 3   DA  u "C2'" 1 
ATOM 3251  C "C1'" . DA  G  1 3   ? 89.573  45.168   126.489 1.00 394.80 ? 3   DA  u "C1'" 1 
ATOM 3252  N N9    . DA  G  1 3   ? 88.524  44.720   125.580 1.00 380.08 ? 3   DA  u N9    1 
ATOM 3253  C C8    . DA  G  1 3   ? 88.125  45.309   124.407 1.00 374.27 ? 3   DA  u C8    1 
ATOM 3254  N N7    . DA  G  1 3   ? 87.169  44.660   123.789 1.00 374.06 ? 3   DA  u N7    1 
ATOM 3255  C C5    . DA  G  1 3   ? 86.932  43.561   124.603 1.00 378.16 ? 3   DA  u C5    1 
ATOM 3256  C C6    . DA  G  1 3   ? 86.033  42.485   124.503 1.00 383.91 ? 3   DA  u C6    1 
ATOM 3257  N N6    . DA  G  1 3   ? 85.169  42.333   123.498 1.00 388.55 ? 3   DA  u N6    1 
ATOM 3258  N N1    . DA  G  1 3   ? 86.052  41.556   125.484 1.00 384.52 ? 3   DA  u N1    1 
ATOM 3259  C C2    . DA  G  1 3   ? 86.913  41.713   126.498 1.00 379.83 ? 3   DA  u C2    1 
ATOM 3260  N N3    . DA  G  1 3   ? 87.802  42.682   126.705 1.00 375.72 ? 3   DA  u N3    1 
ATOM 3261  C C4    . DA  G  1 3   ? 87.763  43.583   125.708 1.00 376.69 ? 3   DA  u C4    1 
ATOM 3262  P P     . DA  G  1 4   ? 93.633  45.548   127.491 1.00 437.03 ? 4   DA  u P     1 
ATOM 3263  O OP1   . DA  G  1 4   ? 94.365  46.600   128.240 1.00 436.33 ? 4   DA  u OP1   1 
ATOM 3264  O OP2   . DA  G  1 4   ? 93.836  45.436   126.020 1.00 443.61 ? 4   DA  u OP2   1 
ATOM 3265  O "O5'" . DA  G  1 4   ? 93.915  44.134   128.171 1.00 429.57 ? 4   DA  u "O5'" 1 
ATOM 3266  C "C5'" . DA  G  1 4   ? 92.942  43.526   129.058 1.00 414.94 ? 4   DA  u "C5'" 1 
ATOM 3267  C "C4'" . DA  G  1 4   ? 92.748  42.063   128.729 1.00 406.57 ? 4   DA  u "C4'" 1 
ATOM 3268  O "O4'" . DA  G  1 4   ? 91.706  41.897   127.736 1.00 399.46 ? 4   DA  u "O4'" 1 
ATOM 3269  C "C3'" . DA  G  1 4   ? 93.975  41.354   128.157 1.00 409.19 ? 4   DA  u "C3'" 1 
ATOM 3270  O "O3'" . DA  G  1 4   ? 93.986  40.018   128.651 1.00 417.13 ? 4   DA  u "O3'" 1 
ATOM 3271  C "C2'" . DA  G  1 4   ? 93.679  41.287   126.671 1.00 403.40 ? 4   DA  u "C2'" 1 
ATOM 3272  C "C1'" . DA  G  1 4   ? 92.190  41.039   126.712 1.00 398.05 ? 4   DA  u "C1'" 1 
ATOM 3273  N N9    . DA  G  1 4   ? 91.462  41.346   125.485 1.00 393.23 ? 4   DA  u N9    1 
ATOM 3274  C C8    . DA  G  1 4   ? 91.667  42.366   124.590 1.00 385.43 ? 4   DA  u C8    1 
ATOM 3275  N N7    . DA  G  1 4   ? 90.810  42.379   123.598 1.00 383.47 ? 4   DA  u N7    1 
ATOM 3276  C C5    . DA  G  1 4   ? 89.987  41.292   123.856 1.00 390.65 ? 4   DA  u C5    1 
ATOM 3277  C C6    . DA  G  1 4   ? 88.871  40.766   123.180 1.00 391.39 ? 4   DA  u C6    1 
ATOM 3278  N N6    . DA  G  1 4   ? 88.379  41.282   122.053 1.00 384.58 ? 4   DA  u N6    1 
ATOM 3279  N N1    . DA  G  1 4   ? 88.281  39.668   123.699 1.00 397.30 ? 4   DA  u N1    1 
ATOM 3280  C C2    . DA  G  1 4   ? 88.771  39.154   124.835 1.00 402.92 ? 4   DA  u C2    1 
ATOM 3281  N N3    . DA  G  1 4   ? 89.804  39.564   125.569 1.00 403.51 ? 4   DA  u N3    1 
ATOM 3282  C C4    . DA  G  1 4   ? 90.378  40.647   125.015 1.00 395.74 ? 4   DA  u C4    1 
ATOM 3283  P P     . DA  G  1 5   ? 95.366  39.237   128.774 1.00 427.09 ? 5   DA  u P     1 
ATOM 3284  O OP1   . DA  G  1 5   ? 95.892  39.463   130.138 1.00 432.63 ? 5   DA  u OP1   1 
ATOM 3285  O OP2   . DA  G  1 5   ? 96.208  39.586   127.596 1.00 430.08 ? 5   DA  u OP2   1 
ATOM 3286  O "O5'" . DA  G  1 5   ? 94.930  37.709   128.660 1.00 419.44 ? 5   DA  u "O5'" 1 
ATOM 3287  C "C5'" . DA  G  1 5   ? 93.720  37.217   129.266 1.00 405.10 ? 5   DA  u "C5'" 1 
ATOM 3288  C "C4'" . DA  G  1 5   ? 93.026  36.231   128.350 1.00 395.30 ? 5   DA  u "C4'" 1 
ATOM 3289  O "O4'" . DA  G  1 5   ? 92.477  36.907   127.192 1.00 395.63 ? 5   DA  u "O4'" 1 
ATOM 3290  C "C3'" . DA  G  1 5   ? 93.885  35.097   127.789 1.00 383.24 ? 5   DA  u "C3'" 1 
ATOM 3291  O "O3'" . DA  G  1 5   ? 92.989  34.002   127.626 1.00 371.16 ? 5   DA  u "O3'" 1 
ATOM 3292  C "C2'" . DA  G  1 5   ? 94.223  35.582   126.392 1.00 383.57 ? 5   DA  u "C2'" 1 
ATOM 3293  C "C1'" . DA  G  1 5   ? 92.901  36.227   126.016 1.00 385.87 ? 5   DA  u "C1'" 1 
ATOM 3294  N N9    . DA  G  1 5   ? 92.892  37.191   124.914 1.00 377.52 ? 5   DA  u N9    1 
ATOM 3295  C C8    . DA  G  1 5   ? 93.726  38.259   124.684 1.00 373.29 ? 5   DA  u C8    1 
ATOM 3296  N N7    . DA  G  1 5   ? 93.399  38.968   123.631 1.00 365.78 ? 5   DA  u N7    1 
ATOM 3297  C C5    . DA  G  1 5   ? 92.262  38.337   123.146 1.00 363.60 ? 5   DA  u C5    1 
ATOM 3298  C C6    . DA  G  1 5   ? 91.429  38.604   122.046 1.00 357.58 ? 5   DA  u C6    1 
ATOM 3299  N N6    . DA  G  1 5   ? 91.622  39.619   121.202 1.00 350.04 ? 5   DA  u N6    1 
ATOM 3300  N N1    . DA  G  1 5   ? 90.377  37.782   121.841 1.00 356.56 ? 5   DA  u N1    1 
ATOM 3301  C C2    . DA  G  1 5   ? 90.186  36.760   122.686 1.00 357.83 ? 5   DA  u C2    1 
ATOM 3302  N N3    . DA  G  1 5   ? 90.895  36.410   123.757 1.00 362.17 ? 5   DA  u N3    1 
ATOM 3303  C C4    . DA  G  1 5   ? 91.935  37.245   123.930 1.00 368.91 ? 5   DA  u C4    1 
ATOM 3304  P P     . DA  G  1 6   ? 93.412  32.548   128.093 1.00 359.15 ? 6   DA  u P     1 
ATOM 3305  O OP1   . DA  G  1 6   ? 92.618  32.204   129.298 1.00 361.51 ? 6   DA  u OP1   1 
ATOM 3306  O OP2   . DA  G  1 6   ? 94.893  32.496   128.143 1.00 350.65 ? 6   DA  u OP2   1 
ATOM 3307  O "O5'" . DA  G  1 6   ? 92.902  31.637   126.890 1.00 362.03 ? 6   DA  u "O5'" 1 
ATOM 3308  C "C5'" . DA  G  1 6   ? 91.535  31.699   126.446 1.00 370.80 ? 6   DA  u "C5'" 1 
ATOM 3309  C "C4'" . DA  G  1 6   ? 91.444  31.340   124.981 1.00 379.89 ? 6   DA  u "C4'" 1 
ATOM 3310  O "O4'" . DA  G  1 6   ? 91.700  32.506   124.158 1.00 384.63 ? 6   DA  u "O4'" 1 
ATOM 3311  C "C3'" . DA  G  1 6   ? 92.420  30.262   124.503 1.00 386.00 ? 6   DA  u "C3'" 1 
ATOM 3312  O "O3'" . DA  G  1 6   ? 91.665  29.453   123.596 1.00 392.43 ? 6   DA  u "O3'" 1 
ATOM 3313  C "C2'" . DA  G  1 6   ? 93.495  31.062   123.783 1.00 389.91 ? 6   DA  u "C2'" 1 
ATOM 3314  C "C1'" . DA  G  1 6   ? 92.664  32.173   123.170 1.00 390.99 ? 6   DA  u "C1'" 1 
ATOM 3315  N N9    . DA  G  1 6   ? 93.362  33.402   122.793 1.00 390.94 ? 6   DA  u N9    1 
ATOM 3316  C C8    . DA  G  1 6   ? 94.442  34.011   123.385 1.00 386.53 ? 6   DA  u C8    1 
ATOM 3317  N N7    . DA  G  1 6   ? 94.804  35.128   122.802 1.00 383.31 ? 6   DA  u N7    1 
ATOM 3318  C C5    . DA  G  1 6   ? 93.898  35.269   121.761 1.00 385.70 ? 6   DA  u C5    1 
ATOM 3319  C C6    . DA  G  1 6   ? 93.740  36.255   120.770 1.00 383.75 ? 6   DA  u C6    1 
ATOM 3320  N N6    . DA  G  1 6   ? 94.528  37.327   120.660 1.00 380.58 ? 6   DA  u N6    1 
ATOM 3321  N N1    . DA  G  1 6   ? 92.740  36.091   119.875 1.00 384.52 ? 6   DA  u N1    1 
ATOM 3322  C C2    . DA  G  1 6   ? 91.951  35.015   119.986 1.00 386.68 ? 6   DA  u C2    1 
ATOM 3323  N N3    . DA  G  1 6   ? 91.993  34.027   120.878 1.00 389.93 ? 6   DA  u N3    1 
ATOM 3324  C C4    . DA  G  1 6   ? 93.002  34.215   121.746 1.00 389.69 ? 6   DA  u C4    1 
ATOM 3325  P P     . DA  G  1 7   ? 92.030  27.912   123.341 1.00 394.21 ? 7   DA  u P     1 
ATOM 3326  O OP1   . DA  G  1 7   ? 90.987  27.081   123.998 1.00 390.43 ? 7   DA  u OP1   1 
ATOM 3327  O OP2   . DA  G  1 7   ? 93.458  27.702   123.704 1.00 393.87 ? 7   DA  u OP2   1 
ATOM 3328  O "O5'" . DA  G  1 7   ? 91.863  27.780   121.758 1.00 396.98 ? 7   DA  u "O5'" 1 
ATOM 3329  C "C5'" . DA  G  1 7   ? 91.020  28.706   121.024 1.00 392.06 ? 7   DA  u "C5'" 1 
ATOM 3330  C "C4'" . DA  G  1 7   ? 91.474  28.847   119.590 1.00 379.97 ? 7   DA  u "C4'" 1 
ATOM 3331  O "O4'" . DA  G  1 7   ? 92.064  30.151   119.353 1.00 374.54 ? 7   DA  u "O4'" 1 
ATOM 3332  C "C3'" . DA  G  1 7   ? 92.524  27.833   119.146 1.00 373.38 ? 7   DA  u "C3'" 1 
ATOM 3333  O "O3'" . DA  G  1 7   ? 92.247  27.556   117.781 1.00 369.25 ? 7   DA  u "O3'" 1 
ATOM 3334  C "C2'" . DA  G  1 7   ? 93.815  28.624   119.210 1.00 368.73 ? 7   DA  u "C2'" 1 
ATOM 3335  C "C1'" . DA  G  1 7   ? 93.337  29.981   118.743 1.00 363.54 ? 7   DA  u "C1'" 1 
ATOM 3336  N N9    . DA  G  1 7   ? 94.199  31.092   119.152 1.00 352.13 ? 7   DA  u N9    1 
ATOM 3337  C C8    . DA  G  1 7   ? 95.063  31.124   120.221 1.00 349.73 ? 7   DA  u C8    1 
ATOM 3338  N N7    . DA  G  1 7   ? 95.734  32.246   120.326 1.00 342.54 ? 7   DA  u N7    1 
ATOM 3339  C C5    . DA  G  1 7   ? 95.296  32.999   119.246 1.00 339.12 ? 7   DA  u C5    1 
ATOM 3340  C C6    . DA  G  1 7   ? 95.626  34.292   118.798 1.00 335.00 ? 7   DA  u C6    1 
ATOM 3341  N N6    . DA  G  1 7   ? 96.516  35.082   119.404 1.00 330.35 ? 7   DA  u N6    1 
ATOM 3342  N N1    . DA  G  1 7   ? 95.003  34.749   117.688 1.00 332.58 ? 7   DA  u N1    1 
ATOM 3343  C C2    . DA  G  1 7   ? 94.110  33.955   117.081 1.00 329.35 ? 7   DA  u C2    1 
ATOM 3344  N N3    . DA  G  1 7   ? 93.711  32.728   117.410 1.00 331.89 ? 7   DA  u N3    1 
ATOM 3345  C C4    . DA  G  1 7   ? 94.352  32.300   118.512 1.00 341.61 ? 7   DA  u C4    1 
ATOM 3346  P P     . DA  G  1 8   ? 92.942  26.330   117.056 1.00 370.29 ? 8   DA  u P     1 
ATOM 3347  O OP1   . DA  G  1 8   ? 91.979  25.202   117.060 1.00 365.23 ? 8   DA  u OP1   1 
ATOM 3348  O OP2   . DA  G  1 8   ? 94.305  26.144   117.625 1.00 368.28 ? 8   DA  u OP2   1 
ATOM 3349  O "O5'" . DA  G  1 8   ? 93.104  26.861   115.564 1.00 383.89 ? 8   DA  u "O5'" 1 
ATOM 3350  C "C5'" . DA  G  1 8   ? 92.463  28.083   115.139 1.00 395.19 ? 8   DA  u "C5'" 1 
ATOM 3351  C "C4'" . DA  G  1 8   ? 93.335  28.840   114.162 1.00 405.31 ? 8   DA  u "C4'" 1 
ATOM 3352  O "O4'" . DA  G  1 8   ? 94.101  29.855   114.859 1.00 410.13 ? 8   DA  u "O4'" 1 
ATOM 3353  C "C3'" . DA  G  1 8   ? 94.358  27.998   113.394 1.00 408.20 ? 8   DA  u "C3'" 1 
ATOM 3354  O "O3'" . DA  G  1 8   ? 94.445  28.491   112.055 1.00 398.49 ? 8   DA  u "O3'" 1 
ATOM 3355  C "C2'" . DA  G  1 8   ? 95.654  28.277   114.134 1.00 414.25 ? 8   DA  u "C2'" 1 
ATOM 3356  C "C1'" . DA  G  1 8   ? 95.464  29.739   114.483 1.00 413.20 ? 8   DA  u "C1'" 1 
ATOM 3357  N N9    . DA  G  1 8   ? 96.287  30.264   115.574 1.00 411.76 ? 8   DA  u N9    1 
ATOM 3358  C C8    . DA  G  1 8   ? 96.719  29.640   116.720 1.00 408.35 ? 8   DA  u C8    1 
ATOM 3359  N N7    . DA  G  1 8   ? 97.440  30.408   117.500 1.00 403.04 ? 8   DA  u N7    1 
ATOM 3360  C C5    . DA  G  1 8   ? 97.489  31.619   116.822 1.00 402.39 ? 8   DA  u C5    1 
ATOM 3361  C C6    . DA  G  1 8   ? 98.102  32.849   117.123 1.00 397.07 ? 8   DA  u C6    1 
ATOM 3362  N N6    . DA  G  1 8   ? 98.814  33.071   118.230 1.00 386.74 ? 8   DA  u N6    1 
ATOM 3363  N N1    . DA  G  1 8   ? 97.956  33.857   116.235 1.00 400.55 ? 8   DA  u N1    1 
ATOM 3364  C C2    . DA  G  1 8   ? 97.241  33.634   115.124 1.00 404.38 ? 8   DA  u C2    1 
ATOM 3365  N N3    . DA  G  1 8   ? 96.614  32.526   114.733 1.00 406.39 ? 8   DA  u N3    1 
ATOM 3366  C C4    . DA  G  1 8   ? 96.784  31.543   115.634 1.00 407.91 ? 8   DA  u C4    1 
ATOM 3367  P P     . DA  G  1 9   ? 94.801  27.497   110.855 1.00 391.79 ? 9   DA  u P     1 
ATOM 3368  O OP1   . DA  G  1 9   ? 93.554  27.219   110.103 1.00 388.10 ? 9   DA  u OP1   1 
ATOM 3369  O OP2   . DA  G  1 9   ? 95.589  26.365   111.405 1.00 392.23 ? 9   DA  u OP2   1 
ATOM 3370  O "O5'" . DA  G  1 9   ? 95.803  28.357   109.964 1.00 399.99 ? 9   DA  u "O5'" 1 
ATOM 3371  C "C5'" . DA  G  1 9   ? 95.510  29.715   109.584 1.00 415.05 ? 9   DA  u "C5'" 1 
ATOM 3372  C "C4'" . DA  G  1 9   ? 96.790  30.511   109.457 1.00 431.50 ? 9   DA  u "C4'" 1 
ATOM 3373  O "O4'" . DA  G  1 9   ? 97.295  30.846   110.775 1.00 430.56 ? 9   DA  u "O4'" 1 
ATOM 3374  C "C3'" . DA  G  1 9   ? 97.943  29.807   108.726 1.00 439.49 ? 9   DA  u "C3'" 1 
ATOM 3375  O "O3'" . DA  G  1 9   ? 98.549  30.741   107.821 1.00 445.42 ? 9   DA  u "O3'" 1 
ATOM 3376  C "C2'" . DA  G  1 9   ? 98.923  29.485   109.842 1.00 435.69 ? 9   DA  u "C2'" 1 
ATOM 3377  C "C1'" . DA  G  1 9   ? 98.700  30.666   110.764 1.00 428.92 ? 9   DA  u "C1'" 1 
ATOM 3378  N N9    . DA  G  1 9   ? 99.158  30.505   112.147 1.00 420.94 ? 9   DA  u N9    1 
ATOM 3379  C C8    . DA  G  1 9   ? 99.143  29.373   112.924 1.00 418.24 ? 9   DA  u C8    1 
ATOM 3380  N N7    . DA  G  1 9   ? 99.639  29.548   114.125 1.00 412.91 ? 9   DA  u N7    1 
ATOM 3381  C C5    . DA  G  1 9   ? 100.018 30.883   114.137 1.00 409.07 ? 9   DA  u C5    1 
ATOM 3382  C C6    . DA  G  1 9   ? 100.620 31.687   115.122 1.00 402.95 ? 9   DA  u C6    1 
ATOM 3383  N N6    . DA  G  1 9   ? 100.951 31.246   116.338 1.00 395.23 ? 9   DA  u N6    1 
ATOM 3384  N N1    . DA  G  1 9   ? 100.864 32.980   114.815 1.00 402.81 ? 9   DA  u N1    1 
ATOM 3385  C C2    . DA  G  1 9   ? 100.531 33.422   113.595 1.00 406.15 ? 9   DA  u C2    1 
ATOM 3386  N N3    . DA  G  1 9   ? 99.966  32.764   112.584 1.00 409.03 ? 9   DA  u N3    1 
ATOM 3387  C C4    . DA  G  1 9   ? 99.735  31.483   112.922 1.00 413.57 ? 9   DA  u C4    1 
ATOM 3388  P P     . DA  G  1 10  ? 99.465  30.260   106.572 1.00 443.34 ? 10  DA  u P     1 
ATOM 3389  O OP1   . DA  G  1 10  ? 98.589  30.125   105.380 1.00 442.29 ? 10  DA  u OP1   1 
ATOM 3390  O OP2   . DA  G  1 10  ? 100.320 29.117   107.000 1.00 442.14 ? 10  DA  u OP2   1 
ATOM 3391  O "O5'" . DA  G  1 10  ? 100.397 31.528   106.334 1.00 429.12 ? 10  DA  u "O5'" 1 
ATOM 3392  C "C5'" . DA  G  1 10  ? 100.066 32.791   106.952 1.00 406.87 ? 10  DA  u "C5'" 1 
ATOM 3393  C "C4'" . DA  G  1 10  ? 101.300 33.450   107.523 1.00 392.88 ? 10  DA  u "C4'" 1 
ATOM 3394  O "O4'" . DA  G  1 10  ? 101.502 33.057   108.905 1.00 394.48 ? 10  DA  u "O4'" 1 
ATOM 3395  C "C3'" . DA  G  1 10  ? 102.597 33.097   106.801 1.00 387.34 ? 10  DA  u "C3'" 1 
ATOM 3396  O "O3'" . DA  G  1 10  ? 103.440 34.238   106.921 1.00 387.43 ? 10  DA  u "O3'" 1 
ATOM 3397  C "C2'" . DA  G  1 10  ? 103.176 32.002   107.670 1.00 388.44 ? 10  DA  u "C2'" 1 
ATOM 3398  C "C1'" . DA  G  1 10  ? 102.818 32.543   109.039 1.00 398.05 ? 10  DA  u "C1'" 1 
ATOM 3399  N N9    . DA  G  1 10  ? 102.820 31.553   110.115 1.00 409.48 ? 10  DA  u N9    1 
ATOM 3400  C C8    . DA  G  1 10  ? 102.469 30.228   110.047 1.00 413.51 ? 10  DA  u C8    1 
ATOM 3401  N N7    . DA  G  1 10  ? 102.600 29.587   111.183 1.00 419.02 ? 10  DA  u N7    1 
ATOM 3402  C C5    . DA  G  1 10  ? 103.089 30.549   112.053 1.00 418.51 ? 10  DA  u C5    1 
ATOM 3403  C C6    . DA  G  1 10  ? 103.446 30.501   113.412 1.00 417.34 ? 10  DA  u C6    1 
ATOM 3404  N N6    . DA  G  1 10  ? 103.358 29.400   114.161 1.00 416.57 ? 10  DA  u N6    1 
ATOM 3405  N N1    . DA  G  1 10  ? 103.898 31.639   113.984 1.00 414.31 ? 10  DA  u N1    1 
ATOM 3406  C C2    . DA  G  1 10  ? 103.990 32.742   113.230 1.00 415.09 ? 10  DA  u C2    1 
ATOM 3407  N N3    . DA  G  1 10  ? 103.677 32.915   111.946 1.00 417.68 ? 10  DA  u N3    1 
ATOM 3408  C C4    . DA  G  1 10  ? 103.235 31.764   111.408 1.00 416.17 ? 10  DA  u C4    1 
ATOM 3409  P P     . DA  G  1 11  ? 104.445 34.616   105.752 1.00 392.30 ? 11  DA  u P     1 
ATOM 3410  O OP1   . DA  G  1 11  ? 103.691 35.408   104.749 1.00 387.05 ? 11  DA  u OP1   1 
ATOM 3411  O OP2   . DA  G  1 11  ? 105.146 33.372   105.328 1.00 395.14 ? 11  DA  u OP2   1 
ATOM 3412  O "O5'" . DA  G  1 11  ? 105.486 35.574   106.488 1.00 399.02 ? 11  DA  u "O5'" 1 
ATOM 3413  C "C5'" . DA  G  1 11  ? 105.198 36.130   107.794 1.00 398.93 ? 11  DA  u "C5'" 1 
ATOM 3414  C "C4'" . DA  G  1 11  ? 106.364 35.944   108.739 1.00 392.22 ? 11  DA  u "C4'" 1 
ATOM 3415  O "O4'" . DA  G  1 11  ? 106.182 34.765   109.564 1.00 389.33 ? 11  DA  u "O4'" 1 
ATOM 3416  C "C3'" . DA  G  1 11  ? 107.734 35.774   108.081 1.00 388.14 ? 11  DA  u "C3'" 1 
ATOM 3417  O "O3'" . DA  G  1 11  ? 108.692 36.334   108.976 1.00 387.02 ? 11  DA  u "O3'" 1 
ATOM 3418  C "C2'" . DA  G  1 11  ? 107.945 34.274   108.115 1.00 384.47 ? 11  DA  u "C2'" 1 
ATOM 3419  C "C1'" . DA  G  1 11  ? 107.357 33.967   109.477 1.00 385.14 ? 11  DA  u "C1'" 1 
ATOM 3420  N N9    . DA  G  1 11  ? 106.985 32.577   109.739 1.00 389.41 ? 11  DA  u N9    1 
ATOM 3421  C C8    . DA  G  1 11  ? 106.536 31.607   108.875 1.00 390.15 ? 11  DA  u C8    1 
ATOM 3422  N N7    . DA  G  1 11  ? 106.287 30.458   109.454 1.00 395.22 ? 11  DA  u N7    1 
ATOM 3423  C C5    . DA  G  1 11  ? 106.597 30.684   110.788 1.00 404.08 ? 11  DA  u C5    1 
ATOM 3424  C C6    . DA  G  1 11  ? 106.547 29.858   111.925 1.00 415.37 ? 11  DA  u C6    1 
ATOM 3425  N N6    . DA  G  1 11  ? 106.148 28.585   111.896 1.00 423.46 ? 11  DA  u N6    1 
ATOM 3426  N N1    . DA  G  1 11  ? 106.928 30.391   113.107 1.00 420.27 ? 11  DA  u N1    1 
ATOM 3427  C C2    . DA  G  1 11  ? 107.331 31.668   113.133 1.00 413.83 ? 11  DA  u C2    1 
ATOM 3428  N N3    . DA  G  1 11  ? 107.405 32.549   112.138 1.00 402.85 ? 11  DA  u N3    1 
ATOM 3429  C C4    . DA  G  1 11  ? 107.029 31.984   110.977 1.00 397.76 ? 11  DA  u C4    1 
ATOM 3430  P P     . DA  G  1 12  ? 110.017 36.991   108.408 1.00 388.48 ? 12  DA  u P     1 
ATOM 3431  O OP1   . DA  G  1 12  ? 109.659 38.321   107.861 1.00 390.37 ? 12  DA  u OP1   1 
ATOM 3432  O OP2   . DA  G  1 12  ? 110.682 35.995   107.529 1.00 391.70 ? 12  DA  u OP2   1 
ATOM 3433  O "O5'" . DA  G  1 12  ? 110.898 37.211   109.716 1.00 388.61 ? 12  DA  u "O5'" 1 
ATOM 3434  C "C5'" . DA  G  1 12  ? 110.315 37.177   111.036 1.00 387.51 ? 12  DA  u "C5'" 1 
ATOM 3435  C "C4'" . DA  G  1 12  ? 111.173 36.338   111.956 1.00 390.59 ? 12  DA  u "C4'" 1 
ATOM 3436  O "O4'" . DA  G  1 12  ? 110.680 34.977   111.966 1.00 385.16 ? 12  DA  u "O4'" 1 
ATOM 3437  C "C3'" . DA  G  1 12  ? 112.645 36.245   111.550 1.00 400.46 ? 12  DA  u "C3'" 1 
ATOM 3438  O "O3'" . DA  G  1 12  ? 113.468 36.255   112.714 1.00 419.13 ? 12  DA  u "O3'" 1 
ATOM 3439  C "C2'" . DA  G  1 12  ? 112.745 34.882   110.895 1.00 396.08 ? 12  DA  u "C2'" 1 
ATOM 3440  C "C1'" . DA  G  1 12  ? 111.765 34.093   111.732 1.00 390.79 ? 12  DA  u "C1'" 1 
ATOM 3441  N N9    . DA  G  1 12  ? 111.234 32.892   111.096 1.00 390.43 ? 12  DA  u N9    1 
ATOM 3442  C C8    . DA  G  1 12  ? 110.962 32.667   109.769 1.00 384.62 ? 12  DA  u C8    1 
ATOM 3443  N N7    . DA  G  1 12  ? 110.471 31.476   109.525 1.00 384.53 ? 12  DA  u N7    1 
ATOM 3444  C C5    . DA  G  1 12  ? 110.415 30.877   110.775 1.00 396.60 ? 12  DA  u C5    1 
ATOM 3445  C C6    . DA  G  1 12  ? 109.983 29.608   111.198 1.00 405.98 ? 12  DA  u C6    1 
ATOM 3446  N N6    . DA  G  1 12  ? 109.505 28.676   110.371 1.00 408.98 ? 12  DA  u N6    1 
ATOM 3447  N N1    . DA  G  1 12  ? 110.060 29.325   112.517 1.00 414.52 ? 12  DA  u N1    1 
ATOM 3448  C C2    . DA  G  1 12  ? 110.542 30.261   113.346 1.00 413.19 ? 12  DA  u C2    1 
ATOM 3449  N N3    . DA  G  1 12  ? 110.968 31.491   113.071 1.00 406.98 ? 12  DA  u N3    1 
ATOM 3450  C C4    . DA  G  1 12  ? 110.882 31.738   111.752 1.00 397.29 ? 12  DA  u C4    1 
ATOM 3451  P P     . DA  G  1 13  ? 114.941 36.859   112.631 1.00 437.04 ? 13  DA  u P     1 
ATOM 3452  O OP1   . DA  G  1 13  ? 114.867 38.292   113.004 1.00 441.44 ? 13  DA  u OP1   1 
ATOM 3453  O OP2   . DA  G  1 13  ? 115.530 36.476   111.317 1.00 434.63 ? 13  DA  u OP2   1 
ATOM 3454  O "O5'" . DA  G  1 13  ? 115.723 36.080   113.782 1.00 442.92 ? 13  DA  u "O5'" 1 
ATOM 3455  C "C5'" . DA  G  1 13  ? 115.049 35.558   114.946 1.00 448.72 ? 13  DA  u "C5'" 1 
ATOM 3456  C "C4'" . DA  G  1 13  ? 115.517 34.149   115.233 1.00 454.94 ? 13  DA  u "C4'" 1 
ATOM 3457  O "O4'" . DA  G  1 13  ? 114.794 33.204   114.406 1.00 462.43 ? 13  DA  u "O4'" 1 
ATOM 3458  C "C3'" . DA  G  1 13  ? 117.002 33.877   114.972 1.00 452.90 ? 13  DA  u "C3'" 1 
ATOM 3459  O "O3'" . DA  G  1 13  ? 117.437 32.944   115.960 1.00 445.32 ? 13  DA  u "O3'" 1 
ATOM 3460  C "C2'" . DA  G  1 13  ? 116.987 33.116   113.659 1.00 456.82 ? 13  DA  u "C2'" 1 
ATOM 3461  C "C1'" . DA  G  1 13  ? 115.731 32.297   113.851 1.00 457.23 ? 13  DA  u "C1'" 1 
ATOM 3462  N N9    . DA  G  1 13  ? 115.151 31.718   112.639 1.00 452.03 ? 13  DA  u N9    1 
ATOM 3463  C C8    . DA  G  1 13  ? 115.164 32.215   111.358 1.00 450.12 ? 13  DA  u C8    1 
ATOM 3464  N N7    . DA  G  1 13  ? 114.563 31.442   110.486 1.00 449.22 ? 13  DA  u N7    1 
ATOM 3465  C C5    . DA  G  1 13  ? 114.133 30.359   111.240 1.00 446.62 ? 13  DA  u C5    1 
ATOM 3466  C C6    . DA  G  1 13  ? 113.429 29.188   110.902 1.00 443.42 ? 13  DA  u C6    1 
ATOM 3467  N N6    . DA  G  1 13  ? 113.017 28.902   109.664 1.00 445.40 ? 13  DA  u N6    1 
ATOM 3468  N N1    . DA  G  1 13  ? 113.156 28.310   111.893 1.00 437.22 ? 13  DA  u N1    1 
ATOM 3469  C C2    . DA  G  1 13  ? 113.564 28.600   113.136 1.00 433.43 ? 13  DA  u C2    1 
ATOM 3470  N N3    . DA  G  1 13  ? 114.232 29.665   113.577 1.00 437.85 ? 13  DA  u N3    1 
ATOM 3471  C C4    . DA  G  1 13  ? 114.491 30.515   112.568 1.00 446.15 ? 13  DA  u C4    1 
ATOM 3472  P P     . DA  G  1 14  ? 118.946 32.951   116.496 1.00 437.68 ? 14  DA  u P     1 
ATOM 3473  O OP1   . DA  G  1 14  ? 119.030 33.946   117.596 1.00 436.07 ? 14  DA  u OP1   1 
ATOM 3474  O OP2   . DA  G  1 14  ? 119.864 33.073   115.331 1.00 439.55 ? 14  DA  u OP2   1 
ATOM 3475  O "O5'" . DA  G  1 14  ? 119.106 31.480   117.094 1.00 435.08 ? 14  DA  u "O5'" 1 
ATOM 3476  C "C5'" . DA  G  1 14  ? 118.038 30.866   117.855 1.00 433.07 ? 14  DA  u "C5'" 1 
ATOM 3477  C "C4'" . DA  G  1 14  ? 117.922 29.385   117.564 1.00 432.98 ? 14  DA  u "C4'" 1 
ATOM 3478  O "O4'" . DA  G  1 14  ? 117.350 29.158   116.251 1.00 431.18 ? 14  DA  u "O4'" 1 
ATOM 3479  C "C3'" . DA  G  1 14  ? 119.229 28.591   117.577 1.00 432.96 ? 14  DA  u "C3'" 1 
ATOM 3480  O "O3'" . DA  G  1 14  ? 118.902 27.256   117.992 1.00 435.25 ? 14  DA  u "O3'" 1 
ATOM 3481  C "C2'" . DA  G  1 14  ? 119.600 28.557   116.107 1.00 429.76 ? 14  DA  u "C2'" 1 
ATOM 3482  C "C1'" . DA  G  1 14  ? 118.227 28.322   115.507 1.00 422.74 ? 14  DA  u "C1'" 1 
ATOM 3483  N N9    . DA  G  1 14  ? 118.051 28.634   114.090 1.00 406.75 ? 14  DA  u N9    1 
ATOM 3484  C C8    . DA  G  1 14  ? 118.495 29.728   113.391 1.00 400.10 ? 14  DA  u C8    1 
ATOM 3485  N N7    . DA  G  1 14  ? 118.130 29.734   112.132 1.00 398.86 ? 14  DA  u N7    1 
ATOM 3486  C C5    . DA  G  1 14  ? 117.393 28.566   111.993 1.00 400.53 ? 14  DA  u C5    1 
ATOM 3487  C C6    . DA  G  1 14  ? 116.724 27.993   110.896 1.00 404.22 ? 14  DA  u C6    1 
ATOM 3488  N N6    . DA  G  1 14  ? 116.697 28.539   109.679 1.00 419.41 ? 14  DA  u N6    1 
ATOM 3489  N N1    . DA  G  1 14  ? 116.077 26.823   111.096 1.00 397.53 ? 14  DA  u N1    1 
ATOM 3490  C C2    . DA  G  1 14  ? 116.106 26.276   112.317 1.00 388.94 ? 14  DA  u C2    1 
ATOM 3491  N N3    . DA  G  1 14  ? 116.688 26.724   113.428 1.00 391.55 ? 14  DA  u N3    1 
ATOM 3492  C C4    . DA  G  1 14  ? 117.327 27.884   113.194 1.00 398.72 ? 14  DA  u C4    1 
ATOM 3493  P P     . DA  G  1 15  ? 120.001 26.310   118.689 1.00 428.48 ? 15  DA  u P     1 
ATOM 3494  O OP1   . DA  G  1 15  ? 119.624 26.140   120.115 1.00 416.33 ? 15  DA  u OP1   1 
ATOM 3495  O OP2   . DA  G  1 15  ? 121.343 26.847   118.356 1.00 432.09 ? 15  DA  u OP2   1 
ATOM 3496  O "O5'" . DA  G  1 15  ? 119.846 24.919   117.917 1.00 431.60 ? 15  DA  u "O5'" 1 
ATOM 3497  C "C5'" . DA  G  1 15  ? 118.569 24.251   117.754 1.00 421.98 ? 15  DA  u "C5'" 1 
ATOM 3498  C "C4'" . DA  G  1 15  ? 118.565 23.260   116.606 1.00 411.14 ? 15  DA  u "C4'" 1 
ATOM 3499  O "O4'" . DA  G  1 15  ? 118.484 23.927   115.321 1.00 405.82 ? 15  DA  u "O4'" 1 
ATOM 3500  C "C3'" . DA  G  1 15  ? 119.752 22.303   116.484 1.00 407.88 ? 15  DA  u "C3'" 1 
ATOM 3501  O "O3'" . DA  G  1 15  ? 119.242 21.128   115.842 1.00 403.83 ? 15  DA  u "O3'" 1 
ATOM 3502  C "C2'" . DA  G  1 15  ? 120.629 23.005   115.464 1.00 405.52 ? 15  DA  u "C2'" 1 
ATOM 3503  C "C1'" . DA  G  1 15  ? 119.565 23.496   114.500 1.00 395.23 ? 15  DA  u "C1'" 1 
ATOM 3504  N N9    . DA  G  1 15  ? 119.932 24.608   113.628 1.00 379.97 ? 15  DA  u N9    1 
ATOM 3505  C C8    . DA  G  1 15  ? 120.673 25.730   113.910 1.00 373.65 ? 15  DA  u C8    1 
ATOM 3506  N N7    . DA  G  1 15  ? 120.773 26.564   112.903 1.00 363.97 ? 15  DA  u N7    1 
ATOM 3507  C C5    . DA  G  1 15  ? 120.044 25.953   111.893 1.00 368.05 ? 15  DA  u C5    1 
ATOM 3508  C C6    . DA  G  1 15  ? 119.762 26.331   110.570 1.00 371.99 ? 15  DA  u C6    1 
ATOM 3509  N N6    . DA  G  1 15  ? 120.210 27.458   110.011 1.00 374.27 ? 15  DA  u N6    1 
ATOM 3510  N N1    . DA  G  1 15  ? 119.003 25.496   109.826 1.00 376.08 ? 15  DA  u N1    1 
ATOM 3511  C C2    . DA  G  1 15  ? 118.560 24.361   110.386 1.00 369.10 ? 15  DA  u C2    1 
ATOM 3512  N N3    . DA  G  1 15  ? 118.754 23.900   111.619 1.00 364.26 ? 15  DA  u N3    1 
ATOM 3513  C C4    . DA  G  1 15  ? 119.513 24.753   112.329 1.00 370.00 ? 15  DA  u C4    1 
ATOM 3514  P P     . DA  G  1 16  ? 120.006 19.719   115.959 1.00 404.39 ? 16  DA  u P     1 
ATOM 3515  O OP1   . DA  G  1 16  ? 119.129 18.787   116.713 1.00 411.64 ? 16  DA  u OP1   1 
ATOM 3516  O OP2   . DA  G  1 16  ? 121.388 19.971   116.446 1.00 407.43 ? 16  DA  u OP2   1 
ATOM 3517  O "O5'" . DA  G  1 16  ? 120.109 19.224   114.444 1.00 391.27 ? 16  DA  u "O5'" 1 
ATOM 3518  C "C5'" . DA  G  1 16  ? 119.040 19.419   113.487 1.00 365.67 ? 16  DA  u "C5'" 1 
ATOM 3519  C "C4'" . DA  G  1 16  ? 119.459 18.974   112.103 1.00 350.16 ? 16  DA  u "C4'" 1 
ATOM 3520  O "O4'" . DA  G  1 16  ? 119.810 20.136   111.317 1.00 340.46 ? 16  DA  u "O4'" 1 
ATOM 3521  C "C3'" . DA  G  1 16  ? 120.676 18.049   112.036 1.00 346.50 ? 16  DA  u "C3'" 1 
ATOM 3522  O "O3'" . DA  G  1 16  ? 120.594 17.184   110.896 1.00 344.59 ? 16  DA  u "O3'" 1 
ATOM 3523  C "C2'" . DA  G  1 16  ? 121.819 19.019   111.819 1.00 342.79 ? 16  DA  u "C2'" 1 
ATOM 3524  C "C1'" . DA  G  1 16  ? 121.172 20.060   110.924 1.00 340.98 ? 16  DA  u "C1'" 1 
ATOM 3525  N N9    . DA  G  1 16  ? 121.749 21.393   111.057 1.00 342.47 ? 16  DA  u N9    1 
ATOM 3526  C C8    . DA  G  1 16  ? 122.390 21.946   112.138 1.00 344.65 ? 16  DA  u C8    1 
ATOM 3527  N N7    . DA  G  1 16  ? 122.807 23.172   111.934 1.00 345.34 ? 16  DA  u N7    1 
ATOM 3528  C C5    . DA  G  1 16  ? 122.413 23.445   110.632 1.00 343.34 ? 16  DA  u C5    1 
ATOM 3529  C C6    . DA  G  1 16  ? 122.560 24.582   109.817 1.00 341.08 ? 16  DA  u C6    1 
ATOM 3530  N N6    . DA  G  1 16  ? 123.163 25.706   110.214 1.00 332.66 ? 16  DA  u N6    1 
ATOM 3531  N N1    . DA  G  1 16  ? 122.052 24.527   108.566 1.00 343.60 ? 16  DA  u N1    1 
ATOM 3532  C C2    . DA  G  1 16  ? 121.448 23.399   108.168 1.00 346.07 ? 16  DA  u C2    1 
ATOM 3533  N N3    . DA  G  1 16  ? 121.250 22.267   108.840 1.00 344.17 ? 16  DA  u N3    1 
ATOM 3534  C C4    . DA  G  1 16  ? 121.760 22.357   110.080 1.00 343.77 ? 16  DA  u C4    1 
ATOM 3535  P P     . DA  G  1 17  ? 121.520 15.863   110.784 1.00 344.96 ? 17  DA  u P     1 
ATOM 3536  O OP1   . DA  G  1 17  ? 120.734 14.702   111.270 1.00 342.34 ? 17  DA  u OP1   1 
ATOM 3537  O OP2   . DA  G  1 17  ? 122.854 16.157   111.373 1.00 346.44 ? 17  DA  u OP2   1 
ATOM 3538  O "O5'" . DA  G  1 17  ? 121.691 15.680   109.214 1.00 348.27 ? 17  DA  u "O5'" 1 
ATOM 3539  C "C5'" . DA  G  1 17  ? 121.029 16.575   108.307 1.00 356.23 ? 17  DA  u "C5'" 1 
ATOM 3540  C "C4'" . DA  G  1 17  ? 122.018 17.106   107.298 1.00 364.69 ? 17  DA  u "C4'" 1 
ATOM 3541  O "O4'" . DA  G  1 17  ? 122.455 18.440   107.663 1.00 361.92 ? 17  DA  u "O4'" 1 
ATOM 3542  C "C3'" . DA  G  1 17  ? 123.292 16.270   107.155 1.00 373.07 ? 17  DA  u "C3'" 1 
ATOM 3543  O "O3'" . DA  G  1 17  ? 123.626 16.234   105.769 1.00 388.83 ? 17  DA  u "O3'" 1 
ATOM 3544  C "C2'" . DA  G  1 17  ? 124.341 17.116   107.849 1.00 368.59 ? 17  DA  u "C2'" 1 
ATOM 3545  C "C1'" . DA  G  1 17  ? 123.853 18.491   107.468 1.00 364.22 ? 17  DA  u "C1'" 1 
ATOM 3546  N N9    . DA  G  1 17  ? 124.389 19.579   108.275 1.00 362.53 ? 17  DA  u N9    1 
ATOM 3547  C C8    . DA  G  1 17  ? 124.876 19.529   109.557 1.00 362.94 ? 17  DA  u C8    1 
ATOM 3548  N N7    . DA  G  1 17  ? 125.312 20.682   110.002 1.00 365.46 ? 17  DA  u N7    1 
ATOM 3549  C C5    . DA  G  1 17  ? 125.118 21.546   108.933 1.00 364.81 ? 17  DA  u C5    1 
ATOM 3550  C C6    . DA  G  1 17  ? 125.381 22.918   108.763 1.00 365.55 ? 17  DA  u C6    1 
ATOM 3551  N N6    . DA  G  1 17  ? 125.920 23.692   109.708 1.00 370.84 ? 17  DA  u N6    1 
ATOM 3552  N N1    . DA  G  1 17  ? 125.063 23.475   107.574 1.00 360.85 ? 17  DA  u N1    1 
ATOM 3553  C C2    . DA  G  1 17  ? 124.528 22.697   106.624 1.00 356.16 ? 17  DA  u C2    1 
ATOM 3554  N N3    . DA  G  1 17  ? 124.231 21.400   106.666 1.00 356.86 ? 17  DA  u N3    1 
ATOM 3555  C C4    . DA  G  1 17  ? 124.555 20.877   107.861 1.00 361.68 ? 17  DA  u C4    1 
ATOM 3556  P P     . DA  G  1 18  ? 124.625 15.126   105.207 1.00 400.80 ? 18  DA  u P     1 
ATOM 3557  O OP1   . DA  G  1 18  ? 123.835 13.902   104.931 1.00 402.20 ? 18  DA  u OP1   1 
ATOM 3558  O OP2   . DA  G  1 18  ? 125.795 15.039   106.120 1.00 401.06 ? 18  DA  u OP2   1 
ATOM 3559  O "O5'" . DA  G  1 18  ? 125.120 15.774   103.835 1.00 403.48 ? 18  DA  u "O5'" 1 
ATOM 3560  C "C5'" . DA  G  1 18  ? 124.262 16.652   103.063 1.00 406.01 ? 18  DA  u "C5'" 1 
ATOM 3561  C "C4'" . DA  G  1 18  ? 125.038 17.772   102.401 1.00 406.77 ? 18  DA  u "C4'" 1 
ATOM 3562  O "O4'" . DA  G  1 18  ? 125.383 18.795   103.368 1.00 419.17 ? 18  DA  u "O4'" 1 
ATOM 3563  C "C3'" . DA  G  1 18  ? 126.355 17.383   101.723 1.00 400.70 ? 18  DA  u "C3'" 1 
ATOM 3564  O "O3'" . DA  G  1 18  ? 126.568 18.170   100.546 1.00 382.53 ? 18  DA  u "O3'" 1 
ATOM 3565  C "C2'" . DA  G  1 18  ? 127.400 17.799   102.739 1.00 413.45 ? 18  DA  u "C2'" 1 
ATOM 3566  C "C1'" . DA  G  1 18  ? 126.773 19.066   103.284 1.00 431.69 ? 18  DA  u "C1'" 1 
ATOM 3567  N N9    . DA  G  1 18  ? 127.230 19.469   104.611 1.00 456.82 ? 18  DA  u N9    1 
ATOM 3568  C C8    . DA  G  1 18  ? 127.478 18.682   105.708 1.00 466.62 ? 18  DA  u C8    1 
ATOM 3569  N N7    . DA  G  1 18  ? 127.864 19.355   106.765 1.00 475.58 ? 18  DA  u N7    1 
ATOM 3570  C C5    . DA  G  1 18  ? 127.870 20.675   106.336 1.00 477.06 ? 18  DA  u C5    1 
ATOM 3571  C C6    . DA  G  1 18  ? 128.185 21.881   106.987 1.00 481.57 ? 18  DA  u C6    1 
ATOM 3572  N N6    . DA  G  1 18  ? 128.579 21.955   108.260 1.00 486.06 ? 18  DA  u N6    1 
ATOM 3573  N N1    . DA  G  1 18  ? 128.080 23.025   106.274 1.00 481.85 ? 18  DA  u N1    1 
ATOM 3574  C C2    . DA  G  1 18  ? 127.692 22.949   104.994 1.00 475.58 ? 18  DA  u C2    1 
ATOM 3575  N N3    . DA  G  1 18  ? 127.360 21.879   104.275 1.00 472.59 ? 18  DA  u N3    1 
ATOM 3576  C C4    . DA  G  1 18  ? 127.474 20.760   105.013 1.00 469.93 ? 18  DA  u C4    1 
ATOM 3577  P P     . DA  G  1 19  ? 127.278 17.510   99.281  1.00 372.83 ? 19  DA  u P     1 
ATOM 3578  O OP1   . DA  G  1 19  ? 126.233 16.816   98.485  1.00 366.19 ? 19  DA  u OP1   1 
ATOM 3579  O OP2   . DA  G  1 19  ? 128.461 16.755   99.763  1.00 375.11 ? 19  DA  u OP2   1 
ATOM 3580  O "O5'" . DA  G  1 19  ? 127.829 18.752   98.451  1.00 373.66 ? 19  DA  u "O5'" 1 
ATOM 3581  C "C5'" . DA  G  1 19  ? 127.347 20.088   98.665  1.00 370.87 ? 19  DA  u "C5'" 1 
ATOM 3582  C "C4'" . DA  G  1 19  ? 128.502 21.058   98.769  1.00 370.58 ? 19  DA  u "C4'" 1 
ATOM 3583  O "O4'" . DA  G  1 19  ? 128.823 21.265   100.165 1.00 372.90 ? 19  DA  u "O4'" 1 
ATOM 3584  C "C3'" . DA  G  1 19  ? 129.815 20.635   98.096  1.00 367.26 ? 19  DA  u "C3'" 1 
ATOM 3585  O "O3'" . DA  G  1 19  ? 130.440 21.800   97.534  1.00 357.08 ? 19  DA  u "O3'" 1 
ATOM 3586  C "C2'" . DA  G  1 19  ? 130.659 20.159   99.265  1.00 372.52 ? 19  DA  u "C2'" 1 
ATOM 3587  C "C1'" . DA  G  1 19  ? 130.226 21.149   100.324 1.00 378.00 ? 19  DA  u "C1'" 1 
ATOM 3588  N N9    . DA  G  1 19  ? 130.492 20.785   101.714 1.00 383.70 ? 19  DA  u N9    1 
ATOM 3589  C C8    . DA  G  1 19  ? 130.524 19.542   102.298 1.00 382.94 ? 19  DA  u C8    1 
ATOM 3590  N N7    . DA  G  1 19  ? 130.779 19.569   103.584 1.00 388.09 ? 19  DA  u N7    1 
ATOM 3591  C C5    . DA  G  1 19  ? 130.918 20.921   103.867 1.00 395.26 ? 19  DA  u C5    1 
ATOM 3592  C C6    . DA  G  1 19  ? 131.192 21.618   105.060 1.00 403.32 ? 19  DA  u C6    1 
ATOM 3593  N N6    . DA  G  1 19  ? 131.392 21.023   106.239 1.00 414.46 ? 19  DA  u N6    1 
ATOM 3594  N N1    . DA  G  1 19  ? 131.264 22.966   104.997 1.00 404.29 ? 19  DA  u N1    1 
ATOM 3595  C C2    . DA  G  1 19  ? 131.070 23.564   103.814 1.00 397.89 ? 19  DA  u C2    1 
ATOM 3596  N N3    . DA  G  1 19  ? 130.802 23.022   102.629 1.00 394.52 ? 19  DA  u N3    1 
ATOM 3597  C C4    . DA  G  1 19  ? 130.739 21.681   102.725 1.00 390.93 ? 19  DA  u C4    1 
ATOM 3598  P P     . DA  G  1 20  ? 131.574 21.668   96.393  1.00 345.50 ? 20  DA  u P     1 
ATOM 3599  O OP1   . DA  G  1 20  ? 130.907 21.746   95.070  1.00 342.34 ? 20  DA  u OP1   1 
ATOM 3600  O OP2   . DA  G  1 20  ? 132.420 20.489   96.707  1.00 341.75 ? 20  DA  u OP2   1 
ATOM 3601  O "O5'" . DA  G  1 20  ? 132.463 22.979   96.598  1.00 348.82 ? 20  DA  u "O5'" 1 
ATOM 3602  C "C5'" . DA  G  1 20  ? 131.907 24.221   97.091  1.00 351.48 ? 20  DA  u "C5'" 1 
ATOM 3603  C "C4'" . DA  G  1 20  ? 132.948 25.046   97.819  1.00 353.59 ? 20  DA  u "C4'" 1 
ATOM 3604  O "O4'" . DA  G  1 20  ? 133.015 24.648   99.209  1.00 348.35 ? 20  DA  u "O4'" 1 
ATOM 3605  C "C3'" . DA  G  1 20  ? 134.380 24.932   97.294  1.00 358.58 ? 20  DA  u "C3'" 1 
ATOM 3606  O "O3'" . DA  G  1 20  ? 135.110 26.143   97.529  1.00 368.11 ? 20  DA  u "O3'" 1 
ATOM 3607  C "C2'" . DA  G  1 20  ? 134.994 23.885   98.201  1.00 354.30 ? 20  DA  u "C2'" 1 
ATOM 3608  C "C1'" . DA  G  1 20  ? 134.344 24.246   99.522  1.00 345.09 ? 20  DA  u "C1'" 1 
ATOM 3609  N N9    . DA  G  1 20  ? 134.264 23.141   100.468 1.00 338.78 ? 20  DA  u N9    1 
ATOM 3610  C C8    . DA  G  1 20  ? 133.999 21.816   100.224 1.00 340.29 ? 20  DA  u C8    1 
ATOM 3611  N N7    . DA  G  1 20  ? 133.997 21.070   101.301 1.00 337.28 ? 20  DA  u N7    1 
ATOM 3612  C C5    . DA  G  1 20  ? 134.278 21.964   102.324 1.00 333.61 ? 20  DA  u C5    1 
ATOM 3613  C C6    . DA  G  1 20  ? 134.414 21.800   103.712 1.00 332.23 ? 20  DA  u C6    1 
ATOM 3614  N N6    . DA  G  1 20  ? 134.281 20.627   104.335 1.00 333.51 ? 20  DA  u N6    1 
ATOM 3615  N N1    . DA  G  1 20  ? 134.694 22.898   104.449 1.00 329.67 ? 20  DA  u N1    1 
ATOM 3616  C C2    . DA  G  1 20  ? 134.829 24.074   103.822 1.00 325.97 ? 20  DA  u C2    1 
ATOM 3617  N N3    . DA  G  1 20  ? 134.719 24.355   102.527 1.00 325.07 ? 20  DA  u N3    1 
ATOM 3618  C C4    . DA  G  1 20  ? 134.444 23.243   101.824 1.00 332.27 ? 20  DA  u C4    1 
ATOM 3619  P P     . DA  G  1 21  ? 136.382 26.487   96.623  1.00 378.43 ? 21  DA  u P     1 
ATOM 3620  O OP1   . DA  G  1 21  ? 136.023 27.631   95.743  1.00 386.18 ? 21  DA  u OP1   1 
ATOM 3621  O OP2   . DA  G  1 21  ? 136.882 25.221   96.027  1.00 379.14 ? 21  DA  u OP2   1 
ATOM 3622  O "O5'" . DA  G  1 21  ? 137.478 26.987   97.665  1.00 375.19 ? 21  DA  u "O5'" 1 
ATOM 3623  C "C5'" . DA  G  1 21  ? 137.160 27.949   98.679  1.00 367.96 ? 21  DA  u "C5'" 1 
ATOM 3624  C "C4'" . DA  G  1 21  ? 138.117 27.780   99.833  1.00 365.16 ? 21  DA  u "C4'" 1 
ATOM 3625  O "O4'" . DA  G  1 21  ? 137.773 26.580   100.568 1.00 353.63 ? 21  DA  u "O4'" 1 
ATOM 3626  C "C3'" . DA  G  1 21  ? 139.583 27.615   99.428  1.00 373.79 ? 21  DA  u "C3'" 1 
ATOM 3627  O "O3'" . DA  G  1 21  ? 140.379 28.266   100.425 1.00 393.16 ? 21  DA  u "O3'" 1 
ATOM 3628  C "C2'" . DA  G  1 21  ? 139.786 26.110   99.486  1.00 364.30 ? 21  DA  u "C2'" 1 
ATOM 3629  C "C1'" . DA  G  1 21  ? 138.929 25.766   100.687 1.00 352.78 ? 21  DA  u "C1'" 1 
ATOM 3630  N N9    . DA  G  1 21  ? 138.493 24.376   100.797 1.00 345.70 ? 21  DA  u N9    1 
ATOM 3631  C C8    . DA  G  1 21  ? 138.099 23.515   99.802  1.00 341.60 ? 21  DA  u C8    1 
ATOM 3632  N N7    . DA  G  1 21  ? 137.762 22.324   100.237 1.00 339.51 ? 21  DA  u N7    1 
ATOM 3633  C C5    . DA  G  1 21  ? 137.943 22.408   101.611 1.00 343.18 ? 21  DA  u C5    1 
ATOM 3634  C C6    . DA  G  1 21  ? 137.752 21.479   102.649 1.00 344.10 ? 21  DA  u C6    1 
ATOM 3635  N N6    . DA  G  1 21  ? 137.322 20.231   102.455 1.00 340.03 ? 21  DA  u N6    1 
ATOM 3636  N N1    . DA  G  1 21  ? 138.026 21.881   103.910 1.00 349.09 ? 21  DA  u N1    1 
ATOM 3637  C C2    . DA  G  1 21  ? 138.454 23.135   104.104 1.00 350.93 ? 21  DA  u C2    1 
ATOM 3638  N N3    . DA  G  1 21  ? 138.665 24.101   103.213 1.00 350.16 ? 21  DA  u N3    1 
ATOM 3639  C C4    . DA  G  1 21  ? 138.388 23.668   101.970 1.00 345.98 ? 21  DA  u C4    1 
ATOM 3640  P P     . DA  G  1 22  ? 141.875 28.749   100.103 1.00 406.42 ? 22  DA  u P     1 
ATOM 3641  O OP1   . DA  G  1 22  ? 141.893 30.235   100.150 1.00 405.58 ? 22  DA  u OP1   1 
ATOM 3642  O OP2   . DA  G  1 22  ? 142.333 28.056   98.870  1.00 406.28 ? 22  DA  u OP2   1 
ATOM 3643  O "O5'" . DA  G  1 22  ? 142.713 28.175   101.338 1.00 412.73 ? 22  DA  u "O5'" 1 
ATOM 3644  C "C5'" . DA  G  1 22  ? 142.299 28.399   102.711 1.00 423.00 ? 22  DA  u "C5'" 1 
ATOM 3645  C "C4'" . DA  G  1 22  ? 142.832 27.331   103.644 1.00 425.07 ? 22  DA  u "C4'" 1 
ATOM 3646  O "O4'" . DA  G  1 22  ? 142.143 26.070   103.432 1.00 425.80 ? 22  DA  u "O4'" 1 
ATOM 3647  C "C3'" . DA  G  1 22  ? 144.325 27.015   103.523 1.00 424.84 ? 22  DA  u "C3'" 1 
ATOM 3648  O "O3'" . DA  G  1 22  ? 144.861 26.731   104.823 1.00 413.84 ? 22  DA  u "O3'" 1 
ATOM 3649  C "C2'" . DA  G  1 22  ? 144.330 25.738   102.703 1.00 425.80 ? 22  DA  u "C2'" 1 
ATOM 3650  C "C1'" . DA  G  1 22  ? 143.109 25.039   103.272 1.00 424.14 ? 22  DA  u "C1'" 1 
ATOM 3651  N N9    . DA  G  1 22  ? 142.528 23.986   102.432 1.00 421.11 ? 22  DA  u N9    1 
ATOM 3652  C C8    . DA  G  1 22  ? 142.312 24.014   101.076 1.00 419.59 ? 22  DA  u C8    1 
ATOM 3653  N N7    . DA  G  1 22  ? 141.777 22.915   100.602 1.00 418.52 ? 22  DA  u N7    1 
ATOM 3654  C C5    . DA  G  1 22  ? 141.639 22.102   101.719 1.00 416.77 ? 22  DA  u C5    1 
ATOM 3655  C C6    . DA  G  1 22  ? 141.134 20.798   101.886 1.00 412.78 ? 22  DA  u C6    1 
ATOM 3656  N N6    . DA  G  1 22  ? 140.660 20.053   100.886 1.00 409.63 ? 22  DA  u N6    1 
ATOM 3657  N N1    . DA  G  1 22  ? 141.139 20.278   103.134 1.00 409.38 ? 22  DA  u N1    1 
ATOM 3658  C C2    . DA  G  1 22  ? 141.624 21.023   104.137 1.00 407.16 ? 22  DA  u C2    1 
ATOM 3659  N N3    . DA  G  1 22  ? 142.113 22.261   104.108 1.00 411.28 ? 22  DA  u N3    1 
ATOM 3660  C C4    . DA  G  1 22  ? 142.101 22.748   102.853 1.00 417.48 ? 22  DA  u C4    1 
ATOM 3661  P P     . DA  G  1 23  ? 146.445 26.821   105.100 1.00 404.68 ? 23  DA  u P     1 
ATOM 3662  O OP1   . DA  G  1 23  ? 146.670 27.845   106.151 1.00 400.48 ? 23  DA  u OP1   1 
ATOM 3663  O OP2   . DA  G  1 23  ? 147.138 26.947   103.795 1.00 411.36 ? 23  DA  u OP2   1 
ATOM 3664  O "O5'" . DA  G  1 23  ? 146.812 25.380   105.679 1.00 393.75 ? 23  DA  u "O5'" 1 
ATOM 3665  C "C5'" . DA  G  1 23  ? 146.192 24.840   106.865 1.00 376.67 ? 23  DA  u "C5'" 1 
ATOM 3666  C "C4'" . DA  G  1 23  ? 146.504 23.366   107.008 1.00 364.26 ? 23  DA  u "C4'" 1 
ATOM 3667  O "O4'" . DA  G  1 23  ? 145.754 22.600   106.033 1.00 354.09 ? 23  DA  u "O4'" 1 
ATOM 3668  C "C3'" . DA  G  1 23  ? 147.968 22.981   106.787 1.00 364.07 ? 23  DA  u "C3'" 1 
ATOM 3669  O "O3'" . DA  G  1 23  ? 148.286 21.827   107.577 1.00 372.41 ? 23  DA  u "O3'" 1 
ATOM 3670  C "C2'" . DA  G  1 23  ? 147.978 22.527   105.341 1.00 357.34 ? 23  DA  u "C2'" 1 
ATOM 3671  C "C1'" . DA  G  1 23  ? 146.660 21.785   105.299 1.00 351.84 ? 23  DA  u "C1'" 1 
ATOM 3672  N N9    . DA  G  1 23  ? 146.111 21.583   103.960 1.00 347.43 ? 23  DA  u N9    1 
ATOM 3673  C C8    . DA  G  1 23  ? 146.173 22.435   102.885 1.00 346.14 ? 23  DA  u C8    1 
ATOM 3674  N N7    . DA  G  1 23  ? 145.591 21.968   101.806 1.00 347.39 ? 23  DA  u N7    1 
ATOM 3675  C C5    . DA  G  1 23  ? 145.125 20.719   102.193 1.00 348.50 ? 23  DA  u C5    1 
ATOM 3676  C C6    . DA  G  1 23  ? 144.421 19.713   101.502 1.00 349.36 ? 23  DA  u C6    1 
ATOM 3677  N N6    . DA  G  1 23  ? 144.048 19.814   100.224 1.00 352.96 ? 23  DA  u N6    1 
ATOM 3678  N N1    . DA  G  1 23  ? 144.115 18.583   102.177 1.00 346.17 ? 23  DA  u N1    1 
ATOM 3679  C C2    . DA  G  1 23  ? 144.503 18.476   103.455 1.00 343.35 ? 23  DA  u C2    1 
ATOM 3680  N N3    . DA  G  1 23  ? 145.156 19.354   104.216 1.00 343.86 ? 23  DA  u N3    1 
ATOM 3681  C C4    . DA  G  1 23  ? 145.446 20.465   103.516 1.00 346.48 ? 23  DA  u C4    1 
ATOM 3682  P P     . DA  G  1 24  ? 149.771 21.607   108.134 1.00 380.10 ? 24  DA  u P     1 
ATOM 3683  O OP1   . DA  G  1 24  ? 149.717 21.753   109.611 1.00 379.13 ? 24  DA  u OP1   1 
ATOM 3684  O OP2   . DA  G  1 24  ? 150.691 22.475   107.355 1.00 377.36 ? 24  DA  u OP2   1 
ATOM 3685  O "O5'" . DA  G  1 24  ? 150.100 20.093   107.736 1.00 397.54 ? 24  DA  u "O5'" 1 
ATOM 3686  C "C5'" . DA  G  1 24  ? 149.386 18.970   108.318 1.00 420.55 ? 24  DA  u "C5'" 1 
ATOM 3687  C "C4'" . DA  G  1 24  ? 149.502 17.710   107.482 1.00 430.14 ? 24  DA  u "C4'" 1 
ATOM 3688  O "O4'" . DA  G  1 24  ? 148.794 17.879   106.226 1.00 436.10 ? 24  DA  u "O4'" 1 
ATOM 3689  C "C3'" . DA  G  1 24  ? 150.921 17.267   107.095 1.00 432.00 ? 24  DA  u "C3'" 1 
ATOM 3690  O "O3'" . DA  G  1 24  ? 151.045 15.836   106.917 1.00 420.01 ? 24  DA  u "O3'" 1 
ATOM 3691  C "C2'" . DA  G  1 24  ? 151.071 17.860   105.711 1.00 438.68 ? 24  DA  u "C2'" 1 
ATOM 3692  C "C1'" . DA  G  1 24  ? 149.687 17.552   105.173 1.00 442.35 ? 24  DA  u "C1'" 1 
ATOM 3693  N N9    . DA  G  1 24  ? 149.287 18.295   103.981 1.00 447.20 ? 24  DA  u N9    1 
ATOM 3694  C C8    . DA  G  1 24  ? 149.632 19.567   103.597 1.00 450.96 ? 24  DA  u C8    1 
ATOM 3695  N N7    . DA  G  1 24  ? 149.115 19.931   102.447 1.00 451.93 ? 24  DA  u N7    1 
ATOM 3696  C C5    . DA  G  1 24  ? 148.401 18.814   102.036 1.00 448.25 ? 24  DA  u C5    1 
ATOM 3697  C C6    . DA  G  1 24  ? 147.642 18.547   100.883 1.00 444.86 ? 24  DA  u C6    1 
ATOM 3698  N N6    . DA  G  1 24  ? 147.461 19.426   99.896  1.00 445.01 ? 24  DA  u N6    1 
ATOM 3699  N N1    . DA  G  1 24  ? 147.059 17.333   100.782 1.00 439.87 ? 24  DA  u N1    1 
ATOM 3700  C C2    . DA  G  1 24  ? 147.244 16.449   101.771 1.00 439.23 ? 24  DA  u C2    1 
ATOM 3701  N N3    . DA  G  1 24  ? 147.935 16.581   102.900 1.00 443.83 ? 24  DA  u N3    1 
ATOM 3702  C C4    . DA  G  1 24  ? 148.503 17.797   102.968 1.00 447.02 ? 24  DA  u C4    1 
ATOM 3703  P P     . DA  G  1 25  ? 152.512 15.156   106.839 1.00 409.87 ? 25  DA  u P     1 
ATOM 3704  O OP1   . DA  G  1 25  ? 152.922 14.804   108.214 1.00 407.26 ? 25  DA  u OP1   1 
ATOM 3705  O OP2   . DA  G  1 25  ? 153.375 16.012   105.991 1.00 403.25 ? 25  DA  u OP2   1 
ATOM 3706  O "O5'" . DA  G  1 25  ? 152.319 13.794   106.037 1.00 419.16 ? 25  DA  u "O5'" 1 
ATOM 3707  C "C5'" . DA  G  1 25  ? 151.123 13.012   106.132 1.00 437.74 ? 25  DA  u "C5'" 1 
ATOM 3708  C "C4'" . DA  G  1 25  ? 150.798 12.324   104.822 1.00 449.40 ? 25  DA  u "C4'" 1 
ATOM 3709  O "O4'" . DA  G  1 25  ? 150.437 13.285   103.807 1.00 457.05 ? 25  DA  u "O4'" 1 
ATOM 3710  C "C3'" . DA  G  1 25  ? 151.884 11.468   104.173 1.00 450.86 ? 25  DA  u "C3'" 1 
ATOM 3711  O "O3'" . DA  G  1 25  ? 151.241 10.512   103.303 1.00 453.40 ? 25  DA  u "O3'" 1 
ATOM 3712  C "C2'" . DA  G  1 25  ? 152.607 12.492   103.328 1.00 450.69 ? 25  DA  u "C2'" 1 
ATOM 3713  C "C1'" . DA  G  1 25  ? 151.405 13.236   102.767 1.00 456.97 ? 25  DA  u "C1'" 1 
ATOM 3714  N N9    . DA  G  1 25  ? 151.601 14.596   102.282 1.00 465.46 ? 25  DA  u N9    1 
ATOM 3715  C C8    . DA  G  1 25  ? 152.339 15.648   102.765 1.00 457.35 ? 25  DA  u C8    1 
ATOM 3716  N N7    . DA  G  1 25  ? 152.218 16.746   102.058 1.00 463.10 ? 25  DA  u N7    1 
ATOM 3717  C C5    . DA  G  1 25  ? 151.331 16.395   101.049 1.00 480.47 ? 25  DA  u C5    1 
ATOM 3718  C C6    . DA  G  1 25  ? 150.800 17.111   99.960  1.00 495.77 ? 25  DA  u C6    1 
ATOM 3719  N N6    . DA  G  1 25  ? 151.083 18.389   99.702  1.00 504.74 ? 25  DA  u N6    1 
ATOM 3720  N N1    . DA  G  1 25  ? 149.955 16.458   99.134  1.00 501.71 ? 25  DA  u N1    1 
ATOM 3721  C C2    . DA  G  1 25  ? 149.661 15.179   99.399  1.00 499.71 ? 25  DA  u C2    1 
ATOM 3722  N N3    . DA  G  1 25  ? 150.092 14.402   100.388 1.00 489.80 ? 25  DA  u N3    1 
ATOM 3723  C C4    . DA  G  1 25  ? 150.936 15.077   101.184 1.00 477.71 ? 25  DA  u C4    1 
ATOM 3724  P P     . DA  G  1 26  ? 151.762 8.988    103.238 1.00 458.95 ? 26  DA  u P     1 
ATOM 3725  O OP1   . DA  G  1 26  ? 151.118 8.221    104.335 1.00 457.14 ? 26  DA  u OP1   1 
ATOM 3726  O OP2   . DA  G  1 26  ? 153.242 9.016    103.111 1.00 463.72 ? 26  DA  u OP2   1 
ATOM 3727  O "O5'" . DA  G  1 26  ? 151.161 8.389    101.887 1.00 456.49 ? 26  DA  u "O5'" 1 
ATOM 3728  C "C5'" . DA  G  1 26  ? 150.232 9.091    101.044 1.00 439.47 ? 26  DA  u "C5'" 1 
ATOM 3729  C "C4'" . DA  G  1 26  ? 150.642 8.954    99.594  1.00 433.70 ? 26  DA  u "C4'" 1 
ATOM 3730  O "O4'" . DA  G  1 26  ? 151.048 10.249   99.099  1.00 432.79 ? 26  DA  u "O4'" 1 
ATOM 3731  C "C3'" . DA  G  1 26  ? 151.813 8.009    99.308  1.00 434.39 ? 26  DA  u "C3'" 1 
ATOM 3732  O "O3'" . DA  G  1 26  ? 151.608 7.264    98.099  1.00 431.57 ? 26  DA  u "O3'" 1 
ATOM 3733  C "C2'" . DA  G  1 26  ? 153.009 8.943    99.212  1.00 435.70 ? 26  DA  u "C2'" 1 
ATOM 3734  C "C1'" . DA  G  1 26  ? 152.401 10.224   98.655  1.00 439.74 ? 26  DA  u "C1'" 1 
ATOM 3735  N N9    . DA  G  1 26  ? 153.031 11.486   99.068  1.00 449.68 ? 26  DA  u N9    1 
ATOM 3736  C C8    . DA  G  1 26  ? 153.855 11.754   100.135 1.00 448.04 ? 26  DA  u C8    1 
ATOM 3737  N N7    . DA  G  1 26  ? 154.221 13.011   100.219 1.00 452.19 ? 26  DA  u N7    1 
ATOM 3738  C C5    . DA  G  1 26  ? 153.585 13.616   99.144  1.00 462.59 ? 26  DA  u C5    1 
ATOM 3739  C C6    . DA  G  1 26  ? 153.567 14.946   98.675  1.00 469.16 ? 26  DA  u C6    1 
ATOM 3740  N N6    . DA  G  1 26  ? 154.230 15.949   99.255  1.00 467.06 ? 26  DA  u N6    1 
ATOM 3741  N N1    . DA  G  1 26  ? 152.838 15.209   97.570  1.00 478.64 ? 26  DA  u N1    1 
ATOM 3742  C C2    . DA  G  1 26  ? 152.173 14.204   96.988  1.00 484.08 ? 26  DA  u C2    1 
ATOM 3743  N N3    . DA  G  1 26  ? 152.115 12.919   97.327  1.00 477.31 ? 26  DA  u N3    1 
ATOM 3744  C C4    . DA  G  1 26  ? 152.844 12.689   98.431  1.00 462.78 ? 26  DA  u C4    1 
ATOM 3745  P P     . DT  H  2 1   ? 151.088 16.935   88.501  1.00 545.00 ? 1   DT  v P     1 
ATOM 3746  O OP1   . DT  H  2 1   ? 151.458 17.003   87.061  1.00 551.45 ? 1   DT  v OP1   1 
ATOM 3747  O OP2   . DT  H  2 1   ? 149.989 17.800   89.007  1.00 541.34 ? 1   DT  v OP2   1 
ATOM 3748  O "O5'" . DT  H  2 1   ? 150.796 15.428   88.940  1.00 541.79 ? 1   DT  v "O5'" 1 
ATOM 3749  C "C5'" . DT  H  2 1   ? 151.867 14.470   89.130  1.00 543.46 ? 1   DT  v "C5'" 1 
ATOM 3750  C "C4'" . DT  H  2 1   ? 151.660 13.631   90.373  1.00 539.10 ? 1   DT  v "C4'" 1 
ATOM 3751  O "O4'" . DT  H  2 1   ? 152.240 14.301   91.522  1.00 537.42 ? 1   DT  v "O4'" 1 
ATOM 3752  C "C3'" . DT  H  2 1   ? 150.204 13.326   90.750  1.00 534.63 ? 1   DT  v "C3'" 1 
ATOM 3753  O "O3'" . DT  H  2 1   ? 150.061 11.975   91.232  1.00 533.72 ? 1   DT  v "O3'" 1 
ATOM 3754  C "C2'" . DT  H  2 1   ? 149.933 14.294   91.889  1.00 530.61 ? 1   DT  v "C2'" 1 
ATOM 3755  C "C1'" . DT  H  2 1   ? 151.289 14.321   92.573  1.00 532.35 ? 1   DT  v "C1'" 1 
ATOM 3756  N N1    . DT  H  2 1   ? 151.585 15.479   93.451  1.00 531.42 ? 1   DT  v N1    1 
ATOM 3757  C C2    . DT  H  2 1   ? 152.149 15.193   94.672  1.00 530.72 ? 1   DT  v C2    1 
ATOM 3758  O O2    . DT  H  2 1   ? 152.401 14.056   95.036  1.00 530.83 ? 1   DT  v O2    1 
ATOM 3759  N N3    . DT  H  2 1   ? 152.404 16.292   95.458  1.00 530.76 ? 1   DT  v N3    1 
ATOM 3760  C C4    . DT  H  2 1   ? 152.149 17.616   95.152  1.00 531.44 ? 1   DT  v C4    1 
ATOM 3761  O O4    . DT  H  2 1   ? 152.428 18.496   95.963  1.00 532.17 ? 1   DT  v O4    1 
ATOM 3762  C C5    . DT  H  2 1   ? 151.553 17.843   93.853  1.00 532.13 ? 1   DT  v C5    1 
ATOM 3763  C C7    . DT  H  2 1   ? 151.244 19.245   93.432  1.00 533.85 ? 1   DT  v C7    1 
ATOM 3764  C C6    . DT  H  2 1   ? 151.303 16.777   93.079  1.00 532.09 ? 1   DT  v C6    1 
ATOM 3765  P P     . DT  H  2 2   ? 148.673 11.155   91.038  1.00 526.53 ? 2   DT  v P     1 
ATOM 3766  O OP1   . DT  H  2 2   ? 148.903 10.079   90.039  1.00 536.99 ? 2   DT  v OP1   1 
ATOM 3767  O OP2   . DT  H  2 2   ? 147.567 12.129   90.833  1.00 524.33 ? 2   DT  v OP2   1 
ATOM 3768  O "O5'" . DT  H  2 2   ? 148.439 10.445   92.447  1.00 517.45 ? 2   DT  v "O5'" 1 
ATOM 3769  C "C5'" . DT  H  2 2   ? 149.518 9.854    93.203  1.00 522.65 ? 2   DT  v "C5'" 1 
ATOM 3770  C "C4'" . DT  H  2 2   ? 149.226 9.918    94.688  1.00 526.59 ? 2   DT  v "C4'" 1 
ATOM 3771  O "O4'" . DT  H  2 2   ? 149.532 11.237   95.206  1.00 524.63 ? 2   DT  v "O4'" 1 
ATOM 3772  C "C3'" . DT  H  2 2   ? 147.782 9.629    95.107  1.00 523.19 ? 2   DT  v "C3'" 1 
ATOM 3773  O "O3'" . DT  H  2 2   ? 147.831 8.866    96.315  1.00 522.66 ? 2   DT  v "O3'" 1 
ATOM 3774  C "C2'" . DT  H  2 2   ? 147.211 11.011   95.385  1.00 519.29 ? 2   DT  v "C2'" 1 
ATOM 3775  C "C1'" . DT  H  2 2   ? 148.424 11.719   95.954  1.00 520.26 ? 2   DT  v "C1'" 1 
ATOM 3776  N N1    . DT  H  2 2   ? 148.440 13.197   95.895  1.00 519.08 ? 2   DT  v N1    1 
ATOM 3777  C C2    . DT  H  2 2   ? 149.071 13.832   96.938  1.00 518.96 ? 2   DT  v C2    1 
ATOM 3778  O O2    . DT  H  2 2   ? 149.542 13.233   97.891  1.00 519.62 ? 2   DT  v O2    1 
ATOM 3779  N N3    . DT  H  2 2   ? 149.101 15.204   96.840  1.00 518.84 ? 2   DT  v N3    1 
ATOM 3780  C C4    . DT  H  2 2   ? 148.572 15.983   95.827  1.00 518.91 ? 2   DT  v C4    1 
ATOM 3781  O O4    . DT  H  2 2   ? 148.658 17.208   95.887  1.00 519.55 ? 2   DT  v O4    1 
ATOM 3782  C C5    . DT  H  2 2   ? 147.931 15.247   94.757  1.00 519.09 ? 2   DT  v C5    1 
ATOM 3783  C C7    . DT  H  2 2   ? 147.328 16.003   93.616  1.00 520.16 ? 2   DT  v C7    1 
ATOM 3784  C C6    . DT  H  2 2   ? 147.905 13.909   94.841  1.00 519.18 ? 2   DT  v C6    1 
ATOM 3785  P P     . DT  H  2 3   ? 146.774 7.686    96.590  1.00 517.90 ? 3   DT  v P     1 
ATOM 3786  O OP1   . DT  H  2 3   ? 147.477 6.388    96.400  1.00 521.59 ? 3   DT  v OP1   1 
ATOM 3787  O OP2   . DT  H  2 3   ? 145.549 7.960    95.791  1.00 521.25 ? 3   DT  v OP2   1 
ATOM 3788  O "O5'" . DT  H  2 3   ? 146.415 7.907    98.131  1.00 501.40 ? 3   DT  v "O5'" 1 
ATOM 3789  C "C5'" . DT  H  2 3   ? 147.425 8.327    99.080  1.00 460.75 ? 3   DT  v "C5'" 1 
ATOM 3790  C "C4'" . DT  H  2 3   ? 146.863 9.177    100.201 1.00 429.18 ? 3   DT  v "C4'" 1 
ATOM 3791  O "O4'" . DT  H  2 3   ? 147.040 10.584   99.904  1.00 408.65 ? 3   DT  v "O4'" 1 
ATOM 3792  C "C3'" . DT  H  2 3   ? 145.381 8.987    100.547 1.00 422.14 ? 3   DT  v "C3'" 1 
ATOM 3793  O "O3'" . DT  H  2 3   ? 145.214 8.815    101.962 1.00 426.97 ? 3   DT  v "O3'" 1 
ATOM 3794  C "C2'" . DT  H  2 3   ? 144.736 10.304   100.146 1.00 408.07 ? 3   DT  v "C2'" 1 
ATOM 3795  C "C1'" . DT  H  2 3   ? 145.879 11.290   100.302 1.00 400.34 ? 3   DT  v "C1'" 1 
ATOM 3796  N N1    . DT  H  2 3   ? 145.768 12.498   99.459  1.00 394.54 ? 3   DT  v N1    1 
ATOM 3797  C C2    . DT  H  2 3   ? 146.376 13.653   99.893  1.00 388.17 ? 3   DT  v C2    1 
ATOM 3798  O O2    . DT  H  2 3   ? 146.988 13.728   100.946 1.00 379.36 ? 3   DT  v O2    1 
ATOM 3799  N N3    . DT  H  2 3   ? 146.227 14.730   99.049  1.00 391.06 ? 3   DT  v N3    1 
ATOM 3800  C C4    . DT  H  2 3   ? 145.544 14.761   97.844  1.00 402.01 ? 3   DT  v C4    1 
ATOM 3801  O O4    . DT  H  2 3   ? 145.479 15.808   97.202  1.00 401.21 ? 3   DT  v O4    1 
ATOM 3802  C C5    . DT  H  2 3   ? 144.942 13.507   97.445  1.00 410.31 ? 3   DT  v C5    1 
ATOM 3803  C C7    . DT  H  2 3   ? 144.187 13.440   96.155  1.00 425.93 ? 3   DT  v C7    1 
ATOM 3804  C C6    . DT  H  2 3   ? 145.087 12.453   98.259  1.00 405.36 ? 3   DT  v C6    1 
ATOM 3805  P P     . DT  H  2 4   ? 143.911 8.065    102.559 1.00 432.21 ? 4   DT  v P     1 
ATOM 3806  O OP1   . DT  H  2 4   ? 144.313 6.689    102.956 1.00 441.58 ? 4   DT  v OP1   1 
ATOM 3807  O OP2   . DT  H  2 4   ? 142.777 8.256    101.617 1.00 428.75 ? 4   DT  v OP2   1 
ATOM 3808  O "O5'" . DT  H  2 4   ? 143.583 8.897    103.881 1.00 428.30 ? 4   DT  v "O5'" 1 
ATOM 3809  C "C5'" . DT  H  2 4   ? 144.634 9.272    104.789 1.00 423.59 ? 4   DT  v "C5'" 1 
ATOM 3810  C "C4'" . DT  H  2 4   ? 144.380 10.652   105.347 1.00 402.47 ? 4   DT  v "C4'" 1 
ATOM 3811  O "O4'" . DT  H  2 4   ? 144.589 11.651   104.318 1.00 387.56 ? 4   DT  v "O4'" 1 
ATOM 3812  C "C3'" . DT  H  2 4   ? 142.966 10.877   105.893 1.00 386.26 ? 4   DT  v "C3'" 1 
ATOM 3813  O "O3'" . DT  H  2 4   ? 143.046 11.292   107.260 1.00 375.57 ? 4   DT  v "O3'" 1 
ATOM 3814  C "C2'" . DT  H  2 4   ? 142.405 11.991   105.023 1.00 374.71 ? 4   DT  v "C2'" 1 
ATOM 3815  C "C1'" . DT  H  2 4   ? 143.653 12.688   104.512 1.00 366.68 ? 4   DT  v "C1'" 1 
ATOM 3816  N N1    . DT  H  2 4   ? 143.470 13.389   103.224 1.00 344.70 ? 4   DT  v N1    1 
ATOM 3817  C C2    . DT  H  2 4   ? 144.078 14.611   103.026 1.00 336.38 ? 4   DT  v C2    1 
ATOM 3818  O O2    . DT  H  2 4   ? 144.794 15.144   103.857 1.00 335.79 ? 4   DT  v O2    1 
ATOM 3819  N N3    . DT  H  2 4   ? 143.812 15.190   101.809 1.00 329.07 ? 4   DT  v N3    1 
ATOM 3820  C C4    . DT  H  2 4   ? 143.017 14.681   100.797 1.00 327.05 ? 4   DT  v C4    1 
ATOM 3821  O O4    . DT  H  2 4   ? 142.869 15.316   99.759  1.00 327.08 ? 4   DT  v O4    1 
ATOM 3822  C C5    . DT  H  2 4   ? 142.422 13.393   101.070 1.00 328.03 ? 4   DT  v C5    1 
ATOM 3823  C C7    . DT  H  2 4   ? 141.548 12.762   100.032 1.00 327.71 ? 4   DT  v C7    1 
ATOM 3824  C C6    . DT  H  2 4   ? 142.665 12.827   102.258 1.00 334.16 ? 4   DT  v C6    1 
ATOM 3825  P P     . DT  H  2 5   ? 141.887 10.912   108.310 1.00 359.77 ? 5   DT  v P     1 
ATOM 3826  O OP1   . DT  H  2 5   ? 142.282 9.670    109.012 1.00 364.27 ? 5   DT  v OP1   1 
ATOM 3827  O OP2   . DT  H  2 5   ? 140.574 10.995   107.623 1.00 353.58 ? 5   DT  v OP2   1 
ATOM 3828  O "O5'" . DT  H  2 5   ? 141.970 12.082   109.384 1.00 350.32 ? 5   DT  v "O5'" 1 
ATOM 3829  C "C5'" . DT  H  2 5   ? 143.210 12.754   109.653 1.00 347.98 ? 5   DT  v "C5'" 1 
ATOM 3830  C "C4'" . DT  H  2 5   ? 142.963 14.242   109.719 1.00 341.11 ? 5   DT  v "C4'" 1 
ATOM 3831  O "O4'" . DT  H  2 5   ? 143.091 14.820   108.397 1.00 333.55 ? 5   DT  v "O4'" 1 
ATOM 3832  C "C3'" . DT  H  2 5   ? 141.562 14.614   110.208 1.00 339.56 ? 5   DT  v "C3'" 1 
ATOM 3833  O "O3'" . DT  H  2 5   ? 141.641 15.670   111.161 1.00 357.41 ? 5   DT  v "O3'" 1 
ATOM 3834  C "C2'" . DT  H  2 5   ? 140.869 15.133   108.963 1.00 329.00 ? 5   DT  v "C2'" 1 
ATOM 3835  C "C1'" . DT  H  2 5   ? 142.032 15.739   108.216 1.00 327.84 ? 5   DT  v "C1'" 1 
ATOM 3836  N N1    . DT  H  2 5   ? 141.780 15.882   106.774 1.00 324.15 ? 5   DT  v N1    1 
ATOM 3837  C C2    . DT  H  2 5   ? 142.390 16.903   106.079 1.00 323.00 ? 5   DT  v C2    1 
ATOM 3838  O O2    . DT  H  2 5   ? 143.181 17.680   106.590 1.00 320.12 ? 5   DT  v O2    1 
ATOM 3839  N N3    . DT  H  2 5   ? 142.042 16.978   104.753 1.00 324.00 ? 5   DT  v N3    1 
ATOM 3840  C C4    . DT  H  2 5   ? 141.161 16.159   104.072 1.00 324.60 ? 5   DT  v C4    1 
ATOM 3841  O O4    . DT  H  2 5   ? 140.955 16.342   102.875 1.00 326.36 ? 5   DT  v O4    1 
ATOM 3842  C C5    . DT  H  2 5   ? 140.544 15.122   104.870 1.00 324.08 ? 5   DT  v C5    1 
ATOM 3843  C C7    . DT  H  2 5   ? 139.579 14.182   104.220 1.00 322.41 ? 5   DT  v C7    1 
ATOM 3844  C C6    . DT  H  2 5   ? 140.869 15.047   106.166 1.00 324.09 ? 5   DT  v C6    1 
ATOM 3845  P P     . DT  H  2 6   ? 140.538 15.780   112.306 1.00 375.62 ? 6   DT  v P     1 
ATOM 3846  O OP1   . DT  H  2 6   ? 141.064 15.104   113.516 1.00 384.57 ? 6   DT  v OP1   1 
ATOM 3847  O OP2   . DT  H  2 6   ? 139.230 15.361   111.736 1.00 370.73 ? 6   DT  v OP2   1 
ATOM 3848  O "O5'" . DT  H  2 6   ? 140.469 17.343   112.601 1.00 389.58 ? 6   DT  v "O5'" 1 
ATOM 3849  C "C5'" . DT  H  2 6   ? 141.657 18.116   112.855 1.00 408.61 ? 6   DT  v "C5'" 1 
ATOM 3850  C "C4'" . DT  H  2 6   ? 141.446 19.537   112.390 1.00 408.68 ? 6   DT  v "C4'" 1 
ATOM 3851  O "O4'" . DT  H  2 6   ? 141.542 19.577   110.944 1.00 390.19 ? 6   DT  v "O4'" 1 
ATOM 3852  C "C3'" . DT  H  2 6   ? 140.075 20.125   112.752 1.00 411.02 ? 6   DT  v "C3'" 1 
ATOM 3853  O "O3'" . DT  H  2 6   ? 140.174 21.452   113.306 1.00 428.50 ? 6   DT  v "O3'" 1 
ATOM 3854  C "C2'" . DT  H  2 6   ? 139.330 20.130   111.429 1.00 390.70 ? 6   DT  v "C2'" 1 
ATOM 3855  C "C1'" . DT  H  2 6   ? 140.447 20.304   110.420 1.00 369.08 ? 6   DT  v "C1'" 1 
ATOM 3856  N N1    . DT  H  2 6   ? 140.115 19.746   109.100 1.00 338.23 ? 6   DT  v N1    1 
ATOM 3857  C C2    . DT  H  2 6   ? 140.548 20.400   107.968 1.00 324.63 ? 6   DT  v C2    1 
ATOM 3858  O O2    . DT  H  2 6   ? 141.238 21.406   107.999 1.00 316.61 ? 6   DT  v O2    1 
ATOM 3859  N N3    . DT  H  2 6   ? 140.153 19.820   106.788 1.00 318.76 ? 6   DT  v N3    1 
ATOM 3860  C C4    . DT  H  2 6   ? 139.382 18.683   106.633 1.00 318.99 ? 6   DT  v C4    1 
ATOM 3861  O O4    . DT  H  2 6   ? 139.112 18.276   105.506 1.00 319.55 ? 6   DT  v O4    1 
ATOM 3862  C C5    . DT  H  2 6   ? 138.947 18.060   107.864 1.00 320.63 ? 6   DT  v C5    1 
ATOM 3863  C C7    . DT  H  2 6   ? 138.100 16.829   107.797 1.00 318.17 ? 6   DT  v C7    1 
ATOM 3864  C C6    . DT  H  2 6   ? 139.329 18.618   109.019 1.00 328.20 ? 6   DT  v C6    1 
ATOM 3865  P P     . DT  H  2 7   ? 138.927 22.137   114.111 1.00 428.54 ? 7   DT  v P     1 
ATOM 3866  O OP1   . DT  H  2 7   ? 139.301 22.242   115.549 1.00 425.55 ? 7   DT  v OP1   1 
ATOM 3867  O OP2   . DT  H  2 7   ? 137.661 21.445   113.720 1.00 427.77 ? 7   DT  v OP2   1 
ATOM 3868  O "O5'" . DT  H  2 7   ? 138.886 23.622   113.528 1.00 416.36 ? 7   DT  v "O5'" 1 
ATOM 3869  C "C5'" . DT  H  2 7   ? 140.072 24.245   112.983 1.00 400.31 ? 7   DT  v "C5'" 1 
ATOM 3870  C "C4'" . DT  H  2 7   ? 139.696 25.271   111.939 1.00 381.83 ? 7   DT  v "C4'" 1 
ATOM 3871  O "O4'" . DT  H  2 7   ? 139.610 24.651   110.630 1.00 366.51 ? 7   DT  v "O4'" 1 
ATOM 3872  C "C3'" . DT  H  2 7   ? 138.342 25.935   112.180 1.00 374.55 ? 7   DT  v "C3'" 1 
ATOM 3873  O "O3'" . DT  H  2 7   ? 138.400 27.327   111.871 1.00 381.52 ? 7   DT  v "O3'" 1 
ATOM 3874  C "C2'" . DT  H  2 7   ? 137.423 25.227   111.204 1.00 360.08 ? 7   DT  v "C2'" 1 
ATOM 3875  C "C1'" . DT  H  2 7   ? 138.351 24.944   110.042 1.00 349.44 ? 7   DT  v "C1'" 1 
ATOM 3876  N N1    . DT  H  2 7   ? 137.939 23.781   109.236 1.00 330.84 ? 7   DT  v N1    1 
ATOM 3877  C C2    . DT  H  2 7   ? 138.078 23.841   107.868 1.00 322.20 ? 7   DT  v C2    1 
ATOM 3878  O O2    . DT  H  2 7   ? 138.547 24.806   107.286 1.00 316.62 ? 7   DT  v O2    1 
ATOM 3879  N N3    . DT  H  2 7   ? 137.655 22.716   107.201 1.00 319.08 ? 7   DT  v N3    1 
ATOM 3880  C C4    . DT  H  2 7   ? 137.104 21.574   107.753 1.00 317.17 ? 7   DT  v C4    1 
ATOM 3881  O O4    . DT  H  2 7   ? 136.763 20.644   107.026 1.00 317.05 ? 7   DT  v O4    1 
ATOM 3882  C C5    . DT  H  2 7   ? 136.974 21.587   109.192 1.00 318.23 ? 7   DT  v C5    1 
ATOM 3883  C C7    . DT  H  2 7   ? 136.377 20.400   109.880 1.00 310.46 ? 7   DT  v C7    1 
ATOM 3884  C C6    . DT  H  2 7   ? 137.389 22.676   109.851 1.00 325.71 ? 7   DT  v C6    1 
ATOM 3885  P P     . DT  H  2 8   ? 137.244 28.294   112.397 1.00 386.46 ? 8   DT  v P     1 
ATOM 3886  O OP1   . DT  H  2 8   ? 137.882 29.403   113.151 1.00 399.79 ? 8   DT  v OP1   1 
ATOM 3887  O OP2   . DT  H  2 8   ? 136.225 27.448   113.076 1.00 388.28 ? 8   DT  v OP2   1 
ATOM 3888  O "O5'" . DT  H  2 8   ? 136.602 28.858   111.051 1.00 370.29 ? 8   DT  v "O5'" 1 
ATOM 3889  C "C5'" . DT  H  2 8   ? 137.417 29.375   109.972 1.00 358.45 ? 8   DT  v "C5'" 1 
ATOM 3890  C "C4'" . DT  H  2 8   ? 136.647 29.400   108.671 1.00 352.66 ? 8   DT  v "C4'" 1 
ATOM 3891  O "O4'" . DT  H  2 8   ? 136.460 28.052   108.177 1.00 341.98 ? 8   DT  v "O4'" 1 
ATOM 3892  C "C3'" . DT  H  2 8   ? 135.247 30.018   108.740 1.00 351.16 ? 8   DT  v "C3'" 1 
ATOM 3893  O "O3'" . DT  H  2 8   ? 134.972 30.749   107.547 1.00 359.97 ? 8   DT  v "O3'" 1 
ATOM 3894  C "C2'" . DT  H  2 8   ? 134.332 28.811   108.723 1.00 344.14 ? 8   DT  v "C2'" 1 
ATOM 3895  C "C1'" . DT  H  2 8   ? 135.103 27.893   107.803 1.00 343.91 ? 8   DT  v "C1'" 1 
ATOM 3896  N N1    . DT  H  2 8   ? 134.764 26.471   107.931 1.00 346.70 ? 8   DT  v N1    1 
ATOM 3897  C C2    . DT  H  2 8   ? 134.620 25.732   106.779 1.00 348.21 ? 8   DT  v C2    1 
ATOM 3898  O O2    . DT  H  2 8   ? 134.749 26.206   105.661 1.00 348.81 ? 8   DT  v O2    1 
ATOM 3899  N N3    . DT  H  2 8   ? 134.311 24.409   106.984 1.00 348.55 ? 8   DT  v N3    1 
ATOM 3900  C C4    . DT  H  2 8   ? 134.126 23.771   108.197 1.00 348.64 ? 8   DT  v C4    1 
ATOM 3901  O O4    . DT  H  2 8   ? 133.851 22.574   108.224 1.00 346.15 ? 8   DT  v O4    1 
ATOM 3902  C C5    . DT  H  2 8   ? 134.282 24.612   109.364 1.00 350.58 ? 8   DT  v C5    1 
ATOM 3903  C C7    . DT  H  2 8   ? 134.097 24.013   110.723 1.00 351.19 ? 8   DT  v C7    1 
ATOM 3904  C C6    . DT  H  2 8   ? 134.592 25.901   109.174 1.00 349.93 ? 8   DT  v C6    1 
ATOM 3905  P P     . DT  H  2 9   ? 133.849 31.888   107.556 1.00 370.07 ? 9   DT  v P     1 
ATOM 3906  O OP1   . DT  H  2 9   ? 134.508 33.181   107.256 1.00 380.29 ? 9   DT  v OP1   1 
ATOM 3907  O OP2   . DT  H  2 9   ? 133.047 31.737   108.793 1.00 365.56 ? 9   DT  v OP2   1 
ATOM 3908  O "O5'" . DT  H  2 9   ? 132.893 31.507   106.340 1.00 373.73 ? 9   DT  v "O5'" 1 
ATOM 3909  C "C5'" . DT  H  2 9   ? 133.409 31.123   105.049 1.00 378.10 ? 9   DT  v "C5'" 1 
ATOM 3910  C "C4'" . DT  H  2 9   ? 132.352 30.429   104.214 1.00 366.34 ? 9   DT  v "C4'" 1 
ATOM 3911  O "O4'" . DT  H  2 9   ? 132.275 29.020   104.554 1.00 354.93 ? 9   DT  v "O4'" 1 
ATOM 3912  C "C3'" . DT  H  2 9   ? 130.924 30.972   104.337 1.00 361.24 ? 9   DT  v "C3'" 1 
ATOM 3913  O "O3'" . DT  H  2 9   ? 130.277 30.990   103.055 1.00 365.01 ? 9   DT  v "O3'" 1 
ATOM 3914  C "C2'" . DT  H  2 9   ? 130.237 29.944   105.216 1.00 350.10 ? 9   DT  v "C2'" 1 
ATOM 3915  C "C1'" . DT  H  2 9   ? 130.920 28.663   104.777 1.00 346.48 ? 9   DT  v "C1'" 1 
ATOM 3916  N N1    . DT  H  2 9   ? 130.896 27.575   105.771 1.00 345.39 ? 9   DT  v N1    1 
ATOM 3917  C C2    . DT  H  2 9   ? 130.698 26.289   105.321 1.00 344.12 ? 9   DT  v C2    1 
ATOM 3918  O O2    . DT  H  2 9   ? 130.535 26.013   104.142 1.00 337.99 ? 9   DT  v O2    1 
ATOM 3919  N N3    . DT  H  2 9   ? 130.697 25.332   106.307 1.00 348.77 ? 9   DT  v N3    1 
ATOM 3920  C C4    . DT  H  2 9   ? 130.865 25.530   107.666 1.00 351.50 ? 9   DT  v C4    1 
ATOM 3921  O O4    . DT  H  2 9   ? 130.834 24.570   108.434 1.00 354.25 ? 9   DT  v O4    1 
ATOM 3922  C C5    . DT  H  2 9   ? 131.062 26.906   108.068 1.00 351.76 ? 9   DT  v C5    1 
ATOM 3923  C C7    . DT  H  2 9   ? 131.242 27.222   109.519 1.00 351.30 ? 9   DT  v C7    1 
ATOM 3924  C C6    . DT  H  2 9   ? 131.075 27.844   107.112 1.00 349.17 ? 9   DT  v C6    1 
ATOM 3925  P P     . DT  H  2 10  ? 129.001 31.934   102.796 1.00 369.84 ? 10  DT  v P     1 
ATOM 3926  O OP1   . DT  H  2 10  ? 129.397 32.997   101.843 1.00 373.41 ? 10  DT  v OP1   1 
ATOM 3927  O OP2   . DT  H  2 10  ? 128.418 32.308   104.110 1.00 370.41 ? 10  DT  v OP2   1 
ATOM 3928  O "O5'" . DT  H  2 10  ? 127.962 30.975   102.061 1.00 367.56 ? 10  DT  v "O5'" 1 
ATOM 3929  C "C5'" . DT  H  2 10  ? 128.385 29.839   101.287 1.00 366.53 ? 10  DT  v "C5'" 1 
ATOM 3930  C "C4'" . DT  H  2 10  ? 127.317 28.767   101.299 1.00 351.27 ? 10  DT  v "C4'" 1 
ATOM 3931  O "O4'" . DT  H  2 10  ? 127.554 27.857   102.399 1.00 335.33 ? 10  DT  v "O4'" 1 
ATOM 3932  C "C3'" . DT  H  2 10  ? 125.877 29.261   101.478 1.00 347.96 ? 10  DT  v "C3'" 1 
ATOM 3933  O "O3'" . DT  H  2 10  ? 124.961 28.428   100.752 1.00 347.80 ? 10  DT  v "O3'" 1 
ATOM 3934  C "C2'" . DT  H  2 10  ? 125.600 28.988   102.941 1.00 337.03 ? 10  DT  v "C2'" 1 
ATOM 3935  C "C1'" . DT  H  2 10  ? 126.330 27.677   103.092 1.00 327.03 ? 10  DT  v "C1'" 1 
ATOM 3936  N N1    . DT  H  2 10  ? 126.645 27.308   104.468 1.00 316.67 ? 10  DT  v N1    1 
ATOM 3937  C C2    . DT  H  2 10  ? 126.618 25.973   104.796 1.00 311.90 ? 10  DT  v C2    1 
ATOM 3938  O O2    . DT  H  2 10  ? 126.340 25.096   103.994 1.00 308.78 ? 10  DT  v O2    1 
ATOM 3939  N N3    . DT  H  2 10  ? 126.933 25.699   106.103 1.00 312.07 ? 10  DT  v N3    1 
ATOM 3940  C C4    . DT  H  2 10  ? 127.259 26.608   107.092 1.00 313.52 ? 10  DT  v C4    1 
ATOM 3941  O O4    . DT  H  2 10  ? 127.521 26.211   108.225 1.00 318.53 ? 10  DT  v O4    1 
ATOM 3942  C C5    . DT  H  2 10  ? 127.258 27.994   106.679 1.00 313.71 ? 10  DT  v C5    1 
ATOM 3943  C C7    . DT  H  2 10  ? 127.595 29.053   107.681 1.00 312.76 ? 10  DT  v C7    1 
ATOM 3944  C C6    . DT  H  2 10  ? 126.953 28.270   105.404 1.00 314.94 ? 10  DT  v C6    1 
ATOM 3945  P P     . DT  H  2 11  ? 123.510 28.981   100.339 1.00 346.15 ? 11  DT  v P     1 
ATOM 3946  O OP1   . DT  H  2 11  ? 123.640 29.612   99.004  1.00 354.40 ? 11  DT  v OP1   1 
ATOM 3947  O OP2   . DT  H  2 11  ? 122.959 29.769   101.476 1.00 338.84 ? 11  DT  v OP2   1 
ATOM 3948  O "O5'" . DT  H  2 11  ? 122.622 27.664   100.200 1.00 345.57 ? 11  DT  v "O5'" 1 
ATOM 3949  C "C5'" . DT  H  2 11  ? 123.198 26.371   99.919  1.00 351.87 ? 11  DT  v "C5'" 1 
ATOM 3950  C "C4'" . DT  H  2 11  ? 122.368 25.266   100.536 1.00 355.43 ? 11  DT  v "C4'" 1 
ATOM 3951  O "O4'" . DT  H  2 11  ? 122.831 25.016   101.887 1.00 343.43 ? 11  DT  v "O4'" 1 
ATOM 3952  C "C3'" . DT  H  2 11  ? 120.865 25.548   100.655 1.00 364.53 ? 11  DT  v "C3'" 1 
ATOM 3953  O "O3'" . DT  H  2 11  ? 120.055 24.371   100.441 1.00 379.63 ? 11  DT  v "O3'" 1 
ATOM 3954  C "C2'" . DT  H  2 11  ? 120.730 26.048   102.082 1.00 351.06 ? 11  DT  v "C2'" 1 
ATOM 3955  C "C1'" . DT  H  2 11  ? 121.759 25.193   102.804 1.00 328.46 ? 11  DT  v "C1'" 1 
ATOM 3956  N N1    . DT  H  2 11  ? 122.316 25.751   104.051 1.00 299.55 ? 11  DT  v N1    1 
ATOM 3957  C C2    . DT  H  2 11  ? 122.606 24.864   105.061 1.00 284.78 ? 11  DT  v C2    1 
ATOM 3958  O O2    . DT  H  2 11  ? 122.413 23.662   104.969 1.00 282.01 ? 11  DT  v O2    1 
ATOM 3959  N N3    . DT  H  2 11  ? 123.130 25.438   106.194 1.00 273.28 ? 11  DT  v N3    1 
ATOM 3960  C C4    . DT  H  2 11  ? 123.398 26.777   106.406 1.00 267.33 ? 11  DT  v C4    1 
ATOM 3961  O O4    . DT  H  2 11  ? 123.870 27.144   107.479 1.00 260.87 ? 11  DT  v O4    1 
ATOM 3962  C C5    . DT  H  2 11  ? 123.073 27.652   105.300 1.00 270.39 ? 11  DT  v C5    1 
ATOM 3963  C C7    . DT  H  2 11  ? 123.318 29.121   105.440 1.00 266.12 ? 11  DT  v C7    1 
ATOM 3964  C C6    . DT  H  2 11  ? 122.558 27.101   104.193 1.00 282.91 ? 11  DT  v C6    1 
ATOM 3965  P P     . DT  H  2 12  ? 118.606 24.495   99.720  1.00 384.00 ? 12  DT  v P     1 
ATOM 3966  O OP1   . DT  H  2 12  ? 118.776 24.213   98.270  1.00 383.87 ? 12  DT  v OP1   1 
ATOM 3967  O OP2   . DT  H  2 12  ? 117.984 25.772   100.157 1.00 390.44 ? 12  DT  v OP2   1 
ATOM 3968  O "O5'" . DT  H  2 12  ? 117.731 23.321   100.354 1.00 366.87 ? 12  DT  v "O5'" 1 
ATOM 3969  C "C5'" . DT  H  2 12  ? 118.308 22.153   100.969 1.00 349.10 ? 12  DT  v "C5'" 1 
ATOM 3970  C "C4'" . DT  H  2 12  ? 117.602 21.852   102.272 1.00 338.95 ? 12  DT  v "C4'" 1 
ATOM 3971  O "O4'" . DT  H  2 12  ? 118.294 22.515   103.354 1.00 325.48 ? 12  DT  v "O4'" 1 
ATOM 3972  C "C3'" . DT  H  2 12  ? 116.144 22.316   102.368 1.00 337.99 ? 12  DT  v "C3'" 1 
ATOM 3973  O "O3'" . DT  H  2 12  ? 115.386 21.409   103.179 1.00 343.20 ? 12  DT  v "O3'" 1 
ATOM 3974  C "C2'" . DT  H  2 12  ? 116.244 23.604   103.161 1.00 328.75 ? 12  DT  v "C2'" 1 
ATOM 3975  C "C1'" . DT  H  2 12  ? 117.341 23.227   104.130 1.00 323.16 ? 12  DT  v "C1'" 1 
ATOM 3976  N N1    . DT  H  2 12  ? 118.032 24.349   104.778 1.00 320.50 ? 12  DT  v N1    1 
ATOM 3977  C C2    . DT  H  2 12  ? 118.634 24.102   105.990 1.00 322.66 ? 12  DT  v C2    1 
ATOM 3978  O O2    . DT  H  2 12  ? 118.611 23.010   106.536 1.00 325.60 ? 12  DT  v O2    1 
ATOM 3979  N N3    . DT  H  2 12  ? 119.272 25.186   106.541 1.00 323.99 ? 12  DT  v N3    1 
ATOM 3980  C C4    . DT  H  2 12  ? 119.366 26.460   106.012 1.00 318.30 ? 12  DT  v C4    1 
ATOM 3981  O O4    . DT  H  2 12  ? 119.982 27.331   106.621 1.00 319.20 ? 12  DT  v O4    1 
ATOM 3982  C C5    . DT  H  2 12  ? 118.710 26.647   104.738 1.00 314.75 ? 12  DT  v C5    1 
ATOM 3983  C C7    . DT  H  2 12  ? 118.758 27.994   104.086 1.00 308.13 ? 12  DT  v C7    1 
ATOM 3984  C C6    . DT  H  2 12  ? 118.081 25.596   104.193 1.00 316.71 ? 12  DT  v C6    1 
ATOM 3985  P P     . DT  H  2 13  ? 113.793 21.324   103.019 1.00 346.60 ? 13  DT  v P     1 
ATOM 3986  O OP1   . DT  H  2 13  ? 113.510 20.631   101.743 1.00 358.19 ? 13  DT  v OP1   1 
ATOM 3987  O OP2   . DT  H  2 13  ? 113.219 22.671   103.252 1.00 340.25 ? 13  DT  v OP2   1 
ATOM 3988  O "O5'" . DT  H  2 13  ? 113.340 20.383   104.225 1.00 336.42 ? 13  DT  v "O5'" 1 
ATOM 3989  C "C5'" . DT  H  2 13  ? 114.267 19.532   104.922 1.00 314.08 ? 13  DT  v "C5'" 1 
ATOM 3990  C "C4'" . DT  H  2 13  ? 114.071 19.680   106.413 1.00 292.09 ? 13  DT  v "C4'" 1 
ATOM 3991  O "O4'" . DT  H  2 13  ? 114.841 20.810   106.885 1.00 285.91 ? 13  DT  v "O4'" 1 
ATOM 3992  C "C3'" . DT  H  2 13  ? 112.629 19.956   106.840 1.00 283.77 ? 13  DT  v "C3'" 1 
ATOM 3993  O "O3'" . DT  H  2 13  ? 112.367 19.345   108.105 1.00 280.60 ? 13  DT  v "O3'" 1 
ATOM 3994  C "C2'" . DT  H  2 13  ? 112.603 21.464   107.003 1.00 280.27 ? 13  DT  v "C2'" 1 
ATOM 3995  C "C1'" . DT  H  2 13  ? 113.982 21.705   107.575 1.00 279.75 ? 13  DT  v "C1'" 1 
ATOM 3996  N N1    . DT  H  2 13  ? 114.499 23.068   107.391 1.00 277.44 ? 13  DT  v N1    1 
ATOM 3997  C C2    . DT  H  2 13  ? 115.310 23.591   108.373 1.00 278.21 ? 13  DT  v C2    1 
ATOM 3998  O O2    . DT  H  2 13  ? 115.636 22.970   109.372 1.00 278.61 ? 13  DT  v O2    1 
ATOM 3999  N N3    . DT  H  2 13  ? 115.731 24.877   108.140 1.00 280.01 ? 13  DT  v N3    1 
ATOM 4000  C C4    . DT  H  2 13  ? 115.434 25.669   107.047 1.00 277.47 ? 13  DT  v C4    1 
ATOM 4001  O O4    . DT  H  2 13  ? 115.892 26.805   106.972 1.00 285.04 ? 13  DT  v O4    1 
ATOM 4002  C C5    . DT  H  2 13  ? 114.573 25.059   106.061 1.00 272.51 ? 13  DT  v C5    1 
ATOM 4003  C C7    . DT  H  2 13  ? 114.190 25.844   104.847 1.00 267.43 ? 13  DT  v C7    1 
ATOM 4004  C C6    . DT  H  2 13  ? 114.148 23.809   106.283 1.00 273.25 ? 13  DT  v C6    1 
ATOM 4005  P P     . DT  H  2 14  ? 110.863 19.013   108.519 1.00 288.13 ? 14  DT  v P     1 
ATOM 4006  O OP1   . DT  H  2 14  ? 110.567 17.628   108.084 1.00 285.26 ? 14  DT  v OP1   1 
ATOM 4007  O OP2   . DT  H  2 14  ? 109.996 20.138   108.075 1.00 284.53 ? 14  DT  v OP2   1 
ATOM 4008  O "O5'" . DT  H  2 14  ? 110.881 19.049   110.111 1.00 311.16 ? 14  DT  v "O5'" 1 
ATOM 4009  C "C5'" . DT  H  2 14  ? 112.091 18.865   110.858 1.00 343.54 ? 14  DT  v "C5'" 1 
ATOM 4010  C "C4'" . DT  H  2 14  ? 112.124 19.815   112.034 1.00 362.93 ? 14  DT  v "C4'" 1 
ATOM 4011  O "O4'" . DT  H  2 14  ? 112.631 21.100   111.600 1.00 367.28 ? 14  DT  v "O4'" 1 
ATOM 4012  C "C3'" . DT  H  2 14  ? 110.773 20.097   112.701 1.00 362.03 ? 14  DT  v "C3'" 1 
ATOM 4013  O "O3'" . DT  H  2 14  ? 110.939 20.164   114.125 1.00 346.01 ? 14  DT  v "O3'" 1 
ATOM 4014  C "C2'" . DT  H  2 14  ? 110.378 21.448   112.129 1.00 362.98 ? 14  DT  v "C2'" 1 
ATOM 4015  C "C1'" . DT  H  2 14  ? 111.729 22.127   111.986 1.00 359.33 ? 14  DT  v "C1'" 1 
ATOM 4016  N N1    . DT  H  2 14  ? 111.815 23.207   110.980 1.00 344.18 ? 14  DT  v N1    1 
ATOM 4017  C C2    . DT  H  2 14  ? 112.645 24.275   111.251 1.00 335.11 ? 14  DT  v C2    1 
ATOM 4018  O O2    . DT  H  2 14  ? 113.298 24.370   112.280 1.00 333.12 ? 14  DT  v O2    1 
ATOM 4019  N N3    . DT  H  2 14  ? 112.672 25.239   110.273 1.00 326.91 ? 14  DT  v N3    1 
ATOM 4020  C C4    . DT  H  2 14  ? 111.982 25.236   109.074 1.00 323.68 ? 14  DT  v C4    1 
ATOM 4021  O O4    . DT  H  2 14  ? 112.116 26.170   108.288 1.00 321.58 ? 14  DT  v O4    1 
ATOM 4022  C C5    . DT  H  2 14  ? 111.133 24.083   108.855 1.00 324.22 ? 14  DT  v C5    1 
ATOM 4023  C C7    . DT  H  2 14  ? 110.344 23.993   107.587 1.00 318.98 ? 14  DT  v C7    1 
ATOM 4024  C C6    . DT  H  2 14  ? 111.092 23.141   109.807 1.00 332.96 ? 14  DT  v C6    1 
ATOM 4025  P P     . DT  H  2 15  ? 109.700 19.867   115.100 1.00 328.87 ? 15  DT  v P     1 
ATOM 4026  O OP1   . DT  H  2 15  ? 109.847 18.485   115.624 1.00 319.85 ? 15  DT  v OP1   1 
ATOM 4027  O OP2   . DT  H  2 15  ? 108.454 20.271   114.398 1.00 332.09 ? 15  DT  v OP2   1 
ATOM 4028  O "O5'" . DT  H  2 15  ? 109.922 20.881   116.309 1.00 329.22 ? 15  DT  v "O5'" 1 
ATOM 4029  C "C5'" . DT  H  2 15  ? 111.240 21.332   116.664 1.00 336.59 ? 15  DT  v "C5'" 1 
ATOM 4030  C "C4'" . DT  H  2 15  ? 111.225 22.803   117.012 1.00 344.38 ? 15  DT  v "C4'" 1 
ATOM 4031  O "O4'" . DT  H  2 15  ? 111.297 23.601   115.804 1.00 336.09 ? 15  DT  v "O4'" 1 
ATOM 4032  C "C3'" . DT  H  2 15  ? 109.990 23.291   117.780 1.00 355.30 ? 15  DT  v "C3'" 1 
ATOM 4033  O "O3'" . DT  H  2 15  ? 110.408 24.142   118.858 1.00 383.83 ? 15  DT  v "O3'" 1 
ATOM 4034  C "C2'" . DT  H  2 15  ? 109.229 24.099   116.745 1.00 341.96 ? 15  DT  v "C2'" 1 
ATOM 4035  C "C1'" . DT  H  2 15  ? 110.354 24.653   115.896 1.00 327.69 ? 15  DT  v "C1'" 1 
ATOM 4036  N N1    . DT  H  2 15  ? 109.977 25.046   114.525 1.00 311.42 ? 15  DT  v N1    1 
ATOM 4037  C C2    . DT  H  2 15  ? 110.543 26.189   114.004 1.00 307.47 ? 15  DT  v C2    1 
ATOM 4038  O O2    . DT  H  2 15  ? 111.334 26.884   114.624 1.00 304.01 ? 15  DT  v O2    1 
ATOM 4039  N N3    . DT  H  2 15  ? 110.144 26.492   112.724 1.00 305.24 ? 15  DT  v N3    1 
ATOM 4040  C C4    . DT  H  2 15  ? 109.265 25.776   111.930 1.00 297.84 ? 15  DT  v C4    1 
ATOM 4041  O O4    . DT  H  2 15  ? 109.008 26.169   110.793 1.00 300.70 ? 15  DT  v O4    1 
ATOM 4042  C C5    . DT  H  2 15  ? 108.707 24.590   112.542 1.00 292.23 ? 15  DT  v C5    1 
ATOM 4043  C C7    . DT  H  2 15  ? 107.741 23.755   111.763 1.00 280.21 ? 15  DT  v C7    1 
ATOM 4044  C C6    . DT  H  2 15  ? 109.090 24.286   113.790 1.00 299.14 ? 15  DT  v C6    1 
ATOM 4045  P P     . DT  H  2 16  ? 109.451 24.432   120.132 1.00 401.07 ? 16  DT  v P     1 
ATOM 4046  O OP1   . DT  H  2 16  ? 109.895 23.568   121.256 1.00 406.49 ? 16  DT  v OP1   1 
ATOM 4047  O OP2   . DT  H  2 16  ? 108.032 24.393   119.693 1.00 398.68 ? 16  DT  v OP2   1 
ATOM 4048  O "O5'" . DT  H  2 16  ? 109.828 25.929   120.522 1.00 400.55 ? 16  DT  v "O5'" 1 
ATOM 4049  C "C5'" . DT  H  2 16  ? 111.010 26.552   119.980 1.00 394.99 ? 16  DT  v "C5'" 1 
ATOM 4050  C "C4'" . DT  H  2 16  ? 110.692 27.944   119.489 1.00 383.13 ? 16  DT  v "C4'" 1 
ATOM 4051  O "O4'" . DT  H  2 16  ? 110.305 27.908   118.092 1.00 365.39 ? 16  DT  v "O4'" 1 
ATOM 4052  C "C3'" . DT  H  2 16  ? 109.540 28.638   120.223 1.00 390.24 ? 16  DT  v "C3'" 1 
ATOM 4053  O "O3'" . DT  H  2 16  ? 109.843 30.030   120.289 1.00 413.93 ? 16  DT  v "O3'" 1 
ATOM 4054  C "C2'" . DT  H  2 16  ? 108.382 28.482   119.259 1.00 376.55 ? 16  DT  v "C2'" 1 
ATOM 4055  C "C1'" . DT  H  2 16  ? 109.119 28.672   117.953 1.00 365.71 ? 16  DT  v "C1'" 1 
ATOM 4056  N N1    . DT  H  2 16  ? 108.409 28.218   116.743 1.00 362.34 ? 16  DT  v N1    1 
ATOM 4057  C C2    . DT  H  2 16  ? 108.575 28.956   115.593 1.00 363.81 ? 16  DT  v C2    1 
ATOM 4058  O O2    . DT  H  2 16  ? 109.305 29.933   115.528 1.00 362.78 ? 16  DT  v O2    1 
ATOM 4059  N N3    . DT  H  2 16  ? 107.863 28.497   114.511 1.00 367.14 ? 16  DT  v N3    1 
ATOM 4060  C C4    . DT  H  2 16  ? 107.009 27.409   114.473 1.00 362.27 ? 16  DT  v C4    1 
ATOM 4061  O O4    . DT  H  2 16  ? 106.442 27.111   113.426 1.00 363.98 ? 16  DT  v O4    1 
ATOM 4062  C C5    . DT  H  2 16  ? 106.865 26.695   115.721 1.00 358.64 ? 16  DT  v C5    1 
ATOM 4063  C C7    . DT  H  2 16  ? 105.962 25.503   115.774 1.00 350.61 ? 16  DT  v C7    1 
ATOM 4064  C C6    . DT  H  2 16  ? 107.555 27.135   116.781 1.00 360.85 ? 16  DT  v C6    1 
ATOM 4065  P P     . DT  H  2 17  ? 109.231 30.955   121.447 1.00 435.89 ? 17  DT  v P     1 
ATOM 4066  O OP1   . DT  H  2 17  ? 110.088 30.811   122.648 1.00 463.36 ? 17  DT  v OP1   1 
ATOM 4067  O OP2   . DT  H  2 17  ? 107.771 30.696   121.554 1.00 425.43 ? 17  DT  v OP2   1 
ATOM 4068  O "O5'" . DT  H  2 17  ? 109.484 32.424   120.888 1.00 428.33 ? 17  DT  v "O5'" 1 
ATOM 4069  C "C5'" . DT  H  2 17  ? 110.485 32.665   119.877 1.00 408.82 ? 17  DT  v "C5'" 1 
ATOM 4070  C "C4'" . DT  H  2 17  ? 109.931 33.583   118.814 1.00 392.21 ? 17  DT  v "C4'" 1 
ATOM 4071  O "O4'" . DT  H  2 17  ? 109.194 32.813   117.830 1.00 374.47 ? 17  DT  v "O4'" 1 
ATOM 4072  C "C3'" . DT  H  2 17  ? 108.948 34.628   119.340 1.00 393.70 ? 17  DT  v "C3'" 1 
ATOM 4073  O "O3'" . DT  H  2 17  ? 109.070 35.790   118.523 1.00 402.95 ? 17  DT  v "O3'" 1 
ATOM 4074  C "C2'" . DT  H  2 17  ? 107.599 33.988   119.077 1.00 380.51 ? 17  DT  v "C2'" 1 
ATOM 4075  C "C1'" . DT  H  2 17  ? 107.869 33.315   117.746 1.00 366.61 ? 17  DT  v "C1'" 1 
ATOM 4076  N N1    . DT  H  2 17  ? 106.970 32.200   117.390 1.00 349.81 ? 17  DT  v N1    1 
ATOM 4077  C C2    . DT  H  2 17  ? 106.591 32.103   116.073 1.00 344.53 ? 17  DT  v C2    1 
ATOM 4078  O O2    . DT  H  2 17  ? 106.977 32.877   115.211 1.00 345.12 ? 17  DT  v O2    1 
ATOM 4079  N N3    . DT  H  2 17  ? 105.738 31.063   115.798 1.00 339.67 ? 17  DT  v N3    1 
ATOM 4080  C C4    . DT  H  2 17  ? 105.238 30.134   116.692 1.00 335.28 ? 17  DT  v C4    1 
ATOM 4081  O O4    . DT  H  2 17  ? 104.477 29.255   116.298 1.00 335.80 ? 17  DT  v O4    1 
ATOM 4082  C C5    . DT  H  2 17  ? 105.667 30.305   118.062 1.00 334.63 ? 17  DT  v C5    1 
ATOM 4083  C C7    . DT  H  2 17  ? 105.173 29.349   119.102 1.00 329.52 ? 17  DT  v C7    1 
ATOM 4084  C C6    . DT  H  2 17  ? 106.498 31.318   118.338 1.00 340.24 ? 17  DT  v C6    1 
ATOM 4085  P P     . DT  H  2 18  ? 108.855 37.248   119.140 1.00 412.99 ? 18  DT  v P     1 
ATOM 4086  O OP1   . DT  H  2 18  ? 110.165 37.720   119.649 1.00 419.69 ? 18  DT  v OP1   1 
ATOM 4087  O OP2   . DT  H  2 18  ? 107.686 37.202   120.068 1.00 412.21 ? 18  DT  v OP2   1 
ATOM 4088  O "O5'" . DT  H  2 18  ? 108.509 38.117   117.848 1.00 404.26 ? 18  DT  v "O5'" 1 
ATOM 4089  C "C5'" . DT  H  2 18  ? 108.563 37.538   116.522 1.00 383.91 ? 18  DT  v "C5'" 1 
ATOM 4090  C "C4'" . DT  H  2 18  ? 107.228 37.706   115.833 1.00 370.87 ? 18  DT  v "C4'" 1 
ATOM 4091  O "O4'" . DT  H  2 18  ? 106.478 36.464   115.864 1.00 358.08 ? 18  DT  v "O4'" 1 
ATOM 4092  C "C3'" . DT  H  2 18  ? 106.333 38.762   116.485 1.00 369.63 ? 18  DT  v "C3'" 1 
ATOM 4093  O "O3'" . DT  H  2 18  ? 105.799 39.624   115.485 1.00 369.60 ? 18  DT  v "O3'" 1 
ATOM 4094  C "C2'" . DT  H  2 18  ? 105.240 37.951   117.157 1.00 363.90 ? 18  DT  v "C2'" 1 
ATOM 4095  C "C1'" . DT  H  2 18  ? 105.141 36.747   116.246 1.00 353.04 ? 18  DT  v "C1'" 1 
ATOM 4096  N N1    . DT  H  2 18  ? 104.561 35.531   116.862 1.00 341.66 ? 18  DT  v N1    1 
ATOM 4097  C C2    . DT  H  2 18  ? 103.875 34.666   116.039 1.00 335.09 ? 18  DT  v C2    1 
ATOM 4098  O O2    . DT  H  2 18  ? 103.742 34.851   114.840 1.00 333.74 ? 18  DT  v O2    1 
ATOM 4099  N N3    . DT  H  2 18  ? 103.353 33.565   116.675 1.00 330.05 ? 18  DT  v N3    1 
ATOM 4100  C C4    . DT  H  2 18  ? 103.439 33.258   118.022 1.00 329.92 ? 18  DT  v C4    1 
ATOM 4101  O O4    . DT  H  2 18  ? 102.918 32.231   118.449 1.00 326.28 ? 18  DT  v O4    1 
ATOM 4102  C C5    . DT  H  2 18  ? 104.166 34.215   118.827 1.00 334.62 ? 18  DT  v C5    1 
ATOM 4103  C C7    . DT  H  2 18  ? 104.311 33.968   120.296 1.00 334.79 ? 18  DT  v C7    1 
ATOM 4104  C C6    . DT  H  2 18  ? 104.674 35.294   118.216 1.00 339.15 ? 18  DT  v C6    1 
ATOM 4105  P P     . DT  H  2 19  ? 105.165 41.031   115.895 1.00 376.93 ? 19  DT  v P     1 
ATOM 4106  O OP1   . DT  H  2 19  ? 106.200 42.074   115.695 1.00 379.34 ? 19  DT  v OP1   1 
ATOM 4107  O OP2   . DT  H  2 19  ? 104.526 40.890   117.230 1.00 376.45 ? 19  DT  v OP2   1 
ATOM 4108  O "O5'" . DT  H  2 19  ? 104.014 41.221   114.811 1.00 386.87 ? 19  DT  v "O5'" 1 
ATOM 4109  C "C5'" . DT  H  2 19  ? 104.041 40.484   113.571 1.00 395.36 ? 19  DT  v "C5'" 1 
ATOM 4110  C "C4'" . DT  H  2 19  ? 102.676 39.919   113.246 1.00 402.33 ? 19  DT  v "C4'" 1 
ATOM 4111  O "O4'" . DT  H  2 19  ? 102.460 38.668   113.946 1.00 399.25 ? 19  DT  v "O4'" 1 
ATOM 4112  C "C3'" . DT  H  2 19  ? 101.482 40.816   113.594 1.00 409.17 ? 19  DT  v "C3'" 1 
ATOM 4113  O "O3'" . DT  H  2 19  ? 100.597 40.845   112.466 1.00 409.65 ? 19  DT  v "O3'" 1 
ATOM 4114  C "C2'" . DT  H  2 19  ? 100.825 40.098   114.761 1.00 403.77 ? 19  DT  v "C2'" 1 
ATOM 4115  C "C1'" . DT  H  2 19  ? 101.127 38.654   114.421 1.00 397.35 ? 19  DT  v "C1'" 1 
ATOM 4116  N N1    . DT  H  2 19  ? 101.046 37.701   115.546 1.00 393.38 ? 19  DT  v N1    1 
ATOM 4117  C C2    . DT  H  2 19  ? 100.496 36.461   115.302 1.00 389.29 ? 19  DT  v C2    1 
ATOM 4118  O O2    . DT  H  2 19  ? 100.090 36.115   114.204 1.00 386.05 ? 19  DT  v O2    1 
ATOM 4119  N N3    . DT  H  2 19  ? 100.441 35.635   116.399 1.00 388.25 ? 19  DT  v N3    1 
ATOM 4120  C C4    . DT  H  2 19  ? 100.862 35.922   117.684 1.00 390.31 ? 19  DT  v C4    1 
ATOM 4121  O O4    . DT  H  2 19  ? 100.749 35.076   118.568 1.00 389.25 ? 19  DT  v O4    1 
ATOM 4122  C C5    . DT  H  2 19  ? 101.422 37.244   117.869 1.00 393.31 ? 19  DT  v C5    1 
ATOM 4123  C C7    . DT  H  2 19  ? 101.907 37.646   119.227 1.00 393.64 ? 19  DT  v C7    1 
ATOM 4124  C C6    . DT  H  2 19  ? 101.482 38.056   116.805 1.00 394.46 ? 19  DT  v C6    1 
ATOM 4125  P P     . DT  H  2 20  ? 99.561  42.065   112.245 1.00 414.02 ? 20  DT  v P     1 
ATOM 4126  O OP1   . DT  H  2 20  ? 100.175 43.036   111.306 1.00 422.82 ? 20  DT  v OP1   1 
ATOM 4127  O OP2   . DT  H  2 20  ? 99.073  42.520   113.572 1.00 418.55 ? 20  DT  v OP2   1 
ATOM 4128  O "O5'" . DT  H  2 20  ? 98.334  41.379   111.496 1.00 407.29 ? 20  DT  v "O5'" 1 
ATOM 4129  C "C5'" . DT  H  2 20  ? 98.479  40.120   110.808 1.00 408.07 ? 20  DT  v "C5'" 1 
ATOM 4130  C "C4'" . DT  H  2 20  ? 97.280  39.235   111.058 1.00 411.38 ? 20  DT  v "C4'" 1 
ATOM 4131  O "O4'" . DT  H  2 20  ? 97.527  38.391   112.211 1.00 395.80 ? 20  DT  v "O4'" 1 
ATOM 4132  C "C3'" . DT  H  2 20  ? 95.970  39.981   111.342 1.00 418.40 ? 20  DT  v "C3'" 1 
ATOM 4133  O "O3'" . DT  H  2 20  ? 94.866  39.402   110.622 1.00 430.97 ? 20  DT  v "O3'" 1 
ATOM 4134  C "C2'" . DT  H  2 20  ? 95.789  39.809   112.839 1.00 406.60 ? 20  DT  v "C2'" 1 
ATOM 4135  C "C1'" . DT  H  2 20  ? 96.397  38.438   113.062 1.00 390.55 ? 20  DT  v "C1'" 1 
ATOM 4136  N N1    . DT  H  2 20  ? 96.844  38.181   114.446 1.00 375.51 ? 20  DT  v N1    1 
ATOM 4137  C C2    . DT  H  2 20  ? 96.661  36.919   114.968 1.00 369.14 ? 20  DT  v C2    1 
ATOM 4138  O O2    . DT  H  2 20  ? 96.180  35.996   114.330 1.00 367.36 ? 20  DT  v O2    1 
ATOM 4139  N N3    . DT  H  2 20  ? 97.071  36.775   116.271 1.00 365.10 ? 20  DT  v N3    1 
ATOM 4140  C C4    . DT  H  2 20  ? 97.612  37.749   117.090 1.00 361.25 ? 20  DT  v C4    1 
ATOM 4141  O O4    . DT  H  2 20  ? 97.932  37.471   118.242 1.00 359.77 ? 20  DT  v O4    1 
ATOM 4142  C C5    . DT  H  2 20  ? 97.762  39.053   116.480 1.00 361.94 ? 20  DT  v C5    1 
ATOM 4143  C C7    . DT  H  2 20  ? 98.345  40.170   117.288 1.00 358.49 ? 20  DT  v C7    1 
ATOM 4144  C C6    . DT  H  2 20  ? 97.367  39.203   115.209 1.00 367.91 ? 20  DT  v C6    1 
ATOM 4145  P P     . DT  H  2 21  ? 93.502  40.242   110.359 1.00 433.81 ? 21  DT  v P     1 
ATOM 4146  O OP1   . DT  H  2 21  ? 93.470  40.640   108.925 1.00 435.53 ? 21  DT  v OP1   1 
ATOM 4147  O OP2   . DT  H  2 21  ? 93.379  41.284   111.414 1.00 436.22 ? 21  DT  v OP2   1 
ATOM 4148  O "O5'" . DT  H  2 21  ? 92.341  39.171   110.592 1.00 415.91 ? 21  DT  v "O5'" 1 
ATOM 4149  C "C5'" . DT  H  2 21  ? 92.521  37.770   110.277 1.00 394.68 ? 21  DT  v "C5'" 1 
ATOM 4150  C "C4'" . DT  H  2 21  ? 91.717  36.877   111.200 1.00 375.13 ? 21  DT  v "C4'" 1 
ATOM 4151  O "O4'" . DT  H  2 21  ? 92.434  36.647   112.439 1.00 359.42 ? 21  DT  v "O4'" 1 
ATOM 4152  C "C3'" . DT  H  2 21  ? 90.334  37.399   111.602 1.00 372.54 ? 21  DT  v "C3'" 1 
ATOM 4153  O "O3'" . DT  H  2 21  ? 89.369  36.338   111.673 1.00 381.04 ? 21  DT  v "O3'" 1 
ATOM 4154  C "C2'" . DT  H  2 21  ? 90.558  37.923   113.007 1.00 359.63 ? 21  DT  v "C2'" 1 
ATOM 4155  C "C1'" . DT  H  2 21  ? 91.578  36.929   113.534 1.00 345.66 ? 21  DT  v "C1'" 1 
ATOM 4156  N N1    . DT  H  2 21  ? 92.402  37.442   114.638 1.00 331.31 ? 21  DT  v N1    1 
ATOM 4157  C C2    . DT  H  2 21  ? 92.737  36.582   115.658 1.00 321.10 ? 21  DT  v C2    1 
ATOM 4158  O O2    . DT  H  2 21  ? 92.408  35.408   115.676 1.00 308.61 ? 21  DT  v O2    1 
ATOM 4159  N N3    . DT  H  2 21  ? 93.488  37.149   116.659 1.00 322.82 ? 21  DT  v N3    1 
ATOM 4160  C C4    . DT  H  2 21  ? 93.912  38.463   116.744 1.00 328.17 ? 21  DT  v C4    1 
ATOM 4161  O O4    . DT  H  2 21  ? 94.576  38.829   117.709 1.00 332.98 ? 21  DT  v O4    1 
ATOM 4162  C C5    . DT  H  2 21  ? 93.512  39.312   115.642 1.00 331.15 ? 21  DT  v C5    1 
ATOM 4163  C C7    . DT  H  2 21  ? 93.925  40.750   115.645 1.00 334.53 ? 21  DT  v C7    1 
ATOM 4164  C C6    . DT  H  2 21  ? 92.786  38.765   114.659 1.00 332.06 ? 21  DT  v C6    1 
ATOM 4165  P P     . DT  H  2 22  ? 87.806  36.651   111.464 1.00 388.88 ? 22  DT  v P     1 
ATOM 4166  O OP1   . DT  H  2 22  ? 87.432  36.204   110.096 1.00 392.99 ? 22  DT  v OP1   1 
ATOM 4167  O OP2   . DT  H  2 22  ? 87.560  38.056   111.870 1.00 389.91 ? 22  DT  v OP2   1 
ATOM 4168  O "O5'" . DT  H  2 22  ? 87.077  35.714   112.530 1.00 393.76 ? 22  DT  v "O5'" 1 
ATOM 4169  C "C5'" . DT  H  2 22  ? 87.621  34.437   112.909 1.00 404.73 ? 22  DT  v "C5'" 1 
ATOM 4170  C "C4'" . DT  H  2 22  ? 87.267  34.116   114.343 1.00 408.19 ? 22  DT  v "C4'" 1 
ATOM 4171  O "O4'" . DT  H  2 22  ? 88.279  34.667   115.219 1.00 409.61 ? 22  DT  v "O4'" 1 
ATOM 4172  C "C3'" . DT  H  2 22  ? 85.926  34.676   114.831 1.00 410.57 ? 22  DT  v "C3'" 1 
ATOM 4173  O "O3'" . DT  H  2 22  ? 85.230  33.710   115.631 1.00 401.12 ? 22  DT  v "O3'" 1 
ATOM 4174  C "C2'" . DT  H  2 22  ? 86.328  35.861   115.689 1.00 415.21 ? 22  DT  v "C2'" 1 
ATOM 4175  C "C1'" . DT  H  2 22  ? 87.650  35.387   116.263 1.00 413.94 ? 22  DT  v "C1'" 1 
ATOM 4176  N N1    . DT  H  2 22  ? 88.559  36.462   116.692 1.00 416.43 ? 22  DT  v N1    1 
ATOM 4177  C C2    . DT  H  2 22  ? 89.370  36.229   117.780 1.00 416.97 ? 22  DT  v C2    1 
ATOM 4178  O O2    . DT  H  2 22  ? 89.386  35.169   118.384 1.00 418.98 ? 22  DT  v O2    1 
ATOM 4179  N N3    . DT  H  2 22  ? 90.172  37.285   118.133 1.00 415.27 ? 22  DT  v N3    1 
ATOM 4180  C C4    . DT  H  2 22  ? 90.236  38.525   117.526 1.00 409.97 ? 22  DT  v C4    1 
ATOM 4181  O O4    . DT  H  2 22  ? 91.005  39.379   117.959 1.00 407.83 ? 22  DT  v O4    1 
ATOM 4182  C C5    . DT  H  2 22  ? 89.352  38.704   116.394 1.00 408.77 ? 22  DT  v C5    1 
ATOM 4183  C C7    . DT  H  2 22  ? 89.351  40.014   115.671 1.00 403.50 ? 22  DT  v C7    1 
ATOM 4184  C C6    . DT  H  2 22  ? 88.566  37.679   116.043 1.00 412.86 ? 22  DT  v C6    1 
ATOM 4185  P P     . DT  H  2 23  ? 83.636  33.819   115.841 1.00 399.35 ? 23  DT  v P     1 
ATOM 4186  O OP1   . DT  H  2 23  ? 82.973  32.943   114.845 1.00 408.00 ? 23  DT  v OP1   1 
ATOM 4187  O OP2   . DT  H  2 23  ? 83.269  35.256   115.941 1.00 399.02 ? 23  DT  v OP2   1 
ATOM 4188  O "O5'" . DT  H  2 23  ? 83.385  33.140   117.257 1.00 396.86 ? 23  DT  v "O5'" 1 
ATOM 4189  C "C5'" . DT  H  2 23  ? 84.341  32.239   117.829 1.00 398.61 ? 23  DT  v "C5'" 1 
ATOM 4190  C "C4'" . DT  H  2 23  ? 84.520  32.564   119.293 1.00 404.02 ? 23  DT  v "C4'" 1 
ATOM 4191  O "O4'" . DT  H  2 23  ? 85.546  33.573   119.457 1.00 406.44 ? 23  DT  v "O4'" 1 
ATOM 4192  C "C3'" . DT  H  2 23  ? 83.266  33.115   119.977 1.00 408.01 ? 23  DT  v "C3'" 1 
ATOM 4193  O "O3'" . DT  H  2 23  ? 83.063  32.390   121.190 1.00 412.27 ? 23  DT  v "O3'" 1 
ATOM 4194  C "C2'" . DT  H  2 23  ? 83.622  34.558   120.288 1.00 408.29 ? 23  DT  v "C2'" 1 
ATOM 4195  C "C1'" . DT  H  2 23  ? 85.125  34.476   120.458 1.00 404.69 ? 23  DT  v "C1'" 1 
ATOM 4196  N N1    . DT  H  2 23  ? 85.832  35.747   120.250 1.00 397.06 ? 23  DT  v N1    1 
ATOM 4197  C C2    . DT  H  2 23  ? 86.917  36.049   121.046 1.00 391.36 ? 23  DT  v C2    1 
ATOM 4198  O O2    . DT  H  2 23  ? 87.336  35.305   121.918 1.00 387.46 ? 23  DT  v O2    1 
ATOM 4199  N N3    . DT  H  2 23  ? 87.504  37.260   120.774 1.00 385.41 ? 23  DT  v N3    1 
ATOM 4200  C C4    . DT  H  2 23  ? 87.121  38.178   119.815 1.00 380.86 ? 23  DT  v C4    1 
ATOM 4201  O O4    . DT  H  2 23  ? 87.748  39.226   119.687 1.00 374.94 ? 23  DT  v O4    1 
ATOM 4202  C C5    . DT  H  2 23  ? 85.973  37.797   119.021 1.00 381.56 ? 23  DT  v C5    1 
ATOM 4203  C C7    . DT  H  2 23  ? 85.483  38.730   117.958 1.00 376.86 ? 23  DT  v C7    1 
ATOM 4204  C C6    . DT  H  2 23  ? 85.396  36.617   119.274 1.00 388.75 ? 23  DT  v C6    1 
ATOM 4205  P P     . DT  H  2 24  ? 81.613  32.319   121.848 1.00 413.56 ? 24  DT  v P     1 
ATOM 4206  O OP1   . DT  H  2 24  ? 80.996  31.034   121.445 1.00 412.16 ? 24  DT  v OP1   1 
ATOM 4207  O OP2   . DT  H  2 24  ? 80.911  33.595   121.558 1.00 412.41 ? 24  DT  v OP2   1 
ATOM 4208  O "O5'" . DT  H  2 24  ? 81.927  32.236   123.408 1.00 420.78 ? 24  DT  v "O5'" 1 
ATOM 4209  C "C5'" . DT  H  2 24  ? 83.193  31.741   123.889 1.00 429.57 ? 24  DT  v "C5'" 1 
ATOM 4210  C "C4'" . DT  H  2 24  ? 83.710  32.610   125.012 1.00 434.97 ? 24  DT  v "C4'" 1 
ATOM 4211  O "O4'" . DT  H  2 24  ? 84.435  33.755   124.492 1.00 431.07 ? 24  DT  v "O4'" 1 
ATOM 4212  C "C3'" . DT  H  2 24  ? 82.633  33.177   125.938 1.00 438.78 ? 24  DT  v "C3'" 1 
ATOM 4213  O "O3'" . DT  H  2 24  ? 83.120  33.085   127.275 1.00 442.09 ? 24  DT  v "O3'" 1 
ATOM 4214  C "C2'" . DT  H  2 24  ? 82.574  34.643   125.552 1.00 436.30 ? 24  DT  v "C2'" 1 
ATOM 4215  C "C1'" . DT  H  2 24  ? 84.024  34.908   125.207 1.00 422.55 ? 24  DT  v "C1'" 1 
ATOM 4216  N N1    . DT  H  2 24  ? 84.244  36.096   124.354 1.00 403.80 ? 24  DT  v N1    1 
ATOM 4217  C C2    . DT  H  2 24  ? 85.334  36.905   124.601 1.00 390.93 ? 24  DT  v C2    1 
ATOM 4218  O O2    . DT  H  2 24  ? 86.165  36.664   125.461 1.00 382.11 ? 24  DT  v O2    1 
ATOM 4219  N N3    . DT  H  2 24  ? 85.429  38.001   123.779 1.00 384.51 ? 24  DT  v N3    1 
ATOM 4220  C C4    . DT  H  2 24  ? 84.553  38.373   122.776 1.00 378.69 ? 24  DT  v C4    1 
ATOM 4221  O O4    . DT  H  2 24  ? 84.774  39.385   122.116 1.00 366.72 ? 24  DT  v O4    1 
ATOM 4222  C C5    . DT  H  2 24  ? 83.424  37.490   122.585 1.00 382.83 ? 24  DT  v C5    1 
ATOM 4223  C C7    . DT  H  2 24  ? 82.425  37.807   121.516 1.00 376.80 ? 24  DT  v C7    1 
ATOM 4224  C C6    . DT  H  2 24  ? 83.322  36.418   123.381 1.00 395.46 ? 24  DT  v C6    1 
ATOM 4225  P P     . DT  H  2 25  ? 82.106  33.115   128.507 1.00 442.54 ? 25  DT  v P     1 
ATOM 4226  O OP1   . DT  H  2 25  ? 81.995  31.731   129.029 1.00 445.98 ? 25  DT  v OP1   1 
ATOM 4227  O OP2   . DT  H  2 25  ? 80.871  33.830   128.080 1.00 436.75 ? 25  DT  v OP2   1 
ATOM 4228  O "O5'" . DT  H  2 25  ? 82.877  34.006   129.587 1.00 441.63 ? 25  DT  v "O5'" 1 
ATOM 4229  C "C5'" . DT  H  2 25  ? 84.328  34.014   129.675 1.00 426.47 ? 25  DT  v "C5'" 1 
ATOM 4230  C "C4'" . DT  H  2 25  ? 84.860  35.332   130.197 1.00 409.74 ? 25  DT  v "C4'" 1 
ATOM 4231  O "O4'" . DT  H  2 25  ? 84.941  36.310   129.127 1.00 395.80 ? 25  DT  v "O4'" 1 
ATOM 4232  C "C3'" . DT  H  2 25  ? 84.052  35.998   131.315 1.00 407.84 ? 25  DT  v "C3'" 1 
ATOM 4233  O "O3'" . DT  H  2 25  ? 84.916  36.619   132.275 1.00 410.34 ? 25  DT  v "O3'" 1 
ATOM 4234  C "C2'" . DT  H  2 25  ? 83.284  37.085   130.587 1.00 397.85 ? 25  DT  v "C2'" 1 
ATOM 4235  C "C1'" . DT  H  2 25  ? 84.282  37.506   129.521 1.00 387.27 ? 25  DT  v "C1'" 1 
ATOM 4236  N N1    . DT  H  2 25  ? 83.712  38.130   128.307 1.00 373.60 ? 25  DT  v N1    1 
ATOM 4237  C C2    . DT  H  2 25  ? 84.355  39.226   127.774 1.00 369.20 ? 25  DT  v C2    1 
ATOM 4238  O O2    . DT  H  2 25  ? 85.354  39.721   128.270 1.00 364.85 ? 25  DT  v O2    1 
ATOM 4239  N N3    . DT  H  2 25  ? 83.774  39.734   126.639 1.00 369.07 ? 25  DT  v N3    1 
ATOM 4240  C C4    . DT  H  2 25  ? 82.645  39.264   125.996 1.00 368.60 ? 25  DT  v C4    1 
ATOM 4241  O O4    . DT  H  2 25  ? 82.241  39.826   124.982 1.00 371.31 ? 25  DT  v O4    1 
ATOM 4242  C C5    . DT  H  2 25  ? 82.022  38.110   126.608 1.00 366.28 ? 25  DT  v C5    1 
ATOM 4243  C C7    . DT  H  2 25  ? 80.789  37.534   125.987 1.00 362.25 ? 25  DT  v C7    1 
ATOM 4244  C C6    . DT  H  2 25  ? 82.583  37.606   127.714 1.00 367.93 ? 25  DT  v C6    1 
ATOM 4245  P P     . DT  H  2 26  ? 84.578  36.523   133.834 1.00 414.86 ? 26  DT  v P     1 
ATOM 4246  O OP1   . DT  H  2 26  ? 85.683  35.788   134.492 1.00 410.92 ? 26  DT  v OP1   1 
ATOM 4247  O OP2   . DT  H  2 26  ? 83.184  36.037   133.970 1.00 418.29 ? 26  DT  v OP2   1 
ATOM 4248  O "O5'" . DT  H  2 26  ? 84.594  38.041   134.319 1.00 422.27 ? 26  DT  v "O5'" 1 
ATOM 4249  C "C5'" . DT  H  2 26  ? 85.744  38.879   134.118 1.00 420.88 ? 26  DT  v "C5'" 1 
ATOM 4250  C "C4'" . DT  H  2 26  ? 85.329  40.331   134.047 1.00 423.90 ? 26  DT  v "C4'" 1 
ATOM 4251  O "O4'" . DT  H  2 26  ? 84.851  40.643   132.718 1.00 417.63 ? 26  DT  v "O4'" 1 
ATOM 4252  C "C3'" . DT  H  2 26  ? 84.215  40.740   135.017 1.00 429.58 ? 26  DT  v "C3'" 1 
ATOM 4253  O "O3'" . DT  H  2 26  ? 84.631  41.851   135.817 1.00 438.89 ? 26  DT  v "O3'" 1 
ATOM 4254  C "C2'" . DT  H  2 26  ? 83.064  41.165   134.119 1.00 426.14 ? 26  DT  v "C2'" 1 
ATOM 4255  C "C1'" . DT  H  2 26  ? 83.751  41.527   132.815 1.00 415.77 ? 26  DT  v "C1'" 1 
ATOM 4256  N N1    . DT  H  2 26  ? 82.909  41.332   131.617 1.00 403.68 ? 26  DT  v N1    1 
ATOM 4257  C C2    . DT  H  2 26  ? 83.137  42.113   130.504 1.00 395.43 ? 26  DT  v C2    1 
ATOM 4258  O O2    . DT  H  2 26  ? 84.002  42.972   130.456 1.00 381.27 ? 26  DT  v O2    1 
ATOM 4259  N N3    . DT  H  2 26  ? 82.304  41.851   129.444 1.00 397.19 ? 26  DT  v N3    1 
ATOM 4260  C C4    . DT  H  2 26  ? 81.289  40.913   129.389 1.00 401.59 ? 26  DT  v C4    1 
ATOM 4261  O O4    . DT  H  2 26  ? 80.617  40.797   128.369 1.00 409.59 ? 26  DT  v O4    1 
ATOM 4262  C C5    . DT  H  2 26  ? 81.108  40.130   130.590 1.00 401.70 ? 26  DT  v C5    1 
ATOM 4263  C C7    . DT  H  2 26  ? 80.036  39.086   130.621 1.00 397.50 ? 26  DT  v C7    1 
ATOM 4264  C C6    . DT  H  2 26  ? 81.917  40.375   131.629 1.00 404.11 ? 26  DT  v C6    1 
ATOM 4265  N N     . SER I  3 1   ? 43.056  -34.038  -31.455 1.00 368.66 ? 14  SER C N     1 
ATOM 4266  C CA    . SER I  3 1   ? 41.716  -33.388  -31.624 1.00 373.31 ? 14  SER C CA    1 
ATOM 4267  C C     . SER I  3 1   ? 41.028  -33.030  -30.272 1.00 375.90 ? 14  SER C C     1 
ATOM 4268  O O     . SER I  3 1   ? 41.352  -33.591  -29.194 1.00 378.54 ? 14  SER C O     1 
ATOM 4269  C CB    . SER I  3 1   ? 40.821  -34.248  -32.550 1.00 370.40 ? 14  SER C CB    1 
ATOM 4270  O OG    . SER I  3 1   ? 39.504  -33.729  -32.691 1.00 371.83 ? 14  SER C OG    1 
ATOM 4271  N N     . TYR I  3 2   ? 40.053  -32.108  -30.350 1.00 378.04 ? 15  TYR C N     1 
ATOM 4272  C CA    . TYR I  3 2   ? 39.450  -31.459  -29.158 1.00 375.19 ? 15  TYR C CA    1 
ATOM 4273  C C     . TYR I  3 2   ? 38.714  -32.298  -28.063 1.00 381.37 ? 15  TYR C C     1 
ATOM 4274  O O     . TYR I  3 2   ? 39.003  -32.096  -26.880 1.00 380.65 ? 15  TYR C O     1 
ATOM 4275  C CB    . TYR I  3 2   ? 38.663  -30.188  -29.546 1.00 366.38 ? 15  TYR C CB    1 
ATOM 4276  C CG    . TYR I  3 2   ? 38.802  -29.129  -28.489 1.00 356.80 ? 15  TYR C CG    1 
ATOM 4277  C CD1   . TYR I  3 2   ? 39.922  -28.310  -28.447 1.00 356.10 ? 15  TYR C CD1   1 
ATOM 4278  C CD2   . TYR I  3 2   ? 37.844  -28.987  -27.491 1.00 351.72 ? 15  TYR C CD2   1 
ATOM 4279  C CE1   . TYR I  3 2   ? 40.062  -27.336  -27.466 1.00 355.96 ? 15  TYR C CE1   1 
ATOM 4280  C CE2   . TYR I  3 2   ? 37.972  -28.034  -26.500 1.00 351.35 ? 15  TYR C CE2   1 
ATOM 4281  C CZ    . TYR I  3 2   ? 39.079  -27.207  -26.495 1.00 355.04 ? 15  TYR C CZ    1 
ATOM 4282  O OH    . TYR I  3 2   ? 39.206  -26.245  -25.523 1.00 359.88 ? 15  TYR C OH    1 
ATOM 4283  N N     . GLN I  3 3   ? 37.802  -33.221  -28.414 1.00 390.16 ? 16  GLN C N     1 
ATOM 4284  C CA    . GLN I  3 3   ? 37.155  -34.104  -27.403 1.00 394.98 ? 16  GLN C CA    1 
ATOM 4285  C C     . GLN I  3 3   ? 38.009  -35.235  -26.793 1.00 406.51 ? 16  GLN C C     1 
ATOM 4286  O O     . GLN I  3 3   ? 37.758  -35.648  -25.650 1.00 414.66 ? 16  GLN C O     1 
ATOM 4287  C CB    . GLN I  3 3   ? 35.821  -34.649  -27.897 1.00 381.07 ? 16  GLN C CB    1 
ATOM 4288  C CG    . GLN I  3 3   ? 34.647  -33.751  -27.548 1.00 364.66 ? 16  GLN C CG    1 
ATOM 4289  C CD    . GLN I  3 3   ? 33.326  -34.497  -27.604 1.00 352.93 ? 16  GLN C CD    1 
ATOM 4290  O OE1   . GLN I  3 3   ? 33.257  -35.636  -28.085 1.00 346.14 ? 16  GLN C OE1   1 
ATOM 4291  N NE2   . GLN I  3 3   ? 32.260  -33.858  -27.115 1.00 346.96 ? 16  GLN C NE2   1 
ATOM 4292  N N     . GLN I  3 4   ? 39.005  -35.710  -27.548 1.00 413.94 ? 17  GLN C N     1 
ATOM 4293  C CA    . GLN I  3 4   ? 40.024  -36.667  -27.063 1.00 414.67 ? 17  GLN C CA    1 
ATOM 4294  C C     . GLN I  3 4   ? 40.817  -36.120  -25.853 1.00 421.83 ? 17  GLN C C     1 
ATOM 4295  O O     . GLN I  3 4   ? 41.040  -36.837  -24.865 1.00 421.44 ? 17  GLN C O     1 
ATOM 4296  C CB    . GLN I  3 4   ? 40.972  -37.049  -28.209 1.00 409.83 ? 17  GLN C CB    1 
ATOM 4297  C CG    . GLN I  3 4   ? 40.314  -37.844  -29.341 1.00 406.09 ? 17  GLN C CG    1 
ATOM 4298  C CD    . GLN I  3 4   ? 41.079  -37.774  -30.657 1.00 405.18 ? 17  GLN C CD    1 
ATOM 4299  O OE1   . GLN I  3 4   ? 42.001  -36.981  -30.806 1.00 401.25 ? 17  GLN C OE1   1 
ATOM 4300  N NE2   . GLN I  3 4   ? 40.690  -38.605  -31.612 1.00 406.49 ? 17  GLN C NE2   1 
ATOM 4301  N N     . ARG I  3 5   ? 41.221  -34.848  -25.939 1.00 428.92 ? 18  ARG C N     1 
ATOM 4302  C CA    . ARG I  3 5   ? 41.845  -34.087  -24.831 1.00 426.28 ? 18  ARG C CA    1 
ATOM 4303  C C     . ARG I  3 5   ? 40.930  -33.836  -23.578 1.00 430.62 ? 18  ARG C C     1 
ATOM 4304  O O     . ARG I  3 5   ? 41.422  -33.856  -22.445 1.00 433.44 ? 18  ARG C O     1 
ATOM 4305  C CB    . ARG I  3 5   ? 42.417  -32.768  -25.385 1.00 413.56 ? 18  ARG C CB    1 
ATOM 4306  C CG    . ARG I  3 5   ? 43.299  -31.983  -24.428 1.00 397.33 ? 18  ARG C CG    1 
ATOM 4307  C CD    . ARG I  3 5   ? 43.041  -30.488  -24.536 1.00 388.26 ? 18  ARG C CD    1 
ATOM 4308  N NE    . ARG I  3 5   ? 41.780  -30.050  -23.911 1.00 384.55 ? 18  ARG C NE    1 
ATOM 4309  C CZ    . ARG I  3 5   ? 41.604  -29.801  -22.610 1.00 385.33 ? 18  ARG C CZ    1 
ATOM 4310  N NH1   . ARG I  3 5   ? 40.417  -29.397  -22.171 1.00 386.26 ? 18  ARG C NH1   1 
ATOM 4311  N NH2   . ARG I  3 5   ? 42.599  -29.956  -21.741 1.00 385.76 ? 18  ARG C NH2   1 
ATOM 4312  N N     . LEU I  3 6   ? 39.630  -33.588  -23.790 1.00 429.85 ? 19  LEU C N     1 
ATOM 4313  C CA    . LEU I  3 6   ? 38.639  -33.429  -22.699 1.00 419.52 ? 19  LEU C CA    1 
ATOM 4314  C C     . LEU I  3 6   ? 38.392  -34.732  -21.922 1.00 406.54 ? 19  LEU C C     1 
ATOM 4315  O O     . LEU I  3 6   ? 38.188  -34.687  -20.712 1.00 402.58 ? 19  LEU C O     1 
ATOM 4316  C CB    . LEU I  3 6   ? 37.306  -32.862  -23.219 1.00 421.51 ? 19  LEU C CB    1 
ATOM 4317  C CG    . LEU I  3 6   ? 37.223  -31.437  -23.776 1.00 419.84 ? 19  LEU C CG    1 
ATOM 4318  C CD1   . LEU I  3 6   ? 35.947  -31.264  -24.581 1.00 416.65 ? 19  LEU C CD1   1 
ATOM 4319  C CD2   . LEU I  3 6   ? 37.316  -30.398  -22.669 1.00 419.50 ? 19  LEU C CD2   1 
ATOM 4320  N N     . LYS I  3 7   ? 38.412  -35.877  -22.617 1.00 391.37 ? 20  LYS C N     1 
ATOM 4321  C CA    . LYS I  3 7   ? 38.370  -37.217  -21.984 1.00 375.53 ? 20  LYS C CA    1 
ATOM 4322  C C     . LYS I  3 7   ? 39.624  -37.418  -21.137 1.00 375.27 ? 20  LYS C C     1 
ATOM 4323  O O     . LYS I  3 7   ? 39.569  -37.938  -20.023 1.00 369.47 ? 20  LYS C O     1 
ATOM 4324  C CB    . LYS I  3 7   ? 38.329  -38.348  -23.032 1.00 365.63 ? 20  LYS C CB    1 
ATOM 4325  C CG    . LYS I  3 7   ? 37.078  -38.463  -23.903 1.00 358.95 ? 20  LYS C CG    1 
ATOM 4326  C CD    . LYS I  3 7   ? 37.340  -39.315  -25.152 1.00 350.21 ? 20  LYS C CD    1 
ATOM 4327  C CE    . LYS I  3 7   ? 36.249  -39.178  -26.213 1.00 345.35 ? 20  LYS C CE    1 
ATOM 4328  N NZ    . LYS I  3 7   ? 36.711  -39.653  -27.541 1.00 340.23 ? 20  LYS C NZ    1 
ATOM 4329  N N     . ALA I  3 8   ? 40.756  -37.001  -21.703 1.00 381.72 ? 21  ALA C N     1 
ATOM 4330  C CA    . ALA I  3 8   ? 42.071  -37.089  -21.068 1.00 385.51 ? 21  ALA C CA    1 
ATOM 4331  C C     . ALA I  3 8   ? 42.313  -36.031  -19.976 1.00 388.05 ? 21  ALA C C     1 
ATOM 4332  O O     . ALA I  3 8   ? 43.089  -36.279  -19.045 1.00 387.18 ? 21  ALA C O     1 
ATOM 4333  C CB    . ALA I  3 8   ? 43.171  -37.037  -22.120 1.00 387.35 ? 21  ALA C CB    1 
ATOM 4334  N N     . ALA I  3 9   ? 41.679  -34.862  -20.098 1.00 392.05 ? 22  ALA C N     1 
ATOM 4335  C CA    . ALA I  3 9   ? 41.667  -33.854  -19.023 1.00 396.41 ? 22  ALA C CA    1 
ATOM 4336  C C     . ALA I  3 9   ? 40.803  -34.326  -17.833 1.00 400.84 ? 22  ALA C C     1 
ATOM 4337  O O     . ALA I  3 9   ? 41.174  -34.128  -16.661 1.00 406.01 ? 22  ALA C O     1 
ATOM 4338  C CB    . ALA I  3 9   ? 41.195  -32.506  -19.547 1.00 395.04 ? 22  ALA C CB    1 
ATOM 4339  N N     . VAL I  3 10  ? 39.663  -34.957  -18.145 1.00 402.76 ? 23  VAL C N     1 
ATOM 4340  C CA    . VAL I  3 10  ? 38.818  -35.652  -17.151 1.00 402.91 ? 23  VAL C CA    1 
ATOM 4341  C C     . VAL I  3 10  ? 39.585  -36.825  -16.476 1.00 410.04 ? 23  VAL C C     1 
ATOM 4342  O O     . VAL I  3 10  ? 39.473  -37.014  -15.264 1.00 413.28 ? 23  VAL C O     1 
ATOM 4343  C CB    . VAL I  3 10  ? 37.446  -36.069  -17.758 1.00 394.43 ? 23  VAL C CB    1 
ATOM 4344  C CG1   . VAL I  3 10  ? 36.785  -37.170  -16.959 1.00 388.42 ? 23  VAL C CG1   1 
ATOM 4345  C CG2   . VAL I  3 10  ? 36.510  -34.873  -17.829 1.00 390.40 ? 23  VAL C CG2   1 
ATOM 4346  N N     . HIS I  3 11  ? 40.375  -37.574  -17.259 1.00 412.43 ? 24  HIS C N     1 
ATOM 4347  C CA    . HIS I  3 11  ? 41.314  -38.638  -16.779 1.00 410.63 ? 24  HIS C CA    1 
ATOM 4348  C C     . HIS I  3 11  ? 42.283  -38.231  -15.621 1.00 427.13 ? 24  HIS C C     1 
ATOM 4349  O O     . HIS I  3 11  ? 42.426  -38.980  -14.645 1.00 442.78 ? 24  HIS C O     1 
ATOM 4350  C CB    . HIS I  3 11  ? 42.088  -39.224  -17.989 1.00 388.66 ? 24  HIS C CB    1 
ATOM 4351  C CG    . HIS I  3 11  ? 42.735  -40.560  -17.743 1.00 369.64 ? 24  HIS C CG    1 
ATOM 4352  N ND1   . HIS I  3 11  ? 42.013  -41.695  -17.430 1.00 363.93 ? 24  HIS C ND1   1 
ATOM 4353  C CD2   . HIS I  3 11  ? 44.031  -40.951  -17.817 1.00 361.07 ? 24  HIS C CD2   1 
ATOM 4354  C CE1   . HIS I  3 11  ? 42.841  -42.716  -17.286 1.00 357.73 ? 24  HIS C CE1   1 
ATOM 4355  N NE2   . HIS I  3 11  ? 44.071  -42.290  -17.513 1.00 355.75 ? 24  HIS C NE2   1 
ATOM 4356  N N     . TYR I  3 12  ? 42.924  -37.058  -15.731 1.00 431.85 ? 25  TYR C N     1 
ATOM 4357  C CA    . TYR I  3 12  ? 43.893  -36.536  -14.727 1.00 420.54 ? 25  TYR C CA    1 
ATOM 4358  C C     . TYR I  3 12  ? 43.237  -36.180  -13.398 1.00 418.97 ? 25  TYR C C     1 
ATOM 4359  O O     . TYR I  3 12  ? 43.769  -36.530  -12.346 1.00 420.50 ? 25  TYR C O     1 
ATOM 4360  C CB    . TYR I  3 12  ? 44.664  -35.324  -15.306 1.00 406.96 ? 25  TYR C CB    1 
ATOM 4361  C CG    . TYR I  3 12  ? 45.519  -34.453  -14.357 1.00 387.78 ? 25  TYR C CG    1 
ATOM 4362  C CD1   . TYR I  3 12  ? 46.876  -34.722  -14.140 1.00 382.26 ? 25  TYR C CD1   1 
ATOM 4363  C CD2   . TYR I  3 12  ? 44.986  -33.317  -13.746 1.00 378.20 ? 25  TYR C CD2   1 
ATOM 4364  C CE1   . TYR I  3 12  ? 47.639  -33.922  -13.293 1.00 373.57 ? 25  TYR C CE1   1 
ATOM 4365  C CE2   . TYR I  3 12  ? 45.739  -32.521  -12.902 1.00 371.09 ? 25  TYR C CE2   1 
ATOM 4366  C CZ    . TYR I  3 12  ? 47.062  -32.820  -12.683 1.00 370.59 ? 25  TYR C CZ    1 
ATOM 4367  O OH    . TYR I  3 12  ? 47.788  -32.013  -11.846 1.00 368.96 ? 25  TYR C OH    1 
ATOM 4368  N N     . THR I  3 13  ? 42.091  -35.499  -13.463 1.00 409.98 ? 26  THR C N     1 
ATOM 4369  C CA    . THR I  3 13  ? 41.347  -35.070  -12.282 1.00 396.67 ? 26  THR C CA    1 
ATOM 4370  C C     . THR I  3 13  ? 40.671  -36.237  -11.537 1.00 392.29 ? 26  THR C C     1 
ATOM 4371  O O     . THR I  3 13  ? 40.767  -36.341  -10.304 1.00 390.58 ? 26  THR C O     1 
ATOM 4372  C CB    . THR I  3 13  ? 40.288  -34.028  -12.665 1.00 393.99 ? 26  THR C CB    1 
ATOM 4373  O OG1   . THR I  3 13  ? 40.927  -32.913  -13.282 1.00 392.95 ? 26  THR C OG1   1 
ATOM 4374  C CG2   . THR I  3 13  ? 39.584  -33.554  -11.446 1.00 394.06 ? 26  THR C CG2   1 
ATOM 4375  N N     . VAL I  3 14  ? 39.989  -37.106  -12.286 1.00 388.60 ? 27  VAL C N     1 
ATOM 4376  C CA    . VAL I  3 14  ? 39.408  -38.343  -11.743 1.00 388.21 ? 27  VAL C CA    1 
ATOM 4377  C C     . VAL I  3 14  ? 40.476  -39.212  -11.056 1.00 406.25 ? 27  VAL C C     1 
ATOM 4378  O O     . VAL I  3 14  ? 40.217  -39.824  -10.007 1.00 416.42 ? 27  VAL C O     1 
ATOM 4379  C CB    . VAL I  3 14  ? 38.691  -39.146  -12.847 1.00 373.70 ? 27  VAL C CB    1 
ATOM 4380  C CG1   . VAL I  3 14  ? 38.321  -40.530  -12.357 1.00 364.81 ? 27  VAL C CG1   1 
ATOM 4381  C CG2   . VAL I  3 14  ? 37.458  -38.398  -13.338 1.00 365.05 ? 27  VAL C CG2   1 
ATOM 4382  N N     . GLY I  3 15  ? 41.671  -39.237  -11.660 1.00 420.18 ? 28  GLY C N     1 
ATOM 4383  C CA    . GLY I  3 15  ? 42.857  -39.948  -11.138 1.00 423.05 ? 28  GLY C CA    1 
ATOM 4384  C C     . GLY I  3 15  ? 43.433  -39.475  -9.802  1.00 419.46 ? 28  GLY C C     1 
ATOM 4385  O O     . GLY I  3 15  ? 43.947  -40.295  -9.017  1.00 415.38 ? 28  GLY C O     1 
ATOM 4386  N N     . CYS I  3 16  ? 43.363  -38.159  -9.556  1.00 415.76 ? 29  CYS C N     1 
ATOM 4387  C CA    . CYS I  3 16  ? 43.727  -37.542  -8.257  1.00 410.85 ? 29  CYS C CA    1 
ATOM 4388  C C     . CYS I  3 16  ? 42.772  -37.955  -7.114  1.00 405.84 ? 29  CYS C C     1 
ATOM 4389  O O     . CYS I  3 16  ? 43.227  -38.372  -6.047  1.00 405.13 ? 29  CYS C O     1 
ATOM 4390  C CB    . CYS I  3 16  ? 43.798  -36.001  -8.361  1.00 413.64 ? 29  CYS C CB    1 
ATOM 4391  S SG    . CYS I  3 16  ? 45.280  -35.310  -9.163  1.00 415.81 ? 29  CYS C SG    1 
ATOM 4392  N N     . LEU I  3 17  ? 41.462  -37.836  -7.351  1.00 399.31 ? 30  LEU C N     1 
ATOM 4393  C CA    . LEU I  3 17  ? 40.425  -38.250  -6.390  1.00 391.86 ? 30  LEU C CA    1 
ATOM 4394  C C     . LEU I  3 17  ? 40.440  -39.759  -6.134  1.00 393.24 ? 30  LEU C C     1 
ATOM 4395  O O     . LEU I  3 17  ? 40.222  -40.215  -5.011  1.00 388.71 ? 30  LEU C O     1 
ATOM 4396  C CB    . LEU I  3 17  ? 39.046  -37.799  -6.876  1.00 385.59 ? 30  LEU C CB    1 
ATOM 4397  C CG    . LEU I  3 17  ? 38.778  -36.288  -6.783  1.00 382.48 ? 30  LEU C CG    1 
ATOM 4398  C CD1   . LEU I  3 17  ? 37.618  -35.869  -7.678  1.00 383.56 ? 30  LEU C CD1   1 
ATOM 4399  C CD2   . LEU I  3 17  ? 38.544  -35.834  -5.346  1.00 377.16 ? 30  LEU C CD2   1 
ATOM 4400  N N     . CYS I  3 18  ? 40.724  -40.527  -7.184  1.00 399.83 ? 31  CYS C N     1 
ATOM 4401  C CA    . CYS I  3 18  ? 40.899  -41.985  -7.068  1.00 398.44 ? 31  CYS C CA    1 
ATOM 4402  C C     . CYS I  3 18  ? 42.225  -42.439  -6.372  1.00 390.12 ? 31  CYS C C     1 
ATOM 4403  O O     . CYS I  3 18  ? 42.278  -43.505  -5.727  1.00 387.58 ? 31  CYS C O     1 
ATOM 4404  C CB    . CYS I  3 18  ? 40.693  -42.668  -8.435  1.00 404.33 ? 31  CYS C CB    1 
ATOM 4405  S SG    . CYS I  3 18  ? 38.982  -42.753  -9.018  1.00 403.14 ? 31  CYS C SG    1 
ATOM 4406  N N     . GLU I  3 19  ? 43.285  -41.637  -6.476  1.00 380.53 ? 32  GLU C N     1 
ATOM 4407  C CA    . GLU I  3 19  ? 44.482  -41.917  -5.683  1.00 377.46 ? 32  GLU C CA    1 
ATOM 4408  C C     . GLU I  3 19  ? 44.369  -41.452  -4.230  1.00 396.51 ? 32  GLU C C     1 
ATOM 4409  O O     . GLU I  3 19  ? 45.046  -41.995  -3.362  1.00 401.51 ? 32  GLU C O     1 
ATOM 4410  C CB    . GLU I  3 19  ? 45.754  -41.419  -6.363  1.00 360.71 ? 32  GLU C CB    1 
ATOM 4411  C CG    . GLU I  3 19  ? 46.298  -42.429  -7.365  1.00 345.69 ? 32  GLU C CG    1 
ATOM 4412  C CD    . GLU I  3 19  ? 46.999  -43.613  -6.695  1.00 339.12 ? 32  GLU C CD    1 
ATOM 4413  O OE1   . GLU I  3 19  ? 47.837  -43.390  -5.794  1.00 337.21 ? 32  GLU C OE1   1 
ATOM 4414  O OE2   . GLU I  3 19  ? 46.735  -44.772  -7.068  1.00 332.27 ? 32  GLU C OE2   1 
ATOM 4415  N N     . GLU I  3 20  ? 43.508  -40.456  -3.983  1.00 419.60 ? 33  GLU C N     1 
ATOM 4416  C CA    . GLU I  3 20  ? 43.001  -40.126  -2.629  1.00 446.83 ? 33  GLU C CA    1 
ATOM 4417  C C     . GLU I  3 20  ? 42.387  -41.359  -1.949  1.00 466.23 ? 33  GLU C C     1 
ATOM 4418  O O     . GLU I  3 20  ? 42.614  -41.608  -0.752  1.00 485.31 ? 33  GLU C O     1 
ATOM 4419  C CB    . GLU I  3 20  ? 41.931  -39.031  -2.693  1.00 441.44 ? 33  GLU C CB    1 
ATOM 4420  C CG    . GLU I  3 20  ? 42.413  -37.634  -2.337  1.00 436.91 ? 33  GLU C CG    1 
ATOM 4421  C CD    . GLU I  3 20  ? 41.344  -36.571  -2.531  1.00 430.99 ? 33  GLU C CD    1 
ATOM 4422  O OE1   . GLU I  3 20  ? 40.142  -36.902  -2.454  1.00 419.87 ? 33  GLU C OE1   1 
ATOM 4423  O OE2   . GLU I  3 20  ? 41.717  -35.401  -2.753  1.00 432.39 ? 33  GLU C OE2   1 
ATOM 4424  N N     . VAL I  3 21  ? 41.604  -42.109  -2.736  1.00 472.02 ? 34  VAL C N     1 
ATOM 4425  C CA    . VAL I  3 21  ? 40.902  -43.364  -2.322  1.00 472.32 ? 34  VAL C CA    1 
ATOM 4426  C C     . VAL I  3 21  ? 41.818  -44.607  -2.089  1.00 467.87 ? 34  VAL C C     1 
ATOM 4427  O O     . VAL I  3 21  ? 41.530  -45.480  -1.236  1.00 465.33 ? 34  VAL C O     1 
ATOM 4428  C CB    . VAL I  3 21  ? 39.749  -43.717  -3.314  1.00 472.11 ? 34  VAL C CB    1 
ATOM 4429  C CG1   . VAL I  3 21  ? 39.024  -45.005  -2.894  1.00 467.70 ? 34  VAL C CG1   1 
ATOM 4430  C CG2   . VAL I  3 21  ? 38.777  -42.540  -3.489  1.00 478.74 ? 34  VAL C CG2   1 
ATOM 4431  N N     . ALA I  3 22  ? 42.907  -44.681  -2.850  1.00 464.48 ? 35  ALA C N     1 
ATOM 4432  C CA    . ALA I  3 22  ? 43.941  -45.681  -2.608  1.00 463.41 ? 35  ALA C CA    1 
ATOM 4433  C C     . ALA I  3 22  ? 44.524  -45.663  -1.146  1.00 464.08 ? 35  ALA C C     1 
ATOM 4434  O O     . ALA I  3 22  ? 44.806  -46.729  -0.592  1.00 470.55 ? 35  ALA C O     1 
ATOM 4435  C CB    . ALA I  3 22  ? 45.031  -45.561  -3.669  1.00 465.34 ? 35  ALA C CB    1 
ATOM 4436  N N     . LEU I  3 23  ? 44.674  -44.465  -0.535  1.00 453.97 ? 36  LEU C N     1 
ATOM 4437  C CA    . LEU I  3 23  ? 45.177  -44.244  0.874   1.00 430.45 ? 36  LEU C CA    1 
ATOM 4438  C C     . LEU I  3 23  ? 44.288  -44.908  1.947   1.00 416.33 ? 36  LEU C C     1 
ATOM 4439  O O     . LEU I  3 23  ? 44.787  -45.558  2.873   1.00 421.81 ? 36  LEU C O     1 
ATOM 4440  C CB    . LEU I  3 23  ? 45.308  -42.724  1.193   1.00 419.54 ? 36  LEU C CB    1 
ATOM 4441  C CG    . LEU I  3 23  ? 46.495  -42.055  1.924   1.00 408.73 ? 36  LEU C CG    1 
ATOM 4442  C CD1   . LEU I  3 23  ? 47.463  -41.388  0.957   1.00 405.54 ? 36  LEU C CD1   1 
ATOM 4443  C CD2   . LEU I  3 23  ? 45.989  -41.029  2.927   1.00 400.88 ? 36  LEU C CD2   1 
ATOM 4444  N N     . ASP I  3 24  ? 42.979  -44.730  1.782   1.00 392.17 ? 37  ASP C N     1 
ATOM 4445  C CA    . ASP I  3 24  ? 41.976  -44.872  2.838   1.00 367.19 ? 37  ASP C CA    1 
ATOM 4446  C C     . ASP I  3 24  ? 41.501  -46.314  3.069   1.00 353.83 ? 37  ASP C C     1 
ATOM 4447  O O     . ASP I  3 24  ? 41.270  -46.718  4.210   1.00 349.48 ? 37  ASP C O     1 
ATOM 4448  C CB    . ASP I  3 24  ? 40.804  -43.919  2.524   1.00 361.34 ? 37  ASP C CB    1 
ATOM 4449  C CG    . ASP I  3 24  ? 39.769  -43.859  3.628   1.00 354.85 ? 37  ASP C CG    1 
ATOM 4450  O OD1   . ASP I  3 24  ? 40.124  -43.590  4.795   1.00 352.56 ? 37  ASP C OD1   1 
ATOM 4451  O OD2   . ASP I  3 24  ? 38.581  -44.066  3.316   1.00 352.43 ? 37  ASP C OD2   1 
ATOM 4452  N N     . LYS I  3 25  ? 41.394  -47.088  1.993   1.00 340.77 ? 38  LYS C N     1 
ATOM 4453  C CA    . LYS I  3 25  ? 40.870  -48.444  2.069   1.00 331.26 ? 38  LYS C CA    1 
ATOM 4454  C C     . LYS I  3 25  ? 41.989  -49.471  2.175   1.00 326.98 ? 38  LYS C C     1 
ATOM 4455  O O     . LYS I  3 25  ? 41.757  -50.653  2.391   1.00 321.57 ? 38  LYS C O     1 
ATOM 4456  C CB    . LYS I  3 25  ? 39.984  -48.731  0.850   1.00 329.75 ? 38  LYS C CB    1 
ATOM 4457  C CG    . LYS I  3 25  ? 38.753  -47.832  0.715   1.00 330.71 ? 38  LYS C CG    1 
ATOM 4458  C CD    . LYS I  3 25  ? 37.903  -47.800  1.994   1.00 331.44 ? 38  LYS C CD    1 
ATOM 4459  C CE    . LYS I  3 25  ? 36.842  -46.693  1.980   1.00 331.20 ? 38  LYS C CE    1 
ATOM 4460  N NZ    . LYS I  3 25  ? 36.002  -46.608  3.217   1.00 332.46 ? 38  LYS C NZ    1 
ATOM 4461  N N     . ALA I  3 26  ? 43.220  -49.005  2.043   1.00 327.70 ? 39  ALA C N     1 
ATOM 4462  C CA    . ALA I  3 26  ? 44.363  -49.898  1.961   1.00 331.35 ? 39  ALA C CA    1 
ATOM 4463  C C     . ALA I  3 26  ? 44.349  -50.707  0.668   1.00 331.53 ? 39  ALA C C     1 
ATOM 4464  O O     . ALA I  3 26  ? 44.982  -51.756  0.591   1.00 331.67 ? 39  ALA C O     1 
ATOM 4465  C CB    . ALA I  3 26  ? 44.427  -50.817  3.176   1.00 333.08 ? 39  ALA C CB    1 
ATOM 4466  N N     . MET I  3 27  ? 43.630  -50.231  -0.349  1.00 333.69 ? 40  MET C N     1 
ATOM 4467  C CA    . MET I  3 27  ? 43.696  -50.870  -1.663  1.00 342.21 ? 40  MET C CA    1 
ATOM 4468  C C     . MET I  3 27  ? 43.639  -49.940  -2.866  1.00 351.31 ? 40  MET C C     1 
ATOM 4469  O O     . MET I  3 27  ? 42.790  -49.047  -2.981  1.00 342.39 ? 40  MET C O     1 
ATOM 4470  C CB    . MET I  3 27  ? 42.696  -52.018  -1.817  1.00 342.99 ? 40  MET C CB    1 
ATOM 4471  C CG    . MET I  3 27  ? 43.110  -53.061  -2.855  1.00 348.56 ? 40  MET C CG    1 
ATOM 4472  S SD    . MET I  3 27  ? 43.833  -54.565  -2.154  1.00 354.83 ? 40  MET C SD    1 
ATOM 4473  C CE    . MET I  3 27  ? 45.465  -54.044  -1.620  1.00 349.97 ? 40  MET C CE    1 
ATOM 4474  N N     . GLN I  3 28  ? 44.562  -50.251  -3.765  1.00 375.00 ? 41  GLN C N     1 
ATOM 4475  C CA    . GLN I  3 28  ? 44.957  -49.465  -4.930  1.00 395.01 ? 41  GLN C CA    1 
ATOM 4476  C C     . GLN I  3 28  ? 44.027  -49.678  -6.162  1.00 396.53 ? 41  GLN C C     1 
ATOM 4477  O O     . GLN I  3 28  ? 43.110  -50.522  -6.099  1.00 406.78 ? 41  GLN C O     1 
ATOM 4478  C CB    . GLN I  3 28  ? 46.469  -49.750  -5.237  1.00 401.84 ? 41  GLN C CB    1 
ATOM 4479  C CG    . GLN I  3 28  ? 46.867  -51.137  -5.801  1.00 401.89 ? 41  GLN C CG    1 
ATOM 4480  C CD    . GLN I  3 28  ? 47.329  -52.196  -4.778  1.00 396.83 ? 41  GLN C CD    1 
ATOM 4481  O OE1   . GLN I  3 28  ? 48.243  -51.977  -3.971  1.00 383.63 ? 41  GLN C OE1   1 
ATOM 4482  N NE2   . GLN I  3 28  ? 46.717  -53.374  -4.859  1.00 401.35 ? 41  GLN C NE2   1 
ATOM 4483  N N     . PHE I  3 29  ? 44.274  -48.914  -7.249  1.00 382.96 ? 42  PHE C N     1 
ATOM 4484  C CA    . PHE I  3 29  ? 43.536  -48.976  -8.553  1.00 360.37 ? 42  PHE C CA    1 
ATOM 4485  C C     . PHE I  3 29  ? 44.374  -49.464  -9.742  1.00 350.07 ? 42  PHE C C     1 
ATOM 4486  O O     . PHE I  3 29  ? 45.509  -49.022  -9.940  1.00 348.61 ? 42  PHE C O     1 
ATOM 4487  C CB    . PHE I  3 29  ? 42.936  -47.606  -8.916  1.00 354.08 ? 42  PHE C CB    1 
ATOM 4488  C CG    . PHE I  3 29  ? 41.988  -47.079  -7.890  1.00 350.39 ? 42  PHE C CG    1 
ATOM 4489  C CD1   . PHE I  3 29  ? 42.410  -46.911  -6.577  1.00 350.27 ? 42  PHE C CD1   1 
ATOM 4490  C CD2   . PHE I  3 29  ? 40.685  -46.747  -8.234  1.00 346.39 ? 42  PHE C CD2   1 
ATOM 4491  C CE1   . PHE I  3 29  ? 41.554  -46.449  -5.622  1.00 346.83 ? 42  PHE C CE1   1 
ATOM 4492  C CE2   . PHE I  3 29  ? 39.818  -46.272  -7.278  1.00 346.64 ? 42  PHE C CE2   1 
ATOM 4493  C CZ    . PHE I  3 29  ? 40.254  -46.122  -5.976  1.00 345.90 ? 42  PHE C CZ    1 
ATOM 4494  N N     . SER I  3 30  ? 43.810  -50.374  -10.532 1.00 339.11 ? 43  SER C N     1 
ATOM 4495  C CA    . SER I  3 30  ? 44.440  -50.753  -11.774 1.00 333.98 ? 43  SER C CA    1 
ATOM 4496  C C     . SER I  3 30  ? 44.156  -49.628  -12.738 1.00 331.53 ? 43  SER C C     1 
ATOM 4497  O O     . SER I  3 30  ? 43.173  -48.877  -12.572 1.00 327.12 ? 43  SER C O     1 
ATOM 4498  C CB    . SER I  3 30  ? 43.858  -52.048  -12.327 1.00 334.97 ? 43  SER C CB    1 
ATOM 4499  O OG    . SER I  3 30  ? 42.558  -51.819  -12.852 1.00 339.50 ? 43  SER C OG    1 
ATOM 4500  N N     . LYS I  3 31  ? 45.041  -49.521  -13.726 1.00 332.43 ? 44  LYS C N     1 
ATOM 4501  C CA    . LYS I  3 31  ? 44.875  -48.671  -14.901 1.00 337.25 ? 44  LYS C CA    1 
ATOM 4502  C C     . LYS I  3 31  ? 43.408  -48.718  -15.384 1.00 342.31 ? 44  LYS C C     1 
ATOM 4503  O O     . LYS I  3 31  ? 42.772  -47.667  -15.585 1.00 345.58 ? 44  LYS C O     1 
ATOM 4504  C CB    . LYS I  3 31  ? 45.857  -49.146  -15.998 1.00 333.92 ? 44  LYS C CB    1 
ATOM 4505  C CG    . LYS I  3 31  ? 46.259  -48.122  -17.067 1.00 333.32 ? 44  LYS C CG    1 
ATOM 4506  C CD    . LYS I  3 31  ? 46.952  -46.886  -16.510 1.00 330.58 ? 44  LYS C CD    1 
ATOM 4507  C CE    . LYS I  3 31  ? 48.347  -47.208  -16.002 1.00 327.46 ? 44  LYS C CE    1 
ATOM 4508  N NZ    . LYS I  3 31  ? 48.996  -45.994  -15.456 1.00 325.74 ? 44  LYS C NZ    1 
ATOM 4509  N N     . GLN I  3 32  ? 42.881  -49.943  -15.524 1.00 344.70 ? 45  GLN C N     1 
ATOM 4510  C CA    . GLN I  3 32  ? 41.537  -50.192  -16.052 1.00 339.69 ? 45  GLN C CA    1 
ATOM 4511  C C     . GLN I  3 32  ? 40.425  -49.557  -15.214 1.00 327.26 ? 45  GLN C C     1 
ATOM 4512  O O     . GLN I  3 32  ? 39.495  -48.993  -15.788 1.00 327.29 ? 45  GLN C O     1 
ATOM 4513  C CB    . GLN I  3 32  ? 41.293  -51.690  -16.261 1.00 345.78 ? 45  GLN C CB    1 
ATOM 4514  C CG    . GLN I  3 32  ? 42.293  -52.353  -17.199 1.00 350.60 ? 45  GLN C CG    1 
ATOM 4515  C CD    . GLN I  3 32  ? 43.436  -53.035  -16.470 1.00 351.20 ? 45  GLN C CD    1 
ATOM 4516  O OE1   . GLN I  3 32  ? 44.098  -52.444  -15.610 1.00 352.11 ? 45  GLN C OE1   1 
ATOM 4517  N NE2   . GLN I  3 32  ? 43.671  -54.304  -16.806 1.00 348.79 ? 45  GLN C NE2   1 
ATOM 4518  N N     . THR I  3 33  ? 40.531  -49.631  -13.879 1.00 312.32 ? 46  THR C N     1 
ATOM 4519  C CA    . THR I  3 33  ? 39.572  -48.957  -12.996 1.00 297.78 ? 46  THR C CA    1 
ATOM 4520  C C     . THR I  3 33  ? 39.658  -47.456  -13.197 1.00 295.98 ? 46  THR C C     1 
ATOM 4521  O O     . THR I  3 33  ? 38.644  -46.803  -13.435 1.00 293.12 ? 46  THR C O     1 
ATOM 4522  C CB    . THR I  3 33  ? 39.724  -49.344  -11.516 1.00 293.34 ? 46  THR C CB    1 
ATOM 4523  O OG1   . THR I  3 33  ? 39.326  -50.706  -11.367 1.00 292.06 ? 46  THR C OG1   1 
ATOM 4524  C CG2   . THR I  3 33  ? 38.804  -48.532  -10.662 1.00 290.29 ? 46  THR C CG2   1 
ATOM 4525  N N     . ILE I  3 34  ? 40.873  -46.924  -13.160 1.00 299.05 ? 47  ILE C N     1 
ATOM 4526  C CA    . ILE I  3 34  ? 41.098  -45.519  -13.454 1.00 308.08 ? 47  ILE C CA    1 
ATOM 4527  C C     . ILE I  3 34  ? 40.554  -45.093  -14.831 1.00 324.50 ? 47  ILE C C     1 
ATOM 4528  O O     . ILE I  3 34  ? 39.793  -44.127  -14.938 1.00 329.54 ? 47  ILE C O     1 
ATOM 4529  C CB    . ILE I  3 34  ? 42.589  -45.177  -13.361 1.00 303.50 ? 47  ILE C CB    1 
ATOM 4530  C CG1   . ILE I  3 34  ? 43.158  -45.600  -12.002 1.00 299.87 ? 47  ILE C CG1   1 
ATOM 4531  C CG2   . ILE I  3 34  ? 42.791  -43.695  -13.617 1.00 304.02 ? 47  ILE C CG2   1 
ATOM 4532  C CD1   . ILE I  3 34  ? 42.525  -44.889  -10.834 1.00 297.79 ? 47  ILE C CD1   1 
ATOM 4533  N N     . ALA I  3 35  ? 40.941  -45.827  -15.871 1.00 345.02 ? 48  ALA C N     1 
ATOM 4534  C CA    . ALA I  3 35  ? 40.498  -45.557  -17.239 1.00 367.66 ? 48  ALA C CA    1 
ATOM 4535  C C     . ALA I  3 35  ? 38.982  -45.711  -17.415 1.00 385.54 ? 48  ALA C C     1 
ATOM 4536  O O     . ALA I  3 35  ? 38.353  -44.974  -18.195 1.00 389.54 ? 48  ALA C O     1 
ATOM 4537  C CB    . ALA I  3 35  ? 41.235  -46.457  -18.218 1.00 365.57 ? 48  ALA C CB    1 
ATOM 4538  N N     . ALA I  3 36  ? 38.395  -46.675  -16.706 1.00 404.01 ? 49  ALA C N     1 
ATOM 4539  C CA    . ALA I  3 36  ? 36.939  -46.892  -16.776 1.00 420.67 ? 49  ALA C CA    1 
ATOM 4540  C C     . ALA I  3 36  ? 36.138  -45.904  -15.909 1.00 431.97 ? 49  ALA C C     1 
ATOM 4541  O O     . ALA I  3 36  ? 34.952  -45.668  -16.184 1.00 433.96 ? 49  ALA C O     1 
ATOM 4542  C CB    . ALA I  3 36  ? 36.562  -48.346  -16.471 1.00 416.01 ? 49  ALA C CB    1 
ATOM 4543  N N     . ILE I  3 37  ? 36.777  -45.314  -14.891 1.00 445.38 ? 50  ILE C N     1 
ATOM 4544  C CA    . ILE I  3 37  ? 36.129  -44.261  -14.068 1.00 460.46 ? 50  ILE C CA    1 
ATOM 4545  C C     . ILE I  3 37  ? 36.111  -42.895  -14.802 1.00 478.97 ? 50  ILE C C     1 
ATOM 4546  O O     . ILE I  3 37  ? 35.171  -42.090  -14.633 1.00 493.26 ? 50  ILE C O     1 
ATOM 4547  C CB    . ILE I  3 37  ? 36.733  -44.135  -12.629 1.00 448.85 ? 50  ILE C CB    1 
ATOM 4548  C CG1   . ILE I  3 37  ? 36.660  -45.470  -11.862 1.00 437.98 ? 50  ILE C CG1   1 
ATOM 4549  C CG2   . ILE I  3 37  ? 35.995  -43.077  -11.817 1.00 447.10 ? 50  ILE C CG2   1 
ATOM 4550  C CD1   . ILE I  3 37  ? 37.444  -45.513  -10.559 1.00 429.08 ? 50  ILE C CD1   1 
ATOM 4551  N N     . SER I  3 38  ? 37.140  -42.652  -15.624 1.00 487.09 ? 51  SER C N     1 
ATOM 4552  C CA    . SER I  3 38  ? 37.281  -41.409  -16.419 1.00 478.42 ? 51  SER C CA    1 
ATOM 4553  C C     . SER I  3 38  ? 36.328  -41.289  -17.655 1.00 462.50 ? 51  SER C C     1 
ATOM 4554  O O     . SER I  3 38  ? 35.699  -40.216  -17.891 1.00 464.01 ? 51  SER C O     1 
ATOM 4555  C CB    . SER I  3 38  ? 38.754  -41.205  -16.815 1.00 482.47 ? 51  SER C CB    1 
ATOM 4556  O OG    . SER I  3 38  ? 39.588  -41.129  -15.667 1.00 485.29 ? 51  SER C OG    1 
ATOM 4557  N N     . GLU I  3 39  ? 36.233  -42.391  -18.421 1.00 435.79 ? 52  GLU C N     1 
ATOM 4558  C CA    . GLU I  3 39  ? 35.249  -42.564  -19.520 1.00 415.50 ? 52  GLU C CA    1 
ATOM 4559  C C     . GLU I  3 39  ? 33.824  -42.191  -19.058 1.00 415.09 ? 52  GLU C C     1 
ATOM 4560  O O     . GLU I  3 39  ? 33.100  -41.467  -19.760 1.00 421.08 ? 52  GLU C O     1 
ATOM 4561  C CB    . GLU I  3 39  ? 35.273  -44.004  -20.084 1.00 395.89 ? 52  GLU C CB    1 
ATOM 4562  C CG    . GLU I  3 39  ? 36.409  -44.314  -21.055 1.00 379.21 ? 52  GLU C CG    1 
ATOM 4563  C CD    . GLU I  3 39  ? 36.514  -45.788  -21.415 1.00 367.15 ? 52  GLU C CD    1 
ATOM 4564  O OE1   . GLU I  3 39  ? 35.479  -46.446  -21.686 1.00 359.75 ? 52  GLU C OE1   1 
ATOM 4565  O OE2   . GLU I  3 39  ? 37.659  -46.283  -21.415 1.00 362.52 ? 52  GLU C OE2   1 
ATOM 4566  N N     . LEU I  3 40  ? 33.459  -42.670  -17.865 1.00 406.93 ? 53  LEU C N     1 
ATOM 4567  C CA    . LEU I  3 40  ? 32.148  -42.434  -17.255 1.00 391.33 ? 53  LEU C CA    1 
ATOM 4568  C C     . LEU I  3 40  ? 31.877  -40.966  -16.909 1.00 373.12 ? 53  LEU C C     1 
ATOM 4569  O O     . LEU I  3 40  ? 30.763  -40.508  -17.145 1.00 368.62 ? 53  LEU C O     1 
ATOM 4570  C CB    . LEU I  3 40  ? 31.944  -43.336  -16.026 1.00 396.97 ? 53  LEU C CB    1 
ATOM 4571  C CG    . LEU I  3 40  ? 30.553  -43.926  -15.739 1.00 397.76 ? 53  LEU C CG    1 
ATOM 4572  C CD1   . LEU I  3 40  ? 29.948  -44.616  -16.958 1.00 404.15 ? 53  LEU C CD1   1 
ATOM 4573  C CD2   . LEU I  3 40  ? 30.635  -44.903  -14.579 1.00 389.17 ? 53  LEU C CD2   1 
ATOM 4574  N N     . THR I  3 41  ? 32.872  -40.253  -16.365 1.00 353.03 ? 54  THR C N     1 
ATOM 4575  C CA    . THR I  3 41  ? 32.735  -38.831  -16.015 1.00 332.56 ? 54  THR C CA    1 
ATOM 4576  C C     . THR I  3 41  ? 32.468  -38.002  -17.241 1.00 324.24 ? 54  THR C C     1 
ATOM 4577  O O     . THR I  3 41  ? 31.523  -37.232  -17.256 1.00 319.25 ? 54  THR C O     1 
ATOM 4578  C CB    . THR I  3 41  ? 33.970  -38.283  -15.289 1.00 330.61 ? 54  THR C CB    1 
ATOM 4579  O OG1   . THR I  3 41  ? 34.097  -38.954  -14.035 1.00 330.42 ? 54  THR C OG1   1 
ATOM 4580  C CG2   . THR I  3 41  ? 33.844  -36.775  -15.053 1.00 327.10 ? 54  THR C CG2   1 
ATOM 4581  N N     . PHE I  3 42  ? 33.296  -38.179  -18.263 1.00 319.45 ? 55  PHE C N     1 
ATOM 4582  C CA    . PHE I  3 42  ? 33.081  -37.555  -19.550 1.00 318.50 ? 55  PHE C CA    1 
ATOM 4583  C C     . PHE I  3 42  ? 31.694  -37.870  -20.149 1.00 320.01 ? 55  PHE C C     1 
ATOM 4584  O O     . PHE I  3 42  ? 30.978  -36.968  -20.573 1.00 321.09 ? 55  PHE C O     1 
ATOM 4585  C CB    . PHE I  3 42  ? 34.200  -37.980  -20.497 1.00 317.91 ? 55  PHE C CB    1 
ATOM 4586  C CG    . PHE I  3 42  ? 34.101  -37.371  -21.862 1.00 320.14 ? 55  PHE C CG    1 
ATOM 4587  C CD1   . PHE I  3 42  ? 34.573  -36.091  -22.096 1.00 320.98 ? 55  PHE C CD1   1 
ATOM 4588  C CD2   . PHE I  3 42  ? 33.532  -38.081  -22.913 1.00 322.44 ? 55  PHE C CD2   1 
ATOM 4589  C CE1   . PHE I  3 42  ? 34.482  -35.530  -23.355 1.00 324.53 ? 55  PHE C CE1   1 
ATOM 4590  C CE2   . PHE I  3 42  ? 33.437  -37.525  -24.175 1.00 324.44 ? 55  PHE C CE2   1 
ATOM 4591  C CZ    . PHE I  3 42  ? 33.915  -36.249  -24.395 1.00 325.60 ? 55  PHE C CZ    1 
ATOM 4592  N N     . ARG I  3 43  ? 31.316  -39.146  -20.175 1.00 322.20 ? 56  ARG C N     1 
ATOM 4593  C CA    . ARG I  3 43  ? 30.028  -39.570  -20.740 1.00 326.43 ? 56  ARG C CA    1 
ATOM 4594  C C     . ARG I  3 43  ? 28.849  -39.187  -19.869 1.00 334.22 ? 56  ARG C C     1 
ATOM 4595  O O     . ARG I  3 43  ? 27.723  -39.059  -20.364 1.00 329.65 ? 56  ARG C O     1 
ATOM 4596  C CB    . ARG I  3 43  ? 29.993  -41.071  -20.872 1.00 323.58 ? 56  ARG C CB    1 
ATOM 4597  C CG    . ARG I  3 43  ? 30.049  -41.604  -22.277 1.00 326.51 ? 56  ARG C CG    1 
ATOM 4598  C CD    . ARG I  3 43  ? 29.597  -43.043  -22.191 1.00 332.07 ? 56  ARG C CD    1 
ATOM 4599  N NE    . ARG I  3 43  ? 30.694  -43.951  -21.831 1.00 342.93 ? 56  ARG C NE    1 
ATOM 4600  C CZ    . ARG I  3 43  ? 30.573  -45.049  -21.077 1.00 351.05 ? 56  ARG C CZ    1 
ATOM 4601  N NH1   . ARG I  3 43  ? 29.398  -45.375  -20.541 1.00 352.06 ? 56  ARG C NH1   1 
ATOM 4602  N NH2   . ARG I  3 43  ? 31.646  -45.802  -20.836 1.00 358.10 ? 56  ARG C NH2   1 
ATOM 4603  N N     . GLN I  3 44  ? 29.109  -39.046  -18.566 1.00 350.83 ? 57  GLN C N     1 
ATOM 4604  C CA    . GLN I  3 44  ? 28.091  -38.626  -17.591 1.00 374.66 ? 57  GLN C CA    1 
ATOM 4605  C C     . GLN I  3 44  ? 27.831  -37.122  -17.701 1.00 396.61 ? 57  GLN C C     1 
ATOM 4606  O O     . GLN I  3 44  ? 26.715  -36.682  -17.419 1.00 414.31 ? 57  GLN C O     1 
ATOM 4607  C CB    . GLN I  3 44  ? 28.483  -39.008  -16.149 1.00 369.64 ? 57  GLN C CB    1 
ATOM 4608  C CG    . GLN I  3 44  ? 27.387  -38.862  -15.089 1.00 366.73 ? 57  GLN C CG    1 
ATOM 4609  C CD    . GLN I  3 44  ? 26.339  -39.972  -15.108 1.00 362.29 ? 57  GLN C CD    1 
ATOM 4610  O OE1   . GLN I  3 44  ? 26.579  -41.076  -15.601 1.00 360.32 ? 57  GLN C OE1   1 
ATOM 4611  N NE2   . GLN I  3 44  ? 25.165  -39.676  -14.557 1.00 358.26 ? 57  GLN C NE2   1 
ATOM 4612  N N     . CYS I  3 45  ? 28.844  -36.352  -18.125 1.00 411.04 ? 58  CYS C N     1 
ATOM 4613  C CA    . CYS I  3 45  ? 28.709  -34.895  -18.319 1.00 424.94 ? 58  CYS C CA    1 
ATOM 4614  C C     . CYS I  3 45  ? 27.674  -34.518  -19.379 1.00 441.25 ? 58  CYS C C     1 
ATOM 4615  O O     . CYS I  3 45  ? 27.141  -33.410  -19.340 1.00 440.82 ? 58  CYS C O     1 
ATOM 4616  C CB    . CYS I  3 45  ? 30.059  -34.239  -18.618 1.00 416.91 ? 58  CYS C CB    1 
ATOM 4617  S SG    . CYS I  3 45  ? 31.163  -34.224  -17.189 1.00 404.02 ? 58  CYS C SG    1 
ATOM 4618  N N     . GLU I  3 46  ? 27.380  -35.452  -20.296 1.00 457.84 ? 59  GLU C N     1 
ATOM 4619  C CA    . GLU I  3 46  ? 26.288  -35.320  -21.297 1.00 468.51 ? 59  GLU C CA    1 
ATOM 4620  C C     . GLU I  3 46  ? 24.901  -35.122  -20.688 1.00 461.21 ? 59  GLU C C     1 
ATOM 4621  O O     . GLU I  3 46  ? 24.251  -34.097  -20.910 1.00 462.76 ? 59  GLU C O     1 
ATOM 4622  C CB    . GLU I  3 46  ? 26.217  -36.536  -22.253 1.00 480.13 ? 59  GLU C CB    1 
ATOM 4623  C CG    . GLU I  3 46  ? 25.079  -36.448  -23.301 1.00 492.19 ? 59  GLU C CG    1 
ATOM 4624  C CD    . GLU I  3 46  ? 25.023  -37.621  -24.291 1.00 496.92 ? 59  GLU C CD    1 
ATOM 4625  O OE1   . GLU I  3 46  ? 25.242  -38.772  -23.849 1.00 494.40 ? 59  GLU C OE1   1 
ATOM 4626  O OE2   . GLU I  3 46  ? 24.744  -37.392  -25.504 1.00 502.73 ? 59  GLU C OE2   1 
ATOM 4627  N N     . ASN I  3 47  ? 24.446  -36.129  -19.955 1.00 448.92 ? 60  ASN C N     1 
ATOM 4628  C CA    . ASN I  3 47  ? 23.087  -36.157  -19.459 1.00 439.60 ? 60  ASN C CA    1 
ATOM 4629  C C     . ASN I  3 47  ? 22.885  -35.169  -18.292 1.00 442.37 ? 60  ASN C C     1 
ATOM 4630  O O     . ASN I  3 47  ? 21.787  -34.665  -18.110 1.00 439.67 ? 60  ASN C O     1 
ATOM 4631  C CB    . ASN I  3 47  ? 22.675  -37.608  -19.160 1.00 428.46 ? 60  ASN C CB    1 
ATOM 4632  C CG    . ASN I  3 47  ? 22.793  -38.514  -20.392 1.00 418.22 ? 60  ASN C CG    1 
ATOM 4633  O OD1   . ASN I  3 47  ? 22.023  -38.390  -21.335 1.00 410.61 ? 60  ASN C OD1   1 
ATOM 4634  N ND2   . ASN I  3 47  ? 23.757  -39.428  -20.383 1.00 413.28 ? 60  ASN C ND2   1 
ATOM 4635  N N     . PHE I  3 48  ? 23.959  -34.854  -17.553 1.00 447.58 ? 61  PHE C N     1 
ATOM 4636  C CA    . PHE I  3 48  ? 23.959  -33.756  -16.553 1.00 449.54 ? 61  PHE C CA    1 
ATOM 4637  C C     . PHE I  3 48  ? 23.700  -32.384  -17.223 1.00 443.17 ? 61  PHE C C     1 
ATOM 4638  O O     . PHE I  3 48  ? 22.826  -31.637  -16.796 1.00 448.70 ? 61  PHE C O     1 
ATOM 4639  C CB    . PHE I  3 48  ? 25.290  -33.688  -15.735 1.00 460.19 ? 61  PHE C CB    1 
ATOM 4640  C CG    . PHE I  3 48  ? 25.410  -34.679  -14.557 1.00 461.03 ? 61  PHE C CG    1 
ATOM 4641  C CD1   . PHE I  3 48  ? 24.291  -35.311  -13.976 1.00 457.71 ? 61  PHE C CD1   1 
ATOM 4642  C CD2   . PHE I  3 48  ? 26.677  -34.940  -13.992 1.00 461.66 ? 61  PHE C CD2   1 
ATOM 4643  C CE1   . PHE I  3 48  ? 24.448  -36.196  -12.904 1.00 453.41 ? 61  PHE C CE1   1 
ATOM 4644  C CE2   . PHE I  3 48  ? 26.830  -35.816  -12.916 1.00 455.82 ? 61  PHE C CE2   1 
ATOM 4645  C CZ    . PHE I  3 48  ? 25.714  -36.444  -12.374 1.00 451.98 ? 61  PHE C CZ    1 
ATOM 4646  N N     . ALA I  3 49  ? 24.465  -32.064  -18.267 1.00 427.14 ? 62  ALA C N     1 
ATOM 4647  C CA    . ALA I  3 49  ? 24.310  -30.817  -19.024 1.00 414.29 ? 62  ALA C CA    1 
ATOM 4648  C C     . ALA I  3 49  ? 22.937  -30.700  -19.673 1.00 406.75 ? 62  ALA C C     1 
ATOM 4649  O O     . ALA I  3 49  ? 22.273  -29.674  -19.544 1.00 406.82 ? 62  ALA C O     1 
ATOM 4650  C CB    . ALA I  3 49  ? 25.388  -30.706  -20.084 1.00 411.34 ? 62  ALA C CB    1 
ATOM 4651  N N     . LYS I  3 50  ? 22.514  -31.746  -20.379 1.00 396.20 ? 63  LYS C N     1 
ATOM 4652  C CA    . LYS I  3 50  ? 21.200  -31.715  -21.011 1.00 390.83 ? 63  LYS C CA    1 
ATOM 4653  C C     . LYS I  3 50  ? 20.030  -31.734  -19.999 1.00 394.30 ? 63  LYS C C     1 
ATOM 4654  O O     . LYS I  3 50  ? 19.035  -31.067  -20.248 1.00 399.06 ? 63  LYS C O     1 
ATOM 4655  C CB    . LYS I  3 50  ? 21.056  -32.760  -22.141 1.00 380.06 ? 63  LYS C CB    1 
ATOM 4656  C CG    . LYS I  3 50  ? 21.715  -32.385  -23.463 1.00 370.50 ? 63  LYS C CG    1 
ATOM 4657  C CD    . LYS I  3 50  ? 21.438  -33.452  -24.536 1.00 360.63 ? 63  LYS C CD    1 
ATOM 4658  C CE    . LYS I  3 50  ? 22.248  -33.268  -25.815 1.00 354.40 ? 63  LYS C CE    1 
ATOM 4659  N NZ    . LYS I  3 50  ? 23.577  -33.931  -25.762 1.00 348.91 ? 63  LYS C NZ    1 
ATOM 4660  N N     . ASP I  3 51  ? 20.152  -32.436  -18.863 1.00 394.89 ? 64  ASP C N     1 
ATOM 4661  C CA    . ASP I  3 51  ? 19.153  -32.305  -17.773 1.00 396.95 ? 64  ASP C CA    1 
ATOM 4662  C C     . ASP I  3 51  ? 19.175  -30.924  -17.092 1.00 406.05 ? 64  ASP C C     1 
ATOM 4663  O O     . ASP I  3 51  ? 18.116  -30.375  -16.780 1.00 409.24 ? 64  ASP C O     1 
ATOM 4664  C CB    . ASP I  3 51  ? 19.273  -33.415  -16.711 1.00 384.31 ? 64  ASP C CB    1 
ATOM 4665  C CG    . ASP I  3 51  ? 18.408  -34.632  -17.021 1.00 376.34 ? 64  ASP C CG    1 
ATOM 4666  O OD1   . ASP I  3 51  ? 18.014  -34.798  -18.201 1.00 377.55 ? 64  ASP C OD1   1 
ATOM 4667  O OD2   . ASP I  3 51  ? 18.158  -35.433  -16.088 1.00 365.03 ? 64  ASP C OD2   1 
ATOM 4668  N N     . LEU I  3 52  ? 20.369  -30.374  -16.862 1.00 412.77 ? 65  LEU C N     1 
ATOM 4669  C CA    . LEU I  3 52  ? 20.508  -28.992  -16.370 1.00 418.33 ? 65  LEU C CA    1 
ATOM 4670  C C     . LEU I  3 52  ? 19.837  -27.984  -17.319 1.00 431.82 ? 65  LEU C C     1 
ATOM 4671  O O     . LEU I  3 52  ? 19.137  -27.064  -16.870 1.00 429.72 ? 65  LEU C O     1 
ATOM 4672  C CB    . LEU I  3 52  ? 21.985  -28.623  -16.167 1.00 411.07 ? 65  LEU C CB    1 
ATOM 4673  C CG    . LEU I  3 52  ? 22.736  -29.038  -14.901 1.00 404.09 ? 65  LEU C CG    1 
ATOM 4674  C CD1   . LEU I  3 52  ? 24.177  -28.572  -14.997 1.00 402.81 ? 65  LEU C CD1   1 
ATOM 4675  C CD2   . LEU I  3 52  ? 22.058  -28.465  -13.664 1.00 397.17 ? 65  LEU C CD2   1 
ATOM 4676  N N     . GLU I  3 53  ? 20.059  -28.180  -18.626 1.00 449.40 ? 66  GLU C N     1 
ATOM 4677  C CA    . GLU I  3 53  ? 19.418  -27.394  -19.700 1.00 469.98 ? 66  GLU C CA    1 
ATOM 4678  C C     . GLU I  3 53  ? 17.884  -27.484  -19.670 1.00 467.46 ? 66  GLU C C     1 
ATOM 4679  O O     . GLU I  3 53  ? 17.207  -26.448  -19.688 1.00 479.61 ? 66  GLU C O     1 
ATOM 4680  C CB    . GLU I  3 53  ? 19.958  -27.801  -21.095 1.00 485.45 ? 66  GLU C CB    1 
ATOM 4681  C CG    . GLU I  3 53  ? 19.294  -27.105  -22.303 1.00 508.86 ? 66  GLU C CG    1 
ATOM 4682  C CD    . GLU I  3 53  ? 18.451  -28.013  -23.216 1.00 516.84 ? 66  GLU C CD    1 
ATOM 4683  O OE1   . GLU I  3 53  ? 18.700  -29.247  -23.259 1.00 516.28 ? 66  GLU C OE1   1 
ATOM 4684  O OE2   . GLU I  3 53  ? 17.555  -27.475  -23.932 1.00 526.08 ? 66  GLU C OE2   1 
ATOM 4685  N N     . MET I  3 54  ? 17.360  -28.718  -19.634 1.00 450.50 ? 67  MET C N     1 
ATOM 4686  C CA    . MET I  3 54  ? 15.915  -29.002  -19.580 1.00 431.73 ? 67  MET C CA    1 
ATOM 4687  C C     . MET I  3 54  ? 15.289  -28.360  -18.357 1.00 416.87 ? 67  MET C C     1 
ATOM 4688  O O     . MET I  3 54  ? 14.146  -27.937  -18.409 1.00 412.31 ? 67  MET C O     1 
ATOM 4689  C CB    . MET I  3 54  ? 15.641  -30.514  -19.590 1.00 432.58 ? 67  MET C CB    1 
ATOM 4690  C CG    . MET I  3 54  ? 15.629  -31.141  -20.981 1.00 434.44 ? 67  MET C CG    1 
ATOM 4691  S SD    . MET I  3 54  ? 15.523  -32.945  -20.986 1.00 431.67 ? 67  MET C SD    1 
ATOM 4692  C CE    . MET I  3 54  ? 17.176  -33.445  -21.473 1.00 426.50 ? 67  MET C CE    1 
ATOM 4693  N N     . PHE I  3 55  ? 16.065  -28.286  -17.276 1.00 401.09 ? 68  PHE C N     1 
ATOM 4694  C CA    . PHE I  3 55  ? 15.670  -27.609  -16.046 1.00 390.44 ? 68  PHE C CA    1 
ATOM 4695  C C     . PHE I  3 55  ? 15.734  -26.078  -16.195 1.00 392.89 ? 68  PHE C C     1 
ATOM 4696  O O     . PHE I  3 55  ? 14.791  -25.383  -15.799 1.00 397.89 ? 68  PHE C O     1 
ATOM 4697  C CB    . PHE I  3 55  ? 16.512  -28.086  -14.839 1.00 380.03 ? 68  PHE C CB    1 
ATOM 4698  C CG    . PHE I  3 55  ? 16.398  -29.572  -14.536 1.00 370.68 ? 68  PHE C CG    1 
ATOM 4699  C CD1   . PHE I  3 55  ? 15.238  -30.298  -14.843 1.00 366.75 ? 68  PHE C CD1   1 
ATOM 4700  C CD2   . PHE I  3 55  ? 17.454  -30.244  -13.920 1.00 366.30 ? 68  PHE C CD2   1 
ATOM 4701  C CE1   . PHE I  3 55  ? 15.148  -31.660  -14.566 1.00 361.19 ? 68  PHE C CE1   1 
ATOM 4702  C CE2   . PHE I  3 55  ? 17.369  -31.603  -13.648 1.00 362.19 ? 68  PHE C CE2   1 
ATOM 4703  C CZ    . PHE I  3 55  ? 16.214  -32.313  -13.962 1.00 359.33 ? 68  PHE C CZ    1 
ATOM 4704  N N     . ALA I  3 56  ? 16.824  -25.561  -16.776 1.00 390.15 ? 69  ALA C N     1 
ATOM 4705  C CA    . ALA I  3 56  ? 17.041  -24.103  -16.916 1.00 389.86 ? 69  ALA C CA    1 
ATOM 4706  C C     . ALA I  3 56  ? 16.097  -23.427  -17.918 1.00 394.39 ? 69  ALA C C     1 
ATOM 4707  O O     . ALA I  3 56  ? 15.573  -22.332  -17.656 1.00 391.84 ? 69  ALA C O     1 
ATOM 4708  C CB    . ALA I  3 56  ? 18.487  -23.806  -17.275 1.00 386.85 ? 69  ALA C CB    1 
ATOM 4709  N N     . ARG I  3 57  ? 15.892  -24.078  -19.065 1.00 401.80 ? 70  ARG C N     1 
ATOM 4710  C CA    . ARG I  3 57  ? 14.954  -23.604  -20.092 1.00 411.04 ? 70  ARG C CA    1 
ATOM 4711  C C     . ARG I  3 57  ? 13.507  -23.866  -19.674 1.00 413.51 ? 70  ARG C C     1 
ATOM 4712  O O     . ARG I  3 57  ? 12.591  -23.126  -20.055 1.00 425.44 ? 70  ARG C O     1 
ATOM 4713  C CB    . ARG I  3 57  ? 15.290  -24.231  -21.465 1.00 411.24 ? 70  ARG C CB    1 
ATOM 4714  C CG    . ARG I  3 57  ? 14.190  -24.244  -22.520 1.00 410.07 ? 70  ARG C CG    1 
ATOM 4715  C CD    . ARG I  3 57  ? 14.780  -24.345  -23.923 1.00 406.30 ? 70  ARG C CD    1 
ATOM 4716  N NE    . ARG I  3 57  ? 15.055  -23.008  -24.446 1.00 406.35 ? 70  ARG C NE    1 
ATOM 4717  C CZ    . ARG I  3 57  ? 14.205  -22.295  -25.189 1.00 407.96 ? 70  ARG C CZ    1 
ATOM 4718  N NH1   . ARG I  3 57  ? 13.016  -22.789  -25.497 1.00 408.37 ? 70  ARG C NH1   1 
ATOM 4719  N NH2   . ARG I  3 57  ? 14.541  -21.087  -25.612 1.00 408.88 ? 70  ARG C NH2   1 
ATOM 4720  N N     . HIS I  3 58  ? 13.318  -24.897  -18.858 1.00 405.15 ? 71  HIS C N     1 
ATOM 4721  C CA    . HIS I  3 58  ? 11.994  -25.251  -18.335 1.00 394.48 ? 71  HIS C CA    1 
ATOM 4722  C C     . HIS I  3 58  ? 11.448  -24.288  -17.270 1.00 389.26 ? 71  HIS C C     1 
ATOM 4723  O O     . HIS I  3 58  ? 10.247  -24.305  -16.969 1.00 385.70 ? 71  HIS C O     1 
ATOM 4724  C CB    . HIS I  3 58  ? 12.034  -26.655  -17.770 1.00 388.32 ? 71  HIS C CB    1 
ATOM 4725  C CG    . HIS I  3 58  ? 10.702  -27.314  -17.700 1.00 383.30 ? 71  HIS C CG    1 
ATOM 4726  N ND1   . HIS I  3 58  ? 9.892   -27.468  -18.803 1.00 381.32 ? 71  HIS C ND1   1 
ATOM 4727  C CD2   . HIS I  3 58  ? 10.048  -27.891  -16.666 1.00 380.75 ? 71  HIS C CD2   1 
ATOM 4728  C CE1   . HIS I  3 58  ? 8.788   -28.095  -18.448 1.00 379.96 ? 71  HIS C CE1   1 
ATOM 4729  N NE2   . HIS I  3 58  ? 8.857   -28.363  -17.157 1.00 379.19 ? 71  HIS C NE2   1 
ATOM 4730  N N     . ALA I  3 59  ? 12.344  -23.454  -16.717 1.00 382.33 ? 72  ALA C N     1 
ATOM 4731  C CA    . ALA I  3 59  ? 12.028  -22.370  -15.756 1.00 375.45 ? 72  ALA C CA    1 
ATOM 4732  C C     . ALA I  3 59  ? 12.114  -20.951  -16.374 1.00 373.47 ? 72  ALA C C     1 
ATOM 4733  O O     . ALA I  3 59  ? 12.287  -19.957  -15.645 1.00 377.32 ? 72  ALA C O     1 
ATOM 4734  C CB    . ALA I  3 59  ? 12.942  -22.460  -14.522 1.00 376.23 ? 72  ALA C CB    1 
ATOM 4735  N N     . LYS I  3 60  ? 12.009  -20.864  -17.704 1.00 366.64 ? 73  LYS C N     1 
ATOM 4736  C CA    . LYS I  3 60  ? 12.099  -19.583  -18.448 1.00 365.53 ? 73  LYS C CA    1 
ATOM 4737  C C     . LYS I  3 60  ? 13.327  -18.721  -18.107 1.00 370.00 ? 73  LYS C C     1 
ATOM 4738  O O     . LYS I  3 60  ? 13.220  -17.505  -17.940 1.00 373.61 ? 73  LYS C O     1 
ATOM 4739  C CB    . LYS I  3 60  ? 10.814  -18.759  -18.294 1.00 361.63 ? 73  LYS C CB    1 
ATOM 4740  C CG    . LYS I  3 60  ? 9.602   -19.336  -19.013 1.00 356.65 ? 73  LYS C CG    1 
ATOM 4741  C CD    . LYS I  3 60  ? 8.282   -18.847  -18.426 1.00 355.55 ? 73  LYS C CD    1 
ATOM 4742  C CE    . LYS I  3 60  ? 7.895   -19.562  -17.131 1.00 351.39 ? 73  LYS C CE    1 
ATOM 4743  N NZ    . LYS I  3 60  ? 7.740   -21.036  -17.282 1.00 345.39 ? 73  LYS C NZ    1 
ATOM 4744  N N     . ARG I  3 61  ? 14.490  -19.350  -18.003 1.00 372.12 ? 74  ARG C N     1 
ATOM 4745  C CA    . ARG I  3 61  ? 15.731  -18.622  -17.777 1.00 377.69 ? 74  ARG C CA    1 
ATOM 4746  C C     . ARG I  3 61  ? 16.752  -19.055  -18.802 1.00 374.66 ? 74  ARG C C     1 
ATOM 4747  O O     . ARG I  3 61  ? 16.670  -20.161  -19.330 1.00 367.06 ? 74  ARG C O     1 
ATOM 4748  C CB    . ARG I  3 61  ? 16.274  -18.903  -16.382 1.00 383.25 ? 74  ARG C CB    1 
ATOM 4749  C CG    . ARG I  3 61  ? 15.537  -18.203  -15.259 1.00 391.67 ? 74  ARG C CG    1 
ATOM 4750  C CD    . ARG I  3 61  ? 16.221  -18.483  -13.930 1.00 393.23 ? 74  ARG C CD    1 
ATOM 4751  N NE    . ARG I  3 61  ? 15.829  -19.771  -13.346 1.00 390.01 ? 74  ARG C NE    1 
ATOM 4752  C CZ    . ARG I  3 61  ? 16.541  -20.897  -13.420 1.00 383.91 ? 74  ARG C CZ    1 
ATOM 4753  N NH1   . ARG I  3 61  ? 17.699  -20.917  -14.064 1.00 381.97 ? 74  ARG C NH1   1 
ATOM 4754  N NH2   . ARG I  3 61  ? 16.095  -22.008  -12.844 1.00 378.75 ? 74  ARG C NH2   1 
ATOM 4755  N N     . THR I  3 62  ? 17.718  -18.191  -19.088 1.00 379.25 ? 75  THR C N     1 
ATOM 4756  C CA    . THR I  3 62  ? 18.805  -18.585  -19.976 1.00 383.31 ? 75  THR C CA    1 
ATOM 4757  C C     . THR I  3 62  ? 19.993  -19.203  -19.204 1.00 388.00 ? 75  THR C C     1 
ATOM 4758  O O     . THR I  3 62  ? 20.748  -19.996  -19.766 1.00 386.71 ? 75  THR C O     1 
ATOM 4759  C CB    . THR I  3 62  ? 19.230  -17.462  -20.968 1.00 385.36 ? 75  THR C CB    1 
ATOM 4760  O OG1   . THR I  3 62  ? 19.851  -16.378  -20.270 1.00 384.84 ? 75  THR C OG1   1 
ATOM 4761  C CG2   . THR I  3 62  ? 18.028  -16.935  -21.752 1.00 387.02 ? 75  THR C CG2   1 
ATOM 4762  N N     . THR I  3 63  ? 20.138  -18.880  -17.918 1.00 398.87 ? 76  THR C N     1 
ATOM 4763  C CA    . THR I  3 63  ? 21.248  -19.432  -17.134 1.00 408.40 ? 76  THR C CA    1 
ATOM 4764  C C     . THR I  3 63  ? 20.775  -20.373  -16.038 1.00 410.85 ? 76  THR C C     1 
ATOM 4765  O O     . THR I  3 63  ? 19.857  -20.066  -15.287 1.00 412.74 ? 76  THR C O     1 
ATOM 4766  C CB    . THR I  3 63  ? 22.160  -18.347  -16.504 1.00 414.60 ? 76  THR C CB    1 
ATOM 4767  O OG1   . THR I  3 63  ? 21.460  -17.669  -15.456 1.00 423.94 ? 76  THR C OG1   1 
ATOM 4768  C CG2   . THR I  3 63  ? 22.651  -17.334  -17.545 1.00 416.23 ? 76  THR C CG2   1 
ATOM 4769  N N     . ILE I  3 64  ? 21.435  -21.519  -15.967 1.00 414.93 ? 77  ILE C N     1 
ATOM 4770  C CA    . ILE I  3 64  ? 21.312  -22.448  -14.855 1.00 422.28 ? 77  ILE C CA    1 
ATOM 4771  C C     . ILE I  3 64  ? 21.766  -21.759  -13.546 1.00 447.34 ? 77  ILE C C     1 
ATOM 4772  O O     . ILE I  3 64  ? 22.801  -21.087  -13.532 1.00 463.54 ? 77  ILE C O     1 
ATOM 4773  C CB    . ILE I  3 64  ? 22.210  -23.685  -15.107 1.00 404.71 ? 77  ILE C CB    1 
ATOM 4774  C CG1   . ILE I  3 64  ? 21.906  -24.336  -16.463 1.00 392.55 ? 77  ILE C CG1   1 
ATOM 4775  C CG2   . ILE I  3 64  ? 22.107  -24.693  -13.969 1.00 399.69 ? 77  ILE C CG2   1 
ATOM 4776  C CD1   . ILE I  3 64  ? 22.991  -25.287  -16.934 1.00 381.79 ? 77  ILE C CD1   1 
ATOM 4777  N N     . ASN I  3 65  ? 21.004  -21.931  -12.456 1.00 463.39 ? 78  ASN C N     1 
ATOM 4778  C CA    . ASN I  3 65  ? 21.435  -21.497  -11.096 1.00 474.40 ? 78  ASN C CA    1 
ATOM 4779  C C     . ASN I  3 65  ? 21.589  -22.639  -10.050 1.00 488.89 ? 78  ASN C C     1 
ATOM 4780  O O     . ASN I  3 65  ? 21.543  -23.828  -10.409 1.00 506.08 ? 78  ASN C O     1 
ATOM 4781  C CB    . ASN I  3 65  ? 20.577  -20.316  -10.562 1.00 458.11 ? 78  ASN C CB    1 
ATOM 4782  C CG    . ASN I  3 65  ? 19.095  -20.657  -10.420 1.00 447.01 ? 78  ASN C CG    1 
ATOM 4783  O OD1   . ASN I  3 65  ? 18.720  -21.774  -10.043 1.00 439.47 ? 78  ASN C OD1   1 
ATOM 4784  N ND2   . ASN I  3 65  ? 18.243  -19.674  -10.698 1.00 443.62 ? 78  ASN C ND2   1 
ATOM 4785  N N     . THR I  3 66  ? 21.787  -22.281  -8.776  1.00 493.99 ? 79  THR C N     1 
ATOM 4786  C CA    . THR I  3 66  ? 21.995  -23.257  -7.677  1.00 494.47 ? 79  THR C CA    1 
ATOM 4787  C C     . THR I  3 66  ? 20.916  -24.364  -7.545  1.00 495.48 ? 79  THR C C     1 
ATOM 4788  O O     . THR I  3 66  ? 21.214  -25.514  -7.168  1.00 490.42 ? 79  THR C O     1 
ATOM 4789  C CB    . THR I  3 66  ? 22.137  -22.537  -6.317  1.00 494.71 ? 79  THR C CB    1 
ATOM 4790  O OG1   . THR I  3 66  ? 20.956  -21.779  -6.046  1.00 497.17 ? 79  THR C OG1   1 
ATOM 4791  C CG2   . THR I  3 66  ? 23.335  -21.597  -6.328  1.00 494.82 ? 79  THR C CG2   1 
ATOM 4792  N N     . GLU I  3 67  ? 19.670  -24.003  -7.849  1.00 497.75 ? 80  GLU C N     1 
ATOM 4793  C CA    . GLU I  3 67  ? 18.530  -24.909  -7.682  1.00 493.52 ? 80  GLU C CA    1 
ATOM 4794  C C     . GLU I  3 67  ? 18.448  -26.046  -8.709  1.00 485.35 ? 80  GLU C C     1 
ATOM 4795  O O     . GLU I  3 67  ? 17.936  -27.114  -8.368  1.00 490.43 ? 80  GLU C O     1 
ATOM 4796  C CB    . GLU I  3 67  ? 17.203  -24.137  -7.610  1.00 497.94 ? 80  GLU C CB    1 
ATOM 4797  C CG    . GLU I  3 67  ? 17.194  -23.010  -6.578  1.00 508.30 ? 80  GLU C CG    1 
ATOM 4798  C CD    . GLU I  3 67  ? 17.610  -23.437  -5.179  1.00 513.77 ? 80  GLU C CD    1 
ATOM 4799  O OE1   . GLU I  3 67  ? 18.419  -22.713  -4.556  1.00 518.49 ? 80  GLU C OE1   1 
ATOM 4800  O OE2   . GLU I  3 67  ? 17.131  -24.479  -4.695  1.00 517.20 ? 80  GLU C OE2   1 
ATOM 4801  N N     . ASP I  3 68  ? 18.940  -25.827  -9.938  1.00 472.05 ? 81  ASP C N     1 
ATOM 4802  C CA    . ASP I  3 68  ? 18.992  -26.885  -10.976 1.00 451.30 ? 81  ASP C CA    1 
ATOM 4803  C C     . ASP I  3 68  ? 20.003  -28.002  -10.643 1.00 442.86 ? 81  ASP C C     1 
ATOM 4804  O O     . ASP I  3 68  ? 19.739  -29.186  -10.897 1.00 445.71 ? 81  ASP C O     1 
ATOM 4805  C CB    . ASP I  3 68  ? 19.269  -26.297  -12.374 1.00 440.46 ? 81  ASP C CB    1 
ATOM 4806  C CG    . ASP I  3 68  ? 18.144  -25.387  -12.870 1.00 434.76 ? 81  ASP C CG    1 
ATOM 4807  O OD1   . ASP I  3 68  ? 16.964  -25.648  -12.549 1.00 428.50 ? 81  ASP C OD1   1 
ATOM 4808  O OD2   . ASP I  3 68  ? 18.425  -24.407  -13.594 1.00 430.18 ? 81  ASP C OD2   1 
ATOM 4809  N N     . VAL I  3 69  ? 21.143  -27.609  -10.061 1.00 431.53 ? 82  VAL C N     1 
ATOM 4810  C CA    . VAL I  3 69  ? 22.211  -28.539  -9.652  1.00 419.59 ? 82  VAL C CA    1 
ATOM 4811  C C     . VAL I  3 69  ? 21.870  -29.377  -8.401  1.00 429.11 ? 82  VAL C C     1 
ATOM 4812  O O     . VAL I  3 69  ? 22.178  -30.574  -8.364  1.00 436.44 ? 82  VAL C O     1 
ATOM 4813  C CB    . VAL I  3 69  ? 23.551  -27.803  -9.426  1.00 406.56 ? 82  VAL C CB    1 
ATOM 4814  C CG1   . VAL I  3 69  ? 24.644  -28.778  -9.021  1.00 396.85 ? 82  VAL C CG1   1 
ATOM 4815  C CG2   . VAL I  3 69  ? 23.945  -27.031  -10.672 1.00 399.75 ? 82  VAL C CG2   1 
ATOM 4816  N N     . LYS I  3 70  ? 21.262  -28.751  -7.382  1.00 433.12 ? 83  LYS C N     1 
ATOM 4817  C CA    . LYS I  3 70  ? 20.758  -29.465  -6.184  1.00 434.70 ? 83  LYS C CA    1 
ATOM 4818  C C     . LYS I  3 70  ? 19.579  -30.391  -6.514  1.00 450.47 ? 83  LYS C C     1 
ATOM 4819  O O     . LYS I  3 70  ? 19.398  -31.439  -5.874  1.00 451.17 ? 83  LYS C O     1 
ATOM 4820  C CB    . LYS I  3 70  ? 20.350  -28.492  -5.083  1.00 416.20 ? 83  LYS C CB    1 
ATOM 4821  C CG    . LYS I  3 70  ? 21.519  -27.868  -4.343  1.00 400.69 ? 83  LYS C CG    1 
ATOM 4822  C CD    . LYS I  3 70  ? 21.232  -27.816  -2.859  1.00 389.78 ? 83  LYS C CD    1 
ATOM 4823  C CE    . LYS I  3 70  ? 19.985  -26.997  -2.587  1.00 387.57 ? 83  LYS C CE    1 
ATOM 4824  N NZ    . LYS I  3 70  ? 19.909  -26.527  -1.181  1.00 383.90 ? 83  LYS C NZ    1 
ATOM 4825  N N     . LEU I  3 71  ? 18.781  -29.983  -7.509  1.00 471.59 ? 84  LEU C N     1 
ATOM 4826  C CA    . LEU I  3 71  ? 17.720  -30.824  -8.106  1.00 482.25 ? 84  LEU C CA    1 
ATOM 4827  C C     . LEU I  3 71  ? 18.302  -32.051  -8.844  1.00 480.82 ? 84  LEU C C     1 
ATOM 4828  O O     . LEU I  3 71  ? 17.625  -33.087  -8.957  1.00 478.77 ? 84  LEU C O     1 
ATOM 4829  C CB    . LEU I  3 71  ? 16.827  -30.001  -9.068  1.00 491.65 ? 84  LEU C CB    1 
ATOM 4830  C CG    . LEU I  3 71  ? 15.490  -30.601  -9.563  1.00 491.74 ? 84  LEU C CG    1 
ATOM 4831  C CD1   . LEU I  3 71  ? 14.453  -30.648  -8.449  1.00 488.96 ? 84  LEU C CD1   1 
ATOM 4832  C CD2   . LEU I  3 71  ? 14.939  -29.881  -10.788 1.00 492.86 ? 84  LEU C CD2   1 
ATOM 4833  N N     . LEU I  3 72  ? 19.542  -31.920  -9.341  1.00 475.86 ? 85  LEU C N     1 
ATOM 4834  C CA    . LEU I  3 72  ? 20.254  -32.993  -10.083 1.00 456.39 ? 85  LEU C CA    1 
ATOM 4835  C C     . LEU I  3 72  ? 20.828  -34.130  -9.176  1.00 439.52 ? 85  LEU C C     1 
ATOM 4836  O O     . LEU I  3 72  ? 21.165  -35.222  -9.660  1.00 441.33 ? 85  LEU C O     1 
ATOM 4837  C CB    . LEU I  3 72  ? 21.327  -32.372  -11.005 1.00 454.10 ? 85  LEU C CB    1 
ATOM 4838  C CG    . LEU I  3 72  ? 21.664  -33.023  -12.354 1.00 445.90 ? 85  LEU C CG    1 
ATOM 4839  C CD1   . LEU I  3 72  ? 20.432  -33.298  -13.203 1.00 440.29 ? 85  LEU C CD1   1 
ATOM 4840  C CD2   . LEU I  3 72  ? 22.638  -32.148  -13.116 1.00 446.49 ? 85  LEU C CD2   1 
ATOM 4841  N N     . ALA I  3 73  ? 20.899  -33.860  -7.869  1.00 418.29 ? 86  ALA C N     1 
ATOM 4842  C CA    . ALA I  3 73  ? 21.254  -34.847  -6.845  1.00 395.47 ? 86  ALA C CA    1 
ATOM 4843  C C     . ALA I  3 73  ? 20.012  -35.355  -6.071  1.00 385.43 ? 86  ALA C C     1 
ATOM 4844  O O     . ALA I  3 73  ? 20.068  -35.508  -4.847  1.00 384.11 ? 86  ALA C O     1 
ATOM 4845  C CB    . ALA I  3 73  ? 22.255  -34.228  -5.888  1.00 393.13 ? 86  ALA C CB    1 
ATOM 4846  N N     . ARG I  3 74  ? 18.922  -35.654  -6.796  1.00 376.41 ? 87  ARG C N     1 
ATOM 4847  C CA    . ARG I  3 74  ? 17.552  -35.827  -6.222  1.00 372.38 ? 87  ARG C CA    1 
ATOM 4848  C C     . ARG I  3 74  ? 17.122  -37.183  -5.605  1.00 371.76 ? 87  ARG C C     1 
ATOM 4849  O O     . ARG I  3 74  ? 16.460  -37.194  -4.566  1.00 373.68 ? 87  ARG C O     1 
ATOM 4850  C CB    . ARG I  3 74  ? 16.456  -35.318  -7.200  1.00 369.23 ? 87  ARG C CB    1 
ATOM 4851  C CG    . ARG I  3 74  ? 16.116  -36.248  -8.367  1.00 366.15 ? 87  ARG C CG    1 
ATOM 4852  C CD    . ARG I  3 74  ? 15.447  -35.523  -9.543  1.00 366.27 ? 87  ARG C CD    1 
ATOM 4853  N NE    . ARG I  3 74  ? 16.317  -35.304  -10.718 1.00 363.86 ? 87  ARG C NE    1 
ATOM 4854  C CZ    . ARG I  3 74  ? 16.169  -35.901  -11.912 1.00 359.18 ? 87  ARG C CZ    1 
ATOM 4855  N NH1   . ARG I  3 74  ? 15.193  -36.782  -12.116 1.00 357.54 ? 87  ARG C NH1   1 
ATOM 4856  N NH2   . ARG I  3 74  ? 17.007  -35.639  -12.915 1.00 354.67 ? 87  ARG C NH2   1 
ATOM 4857  N N     . ARG I  3 75  ? 17.454  -38.322  -6.215  1.00 372.18 ? 88  ARG C N     1 
ATOM 4858  C CA    . ARG I  3 75  ? 16.857  -39.575  -5.718  1.00 380.41 ? 88  ARG C CA    1 
ATOM 4859  C C     . ARG I  3 75  ? 17.549  -40.314  -4.582  1.00 399.66 ? 88  ARG C C     1 
ATOM 4860  O O     . ARG I  3 75  ? 17.034  -41.317  -4.097  1.00 398.21 ? 88  ARG C O     1 
ATOM 4861  C CB    . ARG I  3 75  ? 16.451  -40.510  -6.839  1.00 373.46 ? 88  ARG C CB    1 
ATOM 4862  C CG    . ARG I  3 75  ? 14.998  -40.297  -7.186  1.00 377.61 ? 88  ARG C CG    1 
ATOM 4863  C CD    . ARG I  3 75  ? 14.637  -41.054  -8.433  1.00 391.04 ? 88  ARG C CD    1 
ATOM 4864  N NE    . ARG I  3 75  ? 14.889  -40.252  -9.618  1.00 414.31 ? 88  ARG C NE    1 
ATOM 4865  C CZ    . ARG I  3 75  ? 15.290  -40.752  -10.779 1.00 431.44 ? 88  ARG C CZ    1 
ATOM 4866  N NH1   . ARG I  3 75  ? 15.506  -42.055  -10.892 1.00 435.58 ? 88  ARG C NH1   1 
ATOM 4867  N NH2   . ARG I  3 75  ? 15.490  -39.942  -11.815 1.00 444.01 ? 88  ARG C NH2   1 
ATOM 4868  N N     . SER I  3 76  ? 18.691  -39.802  -4.125  1.00 436.26 ? 89  SER C N     1 
ATOM 4869  C CA    . SER I  3 76  ? 19.286  -40.286  -2.861  1.00 476.69 ? 89  SER C CA    1 
ATOM 4870  C C     . SER I  3 76  ? 19.319  -39.281  -1.675  1.00 488.32 ? 89  SER C C     1 
ATOM 4871  O O     . SER I  3 76  ? 19.661  -38.096  -1.846  1.00 496.30 ? 89  SER C O     1 
ATOM 4872  C CB    . SER I  3 76  ? 20.665  -40.936  -3.091  1.00 494.08 ? 89  SER C CB    1 
ATOM 4873  O OG    . SER I  3 76  ? 21.579  -40.047  -3.700  1.00 510.61 ? 89  SER C OG    1 
ATOM 4874  N N     . ASN I  3 77  ? 18.976  -39.785  -0.479  1.00 491.03 ? 90  ASN C N     1 
ATOM 4875  C CA    . ASN I  3 77  ? 18.969  -39.029  0.798   1.00 488.73 ? 90  ASN C CA    1 
ATOM 4876  C C     . ASN I  3 77  ? 20.322  -38.488  1.239   1.00 483.42 ? 90  ASN C C     1 
ATOM 4877  O O     . ASN I  3 77  ? 20.401  -37.382  1.717   1.00 479.42 ? 90  ASN C O     1 
ATOM 4878  C CB    . ASN I  3 77  ? 18.453  -39.889  1.958   1.00 494.41 ? 90  ASN C CB    1 
ATOM 4879  C CG    . ASN I  3 77  ? 16.956  -40.154  1.894   1.00 499.15 ? 90  ASN C CG    1 
ATOM 4880  O OD1   . ASN I  3 77  ? 16.456  -40.806  0.966   1.00 501.83 ? 90  ASN C OD1   1 
ATOM 4881  N ND2   . ASN I  3 77  ? 16.233  -39.682  2.907   1.00 501.95 ? 90  ASN C ND2   1 
ATOM 4882  N N     . SER I  3 78  ? 21.370  -39.302  1.124   1.00 479.65 ? 91  SER C N     1 
ATOM 4883  C CA    . SER I  3 78  ? 22.731  -38.933  1.544   1.00 475.27 ? 91  SER C CA    1 
ATOM 4884  C C     . SER I  3 78  ? 23.418  -37.870  0.659   1.00 467.03 ? 91  SER C C     1 
ATOM 4885  O O     . SER I  3 78  ? 24.332  -37.164  1.114   1.00 462.43 ? 91  SER C O     1 
ATOM 4886  C CB    . SER I  3 78  ? 23.607  -40.196  1.632   1.00 476.49 ? 91  SER C CB    1 
ATOM 4887  O OG    . SER I  3 78  ? 23.763  -40.845  0.374   1.00 481.01 ? 91  SER C OG    1 
ATOM 4888  N N     . LEU I  3 79  ? 22.994  -37.795  -0.604  1.00 454.86 ? 92  LEU C N     1 
ATOM 4889  C CA    . LEU I  3 79  ? 23.515  -36.825  -1.570  1.00 437.11 ? 92  LEU C CA    1 
ATOM 4890  C C     . LEU I  3 79  ? 22.930  -35.465  -1.206  1.00 434.53 ? 92  LEU C C     1 
ATOM 4891  O O     . LEU I  3 79  ? 23.678  -34.485  -1.169  1.00 439.15 ? 92  LEU C O     1 
ATOM 4892  C CB    . LEU I  3 79  ? 23.185  -37.218  -3.031  1.00 421.68 ? 92  LEU C CB    1 
ATOM 4893  C CG    . LEU I  3 79  ? 24.325  -37.335  -4.069  1.00 406.00 ? 92  LEU C CG    1 
ATOM 4894  C CD1   . LEU I  3 79  ? 23.834  -37.711  -5.468  1.00 394.18 ? 92  LEU C CD1   1 
ATOM 4895  C CD2   . LEU I  3 79  ? 25.178  -36.075  -4.124  1.00 404.52 ? 92  LEU C CD2   1 
ATOM 4896  N N     . LEU I  3 80  ? 21.615  -35.439  -0.919  1.00 423.30 ? 93  LEU C N     1 
ATOM 4897  C CA    . LEU I  3 80  ? 20.910  -34.300  -0.285  1.00 411.52 ? 93  LEU C CA    1 
ATOM 4898  C C     . LEU I  3 80  ? 21.683  -33.746  0.920   1.00 410.11 ? 93  LEU C C     1 
ATOM 4899  O O     . LEU I  3 80  ? 22.003  -32.558  0.942   1.00 418.31 ? 93  LEU C O     1 
ATOM 4900  C CB    . LEU I  3 80  ? 19.431  -34.654  0.094   1.00 399.13 ? 93  LEU C CB    1 
ATOM 4901  C CG    . LEU I  3 80  ? 18.548  -34.069  1.245   1.00 391.60 ? 93  LEU C CG    1 
ATOM 4902  C CD1   . LEU I  3 80  ? 18.189  -32.572  1.184   1.00 392.76 ? 93  LEU C CD1   1 
ATOM 4903  C CD2   . LEU I  3 80  ? 17.264  -34.876  1.372   1.00 383.32 ? 93  LEU C CD2   1 
ATOM 4904  N N     . LYS I  3 81  ? 21.986  -34.624  1.886   1.00 400.11 ? 94  LYS C N     1 
ATOM 4905  C CA    . LYS I  3 81  ? 22.643  -34.291  3.167   1.00 389.38 ? 94  LYS C CA    1 
ATOM 4906  C C     . LYS I  3 81  ? 23.968  -33.579  2.934   1.00 380.14 ? 94  LYS C C     1 
ATOM 4907  O O     . LYS I  3 81  ? 24.170  -32.439  3.350   1.00 383.39 ? 94  LYS C O     1 
ATOM 4908  C CB    . LYS I  3 81  ? 22.904  -35.592  3.957   1.00 388.35 ? 94  LYS C CB    1 
ATOM 4909  C CG    . LYS I  3 81  ? 22.673  -35.552  5.464   1.00 387.21 ? 94  LYS C CG    1 
ATOM 4910  C CD    . LYS I  3 81  ? 22.722  -36.961  6.049   1.00 380.29 ? 94  LYS C CD    1 
ATOM 4911  C CE    . LYS I  3 81  ? 21.575  -37.221  7.017   1.00 373.95 ? 94  LYS C CE    1 
ATOM 4912  N NZ    . LYS I  3 81  ? 21.839  -36.775  8.416   1.00 370.00 ? 94  LYS C NZ    1 
ATOM 4913  N N     . TYR I  3 82  ? 24.845  -34.286  2.235   1.00 365.76 ? 95  TYR C N     1 
ATOM 4914  C CA    . TYR I  3 82  ? 26.213  -33.882  1.978   1.00 357.29 ? 95  TYR C CA    1 
ATOM 4915  C C     . TYR I  3 82  ? 26.323  -32.635  1.078   1.00 363.40 ? 95  TYR C C     1 
ATOM 4916  O O     . TYR I  3 82  ? 27.144  -31.749  1.319   1.00 362.62 ? 95  TYR C O     1 
ATOM 4917  C CB    . TYR I  3 82  ? 26.912  -35.078  1.339   1.00 345.83 ? 95  TYR C CB    1 
ATOM 4918  C CG    . TYR I  3 82  ? 28.403  -34.986  1.263   1.00 339.36 ? 95  TYR C CG    1 
ATOM 4919  C CD1   . TYR I  3 82  ? 29.017  -34.276  0.233   1.00 340.04 ? 95  TYR C CD1   1 
ATOM 4920  C CD2   . TYR I  3 82  ? 29.213  -35.636  2.200   1.00 334.83 ? 95  TYR C CD2   1 
ATOM 4921  C CE1   . TYR I  3 82  ? 30.400  -34.191  0.142   1.00 337.86 ? 95  TYR C CE1   1 
ATOM 4922  C CE2   . TYR I  3 82  ? 30.603  -35.558  2.116   1.00 334.24 ? 95  TYR C CE2   1 
ATOM 4923  C CZ    . TYR I  3 82  ? 31.191  -34.832  1.085   1.00 335.56 ? 95  TYR C CZ    1 
ATOM 4924  O OH    . TYR I  3 82  ? 32.564  -34.737  0.971   1.00 334.90 ? 95  TYR C OH    1 
ATOM 4925  N N     . ILE I  3 83  ? 25.489  -32.569  0.046   1.00 371.05 ? 96  ILE C N     1 
ATOM 4926  C CA    . ILE I  3 83  ? 25.586  -31.494  -0.953  1.00 380.69 ? 96  ILE C CA    1 
ATOM 4927  C C     . ILE I  3 83  ? 24.967  -30.166  -0.484  1.00 396.74 ? 96  ILE C C     1 
ATOM 4928  O O     . ILE I  3 83  ? 25.496  -29.084  -0.801  1.00 397.85 ? 96  ILE C O     1 
ATOM 4929  C CB    . ILE I  3 83  ? 25.081  -31.964  -2.352  1.00 375.06 ? 96  ILE C CB    1 
ATOM 4930  C CG1   . ILE I  3 83  ? 26.162  -32.808  -3.056  1.00 372.85 ? 96  ILE C CG1   1 
ATOM 4931  C CG2   . ILE I  3 83  ? 24.592  -30.814  -3.236  1.00 373.62 ? 96  ILE C CG2   1 
ATOM 4932  C CD1   . ILE I  3 83  ? 27.453  -32.085  -3.409  1.00 372.52 ? 96  ILE C CD1   1 
ATOM 4933  N N     . THR I  3 84  ? 23.874  -30.237  0.284   1.00 416.48 ? 97  THR C N     1 
ATOM 4934  C CA    . THR I  3 84  ? 23.337  -29.017  0.926   1.00 434.30 ? 97  THR C CA    1 
ATOM 4935  C C     . THR I  3 84  ? 24.363  -28.434  1.922   1.00 440.84 ? 97  THR C C     1 
ATOM 4936  O O     . THR I  3 84  ? 24.501  -27.205  2.007   1.00 448.54 ? 97  THR C O     1 
ATOM 4937  C CB    . THR I  3 84  ? 21.933  -29.189  1.590   1.00 437.08 ? 97  THR C CB    1 
ATOM 4938  O OG1   . THR I  3 84  ? 21.982  -30.170  2.637   1.00 439.38 ? 97  THR C OG1   1 
ATOM 4939  C CG2   . THR I  3 84  ? 20.861  -29.574  0.556   1.00 435.55 ? 97  THR C CG2   1 
ATOM 4940  N N     . ASP I  3 85  ? 25.073  -29.322  2.646   1.00 432.07 ? 98  ASP C N     1 
ATOM 4941  C CA    . ASP I  3 85  ? 26.212  -28.957  3.524   1.00 419.63 ? 98  ASP C CA    1 
ATOM 4942  C C     . ASP I  3 85  ? 27.227  -28.144  2.727   1.00 409.34 ? 98  ASP C C     1 
ATOM 4943  O O     . ASP I  3 85  ? 27.576  -27.026  3.120   1.00 410.79 ? 98  ASP C O     1 
ATOM 4944  C CB    . ASP I  3 85  ? 26.905  -30.193  4.141   1.00 414.39 ? 98  ASP C CB    1 
ATOM 4945  C CG    . ASP I  3 85  ? 26.083  -30.860  5.249   1.00 410.92 ? 98  ASP C CG    1 
ATOM 4946  O OD1   . ASP I  3 85  ? 25.009  -30.339  5.642   1.00 413.28 ? 98  ASP C OD1   1 
ATOM 4947  O OD2   . ASP I  3 85  ? 26.510  -31.928  5.732   1.00 403.25 ? 98  ASP C OD2   1 
ATOM 4948  N N     . LYS I  3 86  ? 27.659  -28.713  1.599   1.00 390.00 ? 99  LYS C N     1 
ATOM 4949  C CA    . LYS I  3 86  ? 28.588  -28.073  0.668   1.00 377.48 ? 99  LYS C CA    1 
ATOM 4950  C C     . LYS I  3 86  ? 28.038  -26.802  -0.014  1.00 380.68 ? 99  LYS C C     1 
ATOM 4951  O O     . LYS I  3 86  ? 28.818  -25.915  -0.375  1.00 384.71 ? 99  LYS C O     1 
ATOM 4952  C CB    . LYS I  3 86  ? 29.090  -29.086  -0.367  1.00 364.21 ? 99  LYS C CB    1 
ATOM 4953  C CG    . LYS I  3 86  ? 30.353  -29.817  0.066   1.00 359.03 ? 99  LYS C CG    1 
ATOM 4954  C CD    . LYS I  3 86  ? 30.112  -30.739  1.241   1.00 357.31 ? 99  LYS C CD    1 
ATOM 4955  C CE    . LYS I  3 86  ? 31.417  -31.223  1.841   1.00 358.48 ? 99  LYS C CE    1 
ATOM 4956  N NZ    . LYS I  3 86  ? 32.137  -30.095  2.489   1.00 363.20 ? 99  LYS C NZ    1 
ATOM 4957  N N     . SER I  3 87  ? 26.713  -26.707  -0.174  1.00 380.67 ? 100 SER C N     1 
ATOM 4958  C CA    . SER I  3 87  ? 26.076  -25.508  -0.749  1.00 380.04 ? 100 SER C CA    1 
ATOM 4959  C C     . SER I  3 87  ? 26.032  -24.326  0.239   1.00 380.15 ? 100 SER C C     1 
ATOM 4960  O O     . SER I  3 87  ? 26.119  -23.168  -0.165  1.00 379.14 ? 100 SER C O     1 
ATOM 4961  C CB    . SER I  3 87  ? 24.676  -25.822  -1.283  1.00 377.98 ? 100 SER C CB    1 
ATOM 4962  O OG    . SER I  3 87  ? 23.711  -25.728  -0.255  1.00 376.92 ? 100 SER C OG    1 
ATOM 4963  N N     . GLU I  3 88  ? 25.892  -24.619  1.531   1.00 378.84 ? 101 GLU C N     1 
ATOM 4964  C CA    . GLU I  3 88  ? 25.990  -23.590  2.582   1.00 383.23 ? 101 GLU C CA    1 
ATOM 4965  C C     . GLU I  3 88  ? 27.444  -23.131  2.836   1.00 394.49 ? 101 GLU C C     1 
ATOM 4966  O O     . GLU I  3 88  ? 27.694  -21.982  3.248   1.00 398.69 ? 101 GLU C O     1 
ATOM 4967  C CB    . GLU I  3 88  ? 25.337  -24.082  3.881   1.00 376.50 ? 101 GLU C CB    1 
ATOM 4968  C CG    . GLU I  3 88  ? 23.866  -23.718  4.043   1.00 374.92 ? 101 GLU C CG    1 
ATOM 4969  C CD    . GLU I  3 88  ? 23.189  -24.461  5.189   1.00 372.94 ? 101 GLU C CD    1 
ATOM 4970  O OE1   . GLU I  3 88  ? 23.752  -24.509  6.309   1.00 370.58 ? 101 GLU C OE1   1 
ATOM 4971  O OE2   . GLU I  3 88  ? 22.071  -24.995  4.985   1.00 373.69 ? 101 GLU C OE2   1 
ATOM 4972  N N     . GLU I  3 89  ? 28.391  -24.035  2.574   1.00 406.16 ? 102 GLU C N     1 
ATOM 4973  C CA    . GLU I  3 89  ? 29.837  -23.762  2.682   1.00 422.70 ? 102 GLU C CA    1 
ATOM 4974  C C     . GLU I  3 89  ? 30.355  -22.884  1.526   1.00 436.90 ? 102 GLU C C     1 
ATOM 4975  O O     . GLU I  3 89  ? 31.166  -21.975  1.743   1.00 446.22 ? 102 GLU C O     1 
ATOM 4976  C CB    . GLU I  3 89  ? 30.625  -25.086  2.736   1.00 415.81 ? 102 GLU C CB    1 
ATOM 4977  C CG    . GLU I  3 89  ? 32.145  -24.962  2.888   1.00 412.92 ? 102 GLU C CG    1 
ATOM 4978  C CD    . GLU I  3 89  ? 32.911  -25.941  2.013   1.00 406.00 ? 102 GLU C CD    1 
ATOM 4979  O OE1   . GLU I  3 89  ? 33.679  -25.484  1.135   1.00 401.72 ? 102 GLU C OE1   1 
ATOM 4980  O OE2   . GLU I  3 89  ? 32.745  -27.166  2.201   1.00 403.22 ? 102 GLU C OE2   1 
ATOM 4981  N N     . ILE I  3 90  ? 29.907  -23.170  0.301   1.00 445.13 ? 103 ILE C N     1 
ATOM 4982  C CA    . ILE I  3 90  ? 30.332  -22.382  -0.873  1.00 451.03 ? 103 ILE C CA    1 
ATOM 4983  C C     . ILE I  3 90  ? 29.568  -21.022  -0.938  1.00 455.54 ? 103 ILE C C     1 
ATOM 4984  O O     . ILE I  3 90  ? 30.069  -20.051  -1.520  1.00 461.74 ? 103 ILE C O     1 
ATOM 4985  C CB    . ILE I  3 90  ? 30.323  -23.207  -2.208  1.00 446.50 ? 103 ILE C CB    1 
ATOM 4986  C CG1   . ILE I  3 90  ? 31.290  -24.406  -2.124  1.00 437.76 ? 103 ILE C CG1   1 
ATOM 4987  C CG2   . ILE I  3 90  ? 30.706  -22.334  -3.405  1.00 450.07 ? 103 ILE C CG2   1 
ATOM 4988  C CD1   . ILE I  3 90  ? 30.877  -25.607  -2.952  1.00 427.93 ? 103 ILE C CD1   1 
ATOM 4989  N N     . ALA I  3 91  ? 28.383  -20.954  -0.313  1.00 450.81 ? 104 ALA C N     1 
ATOM 4990  C CA    . ALA I  3 91  ? 27.686  -19.675  -0.046  1.00 448.50 ? 104 ALA C CA    1 
ATOM 4991  C C     . ALA I  3 91  ? 28.449  -18.759  0.933   1.00 450.03 ? 104 ALA C C     1 
ATOM 4992  O O     . ALA I  3 91  ? 28.335  -17.542  0.837   1.00 461.91 ? 104 ALA C O     1 
ATOM 4993  C CB    . ALA I  3 91  ? 26.245  -19.907  0.415   1.00 443.60 ? 104 ALA C CB    1 
ATOM 4994  N N     . GLN I  3 92  ? 29.218  -19.338  1.865   1.00 439.23 ? 105 GLN C N     1 
ATOM 4995  C CA    . GLN I  3 92  ? 30.235  -18.603  2.658   1.00 432.11 ? 105 GLN C CA    1 
ATOM 4996  C C     . GLN I  3 92  ? 31.396  -17.985  1.814   1.00 437.19 ? 105 GLN C C     1 
ATOM 4997  O O     . GLN I  3 92  ? 31.876  -16.873  2.119   1.00 443.96 ? 105 GLN C O     1 
ATOM 4998  C CB    . GLN I  3 92  ? 30.819  -19.518  3.725   1.00 414.80 ? 105 GLN C CB    1 
ATOM 4999  C CG    . GLN I  3 92  ? 30.588  -19.076  5.161   1.00 402.82 ? 105 GLN C CG    1 
ATOM 5000  C CD    . GLN I  3 92  ? 31.639  -19.644  6.057   1.00 392.37 ? 105 GLN C CD    1 
ATOM 5001  O OE1   . GLN I  3 92  ? 31.533  -20.793  6.508   1.00 384.00 ? 105 GLN C OE1   1 
ATOM 5002  N NE2   . GLN I  3 92  ? 32.659  -18.839  6.380   1.00 392.16 ? 105 GLN C NE2   1 
ATOM 5003  N N     . ALA I  3 93  ? 31.833  -18.719  0.779   1.00 435.97 ? 106 ALA C N     1 
ATOM 5004  C CA    . ALA I  3 93  ? 32.967  -18.342  -0.100  1.00 436.38 ? 106 ALA C CA    1 
ATOM 5005  C C     . ALA I  3 93  ? 32.586  -17.451  -1.298  1.00 437.79 ? 106 ALA C C     1 
ATOM 5006  O O     . ALA I  3 93  ? 31.669  -16.620  -1.226  1.00 443.68 ? 106 ALA C O     1 
ATOM 5007  C CB    . ALA I  3 93  ? 33.696  -19.595  -0.592  1.00 430.65 ? 106 ALA C CB    1 
ATOM 5008  N N     . SER J  4 1   ? 43.213  -31.121  -5.443  1.00 481.65 ? 8   SER D N     1 
ATOM 5009  C CA    . SER J  4 1   ? 42.240  -32.203  -5.755  1.00 479.62 ? 8   SER D CA    1 
ATOM 5010  C C     . SER J  4 1   ? 40.776  -31.735  -5.637  1.00 480.75 ? 8   SER D C     1 
ATOM 5011  O O     . SER J  4 1   ? 40.111  -31.916  -4.604  1.00 469.34 ? 8   SER D O     1 
ATOM 5012  C CB    . SER J  4 1   ? 42.510  -33.413  -4.874  1.00 472.63 ? 8   SER D CB    1 
ATOM 5013  O OG    . SER J  4 1   ? 41.861  -34.551  -5.383  1.00 466.12 ? 8   SER D OG    1 
ATOM 5014  N N     . GLY J  4 2   ? 40.303  -31.111  -6.719  1.00 492.16 ? 9   GLY D N     1 
ATOM 5015  C CA    . GLY J  4 2   ? 38.934  -30.569  -6.829  1.00 493.55 ? 9   GLY D CA    1 
ATOM 5016  C C     . GLY J  4 2   ? 38.708  -30.085  -8.250  1.00 497.04 ? 9   GLY D C     1 
ATOM 5017  O O     . GLY J  4 2   ? 39.519  -29.291  -8.755  1.00 509.43 ? 9   GLY D O     1 
ATOM 5018  N N     . PHE J  4 3   ? 37.613  -30.555  -8.878  1.00 481.32 ? 10  PHE D N     1 
ATOM 5019  C CA    . PHE J  4 3   ? 37.339  -30.417  -10.352 1.00 465.62 ? 10  PHE D CA    1 
ATOM 5020  C C     . PHE J  4 3   ? 37.512  -28.961  -10.899 1.00 474.18 ? 10  PHE D C     1 
ATOM 5021  O O     . PHE J  4 3   ? 36.966  -27.997  -10.327 1.00 472.59 ? 10  PHE D O     1 
ATOM 5022  C CB    . PHE J  4 3   ? 35.955  -31.057  -10.742 1.00 432.98 ? 10  PHE D CB    1 
ATOM 5023  C CG    . PHE J  4 3   ? 36.030  -32.480  -11.334 1.00 402.59 ? 10  PHE D CG    1 
ATOM 5024  C CD1   . PHE J  4 3   ? 36.232  -33.600  -10.517 1.00 388.98 ? 10  PHE D CD1   1 
ATOM 5025  C CD2   . PHE J  4 3   ? 35.831  -32.704  -12.711 1.00 388.35 ? 10  PHE D CD2   1 
ATOM 5026  C CE1   . PHE J  4 3   ? 36.282  -34.882  -11.062 1.00 374.15 ? 10  PHE D CE1   1 
ATOM 5027  C CE2   . PHE J  4 3   ? 35.880  -33.983  -13.255 1.00 373.75 ? 10  PHE D CE2   1 
ATOM 5028  C CZ    . PHE J  4 3   ? 36.102  -35.075  -12.426 1.00 368.37 ? 10  PHE D CZ    1 
ATOM 5029  N N     . ARG J  4 4   ? 38.291  -28.818  -11.983 1.00 476.34 ? 11  ARG D N     1 
ATOM 5030  C CA    . ARG J  4 4   ? 38.563  -27.512  -12.625 1.00 468.52 ? 11  ARG D CA    1 
ATOM 5031  C C     . ARG J  4 4   ? 37.279  -26.938  -13.203 1.00 465.84 ? 11  ARG D C     1 
ATOM 5032  O O     . ARG J  4 4   ? 36.533  -27.603  -13.951 1.00 461.51 ? 11  ARG D O     1 
ATOM 5033  C CB    . ARG J  4 4   ? 39.638  -27.594  -13.714 1.00 462.75 ? 11  ARG D CB    1 
ATOM 5034  C CG    . ARG J  4 4   ? 41.071  -27.716  -13.243 1.00 452.95 ? 11  ARG D CG    1 
ATOM 5035  C CD    . ARG J  4 4   ? 41.968  -28.244  -14.349 1.00 443.73 ? 11  ARG D CD    1 
ATOM 5036  N NE    . ARG J  4 4   ? 41.847  -29.688  -14.608 1.00 429.31 ? 11  ARG D NE    1 
ATOM 5037  C CZ    . ARG J  4 4   ? 42.845  -30.566  -14.550 1.00 419.68 ? 11  ARG D CZ    1 
ATOM 5038  N NH1   . ARG J  4 4   ? 44.084  -30.180  -14.268 1.00 417.45 ? 11  ARG D NH1   1 
ATOM 5039  N NH2   . ARG J  4 4   ? 42.610  -31.849  -14.816 1.00 411.80 ? 11  ARG D NH2   1 
ATOM 5040  N N     . LYS J  4 5   ? 37.007  -25.697  -12.825 1.00 463.44 ? 12  LYS D N     1 
ATOM 5041  C CA    . LYS J  4 5   ? 35.743  -25.064  -13.147 1.00 457.69 ? 12  LYS D CA    1 
ATOM 5042  C C     . LYS J  4 5   ? 35.646  -24.714  -14.647 1.00 450.05 ? 12  LYS D C     1 
ATOM 5043  O O     . LYS J  4 5   ? 34.553  -24.737  -15.223 1.00 455.29 ? 12  LYS D O     1 
ATOM 5044  C CB    . LYS J  4 5   ? 35.490  -23.867  -12.207 1.00 463.32 ? 12  LYS D CB    1 
ATOM 5045  C CG    . LYS J  4 5   ? 35.017  -24.255  -10.799 1.00 458.64 ? 12  LYS D CG    1 
ATOM 5046  C CD    . LYS J  4 5   ? 35.542  -23.332  -9.695  1.00 459.98 ? 12  LYS D CD    1 
ATOM 5047  C CE    . LYS J  4 5   ? 35.000  -21.910  -9.786  1.00 464.50 ? 12  LYS D CE    1 
ATOM 5048  N NZ    . LYS J  4 5   ? 33.522  -21.836  -9.648  1.00 461.35 ? 12  LYS D NZ    1 
ATOM 5049  N N     . GLU J  4 6   ? 36.790  -24.432  -15.272 1.00 432.61 ? 13  GLU D N     1 
ATOM 5050  C CA    . GLU J  4 6   ? 36.858  -24.265  -16.713 1.00 414.00 ? 13  GLU D CA    1 
ATOM 5051  C C     . GLU J  4 6   ? 36.476  -25.563  -17.422 1.00 403.33 ? 13  GLU D C     1 
ATOM 5052  O O     . GLU J  4 6   ? 35.690  -25.536  -18.385 1.00 406.29 ? 13  GLU D O     1 
ATOM 5053  C CB    . GLU J  4 6   ? 38.255  -23.827  -17.124 1.00 408.56 ? 13  GLU D CB    1 
ATOM 5054  C CG    . GLU J  4 6   ? 38.341  -23.310  -18.555 1.00 403.69 ? 13  GLU D CG    1 
ATOM 5055  C CD    . GLU J  4 6   ? 39.170  -24.185  -19.482 1.00 400.04 ? 13  GLU D CD    1 
ATOM 5056  O OE1   . GLU J  4 6   ? 39.916  -23.607  -20.310 1.00 401.44 ? 13  GLU D OE1   1 
ATOM 5057  O OE2   . GLU J  4 6   ? 39.078  -25.430  -19.398 1.00 395.76 ? 13  GLU D OE2   1 
ATOM 5058  N N     . LEU J  4 7   ? 37.026  -26.682  -16.929 1.00 388.32 ? 14  LEU D N     1 
ATOM 5059  C CA    . LEU J  4 7   ? 36.724  -28.034  -17.436 1.00 376.72 ? 14  LEU D CA    1 
ATOM 5060  C C     . LEU J  4 7   ? 35.234  -28.373  -17.414 1.00 377.43 ? 14  LEU D C     1 
ATOM 5061  O O     . LEU J  4 7   ? 34.697  -28.801  -18.432 1.00 384.47 ? 14  LEU D O     1 
ATOM 5062  C CB    . LEU J  4 7   ? 37.510  -29.129  -16.686 1.00 362.71 ? 14  LEU D CB    1 
ATOM 5063  C CG    . LEU J  4 7   ? 37.188  -30.603  -17.010 1.00 353.02 ? 14  LEU D CG    1 
ATOM 5064  C CD1   . LEU J  4 7   ? 37.770  -31.027  -18.353 1.00 352.67 ? 14  LEU D CD1   1 
ATOM 5065  C CD2   . LEU J  4 7   ? 37.672  -31.547  -15.916 1.00 347.69 ? 14  LEU D CD2   1 
ATOM 5066  N N     . VAL J  4 8   ? 34.580  -28.193  -16.265 1.00 375.92 ? 15  VAL D N     1 
ATOM 5067  C CA    . VAL J  4 8   ? 33.139  -28.486  -16.110 1.00 376.17 ? 15  VAL D CA    1 
ATOM 5068  C C     . VAL J  4 8   ? 32.216  -27.638  -17.053 1.00 391.35 ? 15  VAL D C     1 
ATOM 5069  O O     . VAL J  4 8   ? 31.253  -28.177  -17.627 1.00 387.38 ? 15  VAL D O     1 
ATOM 5070  C CB    . VAL J  4 8   ? 32.724  -28.465  -14.606 1.00 365.15 ? 15  VAL D CB    1 
ATOM 5071  C CG1   . VAL J  4 8   ? 31.270  -28.867  -14.409 1.00 357.10 ? 15  VAL D CG1   1 
ATOM 5072  C CG2   . VAL J  4 8   ? 33.599  -29.421  -13.816 1.00 360.92 ? 15  VAL D CG2   1 
ATOM 5073  N N     . SER J  4 9   ? 32.539  -26.343  -17.237 1.00 414.75 ? 16  SER D N     1 
ATOM 5074  C CA    . SER J  4 9   ? 31.812  -25.400  -18.152 1.00 436.67 ? 16  SER D CA    1 
ATOM 5075  C C     . SER J  4 9   ? 31.879  -25.767  -19.649 1.00 455.15 ? 16  SER D C     1 
ATOM 5076  O O     . SER J  4 9   ? 30.852  -25.775  -20.340 1.00 460.61 ? 16  SER D O     1 
ATOM 5077  C CB    . SER J  4 9   ? 32.296  -23.942  -17.964 1.00 436.86 ? 16  SER D CB    1 
ATOM 5078  O OG    . SER J  4 9   ? 31.679  -23.043  -18.880 1.00 433.35 ? 16  SER D OG    1 
ATOM 5079  N N     . ARG J  4 10  ? 33.085  -26.040  -20.146 1.00 468.64 ? 17  ARG D N     1 
ATOM 5080  C CA    . ARG J  4 10  ? 33.272  -26.417  -21.550 1.00 473.43 ? 17  ARG D CA    1 
ATOM 5081  C C     . ARG J  4 10  ? 32.670  -27.802  -21.831 1.00 473.92 ? 17  ARG D C     1 
ATOM 5082  O O     . ARG J  4 10  ? 32.073  -28.017  -22.886 1.00 477.30 ? 17  ARG D O     1 
ATOM 5083  C CB    . ARG J  4 10  ? 34.752  -26.330  -21.966 1.00 470.69 ? 17  ARG D CB    1 
ATOM 5084  C CG    . ARG J  4 10  ? 35.283  -24.903  -22.116 1.00 466.12 ? 17  ARG D CG    1 
ATOM 5085  C CD    . ARG J  4 10  ? 36.657  -24.854  -22.778 1.00 465.32 ? 17  ARG D CD    1 
ATOM 5086  N NE    . ARG J  4 10  ? 37.332  -23.559  -22.580 1.00 467.18 ? 17  ARG D NE    1 
ATOM 5087  C CZ    . ARG J  4 10  ? 37.383  -22.568  -23.478 1.00 473.37 ? 17  ARG D CZ    1 
ATOM 5088  N NH1   . ARG J  4 10  ? 36.800  -22.690  -24.666 1.00 477.46 ? 17  ARG D NH1   1 
ATOM 5089  N NH2   . ARG J  4 10  ? 38.028  -21.441  -23.184 1.00 475.65 ? 17  ARG D NH2   1 
ATOM 5090  N N     . LEU J  4 11  ? 32.807  -28.716  -20.864 1.00 465.99 ? 18  LEU D N     1 
ATOM 5091  C CA    . LEU J  4 11  ? 32.139  -30.026  -20.900 1.00 445.11 ? 18  LEU D CA    1 
ATOM 5092  C C     . LEU J  4 11  ? 30.622  -29.897  -20.967 1.00 421.33 ? 18  LEU D C     1 
ATOM 5093  O O     . LEU J  4 11  ? 29.980  -30.581  -21.767 1.00 418.50 ? 18  LEU D O     1 
ATOM 5094  C CB    . LEU J  4 11  ? 32.512  -30.896  -19.683 1.00 449.36 ? 18  LEU D CB    1 
ATOM 5095  C CG    . LEU J  4 11  ? 33.898  -31.542  -19.511 1.00 454.89 ? 18  LEU D CG    1 
ATOM 5096  C CD1   . LEU J  4 11  ? 34.012  -32.237  -18.156 1.00 450.90 ? 18  LEU D CD1   1 
ATOM 5097  C CD2   . LEU J  4 11  ? 34.240  -32.506  -20.638 1.00 455.60 ? 18  LEU D CD2   1 
ATOM 5098  N N     . LEU J  4 12  ? 30.057  -29.042  -20.112 1.00 395.56 ? 19  LEU D N     1 
ATOM 5099  C CA    . LEU J  4 12  ? 28.612  -28.763  -20.144 1.00 373.72 ? 19  LEU D CA    1 
ATOM 5100  C C     . LEU J  4 12  ? 28.164  -28.116  -21.499 1.00 375.93 ? 19  LEU D C     1 
ATOM 5101  O O     . LEU J  4 12  ? 27.156  -28.556  -22.096 1.00 381.47 ? 19  LEU D O     1 
ATOM 5102  C CB    . LEU J  4 12  ? 28.139  -27.950  -18.904 1.00 358.16 ? 19  LEU D CB    1 
ATOM 5103  C CG    . LEU J  4 12  ? 28.162  -28.480  -17.451 1.00 342.84 ? 19  LEU D CG    1 
ATOM 5104  C CD1   . LEU J  4 12  ? 27.518  -27.474  -16.510 1.00 335.98 ? 19  LEU D CD1   1 
ATOM 5105  C CD2   . LEU J  4 12  ? 27.497  -29.837  -17.275 1.00 334.73 ? 19  LEU D CD2   1 
ATOM 5106  N N     . HIS J  4 13  ? 28.928  -27.122  -21.995 1.00 368.95 ? 20  HIS D N     1 
ATOM 5107  C CA    . HIS J  4 13  ? 28.615  -26.379  -23.258 1.00 355.82 ? 20  HIS D CA    1 
ATOM 5108  C C     . HIS J  4 13  ? 28.719  -27.168  -24.601 1.00 354.05 ? 20  HIS D C     1 
ATOM 5109  O O     . HIS J  4 13  ? 28.101  -26.759  -25.597 1.00 353.07 ? 20  HIS D O     1 
ATOM 5110  C CB    . HIS J  4 13  ? 29.399  -25.044  -23.345 1.00 349.00 ? 20  HIS D CB    1 
ATOM 5111  C CG    . HIS J  4 13  ? 28.656  -23.853  -22.801 1.00 340.26 ? 20  HIS D CG    1 
ATOM 5112  N ND1   . HIS J  4 13  ? 27.805  -23.085  -23.568 1.00 336.75 ? 20  HIS D ND1   1 
ATOM 5113  C CD2   . HIS J  4 13  ? 28.654  -23.292  -21.568 1.00 336.78 ? 20  HIS D CD2   1 
ATOM 5114  C CE1   . HIS J  4 13  ? 27.307  -22.108  -22.831 1.00 335.29 ? 20  HIS D CE1   1 
ATOM 5115  N NE2   . HIS J  4 13  ? 27.804  -22.212  -21.611 1.00 335.32 ? 20  HIS D NE2   1 
ATOM 5116  N N     . LEU J  4 14  ? 29.477  -28.276  -24.621 1.00 349.87 ? 21  LEU D N     1 
ATOM 5117  C CA    . LEU J  4 14  ? 29.610  -29.144  -25.819 1.00 346.08 ? 21  LEU D CA    1 
ATOM 5118  C C     . LEU J  4 14  ? 28.310  -29.836  -26.294 1.00 344.92 ? 21  LEU D C     1 
ATOM 5119  O O     . LEU J  4 14  ? 28.076  -29.927  -27.507 1.00 348.29 ? 21  LEU D O     1 
ATOM 5120  C CB    . LEU J  4 14  ? 30.718  -30.193  -25.629 1.00 339.74 ? 21  LEU D CB    1 
ATOM 5121  C CG    . LEU J  4 14  ? 32.173  -29.734  -25.601 1.00 338.64 ? 21  LEU D CG    1 
ATOM 5122  C CD1   . LEU J  4 14  ? 32.997  -30.801  -24.911 1.00 335.15 ? 21  LEU D CD1   1 
ATOM 5123  C CD2   . LEU J  4 14  ? 32.688  -29.471  -27.006 1.00 340.50 ? 21  LEU D CD2   1 
ATOM 5124  N N     . HIS J  4 15  ? 27.486  -30.312  -25.346 1.00 340.40 ? 22  HIS D N     1 
ATOM 5125  C CA    . HIS J  4 15  ? 26.222  -31.015  -25.651 1.00 333.83 ? 22  HIS D CA    1 
ATOM 5126  C C     . HIS J  4 15  ? 24.930  -30.457  -24.968 1.00 331.62 ? 22  HIS D C     1 
ATOM 5127  O O     . HIS J  4 15  ? 24.000  -31.205  -24.689 1.00 326.05 ? 22  HIS D O     1 
ATOM 5128  C CB    . HIS J  4 15  ? 26.401  -32.542  -25.459 1.00 328.21 ? 22  HIS D CB    1 
ATOM 5129  C CG    . HIS J  4 15  ? 27.312  -33.184  -26.474 1.00 326.25 ? 22  HIS D CG    1 
ATOM 5130  N ND1   . HIS J  4 15  ? 26.942  -33.375  -27.788 1.00 324.94 ? 22  HIS D ND1   1 
ATOM 5131  C CD2   . HIS J  4 15  ? 28.570  -33.679  -26.365 1.00 325.95 ? 22  HIS D CD2   1 
ATOM 5132  C CE1   . HIS J  4 15  ? 27.929  -33.962  -28.443 1.00 326.36 ? 22  HIS D CE1   1 
ATOM 5133  N NE2   . HIS J  4 15  ? 28.931  -34.155  -27.604 1.00 325.59 ? 22  HIS D NE2   1 
ATOM 5134  N N     . PHE J  4 16  ? 24.870  -29.143  -24.748 1.00 335.53 ? 23  PHE D N     1 
ATOM 5135  C CA    . PHE J  4 16  ? 23.607  -28.464  -24.415 1.00 336.24 ? 23  PHE D CA    1 
ATOM 5136  C C     . PHE J  4 16  ? 22.635  -28.551  -25.586 1.00 339.32 ? 23  PHE D C     1 
ATOM 5137  O O     . PHE J  4 16  ? 23.052  -28.311  -26.722 1.00 340.98 ? 23  PHE D O     1 
ATOM 5138  C CB    . PHE J  4 16  ? 23.847  -26.974  -24.184 1.00 339.71 ? 23  PHE D CB    1 
ATOM 5139  C CG    . PHE J  4 16  ? 24.334  -26.636  -22.817 1.00 342.01 ? 23  PHE D CG    1 
ATOM 5140  C CD1   . PHE J  4 16  ? 23.947  -27.389  -21.711 1.00 339.30 ? 23  PHE D CD1   1 
ATOM 5141  C CD2   . PHE J  4 16  ? 25.168  -25.540  -22.627 1.00 346.91 ? 23  PHE D CD2   1 
ATOM 5142  C CE1   . PHE J  4 16  ? 24.407  -27.067  -20.437 1.00 340.87 ? 23  PHE D CE1   1 
ATOM 5143  C CE2   . PHE J  4 16  ? 25.632  -25.210  -21.359 1.00 348.65 ? 23  PHE D CE2   1 
ATOM 5144  C CZ    . PHE J  4 16  ? 25.247  -25.972  -20.257 1.00 345.34 ? 23  PHE D CZ    1 
ATOM 5145  N N     . LYS J  4 17  ? 21.351  -28.853  -25.321 1.00 343.76 ? 24  LYS D N     1 
ATOM 5146  C CA    . LYS J  4 17  ? 20.273  -28.787  -26.364 1.00 354.53 ? 24  LYS D CA    1 
ATOM 5147  C C     . LYS J  4 17  ? 19.834  -27.352  -26.833 1.00 366.42 ? 24  LYS D C     1 
ATOM 5148  O O     . LYS J  4 17  ? 19.733  -27.098  -28.049 1.00 370.49 ? 24  LYS D O     1 
ATOM 5149  C CB    . LYS J  4 17  ? 19.049  -29.675  -26.017 1.00 348.75 ? 24  LYS D CB    1 
ATOM 5150  C CG    . LYS J  4 17  ? 19.236  -31.167  -26.227 1.00 341.06 ? 24  LYS D CG    1 
ATOM 5151  C CD    . LYS J  4 17  ? 19.353  -31.487  -27.705 1.00 340.11 ? 24  LYS D CD    1 
ATOM 5152  C CE    . LYS J  4 17  ? 19.930  -32.870  -27.963 1.00 334.56 ? 24  LYS D CE    1 
ATOM 5153  N NZ    . LYS J  4 17  ? 19.175  -33.995  -27.341 1.00 329.09 ? 24  LYS D NZ    1 
ATOM 5154  N N     . ASP J  4 18  ? 19.578  -26.417  -25.904 1.00 376.78 ? 25  ASP D N     1 
ATOM 5155  C CA    . ASP J  4 18  ? 19.449  -24.993  -26.283 1.00 390.80 ? 25  ASP D CA    1 
ATOM 5156  C C     . ASP J  4 18  ? 20.762  -24.252  -26.031 1.00 412.20 ? 25  ASP D C     1 
ATOM 5157  O O     . ASP J  4 18  ? 21.341  -24.323  -24.946 1.00 411.69 ? 25  ASP D O     1 
ATOM 5158  C CB    . ASP J  4 18  ? 18.285  -24.274  -25.578 1.00 379.01 ? 25  ASP D CB    1 
ATOM 5159  C CG    . ASP J  4 18  ? 17.927  -22.929  -26.241 1.00 375.12 ? 25  ASP D CG    1 
ATOM 5160  O OD1   . ASP J  4 18  ? 18.697  -22.388  -27.066 1.00 378.01 ? 25  ASP D OD1   1 
ATOM 5161  O OD2   . ASP J  4 18  ? 16.861  -22.392  -25.931 1.00 367.71 ? 25  ASP D OD2   1 
ATOM 5162  N N     . ASP J  4 19  ? 21.233  -23.542  -27.047 1.00 440.77 ? 26  ASP D N     1 
ATOM 5163  C CA    . ASP J  4 19  ? 22.456  -22.780  -26.886 1.00 462.28 ? 26  ASP D CA    1 
ATOM 5164  C C     . ASP J  4 19  ? 22.291  -21.539  -25.977 1.00 462.98 ? 26  ASP D C     1 
ATOM 5165  O O     . ASP J  4 19  ? 23.292  -20.931  -25.576 1.00 475.88 ? 26  ASP D O     1 
ATOM 5166  C CB    . ASP J  4 19  ? 23.091  -22.469  -28.253 1.00 480.04 ? 26  ASP D CB    1 
ATOM 5167  C CG    . ASP J  4 19  ? 24.087  -23.539  -28.693 1.00 487.22 ? 26  ASP D CG    1 
ATOM 5168  O OD1   . ASP J  4 19  ? 24.468  -24.393  -27.858 1.00 491.27 ? 26  ASP D OD1   1 
ATOM 5169  O OD2   . ASP J  4 19  ? 24.531  -23.483  -29.858 1.00 491.10 ? 26  ASP D OD2   1 
ATOM 5170  N N     . LYS J  4 20  ? 21.042  -21.195  -25.622 1.00 448.91 ? 27  LYS D N     1 
ATOM 5171  C CA    . LYS J  4 20  ? 20.743  -20.090  -24.670 1.00 432.16 ? 27  LYS D CA    1 
ATOM 5172  C C     . LYS J  4 20  ? 21.341  -20.330  -23.274 1.00 425.54 ? 27  LYS D C     1 
ATOM 5173  O O     . LYS J  4 20  ? 21.639  -19.381  -22.540 1.00 428.44 ? 27  LYS D O     1 
ATOM 5174  C CB    . LYS J  4 20  ? 19.230  -19.799  -24.594 1.00 416.44 ? 27  LYS D CB    1 
ATOM 5175  C CG    . LYS J  4 20  ? 18.693  -19.138  -25.862 1.00 402.89 ? 27  LYS D CG    1 
ATOM 5176  C CD    . LYS J  4 20  ? 17.189  -19.255  -26.053 1.00 384.43 ? 27  LYS D CD    1 
ATOM 5177  C CE    . LYS J  4 20  ? 16.878  -19.291  -27.541 1.00 375.80 ? 27  LYS D CE    1 
ATOM 5178  N NZ    . LYS J  4 20  ? 15.514  -19.786  -27.874 1.00 365.63 ? 27  LYS D NZ    1 
ATOM 5179  N N     . THR J  4 21  ? 21.547  -21.609  -22.955 1.00 413.44 ? 28  THR D N     1 
ATOM 5180  C CA    . THR J  4 21  ? 22.099  -22.076  -21.681 1.00 402.21 ? 28  THR D CA    1 
ATOM 5181  C C     . THR J  4 21  ? 23.529  -21.603  -21.367 1.00 395.47 ? 28  THR D C     1 
ATOM 5182  O O     . THR J  4 21  ? 24.460  -21.772  -22.159 1.00 391.71 ? 28  THR D O     1 
ATOM 5183  C CB    . THR J  4 21  ? 22.018  -23.618  -21.588 1.00 401.65 ? 28  THR D CB    1 
ATOM 5184  O OG1   . THR J  4 21  ? 20.822  -24.065  -22.244 1.00 403.60 ? 28  THR D OG1   1 
ATOM 5185  C CG2   . THR J  4 21  ? 21.985  -24.064  -20.136 1.00 399.66 ? 28  THR D CG2   1 
ATOM 5186  N N     . LYS J  4 22  ? 23.650  -20.976  -20.196 1.00 387.04 ? 29  LYS D N     1 
ATOM 5187  C CA    . LYS J  4 22  ? 24.918  -20.652  -19.533 1.00 381.35 ? 29  LYS D CA    1 
ATOM 5188  C C     . LYS J  4 22  ? 24.835  -21.326  -18.147 1.00 377.78 ? 29  LYS D C     1 
ATOM 5189  O O     . LYS J  4 22  ? 23.769  -21.823  -17.750 1.00 373.69 ? 29  LYS D O     1 
ATOM 5190  C CB    . LYS J  4 22  ? 25.099  -19.116  -19.395 1.00 375.98 ? 29  LYS D CB    1 
ATOM 5191  C CG    . LYS J  4 22  ? 25.649  -18.380  -20.617 1.00 368.83 ? 29  LYS D CG    1 
ATOM 5192  C CD    . LYS J  4 22  ? 24.859  -17.110  -20.901 1.00 359.47 ? 29  LYS D CD    1 
ATOM 5193  C CE    . LYS J  4 22  ? 24.844  -16.797  -22.388 1.00 356.88 ? 29  LYS D CE    1 
ATOM 5194  N NZ    . LYS J  4 22  ? 23.750  -15.849  -22.726 1.00 355.31 ? 29  LYS D NZ    1 
ATOM 5195  N N     . VAL J  4 23  ? 25.948  -21.357  -17.419 1.00 377.27 ? 30  VAL D N     1 
ATOM 5196  C CA    . VAL J  4 23  ? 25.949  -21.874  -16.043 1.00 372.49 ? 30  VAL D CA    1 
ATOM 5197  C C     . VAL J  4 23  ? 26.411  -20.748  -15.081 1.00 382.49 ? 30  VAL D C     1 
ATOM 5198  O O     . VAL J  4 23  ? 27.460  -20.139  -15.301 1.00 385.24 ? 30  VAL D O     1 
ATOM 5199  C CB    . VAL J  4 23  ? 26.794  -23.178  -15.915 1.00 362.50 ? 30  VAL D CB    1 
ATOM 5200  C CG1   . VAL J  4 23  ? 26.431  -23.934  -14.647 1.00 354.64 ? 30  VAL D CG1   1 
ATOM 5201  C CG2   . VAL J  4 23  ? 26.590  -24.090  -17.120 1.00 357.99 ? 30  VAL D CG2   1 
ATOM 5202  N N     . SER J  4 24  ? 25.604  -20.439  -14.056 1.00 391.09 ? 31  SER D N     1 
ATOM 5203  C CA    . SER J  4 24  ? 25.961  -19.420  -13.037 1.00 398.14 ? 31  SER D CA    1 
ATOM 5204  C C     . SER J  4 24  ? 27.129  -19.900  -12.179 1.00 400.69 ? 31  SER D C     1 
ATOM 5205  O O     . SER J  4 24  ? 27.431  -21.103  -12.148 1.00 407.94 ? 31  SER D O     1 
ATOM 5206  C CB    . SER J  4 24  ? 24.760  -19.025  -12.146 1.00 397.88 ? 31  SER D CB    1 
ATOM 5207  O OG    . SER J  4 24  ? 24.540  -19.935  -11.069 1.00 396.64 ? 31  SER D OG    1 
ATOM 5208  N N     . GLY J  4 25  ? 27.774  -18.962  -11.482 1.00 399.85 ? 32  GLY D N     1 
ATOM 5209  C CA    . GLY J  4 25  ? 28.974  -19.255  -10.689 1.00 399.36 ? 32  GLY D CA    1 
ATOM 5210  C C     . GLY J  4 25  ? 28.810  -20.344  -9.637  1.00 395.23 ? 32  GLY D C     1 
ATOM 5211  O O     . GLY J  4 25  ? 29.546  -21.349  -9.644  1.00 394.41 ? 32  GLY D O     1 
ATOM 5212  N N     . ASP J  4 26  ? 27.850  -20.150  -8.744  1.00 391.67 ? 33  ASP D N     1 
ATOM 5213  C CA    . ASP J  4 26  ? 27.591  -21.092  -7.652  1.00 385.55 ? 33  ASP D CA    1 
ATOM 5214  C C     . ASP J  4 26  ? 27.114  -22.465  -8.154  1.00 378.40 ? 33  ASP D C     1 
ATOM 5215  O O     . ASP J  4 26  ? 27.520  -23.496  -7.610  1.00 364.30 ? 33  ASP D O     1 
ATOM 5216  C CB    . ASP J  4 26  ? 26.592  -20.492  -6.643  1.00 392.59 ? 33  ASP D CB    1 
ATOM 5217  C CG    . ASP J  4 26  ? 27.202  -19.442  -5.718  1.00 403.10 ? 33  ASP D CG    1 
ATOM 5218  O OD1   . ASP J  4 26  ? 28.394  -19.089  -5.877  1.00 409.24 ? 33  ASP D OD1   1 
ATOM 5219  O OD2   . ASP J  4 26  ? 26.454  -18.954  -4.844  1.00 410.61 ? 33  ASP D OD2   1 
ATOM 5220  N N     . ALA J  4 27  ? 26.277  -22.474  -9.197  1.00 385.22 ? 34  ALA D N     1 
ATOM 5221  C CA    . ALA J  4 27  ? 25.808  -23.718  -9.822  1.00 386.32 ? 34  ALA D CA    1 
ATOM 5222  C C     . ALA J  4 27  ? 26.934  -24.615  -10.361 1.00 379.17 ? 34  ALA D C     1 
ATOM 5223  O O     . ALA J  4 27  ? 26.877  -25.843  -10.215 1.00 368.73 ? 34  ALA D O     1 
ATOM 5224  C CB    . ALA J  4 27  ? 24.815  -23.407  -10.926 1.00 403.10 ? 34  ALA D CB    1 
ATOM 5225  N N     . LEU J  4 28  ? 27.941  -23.999  -10.988 1.00 376.12 ? 35  LEU D N     1 
ATOM 5226  C CA    . LEU J  4 28  ? 29.070  -24.726  -11.579 1.00 366.78 ? 35  LEU D CA    1 
ATOM 5227  C C     . LEU J  4 28  ? 30.045  -25.251  -10.527 1.00 358.21 ? 35  LEU D C     1 
ATOM 5228  O O     . LEU J  4 28  ? 30.586  -26.345  -10.676 1.00 361.28 ? 35  LEU D O     1 
ATOM 5229  C CB    . LEU J  4 28  ? 29.805  -23.846  -12.584 1.00 368.96 ? 35  LEU D CB    1 
ATOM 5230  C CG    . LEU J  4 28  ? 30.695  -24.570  -13.586 1.00 366.09 ? 35  LEU D CG    1 
ATOM 5231  C CD1   . LEU J  4 28  ? 29.897  -25.523  -14.461 1.00 358.60 ? 35  LEU D CD1   1 
ATOM 5232  C CD2   . LEU J  4 28  ? 31.389  -23.530  -14.442 1.00 370.22 ? 35  LEU D CD2   1 
ATOM 5233  N N     . GLN J  4 29  ? 30.262  -24.449  -9.481  1.00 344.53 ? 36  GLN D N     1 
ATOM 5234  C CA    . GLN J  4 29  ? 30.927  -24.881  -8.251  0.50 333.20 ? 36  GLN D CA    1 
ATOM 5235  C C     . GLN J  4 29  ? 30.234  -26.101  -7.657  1.00 329.42 ? 36  GLN D C     1 
ATOM 5236  O O     . GLN J  4 29  ? 30.895  -27.007  -7.154  1.00 329.35 ? 36  GLN D O     1 
ATOM 5237  C CB    . GLN J  4 29  ? 30.903  -23.762  -7.208  0.50 327.17 ? 36  GLN D CB    1 
ATOM 5238  C CG    . GLN J  4 29  ? 32.199  -22.997  -7.062  0.50 325.87 ? 36  GLN D CG    1 
ATOM 5239  C CD    . GLN J  4 29  ? 33.246  -23.801  -6.332  0.50 321.62 ? 36  GLN D CD    1 
ATOM 5240  O OE1   . GLN J  4 29  ? 34.384  -23.901  -6.778  0.50 321.68 ? 36  GLN D OE1   1 
ATOM 5241  N NE2   . GLN J  4 29  ? 32.866  -24.385  -5.207  0.50 317.84 ? 36  GLN D NE2   1 
ATOM 5242  N N     . LEU J  4 30  ? 28.900  -26.105  -7.691  1.00 329.34 ? 37  LEU D N     1 
ATOM 5243  C CA    . LEU J  4 30  ? 28.115  -27.235  -7.175  1.00 329.55 ? 37  LEU D CA    1 
ATOM 5244  C C     . LEU J  4 30  ? 28.137  -28.438  -8.125  1.00 327.64 ? 37  LEU D C     1 
ATOM 5245  O O     . LEU J  4 30  ? 28.031  -29.597  -7.698  1.00 324.54 ? 37  LEU D O     1 
ATOM 5246  C CB    . LEU J  4 30  ? 26.682  -26.807  -6.828  1.00 331.84 ? 37  LEU D CB    1 
ATOM 5247  C CG    . LEU J  4 30  ? 26.481  -26.041  -5.508  1.00 336.32 ? 37  LEU D CG    1 
ATOM 5248  C CD1   . LEU J  4 30  ? 24.996  -25.812  -5.244  1.00 335.58 ? 37  LEU D CD1   1 
ATOM 5249  C CD2   . LEU J  4 30  ? 27.137  -26.716  -4.301  1.00 338.60 ? 37  LEU D CD2   1 
ATOM 5250  N N     . MET J  4 31  ? 28.297  -28.160  -9.413  1.00 328.38 ? 38  MET D N     1 
ATOM 5251  C CA    . MET J  4 31  ? 28.519  -29.217  -10.390 1.00 326.13 ? 38  MET D CA    1 
ATOM 5252  C C     . MET J  4 31  ? 29.907  -29.830  -10.244 1.00 328.65 ? 38  MET D C     1 
ATOM 5253  O O     . MET J  4 31  ? 30.068  -31.047  -10.351 1.00 326.45 ? 38  MET D O     1 
ATOM 5254  C CB    . MET J  4 31  ? 28.251  -28.714  -11.806 1.00 324.19 ? 38  MET D CB    1 
ATOM 5255  C CG    . MET J  4 31  ? 26.766  -28.708  -12.132 1.00 317.51 ? 38  MET D CG    1 
ATOM 5256  S SD    . MET J  4 31  ? 25.866  -30.072  -11.348 1.00 308.39 ? 38  MET D SD    1 
ATOM 5257  C CE    . MET J  4 31  ? 26.445  -31.485  -12.277 1.00 312.98 ? 38  MET D CE    1 
ATOM 5258  N N     . VAL J  4 32  ? 30.891  -28.975  -9.977  1.00 331.29 ? 39  VAL D N     1 
ATOM 5259  C CA    . VAL J  4 32  ? 32.219  -29.391  -9.518  1.00 325.63 ? 39  VAL D CA    1 
ATOM 5260  C C     . VAL J  4 32  ? 32.118  -30.366  -8.312  1.00 313.58 ? 39  VAL D C     1 
ATOM 5261  O O     . VAL J  4 32  ? 32.792  -31.411  -8.294  1.00 306.14 ? 39  VAL D O     1 
ATOM 5262  C CB    . VAL J  4 32  ? 33.076  -28.139  -9.195  1.00 331.55 ? 39  VAL D CB    1 
ATOM 5263  C CG1   . VAL J  4 32  ? 34.264  -28.474  -8.303  1.00 330.66 ? 39  VAL D CG1   1 
ATOM 5264  C CG2   . VAL J  4 32  ? 33.518  -27.454  -10.481 1.00 336.90 ? 39  VAL D CG2   1 
ATOM 5265  N N     . GLU J  4 33  ? 31.268  -30.013  -7.333  1.00 305.56 ? 40  GLU D N     1 
ATOM 5266  C CA    . GLU J  4 33  ? 30.952  -30.857  -6.159  1.00 295.39 ? 40  GLU D CA    1 
ATOM 5267  C C     . GLU J  4 33  ? 30.300  -32.171  -6.584  1.00 287.65 ? 40  GLU D C     1 
ATOM 5268  O O     . GLU J  4 33  ? 30.786  -33.245  -6.220  1.00 284.00 ? 40  GLU D O     1 
ATOM 5269  C CB    . GLU J  4 33  ? 30.022  -30.141  -5.156  1.00 295.13 ? 40  GLU D CB    1 
ATOM 5270  C CG    . GLU J  4 33  ? 30.631  -28.985  -4.371  1.00 297.93 ? 40  GLU D CG    1 
ATOM 5271  C CD    . GLU J  4 33  ? 31.340  -29.400  -3.098  1.00 296.88 ? 40  GLU D CD    1 
ATOM 5272  O OE1   . GLU J  4 33  ? 31.991  -28.541  -2.467  1.00 298.07 ? 40  GLU D OE1   1 
ATOM 5273  O OE2   . GLU J  4 33  ? 31.250  -30.588  -2.740  1.00 295.13 ? 40  GLU D OE2   1 
ATOM 5274  N N     . LEU J  4 34  ? 29.209  -32.081  -7.351  1.00 284.11 ? 41  LEU D N     1 
ATOM 5275  C CA    . LEU J  4 34  ? 28.440  -33.259  -7.780  1.00 281.89 ? 41  LEU D CA    1 
ATOM 5276  C C     . LEU J  4 34  ? 29.262  -34.233  -8.641  1.00 287.88 ? 41  LEU D C     1 
ATOM 5277  O O     . LEU J  4 34  ? 29.156  -35.461  -8.488  1.00 286.12 ? 41  LEU D O     1 
ATOM 5278  C CB    . LEU J  4 34  ? 27.152  -32.824  -8.481  1.00 276.47 ? 41  LEU D CB    1 
ATOM 5279  C CG    . LEU J  4 34  ? 26.065  -33.836  -8.850  1.00 270.52 ? 41  LEU D CG    1 
ATOM 5280  C CD1   . LEU J  4 34  ? 25.874  -34.964  -7.839  1.00 264.43 ? 41  LEU D CD1   1 
ATOM 5281  C CD2   . LEU J  4 34  ? 24.766  -33.078  -9.021  1.00 270.00 ? 41  LEU D CD2   1 
ATOM 5282  N N     . LEU J  4 35  ? 30.104  -33.676  -9.511  1.00 299.07 ? 42  LEU D N     1 
ATOM 5283  C CA    . LEU J  4 35  ? 31.075  -34.462  -10.277 1.00 310.75 ? 42  LEU D CA    1 
ATOM 5284  C C     . LEU J  4 35  ? 32.214  -35.026  -9.428  1.00 314.60 ? 42  LEU D C     1 
ATOM 5285  O O     . LEU J  4 35  ? 32.676  -36.144  -9.659  1.00 326.83 ? 42  LEU D O     1 
ATOM 5286  C CB    . LEU J  4 35  ? 31.673  -33.631  -11.411 1.00 315.66 ? 42  LEU D CB    1 
ATOM 5287  C CG    . LEU J  4 35  ? 30.991  -33.495  -12.774 1.00 318.31 ? 42  LEU D CG    1 
ATOM 5288  C CD1   . LEU J  4 35  ? 31.995  -32.902  -13.748 1.00 322.64 ? 42  LEU D CD1   1 
ATOM 5289  C CD2   . LEU J  4 35  ? 30.457  -34.821  -13.293 1.00 317.21 ? 42  LEU D CD2   1 
ATOM 5290  N N     . LYS J  4 36  ? 32.676  -34.231  -8.470  1.00 309.73 ? 43  LYS D N     1 
ATOM 5291  C CA    . LYS J  4 36  ? 33.669  -34.667  -7.503  1.00 305.56 ? 43  LYS D CA    1 
ATOM 5292  C C     . LYS J  4 36  ? 33.138  -35.860  -6.637  1.00 307.63 ? 43  LYS D C     1 
ATOM 5293  O O     . LYS J  4 36  ? 33.867  -36.847  -6.447  1.00 310.91 ? 43  LYS D O     1 
ATOM 5294  C CB    . LYS J  4 36  ? 34.121  -33.446  -6.697  1.00 296.09 ? 43  LYS D CB    1 
ATOM 5295  C CG    . LYS J  4 36  ? 35.210  -33.661  -5.676  1.00 287.70 ? 43  LYS D CG    1 
ATOM 5296  C CD    . LYS J  4 36  ? 35.583  -32.347  -5.041  1.00 283.31 ? 43  LYS D CD    1 
ATOM 5297  C CE    . LYS J  4 36  ? 35.809  -32.500  -3.544  1.00 278.93 ? 43  LYS D CE    1 
ATOM 5298  N NZ    . LYS J  4 36  ? 37.116  -33.100  -3.143  1.00 277.16 ? 43  LYS D NZ    1 
ATOM 5299  N N     . VAL J  4 37  ? 31.877  -35.796  -6.171  1.00 308.94 ? 44  VAL D N     1 
ATOM 5300  C CA    . VAL J  4 37  ? 31.197  -36.910  -5.418  1.00 308.87 ? 44  VAL D CA    1 
ATOM 5301  C C     . VAL J  4 37  ? 31.004  -38.151  -6.279  1.00 310.93 ? 44  VAL D C     1 
ATOM 5302  O O     . VAL J  4 37  ? 31.121  -39.288  -5.813  1.00 303.04 ? 44  VAL D O     1 
ATOM 5303  C CB    . VAL J  4 37  ? 29.804  -36.505  -4.860  1.00 308.80 ? 44  VAL D CB    1 
ATOM 5304  C CG1   . VAL J  4 37  ? 29.057  -37.703  -4.269  1.00 304.62 ? 44  VAL D CG1   1 
ATOM 5305  C CG2   . VAL J  4 37  ? 29.951  -35.419  -3.807  1.00 314.40 ? 44  VAL D CG2   1 
ATOM 5306  N N     . PHE J  4 38  ? 30.691  -37.902  -7.540  1.00 323.87 ? 45  PHE D N     1 
ATOM 5307  C CA    . PHE J  4 38  ? 30.563  -38.937  -8.534  1.00 337.89 ? 45  PHE D CA    1 
ATOM 5308  C C     . PHE J  4 38  ? 31.852  -39.768  -8.688  1.00 338.74 ? 45  PHE D C     1 
ATOM 5309  O O     . PHE J  4 38  ? 31.809  -40.994  -8.543  1.00 340.03 ? 45  PHE D O     1 
ATOM 5310  C CB    . PHE J  4 38  ? 30.139  -38.288  -9.845  1.00 351.88 ? 45  PHE D CB    1 
ATOM 5311  C CG    . PHE J  4 38  ? 30.100  -39.223  -10.998 1.00 361.18 ? 45  PHE D CG    1 
ATOM 5312  C CD1   . PHE J  4 38  ? 29.095  -40.178  -11.100 1.00 361.59 ? 45  PHE D CD1   1 
ATOM 5313  C CD2   . PHE J  4 38  ? 31.066  -39.148  -11.993 1.00 366.66 ? 45  PHE D CD2   1 
ATOM 5314  C CE1   . PHE J  4 38  ? 29.052  -41.048  -12.181 1.00 364.13 ? 45  PHE D CE1   1 
ATOM 5315  C CE2   . PHE J  4 38  ? 31.030  -40.013  -13.079 1.00 367.04 ? 45  PHE D CE2   1 
ATOM 5316  C CZ    . PHE J  4 38  ? 30.022  -40.966  -13.173 1.00 365.62 ? 45  PHE D CZ    1 
ATOM 5317  N N     . VAL J  4 39  ? 32.981  -39.104  -8.962  1.00 338.47 ? 46  VAL D N     1 
ATOM 5318  C CA    . VAL J  4 39  ? 34.298  -39.771  -9.106  1.00 330.73 ? 46  VAL D CA    1 
ATOM 5319  C C     . VAL J  4 39  ? 34.760  -40.511  -7.838  1.00 322.01 ? 46  VAL D C     1 
ATOM 5320  O O     . VAL J  4 39  ? 35.207  -41.661  -7.927  1.00 320.01 ? 46  VAL D O     1 
ATOM 5321  C CB    . VAL J  4 39  ? 35.416  -38.791  -9.555  1.00 334.82 ? 46  VAL D CB    1 
ATOM 5322  C CG1   . VAL J  4 39  ? 36.779  -39.471  -9.519  1.00 332.54 ? 46  VAL D CG1   1 
ATOM 5323  C CG2   . VAL J  4 39  ? 35.128  -38.226  -10.939 1.00 337.97 ? 46  VAL D CG2   1 
ATOM 5324  N N     . VAL J  4 40  ? 34.664  -39.832  -6.684  1.00 314.31 ? 47  VAL D N     1 
ATOM 5325  C CA    . VAL J  4 40  ? 34.985  -40.376  -5.346  1.00 308.19 ? 47  VAL D CA    1 
ATOM 5326  C C     . VAL J  4 40  ? 34.177  -41.641  -5.044  1.00 308.74 ? 47  VAL D C     1 
ATOM 5327  O O     . VAL J  4 40  ? 34.735  -42.640  -4.619  1.00 310.69 ? 47  VAL D O     1 
ATOM 5328  C CB    . VAL J  4 40  ? 34.835  -39.294  -4.227  1.00 302.55 ? 47  VAL D CB    1 
ATOM 5329  C CG1   . VAL J  4 40  ? 34.484  -39.889  -2.869  1.00 298.97 ? 47  VAL D CG1   1 
ATOM 5330  C CG2   . VAL J  4 40  ? 36.107  -38.464  -4.119  1.00 300.25 ? 47  VAL D CG2   1 
ATOM 5331  N N     . GLU J  4 41  ? 32.874  -41.619  -5.297  1.00 307.89 ? 48  GLU D N     1 
ATOM 5332  C CA    . GLU J  4 41  ? 32.050  -42.802  -5.072  1.00 308.21 ? 48  GLU D CA    1 
ATOM 5333  C C     . GLU J  4 41  ? 32.290  -43.960  -6.049  1.00 320.34 ? 48  GLU D C     1 
ATOM 5334  O O     . GLU J  4 41  ? 32.360  -45.130  -5.635  1.00 314.54 ? 48  GLU D O     1 
ATOM 5335  C CB    . GLU J  4 41  ? 30.581  -42.406  -5.015  1.00 297.91 ? 48  GLU D CB    1 
ATOM 5336  C CG    . GLU J  4 41  ? 30.130  -42.119  -3.598  1.00 288.76 ? 48  GLU D CG    1 
ATOM 5337  C CD    . GLU J  4 41  ? 30.458  -43.273  -2.667  1.00 282.93 ? 48  GLU D CD    1 
ATOM 5338  O OE1   . GLU J  4 41  ? 29.967  -44.397  -2.908  1.00 278.85 ? 48  GLU D OE1   1 
ATOM 5339  O OE2   . GLU J  4 41  ? 31.222  -43.055  -1.710  1.00 279.40 ? 48  GLU D OE2   1 
ATOM 5340  N N     . ALA J  4 42  ? 32.414  -43.630  -7.335  1.00 341.29 ? 49  ALA D N     1 
ATOM 5341  C CA    . ALA J  4 42  ? 32.817  -44.594  -8.362  1.00 361.90 ? 49  ALA D CA    1 
ATOM 5342  C C     . ALA J  4 42  ? 34.112  -45.295  -7.943  1.00 371.74 ? 49  ALA D C     1 
ATOM 5343  O O     . ALA J  4 42  ? 34.243  -46.522  -8.064  1.00 382.64 ? 49  ALA D O     1 
ATOM 5344  C CB    . ALA J  4 42  ? 33.002  -43.893  -9.703  1.00 368.17 ? 49  ALA D CB    1 
ATOM 5345  N N     . ALA J  4 43  ? 35.053  -44.497  -7.437  1.00 371.60 ? 50  ALA D N     1 
ATOM 5346  C CA    . ALA J  4 43  ? 36.337  -44.975  -6.912  1.00 362.67 ? 50  ALA D CA    1 
ATOM 5347  C C     . ALA J  4 43  ? 36.251  -45.842  -5.623  1.00 344.90 ? 50  ALA D C     1 
ATOM 5348  O O     . ALA J  4 43  ? 36.897  -46.907  -5.560  1.00 346.15 ? 50  ALA D O     1 
ATOM 5349  C CB    . ALA J  4 43  ? 37.279  -43.793  -6.711  1.00 370.23 ? 50  ALA D CB    1 
ATOM 5350  N N     . VAL J  4 44  ? 35.478  -45.393  -4.617  1.00 321.46 ? 51  VAL D N     1 
ATOM 5351  C CA    . VAL J  4 44  ? 35.355  -46.101  -3.329  1.00 303.41 ? 51  VAL D CA    1 
ATOM 5352  C C     . VAL J  4 44  ? 34.818  -47.500  -3.580  1.00 305.58 ? 51  VAL D C     1 
ATOM 5353  O O     . VAL J  4 44  ? 35.375  -48.492  -3.099  1.00 305.01 ? 51  VAL D O     1 
ATOM 5354  C CB    . VAL J  4 44  ? 34.452  -45.376  -2.308  1.00 291.53 ? 51  VAL D CB    1 
ATOM 5355  C CG1   . VAL J  4 44  ? 34.691  -45.952  -0.933  1.00 282.40 ? 51  VAL D CG1   1 
ATOM 5356  C CG2   . VAL J  4 44  ? 34.764  -43.902  -2.222  1.00 292.51 ? 51  VAL D CG2   1 
ATOM 5357  N N     . ARG J  4 45  ? 33.765  -47.565  -4.386  1.00 312.98 ? 52  ARG D N     1 
ATOM 5358  C CA    . ARG J  4 45  ? 33.127  -48.825  -4.760  1.00 326.59 ? 52  ARG D CA    1 
ATOM 5359  C C     . ARG J  4 45  ? 33.966  -49.799  -5.602  1.00 340.99 ? 52  ARG D C     1 
ATOM 5360  O O     . ARG J  4 45  ? 33.769  -51.008  -5.502  1.00 349.52 ? 52  ARG D O     1 
ATOM 5361  C CB    . ARG J  4 45  ? 31.858  -48.541  -5.528  1.00 325.32 ? 52  ARG D CB    1 
ATOM 5362  C CG    . ARG J  4 45  ? 30.916  -47.641  -4.792  1.00 326.21 ? 52  ARG D CG    1 
ATOM 5363  C CD    . ARG J  4 45  ? 29.574  -47.768  -5.447  1.00 329.50 ? 52  ARG D CD    1 
ATOM 5364  N NE    . ARG J  4 45  ? 28.996  -46.459  -5.675  1.00 327.87 ? 52  ARG D NE    1 
ATOM 5365  C CZ    . ARG J  4 45  ? 27.698  -46.227  -5.814  1.00 326.72 ? 52  ARG D CZ    1 
ATOM 5366  N NH1   . ARG J  4 45  ? 26.820  -47.219  -5.735  1.00 329.83 ? 52  ARG D NH1   1 
ATOM 5367  N NH2   . ARG J  4 45  ? 27.276  -44.991  -6.018  1.00 323.67 ? 52  ARG D NH2   1 
ATOM 5368  N N     . GLY J  4 46  ? 34.853  -49.279  -6.460  1.00 354.22 ? 53  GLY D N     1 
ATOM 5369  C CA    . GLY J  4 46  ? 35.789  -50.104  -7.268  1.00 365.73 ? 53  GLY D CA    1 
ATOM 5370  C C     . GLY J  4 46  ? 36.777  -50.910  -6.426  1.00 369.97 ? 53  GLY D C     1 
ATOM 5371  O O     . GLY J  4 46  ? 36.925  -52.124  -6.646  1.00 377.32 ? 53  GLY D O     1 
ATOM 5372  N N     . VAL J  4 47  ? 37.441  -50.219  -5.477  1.00 362.04 ? 54  VAL D N     1 
ATOM 5373  C CA    . VAL J  4 47  ? 38.287  -50.804  -4.395  1.00 347.71 ? 54  VAL D CA    1 
ATOM 5374  C C     . VAL J  4 47  ? 37.515  -51.875  -3.581  1.00 345.79 ? 54  VAL D C     1 
ATOM 5375  O O     . VAL J  4 47  ? 38.030  -52.993  -3.363  1.00 349.34 ? 54  VAL D O     1 
ATOM 5376  C CB    . VAL J  4 47  ? 38.911  -49.701  -3.459  1.00 336.36 ? 54  VAL D CB    1 
ATOM 5377  C CG1   . VAL J  4 47  ? 39.501  -50.297  -2.184  1.00 329.64 ? 54  VAL D CG1   1 
ATOM 5378  C CG2   . VAL J  4 47  ? 39.980  -48.906  -4.184  1.00 328.43 ? 54  VAL D CG2   1 
ATOM 5379  N N     . ARG J  4 48  ? 36.288  -51.536  -3.158  1.00 333.05 ? 55  ARG D N     1 
ATOM 5380  C CA    . ARG J  4 48  ? 35.392  -52.446  -2.406  1.00 314.98 ? 55  ARG D CA    1 
ATOM 5381  C C     . ARG J  4 48  ? 35.079  -53.775  -3.143  1.00 316.92 ? 55  ARG D C     1 
ATOM 5382  O O     . ARG J  4 48  ? 34.915  -54.811  -2.493  1.00 305.52 ? 55  ARG D O     1 
ATOM 5383  C CB    . ARG J  4 48  ? 34.098  -51.729  -1.999  1.00 298.12 ? 55  ARG D CB    1 
ATOM 5384  C CG    . ARG J  4 48  ? 34.298  -50.418  -1.256  1.00 284.17 ? 55  ARG D CG    1 
ATOM 5385  C CD    . ARG J  4 48  ? 32.964  -49.933  -0.723  1.00 271.56 ? 55  ARG D CD    1 
ATOM 5386  N NE    . ARG J  4 48  ? 32.893  -48.494  -0.428  1.00 263.18 ? 55  ARG D NE    1 
ATOM 5387  C CZ    . ARG J  4 48  ? 31.987  -47.652  -0.935  1.00 259.75 ? 55  ARG D CZ    1 
ATOM 5388  N NH1   . ARG J  4 48  ? 31.075  -48.082  -1.794  1.00 261.89 ? 55  ARG D NH1   1 
ATOM 5389  N NH2   . ARG J  4 48  ? 31.990  -46.371  -0.580  1.00 254.18 ? 55  ARG D NH2   1 
ATOM 5390  N N     . GLN J  4 49  ? 35.020  -53.739  -4.484  1.00 327.07 ? 56  GLN D N     1 
ATOM 5391  C CA    . GLN J  4 49  ? 34.802  -54.943  -5.327  1.00 327.67 ? 56  GLN D CA    1 
ATOM 5392  C C     . GLN J  4 49  ? 36.040  -55.853  -5.487  1.00 323.99 ? 56  GLN D C     1 
ATOM 5393  O O     . GLN J  4 49  ? 35.910  -57.073  -5.342  1.00 324.89 ? 56  GLN D O     1 
ATOM 5394  C CB    . GLN J  4 49  ? 34.183  -54.592  -6.701  1.00 328.70 ? 56  GLN D CB    1 
ATOM 5395  C CG    . GLN J  4 49  ? 34.047  -55.769  -7.666  1.00 323.66 ? 56  GLN D CG    1 
ATOM 5396  C CD    . GLN J  4 49  ? 32.713  -56.505  -7.652  1.00 320.85 ? 56  GLN D CD    1 
ATOM 5397  O OE1   . GLN J  4 49  ? 31.710  -56.033  -7.102  1.00 321.36 ? 56  GLN D OE1   1 
ATOM 5398  N NE2   . GLN J  4 49  ? 32.695  -57.676  -8.294  1.00 315.56 ? 56  GLN D NE2   1 
ATOM 5399  N N     . ALA J  4 50  ? 37.216  -55.282  -5.781  1.00 315.65 ? 57  ALA D N     1 
ATOM 5400  C CA    . ALA J  4 50  ? 38.454  -56.083  -5.923  1.00 307.36 ? 57  ALA D CA    1 
ATOM 5401  C C     . ALA J  4 50  ? 38.789  -56.927  -4.682  1.00 305.13 ? 57  ALA D C     1 
ATOM 5402  O O     . ALA J  4 50  ? 39.041  -58.111  -4.817  1.00 306.13 ? 57  ALA D O     1 
ATOM 5403  C CB    . ALA J  4 50  ? 39.635  -55.220  -6.319  1.00 304.18 ? 57  ALA D CB    1 
ATOM 5404  N N     . GLN J  4 51  ? 38.765  -56.327  -3.491  1.00 303.57 ? 58  GLN D N     1 
ATOM 5405  C CA    . GLN J  4 51  ? 39.004  -57.054  -2.223  1.00 302.19 ? 58  GLN D CA    1 
ATOM 5406  C C     . GLN J  4 51  ? 37.921  -58.075  -1.832  1.00 292.24 ? 58  GLN D C     1 
ATOM 5407  O O     . GLN J  4 51  ? 38.193  -58.994  -1.062  1.00 288.76 ? 58  GLN D O     1 
ATOM 5408  C CB    . GLN J  4 51  ? 39.169  -56.076  -1.061  1.00 313.58 ? 58  GLN D CB    1 
ATOM 5409  C CG    . GLN J  4 51  ? 40.569  -55.550  -0.810  1.00 328.92 ? 58  GLN D CG    1 
ATOM 5410  C CD    . GLN J  4 51  ? 40.617  -54.544  0.334   1.00 340.26 ? 58  GLN D CD    1 
ATOM 5411  O OE1   . GLN J  4 51  ? 40.031  -53.440  0.274   1.00 349.55 ? 58  GLN D OE1   1 
ATOM 5412  N NE2   . GLN J  4 51  ? 41.323  -54.918  1.393   1.00 342.88 ? 58  GLN D NE2   1 
ATOM 5413  N N     . ALA J  4 52  ? 36.700  -57.896  -2.331  1.00 282.47 ? 59  ALA D N     1 
ATOM 5414  C CA    . ALA J  4 52  ? 35.600  -58.810  -2.031  1.00 277.36 ? 59  ALA D CA    1 
ATOM 5415  C C     . ALA J  4 52  ? 35.828  -60.161  -2.686  1.00 283.05 ? 59  ALA D C     1 
ATOM 5416  O O     . ALA J  4 52  ? 35.640  -61.194  -2.052  1.00 278.86 ? 59  ALA D O     1 
ATOM 5417  C CB    . ALA J  4 52  ? 34.279  -58.219  -2.483  1.00 270.11 ? 59  ALA D CB    1 
ATOM 5418  N N     . GLU J  4 53  ? 36.230  -60.131  -3.959  1.00 295.28 ? 60  GLU D N     1 
ATOM 5419  C CA    . GLU J  4 53  ? 36.693  -61.320  -4.705  1.00 309.24 ? 60  GLU D CA    1 
ATOM 5420  C C     . GLU J  4 53  ? 38.194  -61.568  -4.472  1.00 326.35 ? 60  GLU D C     1 
ATOM 5421  O O     . GLU J  4 53  ? 38.845  -62.317  -5.218  1.00 332.97 ? 60  GLU D O     1 
ATOM 5422  C CB    . GLU J  4 53  ? 36.353  -61.239  -6.227  1.00 301.71 ? 60  GLU D CB    1 
ATOM 5423  C CG    . GLU J  4 53  ? 36.776  -59.975  -6.998  1.00 289.53 ? 60  GLU D CG    1 
ATOM 5424  C CD    . GLU J  4 53  ? 36.143  -59.866  -8.392  1.00 283.03 ? 60  GLU D CD    1 
ATOM 5425  O OE1   . GLU J  4 53  ? 36.745  -60.378  -9.354  1.00 279.92 ? 60  GLU D OE1   1 
ATOM 5426  O OE2   . GLU J  4 53  ? 35.063  -59.248  -8.546  1.00 278.47 ? 60  GLU D OE2   1 
ATOM 5427  N N     . ASP J  4 54  ? 38.706  -60.939  -3.411  1.00 340.56 ? 61  ASP D N     1 
ATOM 5428  C CA    . ASP J  4 54  ? 40.145  -60.871  -3.062  1.00 352.20 ? 61  ASP D CA    1 
ATOM 5429  C C     . ASP J  4 54  ? 41.150  -60.880  -4.243  1.00 362.59 ? 61  ASP D C     1 
ATOM 5430  O O     . ASP J  4 54  ? 41.961  -61.798  -4.393  1.00 377.92 ? 61  ASP D O     1 
ATOM 5431  C CB    . ASP J  4 54  ? 40.495  -61.909  -1.969  1.00 345.24 ? 61  ASP D CB    1 
ATOM 5432  C CG    . ASP J  4 54  ? 41.742  -61.548  -1.164  1.00 337.93 ? 61  ASP D CG    1 
ATOM 5433  O OD1   . ASP J  4 54  ? 41.919  -60.366  -0.805  1.00 327.60 ? 61  ASP D OD1   1 
ATOM 5434  O OD2   . ASP J  4 54  ? 42.531  -62.473  -0.871  1.00 339.11 ? 61  ASP D OD2   1 
ATOM 5435  N N     . ALA J  4 55  ? 41.065  -59.851  -5.087  1.00 357.62 ? 62  ALA D N     1 
ATOM 5436  C CA    . ALA J  4 55  ? 42.064  -59.560  -6.121  1.00 351.90 ? 62  ALA D CA    1 
ATOM 5437  C C     . ALA J  4 55  ? 43.230  -58.770  -5.468  1.00 352.07 ? 62  ALA D C     1 
ATOM 5438  O O     . ALA J  4 55  ? 43.024  -58.113  -4.437  1.00 356.14 ? 62  ALA D O     1 
ATOM 5439  C CB    . ALA J  4 55  ? 41.412  -58.754  -7.236  1.00 342.68 ? 62  ALA D CB    1 
ATOM 5440  N N     . LEU J  4 56  ? 44.443  -58.828  -6.036  1.00 349.70 ? 63  LEU D N     1 
ATOM 5441  C CA    . LEU J  4 56  ? 45.584  -58.071  -5.457  1.00 345.55 ? 63  LEU D CA    1 
ATOM 5442  C C     . LEU J  4 56  ? 45.963  -56.738  -6.158  1.00 345.89 ? 63  LEU D C     1 
ATOM 5443  O O     . LEU J  4 56  ? 47.020  -56.146  -5.908  1.00 341.31 ? 63  LEU D O     1 
ATOM 5444  C CB    . LEU J  4 56  ? 46.748  -58.999  -5.103  1.00 345.19 ? 63  LEU D CB    1 
ATOM 5445  C CG    . LEU J  4 56  ? 46.279  -59.738  -3.843  1.00 342.40 ? 63  LEU D CG    1 
ATOM 5446  C CD1   . LEU J  4 56  ? 46.035  -61.223  -4.066  1.00 343.04 ? 63  LEU D CD1   1 
ATOM 5447  C CD2   . LEU J  4 56  ? 47.306  -59.542  -2.743  1.00 340.37 ? 63  LEU D CD2   1 
ATOM 5448  N N     . ARG J  4 57  ? 45.066  -56.307  -7.054  1.00 349.52 ? 64  ARG D N     1 
ATOM 5449  C CA    . ARG J  4 57  ? 44.644  -54.895  -7.251  1.00 357.59 ? 64  ARG D CA    1 
ATOM 5450  C C     . ARG J  4 57  ? 43.263  -54.842  -7.958  1.00 368.12 ? 64  ARG D C     1 
ATOM 5451  O O     . ARG J  4 57  ? 42.721  -55.886  -8.340  1.00 364.40 ? 64  ARG D O     1 
ATOM 5452  C CB    . ARG J  4 57  ? 45.711  -53.968  -7.880  1.00 349.71 ? 64  ARG D CB    1 
ATOM 5453  C CG    . ARG J  4 57  ? 46.283  -54.336  -9.242  1.00 340.45 ? 64  ARG D CG    1 
ATOM 5454  C CD    . ARG J  4 57  ? 47.012  -53.148  -9.873  1.00 332.41 ? 64  ARG D CD    1 
ATOM 5455  N NE    . ARG J  4 57  ? 48.213  -52.725  -9.137  1.00 324.77 ? 64  ARG D NE    1 
ATOM 5456  C CZ    . ARG J  4 57  ? 48.837  -51.557  -9.304  1.00 321.98 ? 64  ARG D CZ    1 
ATOM 5457  N NH1   . ARG J  4 57  ? 48.366  -50.664  -10.164 1.00 322.16 ? 64  ARG D NH1   1 
ATOM 5458  N NH2   . ARG J  4 57  ? 49.909  -51.271  -8.576  1.00 319.01 ? 64  ARG D NH2   1 
ATOM 5459  N N     . VAL J  4 58  ? 42.679  -53.651  -8.097  1.00 386.91 ? 65  VAL D N     1 
ATOM 5460  C CA    . VAL J  4 58  ? 41.347  -53.508  -8.725  1.00 404.33 ? 65  VAL D CA    1 
ATOM 5461  C C     . VAL J  4 58  ? 41.393  -53.539  -10.282 1.00 433.21 ? 65  VAL D C     1 
ATOM 5462  O O     . VAL J  4 58  ? 41.581  -52.492  -10.918 1.00 441.36 ? 65  VAL D O     1 
ATOM 5463  C CB    . VAL J  4 58  ? 40.594  -52.240  -8.212  1.00 394.39 ? 65  VAL D CB    1 
ATOM 5464  C CG1   . VAL J  4 58  ? 39.126  -52.249  -8.639  1.00 388.88 ? 65  VAL D CG1   1 
ATOM 5465  C CG2   . VAL J  4 58  ? 40.701  -52.104  -6.695  1.00 387.08 ? 65  VAL D CG2   1 
ATOM 5466  N N     . ASP J  4 59  ? 41.211  -54.735  -10.871 1.00 461.44 ? 66  ASP D N     1 
ATOM 5467  C CA    . ASP J  4 59  ? 41.092  -54.957  -12.355 1.00 478.24 ? 66  ASP D CA    1 
ATOM 5468  C C     . ASP J  4 59  ? 39.672  -54.633  -12.916 1.00 497.43 ? 66  ASP D C     1 
ATOM 5469  O O     . ASP J  4 59  ? 38.735  -54.386  -12.122 1.00 499.71 ? 66  ASP D O     1 
ATOM 5470  C CB    . ASP J  4 59  ? 41.478  -56.414  -12.710 1.00 460.53 ? 66  ASP D CB    1 
ATOM 5471  C CG    . ASP J  4 59  ? 42.248  -56.529  -14.048 1.00 438.99 ? 66  ASP D CG    1 
ATOM 5472  O OD1   . ASP J  4 59  ? 41.648  -56.424  -15.141 1.00 419.68 ? 66  ASP D OD1   1 
ATOM 5473  O OD2   . ASP J  4 59  ? 43.475  -56.753  -13.995 1.00 434.87 ? 66  ASP D OD2   1 
ATOM 5474  N N     . VAL J  4 60  ? 39.507  -54.647  -14.256 1.00 496.79 ? 67  VAL D N     1 
ATOM 5475  C CA    . VAL J  4 60  ? 38.218  -54.262  -14.904 1.00 488.22 ? 67  VAL D CA    1 
ATOM 5476  C C     . VAL J  4 60  ? 36.988  -55.064  -14.403 1.00 489.62 ? 67  VAL D C     1 
ATOM 5477  O O     . VAL J  4 60  ? 35.945  -54.464  -14.135 1.00 498.53 ? 67  VAL D O     1 
ATOM 5478  C CB    . VAL J  4 60  ? 38.236  -54.240  -16.468 1.00 480.04 ? 67  VAL D CB    1 
ATOM 5479  C CG1   . VAL J  4 60  ? 37.617  -52.947  -16.979 1.00 472.56 ? 67  VAL D CG1   1 
ATOM 5480  C CG2   . VAL J  4 60  ? 39.627  -54.435  -17.048 1.00 471.11 ? 67  VAL D CG2   1 
ATOM 5481  N N     . ASP J  4 61  ? 37.128  -56.394  -14.274 1.00 475.10 ? 68  ASP D N     1 
ATOM 5482  C CA    . ASP J  4 61  ? 36.107  -57.317  -13.703 1.00 440.76 ? 68  ASP D CA    1 
ATOM 5483  C C     . ASP J  4 61  ? 35.346  -56.788  -12.464 1.00 399.41 ? 68  ASP D C     1 
ATOM 5484  O O     . ASP J  4 61  ? 34.117  -56.844  -12.410 1.00 384.47 ? 68  ASP D O     1 
ATOM 5485  C CB    . ASP J  4 61  ? 36.776  -58.658  -13.358 1.00 455.48 ? 68  ASP D CB    1 
ATOM 5486  C CG    . ASP J  4 61  ? 37.231  -59.463  -14.594 1.00 464.06 ? 68  ASP D CG    1 
ATOM 5487  O OD1   . ASP J  4 61  ? 37.794  -58.914  -15.581 1.00 471.44 ? 68  ASP D OD1   1 
ATOM 5488  O OD2   . ASP J  4 61  ? 37.042  -60.689  -14.543 1.00 457.84 ? 68  ASP D OD2   1 
ATOM 5489  N N     . GLN J  4 62  ? 36.093  -56.269  -11.492 1.00 362.35 ? 69  GLN D N     1 
ATOM 5490  C CA    . GLN J  4 62  ? 35.546  -55.714  -10.257 1.00 329.03 ? 69  GLN D CA    1 
ATOM 5491  C C     . GLN J  4 62  ? 34.742  -54.434  -10.450 1.00 320.37 ? 69  GLN D C     1 
ATOM 5492  O O     . GLN J  4 62  ? 33.516  -54.420  -10.325 1.00 308.24 ? 69  GLN D O     1 
ATOM 5493  C CB    . GLN J  4 62  ? 36.673  -55.477  -9.256  1.00 321.39 ? 69  GLN D CB    1 
ATOM 5494  C CG    . GLN J  4 62  ? 37.233  -56.767  -8.690  1.00 315.43 ? 69  GLN D CG    1 
ATOM 5495  C CD    . GLN J  4 62  ? 38.388  -57.325  -9.489  1.00 318.09 ? 69  GLN D CD    1 
ATOM 5496  O OE1   . GLN J  4 62  ? 39.280  -56.587  -9.905  1.00 326.26 ? 69  GLN D OE1   1 
ATOM 5497  N NE2   . GLN J  4 62  ? 38.382  -58.634  -9.708  1.00 313.91 ? 69  GLN D NE2   1 
ATOM 5498  N N     . LEU J  4 63  ? 35.443  -53.353  -10.738 1.00 322.95 ? 70  LEU D N     1 
ATOM 5499  C CA    . LEU J  4 63  ? 34.807  -52.101  -11.114 1.00 332.37 ? 70  LEU D CA    1 
ATOM 5500  C C     . LEU J  4 63  ? 33.564  -52.263  -12.057 1.00 356.40 ? 70  LEU D C     1 
ATOM 5501  O O     . LEU J  4 63  ? 32.520  -51.644  -11.828 1.00 362.89 ? 70  LEU D O     1 
ATOM 5502  C CB    . LEU J  4 63  ? 35.868  -51.183  -11.723 1.00 318.54 ? 70  LEU D CB    1 
ATOM 5503  C CG    . LEU J  4 63  ? 35.386  -49.821  -12.180 1.00 308.94 ? 70  LEU D CG    1 
ATOM 5504  C CD1   . LEU J  4 63  ? 35.232  -48.916  -10.976 1.00 305.63 ? 70  LEU D CD1   1 
ATOM 5505  C CD2   . LEU J  4 63  ? 36.332  -49.240  -13.197 1.00 304.43 ? 70  LEU D CD2   1 
ATOM 5506  N N     . GLU J  4 64  ? 33.658  -53.103  -13.098 1.00 387.74 ? 71  GLU D N     1 
ATOM 5507  C CA    . GLU J  4 64  ? 32.524  -53.318  -14.053 1.00 403.75 ? 71  GLU D CA    1 
ATOM 5508  C C     . GLU J  4 64  ? 31.306  -54.086  -13.480 1.00 383.12 ? 71  GLU D C     1 
ATOM 5509  O O     . GLU J  4 64  ? 30.188  -53.961  -13.997 1.00 388.70 ? 71  GLU D O     1 
ATOM 5510  C CB    . GLU J  4 64  ? 32.987  -53.983  -15.369 1.00 432.64 ? 71  GLU D CB    1 
ATOM 5511  C CG    . GLU J  4 64  ? 33.800  -53.112  -16.329 1.00 454.37 ? 71  GLU D CG    1 
ATOM 5512  C CD    . GLU J  4 64  ? 34.230  -53.861  -17.596 1.00 469.74 ? 71  GLU D CD    1 
ATOM 5513  O OE1   . GLU J  4 64  ? 34.120  -55.110  -17.654 1.00 478.45 ? 71  GLU D OE1   1 
ATOM 5514  O OE2   . GLU J  4 64  ? 34.686  -53.204  -18.554 1.00 478.30 ? 71  GLU D OE2   1 
ATOM 5515  N N     . LYS J  4 65  ? 31.522  -54.885  -12.437 1.00 346.28 ? 72  LYS D N     1 
ATOM 5516  C CA    . LYS J  4 65  ? 30.404  -55.495  -11.728 1.00 311.76 ? 72  LYS D CA    1 
ATOM 5517  C C     . LYS J  4 65  ? 29.787  -54.445  -10.783 1.00 302.50 ? 72  LYS D C     1 
ATOM 5518  O O     . LYS J  4 65  ? 28.672  -54.625  -10.290 1.00 290.14 ? 72  LYS D O     1 
ATOM 5519  C CB    . LYS J  4 65  ? 30.839  -56.793  -11.029 1.00 292.47 ? 72  LYS D CB    1 
ATOM 5520  C CG    . LYS J  4 65  ? 31.078  -57.949  -12.008 1.00 278.96 ? 72  LYS D CG    1 
ATOM 5521  C CD    . LYS J  4 65  ? 32.053  -59.005  -11.483 1.00 265.15 ? 72  LYS D CD    1 
ATOM 5522  C CE    . LYS J  4 65  ? 32.521  -59.940  -12.598 1.00 261.22 ? 72  LYS D CE    1 
ATOM 5523  N NZ    . LYS J  4 65  ? 33.653  -60.830  -12.212 1.00 257.44 ? 72  LYS D NZ    1 
ATOM 5524  N N     . VAL J  4 66  ? 30.519  -53.338  -10.576 1.00 302.47 ? 73  VAL D N     1 
ATOM 5525  C CA    . VAL J  4 66  ? 30.018  -52.126  -9.887  1.00 300.31 ? 73  VAL D CA    1 
ATOM 5526  C C     . VAL J  4 66  ? 29.581  -50.991  -10.844 1.00 307.23 ? 73  VAL D C     1 
ATOM 5527  O O     . VAL J  4 66  ? 28.997  -50.000  -10.407 1.00 309.93 ? 73  VAL D O     1 
ATOM 5528  C CB    . VAL J  4 66  ? 31.031  -51.538  -8.847  1.00 293.99 ? 73  VAL D CB    1 
ATOM 5529  C CG1   . VAL J  4 66  ? 31.919  -52.614  -8.250  1.00 289.29 ? 73  VAL D CG1   1 
ATOM 5530  C CG2   . VAL J  4 66  ? 31.893  -50.427  -9.440  1.00 293.57 ? 73  VAL D CG2   1 
ATOM 5531  N N     . LEU J  4 67  ? 29.879  -51.103  -12.136 1.00 311.29 ? 74  LEU D N     1 
ATOM 5532  C CA    . LEU J  4 67  ? 29.485  -50.039  -13.074 1.00 307.29 ? 74  LEU D CA    1 
ATOM 5533  C C     . LEU J  4 67  ? 28.005  -50.065  -13.453 1.00 310.59 ? 74  LEU D C     1 
ATOM 5534  O O     . LEU J  4 67  ? 27.428  -49.012  -13.740 1.00 305.69 ? 74  LEU D O     1 
ATOM 5535  C CB    . LEU J  4 67  ? 30.369  -50.021  -14.313 1.00 303.46 ? 74  LEU D CB    1 
ATOM 5536  C CG    . LEU J  4 67  ? 31.815  -49.599  -14.044 1.00 300.27 ? 74  LEU D CG    1 
ATOM 5537  C CD1   . LEU J  4 67  ? 32.558  -49.304  -15.341 1.00 300.19 ? 74  LEU D CD1   1 
ATOM 5538  C CD2   . LEU J  4 67  ? 31.889  -48.405  -13.107 1.00 293.84 ? 74  LEU D CD2   1 
ATOM 5539  N N     . PRO J  4 68  ? 27.385  -51.269  -13.452 1.00 317.57 ? 75  PRO D N     1 
ATOM 5540  C CA    . PRO J  4 68  ? 25.933  -51.409  -13.570 1.00 327.65 ? 75  PRO D CA    1 
ATOM 5541  C C     . PRO J  4 68  ? 25.133  -50.525  -12.606 1.00 343.72 ? 75  PRO D C     1 
ATOM 5542  O O     . PRO J  4 68  ? 24.316  -49.702  -13.033 1.00 349.43 ? 75  PRO D O     1 
ATOM 5543  C CB    . PRO J  4 68  ? 25.710  -52.880  -13.206 1.00 317.84 ? 75  PRO D CB    1 
ATOM 5544  C CG    . PRO J  4 68  ? 26.919  -53.575  -13.701 1.00 313.70 ? 75  PRO D CG    1 
ATOM 5545  C CD    . PRO J  4 68  ? 28.045  -52.593  -13.505 1.00 316.89 ? 75  PRO D CD    1 
ATOM 5546  N N     . GLN J  4 69  ? 25.363  -50.720  -11.312 1.00 362.30 ? 76  GLN D N     1 
ATOM 5547  C CA    . GLN J  4 69  ? 24.716  -49.929  -10.248 1.00 378.35 ? 76  GLN D CA    1 
ATOM 5548  C C     . GLN J  4 69  ? 25.196  -48.444  -10.171 1.00 365.63 ? 76  GLN D C     1 
ATOM 5549  O O     . GLN J  4 69  ? 24.522  -47.612  -9.523  1.00 372.44 ? 76  GLN D O     1 
ATOM 5550  C CB    . GLN J  4 69  ? 24.803  -50.680  -8.879  1.00 403.82 ? 76  GLN D CB    1 
ATOM 5551  C CG    . GLN J  4 69  ? 24.362  -49.942  -7.597  1.00 423.64 ? 76  GLN D CG    1 
ATOM 5552  C CD    . GLN J  4 69  ? 22.926  -50.202  -7.165  1.00 427.58 ? 76  GLN D CD    1 
ATOM 5553  O OE1   . GLN J  4 69  ? 22.407  -51.310  -7.309  1.00 432.09 ? 76  GLN D OE1   1 
ATOM 5554  N NE2   . GLN J  4 69  ? 22.288  -49.183  -6.591  1.00 433.28 ? 76  GLN D NE2   1 
ATOM 5555  N N     . LEU J  4 70  ? 26.328  -48.113  -10.822 1.00 341.65 ? 77  LEU D N     1 
ATOM 5556  C CA    . LEU J  4 70  ? 26.878  -46.737  -10.805 1.00 318.56 ? 77  LEU D CA    1 
ATOM 5557  C C     . LEU J  4 70  ? 26.031  -45.774  -11.637 1.00 316.98 ? 77  LEU D C     1 
ATOM 5558  O O     . LEU J  4 70  ? 25.852  -44.617  -11.273 1.00 317.55 ? 77  LEU D O     1 
ATOM 5559  C CB    . LEU J  4 70  ? 28.341  -46.715  -11.262 1.00 304.40 ? 77  LEU D CB    1 
ATOM 5560  C CG    . LEU J  4 70  ? 29.142  -45.419  -11.160 1.00 297.39 ? 77  LEU D CG    1 
ATOM 5561  C CD1   . LEU J  4 70  ? 28.919  -44.680  -9.845  1.00 296.45 ? 77  LEU D CD1   1 
ATOM 5562  C CD2   . LEU J  4 70  ? 30.604  -45.767  -11.323 1.00 294.41 ? 77  LEU D CD2   1 
ATOM 5563  N N     . LEU J  4 71  ? 25.493  -46.287  -12.735 1.00 316.61 ? 78  LEU D N     1 
ATOM 5564  C CA    . LEU J  4 71  ? 24.661  -45.516  -13.648 1.00 318.20 ? 78  LEU D CA    1 
ATOM 5565  C C     . LEU J  4 71  ? 23.203  -45.328  -13.149 1.00 318.21 ? 78  LEU D C     1 
ATOM 5566  O O     . LEU J  4 71  ? 22.538  -44.348  -13.498 1.00 316.90 ? 78  LEU D O     1 
ATOM 5567  C CB    . LEU J  4 71  ? 24.719  -46.185  -15.028 1.00 318.96 ? 78  LEU D CB    1 
ATOM 5568  C CG    . LEU J  4 71  ? 26.126  -46.582  -15.504 1.00 319.36 ? 78  LEU D CG    1 
ATOM 5569  C CD1   . LEU J  4 71  ? 26.059  -47.387  -16.793 1.00 321.08 ? 78  LEU D CD1   1 
ATOM 5570  C CD2   . LEU J  4 71  ? 27.003  -45.352  -15.677 1.00 320.43 ? 78  LEU D CD2   1 
ATOM 5571  N N     . LEU J  4 72  ? 22.723  -46.259  -12.318 1.00 316.64 ? 79  LEU D N     1 
ATOM 5572  C CA    . LEU J  4 72  ? 21.375  -46.173  -11.692 1.00 310.71 ? 79  LEU D CA    1 
ATOM 5573  C C     . LEU J  4 72  ? 21.255  -45.055  -10.640 1.00 311.41 ? 79  LEU D C     1 
ATOM 5574  O O     . LEU J  4 72  ? 20.202  -44.420  -10.495 1.00 313.05 ? 79  LEU D O     1 
ATOM 5575  C CB    . LEU J  4 72  ? 20.981  -47.506  -11.010 1.00 297.67 ? 79  LEU D CB    1 
ATOM 5576  C CG    . LEU J  4 72  ? 21.025  -48.903  -11.641 1.00 287.33 ? 79  LEU D CG    1 
ATOM 5577  C CD1   . LEU J  4 72  ? 20.802  -49.942  -10.552 1.00 277.09 ? 79  LEU D CD1   1 
ATOM 5578  C CD2   . LEU J  4 72  ? 19.985  -49.014  -12.741 1.00 286.28 ? 79  LEU D CD2   1 
ATOM 5579  N N     . ASP J  4 73  ? 22.327  -44.872  -9.871  1.00 308.46 ? 80  ASP D N     1 
ATOM 5580  C CA    . ASP J  4 73  ? 22.404  -43.853  -8.821  1.00 301.88 ? 80  ASP D CA    1 
ATOM 5581  C C     . ASP J  4 73  ? 22.794  -42.495  -9.401  1.00 299.94 ? 80  ASP D C     1 
ATOM 5582  O O     . ASP J  4 73  ? 22.637  -41.473  -8.727  1.00 300.14 ? 80  ASP D O     1 
ATOM 5583  C CB    . ASP J  4 73  ? 23.419  -44.260  -7.743  1.00 301.95 ? 80  ASP D CB    1 
ATOM 5584  C CG    . ASP J  4 73  ? 22.843  -45.220  -6.709  1.00 300.02 ? 80  ASP D CG    1 
ATOM 5585  O OD1   . ASP J  4 73  ? 21.608  -45.377  -6.619  1.00 297.70 ? 80  ASP D OD1   1 
ATOM 5586  O OD2   . ASP J  4 73  ? 23.644  -45.817  -5.962  1.00 300.22 ? 80  ASP D OD2   1 
ATOM 5587  N N     . PHE J  4 74  ? 23.311  -42.504  -10.637 1.00 295.27 ? 81  PHE D N     1 
ATOM 5588  C CA    . PHE J  4 74  ? 23.726  -41.299  -11.381 1.00 289.19 ? 81  PHE D CA    1 
ATOM 5589  C C     . PHE J  4 74  ? 23.229  -41.364  -12.838 1.00 278.59 ? 81  PHE D C     1 
ATOM 5590  O O     . PHE J  4 74  ? 22.315  -40.641  -13.248 1.00 266.90 ? 81  PHE D O     1 
ATOM 5591  C CB    . PHE J  4 74  ? 25.264  -41.147  -11.376 1.00 297.35 ? 81  PHE D CB    1 
ATOM 5592  C CG    . PHE J  4 74  ? 25.866  -40.699  -10.046 1.00 302.58 ? 81  PHE D CG    1 
ATOM 5593  C CD1   . PHE J  4 74  ? 25.623  -39.415  -9.528  1.00 300.91 ? 81  PHE D CD1   1 
ATOM 5594  C CD2   . PHE J  4 74  ? 26.738  -41.542  -9.342  1.00 306.42 ? 81  PHE D CD2   1 
ATOM 5595  C CE1   . PHE J  4 74  ? 26.197  -39.008  -8.322  1.00 298.75 ? 81  PHE D CE1   1 
ATOM 5596  C CE2   . PHE J  4 74  ? 27.310  -41.130  -8.140  1.00 304.43 ? 81  PHE D CE2   1 
ATOM 5597  C CZ    . PHE J  4 74  ? 27.043  -39.863  -7.632  1.00 299.81 ? 81  PHE D CZ    1 
ATOM 5598  N N     . SER K  3 1   ? 6.575   -56.901  16.276  1.00 349.07 ? 14  SER G N     1 
ATOM 5599  C CA    . SER K  3 1   ? 6.478   -55.510  15.722  1.00 347.55 ? 14  SER G CA    1 
ATOM 5600  C C     . SER K  3 1   ? 5.622   -55.477  14.451  1.00 336.17 ? 14  SER G C     1 
ATOM 5601  O O     . SER K  3 1   ? 5.483   -56.485  13.747  1.00 329.25 ? 14  SER G O     1 
ATOM 5602  C CB    . SER K  3 1   ? 7.876   -54.901  15.453  1.00 354.81 ? 14  SER G CB    1 
ATOM 5603  O OG    . SER K  3 1   ? 7.852   -53.471  15.327  1.00 364.82 ? 14  SER G OG    1 
ATOM 5604  N N     . TYR K  3 2   ? 5.065   -54.296  14.182  1.00 326.92 ? 15  TYR G N     1 
ATOM 5605  C CA    . TYR K  3 2   ? 4.281   -53.987  12.979  1.00 314.74 ? 15  TYR G CA    1 
ATOM 5606  C C     . TYR K  3 2   ? 5.058   -54.181  11.680  1.00 301.24 ? 15  TYR G C     1 
ATOM 5607  O O     . TYR K  3 2   ? 4.510   -54.732  10.737  1.00 296.02 ? 15  TYR G O     1 
ATOM 5608  C CB    . TYR K  3 2   ? 3.790   -52.546  13.037  1.00 320.38 ? 15  TYR G CB    1 
ATOM 5609  C CG    . TYR K  3 2   ? 2.445   -52.313  12.415  1.00 323.77 ? 15  TYR G CG    1 
ATOM 5610  C CD1   . TYR K  3 2   ? 1.286   -52.420  13.189  1.00 326.98 ? 15  TYR G CD1   1 
ATOM 5611  C CD2   . TYR K  3 2   ? 2.321   -51.959  11.071  1.00 324.21 ? 15  TYR G CD2   1 
ATOM 5612  C CE1   . TYR K  3 2   ? 0.036   -52.189  12.645  1.00 331.24 ? 15  TYR G CE1   1 
ATOM 5613  C CE2   . TYR K  3 2   ? 1.067   -51.725  10.512  1.00 328.57 ? 15  TYR G CE2   1 
ATOM 5614  C CZ    . TYR K  3 2   ? -0.072  -51.845  11.306  1.00 332.57 ? 15  TYR G CZ    1 
ATOM 5615  O OH    . TYR K  3 2   ? -1.333  -51.624  10.785  1.00 338.82 ? 15  TYR G OH    1 
ATOM 5616  N N     . GLN K  3 3   ? 6.307   -53.692  11.639  1.00 289.60 ? 16  GLN G N     1 
ATOM 5617  C CA    . GLN K  3 3   ? 7.295   -54.021  10.588  1.00 278.73 ? 16  GLN G CA    1 
ATOM 5618  C C     . GLN K  3 3   ? 7.419   -55.547  10.343  1.00 278.03 ? 16  GLN G C     1 
ATOM 5619  O O     . GLN K  3 3   ? 7.169   -56.004  9.222   1.00 275.49 ? 16  GLN G O     1 
ATOM 5620  C CB    . GLN K  3 3   ? 8.672   -53.367  10.878  1.00 271.15 ? 16  GLN G CB    1 
ATOM 5621  C CG    . GLN K  3 3   ? 8.762   -51.877  10.533  1.00 265.73 ? 16  GLN G CG    1 
ATOM 5622  C CD    . GLN K  3 3   ? 10.180  -51.320  10.566  1.00 260.13 ? 16  GLN G CD    1 
ATOM 5623  O OE1   . GLN K  3 3   ? 11.078  -51.862  9.939   1.00 254.77 ? 16  GLN G OE1   1 
ATOM 5624  N NE2   . GLN K  3 3   ? 10.376  -50.215  11.281  1.00 259.99 ? 16  GLN G NE2   1 
ATOM 5625  N N     . GLN K  3 4   ? 7.762   -56.318  11.384  1.00 281.67 ? 17  GLN G N     1 
ATOM 5626  C CA    . GLN K  3 4   ? 7.872   -57.799  11.332  1.00 284.06 ? 17  GLN G CA    1 
ATOM 5627  C C     . GLN K  3 4   ? 6.592   -58.494  10.864  1.00 283.33 ? 17  GLN G C     1 
ATOM 5628  O O     . GLN K  3 4   ? 6.636   -59.500  10.146  1.00 285.21 ? 17  GLN G O     1 
ATOM 5629  C CB    . GLN K  3 4   ? 8.187   -58.359  12.718  1.00 291.95 ? 17  GLN G CB    1 
ATOM 5630  C CG    . GLN K  3 4   ? 9.565   -58.062  13.288  1.00 297.54 ? 17  GLN G CG    1 
ATOM 5631  C CD    . GLN K  3 4   ? 9.677   -58.458  14.748  1.00 305.91 ? 17  GLN G CD    1 
ATOM 5632  O OE1   . GLN K  3 4   ? 8.803   -58.134  15.546  1.00 314.50 ? 17  GLN G OE1   1 
ATOM 5633  N NE2   . GLN K  3 4   ? 10.758  -59.141  15.102  1.00 305.66 ? 17  GLN G NE2   1 
ATOM 5634  N N     . ARG K  3 5   ? 5.465   -57.957  11.318  1.00 280.57 ? 18  ARG G N     1 
ATOM 5635  C CA    . ARG K  3 5   ? 4.127   -58.453  11.037  1.00 277.80 ? 18  ARG G CA    1 
ATOM 5636  C C     . ARG K  3 5   ? 3.842   -58.349  9.537   1.00 274.31 ? 18  ARG G C     1 
ATOM 5637  O O     . ARG K  3 5   ? 3.414   -59.312  8.897   1.00 273.95 ? 18  ARG G O     1 
ATOM 5638  C CB    . ARG K  3 5   ? 3.158   -57.568  11.792  1.00 278.50 ? 18  ARG G CB    1 
ATOM 5639  C CG    . ARG K  3 5   ? 2.176   -58.232  12.728  1.00 280.63 ? 18  ARG G CG    1 
ATOM 5640  C CD    . ARG K  3 5   ? 1.354   -57.097  13.295  1.00 283.71 ? 18  ARG G CD    1 
ATOM 5641  N NE    . ARG K  3 5   ? 1.009   -56.238  12.172  1.00 285.61 ? 18  ARG G NE    1 
ATOM 5642  C CZ    . ARG K  3 5   ? -0.089  -56.385  11.440  1.00 289.85 ? 18  ARG G CZ    1 
ATOM 5643  N NH1   . ARG K  3 5   ? -0.312  -55.586  10.409  1.00 291.34 ? 18  ARG G NH1   1 
ATOM 5644  N NH2   . ARG K  3 5   ? -0.973  -57.329  11.740  1.00 293.70 ? 18  ARG G NH2   1 
ATOM 5645  N N     . LEU K  3 6   ? 4.104   -57.167  8.982   1.00 270.81 ? 19  LEU G N     1 
ATOM 5646  C CA    . LEU K  3 6   ? 3.985   -56.919  7.543   1.00 268.28 ? 19  LEU G CA    1 
ATOM 5647  C C     . LEU K  3 6   ? 4.975   -57.754  6.750   1.00 268.18 ? 19  LEU G C     1 
ATOM 5648  O O     . LEU K  3 6   ? 4.623   -58.238  5.681   1.00 268.18 ? 19  LEU G O     1 
ATOM 5649  C CB    . LEU K  3 6   ? 4.167   -55.437  7.202   1.00 265.60 ? 19  LEU G CB    1 
ATOM 5650  C CG    . LEU K  3 6   ? 3.086   -54.480  7.725   1.00 266.79 ? 19  LEU G CG    1 
ATOM 5651  C CD1   . LEU K  3 6   ? 3.466   -53.039  7.461   1.00 265.86 ? 19  LEU G CD1   1 
ATOM 5652  C CD2   . LEU K  3 6   ? 1.709   -54.782  7.149   1.00 267.26 ? 19  LEU G CD2   1 
ATOM 5653  N N     . LYS K  3 7   ? 6.199   -57.911  7.278   1.00 270.36 ? 20  LYS G N     1 
ATOM 5654  C CA    . LYS K  3 7   ? 7.232   -58.793  6.692   1.00 270.89 ? 20  LYS G CA    1 
ATOM 5655  C C     . LYS K  3 7   ? 6.731   -60.228  6.535   1.00 275.99 ? 20  LYS G C     1 
ATOM 5656  O O     . LYS K  3 7   ? 6.915   -60.806  5.475   1.00 276.63 ? 20  LYS G O     1 
ATOM 5657  C CB    . LYS K  3 7   ? 8.556   -58.791  7.486   1.00 266.62 ? 20  LYS G CB    1 
ATOM 5658  C CG    . LYS K  3 7   ? 9.493   -57.617  7.243   1.00 262.77 ? 20  LYS G CG    1 
ATOM 5659  C CD    . LYS K  3 7   ? 10.574  -57.577  8.312   1.00 260.40 ? 20  LYS G CD    1 
ATOM 5660  C CE    . LYS K  3 7   ? 11.096  -56.170  8.545   1.00 260.41 ? 20  LYS G CE    1 
ATOM 5661  N NZ    . LYS K  3 7   ? 11.671  -56.078  9.914   1.00 260.36 ? 20  LYS G NZ    1 
ATOM 5662  N N     . ALA K  3 8   ? 6.100   -60.794  7.564   1.00 283.00 ? 21  ALA G N     1 
ATOM 5663  C CA    . ALA K  3 8   ? 5.578   -62.162  7.473   1.00 286.21 ? 21  ALA G CA    1 
ATOM 5664  C C     . ALA K  3 8   ? 4.372   -62.311  6.533   1.00 290.96 ? 21  ALA G C     1 
ATOM 5665  O O     . ALA K  3 8   ? 4.243   -63.343  5.880   1.00 288.47 ? 21  ALA G O     1 
ATOM 5666  C CB    . ALA K  3 8   ? 5.266   -62.719  8.843   1.00 288.00 ? 21  ALA G CB    1 
ATOM 5667  N N     . ALA K  3 9   ? 3.514   -61.288  6.457   1.00 299.02 ? 22  ALA G N     1 
ATOM 5668  C CA    . ALA K  3 9   ? 2.424   -61.228  5.459   1.00 309.83 ? 22  ALA G CA    1 
ATOM 5669  C C     . ALA K  3 9   ? 2.918   -61.098  3.986   1.00 322.94 ? 22  ALA G C     1 
ATOM 5670  O O     . ALA K  3 9   ? 2.357   -61.722  3.076   1.00 329.25 ? 22  ALA G O     1 
ATOM 5671  C CB    . ALA K  3 9   ? 1.441   -60.118  5.810   1.00 304.21 ? 22  ALA G CB    1 
ATOM 5672  N N     . VAL K  3 10  ? 3.959   -60.286  3.762   1.00 337.00 ? 23  VAL G N     1 
ATOM 5673  C CA    . VAL K  3 10  ? 4.666   -60.177  2.444   1.00 344.10 ? 23  VAL G CA    1 
ATOM 5674  C C     . VAL K  3 10  ? 5.374   -61.501  2.061   1.00 352.75 ? 23  VAL G C     1 
ATOM 5675  O O     . VAL K  3 10  ? 5.386   -61.908  0.889   1.00 345.35 ? 23  VAL G O     1 
ATOM 5676  C CB    . VAL K  3 10  ? 5.708   -59.007  2.435   1.00 337.57 ? 23  VAL G CB    1 
ATOM 5677  C CG1   . VAL K  3 10  ? 6.559   -58.978  1.158   1.00 329.23 ? 23  VAL G CG1   1 
ATOM 5678  C CG2   . VAL K  3 10  ? 5.039   -57.660  2.665   1.00 337.55 ? 23  VAL G CG2   1 
ATOM 5679  N N     . HIS K  3 11  ? 5.973   -62.145  3.069   1.00 366.01 ? 24  HIS G N     1 
ATOM 5680  C CA    . HIS K  3 11  ? 6.668   -63.443  2.956   1.00 373.36 ? 24  HIS G CA    1 
ATOM 5681  C C     . HIS K  3 11  ? 5.759   -64.510  2.367   1.00 369.96 ? 24  HIS G C     1 
ATOM 5682  O O     . HIS K  3 11  ? 6.186   -65.339  1.558   1.00 365.82 ? 24  HIS G O     1 
ATOM 5683  C CB    . HIS K  3 11  ? 7.126   -63.895  4.345   1.00 386.29 ? 24  HIS G CB    1 
ATOM 5684  C CG    . HIS K  3 11  ? 8.163   -64.969  4.325   1.00 398.23 ? 24  HIS G CG    1 
ATOM 5685  N ND1   . HIS K  3 11  ? 9.258   -64.934  3.489   1.00 402.28 ? 24  HIS G ND1   1 
ATOM 5686  C CD2   . HIS K  3 11  ? 8.287   -66.096  5.061   1.00 404.07 ? 24  HIS G CD2   1 
ATOM 5687  C CE1   . HIS K  3 11  ? 10.002  -66.004  3.696   1.00 407.84 ? 24  HIS G CE1   1 
ATOM 5688  N NE2   . HIS K  3 11  ? 9.434   -66.727  4.645   1.00 409.82 ? 24  HIS G NE2   1 
ATOM 5689  N N     . TYR K  3 12  ? 4.503   -64.472  2.802   1.00 371.05 ? 25  TYR G N     1 
ATOM 5690  C CA    . TYR K  3 12  ? 3.446   -65.298  2.261   1.00 367.48 ? 25  TYR G CA    1 
ATOM 5691  C C     . TYR K  3 12  ? 3.379   -65.143  0.764   1.00 350.30 ? 25  TYR G C     1 
ATOM 5692  O O     . TYR K  3 12  ? 3.511   -66.125  0.047   1.00 347.93 ? 25  TYR G O     1 
ATOM 5693  C CB    . TYR K  3 12  ? 2.108   -64.864  2.847   1.00 381.78 ? 25  TYR G CB    1 
ATOM 5694  C CG    . TYR K  3 12  ? 0.889   -65.455  2.164   1.00 390.53 ? 25  TYR G CG    1 
ATOM 5695  C CD1   . TYR K  3 12  ? 0.458   -66.750  2.474   1.00 394.08 ? 25  TYR G CD1   1 
ATOM 5696  C CD2   . TYR K  3 12  ? 0.147   -64.715  1.226   1.00 389.34 ? 25  TYR G CD2   1 
ATOM 5697  C CE1   . TYR K  3 12  ? -0.668  -67.299  1.869   1.00 392.82 ? 25  TYR G CE1   1 
ATOM 5698  C CE2   . TYR K  3 12  ? -0.980  -65.262  0.611   1.00 388.39 ? 25  TYR G CE2   1 
ATOM 5699  C CZ    . TYR K  3 12  ? -1.383  -66.554  0.941   1.00 389.58 ? 25  TYR G CZ    1 
ATOM 5700  O OH    . TYR K  3 12  ? -2.497  -67.123  0.362   1.00 383.52 ? 25  TYR G OH    1 
ATOM 5701  N N     . THR K  3 13  ? 3.163   -63.908  0.305   1.00 332.45 ? 26  THR G N     1 
ATOM 5702  C CA    . THR K  3 13  ? 2.912   -63.670  -1.107  1.00 316.16 ? 26  THR G CA    1 
ATOM 5703  C C     . THR K  3 13  ? 4.137   -63.821  -2.015  1.00 311.62 ? 26  THR G C     1 
ATOM 5704  O O     . THR K  3 13  ? 3.999   -64.260  -3.161  1.00 312.76 ? 26  THR G O     1 
ATOM 5705  C CB    . THR K  3 13  ? 2.167   -62.367  -1.369  1.00 310.85 ? 26  THR G CB    1 
ATOM 5706  O OG1   . THR K  3 13  ? 1.323   -62.081  -0.256  1.00 309.65 ? 26  THR G OG1   1 
ATOM 5707  C CG2   . THR K  3 13  ? 1.326   -62.536  -2.564  1.00 308.74 ? 26  THR G CG2   1 
ATOM 5708  N N     . VAL K  3 14  ? 5.323   -63.477  -1.510  1.00 307.77 ? 27  VAL G N     1 
ATOM 5709  C CA    . VAL K  3 14  ? 6.581   -63.768  -2.222  1.00 307.21 ? 27  VAL G CA    1 
ATOM 5710  C C     . VAL K  3 14  ? 6.880   -65.295  -2.337  1.00 311.47 ? 27  VAL G C     1 
ATOM 5711  O O     . VAL K  3 14  ? 7.311   -65.775  -3.401  1.00 315.71 ? 27  VAL G O     1 
ATOM 5712  C CB    . VAL K  3 14  ? 7.771   -62.984  -1.625  1.00 302.68 ? 27  VAL G CB    1 
ATOM 5713  C CG1   . VAL K  3 14  ? 9.065   -63.365  -2.322  1.00 301.37 ? 27  VAL G CG1   1 
ATOM 5714  C CG2   . VAL K  3 14  ? 7.527   -61.488  -1.746  1.00 300.28 ? 27  VAL G CG2   1 
ATOM 5715  N N     . GLY K  3 15  ? 6.624   -66.049  -1.257  1.00 313.39 ? 28  GLY G N     1 
ATOM 5716  C CA    . GLY K  3 15  ? 6.693   -67.531  -1.261  1.00 314.14 ? 28  GLY G CA    1 
ATOM 5717  C C     . GLY K  3 15  ? 5.752   -68.197  -2.261  1.00 319.58 ? 28  GLY G C     1 
ATOM 5718  O O     . GLY K  3 15  ? 6.077   -69.251  -2.808  1.00 314.26 ? 28  GLY G O     1 
ATOM 5719  N N     . CYS K  3 16  ? 4.584   -67.569  -2.474  1.00 328.74 ? 29  CYS G N     1 
ATOM 5720  C CA    . CYS K  3 16  ? 3.593   -67.889  -3.554  1.00 331.69 ? 29  CYS G CA    1 
ATOM 5721  C C     . CYS K  3 16  ? 4.221   -67.901  -4.972  1.00 318.92 ? 29  CYS G C     1 
ATOM 5722  O O     . CYS K  3 16  ? 4.203   -68.938  -5.664  1.00 318.99 ? 29  CYS G O     1 
ATOM 5723  C CB    . CYS K  3 16  ? 2.391   -66.875  -3.582  1.00 343.45 ? 29  CYS G CB    1 
ATOM 5724  S SG    . CYS K  3 16  ? 1.029   -66.856  -2.356  1.00 359.41 ? 29  CYS G SG    1 
ATOM 5725  N N     . LEU K  3 17  ? 4.736   -66.740  -5.399  1.00 301.79 ? 30  LEU G N     1 
ATOM 5726  C CA    . LEU K  3 17  ? 5.274   -66.548  -6.753  1.00 283.51 ? 30  LEU G CA    1 
ATOM 5727  C C     . LEU K  3 17  ? 6.478   -67.454  -6.980  1.00 277.47 ? 30  LEU G C     1 
ATOM 5728  O O     . LEU K  3 17  ? 6.605   -68.060  -8.041  1.00 273.50 ? 30  LEU G O     1 
ATOM 5729  C CB    . LEU K  3 17  ? 5.626   -65.075  -7.015  1.00 274.96 ? 30  LEU G CB    1 
ATOM 5730  C CG    . LEU K  3 17  ? 4.554   -63.997  -6.771  1.00 271.29 ? 30  LEU G CG    1 
ATOM 5731  C CD1   . LEU K  3 17  ? 5.044   -62.650  -7.264  1.00 268.27 ? 30  LEU G CD1   1 
ATOM 5732  C CD2   . LEU K  3 17  ? 3.227   -64.326  -7.440  1.00 268.26 ? 30  LEU G CD2   1 
ATOM 5733  N N     . CYS K  3 18  ? 7.327   -67.564  -5.953  1.00 275.01 ? 31  CYS G N     1 
ATOM 5734  C CA    . CYS K  3 18  ? 8.477   -68.483  -5.923  1.00 273.29 ? 31  CYS G CA    1 
ATOM 5735  C C     . CYS K  3 18  ? 8.083   -69.974  -6.042  1.00 284.03 ? 31  CYS G C     1 
ATOM 5736  O O     . CYS K  3 18  ? 8.759   -70.735  -6.748  1.00 283.35 ? 31  CYS G O     1 
ATOM 5737  C CB    . CYS K  3 18  ? 9.316   -68.235  -4.665  1.00 265.45 ? 31  CYS G CB    1 
ATOM 5738  S SG    . CYS K  3 18  ? 10.102  -66.609  -4.627  1.00 256.40 ? 31  CYS G SG    1 
ATOM 5739  N N     . GLU K  3 19  ? 7.003   -70.381  -5.363  1.00 303.17 ? 32  GLU G N     1 
ATOM 5740  C CA    . GLU K  3 19  ? 6.414   -71.728  -5.517  1.00 321.14 ? 32  GLU G CA    1 
ATOM 5741  C C     . GLU K  3 19  ? 5.795   -71.999  -6.896  1.00 320.11 ? 32  GLU G C     1 
ATOM 5742  O O     . GLU K  3 19  ? 5.914   -73.105  -7.450  1.00 313.98 ? 32  GLU G O     1 
ATOM 5743  C CB    . GLU K  3 19  ? 5.367   -71.994  -4.427  1.00 340.93 ? 32  GLU G CB    1 
ATOM 5744  C CG    . GLU K  3 19  ? 5.793   -73.045  -3.408  1.00 360.07 ? 32  GLU G CG    1 
ATOM 5745  C CD    . GLU K  3 19  ? 5.791   -74.466  -3.975  1.00 372.29 ? 32  GLU G CD    1 
ATOM 5746  O OE1   . GLU K  3 19  ? 4.718   -74.961  -4.385  1.00 384.57 ? 32  GLU G OE1   1 
ATOM 5747  O OE2   . GLU K  3 19  ? 6.867   -75.101  -4.002  1.00 375.65 ? 32  GLU G OE2   1 
ATOM 5748  N N     . GLU K  3 20  ? 5.113   -70.994  -7.435  1.00 324.97 ? 33  GLU G N     1 
ATOM 5749  C CA    . GLU K  3 20  ? 4.597   -71.104  -8.787  1.00 328.84 ? 33  GLU G CA    1 
ATOM 5750  C C     . GLU K  3 20  ? 5.710   -71.251  -9.843  1.00 327.63 ? 33  GLU G C     1 
ATOM 5751  O O     . GLU K  3 20  ? 5.502   -71.934  -10.850 1.00 326.00 ? 33  GLU G O     1 
ATOM 5752  C CB    . GLU K  3 20  ? 3.684   -69.937  -9.107  1.00 338.78 ? 33  GLU G CB    1 
ATOM 5753  C CG    . GLU K  3 20  ? 2.231   -70.196  -8.804  1.00 350.23 ? 33  GLU G CG    1 
ATOM 5754  C CD    . GLU K  3 20  ? 1.349   -69.078  -9.320  1.00 360.15 ? 33  GLU G CD    1 
ATOM 5755  O OE1   . GLU K  3 20  ? 1.467   -68.683  -10.505 1.00 364.46 ? 33  GLU G OE1   1 
ATOM 5756  O OE2   . GLU K  3 20  ? 0.525   -68.577  -8.536  1.00 365.78 ? 33  GLU G OE2   1 
ATOM 5757  N N     . VAL K  3 21  ? 6.869   -70.615  -9.614  1.00 328.11 ? 34  VAL G N     1 
ATOM 5758  C CA    . VAL K  3 21  ? 8.073   -70.821  -10.453 1.00 324.88 ? 34  VAL G CA    1 
ATOM 5759  C C     . VAL K  3 21  ? 8.679   -72.237  -10.233 1.00 325.20 ? 34  VAL G C     1 
ATOM 5760  O O     . VAL K  3 21  ? 9.287   -72.802  -11.156 1.00 327.45 ? 34  VAL G O     1 
ATOM 5761  C CB    . VAL K  3 21  ? 9.137   -69.684  -10.301 1.00 318.60 ? 34  VAL G CB    1 
ATOM 5762  C CG1   . VAL K  3 21  ? 10.330  -69.938  -11.206 1.00 311.49 ? 34  VAL G CG1   1 
ATOM 5763  C CG2   . VAL K  3 21  ? 8.552   -68.313  -10.626 1.00 314.58 ? 34  VAL G CG2   1 
ATOM 5764  N N     . ALA K  3 22  ? 8.479   -72.807  -9.034  1.00 319.36 ? 35  ALA G N     1 
ATOM 5765  C CA    . ALA K  3 22  ? 8.816   -74.216  -8.743  1.00 308.77 ? 35  ALA G CA    1 
ATOM 5766  C C     . ALA K  3 22  ? 8.020   -75.240  -9.576  1.00 306.72 ? 35  ALA G C     1 
ATOM 5767  O O     . ALA K  3 22  ? 8.559   -76.294  -9.919  1.00 304.77 ? 35  ALA G O     1 
ATOM 5768  C CB    . ALA K  3 22  ? 8.692   -74.518  -7.258  1.00 303.19 ? 35  ALA G CB    1 
ATOM 5769  N N     . LEU K  3 23  ? 6.762   -74.909  -9.904  1.00 307.17 ? 36  LEU G N     1 
ATOM 5770  C CA    . LEU K  3 23  ? 5.850   -75.670  -10.837 1.00 307.69 ? 36  LEU G CA    1 
ATOM 5771  C C     . LEU K  3 23  ? 6.290   -75.835  -12.336 1.00 318.54 ? 36  LEU G C     1 
ATOM 5772  O O     . LEU K  3 23  ? 6.246   -76.939  -12.926 1.00 323.22 ? 36  LEU G O     1 
ATOM 5773  C CB    . LEU K  3 23  ? 4.466   -74.977  -10.877 1.00 292.78 ? 36  LEU G CB    1 
ATOM 5774  C CG    . LEU K  3 23  ? 3.182   -75.277  -10.089 1.00 283.47 ? 36  LEU G CG    1 
ATOM 5775  C CD1   . LEU K  3 23  ? 3.309   -75.016  -8.600  1.00 279.89 ? 36  LEU G CD1   1 
ATOM 5776  C CD2   . LEU K  3 23  ? 2.056   -74.433  -10.662 1.00 281.05 ? 36  LEU G CD2   1 
ATOM 5777  N N     . ASP K  3 24  ? 6.681   -74.712  -12.938 1.00 325.12 ? 37  ASP G N     1 
ATOM 5778  C CA    . ASP K  3 24  ? 6.838   -74.536  -14.397 1.00 317.07 ? 37  ASP G CA    1 
ATOM 5779  C C     . ASP K  3 24  ? 8.084   -75.237  -15.006 1.00 300.74 ? 37  ASP G C     1 
ATOM 5780  O O     . ASP K  3 24  ? 7.977   -75.921  -16.032 1.00 289.09 ? 37  ASP G O     1 
ATOM 5781  C CB    . ASP K  3 24  ? 6.796   -73.011  -14.678 1.00 325.35 ? 37  ASP G CB    1 
ATOM 5782  C CG    . ASP K  3 24  ? 7.166   -72.629  -16.101 1.00 325.24 ? 37  ASP G CG    1 
ATOM 5783  O OD1   . ASP K  3 24  ? 6.538   -73.140  -17.048 1.00 325.17 ? 37  ASP G OD1   1 
ATOM 5784  O OD2   . ASP K  3 24  ? 8.066   -71.772  -16.258 1.00 324.67 ? 37  ASP G OD2   1 
ATOM 5785  N N     . LYS K  3 25  ? 9.245   -75.063  -14.364 1.00 288.15 ? 38  LYS G N     1 
ATOM 5786  C CA    . LYS K  3 25  ? 10.528  -75.598  -14.849 1.00 275.61 ? 38  LYS G CA    1 
ATOM 5787  C C     . LYS K  3 25  ? 10.966  -76.864  -14.114 1.00 269.87 ? 38  LYS G C     1 
ATOM 5788  O O     . LYS K  3 25  ? 12.112  -77.295  -14.267 1.00 264.58 ? 38  LYS G O     1 
ATOM 5789  C CB    . LYS K  3 25  ? 11.637  -74.533  -14.735 1.00 273.81 ? 38  LYS G CB    1 
ATOM 5790  C CG    . LYS K  3 25  ? 11.760  -73.631  -15.954 1.00 275.52 ? 38  LYS G CG    1 
ATOM 5791  C CD    . LYS K  3 25  ? 12.214  -74.433  -17.173 1.00 276.53 ? 38  LYS G CD    1 
ATOM 5792  C CE    . LYS K  3 25  ? 11.577  -73.836  -18.425 1.00 274.78 ? 38  LYS G CE    1 
ATOM 5793  N NZ    . LYS K  3 25  ? 11.449  -74.788  -19.562 1.00 272.40 ? 38  LYS G NZ    1 
ATOM 5794  N N     . ALA K  3 26  ? 10.061  -77.459  -13.329 1.00 268.84 ? 39  ALA G N     1 
ATOM 5795  C CA    . ALA K  3 26  ? 10.418  -78.525  -12.380 1.00 269.11 ? 39  ALA G CA    1 
ATOM 5796  C C     . ALA K  3 26  ? 11.754  -78.209  -11.679 1.00 270.82 ? 39  ALA G C     1 
ATOM 5797  O O     . ALA K  3 26  ? 12.670  -79.058  -11.609 1.00 271.21 ? 39  ALA G O     1 
ATOM 5798  C CB    . ALA K  3 26  ? 10.435  -79.896  -13.064 1.00 263.38 ? 39  ALA G CB    1 
ATOM 5799  N N     . MET K  3 27  ? 11.846  -76.968  -11.180 1.00 272.38 ? 40  MET G N     1 
ATOM 5800  C CA    . MET K  3 27  ? 13.027  -76.448  -10.451 1.00 272.13 ? 40  MET G CA    1 
ATOM 5801  C C     . MET K  3 27  ? 12.722  -75.850  -9.039  1.00 279.62 ? 40  MET G C     1 
ATOM 5802  O O     . MET K  3 27  ? 12.051  -74.816  -8.958  1.00 280.15 ? 40  MET G O     1 
ATOM 5803  C CB    . MET K  3 27  ? 13.770  -75.423  -11.332 1.00 262.79 ? 40  MET G CB    1 
ATOM 5804  C CG    . MET K  3 27  ? 15.244  -75.253  -10.981 1.00 256.97 ? 40  MET G CG    1 
ATOM 5805  S SD    . MET K  3 27  ? 16.134  -76.784  -10.569 1.00 252.85 ? 40  MET G SD    1 
ATOM 5806  C CE    . MET K  3 27  ? 15.808  -77.819  -11.997 1.00 249.18 ? 40  MET G CE    1 
ATOM 5807  N N     . GLN K  3 28  ? 13.200  -76.487  -7.943  1.00 285.64 ? 41  GLN G N     1 
ATOM 5808  C CA    . GLN K  3 28  ? 12.874  -76.023  -6.548  1.00 287.68 ? 41  GLN G CA    1 
ATOM 5809  C C     . GLN K  3 28  ? 13.840  -74.972  -5.966  1.00 293.77 ? 41  GLN G C     1 
ATOM 5810  O O     . GLN K  3 28  ? 15.044  -74.974  -6.276  1.00 296.88 ? 41  GLN G O     1 
ATOM 5811  C CB    . GLN K  3 28  ? 12.601  -77.182  -5.540  1.00 277.33 ? 41  GLN G CB    1 
ATOM 5812  C CG    . GLN K  3 28  ? 13.793  -78.057  -5.139  1.00 263.10 ? 41  GLN G CG    1 
ATOM 5813  C CD    . GLN K  3 28  ? 13.712  -79.482  -5.659  1.00 252.79 ? 41  GLN G CD    1 
ATOM 5814  O OE1   . GLN K  3 28  ? 12.829  -80.260  -5.273  1.00 246.67 ? 41  GLN G OE1   1 
ATOM 5815  N NE2   . GLN K  3 28  ? 14.659  -79.843  -6.517  1.00 247.77 ? 41  GLN G NE2   1 
ATOM 5816  N N     . PHE K  3 29  ? 13.280  -74.080  -5.140  1.00 296.75 ? 42  PHE G N     1 
ATOM 5817  C CA    . PHE K  3 29  ? 13.985  -72.920  -4.571  1.00 292.78 ? 42  PHE G CA    1 
ATOM 5818  C C     . PHE K  3 29  ? 14.584  -73.275  -3.212  1.00 288.50 ? 42  PHE G C     1 
ATOM 5819  O O     . PHE K  3 29  ? 13.938  -73.967  -2.420  1.00 288.06 ? 42  PHE G O     1 
ATOM 5820  C CB    . PHE K  3 29  ? 13.017  -71.719  -4.397  1.00 294.61 ? 42  PHE G CB    1 
ATOM 5821  C CG    . PHE K  3 29  ? 12.740  -70.933  -5.676  1.00 291.54 ? 42  PHE G CG    1 
ATOM 5822  C CD1   . PHE K  3 29  ? 12.754  -71.556  -6.925  1.00 290.51 ? 42  PHE G CD1   1 
ATOM 5823  C CD2   . PHE K  3 29  ? 12.430  -69.565  -5.629  1.00 288.46 ? 42  PHE G CD2   1 
ATOM 5824  C CE1   . PHE K  3 29  ? 12.487  -70.836  -8.086  1.00 287.41 ? 42  PHE G CE1   1 
ATOM 5825  C CE2   . PHE K  3 29  ? 12.159  -68.850  -6.791  1.00 284.17 ? 42  PHE G CE2   1 
ATOM 5826  C CZ    . PHE K  3 29  ? 12.182  -69.487  -8.021  1.00 284.81 ? 42  PHE G CZ    1 
ATOM 5827  N N     . SER K  3 30  ? 15.810  -72.809  -2.940  1.00 281.78 ? 43  SER G N     1 
ATOM 5828  C CA    . SER K  3 30  ? 16.319  -72.836  -1.565  1.00 281.16 ? 43  SER G CA    1 
ATOM 5829  C C     . SER K  3 30  ? 15.471  -71.863  -0.749  1.00 290.81 ? 43  SER G C     1 
ATOM 5830  O O     . SER K  3 30  ? 14.945  -70.882  -1.276  1.00 295.94 ? 43  SER G O     1 
ATOM 5831  C CB    . SER K  3 30  ? 17.817  -72.509  -1.467  1.00 272.57 ? 43  SER G CB    1 
ATOM 5832  O OG    . SER K  3 30  ? 18.059  -71.124  -1.601  1.00 268.93 ? 43  SER G OG    1 
ATOM 5833  N N     . LYS K  3 31  ? 15.304  -72.137  0.534   1.00 299.79 ? 44  LYS G N     1 
ATOM 5834  C CA    . LYS K  3 31  ? 14.380  -71.325  1.308   1.00 307.19 ? 44  LYS G CA    1 
ATOM 5835  C C     . LYS K  3 31  ? 14.971  -69.945  1.659   1.00 314.98 ? 44  LYS G C     1 
ATOM 5836  O O     . LYS K  3 31  ? 14.210  -68.975  1.805   1.00 316.15 ? 44  LYS G O     1 
ATOM 5837  C CB    . LYS K  3 31  ? 13.841  -72.111  2.508   1.00 303.00 ? 44  LYS G CB    1 
ATOM 5838  C CG    . LYS K  3 31  ? 12.352  -71.916  2.777   1.00 299.05 ? 44  LYS G CG    1 
ATOM 5839  C CD    . LYS K  3 31  ? 11.452  -71.991  1.544   1.00 296.50 ? 44  LYS G CD    1 
ATOM 5840  C CE    . LYS K  3 31  ? 11.418  -73.357  0.871   1.00 293.21 ? 44  LYS G CE    1 
ATOM 5841  N NZ    . LYS K  3 31  ? 10.513  -73.359  -0.318  1.00 291.84 ? 44  LYS G NZ    1 
ATOM 5842  N N     . GLN K  3 32  ? 16.313  -69.862  1.747   1.00 321.33 ? 45  GLN G N     1 
ATOM 5843  C CA    . GLN K  3 32  ? 17.074  -68.584  1.891   1.00 320.27 ? 45  GLN G CA    1 
ATOM 5844  C C     . GLN K  3 32  ? 16.704  -67.638  0.770   1.00 309.09 ? 45  GLN G C     1 
ATOM 5845  O O     . GLN K  3 32  ? 16.639  -66.412  0.962   1.00 295.21 ? 45  GLN G O     1 
ATOM 5846  C CB    . GLN K  3 32  ? 18.605  -68.752  1.819   1.00 331.28 ? 45  GLN G CB    1 
ATOM 5847  C CG    . GLN K  3 32  ? 19.239  -69.808  2.698   1.00 349.78 ? 45  GLN G CG    1 
ATOM 5848  C CD    . GLN K  3 32  ? 19.321  -71.136  1.984   1.00 361.55 ? 45  GLN G CD    1 
ATOM 5849  O OE1   . GLN K  3 32  ? 18.311  -71.811  1.784   1.00 375.10 ? 45  GLN G OE1   1 
ATOM 5850  N NE2   . GLN K  3 32  ? 20.530  -71.519  1.593   1.00 364.27 ? 45  GLN G NE2   1 
ATOM 5851  N N     . THR K  3 33  ? 16.512  -68.239  -0.408  1.00 309.88 ? 46  THR G N     1 
ATOM 5852  C CA    . THR K  3 33  ? 16.017  -67.572  -1.618  1.00 314.10 ? 46  THR G CA    1 
ATOM 5853  C C     . THR K  3 33  ? 14.633  -66.900  -1.356  1.00 302.72 ? 46  THR G C     1 
ATOM 5854  O O     . THR K  3 33  ? 14.481  -65.688  -1.589  1.00 306.09 ? 46  THR G O     1 
ATOM 5855  C CB    . THR K  3 33  ? 16.026  -68.550  -2.846  1.00 325.67 ? 46  THR G CB    1 
ATOM 5856  O OG1   . THR K  3 33  ? 17.354  -69.059  -3.068  1.00 329.30 ? 46  THR G OG1   1 
ATOM 5857  C CG2   . THR K  3 33  ? 15.519  -67.882  -4.139  1.00 333.97 ? 46  THR G CG2   1 
ATOM 5858  N N     . ILE K  3 34  ? 13.659  -67.663  -0.845  1.00 286.10 ? 47  ILE G N     1 
ATOM 5859  C CA    . ILE K  3 34  ? 12.322  -67.125  -0.525  1.00 269.85 ? 47  ILE G CA    1 
ATOM 5860  C C     . ILE K  3 34  ? 12.377  -65.919  0.457   1.00 264.16 ? 47  ILE G C     1 
ATOM 5861  O O     . ILE K  3 34  ? 11.705  -64.913  0.243   1.00 262.97 ? 47  ILE G O     1 
ATOM 5862  C CB    . ILE K  3 34  ? 11.359  -68.243  -0.044  1.00 266.69 ? 47  ILE G CB    1 
ATOM 5863  C CG1   . ILE K  3 34  ? 11.458  -69.492  -0.950  1.00 261.90 ? 47  ILE G CG1   1 
ATOM 5864  C CG2   . ILE K  3 34  ? 9.938   -67.711  0.084   1.00 265.87 ? 47  ILE G CG2   1 
ATOM 5865  C CD1   . ILE K  3 34  ? 10.505  -69.553  -2.120  1.00 257.35 ? 47  ILE G CD1   1 
ATOM 5866  N N     . ALA K  3 35  ? 13.205  -66.006  1.496   1.00 258.27 ? 48  ALA G N     1 
ATOM 5867  C CA    . ALA K  3 35  ? 13.402  -64.885  2.418   1.00 257.62 ? 48  ALA G CA    1 
ATOM 5868  C C     . ALA K  3 35  ? 14.147  -63.696  1.832   1.00 256.32 ? 48  ALA G C     1 
ATOM 5869  O O     . ALA K  3 35  ? 13.819  -62.569  2.164   1.00 258.42 ? 48  ALA G O     1 
ATOM 5870  C CB    . ALA K  3 35  ? 14.104  -65.344  3.673   1.00 257.45 ? 48  ALA G CB    1 
ATOM 5871  N N     . ALA K  3 36  ? 15.153  -63.937  0.995   1.00 255.00 ? 49  ALA G N     1 
ATOM 5872  C CA    . ALA K  3 36  ? 15.904  -62.841  0.385   1.00 260.77 ? 49  ALA G CA    1 
ATOM 5873  C C     . ALA K  3 36  ? 15.035  -61.964  -0.529  1.00 270.30 ? 49  ALA G C     1 
ATOM 5874  O O     . ALA K  3 36  ? 15.262  -60.754  -0.591  1.00 270.55 ? 49  ALA G O     1 
ATOM 5875  C CB    . ALA K  3 36  ? 17.138  -63.343  -0.350  1.00 255.09 ? 49  ALA G CB    1 
ATOM 5876  N N     . ILE K  3 37  ? 14.052  -62.560  -1.226  1.00 283.99 ? 50  ILE G N     1 
ATOM 5877  C CA    . ILE K  3 37  ? 13.081  -61.771  -2.051  1.00 298.82 ? 50  ILE G CA    1 
ATOM 5878  C C     . ILE K  3 37  ? 11.940  -61.137  -1.225  1.00 308.22 ? 50  ILE G C     1 
ATOM 5879  O O     . ILE K  3 37  ? 11.389  -60.114  -1.635  1.00 314.47 ? 50  ILE G O     1 
ATOM 5880  C CB    . ILE K  3 37  ? 12.455  -62.507  -3.298  1.00 300.63 ? 50  ILE G CB    1 
ATOM 5881  C CG1   . ILE K  3 37  ? 13.496  -63.047  -4.282  1.00 301.19 ? 50  ILE G CG1   1 
ATOM 5882  C CG2   . ILE K  3 37  ? 11.608  -61.550  -4.139  1.00 299.40 ? 50  ILE G CG2   1 
ATOM 5883  C CD1   . ILE K  3 37  ? 12.875  -63.750  -5.479  1.00 298.82 ? 50  ILE G CD1   1 
ATOM 5884  N N     . SER K  3 38  ? 11.576  -61.726  -0.086  1.00 313.09 ? 51  SER G N     1 
ATOM 5885  C CA    . SER K  3 38  ? 10.582  -61.086  0.790   1.00 316.02 ? 51  SER G CA    1 
ATOM 5886  C C     . SER K  3 38  ? 11.160  -59.826  1.466   1.00 315.70 ? 51  SER G C     1 
ATOM 5887  O O     . SER K  3 38  ? 10.517  -58.764  1.457   1.00 315.14 ? 51  SER G O     1 
ATOM 5888  C CB    . SER K  3 38  ? 10.034  -62.076  1.813   1.00 317.71 ? 51  SER G CB    1 
ATOM 5889  O OG    . SER K  3 38  ? 9.349   -63.134  1.171   1.00 315.96 ? 51  SER G OG    1 
ATOM 5890  N N     . GLU K  3 39  ? 12.372  -59.956  2.024   1.00 313.61 ? 52  GLU G N     1 
ATOM 5891  C CA    . GLU K  3 39  ? 13.168  -58.823  2.542   1.00 312.17 ? 52  GLU G CA    1 
ATOM 5892  C C     . GLU K  3 39  ? 13.446  -57.751  1.457   1.00 310.85 ? 52  GLU G C     1 
ATOM 5893  O O     . GLU K  3 39  ? 13.362  -56.541  1.731   1.00 312.67 ? 52  GLU G O     1 
ATOM 5894  C CB    . GLU K  3 39  ? 14.507  -59.324  3.127   1.00 310.27 ? 52  GLU G CB    1 
ATOM 5895  C CG    . GLU K  3 39  ? 14.437  -60.102  4.446   1.00 311.82 ? 52  GLU G CG    1 
ATOM 5896  C CD    . GLU K  3 39  ? 15.714  -60.887  4.786   1.00 313.41 ? 52  GLU G CD    1 
ATOM 5897  O OE1   . GLU K  3 39  ? 16.807  -60.546  4.273   1.00 310.83 ? 52  GLU G OE1   1 
ATOM 5898  O OE2   . GLU K  3 39  ? 15.629  -61.853  5.586   1.00 319.12 ? 52  GLU G OE2   1 
ATOM 5899  N N     . LEU K  3 40  ? 13.782  -58.208  0.241   1.00 306.87 ? 53  LEU G N     1 
ATOM 5900  C CA    . LEU K  3 40  ? 14.088  -57.344  -0.918  1.00 303.88 ? 53  LEU G CA    1 
ATOM 5901  C C     . LEU K  3 40  ? 12.915  -56.468  -1.302  1.00 310.68 ? 53  LEU G C     1 
ATOM 5902  O O     . LEU K  3 40  ? 13.098  -55.288  -1.559  1.00 308.03 ? 53  LEU G O     1 
ATOM 5903  C CB    . LEU K  3 40  ? 14.476  -58.181  -2.139  1.00 296.34 ? 53  LEU G CB    1 
ATOM 5904  C CG    . LEU K  3 40  ? 15.275  -57.571  -3.286  1.00 291.11 ? 53  LEU G CG    1 
ATOM 5905  C CD1   . LEU K  3 40  ? 16.755  -57.802  -3.007  1.00 287.23 ? 53  LEU G CD1   1 
ATOM 5906  C CD2   . LEU K  3 40  ? 14.915  -58.349  -4.536  1.00 289.26 ? 53  LEU G CD2   1 
ATOM 5907  N N     . THR K  3 41  ? 11.725  -57.069  -1.349  1.00 321.52 ? 54  THR G N     1 
ATOM 5908  C CA    . THR K  3 41  ? 10.492  -56.370  -1.692  1.00 331.31 ? 54  THR G CA    1 
ATOM 5909  C C     . THR K  3 41  ? 10.193  -55.282  -0.681  1.00 329.67 ? 54  THR G C     1 
ATOM 5910  O O     . THR K  3 41  ? 9.837   -54.182  -1.071  1.00 336.93 ? 54  THR G O     1 
ATOM 5911  C CB    . THR K  3 41  ? 9.283   -57.330  -1.771  1.00 337.34 ? 54  THR G CB    1 
ATOM 5912  O OG1   . THR K  3 41  ? 9.547   -58.354  -2.735  1.00 337.23 ? 54  THR G OG1   1 
ATOM 5913  C CG2   . THR K  3 41  ? 8.014   -56.583  -2.176  1.00 342.99 ? 54  THR G CG2   1 
ATOM 5914  N N     . PHE K  3 42  ? 10.352  -55.596  0.607   1.00 320.20 ? 55  PHE G N     1 
ATOM 5915  C CA    . PHE K  3 42  ? 10.043  -54.686  1.725   1.00 311.69 ? 55  PHE G CA    1 
ATOM 5916  C C     . PHE K  3 42  ? 10.860  -53.380  1.678   1.00 301.46 ? 55  PHE G C     1 
ATOM 5917  O O     . PHE K  3 42  ? 10.316  -52.271  1.737   1.00 299.89 ? 55  PHE G O     1 
ATOM 5918  C CB    . PHE K  3 42  ? 10.261  -55.432  3.052   1.00 315.49 ? 55  PHE G CB    1 
ATOM 5919  C CG    . PHE K  3 42  ? 9.920   -54.636  4.279   1.00 321.00 ? 55  PHE G CG    1 
ATOM 5920  C CD1   . PHE K  3 42  ? 8.637   -54.682  4.829   1.00 324.56 ? 55  PHE G CD1   1 
ATOM 5921  C CD2   . PHE K  3 42  ? 10.888  -53.856  4.913   1.00 321.12 ? 55  PHE G CD2   1 
ATOM 5922  C CE1   . PHE K  3 42  ? 8.327   -53.955  5.967   1.00 327.16 ? 55  PHE G CE1   1 
ATOM 5923  C CE2   . PHE K  3 42  ? 10.580  -53.129  6.061   1.00 322.48 ? 55  PHE G CE2   1 
ATOM 5924  C CZ    . PHE K  3 42  ? 9.298   -53.181  6.591   1.00 325.45 ? 55  PHE G CZ    1 
ATOM 5925  N N     . ARG K  3 43  ? 12.172  -53.515  1.557   1.00 290.51 ? 56  ARG G N     1 
ATOM 5926  C CA    . ARG K  3 43  ? 13.037  -52.346  1.488   1.00 285.97 ? 56  ARG G CA    1 
ATOM 5927  C C     . ARG K  3 43  ? 13.092  -51.744  0.083   1.00 287.61 ? 56  ARG G C     1 
ATOM 5928  O O     . ARG K  3 43  ? 13.479  -50.593  -0.074  1.00 284.91 ? 56  ARG G O     1 
ATOM 5929  C CB    . ARG K  3 43  ? 14.428  -52.687  2.000   1.00 282.55 ? 56  ARG G CB    1 
ATOM 5930  C CG    . ARG K  3 43  ? 14.443  -53.066  3.466   1.00 282.75 ? 56  ARG G CG    1 
ATOM 5931  C CD    . ARG K  3 43  ? 15.781  -53.661  3.826   1.00 281.87 ? 56  ARG G CD    1 
ATOM 5932  N NE    . ARG K  3 43  ? 16.024  -53.622  5.255   1.00 279.16 ? 56  ARG G NE    1 
ATOM 5933  C CZ    . ARG K  3 43  ? 16.216  -54.698  6.010   1.00 277.58 ? 56  ARG G CZ    1 
ATOM 5934  N NH1   . ARG K  3 43  ? 16.200  -55.916  5.479   1.00 275.90 ? 56  ARG G NH1   1 
ATOM 5935  N NH2   . ARG K  3 43  ? 16.435  -54.549  7.300   1.00 277.16 ? 56  ARG G NH2   1 
ATOM 5936  N N     . GLN K  3 44  ? 12.707  -52.527  -0.927  1.00 294.65 ? 57  GLN G N     1 
ATOM 5937  C CA    . GLN K  3 44  ? 12.509  -52.016  -2.299  1.00 305.30 ? 57  GLN G CA    1 
ATOM 5938  C C     . GLN K  3 44  ? 11.295  -51.090  -2.337  1.00 313.73 ? 57  GLN G C     1 
ATOM 5939  O O     . GLN K  3 44  ? 11.202  -50.198  -3.192  1.00 316.63 ? 57  GLN G O     1 
ATOM 5940  C CB    . GLN K  3 44  ? 12.288  -53.167  -3.294  1.00 306.85 ? 57  GLN G CB    1 
ATOM 5941  C CG    . GLN K  3 44  ? 12.227  -52.756  -4.773  1.00 306.31 ? 57  GLN G CG    1 
ATOM 5942  C CD    . GLN K  3 44  ? 13.601  -52.578  -5.412  1.00 302.95 ? 57  GLN G CD    1 
ATOM 5943  O OE1   . GLN K  3 44  ? 14.623  -52.945  -4.835  1.00 304.35 ? 57  GLN G OE1   1 
ATOM 5944  N NE2   . GLN K  3 44  ? 13.626  -52.013  -6.616  1.00 298.91 ? 57  GLN G NE2   1 
ATOM 5945  N N     . CYS K  3 45  ? 10.356  -51.325  -1.423  1.00 319.73 ? 58  CYS G N     1 
ATOM 5946  C CA    . CYS K  3 45  ? 9.160   -50.502  -1.341  1.00 321.85 ? 58  CYS G CA    1 
ATOM 5947  C C     . CYS K  3 45  ? 9.474   -49.156  -0.718  1.00 319.88 ? 58  CYS G C     1 
ATOM 5948  O O     . CYS K  3 45  ? 8.778   -48.180  -1.000  1.00 321.59 ? 58  CYS G O     1 
ATOM 5949  C CB    . CYS K  3 45  ? 8.013   -51.229  -0.634  1.00 324.12 ? 58  CYS G CB    1 
ATOM 5950  S SG    . CYS K  3 45  ? 7.185   -52.437  -1.674  1.00 327.87 ? 58  CYS G SG    1 
ATOM 5951  N N     . GLU K  3 46  ? 10.536  -49.095  0.092   1.00 313.63 ? 59  GLU G N     1 
ATOM 5952  C CA    . GLU K  3 46  ? 11.140  -47.803  0.426   1.00 307.04 ? 59  GLU G CA    1 
ATOM 5953  C C     . GLU K  3 46  ? 11.607  -47.078  -0.857  1.00 301.96 ? 59  GLU G C     1 
ATOM 5954  O O     . GLU K  3 46  ? 11.201  -45.932  -1.083  1.00 308.17 ? 59  GLU G O     1 
ATOM 5955  C CB    . GLU K  3 46  ? 12.265  -47.920  1.464   1.00 301.76 ? 59  GLU G CB    1 
ATOM 5956  C CG    . GLU K  3 46  ? 12.708  -46.569  2.033   1.00 296.56 ? 59  GLU G CG    1 
ATOM 5957  C CD    . GLU K  3 46  ? 14.131  -46.556  2.562   1.00 292.08 ? 59  GLU G CD    1 
ATOM 5958  O OE1   . GLU K  3 46  ? 14.784  -47.629  2.505   1.00 293.03 ? 59  GLU G OE1   1 
ATOM 5959  O OE2   . GLU K  3 46  ? 14.594  -45.492  3.047   1.00 287.03 ? 59  GLU G OE2   1 
ATOM 5960  N N     . ASN K  3 47  ? 12.425  -47.748  -1.688  1.00 289.56 ? 60  ASN G N     1 
ATOM 5961  C CA    . ASN K  3 47  ? 12.871  -47.215  -2.998  1.00 280.94 ? 60  ASN G CA    1 
ATOM 5962  C C     . ASN K  3 47  ? 11.718  -46.812  -3.915  1.00 283.13 ? 60  ASN G C     1 
ATOM 5963  O O     . ASN K  3 47  ? 11.698  -45.705  -4.446  1.00 288.32 ? 60  ASN G O     1 
ATOM 5964  C CB    . ASN K  3 47  ? 13.797  -48.195  -3.721  1.00 270.03 ? 60  ASN G CB    1 
ATOM 5965  C CG    . ASN K  3 47  ? 15.096  -48.409  -2.982  1.00 263.54 ? 60  ASN G CG    1 
ATOM 5966  O OD1   . ASN K  3 47  ? 15.671  -47.477  -2.405  1.00 259.48 ? 60  ASN G OD1   1 
ATOM 5967  N ND2   . ASN K  3 47  ? 15.566  -49.647  -2.988  1.00 261.36 ? 60  ASN G ND2   1 
ATOM 5968  N N     . PHE K  3 48  ? 10.749  -47.704  -4.076  1.00 280.13 ? 61  PHE G N     1 
ATOM 5969  C CA    . PHE K  3 48  ? 9.566   -47.409  -4.873  1.00 275.73 ? 61  PHE G CA    1 
ATOM 5970  C C     . PHE K  3 48  ? 8.695   -46.258  -4.328  1.00 275.97 ? 61  PHE G C     1 
ATOM 5971  O O     . PHE K  3 48  ? 8.361   -45.335  -5.068  1.00 272.80 ? 61  PHE G O     1 
ATOM 5972  C CB    . PHE K  3 48  ? 8.760   -48.686  -5.110  1.00 274.35 ? 61  PHE G CB    1 
ATOM 5973  C CG    . PHE K  3 48  ? 9.376   -49.607  -6.133  1.00 270.63 ? 61  PHE G CG    1 
ATOM 5974  C CD1   . PHE K  3 48  ? 10.295  -49.125  -7.062  1.00 269.11 ? 61  PHE G CD1   1 
ATOM 5975  C CD2   . PHE K  3 48  ? 9.032   -50.954  -6.182  1.00 268.13 ? 61  PHE G CD2   1 
ATOM 5976  C CE1   . PHE K  3 48  ? 10.855  -49.961  -8.016  1.00 266.64 ? 61  PHE G CE1   1 
ATOM 5977  C CE2   . PHE K  3 48  ? 9.594   -51.799  -7.132  1.00 264.64 ? 61  PHE G CE2   1 
ATOM 5978  C CZ    . PHE K  3 48  ? 10.505  -51.302  -8.050  1.00 264.67 ? 61  PHE G CZ    1 
ATOM 5979  N N     . ALA K  3 49  ? 8.366   -46.287  -3.038  1.00 277.42 ? 62  ALA G N     1 
ATOM 5980  C CA    . ALA K  3 49  ? 7.468   -45.272  -2.453  1.00 279.68 ? 62  ALA G CA    1 
ATOM 5981  C C     . ALA K  3 49  ? 8.053   -43.846  -2.282  1.00 280.06 ? 62  ALA G C     1 
ATOM 5982  O O     . ALA K  3 49  ? 7.352   -42.862  -2.553  1.00 280.19 ? 62  ALA G O     1 
ATOM 5983  C CB    . ALA K  3 49  ? 6.866   -45.776  -1.148  1.00 280.75 ? 62  ALA G CB    1 
ATOM 5984  N N     . LYS K  3 50  ? 9.315   -43.742  -1.835  1.00 277.98 ? 63  LYS G N     1 
ATOM 5985  C CA    . LYS K  3 50  ? 10.026  -42.444  -1.697  1.00 275.34 ? 63  LYS G CA    1 
ATOM 5986  C C     . LYS K  3 50  ? 10.118  -41.760  -3.056  1.00 279.38 ? 63  LYS G C     1 
ATOM 5987  O O     . LYS K  3 50  ? 9.899   -40.558  -3.181  1.00 278.67 ? 63  LYS G O     1 
ATOM 5988  C CB    . LYS K  3 50  ? 11.457  -42.614  -1.148  1.00 265.01 ? 63  LYS G CB    1 
ATOM 5989  C CG    . LYS K  3 50  ? 11.621  -42.715  0.365   1.00 256.15 ? 63  LYS G CG    1 
ATOM 5990  C CD    . LYS K  3 50  ? 13.100  -42.819  0.717   1.00 246.00 ? 63  LYS G CD    1 
ATOM 5991  C CE    . LYS K  3 50  ? 13.402  -42.445  2.161   1.00 241.86 ? 63  LYS G CE    1 
ATOM 5992  N NZ    . LYS K  3 50  ? 12.806  -43.350  3.181   1.00 239.09 ? 63  LYS G NZ    1 
ATOM 5993  N N     . ASP K  3 51  ? 10.462  -42.539  -4.077  1.00 285.38 ? 64  ASP G N     1 
ATOM 5994  C CA    . ASP K  3 51  ? 10.476  -42.032  -5.444  1.00 291.98 ? 64  ASP G CA    1 
ATOM 5995  C C     . ASP K  3 51  ? 9.070   -41.707  -5.955  1.00 299.85 ? 64  ASP G C     1 
ATOM 5996  O O     . ASP K  3 51  ? 8.906   -40.703  -6.643  1.00 308.65 ? 64  ASP G O     1 
ATOM 5997  C CB    . ASP K  3 51  ? 11.196  -42.990  -6.405  1.00 288.62 ? 64  ASP G CB    1 
ATOM 5998  C CG    . ASP K  3 51  ? 12.718  -42.863  -6.360  1.00 287.03 ? 64  ASP G CG    1 
ATOM 5999  O OD1   . ASP K  3 51  ? 13.264  -42.166  -5.471  1.00 287.46 ? 64  ASP G OD1   1 
ATOM 6000  O OD2   . ASP K  3 51  ? 13.367  -43.486  -7.233  1.00 284.58 ? 64  ASP G OD2   1 
ATOM 6001  N N     . LEU K  3 52  ? 8.075   -42.541  -5.626  1.00 300.57 ? 65  LEU G N     1 
ATOM 6002  C CA    . LEU K  3 52  ? 6.682   -42.272  -6.017  1.00 301.97 ? 65  LEU G CA    1 
ATOM 6003  C C     . LEU K  3 52  ? 6.145   -40.983  -5.396  1.00 306.10 ? 65  LEU G C     1 
ATOM 6004  O O     . LEU K  3 52  ? 5.480   -40.195  -6.075  1.00 308.30 ? 65  LEU G O     1 
ATOM 6005  C CB    . LEU K  3 52  ? 5.763   -43.457  -5.705  1.00 297.53 ? 65  LEU G CB    1 
ATOM 6006  C CG    . LEU K  3 52  ? 5.805   -44.640  -6.679  1.00 292.63 ? 65  LEU G CG    1 
ATOM 6007  C CD1   . LEU K  3 52  ? 5.126   -45.844  -6.047  1.00 291.87 ? 65  LEU G CD1   1 
ATOM 6008  C CD2   . LEU K  3 52  ? 5.196   -44.324  -8.044  1.00 293.76 ? 65  LEU G CD2   1 
ATOM 6009  N N     . GLU K  3 53  ? 6.445   -40.772  -4.116  1.00 307.20 ? 66  GLU G N     1 
ATOM 6010  C CA    . GLU K  3 53  ? 6.204   -39.490  -3.458  1.00 312.90 ? 66  GLU G CA    1 
ATOM 6011  C C     . GLU K  3 53  ? 6.855   -38.301  -4.226  1.00 313.79 ? 66  GLU G C     1 
ATOM 6012  O O     . GLU K  3 53  ? 6.163   -37.346  -4.607  1.00 320.51 ? 66  GLU G O     1 
ATOM 6013  C CB    . GLU K  3 53  ? 6.690   -39.564  -2.009  1.00 316.08 ? 66  GLU G CB    1 
ATOM 6014  C CG    . GLU K  3 53  ? 6.597   -38.252  -1.250  1.00 325.30 ? 66  GLU G CG    1 
ATOM 6015  C CD    . GLU K  3 53  ? 7.939   -37.792  -0.709  1.00 325.78 ? 66  GLU G CD    1 
ATOM 6016  O OE1   . GLU K  3 53  ? 8.751   -38.656  -0.321  1.00 323.54 ? 66  GLU G OE1   1 
ATOM 6017  O OE2   . GLU K  3 53  ? 8.175   -36.561  -0.665  1.00 328.89 ? 66  GLU G OE2   1 
ATOM 6018  N N     . MET K  3 54  ? 8.168   -38.381  -4.467  1.00 305.76 ? 67  MET G N     1 
ATOM 6019  C CA    . MET K  3 54  ? 8.915   -37.389  -5.268  1.00 297.00 ? 67  MET G CA    1 
ATOM 6020  C C     . MET K  3 54  ? 8.285   -37.081  -6.647  1.00 299.13 ? 67  MET G C     1 
ATOM 6021  O O     . MET K  3 54  ? 8.250   -35.910  -7.073  1.00 295.06 ? 67  MET G O     1 
ATOM 6022  C CB    . MET K  3 54  ? 10.362  -37.862  -5.466  1.00 284.49 ? 67  MET G CB    1 
ATOM 6023  C CG    . MET K  3 54  ? 11.326  -37.577  -4.330  1.00 274.12 ? 67  MET G CG    1 
ATOM 6024  S SD    . MET K  3 54  ? 12.965  -38.227  -4.726  1.00 260.87 ? 67  MET G SD    1 
ATOM 6025  C CE    . MET K  3 54  ? 13.058  -39.698  -3.712  1.00 257.62 ? 67  MET G CE    1 
ATOM 6026  N N     . PHE K  3 55  ? 7.800   -38.132  -7.331  1.00 304.08 ? 68  PHE G N     1 
ATOM 6027  C CA    . PHE K  3 55  ? 7.161   -38.038  -8.676  1.00 305.93 ? 68  PHE G CA    1 
ATOM 6028  C C     . PHE K  3 55  ? 5.814   -37.317  -8.635  1.00 308.40 ? 68  PHE G C     1 
ATOM 6029  O O     . PHE K  3 55  ? 5.559   -36.408  -9.450  1.00 309.82 ? 68  PHE G O     1 
ATOM 6030  C CB    . PHE K  3 55  ? 6.859   -39.419  -9.308  1.00 306.80 ? 68  PHE G CB    1 
ATOM 6031  C CG    . PHE K  3 55  ? 8.060   -40.290  -9.581  1.00 302.03 ? 68  PHE G CG    1 
ATOM 6032  C CD1   . PHE K  3 55  ? 9.311   -39.749  -9.858  1.00 297.86 ? 68  PHE G CD1   1 
ATOM 6033  C CD2   . PHE K  3 55  ? 7.911   -41.682  -9.606  1.00 300.62 ? 68  PHE G CD2   1 
ATOM 6034  C CE1   . PHE K  3 55  ? 10.392  -40.576  -10.113 1.00 293.32 ? 68  PHE G CE1   1 
ATOM 6035  C CE2   . PHE K  3 55  ? 8.990   -42.508  -9.867  1.00 294.68 ? 68  PHE G CE2   1 
ATOM 6036  C CZ    . PHE K  3 55  ? 10.232  -41.955  -10.119 1.00 291.76 ? 68  PHE G CZ    1 
ATOM 6037  N N     . ALA K  3 56  ? 4.945   -37.769  -7.720  1.00 308.12 ? 69  ALA G N     1 
ATOM 6038  C CA    . ALA K  3 56  ? 3.589   -37.244  -7.578  1.00 310.10 ? 69  ALA G CA    1 
ATOM 6039  C C     . ALA K  3 56  ? 3.680   -35.764  -7.289  1.00 315.00 ? 69  ALA G C     1 
ATOM 6040  O O     . ALA K  3 56  ? 2.971   -34.971  -7.903  1.00 320.22 ? 69  ALA G O     1 
ATOM 6041  C CB    . ALA K  3 56  ? 2.828   -37.968  -6.476  1.00 305.68 ? 69  ALA G CB    1 
ATOM 6042  N N     . ARG K  3 57  ? 4.579   -35.391  -6.377  1.00 316.46 ? 70  ARG G N     1 
ATOM 6043  C CA    . ARG K  3 57  ? 4.765   -33.984  -6.023  1.00 320.14 ? 70  ARG G CA    1 
ATOM 6044  C C     . ARG K  3 57  ? 5.330   -33.116  -7.161  1.00 325.17 ? 70  ARG G C     1 
ATOM 6045  O O     . ARG K  3 57  ? 4.968   -31.938  -7.268  1.00 330.27 ? 70  ARG G O     1 
ATOM 6046  C CB    . ARG K  3 57  ? 5.586   -33.822  -4.729  1.00 313.97 ? 70  ARG G CB    1 
ATOM 6047  C CG    . ARG K  3 57  ? 5.831   -32.379  -4.310  1.00 309.28 ? 70  ARG G CG    1 
ATOM 6048  C CD    . ARG K  3 57  ? 5.120   -31.988  -3.014  1.00 306.17 ? 70  ARG G CD    1 
ATOM 6049  N NE    . ARG K  3 57  ? 3.689   -31.724  -3.171  1.00 302.68 ? 70  ARG G NE    1 
ATOM 6050  C CZ    . ARG K  3 57  ? 3.171   -30.624  -3.713  1.00 302.02 ? 70  ARG G CZ    1 
ATOM 6051  N NH1   . ARG K  3 57  ? 3.951   -29.649  -4.169  1.00 299.80 ? 70  ARG G NH1   1 
ATOM 6052  N NH2   . ARG K  3 57  ? 1.857   -30.495  -3.798  1.00 302.77 ? 70  ARG G NH2   1 
ATOM 6053  N N     . HIS K  3 58  ? 6.184   -33.688  -8.015  1.00 327.32 ? 71  HIS G N     1 
ATOM 6054  C CA    . HIS K  3 58  ? 6.742   -32.937  -9.166  1.00 333.27 ? 71  HIS G CA    1 
ATOM 6055  C C     . HIS K  3 58  ? 5.736   -32.582  -10.306 1.00 335.07 ? 71  HIS G C     1 
ATOM 6056  O O     . HIS K  3 58  ? 5.974   -31.630  -11.061 1.00 339.46 ? 71  HIS G O     1 
ATOM 6057  C CB    . HIS K  3 58  ? 8.021   -33.602  -9.717  1.00 333.79 ? 71  HIS G CB    1 
ATOM 6058  C CG    . HIS K  3 58  ? 8.861   -32.699  -10.580 1.00 337.63 ? 71  HIS G CG    1 
ATOM 6059  N ND1   . HIS K  3 58  ? 9.299   -31.458  -10.165 1.00 338.21 ? 71  HIS G ND1   1 
ATOM 6060  C CD2   . HIS K  3 58  ? 9.358   -32.869  -11.830 1.00 338.25 ? 71  HIS G CD2   1 
ATOM 6061  C CE1   . HIS K  3 58  ? 10.021  -30.900  -11.122 1.00 337.21 ? 71  HIS G CE1   1 
ATOM 6062  N NE2   . HIS K  3 58  ? 10.071  -31.735  -12.144 1.00 337.07 ? 71  HIS G NE2   1 
ATOM 6063  N N     . ALA K  3 59  ? 4.625   -33.327  -10.397 1.00 331.04 ? 72  ALA G N     1 
ATOM 6064  C CA    . ALA K  3 59  ? 3.593   -33.169  -11.454 1.00 325.14 ? 72  ALA G CA    1 
ATOM 6065  C C     . ALA K  3 59  ? 2.301   -32.468  -10.986 1.00 323.84 ? 72  ALA G C     1 
ATOM 6066  O O     . ALA K  3 59  ? 1.202   -32.828  -11.415 1.00 320.56 ? 72  ALA G O     1 
ATOM 6067  C CB    . ALA K  3 59  ? 3.255   -34.535  -12.055 1.00 323.89 ? 72  ALA G CB    1 
ATOM 6068  N N     . LYS K  3 60  ? 2.430   -31.485  -10.097 1.00 324.17 ? 73  LYS G N     1 
ATOM 6069  C CA    . LYS K  3 60  ? 1.258   -30.762  -9.535  1.00 329.50 ? 73  LYS G CA    1 
ATOM 6070  C C     . LYS K  3 60  ? 0.311   -31.544  -8.564  1.00 335.86 ? 73  LYS G C     1 
ATOM 6071  O O     . LYS K  3 60  ? -0.780  -31.043  -8.272  1.00 338.25 ? 73  LYS G O     1 
ATOM 6072  C CB    . LYS K  3 60  ? 0.359   -30.136  -10.638 1.00 328.45 ? 73  LYS G CB    1 
ATOM 6073  C CG    . LYS K  3 60  ? 0.978   -29.235  -11.714 1.00 328.19 ? 73  LYS G CG    1 
ATOM 6074  C CD    . LYS K  3 60  ? 0.003   -28.158  -12.211 1.00 331.98 ? 73  LYS G CD    1 
ATOM 6075  C CE    . LYS K  3 60  ? -1.273  -28.698  -12.860 1.00 333.96 ? 73  LYS G CE    1 
ATOM 6076  N NZ    . LYS K  3 60  ? -1.105  -29.128  -14.277 1.00 335.10 ? 73  LYS G NZ    1 
ATOM 6077  N N     . ARG K  3 61  ? 0.681   -32.731  -8.061  1.00 342.34 ? 74  ARG G N     1 
ATOM 6078  C CA    . ARG K  3 61  ? -0.279  -33.557  -7.267  1.00 351.15 ? 74  ARG G CA    1 
ATOM 6079  C C     . ARG K  3 61  ? 0.247   -34.151  -5.943  1.00 354.47 ? 74  ARG G C     1 
ATOM 6080  O O     . ARG K  3 61  ? 1.439   -34.139  -5.693  1.00 355.03 ? 74  ARG G O     1 
ATOM 6081  C CB    . ARG K  3 61  ? -0.843  -34.689  -8.126  1.00 349.67 ? 74  ARG G CB    1 
ATOM 6082  C CG    . ARG K  3 61  ? -1.549  -34.243  -9.392  1.00 346.38 ? 74  ARG G CG    1 
ATOM 6083  C CD    . ARG K  3 61  ? -1.803  -35.420  -10.317 1.00 342.17 ? 74  ARG G CD    1 
ATOM 6084  N NE    . ARG K  3 61  ? -0.660  -35.763  -11.169 1.00 333.00 ? 74  ARG G NE    1 
ATOM 6085  C CZ    . ARG K  3 61  ? 0.247   -36.693  -10.880 1.00 326.54 ? 74  ARG G CZ    1 
ATOM 6086  N NH1   . ARG K  3 61  ? 0.170   -37.378  -9.746  1.00 326.05 ? 74  ARG G NH1   1 
ATOM 6087  N NH2   . ARG K  3 61  ? 1.235   -36.938  -11.727 1.00 319.26 ? 74  ARG G NH2   1 
ATOM 6088  N N     . THR K  3 62  ? -0.651  -34.651  -5.086  1.00 357.08 ? 75  THR G N     1 
ATOM 6089  C CA    . THR K  3 62  ? -0.241  -35.478  -3.913  1.00 353.89 ? 75  THR G CA    1 
ATOM 6090  C C     . THR K  3 62  ? -0.652  -36.953  -4.070  1.00 355.73 ? 75  THR G C     1 
ATOM 6091  O O     . THR K  3 62  ? -0.045  -37.837  -3.459  1.00 355.54 ? 75  THR G O     1 
ATOM 6092  C CB    . THR K  3 62  ? -0.738  -34.964  -2.516  1.00 352.16 ? 75  THR G CB    1 
ATOM 6093  O OG1   . THR K  3 62  ? -2.178  -34.904  -2.465  1.00 354.96 ? 75  THR G OG1   1 
ATOM 6094  C CG2   . THR K  3 62  ? -0.095  -33.616  -2.120  1.00 348.21 ? 75  THR G CG2   1 
ATOM 6095  N N     . THR K  3 63  ? -1.680  -37.202  -4.886  1.00 358.31 ? 76  THR G N     1 
ATOM 6096  C CA    . THR K  3 63  ? -2.229  -38.544  -5.088  1.00 357.07 ? 76  THR G CA    1 
ATOM 6097  C C     . THR K  3 63  ? -1.510  -39.220  -6.275  1.00 355.78 ? 76  THR G C     1 
ATOM 6098  O O     . THR K  3 63  ? -1.531  -38.691  -7.388  1.00 364.00 ? 76  THR G O     1 
ATOM 6099  C CB    . THR K  3 63  ? -3.777  -38.500  -5.266  1.00 357.18 ? 76  THR G CB    1 
ATOM 6100  O OG1   . THR K  3 63  ? -4.126  -37.773  -6.449  1.00 358.50 ? 76  THR G OG1   1 
ATOM 6101  C CG2   . THR K  3 63  ? -4.465  -37.821  -4.058  1.00 355.91 ? 76  THR G CG2   1 
ATOM 6102  N N     . ILE K  3 64  ? -0.843  -40.349  -6.023  1.00 347.36 ? 77  ILE G N     1 
ATOM 6103  C CA    . ILE K  3 64  ? -0.117  -41.056  -7.074  1.00 338.39 ? 77  ILE G CA    1 
ATOM 6104  C C     . ILE K  3 64  ? -1.119  -41.790  -7.966  1.00 350.07 ? 77  ILE G C     1 
ATOM 6105  O O     . ILE K  3 64  ? -2.001  -42.500  -7.469  1.00 354.10 ? 77  ILE G O     1 
ATOM 6106  C CB    . ILE K  3 64  ? 0.930   -42.036  -6.509  1.00 321.58 ? 77  ILE G CB    1 
ATOM 6107  C CG1   . ILE K  3 64  ? 1.888   -41.306  -5.570  1.00 308.52 ? 77  ILE G CG1   1 
ATOM 6108  C CG2   . ILE K  3 64  ? 1.722   -42.676  -7.640  1.00 318.47 ? 77  ILE G CG2   1 
ATOM 6109  C CD1   . ILE K  3 64  ? 2.591   -42.213  -4.590  1.00 299.10 ? 77  ILE G CD1   1 
ATOM 6110  N N     . ASN K  3 65  ? -0.994  -41.577  -9.280  1.00 358.03 ? 78  ASN G N     1 
ATOM 6111  C CA    . ASN K  3 65  ? -1.884  -42.166  -10.298 1.00 362.99 ? 78  ASN G CA    1 
ATOM 6112  C C     . ASN K  3 65  ? -1.164  -43.149  -11.225 1.00 363.20 ? 78  ASN G C     1 
ATOM 6113  O O     . ASN K  3 65  ? -0.019  -43.552  -10.958 1.00 366.23 ? 78  ASN G O     1 
ATOM 6114  C CB    . ASN K  3 65  ? -2.644  -41.075  -11.126 1.00 361.41 ? 78  ASN G CB    1 
ATOM 6115  C CG    . ASN K  3 65  ? -1.720  -40.100  -11.891 1.00 355.09 ? 78  ASN G CG    1 
ATOM 6116  O OD1   . ASN K  3 65  ? -0.580  -40.414  -12.231 1.00 347.32 ? 78  ASN G OD1   1 
ATOM 6117  N ND2   . ASN K  3 65  ? -2.236  -38.902  -12.170 1.00 355.12 ? 78  ASN G ND2   1 
ATOM 6118  N N     . THR K  3 66  ? -1.841  -43.505  -12.315 1.00 361.80 ? 79  THR G N     1 
ATOM 6119  C CA    . THR K  3 66  ? -1.262  -44.307  -13.394 1.00 354.43 ? 79  THR G CA    1 
ATOM 6120  C C     . THR K  3 66  ? 0.083   -43.772  -13.985 1.00 349.25 ? 79  THR G C     1 
ATOM 6121  O O     . THR K  3 66  ? 0.978   -44.567  -14.279 1.00 345.72 ? 79  THR G O     1 
ATOM 6122  C CB    . THR K  3 66  ? -2.303  -44.537  -14.515 1.00 354.01 ? 79  THR G CB    1 
ATOM 6123  O OG1   . THR K  3 66  ? -2.809  -43.270  -14.951 1.00 356.86 ? 79  THR G OG1   1 
ATOM 6124  C CG2   . THR K  3 66  ? -3.470  -45.402  -14.020 1.00 353.82 ? 79  THR G CG2   1 
ATOM 6125  N N     . GLU K  3 67  ? 0.236   -42.448  -14.118 1.00 346.82 ? 80  GLU G N     1 
ATOM 6126  C CA    . GLU K  3 67  ? 1.390   -41.825  -14.832 1.00 343.52 ? 80  GLU G CA    1 
ATOM 6127  C C     . GLU K  3 67  ? 2.737   -42.018  -14.180 1.00 337.54 ? 80  GLU G C     1 
ATOM 6128  O O     . GLU K  3 67  ? 3.727   -42.316  -14.850 1.00 331.54 ? 80  GLU G O     1 
ATOM 6129  C CB    . GLU K  3 67  ? 1.178   -40.318  -15.036 1.00 349.72 ? 80  GLU G CB    1 
ATOM 6130  C CG    . GLU K  3 67  ? -0.115  -39.921  -15.732 1.00 359.55 ? 80  GLU G CG    1 
ATOM 6131  C CD    . GLU K  3 67  ? -0.430  -40.782  -16.952 1.00 365.51 ? 80  GLU G CD    1 
ATOM 6132  O OE1   . GLU K  3 67  ? -1.566  -41.298  -17.018 1.00 370.14 ? 80  GLU G OE1   1 
ATOM 6133  O OE2   . GLU K  3 67  ? 0.443   -40.974  -17.834 1.00 369.52 ? 80  GLU G OE2   1 
ATOM 6134  N N     . ASP K  3 68  ? 2.752   -41.815  -12.869 1.00 337.73 ? 81  ASP G N     1 
ATOM 6135  C CA    . ASP K  3 68  ? 3.947   -41.929  -12.061 1.00 340.01 ? 81  ASP G CA    1 
ATOM 6136  C C     . ASP K  3 68  ? 4.362   -43.382  -11.939 1.00 346.67 ? 81  ASP G C     1 
ATOM 6137  O O     . ASP K  3 68  ? 5.552   -43.686  -12.017 1.00 349.98 ? 81  ASP G O     1 
ATOM 6138  C CB    . ASP K  3 68  ? 3.711   -41.352  -10.664 1.00 333.74 ? 81  ASP G CB    1 
ATOM 6139  C CG    . ASP K  3 68  ? 3.302   -39.892  -10.691 1.00 327.87 ? 81  ASP G CG    1 
ATOM 6140  O OD1   . ASP K  3 68  ? 3.828   -39.134  -11.533 1.00 323.38 ? 81  ASP G OD1   1 
ATOM 6141  O OD2   . ASP K  3 68  ? 2.456   -39.503  -9.853  1.00 324.10 ? 81  ASP G OD2   1 
ATOM 6142  N N     . VAL K  3 69  ? 3.374   -44.261  -11.732 1.00 353.45 ? 82  VAL G N     1 
ATOM 6143  C CA    . VAL K  3 69  ? 3.579   -45.723  -11.650 1.00 352.51 ? 82  VAL G CA    1 
ATOM 6144  C C     . VAL K  3 69  ? 4.199   -46.304  -12.967 1.00 350.29 ? 82  VAL G C     1 
ATOM 6145  O O     . VAL K  3 69  ? 5.179   -47.073  -12.914 1.00 355.42 ? 82  VAL G O     1 
ATOM 6146  C CB    . VAL K  3 69  ? 2.277   -46.471  -11.176 1.00 352.83 ? 82  VAL G CB    1 
ATOM 6147  C CG1   . VAL K  3 69  ? 2.453   -47.982  -11.186 1.00 350.51 ? 82  VAL G CG1   1 
ATOM 6148  C CG2   . VAL K  3 69  ? 1.847   -46.034  -9.776  1.00 351.07 ? 82  VAL G CG2   1 
ATOM 6149  N N     . LYS K  3 70  ? 3.665   -45.905  -14.132 1.00 342.30 ? 83  LYS G N     1 
ATOM 6150  C CA    . LYS K  3 70  ? 4.177   -46.350  -15.454 1.00 329.81 ? 83  LYS G CA    1 
ATOM 6151  C C     . LYS K  3 70  ? 5.590   -45.854  -15.754 1.00 325.43 ? 83  LYS G C     1 
ATOM 6152  O O     . LYS K  3 70  ? 6.367   -46.548  -16.420 1.00 321.53 ? 83  LYS G O     1 
ATOM 6153  C CB    . LYS K  3 70  ? 3.242   -45.926  -16.593 1.00 325.33 ? 83  LYS G CB    1 
ATOM 6154  C CG    . LYS K  3 70  ? 2.031   -46.831  -16.757 1.00 323.60 ? 83  LYS G CG    1 
ATOM 6155  C CD    . LYS K  3 70  ? 1.305   -46.642  -18.085 1.00 320.21 ? 83  LYS G CD    1 
ATOM 6156  C CE    . LYS K  3 70  ? 0.170   -45.632  -17.986 1.00 320.67 ? 83  LYS G CE    1 
ATOM 6157  N NZ    . LYS K  3 70  ? -1.033  -46.018  -18.771 1.00 320.18 ? 83  LYS G NZ    1 
ATOM 6158  N N     . LEU K  3 71  ? 5.902   -44.647  -15.273 1.00 324.78 ? 84  LEU G N     1 
ATOM 6159  C CA    . LEU K  3 71  ? 7.254   -44.071  -15.349 1.00 322.42 ? 84  LEU G CA    1 
ATOM 6160  C C     . LEU K  3 71  ? 8.272   -44.811  -14.444 1.00 330.11 ? 84  LEU G C     1 
ATOM 6161  O O     . LEU K  3 71  ? 9.449   -44.854  -14.788 1.00 333.00 ? 84  LEU G O     1 
ATOM 6162  C CB    . LEU K  3 71  ? 7.231   -42.553  -15.043 1.00 311.32 ? 84  LEU G CB    1 
ATOM 6163  C CG    . LEU K  3 71  ? 8.377   -41.636  -15.512 1.00 302.28 ? 84  LEU G CG    1 
ATOM 6164  C CD1   . LEU K  3 71  ? 8.408   -41.552  -17.031 1.00 298.81 ? 84  LEU G CD1   1 
ATOM 6165  C CD2   . LEU K  3 71  ? 8.258   -40.238  -14.907 1.00 301.00 ? 84  LEU G CD2   1 
ATOM 6166  N N     . LEU K  3 72  ? 7.833   -45.397  -13.314 1.00 336.88 ? 85  LEU G N     1 
ATOM 6167  C CA    . LEU K  3 72  ? 8.731   -46.129  -12.358 1.00 332.46 ? 85  LEU G CA    1 
ATOM 6168  C C     . LEU K  3 72  ? 9.235   -47.515  -12.849 1.00 329.88 ? 85  LEU G C     1 
ATOM 6169  O O     . LEU K  3 72  ? 10.251  -48.032  -12.348 1.00 328.15 ? 85  LEU G O     1 
ATOM 6170  C CB    . LEU K  3 72  ? 8.085   -46.232  -10.962 1.00 325.73 ? 85  LEU G CB    1 
ATOM 6171  C CG    . LEU K  3 72  ? 8.838   -46.819  -9.767  1.00 315.36 ? 85  LEU G CG    1 
ATOM 6172  C CD1   . LEU K  3 72  ? 9.934   -45.913  -9.223  1.00 309.13 ? 85  LEU G CD1   1 
ATOM 6173  C CD2   . LEU K  3 72  ? 7.821   -47.122  -8.690  1.00 310.20 ? 85  LEU G CD2   1 
ATOM 6174  N N     . ALA K  3 73  ? 8.533   -48.085  -13.838 1.00 324.87 ? 86  ALA G N     1 
ATOM 6175  C CA    . ALA K  3 73  ? 8.912   -49.348  -14.500 1.00 310.64 ? 86  ALA G CA    1 
ATOM 6176  C C     . ALA K  3 73  ? 9.545   -49.179  -15.914 1.00 301.04 ? 86  ALA G C     1 
ATOM 6177  O O     . ALA K  3 73  ? 9.279   -49.987  -16.804 1.00 299.33 ? 86  ALA G O     1 
ATOM 6178  C CB    . ALA K  3 73  ? 7.691   -50.269  -14.571 1.00 310.53 ? 86  ALA G CB    1 
ATOM 6179  N N     . ARG K  3 74  ? 10.389  -48.155  -16.119 1.00 290.95 ? 87  ARG G N     1 
ATOM 6180  C CA    . ARG K  3 74  ? 10.900  -47.805  -17.473 1.00 281.79 ? 87  ARG G CA    1 
ATOM 6181  C C     . ARG K  3 74  ? 12.364  -48.255  -17.748 1.00 273.27 ? 87  ARG G C     1 
ATOM 6182  O O     . ARG K  3 74  ? 13.027  -47.779  -18.681 1.00 274.11 ? 87  ARG G O     1 
ATOM 6183  C CB    . ARG K  3 74  ? 10.654  -46.304  -17.781 1.00 280.55 ? 87  ARG G CB    1 
ATOM 6184  C CG    . ARG K  3 74  ? 11.900  -45.435  -17.872 1.00 272.18 ? 87  ARG G CG    1 
ATOM 6185  C CD    . ARG K  3 74  ? 11.657  -43.977  -17.544 1.00 265.89 ? 87  ARG G CD    1 
ATOM 6186  N NE    . ARG K  3 74  ? 11.887  -43.718  -16.130 1.00 260.29 ? 87  ARG G NE    1 
ATOM 6187  C CZ    . ARG K  3 74  ? 13.043  -43.926  -15.504 1.00 255.20 ? 87  ARG G CZ    1 
ATOM 6188  N NH1   . ARG K  3 74  ? 14.092  -44.399  -16.166 1.00 251.01 ? 87  ARG G NH1   1 
ATOM 6189  N NH2   . ARG K  3 74  ? 13.142  -43.670  -14.211 1.00 253.84 ? 87  ARG G NH2   1 
ATOM 6190  N N     . ARG K  3 75  ? 12.845  -49.214  -16.964 1.00 263.53 ? 88  ARG G N     1 
ATOM 6191  C CA    . ARG K  3 75  ? 14.264  -49.558  -16.990 1.00 258.33 ? 88  ARG G CA    1 
ATOM 6192  C C     . ARG K  3 75  ? 14.705  -50.664  -17.963 1.00 260.04 ? 88  ARG G C     1 
ATOM 6193  O O     . ARG K  3 75  ? 15.540  -50.415  -18.834 1.00 259.80 ? 88  ARG G O     1 
ATOM 6194  C CB    . ARG K  3 75  ? 14.774  -49.781  -15.566 1.00 252.20 ? 88  ARG G CB    1 
ATOM 6195  C CG    . ARG K  3 75  ? 14.909  -48.484  -14.769 1.00 246.93 ? 88  ARG G CG    1 
ATOM 6196  C CD    . ARG K  3 75  ? 16.326  -47.922  -14.775 1.00 243.18 ? 88  ARG G CD    1 
ATOM 6197  N NE    . ARG K  3 75  ? 16.486  -46.734  -15.618 1.00 238.93 ? 88  ARG G NE    1 
ATOM 6198  C CZ    . ARG K  3 75  ? 17.232  -46.678  -16.719 1.00 234.61 ? 88  ARG G CZ    1 
ATOM 6199  N NH1   . ARG K  3 75  ? 17.899  -47.748  -17.141 1.00 228.93 ? 88  ARG G NH1   1 
ATOM 6200  N NH2   . ARG K  3 75  ? 17.303  -45.543  -17.403 1.00 233.97 ? 88  ARG G NH2   1 
ATOM 6201  N N     . SER K  3 76  ? 14.166  -51.871  -17.812 1.00 262.69 ? 89  SER G N     1 
ATOM 6202  C CA    . SER K  3 76  ? 14.359  -52.907  -18.815 1.00 265.21 ? 89  SER G CA    1 
ATOM 6203  C C     . SER K  3 76  ? 13.154  -52.902  -19.737 1.00 272.42 ? 89  SER G C     1 
ATOM 6204  O O     . SER K  3 76  ? 12.025  -52.603  -19.303 1.00 278.14 ? 89  SER G O     1 
ATOM 6205  C CB    . SER K  3 76  ? 14.511  -54.281  -18.175 1.00 260.89 ? 89  SER G CB    1 
ATOM 6206  O OG    . SER K  3 76  ? 13.319  -54.645  -17.507 1.00 260.51 ? 89  SER G OG    1 
ATOM 6207  N N     . ASN K  3 77  ? 13.387  -53.236  -21.003 1.00 276.37 ? 90  ASN G N     1 
ATOM 6208  C CA    . ASN K  3 77  ? 12.312  -53.209  -22.001 1.00 282.35 ? 90  ASN G CA    1 
ATOM 6209  C C     . ASN K  3 77  ? 11.144  -54.221  -21.889 1.00 293.74 ? 90  ASN G C     1 
ATOM 6210  O O     . ASN K  3 77  ? 10.018  -53.859  -22.251 1.00 301.86 ? 90  ASN G O     1 
ATOM 6211  C CB    . ASN K  3 77  ? 12.872  -53.122  -23.419 1.00 272.06 ? 90  ASN G CB    1 
ATOM 6212  C CG    . ASN K  3 77  ? 13.370  -51.738  -23.738 1.00 266.10 ? 90  ASN G CG    1 
ATOM 6213  O OD1   . ASN K  3 77  ? 14.248  -51.211  -23.051 1.00 261.08 ? 90  ASN G OD1   1 
ATOM 6214  N ND2   . ASN K  3 77  ? 12.794  -51.122  -24.759 1.00 265.55 ? 90  ASN G ND2   1 
ATOM 6215  N N     . SER K  3 78  ? 11.393  -55.453  -21.394 1.00 297.45 ? 91  SER G N     1 
ATOM 6216  C CA    . SER K  3 78  ? 10.318  -56.479  -21.179 1.00 296.46 ? 91  SER G CA    1 
ATOM 6217  C C     . SER K  3 78  ? 9.351   -56.083  -20.064 1.00 302.88 ? 91  SER G C     1 
ATOM 6218  O O     . SER K  3 78  ? 8.182   -56.470  -20.093 1.00 300.32 ? 91  SER G O     1 
ATOM 6219  C CB    . SER K  3 78  ? 10.863  -57.901  -20.935 1.00 286.76 ? 91  SER G CB    1 
ATOM 6220  O OG    . SER K  3 78  ? 11.435  -58.019  -19.648 1.00 282.33 ? 91  SER G OG    1 
ATOM 6221  N N     . LEU K  3 79  ? 9.859   -55.299  -19.109 1.00 311.54 ? 92  LEU G N     1 
ATOM 6222  C CA    . LEU K  3 79  ? 9.068   -54.649  -18.059 1.00 316.92 ? 92  LEU G CA    1 
ATOM 6223  C C     . LEU K  3 79  ? 8.080   -53.583  -18.601 1.00 321.23 ? 92  LEU G C     1 
ATOM 6224  O O     . LEU K  3 79  ? 6.900   -53.593  -18.226 1.00 325.89 ? 92  LEU G O     1 
ATOM 6225  C CB    . LEU K  3 79  ? 10.007  -54.021  -17.023 1.00 313.73 ? 92  LEU G CB    1 
ATOM 6226  C CG    . LEU K  3 79  ? 9.792   -54.278  -15.532 1.00 310.32 ? 92  LEU G CG    1 
ATOM 6227  C CD1   . LEU K  3 79  ? 10.557  -53.220  -14.752 1.00 307.32 ? 92  LEU G CD1   1 
ATOM 6228  C CD2   . LEU K  3 79  ? 8.323   -54.276  -15.136 1.00 311.40 ? 92  LEU G CD2   1 
ATOM 6229  N N     . LEU K  3 80  ? 8.562   -52.679  -19.468 1.00 317.77 ? 93  LEU G N     1 
ATOM 6230  C CA    . LEU K  3 80  ? 7.735   -51.621  -20.106 1.00 310.34 ? 93  LEU G CA    1 
ATOM 6231  C C     . LEU K  3 80  ? 6.568   -52.204  -20.913 1.00 314.41 ? 93  LEU G C     1 
ATOM 6232  O O     . LEU K  3 80  ? 5.421   -51.737  -20.818 1.00 314.61 ? 93  LEU G O     1 
ATOM 6233  C CB    . LEU K  3 80  ? 8.613   -50.722  -21.006 1.00 297.64 ? 93  LEU G CB    1 
ATOM 6234  C CG    . LEU K  3 80  ? 8.067   -50.141  -22.324 1.00 288.84 ? 93  LEU G CG    1 
ATOM 6235  C CD1   . LEU K  3 80  ? 7.319   -48.833  -22.105 1.00 288.54 ? 93  LEU G CD1   1 
ATOM 6236  C CD2   . LEU K  3 80  ? 9.184   -49.964  -23.348 1.00 281.72 ? 93  LEU G CD2   1 
ATOM 6237  N N     . LYS K  3 81  ? 6.903   -53.227  -21.697 1.00 318.88 ? 94  LYS G N     1 
ATOM 6238  C CA    . LYS K  3 81  ? 5.988   -53.977  -22.559 1.00 324.92 ? 94  LYS G CA    1 
ATOM 6239  C C     . LYS K  3 81  ? 4.902   -54.635  -21.712 1.00 332.19 ? 94  LYS G C     1 
ATOM 6240  O O     . LYS K  3 81  ? 3.713   -54.459  -21.969 1.00 339.85 ? 94  LYS G O     1 
ATOM 6241  C CB    . LYS K  3 81  ? 6.769   -55.032  -23.375 1.00 319.30 ? 94  LYS G CB    1 
ATOM 6242  C CG    . LYS K  3 81  ? 6.853   -54.777  -24.898 1.00 311.97 ? 94  LYS G CG    1 
ATOM 6243  C CD    . LYS K  3 81  ? 8.131   -55.337  -25.535 1.00 302.75 ? 94  LYS G CD    1 
ATOM 6244  C CE    . LYS K  3 81  ? 8.215   -55.100  -27.047 1.00 295.50 ? 94  LYS G CE    1 
ATOM 6245  N NZ    . LYS K  3 81  ? 7.784   -56.267  -27.875 1.00 289.87 ? 94  LYS G NZ    1 
ATOM 6246  N N     . TYR K  3 82  ? 5.340   -55.350  -20.677 1.00 333.28 ? 95  TYR G N     1 
ATOM 6247  C CA    . TYR K  3 82  ? 4.489   -56.032  -19.693 1.00 334.17 ? 95  TYR G CA    1 
ATOM 6248  C C     . TYR K  3 82  ? 3.400   -55.134  -19.111 1.00 344.72 ? 95  TYR G C     1 
ATOM 6249  O O     . TYR K  3 82  ? 2.202   -55.464  -19.138 1.00 344.13 ? 95  TYR G O     1 
ATOM 6250  C CB    . TYR K  3 82  ? 5.372   -56.530  -18.530 1.00 323.34 ? 95  TYR G CB    1 
ATOM 6251  C CG    . TYR K  3 82  ? 4.853   -57.770  -17.828 1.00 315.46 ? 95  TYR G CG    1 
ATOM 6252  C CD1   . TYR K  3 82  ? 3.557   -57.797  -17.277 1.00 315.60 ? 95  TYR G CD1   1 
ATOM 6253  C CD2   . TYR K  3 82  ? 5.655   -58.935  -17.720 1.00 309.01 ? 95  TYR G CD2   1 
ATOM 6254  C CE1   . TYR K  3 82  ? 3.071   -58.945  -16.644 1.00 312.79 ? 95  TYR G CE1   1 
ATOM 6255  C CE2   . TYR K  3 82  ? 5.172   -60.084  -17.090 1.00 306.70 ? 95  TYR G CE2   1 
ATOM 6256  C CZ    . TYR K  3 82  ? 3.881   -60.088  -16.549 1.00 309.00 ? 95  TYR G CZ    1 
ATOM 6257  O OH    . TYR K  3 82  ? 3.383   -61.220  -15.916 1.00 306.57 ? 95  TYR G OH    1 
ATOM 6258  N N     . ILE K  3 83  ? 3.855   -53.997  -18.585 1.00 355.91 ? 96  ILE G N     1 
ATOM 6259  C CA    . ILE K  3 83  ? 3.039   -53.031  -17.839 1.00 368.75 ? 96  ILE G CA    1 
ATOM 6260  C C     . ILE K  3 83  ? 1.896   -52.383  -18.673 1.00 386.14 ? 96  ILE G C     1 
ATOM 6261  O O     . ILE K  3 83  ? 0.745   -52.358  -18.215 1.00 396.15 ? 96  ILE G O     1 
ATOM 6262  C CB    . ILE K  3 83  ? 3.960   -52.005  -17.081 1.00 360.94 ? 96  ILE G CB    1 
ATOM 6263  C CG1   . ILE K  3 83  ? 4.644   -52.651  -15.856 1.00 351.73 ? 96  ILE G CG1   1 
ATOM 6264  C CG2   . ILE K  3 83  ? 3.243   -50.711  -16.691 1.00 365.32 ? 96  ILE G CG2   1 
ATOM 6265  C CD1   . ILE K  3 83  ? 3.725   -53.272  -14.816 1.00 349.66 ? 96  ILE G CD1   1 
ATOM 6266  N N     . THR K  3 84  ? 2.196   -51.898  -19.885 1.00 395.06 ? 97  THR G N     1 
ATOM 6267  C CA    . THR K  3 84  ? 1.201   -51.176  -20.722 1.00 401.01 ? 97  THR G CA    1 
ATOM 6268  C C     . THR K  3 84  ? -0.059  -51.989  -21.068 1.00 403.07 ? 97  THR G C     1 
ATOM 6269  O O     . THR K  3 84  ? -1.163  -51.449  -21.065 1.00 406.45 ? 97  THR G O     1 
ATOM 6270  C CB    . THR K  3 84  ? 1.813   -50.617  -22.023 1.00 399.25 ? 97  THR G CB    1 
ATOM 6271  O OG1   . THR K  3 84  ? 2.412   -51.684  -22.761 1.00 394.68 ? 97  THR G OG1   1 
ATOM 6272  C CG2   . THR K  3 84  ? 2.871   -49.560  -21.716 1.00 399.91 ? 97  THR G CG2   1 
ATOM 6273  N N     . ASP K  3 85  ? 0.129   -53.281  -21.339 1.00 402.53 ? 98  ASP G N     1 
ATOM 6274  C CA    . ASP K  3 85  ? -0.953  -54.240  -21.651 1.00 400.46 ? 98  ASP G CA    1 
ATOM 6275  C C     . ASP K  3 85  ? -1.945  -54.398  -20.516 1.00 386.76 ? 98  ASP G C     1 
ATOM 6276  O O     . ASP K  3 85  ? -3.164  -54.247  -20.702 1.00 387.56 ? 98  ASP G O     1 
ATOM 6277  C CB    . ASP K  3 85  ? -0.374  -55.633  -21.947 1.00 417.58 ? 98  ASP G CB    1 
ATOM 6278  C CG    . ASP K  3 85  ? 0.623   -55.629  -23.103 1.00 431.74 ? 98  ASP G CG    1 
ATOM 6279  O OD1   . ASP K  3 85  ? 0.691   -54.627  -23.845 1.00 436.68 ? 98  ASP G OD1   1 
ATOM 6280  O OD2   . ASP K  3 85  ? 1.337   -56.637  -23.286 1.00 443.39 ? 98  ASP G OD2   1 
ATOM 6281  N N     . LYS K  3 86  ? -1.399  -54.734  -19.348 1.00 366.70 ? 99  LYS G N     1 
ATOM 6282  C CA    . LYS K  3 86  ? -2.172  -54.937  -18.130 1.00 357.17 ? 99  LYS G CA    1 
ATOM 6283  C C     . LYS K  3 86  ? -2.900  -53.656  -17.696 1.00 374.33 ? 99  LYS G C     1 
ATOM 6284  O O     . LYS K  3 86  ? -3.924  -53.739  -17.039 1.00 387.02 ? 99  LYS G O     1 
ATOM 6285  C CB    . LYS K  3 86  ? -1.286  -55.501  -17.007 1.00 334.16 ? 99  LYS G CB    1 
ATOM 6286  C CG    . LYS K  3 86  ? -1.334  -57.021  -16.890 1.00 313.85 ? 99  LYS G CG    1 
ATOM 6287  C CD    . LYS K  3 86  ? -0.377  -57.744  -17.834 1.00 299.34 ? 99  LYS G CD    1 
ATOM 6288  C CE    . LYS K  3 86  ? -0.478  -59.257  -17.694 1.00 291.04 ? 99  LYS G CE    1 
ATOM 6289  N NZ    . LYS K  3 86  ? -1.681  -59.864  -18.344 1.00 286.51 ? 99  LYS G NZ    1 
ATOM 6290  N N     . SER K  3 87  ? -2.377  -52.487  -18.090 1.00 383.12 ? 100 SER G N     1 
ATOM 6291  C CA    . SER K  3 87  ? -2.989  -51.173  -17.793 1.00 389.53 ? 100 SER G CA    1 
ATOM 6292  C C     . SER K  3 87  ? -4.286  -50.928  -18.560 1.00 398.25 ? 100 SER G C     1 
ATOM 6293  O O     . SER K  3 87  ? -5.217  -50.338  -18.016 1.00 396.59 ? 100 SER G O     1 
ATOM 6294  C CB    . SER K  3 87  ? -2.018  -50.011  -18.054 1.00 385.34 ? 100 SER G CB    1 
ATOM 6295  O OG    . SER K  3 87  ? -2.141  -49.508  -19.376 1.00 384.75 ? 100 SER G OG    1 
ATOM 6296  N N     . GLU K  3 88  ? -4.330  -51.353  -19.824 1.00 406.94 ? 101 GLU G N     1 
ATOM 6297  C CA    . GLU K  3 88  ? -5.554  -51.271  -20.644 1.00 413.94 ? 101 GLU G CA    1 
ATOM 6298  C C     . GLU K  3 88  ? -6.629  -52.298  -20.195 1.00 419.75 ? 101 GLU G C     1 
ATOM 6299  O O     . GLU K  3 88  ? -7.847  -52.008  -20.204 1.00 419.23 ? 101 GLU G O     1 
ATOM 6300  C CB    . GLU K  3 88  ? -5.209  -51.424  -22.139 1.00 411.36 ? 101 GLU G CB    1 
ATOM 6301  C CG    . GLU K  3 88  ? -4.550  -50.208  -22.789 1.00 408.08 ? 101 GLU G CG    1 
ATOM 6302  C CD    . GLU K  3 88  ? -3.755  -50.553  -24.056 1.00 403.93 ? 101 GLU G CD    1 
ATOM 6303  O OE1   . GLU K  3 88  ? -4.108  -51.541  -24.741 1.00 405.16 ? 101 GLU G OE1   1 
ATOM 6304  O OE2   . GLU K  3 88  ? -2.774  -49.837  -24.377 1.00 399.29 ? 101 GLU G OE2   1 
ATOM 6305  N N     . GLU K  3 89  ? -6.161  -53.483  -19.790 1.00 424.02 ? 102 GLU G N     1 
ATOM 6306  C CA    . GLU K  3 89  ? -7.003  -54.556  -19.240 1.00 427.26 ? 102 GLU G CA    1 
ATOM 6307  C C     . GLU K  3 89  ? -7.682  -54.158  -17.899 1.00 430.48 ? 102 GLU G C     1 
ATOM 6308  O O     . GLU K  3 89  ? -8.888  -54.362  -17.720 1.00 434.83 ? 102 GLU G O     1 
ATOM 6309  C CB    . GLU K  3 89  ? -6.152  -55.823  -19.088 1.00 424.42 ? 102 GLU G CB    1 
ATOM 6310  C CG    . GLU K  3 89  ? -6.869  -57.039  -18.529 1.00 428.30 ? 102 GLU G CG    1 
ATOM 6311  C CD    . GLU K  3 89  ? -5.955  -57.884  -17.656 1.00 425.87 ? 102 GLU G CD    1 
ATOM 6312  O OE1   . GLU K  3 89  ? -6.308  -58.150  -16.485 1.00 433.43 ? 102 GLU G OE1   1 
ATOM 6313  O OE2   . GLU K  3 89  ? -4.871  -58.290  -18.132 1.00 414.87 ? 102 GLU G OE2   1 
ATOM 6314  N N     . ILE K  3 90  ? -6.909  -53.591  -16.964 1.00 425.78 ? 103 ILE G N     1 
ATOM 6315  C CA    . ILE K  3 90  ? -7.468  -53.088  -15.688 1.00 412.19 ? 103 ILE G CA    1 
ATOM 6316  C C     . ILE K  3 90  ? -8.067  -51.659  -15.814 1.00 407.57 ? 103 ILE G C     1 
ATOM 6317  O O     . ILE K  3 90  ? -8.861  -51.264  -14.963 1.00 405.88 ? 103 ILE G O     1 
ATOM 6318  C CB    . ILE K  3 90  ? -6.497  -53.205  -14.462 1.00 405.49 ? 103 ILE G CB    1 
ATOM 6319  C CG1   . ILE K  3 90  ? -5.724  -54.539  -14.459 1.00 399.78 ? 103 ILE G CG1   1 
ATOM 6320  C CG2   . ILE K  3 90  ? -7.281  -53.114  -13.161 1.00 398.41 ? 103 ILE G CG2   1 
ATOM 6321  C CD1   . ILE K  3 90  ? -4.319  -54.480  -13.893 1.00 393.78 ? 103 ILE G CD1   1 
ATOM 6322  N N     . ALA K  3 91  ? -7.711  -50.893  -16.861 1.00 398.32 ? 104 ALA G N     1 
ATOM 6323  C CA    . ALA K  3 91  ? -8.391  -49.599  -17.161 1.00 392.66 ? 104 ALA G CA    1 
ATOM 6324  C C     . ALA K  3 91  ? -9.840  -49.831  -17.588 1.00 395.09 ? 104 ALA G C     1 
ATOM 6325  O O     . ALA K  3 91  ? -10.687 -48.944  -17.470 1.00 401.32 ? 104 ALA G O     1 
ATOM 6326  C CB    . ALA K  3 91  ? -7.649  -48.783  -18.218 1.00 383.76 ? 104 ALA G CB    1 
ATOM 6327  N N     . GLN K  3 92  ? -10.113 -51.035  -18.085 1.00 392.80 ? 105 GLN G N     1 
ATOM 6328  C CA    . GLN K  3 92  ? -11.481 -51.485  -18.327 1.00 394.07 ? 105 GLN G CA    1 
ATOM 6329  C C     . GLN K  3 92  ? -12.294 -51.667  -17.022 1.00 396.69 ? 105 GLN G C     1 
ATOM 6330  O O     . GLN K  3 92  ? -13.527 -51.609  -17.050 1.00 406.74 ? 105 GLN G O     1 
ATOM 6331  C CB    . GLN K  3 92  ? -11.489 -52.761  -19.176 1.00 387.38 ? 105 GLN G CB    1 
ATOM 6332  C CG    . GLN K  3 92  ? -11.339 -52.510  -20.669 1.00 381.79 ? 105 GLN G CG    1 
ATOM 6333  C CD    . GLN K  3 92  ? -11.349 -53.791  -21.477 1.00 377.45 ? 105 GLN G CD    1 
ATOM 6334  O OE1   . GLN K  3 92  ? -10.524 -54.687  -21.261 1.00 375.52 ? 105 GLN G OE1   1 
ATOM 6335  N NE2   . GLN K  3 92  ? -12.283 -53.886  -22.423 1.00 375.01 ? 105 GLN G NE2   1 
ATOM 6336  N N     . ALA K  3 93  ? -11.600 -51.892  -15.897 1.00 387.92 ? 106 ALA G N     1 
ATOM 6337  C CA    . ALA K  3 93  ? -12.218 -51.917  -14.558 1.00 381.50 ? 106 ALA G CA    1 
ATOM 6338  C C     . ALA K  3 93  ? -12.389 -50.507  -13.992 1.00 377.97 ? 106 ALA G C     1 
ATOM 6339  O O     . ALA K  3 93  ? -13.046 -49.659  -14.596 1.00 375.53 ? 106 ALA G O     1 
ATOM 6340  C CB    . ALA K  3 93  ? -11.409 -52.780  -13.595 1.00 377.42 ? 106 ALA G CB    1 
ATOM 6341  N N     . SER L  4 1   ? -3.467  -64.960  -10.303 1.00 286.51 ? 8   SER H N     1 
ATOM 6342  C CA    . SER L  4 1   ? -2.443  -65.836  -9.683  1.00 279.70 ? 8   SER H CA    1 
ATOM 6343  C C     . SER L  4 1   ? -1.417  -65.007  -8.877  1.00 274.93 ? 8   SER H C     1 
ATOM 6344  O O     . SER L  4 1   ? -0.594  -64.327  -9.482  1.00 265.07 ? 8   SER H O     1 
ATOM 6345  C CB    . SER L  4 1   ? -1.753  -66.636  -10.795 1.00 272.90 ? 8   SER H CB    1 
ATOM 6346  O OG    . SER L  4 1   ? -1.048  -67.726  -10.250 1.00 269.15 ? 8   SER H OG    1 
ATOM 6347  N N     . GLY L  4 2   ? -1.481  -65.036  -7.533  1.00 281.12 ? 9   GLY H N     1 
ATOM 6348  C CA    . GLY L  4 2   ? -0.479  -64.334  -6.662  1.00 284.02 ? 9   GLY H CA    1 
ATOM 6349  C C     . GLY L  4 2   ? -0.866  -63.209  -5.672  1.00 294.67 ? 9   GLY H C     1 
ATOM 6350  O O     . GLY L  4 2   ? -1.656  -63.447  -4.755  1.00 301.45 ? 9   GLY H O     1 
ATOM 6351  N N     . PHE L  4 3   ? -0.276  -62.005  -5.865  1.00 296.89 ? 10  PHE H N     1 
ATOM 6352  C CA    . PHE L  4 3   ? -0.379  -60.749  -5.008  1.00 298.58 ? 10  PHE H CA    1 
ATOM 6353  C C     . PHE L  4 3   ? -1.781  -60.161  -4.683  1.00 299.54 ? 10  PHE H C     1 
ATOM 6354  O O     . PHE L  4 3   ? -2.534  -59.811  -5.596  1.00 305.74 ? 10  PHE H O     1 
ATOM 6355  C CB    . PHE L  4 3   ? 0.461   -59.600  -5.646  1.00 297.48 ? 10  PHE H CB    1 
ATOM 6356  C CG    . PHE L  4 3   ? 1.866   -59.432  -5.085  1.00 296.34 ? 10  PHE H CG    1 
ATOM 6357  C CD1   . PHE L  4 3   ? 2.889   -60.341  -5.415  1.00 296.22 ? 10  PHE H CD1   1 
ATOM 6358  C CD2   . PHE L  4 3   ? 2.184   -58.325  -4.280  1.00 292.38 ? 10  PHE H CD2   1 
ATOM 6359  C CE1   . PHE L  4 3   ? 4.184   -60.173  -4.923  1.00 289.87 ? 10  PHE H CE1   1 
ATOM 6360  C CE2   . PHE L  4 3   ? 3.478   -58.155  -3.778  1.00 287.84 ? 10  PHE H CE2   1 
ATOM 6361  C CZ    . PHE L  4 3   ? 4.472   -59.087  -4.094  1.00 285.97 ? 10  PHE H CZ    1 
ATOM 6362  N N     . ARG L  4 4   ? -2.098  -59.988  -3.396  1.00 292.11 ? 11  ARG H N     1 
ATOM 6363  C CA    . ARG L  4 4   ? -3.375  -59.386  -3.014  1.00 292.26 ? 11  ARG H CA    1 
ATOM 6364  C C     . ARG L  4 4   ? -3.243  -57.892  -2.966  1.00 292.60 ? 11  ARG H C     1 
ATOM 6365  O O     . ARG L  4 4   ? -2.168  -57.341  -2.678  1.00 283.35 ? 11  ARG H O     1 
ATOM 6366  C CB    . ARG L  4 4   ? -3.877  -59.894  -1.671  1.00 291.15 ? 11  ARG H CB    1 
ATOM 6367  C CG    . ARG L  4 4   ? -4.293  -61.353  -1.681  1.00 290.12 ? 11  ARG H CG    1 
ATOM 6368  C CD    . ARG L  4 4   ? -4.102  -61.989  -0.310  1.00 288.66 ? 11  ARG H CD    1 
ATOM 6369  N NE    . ARG L  4 4   ? -2.860  -61.552  0.344   1.00 278.95 ? 11  ARG H NE    1 
ATOM 6370  C CZ    . ARG L  4 4   ? -1.630  -61.970  0.039   1.00 271.66 ? 11  ARG H CZ    1 
ATOM 6371  N NH1   . ARG L  4 4   ? -1.430  -62.861  -0.921  1.00 268.59 ? 11  ARG H NH1   1 
ATOM 6372  N NH2   . ARG L  4 4   ? -0.590  -61.484  0.703   1.00 266.33 ? 11  ARG H NH2   1 
ATOM 6373  N N     . LYS L  4 5   ? -4.372  -57.257  -3.243  1.00 303.69 ? 12  LYS H N     1 
ATOM 6374  C CA    . LYS L  4 5   ? -4.473  -55.815  -3.383  1.00 311.72 ? 12  LYS H CA    1 
ATOM 6375  C C     . LYS L  4 5   ? -4.007  -55.045  -2.127  1.00 323.39 ? 12  LYS H C     1 
ATOM 6376  O O     . LYS L  4 5   ? -3.249  -54.067  -2.237  1.00 332.56 ? 12  LYS H O     1 
ATOM 6377  C CB    . LYS L  4 5   ? -5.911  -55.425  -3.789  1.00 306.63 ? 12  LYS H CB    1 
ATOM 6378  C CG    . LYS L  4 5   ? -6.351  -55.958  -5.153  1.00 297.27 ? 12  LYS H CG    1 
ATOM 6379  C CD    . LYS L  4 5   ? -7.807  -55.654  -5.502  1.00 299.25 ? 12  LYS H CD    1 
ATOM 6380  C CE    . LYS L  4 5   ? -8.085  -54.164  -5.694  1.00 299.31 ? 12  LYS H CE    1 
ATOM 6381  N NZ    . LYS L  4 5   ? -7.236  -53.483  -6.718  1.00 287.75 ? 12  LYS H NZ    1 
ATOM 6382  N N     . GLU L  4 6   ? -4.451  -55.494  -0.946  1.00 333.02 ? 13  GLU H N     1 
ATOM 6383  C CA    . GLU L  4 6   ? -4.167  -54.808  0.341   1.00 328.31 ? 13  GLU H CA    1 
ATOM 6384  C C     . GLU L  4 6   ? -2.672  -54.812  0.714   1.00 313.72 ? 13  GLU H C     1 
ATOM 6385  O O     . GLU L  4 6   ? -2.146  -53.785  1.204   1.00 306.82 ? 13  GLU H O     1 
ATOM 6386  C CB    . GLU L  4 6   ? -5.048  -55.377  1.475   1.00 341.45 ? 13  GLU H CB    1 
ATOM 6387  C CG    . GLU L  4 6   ? -4.865  -54.749  2.859   1.00 348.09 ? 13  GLU H CG    1 
ATOM 6388  C CD    . GLU L  4 6   ? -4.360  -55.731  3.914   1.00 354.28 ? 13  GLU H CD    1 
ATOM 6389  O OE1   . GLU L  4 6   ? -5.046  -55.894  4.956   1.00 364.69 ? 13  GLU H OE1   1 
ATOM 6390  O OE2   . GLU L  4 6   ? -3.293  -56.346  3.702   1.00 349.14 ? 13  GLU H OE2   1 
ATOM 6391  N N     . LEU L  4 7   ? -2.012  -55.957  0.460   1.00 302.09 ? 14  LEU H N     1 
ATOM 6392  C CA    . LEU L  4 7   ? -0.558  -56.158  0.677   1.00 283.27 ? 14  LEU H CA    1 
ATOM 6393  C C     . LEU L  4 7   ? 0.214   -54.946  0.185   1.00 273.03 ? 14  LEU H C     1 
ATOM 6394  O O     . LEU L  4 7   ? 0.851   -54.215  0.958   1.00 270.19 ? 14  LEU H O     1 
ATOM 6395  C CB    . LEU L  4 7   ? -0.038  -57.421  -0.056  1.00 275.93 ? 14  LEU H CB    1 
ATOM 6396  C CG    . LEU L  4 7   ? 1.442   -57.785  0.142   1.00 266.45 ? 14  LEU H CG    1 
ATOM 6397  C CD1   . LEU L  4 7   ? 1.705   -58.085  1.606   1.00 271.79 ? 14  LEU H CD1   1 
ATOM 6398  C CD2   . LEU L  4 7   ? 1.831   -58.977  -0.712  1.00 260.74 ? 14  LEU H CD2   1 
ATOM 6399  N N     . VAL L  4 8   ? 0.091   -54.738  -1.118  1.00 265.55 ? 15  VAL H N     1 
ATOM 6400  C CA    . VAL L  4 8   ? 0.737   -53.660  -1.818  1.00 255.00 ? 15  VAL H CA    1 
ATOM 6401  C C     . VAL L  4 8   ? 0.373   -52.257  -1.249  1.00 250.33 ? 15  VAL H C     1 
ATOM 6402  O O     . VAL L  4 8   ? 1.266   -51.442  -1.008  1.00 245.36 ? 15  VAL H O     1 
ATOM 6403  C CB    . VAL L  4 8   ? 0.452   -53.783  -3.333  1.00 255.76 ? 15  VAL H CB    1 
ATOM 6404  C CG1   . VAL L  4 8   ? 1.463   -52.975  -4.107  1.00 253.38 ? 15  VAL H CG1   1 
ATOM 6405  C CG2   . VAL L  4 8   ? 0.503   -55.244  -3.784  1.00 251.55 ? 15  VAL H CG2   1 
ATOM 6406  N N     . SER L  4 9   ? -0.917  -51.992  -1.006  1.00 247.43 ? 16  SER H N     1 
ATOM 6407  C CA    . SER L  4 9   ? -1.391  -50.669  -0.540  1.00 237.10 ? 16  SER H CA    1 
ATOM 6408  C C     . SER L  4 9   ? -0.814  -50.273  0.812   1.00 232.37 ? 16  SER H C     1 
ATOM 6409  O O     . SER L  4 9   ? -0.300  -49.162  0.972   1.00 227.28 ? 16  SER H O     1 
ATOM 6410  C CB    . SER L  4 9   ? -2.921  -50.617  -0.481  1.00 238.74 ? 16  SER H CB    1 
ATOM 6411  O OG    . SER L  4 9   ? -3.372  -49.347  -0.051  1.00 232.59 ? 16  SER H OG    1 
ATOM 6412  N N     . ARG L  4 10  ? -0.918  -51.182  1.779   1.00 234.62 ? 17  ARG H N     1 
ATOM 6413  C CA    . ARG L  4 10  ? -0.372  -50.966  3.113   1.00 235.70 ? 17  ARG H CA    1 
ATOM 6414  C C     . ARG L  4 10  ? 1.136   -50.811  3.036   1.00 231.59 ? 17  ARG H C     1 
ATOM 6415  O O     . ARG L  4 10  ? 1.741   -49.977  3.728   1.00 231.42 ? 17  ARG H O     1 
ATOM 6416  C CB    . ARG L  4 10  ? -0.699  -52.141  4.019   1.00 241.91 ? 17  ARG H CB    1 
ATOM 6417  C CG    . ARG L  4 10  ? -2.040  -52.075  4.730   1.00 257.80 ? 17  ARG H CG    1 
ATOM 6418  C CD    . ARG L  4 10  ? -2.073  -53.170  5.790   1.00 270.86 ? 17  ARG H CD    1 
ATOM 6419  N NE    . ARG L  4 10  ? -3.331  -53.313  6.553   1.00 289.68 ? 17  ARG H NE    1 
ATOM 6420  C CZ    . ARG L  4 10  ? -3.602  -52.716  7.719   1.00 294.48 ? 17  ARG H CZ    1 
ATOM 6421  N NH1   . ARG L  4 10  ? -2.714  -51.890  8.256   1.00 295.89 ? 17  ARG H NH1   1 
ATOM 6422  N NH2   . ARG L  4 10  ? -4.768  -52.920  8.329   1.00 298.93 ? 17  ARG H NH2   1 
ATOM 6423  N N     . LEU L  4 11  ? 1.732   -51.626  2.176   1.00 231.80 ? 18  LEU H N     1 
ATOM 6424  C CA    . LEU L  4 11  ? 3.166   -51.624  2.005   1.00 229.20 ? 18  LEU H CA    1 
ATOM 6425  C C     . LEU L  4 11  ? 3.681   -50.277  1.528   1.00 227.90 ? 18  LEU H C     1 
ATOM 6426  O O     . LEU L  4 11  ? 4.714   -49.808  1.986   1.00 220.19 ? 18  LEU H O     1 
ATOM 6427  C CB    . LEU L  4 11  ? 3.601   -52.739  1.058   1.00 229.40 ? 18  LEU H CB    1 
ATOM 6428  C CG    . LEU L  4 11  ? 3.703   -54.160  1.629   1.00 232.39 ? 18  LEU H CG    1 
ATOM 6429  C CD1   . LEU L  4 11  ? 4.178   -55.101  0.535   1.00 230.66 ? 18  LEU H CD1   1 
ATOM 6430  C CD2   . LEU L  4 11  ? 4.607   -54.246  2.860   1.00 232.43 ? 18  LEU H CD2   1 
ATOM 6431  N N     . LEU L  4 12  ? 2.942   -49.656  0.620   1.00 237.46 ? 19  LEU H N     1 
ATOM 6432  C CA    . LEU L  4 12  ? 3.292   -48.340  0.124   1.00 249.95 ? 19  LEU H CA    1 
ATOM 6433  C C     . LEU L  4 12  ? 3.235   -47.272  1.197   1.00 261.88 ? 19  LEU H C     1 
ATOM 6434  O O     . LEU L  4 12  ? 4.125   -46.424  1.273   1.00 259.14 ? 19  LEU H O     1 
ATOM 6435  C CB    . LEU L  4 12  ? 2.335   -47.928  -0.974  1.00 257.50 ? 19  LEU H CB    1 
ATOM 6436  C CG    . LEU L  4 12  ? 2.557   -48.566  -2.324  1.00 260.72 ? 19  LEU H CG    1 
ATOM 6437  C CD1   . LEU L  4 12  ? 1.354   -48.233  -3.186  1.00 267.88 ? 19  LEU H CD1   1 
ATOM 6438  C CD2   . LEU L  4 12  ? 3.851   -48.033  -2.917  1.00 262.21 ? 19  LEU H CD2   1 
ATOM 6439  N N     . HIS L  4 13  ? 2.172   -47.290  2.001   1.00 280.11 ? 20  HIS H N     1 
ATOM 6440  C CA    . HIS L  4 13  ? 1.930   -46.225  2.989   1.00 290.84 ? 20  HIS H CA    1 
ATOM 6441  C C     . HIS L  4 13  ? 2.921   -46.251  4.154   1.00 292.18 ? 20  HIS H C     1 
ATOM 6442  O O     . HIS L  4 13  ? 2.983   -45.316  4.960   1.00 294.08 ? 20  HIS H O     1 
ATOM 6443  C CB    . HIS L  4 13  ? 0.481   -46.261  3.505   1.00 292.79 ? 20  HIS H CB    1 
ATOM 6444  C CG    . HIS L  4 13  ? -0.500  -45.489  2.657   1.00 289.06 ? 20  HIS H CG    1 
ATOM 6445  N ND1   . HIS L  4 13  ? -0.851  -44.183  2.931   1.00 285.71 ? 20  HIS H ND1   1 
ATOM 6446  C CD2   . HIS L  4 13  ? -1.221  -45.850  1.566   1.00 289.01 ? 20  HIS H CD2   1 
ATOM 6447  C CE1   . HIS L  4 13  ? -1.738  -43.772  2.041   1.00 288.94 ? 20  HIS H CE1   1 
ATOM 6448  N NE2   . HIS L  4 13  ? -1.980  -44.764  1.202   1.00 291.46 ? 20  HIS H NE2   1 
ATOM 6449  N N     . LEU L  4 14  ? 3.710   -47.321  4.216   1.00 288.22 ? 21  LEU H N     1 
ATOM 6450  C CA    . LEU L  4 14  ? 4.737   -47.472  5.247   1.00 276.21 ? 21  LEU H CA    1 
ATOM 6451  C C     . LEU L  4 14  ? 5.873   -46.435  5.143   1.00 263.95 ? 21  LEU H C     1 
ATOM 6452  O O     . LEU L  4 14  ? 6.292   -45.843  6.145   1.00 255.78 ? 21  LEU H O     1 
ATOM 6453  C CB    . LEU L  4 14  ? 5.325   -48.896  5.212   1.00 275.78 ? 21  LEU H CB    1 
ATOM 6454  C CG    . LEU L  4 14  ? 4.860   -50.021  6.154   1.00 273.87 ? 21  LEU H CG    1 
ATOM 6455  C CD1   . LEU L  4 14  ? 5.516   -51.335  5.734   1.00 271.84 ? 21  LEU H CD1   1 
ATOM 6456  C CD2   . LEU L  4 14  ? 5.147   -49.732  7.623   1.00 271.17 ? 21  LEU H CD2   1 
ATOM 6457  N N     . HIS L  4 15  ? 6.352   -46.214  3.921   1.00 255.68 ? 22  HIS H N     1 
ATOM 6458  C CA    . HIS L  4 15  ? 7.528   -45.390  3.686   1.00 249.46 ? 22  HIS H CA    1 
ATOM 6459  C C     . HIS L  4 15  ? 7.179   -43.958  3.247   1.00 247.43 ? 22  HIS H C     1 
ATOM 6460  O O     . HIS L  4 15  ? 8.073   -43.129  3.078   1.00 249.90 ? 22  HIS H O     1 
ATOM 6461  C CB    . HIS L  4 15  ? 8.451   -46.058  2.652   1.00 251.94 ? 22  HIS H CB    1 
ATOM 6462  C CG    . HIS L  4 15  ? 8.804   -47.488  2.956   1.00 252.51 ? 22  HIS H CG    1 
ATOM 6463  N ND1   . HIS L  4 15  ? 9.707   -47.845  3.938   1.00 252.95 ? 22  HIS H ND1   1 
ATOM 6464  C CD2   . HIS L  4 15  ? 8.413   -48.648  2.371   1.00 251.62 ? 22  HIS H CD2   1 
ATOM 6465  C CE1   . HIS L  4 15  ? 9.828   -49.160  3.966   1.00 251.95 ? 22  HIS H CE1   1 
ATOM 6466  N NE2   . HIS L  4 15  ? 9.054   -49.670  3.025   1.00 250.90 ? 22  HIS H NE2   1 
ATOM 6467  N N     . PHE L  4 16  ? 5.892   -43.664  3.049   1.00 244.27 ? 23  PHE H N     1 
ATOM 6468  C CA    . PHE L  4 16  ? 5.484   -42.310  2.680   1.00 245.54 ? 23  PHE H CA    1 
ATOM 6469  C C     . PHE L  4 16  ? 5.859   -41.371  3.787   1.00 247.87 ? 23  PHE H C     1 
ATOM 6470  O O     . PHE L  4 16  ? 5.544   -41.620  4.947   1.00 241.03 ? 23  PHE H O     1 
ATOM 6471  C CB    . PHE L  4 16  ? 3.979   -42.181  2.454   1.00 244.96 ? 23  PHE H CB    1 
ATOM 6472  C CG    . PHE L  4 16  ? 3.506   -42.746  1.157   1.00 249.54 ? 23  PHE H CG    1 
ATOM 6473  C CD1   . PHE L  4 16  ? 4.302   -42.697  0.013   1.00 249.88 ? 23  PHE H CD1   1 
ATOM 6474  C CD2   . PHE L  4 16  ? 2.238   -43.308  1.071   1.00 256.55 ? 23  PHE H CD2   1 
ATOM 6475  C CE1   . PHE L  4 16  ? 3.851   -43.230  -1.186  1.00 256.06 ? 23  PHE H CE1   1 
ATOM 6476  C CE2   . PHE L  4 16  ? 1.779   -43.847  -0.119  1.00 265.62 ? 23  PHE H CE2   1 
ATOM 6477  C CZ    . PHE L  4 16  ? 2.589   -43.807  -1.251  1.00 265.03 ? 23  PHE H CZ    1 
ATOM 6478  N N     . LYS L  4 17  ? 6.544   -40.299  3.423   1.00 257.60 ? 24  LYS H N     1 
ATOM 6479  C CA    . LYS L  4 17  ? 6.774   -39.218  4.368   1.00 261.22 ? 24  LYS H CA    1 
ATOM 6480  C C     . LYS L  4 17  ? 5.558   -38.283  4.399   1.00 263.91 ? 24  LYS H C     1 
ATOM 6481  O O     . LYS L  4 17  ? 5.210   -37.783  5.459   1.00 268.13 ? 24  LYS H O     1 
ATOM 6482  C CB    . LYS L  4 17  ? 8.131   -38.518  4.145   1.00 260.77 ? 24  LYS H CB    1 
ATOM 6483  C CG    . LYS L  4 17  ? 9.346   -39.439  4.389   1.00 254.16 ? 24  LYS H CG    1 
ATOM 6484  C CD    . LYS L  4 17  ? 9.404   -40.042  5.802   1.00 245.87 ? 24  LYS H CD    1 
ATOM 6485  C CE    . LYS L  4 17  ? 9.864   -41.508  5.838   1.00 236.06 ? 24  LYS H CE    1 
ATOM 6486  N NZ    . LYS L  4 17  ? 11.247  -41.749  5.333   1.00 229.03 ? 24  LYS H NZ    1 
ATOM 6487  N N     . ASP L  4 18  ? 4.884   -38.087  3.263   1.00 262.30 ? 25  ASP H N     1 
ATOM 6488  C CA    . ASP L  4 18  ? 3.524   -37.511  3.287   1.00 261.59 ? 25  ASP H CA    1 
ATOM 6489  C C     . ASP L  4 18  ? 2.444   -38.582  3.029   1.00 263.45 ? 25  ASP H C     1 
ATOM 6490  O O     . ASP L  4 18  ? 2.438   -39.221  1.973   1.00 262.62 ? 25  ASP H O     1 
ATOM 6491  C CB    . ASP L  4 18  ? 3.366   -36.320  2.311   1.00 261.16 ? 25  ASP H CB    1 
ATOM 6492  C CG    . ASP L  4 18  ? 2.029   -35.567  2.500   1.00 263.01 ? 25  ASP H CG    1 
ATOM 6493  O OD1   . ASP L  4 18  ? 1.307   -35.883  3.471   1.00 262.00 ? 25  ASP H OD1   1 
ATOM 6494  O OD2   . ASP L  4 18  ? 1.702   -34.660  1.691   1.00 265.11 ? 25  ASP H OD2   1 
ATOM 6495  N N     . ASP L  4 19  ? 1.539   -38.769  3.996   1.00 267.32 ? 26  ASP H N     1 
ATOM 6496  C CA    . ASP L  4 19  ? 0.409   -39.727  3.880   1.00 271.98 ? 26  ASP H CA    1 
ATOM 6497  C C     . ASP L  4 19  ? -0.866  -39.116  3.300   1.00 280.21 ? 26  ASP H C     1 
ATOM 6498  O O     . ASP L  4 19  ? -1.922  -39.769  3.285   1.00 279.85 ? 26  ASP H O     1 
ATOM 6499  C CB    . ASP L  4 19  ? 0.038   -40.364  5.222   1.00 275.05 ? 26  ASP H CB    1 
ATOM 6500  C CG    . ASP L  4 19  ? 1.131   -41.231  5.796   1.00 272.23 ? 26  ASP H CG    1 
ATOM 6501  O OD1   . ASP L  4 19  ? 1.894   -41.869  5.033   1.00 262.96 ? 26  ASP H OD1   1 
ATOM 6502  O OD2   . ASP L  4 19  ? 1.220   -41.265  7.042   1.00 279.84 ? 26  ASP H OD2   1 
ATOM 6503  N N     . LYS L  4 20  ? -0.780  -37.864  2.850   1.00 287.58 ? 27  LYS H N     1 
ATOM 6504  C CA    . LYS L  4 20  ? -1.852  -37.269  2.048   1.00 301.04 ? 27  LYS H CA    1 
ATOM 6505  C C     . LYS L  4 20  ? -1.854  -37.927  0.665   1.00 315.91 ? 27  LYS H C     1 
ATOM 6506  O O     . LYS L  4 20  ? -2.883  -37.928  -0.032  1.00 318.66 ? 27  LYS H O     1 
ATOM 6507  C CB    . LYS L  4 20  ? -1.675  -35.752  1.934   1.00 295.88 ? 27  LYS H CB    1 
ATOM 6508  C CG    . LYS L  4 20  ? -1.769  -35.020  3.262   1.00 289.88 ? 27  LYS H CG    1 
ATOM 6509  C CD    . LYS L  4 20  ? -1.254  -33.607  3.112   1.00 291.26 ? 27  LYS H CD    1 
ATOM 6510  C CE    . LYS L  4 20  ? -0.524  -33.177  4.365   1.00 288.54 ? 27  LYS H CE    1 
ATOM 6511  N NZ    . LYS L  4 20  ? 0.267   -31.961  4.052   1.00 295.81 ? 27  LYS H NZ    1 
ATOM 6512  N N     . THR L  4 21  ? -0.681  -38.482  0.308   1.00 331.14 ? 28  THR H N     1 
ATOM 6513  C CA    . THR L  4 21  ? -0.464  -39.350  -0.860  1.00 346.13 ? 28  THR H CA    1 
ATOM 6514  C C     . THR L  4 21  ? -1.505  -40.469  -0.916  1.00 349.69 ? 28  THR H C     1 
ATOM 6515  O O     . THR L  4 21  ? -1.587  -41.312  -0.015  1.00 357.26 ? 28  THR H O     1 
ATOM 6516  C CB    . THR L  4 21  ? 0.968   -39.970  -0.878  1.00 341.88 ? 28  THR H CB    1 
ATOM 6517  O OG1   . THR L  4 21  ? 1.943   -38.973  -0.554  1.00 343.66 ? 28  THR H OG1   1 
ATOM 6518  C CG2   . THR L  4 21  ? 1.309   -40.518  -2.241  1.00 339.35 ? 28  THR H CG2   1 
ATOM 6519  N N     . LYS L  4 22  ? -2.307  -40.449  -1.979  1.00 342.09 ? 29  LYS H N     1 
ATOM 6520  C CA    . LYS L  4 22  ? -3.334  -41.459  -2.209  1.00 330.26 ? 29  LYS H CA    1 
ATOM 6521  C C     . LYS L  4 22  ? -2.931  -42.367  -3.380  1.00 332.03 ? 29  LYS H C     1 
ATOM 6522  O O     . LYS L  4 22  ? -2.039  -42.040  -4.174  1.00 329.54 ? 29  LYS H O     1 
ATOM 6523  C CB    . LYS L  4 22  ? -4.711  -40.799  -2.439  1.00 321.05 ? 29  LYS H CB    1 
ATOM 6524  C CG    . LYS L  4 22  ? -5.372  -40.200  -1.200  1.00 307.33 ? 29  LYS H CG    1 
ATOM 6525  C CD    . LYS L  4 22  ? -6.253  -41.227  -0.506  1.00 299.99 ? 29  LYS H CD    1 
ATOM 6526  C CE    . LYS L  4 22  ? -6.700  -40.760  0.870   1.00 292.75 ? 29  LYS H CE    1 
ATOM 6527  N NZ    . LYS L  4 22  ? -7.389  -41.852  1.616   1.00 290.22 ? 29  LYS H NZ    1 
ATOM 6528  N N     . VAL L  4 23  ? -3.576  -43.524  -3.460  1.00 334.91 ? 30  VAL H N     1 
ATOM 6529  C CA    . VAL L  4 23  ? -3.306  -44.476  -4.531  1.00 333.49 ? 30  VAL H CA    1 
ATOM 6530  C C     . VAL L  4 23  ? -4.628  -44.837  -5.238  1.00 355.00 ? 30  VAL H C     1 
ATOM 6531  O O     . VAL L  4 23  ? -5.581  -45.295  -4.587  1.00 364.69 ? 30  VAL H O     1 
ATOM 6532  C CB    . VAL L  4 23  ? -2.575  -45.754  -4.016  1.00 315.09 ? 30  VAL H CB    1 
ATOM 6533  C CG1   . VAL L  4 23  ? -1.997  -46.535  -5.186  1.00 303.24 ? 30  VAL H CG1   1 
ATOM 6534  C CG2   . VAL L  4 23  ? -1.470  -45.426  -3.012  1.00 303.72 ? 30  VAL H CG2   1 
ATOM 6535  N N     . SER L  4 24  ? -4.685  -44.608  -6.554  1.00 369.67 ? 31  SER H N     1 
ATOM 6536  C CA    . SER L  4 24  ? -5.837  -45.032  -7.362  1.00 389.49 ? 31  SER H CA    1 
ATOM 6537  C C     . SER L  4 24  ? -5.903  -46.574  -7.499  1.00 403.45 ? 31  SER H C     1 
ATOM 6538  O O     . SER L  4 24  ? -4.868  -47.261  -7.443  1.00 403.66 ? 31  SER H O     1 
ATOM 6539  C CB    . SER L  4 24  ? -5.847  -44.326  -8.729  1.00 386.92 ? 31  SER H CB    1 
ATOM 6540  O OG    . SER L  4 24  ? -4.776  -44.753  -9.552  1.00 376.57 ? 31  SER H OG    1 
ATOM 6541  N N     . GLY L  4 25  ? -7.118  -47.112  -7.651  1.00 423.38 ? 32  GLY H N     1 
ATOM 6542  C CA    . GLY L  4 25  ? -7.355  -48.571  -7.663  1.00 430.22 ? 32  GLY H CA    1 
ATOM 6543  C C     . GLY L  4 25  ? -6.742  -49.337  -8.830  1.00 429.97 ? 32  GLY H C     1 
ATOM 6544  O O     . GLY L  4 25  ? -6.304  -50.487  -8.667  1.00 412.31 ? 32  GLY H O     1 
ATOM 6545  N N     . ASP L  4 26  ? -6.731  -48.699  -10.001 1.00 444.21 ? 33  ASP H N     1 
ATOM 6546  C CA    . ASP L  4 26  ? -6.054  -49.222  -11.190 1.00 440.92 ? 33  ASP H CA    1 
ATOM 6547  C C     . ASP L  4 26  ? -4.534  -49.227  -11.024 1.00 426.57 ? 33  ASP H C     1 
ATOM 6548  O O     . ASP L  4 26  ? -3.922  -50.238  -11.329 1.00 423.91 ? 33  ASP H O     1 
ATOM 6549  C CB    . ASP L  4 26  ? -6.479  -48.488  -12.480 1.00 450.89 ? 33  ASP H CB    1 
ATOM 6550  C CG    . ASP L  4 26  ? -7.833  -48.962  -13.037 1.00 458.38 ? 33  ASP H CG    1 
ATOM 6551  O OD1   . ASP L  4 26  ? -8.460  -49.876  -12.447 1.00 456.48 ? 33  ASP H OD1   1 
ATOM 6552  O OD2   . ASP L  4 26  ? -8.282  -48.391  -14.059 1.00 463.46 ? 33  ASP H OD2   1 
ATOM 6553  N N     . ALA L  4 27  ? -3.936  -48.127  -10.539 1.00 414.02 ? 34  ALA H N     1 
ATOM 6554  C CA    . ALA L  4 27  ? -2.496  -48.104  -10.203 1.00 391.15 ? 34  ALA H CA    1 
ATOM 6555  C C     . ALA L  4 27  ? -2.115  -49.169  -9.155  1.00 377.51 ? 34  ALA H C     1 
ATOM 6556  O O     . ALA L  4 27  ? -0.984  -49.661  -9.181  1.00 360.16 ? 34  ALA H O     1 
ATOM 6557  C CB    . ALA L  4 27  ? -2.041  -46.714  -9.761  1.00 384.84 ? 34  ALA H CB    1 
ATOM 6558  N N     . LEU L  4 28  ? -3.058  -49.521  -8.260  1.00 380.84 ? 35  LEU H N     1 
ATOM 6559  C CA    . LEU L  4 28  ? -2.905  -50.634  -7.272  1.00 382.03 ? 35  LEU H CA    1 
ATOM 6560  C C     . LEU L  4 28  ? -2.924  -52.035  -7.918  1.00 381.22 ? 35  LEU H C     1 
ATOM 6561  O O     . LEU L  4 28  ? -2.064  -52.888  -7.630  1.00 379.98 ? 35  LEU H O     1 
ATOM 6562  C CB    . LEU L  4 28  ? -3.960  -50.548  -6.149  1.00 394.03 ? 35  LEU H CB    1 
ATOM 6563  C CG    . LEU L  4 28  ? -3.812  -51.496  -4.952  1.00 399.37 ? 35  LEU H CG    1 
ATOM 6564  C CD1   . LEU L  4 28  ? -2.502  -51.260  -4.213  1.00 396.62 ? 35  LEU H CD1   1 
ATOM 6565  C CD2   . LEU L  4 28  ? -4.985  -51.359  -3.997  1.00 406.05 ? 35  LEU H CD2   1 
ATOM 6566  N N     . GLN L  4 29  ? -3.914  -52.259  -8.782  1.00 382.63 ? 36  GLN H N     1 
ATOM 6567  C CA    . GLN L  4 29  ? -3.968  -53.418  -9.678  0.50 385.73 ? 36  GLN H CA    1 
ATOM 6568  C C     . GLN L  4 29  ? -2.695  -53.603  -10.525 1.00 391.92 ? 36  GLN H C     1 
ATOM 6569  O O     . GLN L  4 29  ? -2.280  -54.735  -10.814 1.00 396.63 ? 36  GLN H O     1 
ATOM 6570  C CB    . GLN L  4 29  ? -5.168  -53.256  -10.597 0.50 381.75 ? 36  GLN H CB    1 
ATOM 6571  C CG    . GLN L  4 29  ? -6.458  -53.742  -9.983  0.50 379.05 ? 36  GLN H CG    1 
ATOM 6572  C CD    . GLN L  4 29  ? -6.519  -55.247  -10.005 0.50 378.13 ? 36  GLN H CD    1 
ATOM 6573  O OE1   . GLN L  4 29  ? -6.885  -55.879  -9.020  0.50 379.17 ? 36  GLN H OE1   1 
ATOM 6574  N NE2   . GLN L  4 29  ? -6.124  -55.833  -11.127 0.50 374.53 ? 36  GLN H NE2   1 
ATOM 6575  N N     . LEU L  4 30  ? -2.084  -52.474  -10.901 1.00 398.23 ? 37  LEU H N     1 
ATOM 6576  C CA    . LEU L  4 30  ? -0.847  -52.423  -11.708 1.00 393.61 ? 37  LEU H CA    1 
ATOM 6577  C C     . LEU L  4 30  ? 0.463   -52.720  -10.932 1.00 375.18 ? 37  LEU H C     1 
ATOM 6578  O O     . LEU L  4 30  ? 1.383   -53.352  -11.470 1.00 375.85 ? 37  LEU H O     1 
ATOM 6579  C CB    . LEU L  4 30  ? -0.763  -51.080  -12.470 1.00 405.84 ? 37  LEU H CB    1 
ATOM 6580  C CG    . LEU L  4 30  ? -1.777  -50.873  -13.612 1.00 417.02 ? 37  LEU H CG    1 
ATOM 6581  C CD1   . LEU L  4 30  ? -1.515  -49.589  -14.389 1.00 421.43 ? 37  LEU H CD1   1 
ATOM 6582  C CD2   . LEU L  4 30  ? -1.853  -52.078  -14.538 1.00 416.08 ? 37  LEU H CD2   1 
ATOM 6583  N N     . MET L  4 31  ? 0.537   -52.269  -9.679  1.00 351.71 ? 38  MET H N     1 
ATOM 6584  C CA    . MET L  4 31  ? 1.658   -52.584  -8.785  1.00 322.24 ? 38  MET H CA    1 
ATOM 6585  C C     . MET L  4 31  ? 1.689   -54.055  -8.386  1.00 304.87 ? 38  MET H C     1 
ATOM 6586  O O     . MET L  4 31  ? 2.765   -54.604  -8.119  1.00 292.70 ? 38  MET H O     1 
ATOM 6587  C CB    . MET L  4 31  ? 1.589   -51.713  -7.534  1.00 320.53 ? 38  MET H CB    1 
ATOM 6588  C CG    . MET L  4 31  ? 2.151   -50.328  -7.737  1.00 316.64 ? 38  MET H CG    1 
ATOM 6589  S SD    . MET L  4 31  ? 3.852   -50.552  -8.252  1.00 305.83 ? 38  MET H SD    1 
ATOM 6590  C CE    . MET L  4 31  ? 4.560   -51.215  -6.745  1.00 305.54 ? 38  MET H CE    1 
ATOM 6591  N N     . VAL L  4 32  ? 0.496   -54.663  -8.327  1.00 295.65 ? 39  VAL H N     1 
ATOM 6592  C CA    . VAL L  4 32  ? 0.325   -56.118  -8.213  1.00 284.91 ? 39  VAL H CA    1 
ATOM 6593  C C     . VAL L  4 32  ? 1.022   -56.809  -9.389  1.00 278.45 ? 39  VAL H C     1 
ATOM 6594  O O     . VAL L  4 32  ? 1.787   -57.738  -9.163  1.00 270.78 ? 39  VAL H O     1 
ATOM 6595  C CB    . VAL L  4 32  ? -1.168  -56.530  -8.099  1.00 292.33 ? 39  VAL H CB    1 
ATOM 6596  C CG1   . VAL L  4 32  ? -1.398  -57.990  -8.501  1.00 293.80 ? 39  VAL H CG1   1 
ATOM 6597  C CG2   . VAL L  4 32  ? -1.677  -56.261  -6.689  1.00 293.02 ? 39  VAL H CG2   1 
ATOM 6598  N N     . GLU L  4 33  ? 0.774   -56.331  -10.618 1.00 279.81 ? 40  GLU H N     1 
ATOM 6599  C CA    . GLU L  4 33  ? 1.489   -56.779  -11.839 1.00 276.35 ? 40  GLU H CA    1 
ATOM 6600  C C     . GLU L  4 33  ? 3.010   -56.559  -11.732 1.00 269.68 ? 40  GLU H C     1 
ATOM 6601  O O     . GLU L  4 33  ? 3.787   -57.473  -12.027 1.00 270.60 ? 40  GLU H O     1 
ATOM 6602  C CB    . GLU L  4 33  ? 0.956   -56.091  -13.120 1.00 277.77 ? 40  GLU H CB    1 
ATOM 6603  C CG    . GLU L  4 33  ? -0.562  -56.082  -13.320 1.00 278.28 ? 40  GLU H CG    1 
ATOM 6604  C CD    . GLU L  4 33  ? -1.117  -57.397  -13.860 1.00 276.63 ? 40  GLU H CD    1 
ATOM 6605  O OE1   . GLU L  4 33  ? -2.349  -57.592  -13.813 1.00 275.04 ? 40  GLU H OE1   1 
ATOM 6606  O OE2   . GLU L  4 33  ? -0.316  -58.236  -14.326 1.00 274.59 ? 40  GLU H OE2   1 
ATOM 6607  N N     . LEU L  4 34  ? 3.423   -55.360  -11.309 1.00 261.65 ? 41  LEU H N     1 
ATOM 6608  C CA    . LEU L  4 34  ? 4.850   -55.012  -11.176 1.00 248.04 ? 41  LEU H CA    1 
ATOM 6609  C C     . LEU L  4 34  ? 5.625   -55.899  -10.187 1.00 239.13 ? 41  LEU H C     1 
ATOM 6610  O O     . LEU L  4 34  ? 6.675   -56.463  -10.525 1.00 236.01 ? 41  LEU H O     1 
ATOM 6611  C CB    . LEU L  4 34  ? 5.024   -53.526  -10.799 1.00 247.20 ? 41  LEU H CB    1 
ATOM 6612  C CG    . LEU L  4 34  ? 6.348   -53.055  -10.148 1.00 242.64 ? 41  LEU H CG    1 
ATOM 6613  C CD1   . LEU L  4 34  ? 7.604   -53.416  -10.941 1.00 241.09 ? 41  LEU H CD1   1 
ATOM 6614  C CD2   . LEU L  4 34  ? 6.328   -51.562  -9.880  1.00 246.92 ? 41  LEU H CD2   1 
ATOM 6615  N N     . LEU L  4 35  ? 5.122   -55.998  -8.964  1.00 233.34 ? 42  LEU H N     1 
ATOM 6616  C CA    . LEU L  4 35  ? 5.842   -56.746  -7.948  1.00 228.18 ? 42  LEU H CA    1 
ATOM 6617  C C     . LEU L  4 35  ? 5.724   -58.244  -8.221  1.00 234.61 ? 42  LEU H C     1 
ATOM 6618  O O     . LEU L  4 35  ? 6.612   -59.007  -7.890  1.00 235.04 ? 42  LEU H O     1 
ATOM 6619  C CB    . LEU L  4 35  ? 5.379   -56.370  -6.541  1.00 222.52 ? 42  LEU H CB    1 
ATOM 6620  C CG    . LEU L  4 35  ? 5.657   -54.958  -6.001  1.00 215.86 ? 42  LEU H CG    1 
ATOM 6621  C CD1   . LEU L  4 35  ? 5.093   -54.845  -4.592  1.00 218.93 ? 42  LEU H CD1   1 
ATOM 6622  C CD2   . LEU L  4 35  ? 7.137   -54.585  -6.025  1.00 207.10 ? 42  LEU H CD2   1 
ATOM 6623  N N     . LYS L  4 36  ? 4.630   -58.645  -8.854  1.00 241.24 ? 43  LYS H N     1 
ATOM 6624  C CA    . LYS L  4 36  ? 4.476   -59.984  -9.382  1.00 242.29 ? 43  LYS H CA    1 
ATOM 6625  C C     . LYS L  4 36  ? 5.633   -60.289  -10.354 1.00 245.20 ? 43  LYS H C     1 
ATOM 6626  O O     . LYS L  4 36  ? 6.359   -61.265  -10.149 1.00 246.72 ? 43  LYS H O     1 
ATOM 6627  C CB    . LYS L  4 36  ? 3.090   -60.068  -10.014 1.00 239.18 ? 43  LYS H CB    1 
ATOM 6628  C CG    . LYS L  4 36  ? 2.701   -61.282  -10.816 1.00 234.42 ? 43  LYS H CG    1 
ATOM 6629  C CD    . LYS L  4 36  ? 1.225   -61.113  -11.159 1.00 237.61 ? 43  LYS H CD    1 
ATOM 6630  C CE    . LYS L  4 36  ? 0.819   -61.861  -12.424 1.00 241.64 ? 43  LYS H CE    1 
ATOM 6631  N NZ    . LYS L  4 36  ? 0.254   -63.211  -12.141 1.00 246.52 ? 43  LYS H NZ    1 
ATOM 6632  N N     . VAL L  4 37  ? 5.849   -59.443  -11.370 1.00 250.00 ? 44  VAL H N     1 
ATOM 6633  C CA    . VAL L  4 37  ? 7.007   -59.629  -12.297 1.00 250.77 ? 44  VAL H CA    1 
ATOM 6634  C C     . VAL L  4 37  ? 8.352   -59.403  -11.599 1.00 252.41 ? 44  VAL H C     1 
ATOM 6635  O O     . VAL L  4 37  ? 9.391   -59.909  -12.049 1.00 252.11 ? 44  VAL H O     1 
ATOM 6636  C CB    . VAL L  4 37  ? 6.986   -58.742  -13.573 1.00 250.33 ? 44  VAL H CB    1 
ATOM 6637  C CG1   . VAL L  4 37  ? 7.969   -59.280  -14.613 1.00 247.97 ? 44  VAL H CG1   1 
ATOM 6638  C CG2   . VAL L  4 37  ? 5.607   -58.679  -14.180 1.00 252.67 ? 44  VAL H CG2   1 
ATOM 6639  N N     . PHE L  4 38  ? 8.327   -58.639  -10.508 1.00 254.53 ? 45  PHE H N     1 
ATOM 6640  C CA    . PHE L  4 38  ? 9.524   -58.358  -9.723  1.00 252.17 ? 45  PHE H CA    1 
ATOM 6641  C C     . PHE L  4 38  ? 10.087  -59.623  -9.064  1.00 253.73 ? 45  PHE H C     1 
ATOM 6642  O O     . PHE L  4 38  ? 11.280  -59.930  -9.198  1.00 248.17 ? 45  PHE H O     1 
ATOM 6643  C CB    . PHE L  4 38  ? 9.231   -57.281  -8.677  1.00 250.47 ? 45  PHE H CB    1 
ATOM 6644  C CG    . PHE L  4 38  ? 10.357  -57.056  -7.715  1.00 247.78 ? 45  PHE H CG    1 
ATOM 6645  C CD1   . PHE L  4 38  ? 11.346  -56.125  -7.996  1.00 247.97 ? 45  PHE H CD1   1 
ATOM 6646  C CD2   . PHE L  4 38  ? 10.445  -57.783  -6.529  1.00 249.61 ? 45  PHE H CD2   1 
ATOM 6647  C CE1   . PHE L  4 38  ? 12.400  -55.920  -7.116  1.00 251.91 ? 45  PHE H CE1   1 
ATOM 6648  C CE2   . PHE L  4 38  ? 11.495  -57.584  -5.643  1.00 252.99 ? 45  PHE H CE2   1 
ATOM 6649  C CZ    . PHE L  4 38  ? 12.473  -56.646  -5.936  1.00 254.17 ? 45  PHE H CZ    1 
ATOM 6650  N N     . VAL L  4 39  ? 9.212   -60.334  -8.350  1.00 258.56 ? 46  VAL H N     1 
ATOM 6651  C CA    . VAL L  4 39  ? 9.538   -61.615  -7.720  1.00 261.40 ? 46  VAL H CA    1 
ATOM 6652  C C     . VAL L  4 39  ? 9.876   -62.680  -8.770  1.00 274.28 ? 46  VAL H C     1 
ATOM 6653  O O     . VAL L  4 39  ? 10.847  -63.418  -8.582  1.00 276.65 ? 46  VAL H O     1 
ATOM 6654  C CB    . VAL L  4 39  ? 8.394   -62.136  -6.806  1.00 254.82 ? 46  VAL H CB    1 
ATOM 6655  C CG1   . VAL L  4 39  ? 8.763   -63.472  -6.170  1.00 252.31 ? 46  VAL H CG1   1 
ATOM 6656  C CG2   . VAL L  4 39  ? 8.037   -61.124  -5.724  1.00 248.12 ? 46  VAL H CG2   1 
ATOM 6657  N N     . VAL L  4 40  ? 9.078   -62.750  -9.852  1.00 286.08 ? 47  VAL H N     1 
ATOM 6658  C CA    . VAL L  4 40  ? 9.265   -63.719  -10.978 1.00 289.10 ? 47  VAL H CA    1 
ATOM 6659  C C     . VAL L  4 40  ? 10.622  -63.572  -11.685 1.00 290.90 ? 47  VAL H C     1 
ATOM 6660  O O     . VAL L  4 40  ? 11.273  -64.580  -11.964 1.00 300.67 ? 47  VAL H O     1 
ATOM 6661  C CB    . VAL L  4 40  ? 8.068   -63.742  -11.995 1.00 285.58 ? 47  VAL H CB    1 
ATOM 6662  C CG1   . VAL L  4 40  ? 8.461   -64.243  -13.391 1.00 277.90 ? 47  VAL H CG1   1 
ATOM 6663  C CG2   . VAL L  4 40  ? 6.945   -64.595  -11.442 1.00 288.27 ? 47  VAL H CG2   1 
ATOM 6664  N N     . GLU L  4 41  ? 11.058  -62.335  -11.942 1.00 281.82 ? 48  GLU H N     1 
ATOM 6665  C CA    . GLU L  4 41  ? 12.377  -62.112  -12.553 1.00 268.47 ? 48  GLU H CA    1 
ATOM 6666  C C     . GLU L  4 41  ? 13.562  -62.216  -11.588 1.00 258.99 ? 48  GLU H C     1 
ATOM 6667  O O     . GLU L  4 41  ? 14.657  -62.639  -12.005 1.00 257.21 ? 48  GLU H O     1 
ATOM 6668  C CB    . GLU L  4 41  ? 12.410  -60.821  -13.376 1.00 269.28 ? 48  GLU H CB    1 
ATOM 6669  C CG    . GLU L  4 41  ? 11.711  -60.960  -14.728 1.00 276.13 ? 48  GLU H CG    1 
ATOM 6670  C CD    . GLU L  4 41  ? 12.479  -61.818  -15.739 1.00 277.28 ? 48  GLU H CD    1 
ATOM 6671  O OE1   . GLU L  4 41  ? 13.708  -61.618  -15.924 1.00 280.73 ? 48  GLU H OE1   1 
ATOM 6672  O OE2   . GLU L  4 41  ? 11.844  -62.693  -16.370 1.00 274.74 ? 48  GLU H OE2   1 
ATOM 6673  N N     . ALA L  4 42  ? 13.332  -61.836  -10.323 1.00 249.37 ? 49  ALA H N     1 
ATOM 6674  C CA    . ALA L  4 42  ? 14.253  -62.117  -9.216  1.00 244.67 ? 49  ALA H CA    1 
ATOM 6675  C C     . ALA L  4 42  ? 14.531  -63.635  -9.103  1.00 250.13 ? 49  ALA H C     1 
ATOM 6676  O O     . ALA L  4 42  ? 15.693  -64.069  -9.077  1.00 244.30 ? 49  ALA H O     1 
ATOM 6677  C CB    . ALA L  4 42  ? 13.704  -61.553  -7.911  1.00 238.17 ? 49  ALA H CB    1 
ATOM 6678  N N     . ALA L  4 43  ? 13.456  -64.432  -9.085  1.00 263.02 ? 50  ALA H N     1 
ATOM 6679  C CA    . ALA L  4 43  ? 13.519  -65.915  -9.132  1.00 276.83 ? 50  ALA H CA    1 
ATOM 6680  C C     . ALA L  4 43  ? 14.144  -66.504  -10.433 1.00 290.17 ? 50  ALA H C     1 
ATOM 6681  O O     . ALA L  4 43  ? 15.102  -67.294  -10.359 1.00 293.89 ? 50  ALA H O     1 
ATOM 6682  C CB    . ALA L  4 43  ? 12.130  -66.504  -8.885  1.00 272.39 ? 50  ALA H CB    1 
ATOM 6683  N N     . VAL L  4 44  ? 13.600  -66.106  -11.599 1.00 300.08 ? 51  VAL H N     1 
ATOM 6684  C CA    . VAL L  4 44  ? 13.986  -66.607  -12.946 1.00 296.22 ? 51  VAL H CA    1 
ATOM 6685  C C     . VAL L  4 44  ? 15.481  -66.546  -13.185 1.00 293.87 ? 51  VAL H C     1 
ATOM 6686  O O     . VAL L  4 44  ? 16.087  -67.539  -13.559 1.00 296.89 ? 51  VAL H O     1 
ATOM 6687  C CB    . VAL L  4 44  ? 13.261  -65.859  -14.098 1.00 291.43 ? 51  VAL H CB    1 
ATOM 6688  C CG1   . VAL L  4 44  ? 14.058  -65.934  -15.375 1.00 285.50 ? 51  VAL H CG1   1 
ATOM 6689  C CG2   . VAL L  4 44  ? 11.884  -66.463  -14.356 1.00 289.77 ? 51  VAL H CG2   1 
ATOM 6690  N N     . ARG L  4 45  ? 16.063  -65.380  -12.957 1.00 283.46 ? 52  ARG H N     1 
ATOM 6691  C CA    . ARG L  4 45  ? 17.483  -65.205  -13.171 1.00 268.89 ? 52  ARG H CA    1 
ATOM 6692  C C     . ARG L  4 45  ? 18.333  -65.826  -12.051 1.00 256.28 ? 52  ARG H C     1 
ATOM 6693  O O     . ARG L  4 45  ? 19.437  -66.282  -12.313 1.00 251.17 ? 52  ARG H O     1 
ATOM 6694  C CB    . ARG L  4 45  ? 17.818  -63.736  -13.424 1.00 273.38 ? 52  ARG H CB    1 
ATOM 6695  C CG    . ARG L  4 45  ? 17.149  -63.182  -14.673 1.00 278.76 ? 52  ARG H CG    1 
ATOM 6696  C CD    . ARG L  4 45  ? 17.686  -61.802  -15.035 1.00 281.73 ? 52  ARG H CD    1 
ATOM 6697  N NE    . ARG L  4 45  ? 16.882  -61.142  -16.073 1.00 283.65 ? 52  ARG H NE    1 
ATOM 6698  C CZ    . ARG L  4 45  ? 16.995  -59.862  -16.439 1.00 282.48 ? 52  ARG H CZ    1 
ATOM 6699  N NH1   . ARG L  4 45  ? 17.879  -59.057  -15.854 1.00 279.14 ? 52  ARG H NH1   1 
ATOM 6700  N NH2   . ARG L  4 45  ? 16.209  -59.377  -17.395 1.00 282.65 ? 52  ARG H NH2   1 
ATOM 6701  N N     . GLY L  4 46  ? 17.807  -65.874  -10.824 1.00 244.83 ? 53  GLY H N     1 
ATOM 6702  C CA    . GLY L  4 46  ? 18.430  -66.644  -9.738  1.00 239.01 ? 53  GLY H CA    1 
ATOM 6703  C C     . GLY L  4 46  ? 18.493  -68.110  -10.126 1.00 241.42 ? 53  GLY H C     1 
ATOM 6704  O O     . GLY L  4 46  ? 19.558  -68.733  -10.069 1.00 240.28 ? 53  GLY H O     1 
ATOM 6705  N N     . VAL L  4 47  ? 17.344  -68.635  -10.559 1.00 246.10 ? 54  VAL H N     1 
ATOM 6706  C CA    . VAL L  4 47  ? 17.198  -70.002  -11.108 1.00 254.14 ? 54  VAL H CA    1 
ATOM 6707  C C     . VAL L  4 47  ? 18.085  -70.233  -12.351 1.00 258.74 ? 54  VAL H C     1 
ATOM 6708  O O     . VAL L  4 47  ? 18.847  -71.214  -12.405 1.00 260.32 ? 54  VAL H O     1 
ATOM 6709  C CB    . VAL L  4 47  ? 15.703  -70.329  -11.422 1.00 252.25 ? 54  VAL H CB    1 
ATOM 6710  C CG1   . VAL L  4 47  ? 15.533  -71.614  -12.223 1.00 249.92 ? 54  VAL H CG1   1 
ATOM 6711  C CG2   . VAL L  4 47  ? 14.910  -70.446  -10.139 1.00 253.37 ? 54  VAL H CG2   1 
ATOM 6712  N N     . ARG L  4 48  ? 17.987  -69.333  -13.338 1.00 262.07 ? 55  ARG H N     1 
ATOM 6713  C CA    . ARG L  4 48  ? 18.801  -69.405  -14.572 1.00 265.66 ? 55  ARG H CA    1 
ATOM 6714  C C     . ARG L  4 48  ? 20.321  -69.383  -14.317 1.00 263.46 ? 55  ARG H C     1 
ATOM 6715  O O     . ARG L  4 48  ? 21.091  -69.945  -15.113 1.00 269.24 ? 55  ARG H O     1 
ATOM 6716  C CB    . ARG L  4 48  ? 18.435  -68.285  -15.555 1.00 272.25 ? 55  ARG H CB    1 
ATOM 6717  C CG    . ARG L  4 48  ? 17.268  -68.561  -16.496 1.00 279.80 ? 55  ARG H CG    1 
ATOM 6718  C CD    . ARG L  4 48  ? 17.403  -67.709  -17.757 1.00 287.80 ? 55  ARG H CD    1 
ATOM 6719  N NE    . ARG L  4 48  ? 16.487  -66.558  -17.867 1.00 287.94 ? 55  ARG H NE    1 
ATOM 6720  C CZ    . ARG L  4 48  ? 16.814  -65.265  -17.726 1.00 286.73 ? 55  ARG H CZ    1 
ATOM 6721  N NH1   . ARG L  4 48  ? 18.054  -64.881  -17.422 1.00 291.27 ? 55  ARG H NH1   1 
ATOM 6722  N NH2   . ARG L  4 48  ? 15.877  -64.334  -17.883 1.00 279.14 ? 55  ARG H NH2   1 
ATOM 6723  N N     . GLN L  4 49  ? 20.740  -68.728  -13.226 1.00 255.43 ? 56  GLN H N     1 
ATOM 6724  C CA    . GLN L  4 49  ? 22.158  -68.665  -12.842 1.00 250.73 ? 56  GLN H CA    1 
ATOM 6725  C C     . GLN L  4 49  ? 22.638  -69.992  -12.243 1.00 252.92 ? 56  GLN H C     1 
ATOM 6726  O O     . GLN L  4 49  ? 23.702  -70.480  -12.629 1.00 258.55 ? 56  GLN H O     1 
ATOM 6727  C CB    . GLN L  4 49  ? 22.458  -67.462  -11.925 1.00 248.49 ? 56  GLN H CB    1 
ATOM 6728  C CG    . GLN L  4 49  ? 23.944  -67.197  -11.651 1.00 249.27 ? 56  GLN H CG    1 
ATOM 6729  C CD    . GLN L  4 49  ? 24.762  -66.754  -12.860 1.00 248.08 ? 56  GLN H CD    1 
ATOM 6730  O OE1   . GLN L  4 49  ? 24.234  -66.211  -13.829 1.00 245.42 ? 56  GLN H OE1   1 
ATOM 6731  N NE2   . GLN L  4 49  ? 26.073  -66.971  -12.791 1.00 250.68 ? 56  GLN H NE2   1 
ATOM 6732  N N     . ALA L  4 50  ? 21.846  -70.579  -11.337 1.00 248.85 ? 57  ALA H N     1 
ATOM 6733  C CA    . ALA L  4 50  ? 22.137  -71.896  -10.742 1.00 248.21 ? 57  ALA H CA    1 
ATOM 6734  C C     . ALA L  4 50  ? 22.337  -72.958  -11.806 1.00 249.26 ? 57  ALA H C     1 
ATOM 6735  O O     . ALA L  4 50  ? 23.291  -73.717  -11.765 1.00 247.06 ? 57  ALA H O     1 
ATOM 6736  C CB    . ALA L  4 50  ? 21.028  -72.312  -9.792  1.00 245.60 ? 57  ALA H CB    1 
ATOM 6737  N N     . GLN L  4 51  ? 21.439  -72.981  -12.774 1.00 256.79 ? 58  GLN H N     1 
ATOM 6738  C CA    . GLN L  4 51  ? 21.564  -73.876  -13.906 1.00 275.42 ? 58  GLN H CA    1 
ATOM 6739  C C     . GLN L  4 51  ? 22.683  -73.538  -14.927 1.00 297.98 ? 58  GLN H C     1 
ATOM 6740  O O     . GLN L  4 51  ? 23.273  -74.467  -15.485 1.00 306.24 ? 58  GLN H O     1 
ATOM 6741  C CB    . GLN L  4 51  ? 20.223  -73.993  -14.607 1.00 267.66 ? 58  GLN H CB    1 
ATOM 6742  C CG    . GLN L  4 51  ? 19.076  -74.326  -13.670 1.00 261.05 ? 58  GLN H CG    1 
ATOM 6743  C CD    . GLN L  4 51  ? 17.738  -73.869  -14.223 1.00 258.41 ? 58  GLN H CD    1 
ATOM 6744  O OE1   . GLN L  4 51  ? 17.678  -73.167  -15.247 1.00 262.58 ? 58  GLN H OE1   1 
ATOM 6745  N NE2   . GLN L  4 51  ? 16.655  -74.262  -13.554 1.00 253.23 ? 58  GLN H NE2   1 
ATOM 6746  N N     . ALA L  4 52  ? 22.983  -72.247  -15.173 1.00 314.37 ? 59  ALA H N     1 
ATOM 6747  C CA    . ALA L  4 52  ? 24.046  -71.821  -16.156 1.00 322.32 ? 59  ALA H CA    1 
ATOM 6748  C C     . ALA L  4 52  ? 25.513  -72.142  -15.758 1.00 330.82 ? 59  ALA H C     1 
ATOM 6749  O O     . ALA L  4 52  ? 26.383  -72.366  -16.622 1.00 324.37 ? 59  ALA H O     1 
ATOM 6750  C CB    . ALA L  4 52  ? 23.905  -70.341  -16.526 1.00 311.97 ? 59  ALA H CB    1 
ATOM 6751  N N     . GLU L  4 53  ? 25.768  -72.151  -14.449 1.00 338.70 ? 60  GLU H N     1 
ATOM 6752  C CA    . GLU L  4 53  ? 27.073  -72.525  -13.861 1.00 343.54 ? 60  GLU H CA    1 
ATOM 6753  C C     . GLU L  4 53  ? 27.038  -73.942  -13.215 1.00 348.93 ? 60  GLU H C     1 
ATOM 6754  O O     . GLU L  4 53  ? 27.938  -74.362  -12.460 1.00 356.69 ? 60  GLU H O     1 
ATOM 6755  C CB    . GLU L  4 53  ? 27.539  -71.441  -12.868 1.00 334.07 ? 60  GLU H CB    1 
ATOM 6756  C CG    . GLU L  4 53  ? 26.680  -71.306  -11.615 1.00 318.38 ? 60  GLU H CG    1 
ATOM 6757  C CD    . GLU L  4 53  ? 27.127  -70.182  -10.690 1.00 309.30 ? 60  GLU H CD    1 
ATOM 6758  O OE1   . GLU L  4 53  ? 27.623  -70.494  -9.583  1.00 312.47 ? 60  GLU H OE1   1 
ATOM 6759  O OE2   . GLU L  4 53  ? 26.978  -68.993  -11.060 1.00 296.55 ? 60  GLU H OE2   1 
ATOM 6760  N N     . ASP L  4 54  ? 25.965  -74.663  -13.531 1.00 340.41 ? 61  ASP H N     1 
ATOM 6761  C CA    . ASP L  4 54  ? 25.767  -76.054  -13.138 1.00 331.15 ? 61  ASP H CA    1 
ATOM 6762  C C     . ASP L  4 54  ? 25.829  -76.335  -11.622 1.00 325.53 ? 61  ASP H C     1 
ATOM 6763  O O     . ASP L  4 54  ? 26.721  -77.045  -11.162 1.00 324.15 ? 61  ASP H O     1 
ATOM 6764  C CB    . ASP L  4 54  ? 26.714  -76.962  -13.925 1.00 337.71 ? 61  ASP H CB    1 
ATOM 6765  C CG    . ASP L  4 54  ? 26.117  -78.326  -14.163 1.00 337.33 ? 61  ASP H CG    1 
ATOM 6766  O OD1   . ASP L  4 54  ? 24.873  -78.445  -14.173 1.00 331.11 ? 61  ASP H OD1   1 
ATOM 6767  O OD2   . ASP L  4 54  ? 26.880  -79.291  -14.334 1.00 345.26 ? 61  ASP H OD2   1 
ATOM 6768  N N     . ALA L  4 55  ? 24.867  -75.768  -10.875 1.00 314.19 ? 62  ALA H N     1 
ATOM 6769  C CA    . ALA L  4 55  ? 24.689  -75.988  -9.428  1.00 317.35 ? 62  ALA H CA    1 
ATOM 6770  C C     . ALA L  4 55  ? 23.646  -77.077  -9.159  1.00 322.31 ? 62  ALA H C     1 
ATOM 6771  O O     . ALA L  4 55  ? 22.802  -77.362  -10.020 1.00 327.49 ? 62  ALA H O     1 
ATOM 6772  C CB    . ALA L  4 55  ? 24.276  -74.699  -8.742  1.00 308.49 ? 62  ALA H CB    1 
ATOM 6773  N N     . LEU L  4 56  ? 23.703  -77.673  -7.963  1.00 325.02 ? 63  LEU H N     1 
ATOM 6774  C CA    . LEU L  4 56  ? 22.900  -78.871  -7.635  1.00 321.35 ? 63  LEU H CA    1 
ATOM 6775  C C     . LEU L  4 56  ? 21.559  -78.577  -6.907  1.00 313.49 ? 63  LEU H C     1 
ATOM 6776  O O     . LEU L  4 56  ? 20.763  -79.479  -6.622  1.00 308.61 ? 63  LEU H O     1 
ATOM 6777  C CB    . LEU L  4 56  ? 23.776  -79.940  -6.952  1.00 328.09 ? 63  LEU H CB    1 
ATOM 6778  C CG    . LEU L  4 56  ? 25.060  -80.311  -7.737  1.00 327.49 ? 63  LEU H CG    1 
ATOM 6779  C CD1   . LEU L  4 56  ? 26.047  -81.120  -6.909  1.00 338.25 ? 63  LEU H CD1   1 
ATOM 6780  C CD2   . LEU L  4 56  ? 24.768  -81.068  -9.029  1.00 319.92 ? 63  LEU H CD2   1 
ATOM 6781  N N     . ARG L  4 57  ? 21.332  -77.290  -6.638  1.00 303.71 ? 64  ARG H N     1 
ATOM 6782  C CA    . ARG L  4 57  ? 19.982  -76.694  -6.480  1.00 296.15 ? 64  ARG H CA    1 
ATOM 6783  C C     . ARG L  4 57  ? 20.065  -75.166  -6.655  1.00 298.67 ? 64  ARG H C     1 
ATOM 6784  O O     . ARG L  4 57  ? 21.159  -74.649  -6.936  1.00 301.81 ? 64  ARG H O     1 
ATOM 6785  C CB    . ARG L  4 57  ? 19.321  -77.074  -5.149  1.00 287.21 ? 64  ARG H CB    1 
ATOM 6786  C CG    . ARG L  4 57  ? 20.046  -76.602  -3.898  1.00 284.01 ? 64  ARG H CG    1 
ATOM 6787  C CD    . ARG L  4 57  ? 19.089  -75.948  -2.890  1.00 276.39 ? 64  ARG H CD    1 
ATOM 6788  N NE    . ARG L  4 57  ? 17.676  -76.078  -3.286  1.00 268.88 ? 64  ARG H NE    1 
ATOM 6789  C CZ    . ARG L  4 57  ? 16.635  -76.044  -2.464  1.00 270.11 ? 64  ARG H CZ    1 
ATOM 6790  N NH1   . ARG L  4 57  ? 16.807  -75.867  -1.157  1.00 274.72 ? 64  ARG H NH1   1 
ATOM 6791  N NH2   . ARG L  4 57  ? 15.403  -76.177  -2.948  1.00 267.61 ? 64  ARG H NH2   1 
ATOM 6792  N N     . VAL L  4 58  ? 18.933  -74.455  -6.520  1.00 302.43 ? 65  VAL H N     1 
ATOM 6793  C CA    . VAL L  4 58  ? 18.955  -72.968  -6.522  1.00 303.39 ? 65  VAL H CA    1 
ATOM 6794  C C     . VAL L  4 58  ? 19.474  -72.388  -5.163  1.00 307.17 ? 65  VAL H C     1 
ATOM 6795  O O     . VAL L  4 58  ? 18.746  -72.333  -4.167  1.00 302.53 ? 65  VAL H O     1 
ATOM 6796  C CB    . VAL L  4 58  ? 17.636  -72.320  -7.069  1.00 298.66 ? 65  VAL H CB    1 
ATOM 6797  C CG1   . VAL L  4 58  ? 17.767  -70.801  -7.183  1.00 292.54 ? 65  VAL H CG1   1 
ATOM 6798  C CG2   . VAL L  4 58  ? 17.277  -72.873  -8.449  1.00 295.05 ? 65  VAL H CG2   1 
ATOM 6799  N N     . ASP L  4 59  ? 20.749  -71.954  -5.184  1.00 310.97 ? 66  ASP H N     1 
ATOM 6800  C CA    . ASP L  4 59  ? 21.585  -71.512  -4.034  1.00 311.19 ? 66  ASP H CA    1 
ATOM 6801  C C     . ASP L  4 59  ? 21.892  -69.979  -4.091  1.00 310.79 ? 66  ASP H C     1 
ATOM 6802  O O     . ASP L  4 59  ? 21.882  -69.396  -5.178  1.00 316.14 ? 66  ASP H O     1 
ATOM 6803  C CB    . ASP L  4 59  ? 22.901  -72.317  -4.058  1.00 308.94 ? 66  ASP H CB    1 
ATOM 6804  C CG    . ASP L  4 59  ? 23.301  -72.827  -2.678  1.00 310.18 ? 66  ASP H CG    1 
ATOM 6805  O OD1   . ASP L  4 59  ? 23.804  -72.027  -1.859  1.00 312.76 ? 66  ASP H OD1   1 
ATOM 6806  O OD2   . ASP L  4 59  ? 23.114  -74.027  -2.405  1.00 310.16 ? 66  ASP H OD2   1 
ATOM 6807  N N     . VAL L  4 60  ? 22.180  -69.337  -2.956  1.00 308.36 ? 67  VAL H N     1 
ATOM 6808  C CA    . VAL L  4 60  ? 22.236  -67.852  -2.862  1.00 298.06 ? 67  VAL H CA    1 
ATOM 6809  C C     . VAL L  4 60  ? 23.329  -67.159  -3.699  1.00 294.77 ? 67  VAL H C     1 
ATOM 6810  O O     . VAL L  4 60  ? 23.126  -66.036  -4.194  1.00 287.63 ? 67  VAL H O     1 
ATOM 6811  C CB    . VAL L  4 60  ? 22.309  -67.377  -1.389  1.00 299.36 ? 67  VAL H CB    1 
ATOM 6812  C CG1   . VAL L  4 60  ? 21.855  -65.930  -1.254  1.00 291.73 ? 67  VAL H CG1   1 
ATOM 6813  C CG2   . VAL L  4 60  ? 21.450  -68.263  -0.506  1.00 301.35 ? 67  VAL H CG2   1 
ATOM 6814  N N     . ASP L  4 61  ? 24.471  -67.828  -3.851  1.00 299.53 ? 68  ASP H N     1 
ATOM 6815  C CA    . ASP L  4 61  ? 25.598  -67.335  -4.679  1.00 304.39 ? 68  ASP H CA    1 
ATOM 6816  C C     . ASP L  4 61  ? 25.145  -66.924  -6.105  1.00 306.30 ? 68  ASP H C     1 
ATOM 6817  O O     . ASP L  4 61  ? 25.623  -65.922  -6.671  1.00 309.70 ? 68  ASP H O     1 
ATOM 6818  C CB    . ASP L  4 61  ? 26.717  -68.411  -4.768  1.00 305.82 ? 68  ASP H CB    1 
ATOM 6819  C CG    . ASP L  4 61  ? 27.770  -68.338  -3.641  1.00 308.74 ? 68  ASP H CG    1 
ATOM 6820  O OD1   . ASP L  4 61  ? 27.428  -68.106  -2.453  1.00 303.96 ? 68  ASP H OD1   1 
ATOM 6821  O OD2   . ASP L  4 61  ? 28.942  -68.602  -3.964  1.00 314.26 ? 68  ASP H OD2   1 
ATOM 6822  N N     . GLN L  4 62  ? 24.207  -67.701  -6.657  1.00 309.41 ? 69  GLN H N     1 
ATOM 6823  C CA    . GLN L  4 62  ? 23.663  -67.510  -8.010  1.00 307.21 ? 69  GLN H CA    1 
ATOM 6824  C C     . GLN L  4 62  ? 22.659  -66.337  -8.131  1.00 300.03 ? 69  GLN H C     1 
ATOM 6825  O O     . GLN L  4 62  ? 22.787  -65.503  -9.036  1.00 296.64 ? 69  GLN H O     1 
ATOM 6826  C CB    . GLN L  4 62  ? 23.075  -68.832  -8.534  1.00 305.84 ? 69  GLN H CB    1 
ATOM 6827  C CG    . GLN L  4 62  ? 24.123  -69.827  -9.053  1.00 306.11 ? 69  GLN H CG    1 
ATOM 6828  C CD    . GLN L  4 62  ? 24.471  -70.983  -8.103  1.00 311.49 ? 69  GLN H CD    1 
ATOM 6829  O OE1   . GLN L  4 62  ? 23.705  -71.338  -7.202  1.00 315.56 ? 69  GLN H OE1   1 
ATOM 6830  N NE2   . GLN L  4 62  ? 25.631  -71.593  -8.326  1.00 314.65 ? 69  GLN H NE2   1 
ATOM 6831  N N     . LEU L  4 63  ? 21.675  -66.278  -7.225  1.00 296.55 ? 70  LEU H N     1 
ATOM 6832  C CA    . LEU L  4 63  ? 20.803  -65.096  -7.074  1.00 293.19 ? 70  LEU H CA    1 
ATOM 6833  C C     . LEU L  4 63  ? 21.621  -63.805  -6.961  1.00 291.39 ? 70  LEU H C     1 
ATOM 6834  O O     . LEU L  4 63  ? 21.356  -62.827  -7.658  1.00 287.34 ? 70  LEU H O     1 
ATOM 6835  C CB    . LEU L  4 63  ? 19.902  -65.208  -5.826  1.00 300.53 ? 70  LEU H CB    1 
ATOM 6836  C CG    . LEU L  4 63  ? 19.377  -63.864  -5.267  1.00 305.96 ? 70  LEU H CG    1 
ATOM 6837  C CD1   . LEU L  4 63  ? 18.064  -63.482  -5.939  1.00 307.12 ? 70  LEU H CD1   1 
ATOM 6838  C CD2   . LEU L  4 63  ? 19.261  -63.809  -3.740  1.00 310.02 ? 70  LEU H CD2   1 
ATOM 6839  N N     . GLU L  4 64  ? 22.608  -63.799  -6.069  1.00 291.52 ? 71  GLU H N     1 
ATOM 6840  C CA    . GLU L  4 64  ? 23.374  -62.584  -5.821  1.00 289.53 ? 71  GLU H CA    1 
ATOM 6841  C C     . GLU L  4 64  ? 24.387  -62.282  -6.923  1.00 292.91 ? 71  GLU H C     1 
ATOM 6842  O O     . GLU L  4 64  ? 24.881  -61.155  -7.014  1.00 294.18 ? 71  GLU H O     1 
ATOM 6843  C CB    . GLU L  4 64  ? 24.042  -62.621  -4.454  1.00 290.32 ? 71  GLU H CB    1 
ATOM 6844  C CG    . GLU L  4 64  ? 23.087  -62.601  -3.272  1.00 282.28 ? 71  GLU H CG    1 
ATOM 6845  C CD    . GLU L  4 64  ? 23.817  -62.877  -1.959  1.00 289.51 ? 71  GLU H CD    1 
ATOM 6846  O OE1   . GLU L  4 64  ? 24.898  -63.521  -1.979  1.00 297.87 ? 71  GLU H OE1   1 
ATOM 6847  O OE2   . GLU L  4 64  ? 23.325  -62.451  -0.895  1.00 288.89 ? 71  GLU H OE2   1 
ATOM 6848  N N     . LYS L  4 65  ? 24.694  -63.284  -7.751  1.00 291.87 ? 72  LYS H N     1 
ATOM 6849  C CA    . LYS L  4 65  ? 25.402  -63.050  -9.014  1.00 287.27 ? 72  LYS H CA    1 
ATOM 6850  C C     . LYS L  4 65  ? 24.480  -62.379  -10.068 1.00 282.77 ? 72  LYS H C     1 
ATOM 6851  O O     . LYS L  4 65  ? 24.959  -61.707  -10.995 1.00 285.92 ? 72  LYS H O     1 
ATOM 6852  C CB    . LYS L  4 65  ? 26.067  -64.335  -9.531  1.00 283.05 ? 72  LYS H CB    1 
ATOM 6853  C CG    . LYS L  4 65  ? 27.453  -64.546  -8.951  1.00 282.40 ? 72  LYS H CG    1 
ATOM 6854  C CD    . LYS L  4 65  ? 27.991  -65.941  -9.204  1.00 277.40 ? 72  LYS H CD    1 
ATOM 6855  C CE    . LYS L  4 65  ? 29.223  -66.171  -8.346  1.00 280.62 ? 72  LYS H CE    1 
ATOM 6856  N NZ    . LYS L  4 65  ? 29.463  -67.600  -8.004  1.00 280.60 ? 72  LYS H NZ    1 
ATOM 6857  N N     . VAL L  4 66  ? 23.164  -62.552  -9.911  1.00 276.01 ? 73  VAL H N     1 
ATOM 6858  C CA    . VAL L  4 66  ? 22.187  -61.817  -10.726 1.00 266.38 ? 73  VAL H CA    1 
ATOM 6859  C C     . VAL L  4 66  ? 21.633  -60.558  -10.012 1.00 261.50 ? 73  VAL H C     1 
ATOM 6860  O O     . VAL L  4 66  ? 20.814  -59.850  -10.595 1.00 265.13 ? 73  VAL H O     1 
ATOM 6861  C CB    . VAL L  4 66  ? 21.030  -62.719  -11.264 1.00 261.50 ? 73  VAL H CB    1 
ATOM 6862  C CG1   . VAL L  4 66  ? 21.564  -64.023  -11.846 1.00 263.07 ? 73  VAL H CG1   1 
ATOM 6863  C CG2   . VAL L  4 66  ? 19.987  -62.993  -10.188 1.00 258.12 ? 73  VAL H CG2   1 
ATOM 6864  N N     . LEU L  4 67  ? 22.080  -60.279  -8.776  1.00 253.35 ? 74  LEU H N     1 
ATOM 6865  C CA    . LEU L  4 67  ? 21.619  -59.095  -7.999  1.00 243.43 ? 74  LEU H CA    1 
ATOM 6866  C C     . LEU L  4 67  ? 22.042  -57.704  -8.528  1.00 254.68 ? 74  LEU H C     1 
ATOM 6867  O O     . LEU L  4 67  ? 21.181  -56.807  -8.590  1.00 250.12 ? 74  LEU H O     1 
ATOM 6868  C CB    . LEU L  4 67  ? 21.913  -59.220  -6.494  1.00 230.82 ? 74  LEU H CB    1 
ATOM 6869  C CG    . LEU L  4 67  ? 20.956  -60.026  -5.608  1.00 220.02 ? 74  LEU H CG    1 
ATOM 6870  C CD1   . LEU L  4 67  ? 21.086  -59.600  -4.158  1.00 215.96 ? 74  LEU H CD1   1 
ATOM 6871  C CD2   . LEU L  4 67  ? 19.507  -59.897  -6.059  1.00 212.89 ? 74  LEU H CD2   1 
ATOM 6872  N N     . PRO L  4 68  ? 23.347  -57.512  -8.902  1.00 270.50 ? 75  PRO H N     1 
ATOM 6873  C CA    . PRO L  4 68  ? 23.724  -56.247  -9.567  1.00 282.93 ? 75  PRO H CA    1 
ATOM 6874  C C     . PRO L  4 68  ? 22.895  -55.996  -10.840 1.00 294.55 ? 75  PRO H C     1 
ATOM 6875  O O     . PRO L  4 68  ? 22.312  -54.904  -10.979 1.00 294.47 ? 75  PRO H O     1 
ATOM 6876  C CB    . PRO L  4 68  ? 25.218  -56.439  -9.897  1.00 283.14 ? 75  PRO H CB    1 
ATOM 6877  C CG    . PRO L  4 68  ? 25.690  -57.443  -8.906  1.00 279.38 ? 75  PRO H CG    1 
ATOM 6878  C CD    . PRO L  4 68  ? 24.527  -58.391  -8.753  1.00 275.34 ? 75  PRO H CD    1 
ATOM 6879  N N     . GLN L  4 69  ? 22.824  -57.001  -11.730 1.00 307.19 ? 76  GLN H N     1 
ATOM 6880  C CA    . GLN L  4 69  ? 21.987  -56.972  -12.963 1.00 308.98 ? 76  GLN H CA    1 
ATOM 6881  C C     . GLN L  4 69  ? 20.448  -56.814  -12.715 1.00 313.53 ? 76  GLN H C     1 
ATOM 6882  O O     . GLN L  4 69  ? 19.746  -56.166  -13.501 1.00 325.22 ? 76  GLN H O     1 
ATOM 6883  C CB    . GLN L  4 69  ? 22.319  -58.179  -13.885 1.00 297.89 ? 76  GLN H CB    1 
ATOM 6884  C CG    . GLN L  4 69  ? 21.650  -58.185  -15.265 1.00 287.08 ? 76  GLN H CG    1 
ATOM 6885  C CD    . GLN L  4 69  ? 21.933  -56.940  -16.108 1.00 290.26 ? 76  GLN H CD    1 
ATOM 6886  O OE1   . GLN L  4 69  ? 23.074  -56.478  -16.207 1.00 290.93 ? 76  GLN H OE1   1 
ATOM 6887  N NE2   . GLN L  4 69  ? 20.883  -56.396  -16.727 1.00 289.06 ? 76  GLN H NE2   1 
ATOM 6888  N N     . LEU L  4 70  ? 19.929  -57.376  -11.623 1.00 306.74 ? 77  LEU H N     1 
ATOM 6889  C CA    . LEU L  4 70  ? 18.497  -57.244  -11.301 1.00 287.06 ? 77  LEU H CA    1 
ATOM 6890  C C     . LEU L  4 70  ? 18.121  -55.889  -10.690 1.00 280.95 ? 77  LEU H C     1 
ATOM 6891  O O     . LEU L  4 70  ? 17.017  -55.387  -10.892 1.00 284.47 ? 77  LEU H O     1 
ATOM 6892  C CB    . LEU L  4 70  ? 18.055  -58.369  -10.369 1.00 274.41 ? 77  LEU H CB    1 
ATOM 6893  C CG    . LEU L  4 70  ? 16.594  -58.375  -9.918  1.00 262.23 ? 77  LEU H CG    1 
ATOM 6894  C CD1   . LEU L  4 70  ? 15.670  -58.899  -11.010 1.00 255.94 ? 77  LEU H CD1   1 
ATOM 6895  C CD2   . LEU L  4 70  ? 16.481  -59.182  -8.640  1.00 254.27 ? 77  LEU H CD2   1 
ATOM 6896  N N     . LEU L  4 71  ? 19.023  -55.297  -9.926  1.00 265.30 ? 78  LEU H N     1 
ATOM 6897  C CA    . LEU L  4 71  ? 18.682  -54.041  -9.302  1.00 250.83 ? 78  LEU H CA    1 
ATOM 6898  C C     . LEU L  4 71  ? 18.966  -52.874  -10.214 1.00 252.77 ? 78  LEU H C     1 
ATOM 6899  O O     . LEU L  4 71  ? 18.384  -51.818  -10.051 1.00 240.85 ? 78  LEU H O     1 
ATOM 6900  C CB    . LEU L  4 71  ? 19.297  -53.940  -7.923  1.00 244.83 ? 78  LEU H CB    1 
ATOM 6901  C CG    . LEU L  4 71  ? 18.528  -55.015  -7.145  1.00 237.53 ? 78  LEU H CG    1 
ATOM 6902  C CD1   . LEU L  4 71  ? 19.249  -55.483  -5.887  1.00 237.53 ? 78  LEU H CD1   1 
ATOM 6903  C CD2   . LEU L  4 71  ? 17.102  -54.562  -6.859  1.00 234.15 ? 78  LEU H CD2   1 
ATOM 6904  N N     . LEU L  4 72  ? 19.827  -53.100  -11.209 1.00 267.72 ? 79  LEU H N     1 
ATOM 6905  C CA    . LEU L  4 72  ? 19.859  -52.304  -12.454 1.00 294.42 ? 79  LEU H CA    1 
ATOM 6906  C C     . LEU L  4 72  ? 18.508  -52.242  -13.221 1.00 314.72 ? 79  LEU H C     1 
ATOM 6907  O O     . LEU L  4 72  ? 18.074  -51.137  -13.589 1.00 328.50 ? 79  LEU H O     1 
ATOM 6908  C CB    . LEU L  4 72  ? 20.914  -52.852  -13.415 1.00 302.37 ? 79  LEU H CB    1 
ATOM 6909  C CG    . LEU L  4 72  ? 22.209  -52.227  -13.913 1.00 312.36 ? 79  LEU H CG    1 
ATOM 6910  C CD1   . LEU L  4 72  ? 22.845  -53.304  -14.767 1.00 318.01 ? 79  LEU H CD1   1 
ATOM 6911  C CD2   . LEU L  4 72  ? 22.001  -50.984  -14.765 1.00 317.58 ? 79  LEU H CD2   1 
ATOM 6912  N N     . ASP L  4 73  ? 17.903  -53.418  -13.510 1.00 330.31 ? 80  ASP H N     1 
ATOM 6913  C CA    . ASP L  4 73  ? 16.578  -53.581  -14.228 1.00 335.33 ? 80  ASP H CA    1 
ATOM 6914  C C     . ASP L  4 73  ? 15.354  -53.112  -13.369 1.00 344.10 ? 80  ASP H C     1 
ATOM 6915  O O     . ASP L  4 73  ? 14.267  -52.819  -13.915 1.00 352.44 ? 80  ASP H O     1 
ATOM 6916  C CB    . ASP L  4 73  ? 16.352  -55.042  -14.758 1.00 312.05 ? 80  ASP H CB    1 
ATOM 6917  C CG    . ASP L  4 73  ? 16.844  -55.277  -16.225 1.00 295.12 ? 80  ASP H CG    1 
ATOM 6918  O OD1   . ASP L  4 73  ? 17.295  -54.339  -16.925 1.00 294.56 ? 80  ASP H OD1   1 
ATOM 6919  O OD2   . ASP L  4 73  ? 16.769  -56.434  -16.682 1.00 275.75 ? 80  ASP H OD2   1 
ATOM 6920  N N     . PHE L  4 74  ? 15.547  -53.031  -12.042 1.00 340.78 ? 81  PHE H N     1 
ATOM 6921  C CA    . PHE L  4 74  ? 14.534  -52.514  -11.099 1.00 328.09 ? 81  PHE H CA    1 
ATOM 6922  C C     . PHE L  4 74  ? 14.996  -51.281  -10.319 1.00 329.52 ? 81  PHE H C     1 
ATOM 6923  O O     . PHE L  4 74  ? 14.385  -50.208  -10.380 1.00 330.22 ? 81  PHE H O     1 
ATOM 6924  C CB    . PHE L  4 74  ? 14.075  -53.618  -10.136 1.00 310.60 ? 81  PHE H CB    1 
ATOM 6925  C CG    . PHE L  4 74  ? 13.190  -54.656  -10.781 1.00 293.00 ? 81  PHE H CG    1 
ATOM 6926  C CD1   . PHE L  4 74  ? 12.029  -54.271  -11.453 1.00 288.03 ? 81  PHE H CD1   1 
ATOM 6927  C CD2   . PHE L  4 74  ? 13.513  -56.015  -10.724 1.00 280.62 ? 81  PHE H CD2   1 
ATOM 6928  C CE1   . PHE L  4 74  ? 11.206  -55.221  -12.046 1.00 277.50 ? 81  PHE H CE1   1 
ATOM 6929  C CE2   . PHE L  4 74  ? 12.695  -56.969  -11.320 1.00 268.93 ? 81  PHE H CE2   1 
ATOM 6930  C CZ    . PHE L  4 74  ? 11.546  -56.565  -11.987 1.00 269.39 ? 81  PHE H CZ    1 
ATOM 6931  N N     . SER M  3 1   ? 40.924  -88.506  -26.131 1.00 281.61 ? 14  SER A N     1 
ATOM 6932  C CA    . SER M  3 1   ? 42.025  -89.441  -25.765 1.00 274.75 ? 14  SER A CA    1 
ATOM 6933  C C     . SER M  3 1   ? 41.573  -90.747  -25.099 1.00 275.29 ? 14  SER A C     1 
ATOM 6934  O O     . SER M  3 1   ? 40.416  -90.895  -24.696 1.00 269.39 ? 14  SER A O     1 
ATOM 6935  C CB    . SER M  3 1   ? 43.112  -88.755  -24.940 1.00 268.67 ? 14  SER A CB    1 
ATOM 6936  O OG    . SER M  3 1   ? 44.266  -89.571  -25.003 1.00 259.16 ? 14  SER A OG    1 
ATOM 6937  N N     . TYR M  3 2   ? 42.488  -91.713  -25.028 1.00 282.89 ? 15  TYR A N     1 
ATOM 6938  C CA    . TYR M  3 2   ? 42.138  -92.991  -24.461 1.00 290.57 ? 15  TYR A CA    1 
ATOM 6939  C C     . TYR M  3 2   ? 41.890  -92.641  -23.033 1.00 294.73 ? 15  TYR A C     1 
ATOM 6940  O O     . TYR M  3 2   ? 40.798  -92.824  -22.506 1.00 290.13 ? 15  TYR A O     1 
ATOM 6941  C CB    . TYR M  3 2   ? 43.228  -94.057  -24.666 1.00 291.10 ? 15  TYR A CB    1 
ATOM 6942  C CG    . TYR M  3 2   ? 42.609  -95.375  -25.114 1.00 292.54 ? 15  TYR A CG    1 
ATOM 6943  C CD1   . TYR M  3 2   ? 42.538  -95.740  -26.474 1.00 298.89 ? 15  TYR A CD1   1 
ATOM 6944  C CD2   . TYR M  3 2   ? 42.019  -96.233  -24.176 1.00 286.39 ? 15  TYR A CD2   1 
ATOM 6945  C CE1   . TYR M  3 2   ? 41.921  -96.939  -26.874 1.00 299.14 ? 15  TYR A CE1   1 
ATOM 6946  C CE2   . TYR M  3 2   ? 41.408  -97.428  -24.565 1.00 288.25 ? 15  TYR A CE2   1 
ATOM 6947  C CZ    . TYR M  3 2   ? 41.355  -97.777  -25.900 1.00 294.77 ? 15  TYR A CZ    1 
ATOM 6948  O OH    . TYR M  3 2   ? 40.742  -98.970  -26.227 1.00 296.53 ? 15  TYR A OH    1 
ATOM 6949  N N     . GLN M  3 3   ? 42.916  -92.029  -22.473 1.00 310.18 ? 16  GLN A N     1 
ATOM 6950  C CA    . GLN M  3 3   ? 42.844  -91.350  -21.214 1.00 327.49 ? 16  GLN A CA    1 
ATOM 6951  C C     . GLN M  3 3   ? 41.598  -90.434  -21.085 1.00 333.32 ? 16  GLN A C     1 
ATOM 6952  O O     . GLN M  3 3   ? 40.922  -90.535  -20.070 1.00 350.46 ? 16  GLN A O     1 
ATOM 6953  C CB    . GLN M  3 3   ? 44.180  -90.622  -20.977 1.00 335.34 ? 16  GLN A CB    1 
ATOM 6954  C CG    . GLN M  3 3   ? 45.385  -91.562  -21.174 1.00 335.67 ? 16  GLN A CG    1 
ATOM 6955  C CD    . GLN M  3 3   ? 46.422  -91.092  -22.200 1.00 340.82 ? 16  GLN A CD    1 
ATOM 6956  O OE1   . GLN M  3 3   ? 46.895  -89.948  -22.159 1.00 344.40 ? 16  GLN A OE1   1 
ATOM 6957  N NE2   . GLN M  3 3   ? 46.814  -92.002  -23.105 1.00 339.81 ? 16  GLN A NE2   1 
ATOM 6958  N N     . GLN M  3 4   ? 41.272  -89.605  -22.099 1.00 324.49 ? 17  GLN A N     1 
ATOM 6959  C CA    . GLN M  3 4   ? 40.176  -88.579  -22.003 1.00 315.26 ? 17  GLN A CA    1 
ATOM 6960  C C     . GLN M  3 4   ? 38.721  -89.041  -21.810 1.00 309.01 ? 17  GLN A C     1 
ATOM 6961  O O     . GLN M  3 4   ? 38.016  -88.513  -20.948 1.00 302.47 ? 17  GLN A O     1 
ATOM 6962  C CB    . GLN M  3 4   ? 40.197  -87.585  -23.176 1.00 319.16 ? 17  GLN A CB    1 
ATOM 6963  C CG    . GLN M  3 4   ? 40.908  -86.254  -22.946 1.00 322.56 ? 17  GLN A CG    1 
ATOM 6964  C CD    . GLN M  3 4   ? 40.937  -85.392  -24.196 1.00 328.36 ? 17  GLN A CD    1 
ATOM 6965  O OE1   . GLN M  3 4   ? 41.577  -85.759  -25.186 1.00 333.83 ? 17  GLN A OE1   1 
ATOM 6966  N NE2   . GLN M  3 4   ? 40.265  -84.245  -24.153 1.00 324.92 ? 17  GLN A NE2   1 
ATOM 6967  N N     . ARG M  3 5   ? 38.232  -89.965  -22.625 1.00 309.59 ? 18  ARG A N     1 
ATOM 6968  C CA    . ARG M  3 5   ? 36.885  -90.430  -22.338 1.00 321.00 ? 18  ARG A CA    1 
ATOM 6969  C C     . ARG M  3 5   ? 36.947  -91.459  -21.227 1.00 326.95 ? 18  ARG A C     1 
ATOM 6970  O O     . ARG M  3 5   ? 35.971  -91.682  -20.515 1.00 327.78 ? 18  ARG A O     1 
ATOM 6971  C CB    . ARG M  3 5   ? 36.148  -90.971  -23.554 1.00 321.74 ? 18  ARG A CB    1 
ATOM 6972  C CG    . ARG M  3 5   ? 34.635  -90.813  -23.442 1.00 326.05 ? 18  ARG A CG    1 
ATOM 6973  C CD    . ARG M  3 5   ? 33.855  -92.061  -23.827 1.00 324.88 ? 18  ARG A CD    1 
ATOM 6974  N NE    . ARG M  3 5   ? 34.299  -93.250  -23.090 1.00 320.46 ? 18  ARG A NE    1 
ATOM 6975  C CZ    . ARG M  3 5   ? 33.828  -93.651  -21.909 1.00 316.86 ? 18  ARG A CZ    1 
ATOM 6976  N NH1   . ARG M  3 5   ? 34.315  -94.747  -21.335 1.00 307.79 ? 18  ARG A NH1   1 
ATOM 6977  N NH2   . ARG M  3 5   ? 32.877  -92.967  -21.293 1.00 315.33 ? 18  ARG A NH2   1 
ATOM 6978  N N     . LEU M  3 6   ? 38.098  -92.086  -21.059 1.00 338.66 ? 19  LEU A N     1 
ATOM 6979  C CA    . LEU M  3 6   ? 38.259  -92.895  -19.867 1.00 351.77 ? 19  LEU A CA    1 
ATOM 6980  C C     . LEU M  3 6   ? 38.392  -92.066  -18.546 1.00 365.16 ? 19  LEU A C     1 
ATOM 6981  O O     . LEU M  3 6   ? 37.894  -92.502  -17.478 1.00 377.14 ? 19  LEU A O     1 
ATOM 6982  C CB    . LEU M  3 6   ? 39.293  -94.014  -20.075 1.00 340.11 ? 19  LEU A CB    1 
ATOM 6983  C CG    . LEU M  3 6   ? 38.627  -95.204  -20.788 1.00 328.56 ? 19  LEU A CG    1 
ATOM 6984  C CD1   . LEU M  3 6   ? 39.653  -96.273  -21.150 1.00 319.12 ? 19  LEU A CD1   1 
ATOM 6985  C CD2   . LEU M  3 6   ? 37.495  -95.814  -19.960 1.00 322.81 ? 19  LEU A CD2   1 
ATOM 6986  N N     . LYS M  3 7   ? 38.986  -90.858  -18.626 1.00 367.53 ? 20  LYS A N     1 
ATOM 6987  C CA    . LYS M  3 7   ? 38.842  -89.835  -17.533 1.00 355.27 ? 20  LYS A CA    1 
ATOM 6988  C C     . LYS M  3 7   ? 37.363  -89.417  -17.349 1.00 345.59 ? 20  LYS A C     1 
ATOM 6989  O O     . LYS M  3 7   ? 36.952  -89.063  -16.236 1.00 340.92 ? 20  LYS A O     1 
ATOM 6990  C CB    . LYS M  3 7   ? 39.731  -88.578  -17.722 1.00 360.08 ? 20  LYS A CB    1 
ATOM 6991  C CG    . LYS M  3 7   ? 41.035  -88.515  -16.912 1.00 358.17 ? 20  LYS A CG    1 
ATOM 6992  C CD    . LYS M  3 7   ? 41.242  -87.165  -16.225 1.00 348.59 ? 20  LYS A CD    1 
ATOM 6993  C CE    . LYS M  3 7   ? 42.697  -86.699  -16.182 1.00 346.67 ? 20  LYS A CE    1 
ATOM 6994  N NZ    . LYS M  3 7   ? 43.270  -86.251  -17.484 1.00 352.19 ? 20  LYS A NZ    1 
ATOM 6995  N N     . ALA M  3 8   ? 36.599  -89.476  -18.451 1.00 338.39 ? 21  ALA A N     1 
ATOM 6996  C CA    . ALA M  3 8   ? 35.144  -89.293  -18.486 1.00 331.93 ? 21  ALA A CA    1 
ATOM 6997  C C     . ALA M  3 8   ? 34.338  -90.414  -17.821 1.00 324.17 ? 21  ALA A C     1 
ATOM 6998  O O     . ALA M  3 8   ? 33.333  -90.148  -17.172 1.00 322.08 ? 21  ALA A O     1 
ATOM 6999  C CB    . ALA M  3 8   ? 34.704  -89.139  -19.921 1.00 339.12 ? 21  ALA A CB    1 
ATOM 7000  N N     . ALA M  3 9   ? 34.757  -91.660  -18.019 1.00 316.46 ? 22  ALA A N     1 
ATOM 7001  C CA    . ALA M  3 9   ? 34.197  -92.777  -17.275 1.00 310.42 ? 22  ALA A CA    1 
ATOM 7002  C C     . ALA M  3 9   ? 34.648  -92.803  -15.805 1.00 314.57 ? 22  ALA A C     1 
ATOM 7003  O O     . ALA M  3 9   ? 33.884  -93.240  -14.968 1.00 310.56 ? 22  ALA A O     1 
ATOM 7004  C CB    . ALA M  3 9   ? 34.513  -94.098  -17.952 1.00 299.73 ? 22  ALA A CB    1 
ATOM 7005  N N     . VAL M  3 10  ? 35.875  -92.355  -15.493 1.00 323.70 ? 23  VAL A N     1 
ATOM 7006  C CA    . VAL M  3 10  ? 36.337  -92.149  -14.086 1.00 324.49 ? 23  VAL A CA    1 
ATOM 7007  C C     . VAL M  3 10  ? 35.484  -91.049  -13.453 1.00 336.29 ? 23  VAL A C     1 
ATOM 7008  O O     . VAL M  3 10  ? 34.911  -91.233  -12.359 1.00 341.22 ? 23  VAL A O     1 
ATOM 7009  C CB    . VAL M  3 10  ? 37.844  -91.734  -13.973 1.00 313.91 ? 23  VAL A CB    1 
ATOM 7010  C CG1   . VAL M  3 10  ? 38.155  -91.137  -12.611 1.00 304.41 ? 23  VAL A CG1   1 
ATOM 7011  C CG2   . VAL M  3 10  ? 38.778  -92.909  -14.226 1.00 304.32 ? 23  VAL A CG2   1 
ATOM 7012  N N     . HIS M  3 11  ? 35.424  -89.917  -14.170 1.00 344.33 ? 24  HIS A N     1 
ATOM 7013  C CA    . HIS M  3 11  ? 34.578  -88.751  -13.861 1.00 344.80 ? 24  HIS A CA    1 
ATOM 7014  C C     . HIS M  3 11  ? 33.160  -89.253  -13.564 1.00 349.52 ? 24  HIS A C     1 
ATOM 7015  O O     . HIS M  3 11  ? 32.514  -88.764  -12.638 1.00 350.99 ? 24  HIS A O     1 
ATOM 7016  C CB    . HIS M  3 11  ? 34.610  -87.738  -15.044 1.00 334.86 ? 24  HIS A CB    1 
ATOM 7017  C CG    . HIS M  3 11  ? 34.447  -86.274  -14.676 1.00 324.58 ? 24  HIS A CG    1 
ATOM 7018  N ND1   . HIS M  3 11  ? 34.816  -85.724  -13.461 1.00 321.08 ? 24  HIS A ND1   1 
ATOM 7019  C CD2   . HIS M  3 11  ? 33.997  -85.233  -15.424 1.00 320.90 ? 24  HIS A CD2   1 
ATOM 7020  C CE1   . HIS M  3 11  ? 34.557  -84.427  -13.464 1.00 319.06 ? 24  HIS A CE1   1 
ATOM 7021  N NE2   . HIS M  3 11  ? 34.074  -84.101  -14.647 1.00 318.44 ? 24  HIS A NE2   1 
ATOM 7022  N N     . TYR M  3 12  ? 32.707  -90.262  -14.307 1.00 350.71 ? 25  TYR A N     1 
ATOM 7023  C CA    . TYR M  3 12  ? 31.395  -90.852  -14.072 1.00 351.27 ? 25  TYR A CA    1 
ATOM 7024  C C     . TYR M  3 12  ? 31.246  -91.637  -12.762 1.00 335.13 ? 25  TYR A C     1 
ATOM 7025  O O     . TYR M  3 12  ? 30.318  -91.364  -12.003 1.00 340.02 ? 25  TYR A O     1 
ATOM 7026  C CB    . TYR M  3 12  ? 30.968  -91.707  -15.257 1.00 369.62 ? 25  TYR A CB    1 
ATOM 7027  C CG    . TYR M  3 12  ? 29.920  -92.763  -14.933 1.00 390.92 ? 25  TYR A CG    1 
ATOM 7028  C CD1   . TYR M  3 12  ? 28.552  -92.484  -15.041 1.00 404.98 ? 25  TYR A CD1   1 
ATOM 7029  C CD2   . TYR M  3 12  ? 30.294  -94.052  -14.535 1.00 393.61 ? 25  TYR A CD2   1 
ATOM 7030  C CE1   . TYR M  3 12  ? 27.595  -93.459  -14.758 1.00 415.79 ? 25  TYR A CE1   1 
ATOM 7031  C CE2   . TYR M  3 12  ? 29.344  -95.033  -14.245 1.00 404.01 ? 25  TYR A CE2   1 
ATOM 7032  C CZ    . TYR M  3 12  ? 27.996  -94.735  -14.365 1.00 413.44 ? 25  TYR A CZ    1 
ATOM 7033  O OH    . TYR M  3 12  ? 27.059  -95.705  -14.093 1.00 418.76 ? 25  TYR A OH    1 
ATOM 7034  N N     . THR M  3 13  ? 32.135  -92.604  -12.506 1.00 313.32 ? 26  THR A N     1 
ATOM 7035  C CA    . THR M  3 13  ? 31.983  -93.525  -11.367 1.00 297.57 ? 26  THR A CA    1 
ATOM 7036  C C     . THR M  3 13  ? 32.062  -92.767  -10.064 1.00 298.08 ? 26  THR A C     1 
ATOM 7037  O O     . THR M  3 13  ? 31.318  -93.012  -9.110  1.00 296.88 ? 26  THR A O     1 
ATOM 7038  C CB    . THR M  3 13  ? 33.077  -94.599  -11.352 1.00 288.22 ? 26  THR A CB    1 
ATOM 7039  O OG1   . THR M  3 13  ? 33.058  -95.313  -12.588 1.00 285.61 ? 26  THR A OG1   1 
ATOM 7040  C CG2   . THR M  3 13  ? 32.825  -95.578  -10.247 1.00 286.33 ? 26  THR A CG2   1 
ATOM 7041  N N     . VAL M  3 14  ? 32.995  -91.838  -10.041 1.00 302.29 ? 27  VAL A N     1 
ATOM 7042  C CA    . VAL M  3 14  ? 33.165  -90.976  -8.906  1.00 310.58 ? 27  VAL A CA    1 
ATOM 7043  C C     . VAL M  3 14  ? 31.933  -90.048  -8.742  1.00 321.71 ? 27  VAL A C     1 
ATOM 7044  O O     . VAL M  3 14  ? 31.546  -89.734  -7.623  1.00 329.65 ? 27  VAL A O     1 
ATOM 7045  C CB    . VAL M  3 14  ? 34.505  -90.217  -9.010  1.00 307.40 ? 27  VAL A CB    1 
ATOM 7046  C CG1   . VAL M  3 14  ? 34.702  -89.313  -7.806  1.00 306.15 ? 27  VAL A CG1   1 
ATOM 7047  C CG2   . VAL M  3 14  ? 35.668  -91.203  -9.141  1.00 304.56 ? 27  VAL A CG2   1 
ATOM 7048  N N     . GLY M  3 15  ? 31.287  -89.656  -9.843  1.00 326.45 ? 28  GLY A N     1 
ATOM 7049  C CA    . GLY M  3 15  ? 30.071  -88.810  -9.782  1.00 323.29 ? 28  GLY A CA    1 
ATOM 7050  C C     . GLY M  3 15  ? 28.877  -89.484  -9.130  1.00 316.60 ? 28  GLY A C     1 
ATOM 7051  O O     . GLY M  3 15  ? 28.037  -88.837  -8.485  1.00 305.29 ? 28  GLY A O     1 
ATOM 7052  N N     . CYS M  3 16  ? 28.819  -90.798  -9.315  1.00 316.14 ? 29  CYS A N     1 
ATOM 7053  C CA    . CYS M  3 16  ? 27.873  -91.659  -8.631  1.00 314.81 ? 29  CYS A CA    1 
ATOM 7054  C C     . CYS M  3 16  ? 28.033  -91.510  -7.136  1.00 303.68 ? 29  CYS A C     1 
ATOM 7055  O O     . CYS M  3 16  ? 27.083  -91.158  -6.439  1.00 297.77 ? 29  CYS A O     1 
ATOM 7056  C CB    . CYS M  3 16  ? 28.123  -93.126  -8.981  1.00 320.81 ? 29  CYS A CB    1 
ATOM 7057  S SG    . CYS M  3 16  ? 27.937  -93.541  -10.723 1.00 328.29 ? 29  CYS A SG    1 
ATOM 7058  N N     . LEU M  3 17  ? 29.239  -91.804  -6.651  1.00 294.14 ? 30  LEU A N     1 
ATOM 7059  C CA    . LEU M  3 17  ? 29.528  -91.786  -5.218  1.00 286.76 ? 30  LEU A CA    1 
ATOM 7060  C C     . LEU M  3 17  ? 29.320  -90.425  -4.544  1.00 286.36 ? 30  LEU A C     1 
ATOM 7061  O O     . LEU M  3 17  ? 28.881  -90.376  -3.393  1.00 288.00 ? 30  LEU A O     1 
ATOM 7062  C CB    . LEU M  3 17  ? 30.923  -92.354  -4.921  1.00 277.47 ? 30  LEU A CB    1 
ATOM 7063  C CG    . LEU M  3 17  ? 31.174  -93.851  -5.154  1.00 270.24 ? 30  LEU A CG    1 
ATOM 7064  C CD1   . LEU M  3 17  ? 32.487  -94.239  -4.502  1.00 263.11 ? 30  LEU A CD1   1 
ATOM 7065  C CD2   . LEU M  3 17  ? 30.059  -94.750  -4.639  1.00 272.33 ? 30  LEU A CD2   1 
ATOM 7066  N N     . CYS M  3 18  ? 29.596  -89.334  -5.264  1.00 285.82 ? 31  CYS A N     1 
ATOM 7067  C CA    . CYS M  3 18  ? 29.455  -87.968  -4.716  1.00 288.27 ? 31  CYS A CA    1 
ATOM 7068  C C     . CYS M  3 18  ? 28.014  -87.523  -4.517  1.00 291.42 ? 31  CYS A C     1 
ATOM 7069  O O     . CYS M  3 18  ? 27.699  -86.751  -3.610  1.00 289.27 ? 31  CYS A O     1 
ATOM 7070  C CB    . CYS M  3 18  ? 30.186  -86.962  -5.590  1.00 292.38 ? 31  CYS A CB    1 
ATOM 7071  S SG    . CYS M  3 18  ? 31.972  -86.980  -5.339  1.00 303.98 ? 31  CYS A SG    1 
ATOM 7072  N N     . GLU M  3 19  ? 27.150  -88.016  -5.384  1.00 302.52 ? 32  GLU A N     1 
ATOM 7073  C CA    . GLU M  3 19  ? 25.730  -87.887  -5.185  1.00 329.35 ? 32  GLU A CA    1 
ATOM 7074  C C     . GLU M  3 19  ? 25.185  -88.708  -4.009  1.00 343.29 ? 32  GLU A C     1 
ATOM 7075  O O     . GLU M  3 19  ? 24.317  -88.235  -3.287  1.00 358.60 ? 32  GLU A O     1 
ATOM 7076  C CB    . GLU M  3 19  ? 25.009  -88.257  -6.475  1.00 338.65 ? 32  GLU A CB    1 
ATOM 7077  C CG    . GLU M  3 19  ? 24.482  -87.041  -7.207  1.00 356.28 ? 32  GLU A CG    1 
ATOM 7078  C CD    . GLU M  3 19  ? 23.354  -86.376  -6.441  1.00 373.14 ? 32  GLU A CD    1 
ATOM 7079  O OE1   . GLU M  3 19  ? 22.282  -87.005  -6.324  1.00 381.43 ? 32  GLU A OE1   1 
ATOM 7080  O OE2   . GLU M  3 19  ? 23.544  -85.241  -5.945  1.00 381.47 ? 32  GLU A OE2   1 
ATOM 7081  N N     . GLU M  3 20  ? 25.669  -89.940  -3.828  1.00 348.41 ? 33  GLU A N     1 
ATOM 7082  C CA    . GLU M  3 20  ? 25.284  -90.764  -2.664  1.00 356.12 ? 33  GLU A CA    1 
ATOM 7083  C C     . GLU M  3 20  ? 25.735  -90.150  -1.332  1.00 362.53 ? 33  GLU A C     1 
ATOM 7084  O O     . GLU M  3 20  ? 25.121  -90.388  -0.286  1.00 370.14 ? 33  GLU A O     1 
ATOM 7085  C CB    . GLU M  3 20  ? 25.837  -92.180  -2.785  1.00 346.60 ? 33  GLU A CB    1 
ATOM 7086  C CG    . GLU M  3 20  ? 24.932  -93.158  -3.513  1.00 337.79 ? 33  GLU A CG    1 
ATOM 7087  C CD    . GLU M  3 20  ? 25.511  -94.563  -3.561  1.00 330.03 ? 33  GLU A CD    1 
ATOM 7088  O OE1   . GLU M  3 20  ? 26.301  -94.929  -2.657  1.00 329.33 ? 33  GLU A OE1   1 
ATOM 7089  O OE2   . GLU M  3 20  ? 25.178  -95.320  -4.504  1.00 322.24 ? 33  GLU A OE2   1 
ATOM 7090  N N     . VAL M  3 21  ? 26.821  -89.379  -1.385  1.00 360.18 ? 34  VAL A N     1 
ATOM 7091  C CA    . VAL M  3 21  ? 27.254  -88.530  -0.273  1.00 355.29 ? 34  VAL A CA    1 
ATOM 7092  C C     . VAL M  3 21  ? 26.259  -87.354  -0.094  1.00 352.59 ? 34  VAL A C     1 
ATOM 7093  O O     . VAL M  3 21  ? 25.908  -87.018  1.051   1.00 352.43 ? 34  VAL A O     1 
ATOM 7094  C CB    . VAL M  3 21  ? 28.727  -88.050  -0.442  1.00 353.06 ? 34  VAL A CB    1 
ATOM 7095  C CG1   . VAL M  3 21  ? 29.126  -87.100  0.677   1.00 349.68 ? 34  VAL A CG1   1 
ATOM 7096  C CG2   . VAL M  3 21  ? 29.694  -89.231  -0.457  1.00 353.26 ? 34  VAL A CG2   1 
ATOM 7097  N N     . ALA M  3 22  ? 25.788  -86.768  -1.211  1.00 345.44 ? 35  ALA A N     1 
ATOM 7098  C CA    . ALA M  3 22  ? 24.769  -85.683  -1.190  1.00 337.98 ? 35  ALA A CA    1 
ATOM 7099  C C     . ALA M  3 22  ? 23.424  -86.098  -0.547  1.00 340.60 ? 35  ALA A C     1 
ATOM 7100  O O     . ALA M  3 22  ? 22.663  -85.238  -0.098  1.00 333.37 ? 35  ALA A O     1 
ATOM 7101  C CB    . ALA M  3 22  ? 24.571  -85.073  -2.588  1.00 335.26 ? 35  ALA A CB    1 
ATOM 7102  N N     . LEU M  3 23  ? 23.169  -87.415  -0.493  1.00 348.13 ? 36  LEU A N     1 
ATOM 7103  C CA    . LEU M  3 23  ? 22.033  -88.038  0.235   1.00 354.04 ? 36  LEU A CA    1 
ATOM 7104  C C     . LEU M  3 23  ? 22.199  -88.087  1.776   1.00 355.03 ? 36  LEU A C     1 
ATOM 7105  O O     . LEU M  3 23  ? 21.280  -87.698  2.509   1.00 367.14 ? 36  LEU A O     1 
ATOM 7106  C CB    . LEU M  3 23  ? 21.771  -89.490  -0.259  1.00 351.34 ? 36  LEU A CB    1 
ATOM 7107  C CG    . LEU M  3 23  ? 20.714  -89.971  -1.268  1.00 350.25 ? 36  LEU A CG    1 
ATOM 7108  C CD1   . LEU M  3 23  ? 21.074  -89.560  -2.690  1.00 347.66 ? 36  LEU A CD1   1 
ATOM 7109  C CD2   . LEU M  3 23  ? 20.580  -91.487  -1.192  1.00 348.00 ? 36  LEU A CD2   1 
ATOM 7110  N N     . ASP M  3 24  ? 23.353  -88.583  2.246   1.00 341.44 ? 37  ASP A N     1 
ATOM 7111  C CA    . ASP M  3 24  ? 23.595  -88.977  3.655   1.00 323.48 ? 37  ASP A CA    1 
ATOM 7112  C C     . ASP M  3 24  ? 23.550  -87.826  4.665   1.00 316.92 ? 37  ASP A C     1 
ATOM 7113  O O     . ASP M  3 24  ? 22.885  -87.916  5.711   1.00 317.06 ? 37  ASP A O     1 
ATOM 7114  C CB    . ASP M  3 24  ? 24.931  -89.746  3.758   1.00 311.25 ? 37  ASP A CB    1 
ATOM 7115  C CG    . ASP M  3 24  ? 25.381  -89.956  5.187   1.00 304.56 ? 37  ASP A CG    1 
ATOM 7116  O OD1   . ASP M  3 24  ? 24.579  -90.458  5.995   1.00 307.81 ? 37  ASP A OD1   1 
ATOM 7117  O OD2   . ASP M  3 24  ? 26.539  -89.615  5.506   1.00 295.49 ? 37  ASP A OD2   1 
ATOM 7118  N N     . LYS M  3 25  ? 24.259  -86.752  4.335   1.00 303.75 ? 38  LYS A N     1 
ATOM 7119  C CA    . LYS M  3 25  ? 24.294  -85.569  5.161   1.00 293.40 ? 38  LYS A CA    1 
ATOM 7120  C C     . LYS M  3 25  ? 23.384  -84.470  4.622   1.00 297.95 ? 38  LYS A C     1 
ATOM 7121  O O     . LYS M  3 25  ? 23.188  -83.456  5.290   1.00 297.77 ? 38  LYS A O     1 
ATOM 7122  C CB    . LYS M  3 25  ? 25.745  -85.098  5.336   1.00 279.78 ? 38  LYS A CB    1 
ATOM 7123  C CG    . LYS M  3 25  ? 26.550  -85.997  6.275   1.00 271.50 ? 38  LYS A CG    1 
ATOM 7124  C CD    . LYS M  3 25  ? 25.953  -85.980  7.672   1.00 272.28 ? 38  LYS A CD    1 
ATOM 7125  C CE    . LYS M  3 25  ? 26.076  -87.323  8.373   1.00 274.14 ? 38  LYS A CE    1 
ATOM 7126  N NZ    . LYS M  3 25  ? 24.915  -87.509  9.270   1.00 282.23 ? 38  LYS A NZ    1 
ATOM 7127  N N     . ALA M  3 26  ? 22.840  -84.684  3.416   1.00 300.98 ? 39  ALA A N     1 
ATOM 7128  C CA    . ALA M  3 26  ? 21.862  -83.795  2.751   1.00 301.05 ? 39  ALA A CA    1 
ATOM 7129  C C     . ALA M  3 26  ? 22.432  -82.440  2.327   1.00 297.63 ? 39  ALA A C     1 
ATOM 7130  O O     . ALA M  3 26  ? 21.923  -81.372  2.711   1.00 297.49 ? 39  ALA A O     1 
ATOM 7131  C CB    . ALA M  3 26  ? 20.602  -83.630  3.592   1.00 303.40 ? 39  ALA A CB    1 
ATOM 7132  N N     . MET M  3 27  ? 23.498  -82.510  1.530   1.00 291.83 ? 40  MET A N     1 
ATOM 7133  C CA    . MET M  3 27  ? 24.229  -81.336  1.027   1.00 286.97 ? 40  MET A CA    1 
ATOM 7134  C C     . MET M  3 27  ? 25.294  -81.807  0.042   1.00 287.38 ? 40  MET A C     1 
ATOM 7135  O O     . MET M  3 27  ? 25.881  -82.873  0.217   1.00 283.02 ? 40  MET A O     1 
ATOM 7136  C CB    . MET M  3 27  ? 24.906  -80.560  2.164   1.00 276.75 ? 40  MET A CB    1 
ATOM 7137  C CG    . MET M  3 27  ? 25.014  -79.057  1.934   1.00 265.31 ? 40  MET A CG    1 
ATOM 7138  S SD    . MET M  3 27  ? 23.919  -78.114  3.016   1.00 258.79 ? 40  MET A SD    1 
ATOM 7139  C CE    . MET M  3 27  ? 22.360  -78.189  2.119   1.00 265.61 ? 40  MET A CE    1 
ATOM 7140  N N     . GLN M  3 28  ? 25.572  -80.980  -0.960  1.00 295.20 ? 41  GLN A N     1 
ATOM 7141  C CA    . GLN M  3 28  ? 26.270  -81.425  -2.174  1.00 304.25 ? 41  GLN A CA    1 
ATOM 7142  C C     . GLN M  3 28  ? 27.670  -80.786  -2.380  1.00 308.91 ? 41  GLN A C     1 
ATOM 7143  O O     . GLN M  3 28  ? 28.149  -80.006  -1.532  1.00 310.05 ? 41  GLN A O     1 
ATOM 7144  C CB    . GLN M  3 28  ? 25.337  -81.238  -3.404  1.00 310.03 ? 41  GLN A CB    1 
ATOM 7145  C CG    . GLN M  3 28  ? 25.102  -79.784  -3.876  1.00 316.06 ? 41  GLN A CG    1 
ATOM 7146  C CD    . GLN M  3 28  ? 24.011  -79.001  -3.131  1.00 322.52 ? 41  GLN A CD    1 
ATOM 7147  O OE1   . GLN M  3 28  ? 22.806  -79.245  -3.299  1.00 332.79 ? 41  GLN A OE1   1 
ATOM 7148  N NE2   . GLN M  3 28  ? 24.434  -78.013  -2.337  1.00 319.60 ? 41  GLN A NE2   1 
ATOM 7149  N N     . PHE M  3 29  ? 28.302  -81.133  -3.506  1.00 317.38 ? 42  PHE A N     1 
ATOM 7150  C CA    . PHE M  3 29  ? 29.581  -80.560  -3.911  1.00 320.74 ? 42  PHE A CA    1 
ATOM 7151  C C     . PHE M  3 29  ? 29.505  -79.655  -5.131  1.00 312.41 ? 42  PHE A C     1 
ATOM 7152  O O     . PHE M  3 29  ? 28.602  -79.769  -5.969  1.00 312.51 ? 42  PHE A O     1 
ATOM 7153  C CB    . PHE M  3 29  ? 30.577  -81.666  -4.226  1.00 340.83 ? 42  PHE A CB    1 
ATOM 7154  C CG    . PHE M  3 29  ? 30.837  -82.615  -3.089  1.00 370.11 ? 42  PHE A CG    1 
ATOM 7155  C CD1   . PHE M  3 29  ? 31.163  -82.157  -1.809  1.00 379.66 ? 42  PHE A CD1   1 
ATOM 7156  C CD2   . PHE M  3 29  ? 30.816  -83.988  -3.314  1.00 389.95 ? 42  PHE A CD2   1 
ATOM 7157  C CE1   . PHE M  3 29  ? 31.427  -83.064  -0.775  1.00 393.35 ? 42  PHE A CE1   1 
ATOM 7158  C CE2   . PHE M  3 29  ? 31.087  -84.898  -2.292  1.00 404.61 ? 42  PHE A CE2   1 
ATOM 7159  C CZ    . PHE M  3 29  ? 31.395  -84.430  -1.018  1.00 402.31 ? 42  PHE A CZ    1 
ATOM 7160  N N     . SER M  3 30  ? 30.500  -78.776  -5.214  1.00 302.30 ? 43  SER A N     1 
ATOM 7161  C CA    . SER M  3 30  ? 30.719  -77.914  -6.360  1.00 305.97 ? 43  SER A CA    1 
ATOM 7162  C C     . SER M  3 30  ? 31.219  -78.716  -7.584  1.00 315.67 ? 43  SER A C     1 
ATOM 7163  O O     . SER M  3 30  ? 31.787  -79.809  -7.432  1.00 313.12 ? 43  SER A O     1 
ATOM 7164  C CB    . SER M  3 30  ? 31.704  -76.813  -5.976  1.00 294.13 ? 43  SER A CB    1 
ATOM 7165  O OG    . SER M  3 30  ? 32.991  -77.351  -5.771  1.00 279.70 ? 43  SER A OG    1 
ATOM 7166  N N     . LYS M  3 31  ? 30.988  -78.170  -8.783  1.00 329.10 ? 44  LYS A N     1 
ATOM 7167  C CA    . LYS M  3 31  ? 31.352  -78.792  -10.083 1.00 331.38 ? 44  LYS A CA    1 
ATOM 7168  C C     . LYS M  3 31  ? 32.854  -79.104  -10.239 1.00 340.83 ? 44  LYS A C     1 
ATOM 7169  O O     . LYS M  3 31  ? 33.274  -80.200  -10.714 1.00 342.21 ? 44  LYS A O     1 
ATOM 7170  C CB    . LYS M  3 31  ? 30.873  -77.877  -11.219 1.00 321.23 ? 44  LYS A CB    1 
ATOM 7171  C CG    . LYS M  3 31  ? 30.439  -78.601  -12.484 1.00 310.27 ? 44  LYS A CG    1 
ATOM 7172  C CD    . LYS M  3 31  ? 29.464  -79.754  -12.232 1.00 300.25 ? 44  LYS A CD    1 
ATOM 7173  C CE    . LYS M  3 31  ? 28.234  -79.339  -11.440 1.00 293.43 ? 44  LYS A CE    1 
ATOM 7174  N NZ    . LYS M  3 31  ? 27.588  -80.489  -10.755 1.00 282.70 ? 44  LYS A NZ    1 
ATOM 7175  N N     . GLN M  3 32  ? 33.648  -78.123  -9.815  1.00 350.60 ? 45  GLN A N     1 
ATOM 7176  C CA    . GLN M  3 32  ? 35.109  -78.217  -9.803  1.00 351.56 ? 45  GLN A CA    1 
ATOM 7177  C C     . GLN M  3 32  ? 35.586  -79.249  -8.776  1.00 345.56 ? 45  GLN A C     1 
ATOM 7178  O O     . GLN M  3 32  ? 36.564  -79.933  -9.030  1.00 344.82 ? 45  GLN A O     1 
ATOM 7179  C CB    . GLN M  3 32  ? 35.780  -76.861  -9.542  1.00 357.20 ? 45  GLN A CB    1 
ATOM 7180  C CG    . GLN M  3 32  ? 34.985  -75.644  -9.986  1.00 366.18 ? 45  GLN A CG    1 
ATOM 7181  C CD    . GLN M  3 32  ? 33.992  -75.218  -8.929  1.00 370.87 ? 45  GLN A CD    1 
ATOM 7182  O OE1   . GLN M  3 32  ? 32.825  -75.625  -8.956  1.00 376.99 ? 45  GLN A OE1   1 
ATOM 7183  N NE2   . GLN M  3 32  ? 34.459  -74.429  -7.965  1.00 370.69 ? 45  GLN A NE2   1 
ATOM 7184  N N     . THR M  3 33  ? 34.910  -79.360  -7.629  1.00 338.47 ? 46  THR A N     1 
ATOM 7185  C CA    . THR M  3 33  ? 35.159  -80.462  -6.689  1.00 326.54 ? 46  THR A CA    1 
ATOM 7186  C C     . THR M  3 33  ? 34.999  -81.876  -7.334  1.00 320.04 ? 46  THR A C     1 
ATOM 7187  O O     . THR M  3 33  ? 35.848  -82.754  -7.132  1.00 322.04 ? 46  THR A O     1 
ATOM 7188  C CB    . THR M  3 33  ? 34.287  -80.313  -5.422  1.00 323.12 ? 46  THR A CB    1 
ATOM 7189  O OG1   . THR M  3 33  ? 34.509  -79.025  -4.836  1.00 316.97 ? 46  THR A OG1   1 
ATOM 7190  C CG2   . THR M  3 33  ? 34.618  -81.374  -4.407  1.00 326.10 ? 46  THR A CG2   1 
ATOM 7191  N N     . ILE M  3 34  ? 33.929  -82.083  -8.111  1.00 311.65 ? 47  ILE A N     1 
ATOM 7192  C CA    . ILE M  3 34  ? 33.675  -83.358  -8.815  1.00 302.41 ? 47  ILE A CA    1 
ATOM 7193  C C     . ILE M  3 34  ? 34.814  -83.661  -9.754  1.00 305.61 ? 47  ILE A C     1 
ATOM 7194  O O     . ILE M  3 34  ? 35.411  -84.749  -9.720  1.00 297.29 ? 47  ILE A O     1 
ATOM 7195  C CB    . ILE M  3 34  ? 32.416  -83.286  -9.696  1.00 301.31 ? 47  ILE A CB    1 
ATOM 7196  C CG1   . ILE M  3 34  ? 31.171  -82.918  -8.877  1.00 300.61 ? 47  ILE A CG1   1 
ATOM 7197  C CG2   . ILE M  3 34  ? 32.256  -84.566  -10.509 1.00 299.19 ? 47  ILE A CG2   1 
ATOM 7198  C CD1   . ILE M  3 34  ? 30.905  -83.799  -7.676  1.00 296.47 ? 47  ILE A CD1   1 
ATOM 7199  N N     . ALA M  3 35  ? 35.085  -82.670  -10.598 1.00 319.38 ? 48  ALA A N     1 
ATOM 7200  C CA    . ALA M  3 35  ? 36.238  -82.673  -11.462 1.00 333.57 ? 48  ALA A CA    1 
ATOM 7201  C C     . ALA M  3 35  ? 37.553  -82.954  -10.697 1.00 339.63 ? 48  ALA A C     1 
ATOM 7202  O O     . ALA M  3 35  ? 38.343  -83.807  -11.134 1.00 347.08 ? 48  ALA A O     1 
ATOM 7203  C CB    . ALA M  3 35  ? 36.311  -81.373  -12.261 1.00 334.56 ? 48  ALA A CB    1 
ATOM 7204  N N     . ALA M  3 36  ? 37.755  -82.278  -9.551  1.00 339.68 ? 49  ALA A N     1 
ATOM 7205  C CA    . ALA M  3 36  ? 39.031  -82.326  -8.793  1.00 334.56 ? 49  ALA A CA    1 
ATOM 7206  C C     . ALA M  3 36  ? 39.330  -83.699  -8.216  1.00 336.05 ? 49  ALA A C     1 
ATOM 7207  O O     . ALA M  3 36  ? 40.498  -84.088  -8.151  1.00 324.61 ? 49  ALA A O     1 
ATOM 7208  C CB    . ALA M  3 36  ? 39.066  -81.278  -7.685  1.00 327.08 ? 49  ALA A CB    1 
ATOM 7209  N N     . ILE M  3 37  ? 38.279  -84.413  -7.793  1.00 352.86 ? 50  ILE A N     1 
ATOM 7210  C CA    . ILE M  3 37  ? 38.432  -85.796  -7.315  1.00 371.31 ? 50  ILE A CA    1 
ATOM 7211  C C     . ILE M  3 37  ? 38.740  -86.758  -8.468  1.00 378.55 ? 50  ILE A C     1 
ATOM 7212  O O     . ILE M  3 37  ? 39.525  -87.693  -8.278  1.00 390.90 ? 50  ILE A O     1 
ATOM 7213  C CB    . ILE M  3 37  ? 37.233  -86.342  -6.488  1.00 377.09 ? 50  ILE A CB    1 
ATOM 7214  C CG1   . ILE M  3 37  ? 36.881  -85.408  -5.337  1.00 387.09 ? 50  ILE A CG1   1 
ATOM 7215  C CG2   . ILE M  3 37  ? 37.582  -87.688  -5.858  1.00 376.02 ? 50  ILE A CG2   1 
ATOM 7216  C CD1   . ILE M  3 37  ? 35.633  -85.813  -4.581  1.00 390.51 ? 50  ILE A CD1   1 
ATOM 7217  N N     . SER M  3 38  ? 38.132  -86.533  -9.645  1.00 377.72 ? 51  SER A N     1 
ATOM 7218  C CA    . SER M  3 38  ? 38.354  -87.390  -10.846 1.00 364.47 ? 51  SER A CA    1 
ATOM 7219  C C     . SER M  3 38  ? 39.797  -87.330  -11.357 1.00 356.45 ? 51  SER A C     1 
ATOM 7220  O O     . SER M  3 38  ? 40.448  -88.365  -11.590 1.00 344.39 ? 51  SER A O     1 
ATOM 7221  C CB    . SER M  3 38  ? 37.377  -87.040  -11.966 1.00 364.22 ? 51  SER A CB    1 
ATOM 7222  O OG    . SER M  3 38  ? 36.040  -87.134  -11.503 1.00 363.98 ? 51  SER A OG    1 
ATOM 7223  N N     . GLU M  3 39  ? 40.277  -86.096  -11.497 1.00 360.75 ? 52  GLU A N     1 
ATOM 7224  C CA    . GLU M  3 39  ? 41.681  -85.775  -11.715 1.00 368.18 ? 52  GLU A CA    1 
ATOM 7225  C C     . GLU M  3 39  ? 42.578  -86.371  -10.629 1.00 357.79 ? 52  GLU A C     1 
ATOM 7226  O O     . GLU M  3 39  ? 43.575  -86.999  -10.942 1.00 363.36 ? 52  GLU A O     1 
ATOM 7227  C CB    . GLU M  3 39  ? 41.871  -84.254  -11.721 1.00 395.10 ? 52  GLU A CB    1 
ATOM 7228  C CG    . GLU M  3 39  ? 41.349  -83.515  -12.961 1.00 433.15 ? 52  GLU A CG    1 
ATOM 7229  C CD    . GLU M  3 39  ? 41.065  -82.018  -12.728 1.00 458.07 ? 52  GLU A CD    1 
ATOM 7230  O OE1   . GLU M  3 39  ? 41.702  -81.402  -11.833 1.00 457.37 ? 52  GLU A OE1   1 
ATOM 7231  O OE2   . GLU M  3 39  ? 40.194  -81.453  -13.443 1.00 460.44 ? 52  GLU A OE2   1 
ATOM 7232  N N     . LEU M  3 40  ? 42.222  -86.165  -9.360  1.00 345.38 ? 53  LEU A N     1 
ATOM 7233  C CA    . LEU M  3 40  ? 43.050  -86.591  -8.222  1.00 336.99 ? 53  LEU A CA    1 
ATOM 7234  C C     . LEU M  3 40  ? 43.304  -88.097  -8.174  1.00 334.31 ? 53  LEU A C     1 
ATOM 7235  O O     . LEU M  3 40  ? 44.406  -88.549  -7.841  1.00 327.27 ? 53  LEU A O     1 
ATOM 7236  C CB    . LEU M  3 40  ? 42.390  -86.173  -6.912  1.00 336.62 ? 53  LEU A CB    1 
ATOM 7237  C CG    . LEU M  3 40  ? 43.302  -85.951  -5.708  1.00 335.09 ? 53  LEU A CG    1 
ATOM 7238  C CD1   . LEU M  3 40  ? 43.606  -84.466  -5.557  1.00 332.60 ? 53  LEU A CD1   1 
ATOM 7239  C CD2   . LEU M  3 40  ? 42.666  -86.509  -4.452  1.00 340.06 ? 53  LEU A CD2   1 
ATOM 7240  N N     . THR M  3 41  ? 42.265  -88.870  -8.477  1.00 336.17 ? 54  THR A N     1 
ATOM 7241  C CA    . THR M  3 41  ? 42.374  -90.323  -8.442  1.00 332.23 ? 54  THR A CA    1 
ATOM 7242  C C     . THR M  3 41  ? 43.203  -90.791  -9.617  1.00 331.57 ? 54  THR A C     1 
ATOM 7243  O O     . THR M  3 41  ? 43.976  -91.714  -9.469  1.00 325.84 ? 54  THR A O     1 
ATOM 7244  C CB    . THR M  3 41  ? 41.018  -91.060  -8.474  1.00 331.78 ? 54  THR A CB    1 
ATOM 7245  O OG1   . THR M  3 41  ? 40.129  -90.508  -7.494  1.00 336.96 ? 54  THR A OG1   1 
ATOM 7246  C CG2   . THR M  3 41  ? 41.222  -92.560  -8.186  1.00 325.82 ? 54  THR A CG2   1 
ATOM 7247  N N     . PHE M  3 42  ? 43.024  -90.149  -10.772 1.00 335.32 ? 55  PHE A N     1 
ATOM 7248  C CA    . PHE M  3 42  ? 43.812  -90.402  -11.985 1.00 338.26 ? 55  PHE A CA    1 
ATOM 7249  C C     . PHE M  3 42  ? 45.307  -90.251  -11.712 1.00 347.01 ? 55  PHE A C     1 
ATOM 7250  O O     . PHE M  3 42  ? 46.106  -91.105  -12.090 1.00 351.11 ? 55  PHE A O     1 
ATOM 7251  C CB    . PHE M  3 42  ? 43.352  -89.425  -13.067 1.00 329.24 ? 55  PHE A CB    1 
ATOM 7252  C CG    . PHE M  3 42  ? 44.030  -89.589  -14.391 1.00 318.27 ? 55  PHE A CG    1 
ATOM 7253  C CD1   . PHE M  3 42  ? 43.529  -90.495  -15.329 1.00 310.39 ? 55  PHE A CD1   1 
ATOM 7254  C CD2   . PHE M  3 42  ? 45.122  -88.786  -14.737 1.00 315.80 ? 55  PHE A CD2   1 
ATOM 7255  C CE1   . PHE M  3 42  ? 44.125  -90.618  -16.573 1.00 305.26 ? 55  PHE A CE1   1 
ATOM 7256  C CE2   . PHE M  3 42  ? 45.724  -88.909  -15.974 1.00 308.09 ? 55  PHE A CE2   1 
ATOM 7257  C CZ    . PHE M  3 42  ? 45.218  -89.816  -16.893 1.00 305.01 ? 55  PHE A CZ    1 
ATOM 7258  N N     . ARG M  3 43  ? 45.662  -89.165  -11.030 1.00 351.96 ? 56  ARG A N     1 
ATOM 7259  C CA    . ARG M  3 43  ? 47.025  -88.917  -10.583 1.00 347.87 ? 56  ARG A CA    1 
ATOM 7260  C C     . ARG M  3 43  ? 47.414  -89.926  -9.516  1.00 325.26 ? 56  ARG A C     1 
ATOM 7261  O O     . ARG M  3 43  ? 48.569  -90.322  -9.420  1.00 320.10 ? 56  ARG A O     1 
ATOM 7262  C CB    . ARG M  3 43  ? 47.150  -87.507  -9.998  1.00 368.56 ? 56  ARG A CB    1 
ATOM 7263  C CG    . ARG M  3 43  ? 46.556  -86.365  -10.834 1.00 396.27 ? 56  ARG A CG    1 
ATOM 7264  C CD    . ARG M  3 43  ? 46.828  -85.008  -10.190 1.00 416.81 ? 56  ARG A CD    1 
ATOM 7265  N NE    . ARG M  3 43  ? 46.009  -83.869  -10.640 1.00 440.55 ? 56  ARG A NE    1 
ATOM 7266  C CZ    . ARG M  3 43  ? 45.066  -83.260  -9.909  1.00 445.50 ? 56  ARG A CZ    1 
ATOM 7267  N NH1   . ARG M  3 43  ? 44.767  -83.688  -8.689  1.00 442.26 ? 56  ARG A NH1   1 
ATOM 7268  N NH2   . ARG M  3 43  ? 44.405  -82.220  -10.407 1.00 454.44 ? 56  ARG A NH2   1 
ATOM 7269  N N     . GLN M  3 44  ? 46.435  -90.330  -8.715  1.00 304.14 ? 57  GLN A N     1 
ATOM 7270  C CA    . GLN M  3 44  ? 46.642  -91.301  -7.665  1.00 291.61 ? 57  GLN A CA    1 
ATOM 7271  C C     . GLN M  3 44  ? 46.892  -92.685  -8.238  1.00 297.36 ? 57  GLN A C     1 
ATOM 7272  O O     . GLN M  3 44  ? 47.586  -93.502  -7.630  1.00 289.00 ? 57  GLN A O     1 
ATOM 7273  C CB    . GLN M  3 44  ? 45.424  -91.339  -6.746  1.00 280.30 ? 57  GLN A CB    1 
ATOM 7274  C CG    . GLN M  3 44  ? 45.695  -91.982  -5.401  1.00 273.55 ? 57  GLN A CG    1 
ATOM 7275  C CD    . GLN M  3 44  ? 46.779  -91.260  -4.630  1.00 271.03 ? 57  GLN A CD    1 
ATOM 7276  O OE1   . GLN M  3 44  ? 47.011  -90.074  -4.846  1.00 268.91 ? 57  GLN A OE1   1 
ATOM 7277  N NE2   . GLN M  3 44  ? 47.452  -91.971  -3.728  1.00 268.87 ? 57  GLN A NE2   1 
ATOM 7278  N N     . CYS M  3 45  ? 46.315  -92.942  -9.410  1.00 316.02 ? 58  CYS A N     1 
ATOM 7279  C CA    . CYS M  3 45  ? 46.468  -94.226  -10.114 1.00 337.11 ? 58  CYS A CA    1 
ATOM 7280  C C     . CYS M  3 45  ? 47.907  -94.442  -10.592 1.00 339.93 ? 58  CYS A C     1 
ATOM 7281  O O     . CYS M  3 45  ? 48.342  -95.584  -10.758 1.00 349.17 ? 58  CYS A O     1 
ATOM 7282  C CB    . CYS M  3 45  ? 45.455  -94.381  -11.272 1.00 352.45 ? 58  CYS A CB    1 
ATOM 7283  S SG    . CYS M  3 45  ? 43.803  -95.025  -10.825 1.00 379.61 ? 58  CYS A SG    1 
ATOM 7284  N N     . GLU M  3 46  ? 48.622  -93.334  -10.795 1.00 334.07 ? 59  GLU A N     1 
ATOM 7285  C CA    . GLU M  3 46  ? 50.062  -93.327  -11.044 1.00 323.83 ? 59  GLU A CA    1 
ATOM 7286  C C     . GLU M  3 46  ? 50.787  -93.931  -9.828  1.00 309.23 ? 59  GLU A C     1 
ATOM 7287  O O     . GLU M  3 46  ? 51.555  -94.893  -9.961  1.00 313.19 ? 59  GLU A O     1 
ATOM 7288  C CB    . GLU M  3 46  ? 50.533  -91.886  -11.366 1.00 330.48 ? 59  GLU A CB    1 
ATOM 7289  C CG    . GLU M  3 46  ? 51.929  -91.751  -11.990 1.00 340.82 ? 59  GLU A CG    1 
ATOM 7290  C CD    . GLU M  3 46  ? 52.026  -90.770  -13.171 1.00 347.37 ? 59  GLU A CD    1 
ATOM 7291  O OE1   . GLU M  3 46  ? 51.048  -90.040  -13.438 1.00 347.69 ? 59  GLU A OE1   1 
ATOM 7292  O OE2   . GLU M  3 46  ? 53.080  -90.763  -13.846 1.00 354.09 ? 59  GLU A OE2   1 
ATOM 7293  N N     . ASN M  3 47  ? 50.490  -93.391  -8.650  1.00 286.61 ? 60  ASN A N     1 
ATOM 7294  C CA    . ASN M  3 47  ? 51.022  -93.893  -7.395  1.00 271.89 ? 60  ASN A CA    1 
ATOM 7295  C C     . ASN M  3 47  ? 50.694  -95.363  -7.142  1.00 271.55 ? 60  ASN A C     1 
ATOM 7296  O O     . ASN M  3 47  ? 51.602  -96.149  -6.863  1.00 276.46 ? 60  ASN A O     1 
ATOM 7297  C CB    . ASN M  3 47  ? 50.602  -92.956  -6.265  1.00 259.47 ? 60  ASN A CB    1 
ATOM 7298  C CG    . ASN M  3 47  ? 50.911  -91.500  -6.589  1.00 255.50 ? 60  ASN A CG    1 
ATOM 7299  O OD1   . ASN M  3 47  ? 51.895  -91.195  -7.272  1.00 250.68 ? 60  ASN A OD1   1 
ATOM 7300  N ND2   . ASN M  3 47  ? 50.059  -90.596  -6.122  1.00 254.55 ? 60  ASN A ND2   1 
ATOM 7301  N N     . PHE M  3 48  ? 49.426  -95.745  -7.312  1.00 267.29 ? 61  PHE A N     1 
ATOM 7302  C CA    . PHE M  3 48  ? 49.003  -97.160  -7.236  1.00 265.06 ? 61  PHE A CA    1 
ATOM 7303  C C     . PHE M  3 48  ? 49.835  -98.083  -8.121  1.00 268.53 ? 61  PHE A C     1 
ATOM 7304  O O     . PHE M  3 48  ? 50.440  -99.028  -7.630  1.00 260.90 ? 61  PHE A O     1 
ATOM 7305  C CB    . PHE M  3 48  ? 47.539  -97.373  -7.651  1.00 261.86 ? 61  PHE A CB    1 
ATOM 7306  C CG    . PHE M  3 48  ? 46.518  -96.654  -6.802  1.00 265.49 ? 61  PHE A CG    1 
ATOM 7307  C CD1   . PHE M  3 48  ? 46.726  -96.403  -5.447  1.00 268.93 ? 61  PHE A CD1   1 
ATOM 7308  C CD2   . PHE M  3 48  ? 45.304  -96.259  -7.367  1.00 267.04 ? 61  PHE A CD2   1 
ATOM 7309  C CE1   . PHE M  3 48  ? 45.754  -95.746  -4.693  1.00 272.82 ? 61  PHE A CE1   1 
ATOM 7310  C CE2   . PHE M  3 48  ? 44.334  -95.603  -6.619  1.00 269.49 ? 61  PHE A CE2   1 
ATOM 7311  C CZ    . PHE M  3 48  ? 44.556  -95.351  -5.276  1.00 271.84 ? 61  PHE A CZ    1 
ATOM 7312  N N     . ALA M  3 49  ? 49.834  -97.811  -9.427  1.00 281.18 ? 62  ALA A N     1 
ATOM 7313  C CA    . ALA M  3 49  ? 50.429  -98.691  -10.456 1.00 293.45 ? 62  ALA A CA    1 
ATOM 7314  C C     . ALA M  3 49  ? 51.930  -99.007  -10.295 1.00 298.81 ? 62  ALA A C     1 
ATOM 7315  O O     . ALA M  3 49  ? 52.332  -100.180 -10.333 1.00 302.07 ? 62  ALA A O     1 
ATOM 7316  C CB    . ALA M  3 49  ? 50.149  -98.139  -11.853 1.00 300.47 ? 62  ALA A CB    1 
ATOM 7317  N N     . LYS M  3 50  ? 52.745  -97.961  -10.138 1.00 297.81 ? 63  LYS A N     1 
ATOM 7318  C CA    . LYS M  3 50  ? 54.193  -98.086  -9.923  1.00 293.37 ? 63  LYS A CA    1 
ATOM 7319  C C     . LYS M  3 50  ? 54.502  -99.060  -8.812  1.00 295.21 ? 63  LYS A C     1 
ATOM 7320  O O     . LYS M  3 50  ? 55.242  -100.022 -8.986  1.00 297.85 ? 63  LYS A O     1 
ATOM 7321  C CB    . LYS M  3 50  ? 54.777  -96.736  -9.512  1.00 288.08 ? 63  LYS A CB    1 
ATOM 7322  C CG    . LYS M  3 50  ? 55.383  -95.968  -10.662 1.00 288.25 ? 63  LYS A CG    1 
ATOM 7323  C CD    . LYS M  3 50  ? 56.178  -94.802  -10.132 1.00 292.74 ? 63  LYS A CD    1 
ATOM 7324  C CE    . LYS M  3 50  ? 56.414  -93.781  -11.217 1.00 304.10 ? 63  LYS A CE    1 
ATOM 7325  N NZ    . LYS M  3 50  ? 55.161  -93.047  -11.527 1.00 307.84 ? 63  LYS A NZ    1 
ATOM 7326  N N     . ASP M  3 51  ? 53.905  -98.775  -7.663  1.00 295.67 ? 64  ASP A N     1 
ATOM 7327  C CA    . ASP M  3 51  ? 54.207  -99.435  -6.405  1.00 295.84 ? 64  ASP A CA    1 
ATOM 7328  C C     . ASP M  3 51  ? 53.759  -100.881 -6.382  1.00 291.66 ? 64  ASP A C     1 
ATOM 7329  O O     . ASP M  3 51  ? 54.430  -101.730 -5.803  1.00 295.95 ? 64  ASP A O     1 
ATOM 7330  C CB    . ASP M  3 51  ? 53.523  -98.675  -5.269  1.00 301.73 ? 64  ASP A CB    1 
ATOM 7331  C CG    . ASP M  3 51  ? 53.994  -97.225  -5.151  1.00 308.35 ? 64  ASP A CG    1 
ATOM 7332  O OD1   . ASP M  3 51  ? 54.764  -96.726  -6.008  1.00 307.65 ? 64  ASP A OD1   1 
ATOM 7333  O OD2   . ASP M  3 51  ? 53.572  -96.575  -4.178  1.00 316.99 ? 64  ASP A OD2   1 
ATOM 7334  N N     . LEU M  3 52  ? 52.606  -101.136 -6.994  1.00 281.09 ? 65  LEU A N     1 
ATOM 7335  C CA    . LEU M  3 52  ? 52.047  -102.473 -7.128  1.00 277.41 ? 65  LEU A CA    1 
ATOM 7336  C C     . LEU M  3 52  ? 52.994  -103.364 -7.949  1.00 295.59 ? 65  LEU A C     1 
ATOM 7337  O O     . LEU M  3 52  ? 53.277  -104.504 -7.563  1.00 304.40 ? 65  LEU A O     1 
ATOM 7338  C CB    . LEU M  3 52  ? 50.636  -102.409 -7.757  1.00 255.89 ? 65  LEU A CB    1 
ATOM 7339  C CG    . LEU M  3 52  ? 49.447  -101.858 -6.945  1.00 244.39 ? 65  LEU A CG    1 
ATOM 7340  C CD1   . LEU M  3 52  ? 48.248  -101.503 -7.823  1.00 237.74 ? 65  LEU A CD1   1 
ATOM 7341  C CD2   . LEU M  3 52  ? 49.049  -102.833 -5.849  1.00 245.28 ? 65  LEU A CD2   1 
ATOM 7342  N N     . GLU M  3 53  ? 53.509  -102.836 -9.058  1.00 310.96 ? 66  GLU A N     1 
ATOM 7343  C CA    . GLU M  3 53  ? 54.426  -103.590 -9.915  1.00 322.98 ? 66  GLU A CA    1 
ATOM 7344  C C     . GLU M  3 53  ? 55.728  -103.978 -9.187  1.00 332.75 ? 66  GLU A C     1 
ATOM 7345  O O     . GLU M  3 53  ? 56.256  -105.084 -9.364  1.00 337.19 ? 66  GLU A O     1 
ATOM 7346  C CB    . GLU M  3 53  ? 54.728  -102.788 -11.172 1.00 321.25 ? 66  GLU A CB    1 
ATOM 7347  C CG    . GLU M  3 53  ? 55.561  -103.516 -12.204 1.00 321.12 ? 66  GLU A CG    1 
ATOM 7348  C CD    . GLU M  3 53  ? 56.624  -102.592 -12.759 1.00 326.13 ? 66  GLU A CD    1 
ATOM 7349  O OE1   . GLU M  3 53  ? 56.373  -101.366 -12.810 1.00 326.41 ? 66  GLU A OE1   1 
ATOM 7350  O OE2   . GLU M  3 53  ? 57.721  -103.075 -13.106 1.00 330.73 ? 66  GLU A OE2   1 
ATOM 7351  N N     . MET M  3 54  ? 56.234  -103.062 -8.372  1.00 335.93 ? 67  MET A N     1 
ATOM 7352  C CA    . MET M  3 54  ? 57.444  -103.306 -7.598  1.00 334.23 ? 67  MET A CA    1 
ATOM 7353  C C     . MET M  3 54  ? 57.275  -104.292 -6.430  1.00 330.00 ? 67  MET A C     1 
ATOM 7354  O O     . MET M  3 54  ? 58.253  -104.916 -6.008  1.00 325.23 ? 67  MET A O     1 
ATOM 7355  C CB    . MET M  3 54  ? 58.014  -101.972 -7.145  1.00 339.52 ? 67  MET A CB    1 
ATOM 7356  C CG    . MET M  3 54  ? 58.410  -101.116 -8.339  1.00 345.98 ? 67  MET A CG    1 
ATOM 7357  S SD    . MET M  3 54  ? 59.094  -99.475  -7.981  1.00 358.29 ? 67  MET A SD    1 
ATOM 7358  C CE    . MET M  3 54  ? 57.677  -98.415  -7.843  1.00 340.91 ? 67  MET A CE    1 
ATOM 7359  N N     . PHE M  3 55  ? 56.041  -104.435 -5.925  1.00 327.25 ? 68  PHE A N     1 
ATOM 7360  C CA    . PHE M  3 55  ? 55.652  -105.529 -4.992  1.00 323.68 ? 68  PHE A CA    1 
ATOM 7361  C C     . PHE M  3 55  ? 55.538  -106.926 -5.640  1.00 315.67 ? 68  PHE A C     1 
ATOM 7362  O O     . PHE M  3 55  ? 55.939  -107.923 -5.031  1.00 315.90 ? 68  PHE A O     1 
ATOM 7363  C CB    . PHE M  3 55  ? 54.305  -105.243 -4.307  1.00 324.82 ? 68  PHE A CB    1 
ATOM 7364  C CG    . PHE M  3 55  ? 54.296  -104.042 -3.411  1.00 321.90 ? 68  PHE A CG    1 
ATOM 7365  C CD1   . PHE M  3 55  ? 55.443  -103.634 -2.743  1.00 324.39 ? 68  PHE A CD1   1 
ATOM 7366  C CD2   . PHE M  3 55  ? 53.111  -103.341 -3.205  1.00 315.42 ? 68  PHE A CD2   1 
ATOM 7367  C CE1   . PHE M  3 55  ? 55.410  -102.532 -1.908  1.00 322.23 ? 68  PHE A CE1   1 
ATOM 7368  C CE2   . PHE M  3 55  ? 53.071  -102.245 -2.368  1.00 313.09 ? 68  PHE A CE2   1 
ATOM 7369  C CZ    . PHE M  3 55  ? 54.225  -101.836 -1.721  1.00 317.31 ? 68  PHE A CZ    1 
ATOM 7370  N N     . ALA M  3 56  ? 54.949  -106.992 -6.843  1.00 305.10 ? 69  ALA A N     1 
ATOM 7371  C CA    . ALA M  3 56  ? 54.791  -108.245 -7.603  1.00 299.42 ? 69  ALA A CA    1 
ATOM 7372  C C     . ALA M  3 56  ? 56.144  -108.783 -8.095  1.00 305.98 ? 69  ALA A C     1 
ATOM 7373  O O     . ALA M  3 56  ? 56.363  -109.987 -8.086  1.00 303.07 ? 69  ALA A O     1 
ATOM 7374  C CB    . ALA M  3 56  ? 53.817  -108.059 -8.763  1.00 290.88 ? 69  ALA A CB    1 
ATOM 7375  N N     . ARG M  3 57  ? 57.037  -107.877 -8.507  1.00 317.70 ? 70  ARG A N     1 
ATOM 7376  C CA    . ARG M  3 57  ? 58.466  -108.167 -8.772  1.00 333.80 ? 70  ARG A CA    1 
ATOM 7377  C C     . ARG M  3 57  ? 59.331  -108.603 -7.543  1.00 339.99 ? 70  ARG A C     1 
ATOM 7378  O O     . ARG M  3 57  ? 60.271  -109.402 -7.701  1.00 341.50 ? 70  ARG A O     1 
ATOM 7379  C CB    . ARG M  3 57  ? 59.111  -106.984 -9.519  1.00 340.44 ? 70  ARG A CB    1 
ATOM 7380  C CG    . ARG M  3 57  ? 60.634  -106.935 -9.523  1.00 350.61 ? 70  ARG A CG    1 
ATOM 7381  C CD    . ARG M  3 57  ? 61.277  -108.010 -10.402 1.00 355.26 ? 70  ARG A CD    1 
ATOM 7382  N NE    . ARG M  3 57  ? 60.402  -108.513 -11.461 1.00 350.64 ? 70  ARG A NE    1 
ATOM 7383  C CZ    . ARG M  3 57  ? 59.980  -109.772 -11.544 1.00 348.58 ? 70  ARG A CZ    1 
ATOM 7384  N NH1   . ARG M  3 57  ? 60.364  -110.662 -10.639 1.00 350.54 ? 70  ARG A NH1   1 
ATOM 7385  N NH2   . ARG M  3 57  ? 59.182  -110.142 -12.535 1.00 344.18 ? 70  ARG A NH2   1 
ATOM 7386  N N     . HIS M  3 58  ? 59.031  -108.071 -6.345  1.00 343.55 ? 71  HIS A N     1 
ATOM 7387  C CA    . HIS M  3 58  ? 59.605  -108.573 -5.049  1.00 351.53 ? 71  HIS A CA    1 
ATOM 7388  C C     . HIS M  3 58  ? 59.342  -110.060 -4.760  1.00 357.67 ? 71  HIS A C     1 
ATOM 7389  O O     . HIS M  3 58  ? 60.154  -110.712 -4.092  1.00 360.99 ? 71  HIS A O     1 
ATOM 7390  C CB    . HIS M  3 58  ? 59.115  -107.754 -3.820  1.00 348.15 ? 71  HIS A CB    1 
ATOM 7391  C CG    . HIS M  3 58  ? 59.005  -108.554 -2.537  1.00 345.97 ? 71  HIS A CG    1 
ATOM 7392  N ND1   . HIS M  3 58  ? 60.104  -108.989 -1.822  1.00 347.85 ? 71  HIS A ND1   1 
ATOM 7393  C CD2   . HIS M  3 58  ? 57.919  -108.990 -1.849  1.00 340.67 ? 71  HIS A CD2   1 
ATOM 7394  C CE1   . HIS M  3 58  ? 59.701  -109.657 -0.754  1.00 345.13 ? 71  HIS A CE1   1 
ATOM 7395  N NE2   . HIS M  3 58  ? 58.380  -109.671 -0.747  1.00 339.66 ? 71  HIS A NE2   1 
ATOM 7396  N N     . ALA M  3 59  ? 58.197  -110.563 -5.231  1.00 359.72 ? 72  ALA A N     1 
ATOM 7397  C CA    . ALA M  3 59  ? 57.691  -111.903 -4.893  1.00 361.93 ? 72  ALA A CA    1 
ATOM 7398  C C     . ALA M  3 59  ? 57.863  -112.938 -6.030  1.00 353.01 ? 72  ALA A C     1 
ATOM 7399  O O     . ALA M  3 59  ? 57.163  -113.958 -6.054  1.00 364.20 ? 72  ALA A O     1 
ATOM 7400  C CB    . ALA M  3 59  ? 56.221  -111.808 -4.457  1.00 367.39 ? 72  ALA A CB    1 
ATOM 7401  N N     . LYS M  3 60  ? 58.796  -112.672 -6.954  1.00 331.06 ? 73  LYS A N     1 
ATOM 7402  C CA    . LYS M  3 60  ? 59.071  -113.545 -8.126  1.00 314.41 ? 73  LYS A CA    1 
ATOM 7403  C C     . LYS M  3 60  ? 57.830  -113.853 -9.025  1.00 306.98 ? 73  LYS A C     1 
ATOM 7404  O O     . LYS M  3 60  ? 57.706  -114.957 -9.559  1.00 304.02 ? 73  LYS A O     1 
ATOM 7405  C CB    . LYS M  3 60  ? 59.814  -114.841 -7.701  1.00 310.15 ? 73  LYS A CB    1 
ATOM 7406  C CG    . LYS M  3 60  ? 60.964  -114.658 -6.696  1.00 306.43 ? 73  LYS A CG    1 
ATOM 7407  C CD    . LYS M  3 60  ? 61.375  -115.961 -5.999  1.00 304.79 ? 73  LYS A CD    1 
ATOM 7408  C CE    . LYS M  3 60  ? 60.298  -116.573 -5.096  1.00 300.68 ? 73  LYS A CE    1 
ATOM 7409  N NZ    . LYS M  3 60  ? 60.121  -115.907 -3.775  1.00 297.92 ? 73  LYS A NZ    1 
ATOM 7410  N N     . ARG M  3 61  ? 56.934  -112.874 -9.194  1.00 301.06 ? 74  ARG A N     1 
ATOM 7411  C CA    . ARG M  3 61  ? 55.699  -113.039 -9.993  1.00 296.97 ? 74  ARG A CA    1 
ATOM 7412  C C     . ARG M  3 61  ? 55.382  -111.874 -10.920 1.00 300.36 ? 74  ARG A C     1 
ATOM 7413  O O     . ARG M  3 61  ? 55.782  -110.727 -10.674 1.00 298.37 ? 74  ARG A O     1 
ATOM 7414  C CB    . ARG M  3 61  ? 54.480  -113.148 -9.091  1.00 290.19 ? 74  ARG A CB    1 
ATOM 7415  C CG    . ARG M  3 61  ? 54.220  -114.472 -8.428  1.00 292.23 ? 74  ARG A CG    1 
ATOM 7416  C CD    . ARG M  3 61  ? 53.018  -114.279 -7.514  1.00 293.59 ? 74  ARG A CD    1 
ATOM 7417  N NE    . ARG M  3 61  ? 53.245  -113.323 -6.411  1.00 299.39 ? 74  ARG A NE    1 
ATOM 7418  C CZ    . ARG M  3 61  ? 52.873  -112.036 -6.392  1.00 296.56 ? 74  ARG A CZ    1 
ATOM 7419  N NH1   . ARG M  3 61  ? 52.261  -111.481 -7.432  1.00 288.29 ? 74  ARG A NH1   1 
ATOM 7420  N NH2   . ARG M  3 61  ? 53.120  -111.295 -5.318  1.00 298.67 ? 74  ARG A NH2   1 
ATOM 7421  N N     . THR M  3 62  ? 54.615  -112.180 -11.967 1.00 309.77 ? 75  THR A N     1 
ATOM 7422  C CA    . THR M  3 62  ? 53.930  -111.155 -12.767 1.00 318.78 ? 75  THR A CA    1 
ATOM 7423  C C     . THR M  3 62  ? 52.437  -111.125 -12.466 1.00 314.80 ? 75  THR A C     1 
ATOM 7424  O O     . THR M  3 62  ? 51.800  -110.105 -12.703 1.00 322.50 ? 75  THR A O     1 
ATOM 7425  C CB    . THR M  3 62  ? 54.083  -111.309 -14.309 1.00 326.22 ? 75  THR A CB    1 
ATOM 7426  O OG1   . THR M  3 62  ? 53.636  -112.607 -14.735 1.00 333.11 ? 75  THR A OG1   1 
ATOM 7427  C CG2   . THR M  3 62  ? 55.523  -111.054 -14.764 1.00 331.24 ? 75  THR A CG2   1 
ATOM 7428  N N     . THR M  3 63  ? 51.884  -112.233 -11.962 1.00 305.28 ? 76  THR A N     1 
ATOM 7429  C CA    . THR M  3 63  ? 50.436  -112.351 -11.756 1.00 297.22 ? 76  THR A CA    1 
ATOM 7430  C C     . THR M  3 63  ? 50.039  -111.823 -10.380 1.00 300.40 ? 76  THR A C     1 
ATOM 7431  O O     . THR M  3 63  ? 50.486  -112.346 -9.365  1.00 298.25 ? 76  THR A O     1 
ATOM 7432  C CB    . THR M  3 63  ? 49.981  -113.805 -11.893 1.00 291.88 ? 76  THR A CB    1 
ATOM 7433  O OG1   . THR M  3 63  ? 50.610  -114.580 -10.874 1.00 285.60 ? 76  THR A OG1   1 
ATOM 7434  C CG2   . THR M  3 63  ? 50.380  -114.359 -13.246 1.00 290.59 ? 76  THR A CG2   1 
ATOM 7435  N N     . ILE M  3 64  ? 49.204  -110.785 -10.358 1.00 305.36 ? 77  ILE A N     1 
ATOM 7436  C CA    . ILE M  3 64  ? 48.970  -109.984 -9.141  1.00 313.09 ? 77  ILE A CA    1 
ATOM 7437  C C     . ILE M  3 64  ? 47.887  -110.601 -8.221  1.00 323.69 ? 77  ILE A C     1 
ATOM 7438  O O     . ILE M  3 64  ? 46.793  -110.949 -8.688  1.00 327.80 ? 77  ILE A O     1 
ATOM 7439  C CB    . ILE M  3 64  ? 48.734  -108.475 -9.495  1.00 305.33 ? 77  ILE A CB    1 
ATOM 7440  C CG1   . ILE M  3 64  ? 50.079  -107.785 -9.808  1.00 302.71 ? 77  ILE A CG1   1 
ATOM 7441  C CG2   . ILE M  3 64  ? 47.958  -107.733 -8.397  1.00 306.11 ? 77  ILE A CG2   1 
ATOM 7442  C CD1   . ILE M  3 64  ? 49.984  -106.416 -10.447 1.00 298.70 ? 77  ILE A CD1   1 
ATOM 7443  N N     . ASN M  3 65  ? 48.230  -110.753 -6.928  1.00 332.19 ? 78  ASN A N     1 
ATOM 7444  C CA    . ASN M  3 65  ? 47.332  -111.334 -5.902  1.00 329.79 ? 78  ASN A CA    1 
ATOM 7445  C C     . ASN M  3 65  ? 46.907  -110.387 -4.787  1.00 325.83 ? 78  ASN A C     1 
ATOM 7446  O O     . ASN M  3 65  ? 47.239  -109.189 -4.761  1.00 336.80 ? 78  ASN A O     1 
ATOM 7447  C CB    . ASN M  3 65  ? 47.857  -112.688 -5.303  1.00 333.24 ? 78  ASN A CB    1 
ATOM 7448  C CG    . ASN M  3 65  ? 49.180  -112.559 -4.528  1.00 338.87 ? 78  ASN A CG    1 
ATOM 7449  O OD1   . ASN M  3 65  ? 49.381  -111.638 -3.739  1.00 339.71 ? 78  ASN A OD1   1 
ATOM 7450  N ND2   . ASN M  3 65  ? 50.083  -113.514 -4.747  1.00 343.22 ? 78  ASN A ND2   1 
ATOM 7451  N N     . THR M  3 66  ? 46.171  -110.983 -3.865  1.00 313.69 ? 79  THR A N     1 
ATOM 7452  C CA    . THR M  3 66  ? 45.594  -110.345 -2.698  1.00 310.38 ? 79  THR A CA    1 
ATOM 7453  C C     . THR M  3 66  ? 46.580  -109.496 -1.834  1.00 317.52 ? 79  THR A C     1 
ATOM 7454  O O     . THR M  3 66  ? 46.207  -108.422 -1.298  1.00 327.10 ? 79  THR A O     1 
ATOM 7455  C CB    . THR M  3 66  ? 44.938  -111.449 -1.844  1.00 306.40 ? 79  THR A CB    1 
ATOM 7456  O OG1   . THR M  3 66  ? 45.924  -112.439 -1.523  1.00 304.52 ? 79  THR A OG1   1 
ATOM 7457  C CG2   . THR M  3 66  ? 43.807  -112.134 -2.625  1.00 299.21 ? 79  THR A CG2   1 
ATOM 7458  N N     . GLU M  3 67  ? 47.820  -109.981 -1.709  1.00 315.31 ? 80  GLU A N     1 
ATOM 7459  C CA    . GLU M  3 67  ? 48.793  -109.429 -0.749  1.00 310.79 ? 80  GLU A CA    1 
ATOM 7460  C C     . GLU M  3 67  ? 49.338  -108.061 -1.078  1.00 306.61 ? 80  GLU A C     1 
ATOM 7461  O O     . GLU M  3 67  ? 49.524  -107.231 -0.174  1.00 296.74 ? 80  GLU A O     1 
ATOM 7462  C CB    . GLU M  3 67  ? 49.944  -110.403 -0.509  1.00 312.81 ? 80  GLU A CB    1 
ATOM 7463  C CG    . GLU M  3 67  ? 49.494  -111.582 0.332   1.00 319.03 ? 80  GLU A CG    1 
ATOM 7464  C CD    . GLU M  3 67  ? 48.530  -111.195 1.456   1.00 321.28 ? 80  GLU A CD    1 
ATOM 7465  O OE1   . GLU M  3 67  ? 47.391  -111.723 1.464   1.00 326.63 ? 80  GLU A OE1   1 
ATOM 7466  O OE2   . GLU M  3 67  ? 48.889  -110.382 2.340   1.00 319.48 ? 80  GLU A OE2   1 
ATOM 7467  N N     . ASP M  3 68  ? 49.588  -107.833 -2.367  1.00 310.25 ? 81  ASP A N     1 
ATOM 7468  C CA    . ASP M  3 68  ? 50.105  -106.551 -2.850  1.00 311.16 ? 81  ASP A CA    1 
ATOM 7469  C C     . ASP M  3 68  ? 49.071  -105.413 -2.616  1.00 312.41 ? 81  ASP A C     1 
ATOM 7470  O O     . ASP M  3 68  ? 49.422  -104.306 -2.156  1.00 308.91 ? 81  ASP A O     1 
ATOM 7471  C CB    . ASP M  3 68  ? 50.530  -106.694 -4.330  1.00 308.02 ? 81  ASP A CB    1 
ATOM 7472  C CG    . ASP M  3 68  ? 51.517  -107.871 -4.572  1.00 304.22 ? 81  ASP A CG    1 
ATOM 7473  O OD1   . ASP M  3 68  ? 52.348  -108.180 -3.685  1.00 300.56 ? 81  ASP A OD1   1 
ATOM 7474  O OD2   . ASP M  3 68  ? 51.476  -108.486 -5.664  1.00 300.85 ? 81  ASP A OD2   1 
ATOM 7475  N N     . VAL M  3 69  ? 47.803  -105.745 -2.888  1.00 312.86 ? 82  VAL A N     1 
ATOM 7476  C CA    . VAL M  3 69  ? 46.637  -104.849 -2.749  1.00 301.14 ? 82  VAL A CA    1 
ATOM 7477  C C     . VAL M  3 69  ? 46.401  -104.394 -1.297  1.00 306.15 ? 82  VAL A C     1 
ATOM 7478  O O     . VAL M  3 69  ? 46.342  -103.198 -1.023  1.00 310.03 ? 82  VAL A O     1 
ATOM 7479  C CB    . VAL M  3 69  ? 45.316  -105.507 -3.270  1.00 286.60 ? 82  VAL A CB    1 
ATOM 7480  C CG1   . VAL M  3 69  ? 44.137  -104.553 -3.125  1.00 270.92 ? 82  VAL A CG1   1 
ATOM 7481  C CG2   . VAL M  3 69  ? 45.437  -106.001 -4.713  1.00 280.90 ? 82  VAL A CG2   1 
ATOM 7482  N N     . LYS M  3 70  ? 46.253  -105.342 -0.374  1.00 306.81 ? 83  LYS A N     1 
ATOM 7483  C CA    . LYS M  3 70  ? 46.003  -104.992 1.020   1.00 302.59 ? 83  LYS A CA    1 
ATOM 7484  C C     . LYS M  3 70  ? 47.247  -104.357 1.652   1.00 302.43 ? 83  LYS A C     1 
ATOM 7485  O O     . LYS M  3 70  ? 47.120  -103.597 2.616   1.00 309.65 ? 83  LYS A O     1 
ATOM 7486  C CB    . LYS M  3 70  ? 45.473  -106.188 1.825   1.00 299.29 ? 83  LYS A CB    1 
ATOM 7487  C CG    . LYS M  3 70  ? 44.090  -106.636 1.380   1.00 293.83 ? 83  LYS A CG    1 
ATOM 7488  C CD    . LYS M  3 70  ? 43.382  -107.442 2.445   1.00 291.31 ? 83  LYS A CD    1 
ATOM 7489  C CE    . LYS M  3 70  ? 43.914  -108.854 2.442   1.00 293.03 ? 83  LYS A CE    1 
ATOM 7490  N NZ    . LYS M  3 70  ? 43.523  -109.521 3.698   1.00 292.07 ? 83  LYS A NZ    1 
ATOM 7491  N N     . LEU M  3 71  ? 48.435  -104.629 1.090   1.00 293.61 ? 84  LEU A N     1 
ATOM 7492  C CA    . LEU M  3 71  ? 49.658  -103.932 1.534   1.00 286.19 ? 84  LEU A CA    1 
ATOM 7493  C C     . LEU M  3 71  ? 49.734  -102.528 0.913   1.00 283.13 ? 84  LEU A C     1 
ATOM 7494  O O     . LEU M  3 71  ? 50.469  -101.668 1.392   1.00 277.73 ? 84  LEU A O     1 
ATOM 7495  C CB    . LEU M  3 71  ? 50.946  -104.753 1.300   1.00 284.66 ? 84  LEU A CB    1 
ATOM 7496  C CG    . LEU M  3 71  ? 52.208  -104.468 2.133   1.00 290.60 ? 84  LEU A CG    1 
ATOM 7497  C CD1   . LEU M  3 71  ? 51.992  -104.662 3.634   1.00 295.79 ? 84  LEU A CD1   1 
ATOM 7498  C CD2   . LEU M  3 71  ? 53.367  -105.326 1.642   1.00 296.78 ? 84  LEU A CD2   1 
ATOM 7499  N N     . LEU M  3 72  ? 48.954  -102.284 -0.135  1.00 288.25 ? 85  LEU A N     1 
ATOM 7500  C CA    . LEU M  3 72  ? 48.847  -100.931 -0.669  1.00 294.73 ? 85  LEU A CA    1 
ATOM 7501  C C     . LEU M  3 72  ? 47.956  -100.031 0.216   1.00 289.49 ? 85  LEU A C     1 
ATOM 7502  O O     . LEU M  3 72  ? 48.166  -98.811  0.313   1.00 285.47 ? 85  LEU A O     1 
ATOM 7503  C CB    . LEU M  3 72  ? 48.347  -100.980 -2.106  1.00 307.17 ? 85  LEU A CB    1 
ATOM 7504  C CG    . LEU M  3 72  ? 48.881  -99.856  -2.978  1.00 315.05 ? 85  LEU A CG    1 
ATOM 7505  C CD1   . LEU M  3 72  ? 50.377  -100.026 -3.203  1.00 318.09 ? 85  LEU A CD1   1 
ATOM 7506  C CD2   . LEU M  3 72  ? 48.125  -99.826  -4.297  1.00 315.90 ? 85  LEU A CD2   1 
ATOM 7507  N N     . ALA M  3 73  ? 46.981  -100.660 0.873   1.00 284.77 ? 86  ALA A N     1 
ATOM 7508  C CA    . ALA M  3 73  ? 46.100  -100.006 1.840   1.00 275.39 ? 86  ALA A CA    1 
ATOM 7509  C C     . ALA M  3 73  ? 46.705  -100.038 3.245   1.00 272.92 ? 86  ALA A C     1 
ATOM 7510  O O     . ALA M  3 73  ? 45.978  -100.135 4.247   1.00 268.55 ? 86  ALA A O     1 
ATOM 7511  C CB    . ALA M  3 73  ? 44.744  -100.687 1.842   1.00 275.69 ? 86  ALA A CB    1 
ATOM 7512  N N     . ARG M  3 74  ? 48.041  -99.943  3.289   1.00 271.73 ? 87  ARG A N     1 
ATOM 7513  C CA    . ARG M  3 74  ? 48.878  -100.027 4.522   1.00 274.70 ? 87  ARG A CA    1 
ATOM 7514  C C     . ARG M  3 74  ? 48.859  -98.756  5.388   1.00 277.63 ? 87  ARG A C     1 
ATOM 7515  O O     . ARG M  3 74  ? 49.300  -98.754  6.554   1.00 280.72 ? 87  ARG A O     1 
ATOM 7516  C CB    . ARG M  3 74  ? 50.346  -100.361 4.145   1.00 271.55 ? 87  ARG A CB    1 
ATOM 7517  C CG    . ARG M  3 74  ? 51.246  -99.163  3.798   1.00 265.69 ? 87  ARG A CG    1 
ATOM 7518  C CD    . ARG M  3 74  ? 52.186  -99.426  2.625   1.00 261.47 ? 87  ARG A CD    1 
ATOM 7519  N NE    . ARG M  3 74  ? 51.657  -98.884  1.382   1.00 255.49 ? 87  ARG A NE    1 
ATOM 7520  C CZ    . ARG M  3 74  ? 52.151  -97.826  0.756   1.00 254.65 ? 87  ARG A CZ    1 
ATOM 7521  N NH1   . ARG M  3 74  ? 53.209  -97.196  1.237   1.00 254.84 ? 87  ARG A NH1   1 
ATOM 7522  N NH2   . ARG M  3 74  ? 51.588  -97.405  -0.359  1.00 252.55 ? 87  ARG A NH2   1 
ATOM 7523  N N     . ARG M  3 75  ? 48.323  -97.698  4.795   1.00 278.50 ? 88  ARG A N     1 
ATOM 7524  C CA    . ARG M  3 75  ? 48.586  -96.331  5.207   1.00 282.89 ? 88  ARG A CA    1 
ATOM 7525  C C     . ARG M  3 75  ? 47.802  -95.836  6.462   1.00 292.00 ? 88  ARG A C     1 
ATOM 7526  O O     . ARG M  3 75  ? 48.424  -95.480  7.480   1.00 290.56 ? 88  ARG A O     1 
ATOM 7527  C CB    . ARG M  3 75  ? 48.432  -95.449  3.969   1.00 275.61 ? 88  ARG A CB    1 
ATOM 7528  C CG    . ARG M  3 75  ? 49.510  -95.691  2.914   1.00 265.89 ? 88  ARG A CG    1 
ATOM 7529  C CD    . ARG M  3 75  ? 50.543  -94.584  3.004   1.00 260.35 ? 88  ARG A CD    1 
ATOM 7530  N NE    . ARG M  3 75  ? 51.911  -95.063  3.004   1.00 254.25 ? 88  ARG A NE    1 
ATOM 7531  C CZ    . ARG M  3 75  ? 52.586  -95.406  4.095   1.00 253.67 ? 88  ARG A CZ    1 
ATOM 7532  N NH1   . ARG M  3 75  ? 52.030  -95.330  5.295   1.00 252.61 ? 88  ARG A NH1   1 
ATOM 7533  N NH2   . ARG M  3 75  ? 53.829  -95.824  3.976   1.00 252.53 ? 88  ARG A NH2   1 
ATOM 7534  N N     . SER M  3 76  ? 46.461  -95.826  6.393   1.00 302.05 ? 89  SER A N     1 
ATOM 7535  C CA    . SER M  3 76  ? 45.585  -95.600  7.579   1.00 307.92 ? 89  SER A CA    1 
ATOM 7536  C C     . SER M  3 76  ? 45.000  -96.927  8.094   1.00 310.99 ? 89  SER A C     1 
ATOM 7537  O O     . SER M  3 76  ? 44.557  -97.780  7.306   1.00 315.07 ? 89  SER A O     1 
ATOM 7538  C CB    . SER M  3 76  ? 44.469  -94.558  7.316   1.00 308.37 ? 89  SER A CB    1 
ATOM 7539  O OG    . SER M  3 76  ? 43.364  -95.094  6.594   1.00 309.86 ? 89  SER A OG    1 
ATOM 7540  N N     . ASN M  3 77  ? 45.016  -97.123  9.407   1.00 309.69 ? 90  ASN A N     1 
ATOM 7541  C CA    . ASN M  3 77  ? 44.709  -98.457  9.912   1.00 308.54 ? 90  ASN A CA    1 
ATOM 7542  C C     . ASN M  3 77  ? 43.211  -98.701  10.164  1.00 305.82 ? 90  ASN A C     1 
ATOM 7543  O O     . ASN M  3 77  ? 42.765  -99.855  10.216  1.00 305.59 ? 90  ASN A O     1 
ATOM 7544  C CB    . ASN M  3 77  ? 45.645  -98.855  11.060  1.00 310.19 ? 90  ASN A CB    1 
ATOM 7545  C CG    . ASN M  3 77  ? 47.099  -98.485  10.777  1.00 308.24 ? 90  ASN A CG    1 
ATOM 7546  O OD1   . ASN M  3 77  ? 47.500  -97.335  10.981  1.00 304.76 ? 90  ASN A OD1   1 
ATOM 7547  N ND2   . ASN M  3 77  ? 47.890  -99.453  10.295  1.00 307.09 ? 90  ASN A ND2   1 
ATOM 7548  N N     . SER M  3 78  ? 42.441  -97.609  10.251  1.00 298.14 ? 91  SER A N     1 
ATOM 7549  C CA    . SER M  3 78  ? 40.968  -97.656  10.134  1.00 292.59 ? 91  SER A CA    1 
ATOM 7550  C C     . SER M  3 78  ? 40.522  -98.354  8.820   1.00 291.56 ? 91  SER A C     1 
ATOM 7551  O O     . SER M  3 78  ? 39.593  -99.192  8.788   1.00 286.34 ? 91  SER A O     1 
ATOM 7552  C CB    . SER M  3 78  ? 40.384  -96.232  10.245  1.00 283.48 ? 91  SER A CB    1 
ATOM 7553  O OG    . SER M  3 78  ? 40.866  -95.364  9.229   1.00 265.40 ? 91  SER A OG    1 
ATOM 7554  N N     . LEU M  3 79  ? 41.228  -98.009  7.746   1.00 293.38 ? 92  LEU A N     1 
ATOM 7555  C CA    . LEU M  3 79  ? 41.065  -98.616  6.426   1.00 295.81 ? 92  LEU A CA    1 
ATOM 7556  C C     . LEU M  3 79  ? 41.480  -100.102 6.391   1.00 296.36 ? 92  LEU A C     1 
ATOM 7557  O O     . LEU M  3 79  ? 40.722  -100.947 5.880   1.00 301.07 ? 92  LEU A O     1 
ATOM 7558  C CB    . LEU M  3 79  ? 41.919  -97.825  5.434   1.00 297.49 ? 92  LEU A CB    1 
ATOM 7559  C CG    . LEU M  3 79  ? 41.653  -97.669  3.937   1.00 298.03 ? 92  LEU A CG    1 
ATOM 7560  C CD1   . LEU M  3 79  ? 43.007  -97.604  3.251   1.00 293.66 ? 92  LEU A CD1   1 
ATOM 7561  C CD2   . LEU M  3 79  ? 40.812  -98.782  3.328   1.00 303.09 ? 92  LEU A CD2   1 
ATOM 7562  N N     . LEU M  3 80  ? 42.685  -100.396 6.903   1.00 291.92 ? 93  LEU A N     1 
ATOM 7563  C CA    . LEU M  3 80  ? 43.257  -101.752 6.944   1.00 285.97 ? 93  LEU A CA    1 
ATOM 7564  C C     . LEU M  3 80  ? 42.344  -102.757 7.653   1.00 292.93 ? 93  LEU A C     1 
ATOM 7565  O O     . LEU M  3 80  ? 42.170  -103.885 7.178   1.00 294.28 ? 93  LEU A O     1 
ATOM 7566  C CB    . LEU M  3 80  ? 44.650  -101.743 7.579   1.00 276.66 ? 93  LEU A CB    1 
ATOM 7567  C CG    . LEU M  3 80  ? 45.300  -103.104 7.790   1.00 272.47 ? 93  LEU A CG    1 
ATOM 7568  C CD1   . LEU M  3 80  ? 45.630  -103.746 6.454   1.00 267.57 ? 93  LEU A CD1   1 
ATOM 7569  C CD2   . LEU M  3 80  ? 46.551  -102.939 8.630   1.00 272.95 ? 93  LEU A CD2   1 
ATOM 7570  N N     . LYS M  3 81  ? 41.751  -102.343 8.773   1.00 299.30 ? 94  LYS A N     1 
ATOM 7571  C CA    . LYS M  3 81  ? 40.743  -103.170 9.447   1.00 310.05 ? 94  LYS A CA    1 
ATOM 7572  C C     . LYS M  3 81  ? 39.442  -103.343 8.637   1.00 318.39 ? 94  LYS A C     1 
ATOM 7573  O O     . LYS M  3 81  ? 38.964  -104.467 8.499   1.00 333.28 ? 94  LYS A O     1 
ATOM 7574  C CB    . LYS M  3 81  ? 40.491  -102.703 10.892  1.00 308.56 ? 94  LYS A CB    1 
ATOM 7575  C CG    . LYS M  3 81  ? 41.413  -103.387 11.899  1.00 313.00 ? 94  LYS A CG    1 
ATOM 7576  C CD    . LYS M  3 81  ? 41.444  -102.699 13.269  1.00 316.92 ? 94  LYS A CD    1 
ATOM 7577  C CE    . LYS M  3 81  ? 42.768  -102.921 14.000  1.00 321.89 ? 94  LYS A CE    1 
ATOM 7578  N NZ    . LYS M  3 81  ? 42.922  -104.250 14.669  1.00 329.60 ? 94  LYS A NZ    1 
ATOM 7579  N N     . TYR M  3 82  ? 38.900  -102.265 8.071   1.00 316.79 ? 95  TYR A N     1 
ATOM 7580  C CA    . TYR M  3 82  ? 37.723  -102.357 7.186   1.00 321.05 ? 95  TYR A CA    1 
ATOM 7581  C C     . TYR M  3 82  ? 37.920  -103.264 5.961   1.00 321.89 ? 95  TYR A C     1 
ATOM 7582  O O     . TYR M  3 82  ? 37.031  -104.029 5.600   1.00 323.85 ? 95  TYR A O     1 
ATOM 7583  C CB    . TYR M  3 82  ? 37.305  -100.968 6.713   1.00 316.75 ? 95  TYR A CB    1 
ATOM 7584  C CG    . TYR M  3 82  ? 36.087  -100.933 5.797   1.00 324.25 ? 95  TYR A CG    1 
ATOM 7585  C CD1   . TYR M  3 82  ? 36.190  -101.216 4.428   1.00 323.21 ? 95  TYR A CD1   1 
ATOM 7586  C CD2   . TYR M  3 82  ? 34.833  -100.579 6.292   1.00 334.77 ? 95  TYR A CD2   1 
ATOM 7587  C CE1   . TYR M  3 82  ? 35.079  -101.177 3.587   1.00 332.75 ? 95  TYR A CE1   1 
ATOM 7588  C CE2   . TYR M  3 82  ? 33.712  -100.524 5.453   1.00 344.06 ? 95  TYR A CE2   1 
ATOM 7589  C CZ    . TYR M  3 82  ? 33.836  -100.825 4.102   1.00 342.64 ? 95  TYR A CZ    1 
ATOM 7590  O OH    . TYR M  3 82  ? 32.731  -100.769 3.265   1.00 350.43 ? 95  TYR A OH    1 
ATOM 7591  N N     . ILE M  3 83  ? 39.073  -103.175 5.313   1.00 320.38 ? 96  ILE A N     1 
ATOM 7592  C CA    . ILE M  3 83  ? 39.279  -103.908 4.057   1.00 313.66 ? 96  ILE A CA    1 
ATOM 7593  C C     . ILE M  3 83  ? 39.614  -105.429 4.204   1.00 320.41 ? 96  ILE A C     1 
ATOM 7594  O O     . ILE M  3 83  ? 39.210  -106.223 3.343   1.00 321.03 ? 96  ILE A O     1 
ATOM 7595  C CB    . ILE M  3 83  ? 40.243  -103.133 3.108   1.00 302.29 ? 96  ILE A CB    1 
ATOM 7596  C CG1   . ILE M  3 83  ? 39.619  -101.803 2.646   1.00 294.38 ? 96  ILE A CG1   1 
ATOM 7597  C CG2   . ILE M  3 83  ? 40.670  -103.975 1.911   1.00 295.32 ? 96  ILE A CG2   1 
ATOM 7598  C CD1   . ILE M  3 83  ? 38.514  -101.933 1.613   1.00 285.50 ? 96  ILE A CD1   1 
ATOM 7599  N N     . THR M  3 84  ? 40.317  -105.843 5.276   1.00 322.11 ? 97  THR A N     1 
ATOM 7600  C CA    . THR M  3 84  ? 40.581  -107.290 5.528   1.00 318.21 ? 97  THR A CA    1 
ATOM 7601  C C     . THR M  3 84  ? 39.288  -108.094 5.660   1.00 321.91 ? 97  THR A C     1 
ATOM 7602  O O     . THR M  3 84  ? 39.216  -109.238 5.201   1.00 321.67 ? 97  THR A O     1 
ATOM 7603  C CB    . THR M  3 84  ? 41.478  -107.571 6.763   1.00 315.34 ? 97  THR A CB    1 
ATOM 7604  O OG1   . THR M  3 84  ? 40.925  -106.975 7.948   1.00 313.36 ? 97  THR A OG1   1 
ATOM 7605  C CG2   . THR M  3 84  ? 42.884  -107.055 6.527   1.00 309.27 ? 97  THR A CG2   1 
ATOM 7606  N N     . ASP M  3 85  ? 38.277  -107.472 6.281   1.00 324.71 ? 98  ASP A N     1 
ATOM 7607  C CA    . ASP M  3 85  ? 36.890  -107.995 6.376   1.00 327.56 ? 98  ASP A CA    1 
ATOM 7608  C C     . ASP M  3 85  ? 36.214  -108.251 5.025   1.00 334.08 ? 98  ASP A C     1 
ATOM 7609  O O     . ASP M  3 85  ? 35.650  -109.331 4.778   1.00 343.19 ? 98  ASP A O     1 
ATOM 7610  C CB    . ASP M  3 85  ? 35.993  -107.021 7.169   1.00 322.45 ? 98  ASP A CB    1 
ATOM 7611  C CG    . ASP M  3 85  ? 36.233  -107.067 8.681   1.00 322.77 ? 98  ASP A CG    1 
ATOM 7612  O OD1   . ASP M  3 85  ? 37.223  -107.688 9.141   1.00 318.91 ? 98  ASP A OD1   1 
ATOM 7613  O OD2   . ASP M  3 85  ? 35.417  -106.452 9.406   1.00 326.95 ? 98  ASP A OD2   1 
ATOM 7614  N N     . LYS M  3 86  ? 36.240  -107.243 4.162   1.00 335.31 ? 99  LYS A N     1 
ATOM 7615  C CA    . LYS M  3 86  ? 35.605  -107.374 2.869   1.00 333.49 ? 99  LYS A CA    1 
ATOM 7616  C C     . LYS M  3 86  ? 36.366  -108.352 1.978   1.00 332.64 ? 99  LYS A C     1 
ATOM 7617  O O     . LYS M  3 86  ? 35.789  -108.906 1.059   1.00 333.36 ? 99  LYS A O     1 
ATOM 7618  C CB    . LYS M  3 86  ? 35.398  -106.005 2.226   1.00 326.29 ? 99  LYS A CB    1 
ATOM 7619  C CG    . LYS M  3 86  ? 34.050  -105.360 2.586   1.00 326.71 ? 99  LYS A CG    1 
ATOM 7620  C CD    . LYS M  3 86  ? 33.895  -104.945 4.057   1.00 326.07 ? 99  LYS A CD    1 
ATOM 7621  C CE    . LYS M  3 86  ? 32.515  -104.360 4.378   1.00 325.21 ? 99  LYS A CE    1 
ATOM 7622  N NZ    . LYS M  3 86  ? 31.405  -105.350 4.285   1.00 328.52 ? 99  LYS A NZ    1 
ATOM 7623  N N     . SER M  3 87  ? 37.647  -108.576 2.291   1.00 328.98 ? 100 SER A N     1 
ATOM 7624  C CA    . SER M  3 87  ? 38.473  -109.607 1.649   1.00 323.27 ? 100 SER A CA    1 
ATOM 7625  C C     . SER M  3 87  ? 38.024  -111.026 2.018   1.00 330.49 ? 100 SER A C     1 
ATOM 7626  O O     . SER M  3 87  ? 38.236  -111.961 1.255   1.00 323.36 ? 100 SER A O     1 
ATOM 7627  C CB    . SER M  3 87  ? 39.957  -109.425 1.985   1.00 315.55 ? 100 SER A CB    1 
ATOM 7628  O OG    . SER M  3 87  ? 40.319  -110.145 3.149   1.00 309.29 ? 100 SER A OG    1 
ATOM 7629  N N     . GLU M  3 88  ? 37.421  -111.195 3.191   1.00 345.12 ? 101 GLU A N     1 
ATOM 7630  C CA    . GLU M  3 88  ? 36.739  -112.467 3.519   1.00 357.49 ? 101 GLU A CA    1 
ATOM 7631  C C     . GLU M  3 88  ? 35.410  -112.635 2.724   1.00 359.28 ? 101 GLU A C     1 
ATOM 7632  O O     . GLU M  3 88  ? 34.997  -113.766 2.347   1.00 358.38 ? 101 GLU A O     1 
ATOM 7633  C CB    . GLU M  3 88  ? 36.510  -112.595 5.042   1.00 365.54 ? 101 GLU A CB    1 
ATOM 7634  C CG    . GLU M  3 88  ? 37.792  -112.759 5.865   1.00 366.37 ? 101 GLU A CG    1 
ATOM 7635  C CD    . GLU M  3 88  ? 37.627  -112.438 7.353   1.00 367.17 ? 101 GLU A CD    1 
ATOM 7636  O OE1   . GLU M  3 88  ? 36.507  -112.572 7.886   1.00 366.99 ? 101 GLU A OE1   1 
ATOM 7637  O OE2   . GLU M  3 88  ? 38.634  -112.031 7.990   1.00 365.85 ? 101 GLU A OE2   1 
ATOM 7638  N N     . GLU M  3 89  ? 34.745  -111.507 2.462   1.00 359.56 ? 102 GLU A N     1 
ATOM 7639  C CA    . GLU M  3 89  ? 33.488  -111.506 1.705   1.00 356.98 ? 102 GLU A CA    1 
ATOM 7640  C C     . GLU M  3 89  ? 33.741  -111.903 0.257   1.00 353.95 ? 102 GLU A C     1 
ATOM 7641  O O     . GLU M  3 89  ? 32.964  -112.617 -0.378  1.00 351.08 ? 102 GLU A O     1 
ATOM 7642  C CB    . GLU M  3 89  ? 32.868  -110.126 1.751   1.00 358.37 ? 102 GLU A CB    1 
ATOM 7643  C CG    . GLU M  3 89  ? 31.590  -110.021 0.962   1.00 361.32 ? 102 GLU A CG    1 
ATOM 7644  C CD    . GLU M  3 89  ? 31.213  -108.586 0.740   1.00 367.37 ? 102 GLU A CD    1 
ATOM 7645  O OE1   . GLU M  3 89  ? 30.701  -108.281 -0.352  1.00 371.01 ? 102 GLU A OE1   1 
ATOM 7646  O OE2   . GLU M  3 89  ? 31.445  -107.758 1.650   1.00 372.98 ? 102 GLU A OE2   1 
ATOM 7647  N N     . ILE M  3 90  ? 34.860  -111.418 -0.248  1.00 353.67 ? 103 ILE A N     1 
ATOM 7648  C CA    . ILE M  3 90  ? 35.332  -111.772 -1.574  1.00 353.99 ? 103 ILE A CA    1 
ATOM 7649  C C     . ILE M  3 90  ? 35.942  -113.221 -1.645  1.00 371.30 ? 103 ILE A C     1 
ATOM 7650  O O     . ILE M  3 90  ? 35.737  -113.916 -2.657  1.00 387.23 ? 103 ILE A O     1 
ATOM 7651  C CB    . ILE M  3 90  ? 36.235  -110.626 -2.142  1.00 334.41 ? 103 ILE A CB    1 
ATOM 7652  C CG1   . ILE M  3 90  ? 35.464  -109.282 -2.119  1.00 319.59 ? 103 ILE A CG1   1 
ATOM 7653  C CG2   . ILE M  3 90  ? 36.741  -110.968 -3.542  1.00 328.46 ? 103 ILE A CG2   1 
ATOM 7654  C CD1   . ILE M  3 90  ? 36.309  -108.024 -1.991  1.00 305.79 ? 103 ILE A CD1   1 
ATOM 7655  N N     . ALA M  3 91  ? 36.635  -113.677 -0.582  1.00 375.14 ? 104 ALA A N     1 
ATOM 7656  C CA    . ALA M  3 91  ? 37.279  -115.025 -0.516  1.00 372.23 ? 104 ALA A CA    1 
ATOM 7657  C C     . ALA M  3 91  ? 36.278  -116.182 -0.619  1.00 372.33 ? 104 ALA A C     1 
ATOM 7658  O O     . ALA M  3 91  ? 36.644  -117.318 -0.919  1.00 367.28 ? 104 ALA A O     1 
ATOM 7659  C CB    . ALA M  3 91  ? 38.137  -115.169 0.738   1.00 368.11 ? 104 ALA A CB    1 
ATOM 7660  N N     . GLN M  3 92  ? 35.013  -115.865 -0.373  1.00 376.09 ? 105 GLN A N     1 
ATOM 7661  C CA    . GLN M  3 92  ? 33.884  -116.763 -0.603  1.00 382.37 ? 105 GLN A CA    1 
ATOM 7662  C C     . GLN M  3 92  ? 33.662  -117.246 -2.048  1.00 381.47 ? 105 GLN A C     1 
ATOM 7663  O O     . GLN M  3 92  ? 33.234  -118.383 -2.253  1.00 382.02 ? 105 GLN A O     1 
ATOM 7664  C CB    . GLN M  3 92  ? 32.617  -116.074 -0.138  1.00 390.60 ? 105 GLN A CB    1 
ATOM 7665  C CG    . GLN M  3 92  ? 32.295  -116.293 1.313   1.00 408.48 ? 105 GLN A CG    1 
ATOM 7666  C CD    . GLN M  3 92  ? 30.996  -115.631 1.659   1.00 421.10 ? 105 GLN A CD    1 
ATOM 7667  O OE1   . GLN M  3 92  ? 30.947  -114.418 1.828   1.00 416.91 ? 105 GLN A OE1   1 
ATOM 7668  N NE2   . GLN M  3 92  ? 29.928  -116.411 1.730   1.00 436.68 ? 105 GLN A NE2   1 
ATOM 7669  N N     . ALA M  3 93  ? 33.899  -116.376 -3.032  1.00 380.98 ? 106 ALA A N     1 
ATOM 7670  C CA    . ALA M  3 93  ? 33.636  -116.700 -4.450  1.00 380.07 ? 106 ALA A CA    1 
ATOM 7671  C C     . ALA M  3 93  ? 34.713  -117.592 -5.082  1.00 381.70 ? 106 ALA A C     1 
ATOM 7672  O O     . ALA M  3 93  ? 35.069  -118.644 -4.542  1.00 390.47 ? 106 ALA A O     1 
ATOM 7673  C CB    . ALA M  3 93  ? 33.433  -115.429 -5.272  1.00 370.37 ? 106 ALA A CB    1 
ATOM 7674  N N     . SER N  4 1   ? 27.183  -99.920  -2.184  1.00 325.31 ? 8   SER B N     1 
ATOM 7675  C CA    . SER N  4 1   ? 27.156  -99.159  -3.467  1.00 324.34 ? 8   SER B CA    1 
ATOM 7676  C C     . SER N  4 1   ? 28.560  -98.682  -3.885  1.00 331.20 ? 8   SER B C     1 
ATOM 7677  O O     . SER N  4 1   ? 29.311  -98.215  -3.034  1.00 331.47 ? 8   SER B O     1 
ATOM 7678  C CB    . SER N  4 1   ? 26.212  -97.977  -3.288  1.00 317.80 ? 8   SER B CB    1 
ATOM 7679  O OG    . SER N  4 1   ? 25.847  -97.443  -4.537  1.00 308.05 ? 8   SER B OG    1 
ATOM 7680  N N     . GLY N  4 2   ? 28.930  -98.818  -5.168  1.00 341.95 ? 9   GLY B N     1 
ATOM 7681  C CA    . GLY N  4 2   ? 30.298  -98.430  -5.623  1.00 351.26 ? 9   GLY B CA    1 
ATOM 7682  C C     . GLY N  4 2   ? 30.898  -98.815  -6.977  1.00 358.25 ? 9   GLY B C     1 
ATOM 7683  O O     . GLY N  4 2   ? 30.183  -98.876  -7.992  1.00 368.51 ? 9   GLY B O     1 
ATOM 7684  N N     . PHE N  4 3   ? 32.211  -99.129  -6.965  1.00 351.41 ? 10  PHE B N     1 
ATOM 7685  C CA    . PHE N  4 3   ? 33.126  -99.113  -8.158  1.00 341.25 ? 10  PHE B CA    1 
ATOM 7686  C C     . PHE N  4 3   ? 32.995  -100.246 -9.212  1.00 333.67 ? 10  PHE B C     1 
ATOM 7687  O O     . PHE N  4 3   ? 32.830  -101.412 -8.846  1.00 327.75 ? 10  PHE B O     1 
ATOM 7688  C CB    . PHE N  4 3   ? 34.599  -98.962  -7.697  1.00 335.63 ? 10  PHE B CB    1 
ATOM 7689  C CG    . PHE N  4 3   ? 35.091  -97.517  -7.620  1.00 334.27 ? 10  PHE B CG    1 
ATOM 7690  C CD1   . PHE N  4 3   ? 34.522  -96.598  -6.729  1.00 331.45 ? 10  PHE B CD1   1 
ATOM 7691  C CD2   . PHE N  4 3   ? 36.134  -97.072  -8.438  1.00 336.17 ? 10  PHE B CD2   1 
ATOM 7692  C CE1   . PHE N  4 3   ? 34.973  -95.279  -6.673  1.00 332.20 ? 10  PHE B CE1   1 
ATOM 7693  C CE2   . PHE N  4 3   ? 36.587  -95.754  -8.380  1.00 336.87 ? 10  PHE B CE2   1 
ATOM 7694  C CZ    . PHE N  4 3   ? 36.004  -94.856  -7.495  1.00 335.42 ? 10  PHE B CZ    1 
ATOM 7695  N N     . ARG N  4 4   ? 33.083  -99.899  -10.508 1.00 320.77 ? 11  ARG B N     1 
ATOM 7696  C CA    . ARG N  4 4   ? 32.878  -100.880 -11.593 1.00 309.40 ? 11  ARG B CA    1 
ATOM 7697  C C     . ARG N  4 4   ? 34.147  -101.596 -11.945 1.00 303.46 ? 11  ARG B C     1 
ATOM 7698  O O     . ARG N  4 4   ? 35.185  -100.968 -12.141 1.00 300.99 ? 11  ARG B O     1 
ATOM 7699  C CB    . ARG N  4 4   ? 32.389  -100.241 -12.871 1.00 314.60 ? 11  ARG B CB    1 
ATOM 7700  C CG    . ARG N  4 4   ? 31.240  -99.273  -12.731 1.00 323.66 ? 11  ARG B CG    1 
ATOM 7701  C CD    . ARG N  4 4   ? 30.658  -98.993  -14.103 1.00 334.40 ? 11  ARG B CD    1 
ATOM 7702  N NE    . ARG N  4 4   ? 31.679  -99.027  -15.154 1.00 349.62 ? 11  ARG B NE    1 
ATOM 7703  C CZ    . ARG N  4 4   ? 32.505  -98.023  -15.451 1.00 360.90 ? 11  ARG B CZ    1 
ATOM 7704  N NH1   . ARG N  4 4   ? 32.441  -96.879  -14.777 1.00 361.92 ? 11  ARG B NH1   1 
ATOM 7705  N NH2   . ARG N  4 4   ? 33.394  -98.166  -16.427 1.00 369.90 ? 11  ARG B NH2   1 
ATOM 7706  N N     . LYS N  4 5   ? 34.029  -102.916 -12.066 1.00 303.56 ? 12  LYS B N     1 
ATOM 7707  C CA    . LYS N  4 5   ? 35.179  -103.810 -12.187 1.00 311.16 ? 12  LYS B CA    1 
ATOM 7708  C C     . LYS N  4 5   ? 36.060  -103.489 -13.386 1.00 310.73 ? 12  LYS B C     1 
ATOM 7709  O O     . LYS N  4 5   ? 37.301  -103.431 -13.277 1.00 322.32 ? 12  LYS B O     1 
ATOM 7710  C CB    . LYS N  4 5   ? 34.731  -105.279 -12.247 1.00 319.88 ? 12  LYS B CB    1 
ATOM 7711  C CG    . LYS N  4 5   ? 34.636  -105.973 -10.897 1.00 323.64 ? 12  LYS B CG    1 
ATOM 7712  C CD    . LYS N  4 5   ? 34.311  -107.445 -11.074 1.00 331.43 ? 12  LYS B CD    1 
ATOM 7713  C CE    . LYS N  4 5   ? 35.533  -108.219 -11.540 1.00 333.01 ? 12  LYS B CE    1 
ATOM 7714  N NZ    . LYS N  4 5   ? 36.334  -108.605 -10.356 1.00 331.20 ? 12  LYS B NZ    1 
ATOM 7715  N N     . GLU N  4 6   ? 35.420  -103.289 -14.527 1.00 297.61 ? 13  GLU B N     1 
ATOM 7716  C CA    . GLU N  4 6   ? 36.170  -103.169 -15.763 1.00 284.01 ? 13  GLU B CA    1 
ATOM 7717  C C     . GLU N  4 6   ? 36.906  -101.826 -15.830 1.00 276.70 ? 13  GLU B C     1 
ATOM 7718  O O     . GLU N  4 6   ? 38.067  -101.761 -16.248 1.00 271.49 ? 13  GLU B O     1 
ATOM 7719  C CB    . GLU N  4 6   ? 35.273  -103.459 -16.956 1.00 281.88 ? 13  GLU B CB    1 
ATOM 7720  C CG    . GLU N  4 6   ? 36.048  -103.678 -18.222 1.00 282.59 ? 13  GLU B CG    1 
ATOM 7721  C CD    . GLU N  4 6   ? 35.719  -102.614 -19.217 1.00 285.60 ? 13  GLU B CD    1 
ATOM 7722  O OE1   . GLU N  4 6   ? 35.536  -102.942 -20.405 1.00 288.57 ? 13  GLU B OE1   1 
ATOM 7723  O OE2   . GLU N  4 6   ? 35.577  -101.465 -18.767 1.00 286.29 ? 13  GLU B OE2   1 
ATOM 7724  N N     . LEU N  4 7   ? 36.238  -100.781 -15.344 1.00 270.78 ? 14  LEU B N     1 
ATOM 7725  C CA    . LEU N  4 7   ? 36.858  -99.486  -15.068 1.00 261.54 ? 14  LEU B CA    1 
ATOM 7726  C C     . LEU N  4 7   ? 38.192  -99.581  -14.317 1.00 255.02 ? 14  LEU B C     1 
ATOM 7727  O O     . LEU N  4 7   ? 39.215  -99.116  -14.817 1.00 252.33 ? 14  LEU B O     1 
ATOM 7728  C CB    . LEU N  4 7   ? 35.897  -98.621  -14.257 1.00 259.22 ? 14  LEU B CB    1 
ATOM 7729  C CG    . LEU N  4 7   ? 36.427  -97.245  -13.855 1.00 252.99 ? 14  LEU B CG    1 
ATOM 7730  C CD1   . LEU N  4 7   ? 36.424  -96.300  -15.045 1.00 251.83 ? 14  LEU B CD1   1 
ATOM 7731  C CD2   . LEU N  4 7   ? 35.611  -96.686  -12.715 1.00 252.13 ? 14  LEU B CD2   1 
ATOM 7732  N N     . VAL N  4 8   ? 38.167  -100.169 -13.117 1.00 249.86 ? 15  VAL B N     1 
ATOM 7733  C CA    . VAL N  4 8   ? 39.348  -100.270 -12.230 1.00 242.64 ? 15  VAL B CA    1 
ATOM 7734  C C     . VAL N  4 8   ? 40.513  -100.975 -12.943 1.00 246.23 ? 15  VAL B C     1 
ATOM 7735  O O     . VAL N  4 8   ? 41.671  -100.524 -12.874 1.00 243.61 ? 15  VAL B O     1 
ATOM 7736  C CB    . VAL N  4 8   ? 39.022  -101.004 -10.887 1.00 236.43 ? 15  VAL B CB    1 
ATOM 7737  C CG1   . VAL N  4 8   ? 40.221  -101.024 -9.950  1.00 230.43 ? 15  VAL B CG1   1 
ATOM 7738  C CG2   . VAL N  4 8   ? 37.835  -100.376 -10.165 1.00 232.19 ? 15  VAL B CG2   1 
ATOM 7739  N N     . SER N  4 9   ? 40.179  -102.065 -13.638 1.00 251.49 ? 16  SER B N     1 
ATOM 7740  C CA    . SER N  4 9   ? 41.150  -102.929 -14.312 1.00 254.32 ? 16  SER B CA    1 
ATOM 7741  C C     . SER N  4 9   ? 41.884  -102.189 -15.404 1.00 261.91 ? 16  SER B C     1 
ATOM 7742  O O     . SER N  4 9   ? 43.117  -102.225 -15.463 1.00 267.21 ? 16  SER B O     1 
ATOM 7743  C CB    . SER N  4 9   ? 40.461  -104.159 -14.918 1.00 250.27 ? 16  SER B CB    1 
ATOM 7744  O OG    . SER N  4 9   ? 41.394  -105.057 -15.503 1.00 245.66 ? 16  SER B OG    1 
ATOM 7745  N N     . ARG N  4 10  ? 41.112  -101.539 -16.272 1.00 266.87 ? 17  ARG B N     1 
ATOM 7746  C CA    . ARG N  4 10  ? 41.651  -100.813 -17.417 1.00 272.32 ? 17  ARG B CA    1 
ATOM 7747  C C     . ARG N  4 10  ? 42.630  -99.725  -16.963 1.00 270.11 ? 17  ARG B C     1 
ATOM 7748  O O     . ARG N  4 10  ? 43.696  -99.547  -17.567 1.00 274.53 ? 17  ARG B O     1 
ATOM 7749  C CB    . ARG N  4 10  ? 40.513  -100.203 -18.258 1.00 275.77 ? 17  ARG B CB    1 
ATOM 7750  C CG    . ARG N  4 10  ? 39.733  -101.184 -19.131 1.00 279.68 ? 17  ARG B CG    1 
ATOM 7751  C CD    . ARG N  4 10  ? 38.775  -100.443 -20.060 1.00 285.19 ? 17  ARG B CD    1 
ATOM 7752  N NE    . ARG N  4 10  ? 38.306  -101.273 -21.171 1.00 289.94 ? 17  ARG B NE    1 
ATOM 7753  C CZ    . ARG N  4 10  ? 38.429  -100.953 -22.459 1.00 292.60 ? 17  ARG B CZ    1 
ATOM 7754  N NH1   . ARG N  4 10  ? 39.002  -99.808  -22.811 1.00 291.17 ? 17  ARG B NH1   1 
ATOM 7755  N NH2   . ARG N  4 10  ? 37.964  -101.777 -23.392 1.00 294.21 ? 17  ARG B NH2   1 
ATOM 7756  N N     . LEU N  4 11  ? 42.253  -99.025  -15.889 1.00 261.63 ? 18  LEU B N     1 
ATOM 7757  C CA    . LEU N  4 11  ? 42.998  -97.875  -15.374 1.00 250.69 ? 18  LEU B CA    1 
ATOM 7758  C C     . LEU N  4 11  ? 44.384  -98.274  -14.937 1.00 241.36 ? 18  LEU B C     1 
ATOM 7759  O O     . LEU N  4 11  ? 45.351  -97.643  -15.304 1.00 235.63 ? 18  LEU B O     1 
ATOM 7760  C CB    . LEU N  4 11  ? 42.256  -97.206  -14.212 1.00 251.52 ? 18  LEU B CB    1 
ATOM 7761  C CG    . LEU N  4 11  ? 41.350  -96.021  -14.571 1.00 253.02 ? 18  LEU B CG    1 
ATOM 7762  C CD1   . LEU N  4 11  ? 40.379  -95.772  -13.429 1.00 252.00 ? 18  LEU B CD1   1 
ATOM 7763  C CD2   . LEU N  4 11  ? 42.120  -94.748  -14.913 1.00 251.22 ? 18  LEU B CD2   1 
ATOM 7764  N N     . LEU N  4 12  ? 44.470  -99.334  -14.154 1.00 235.90 ? 19  LEU B N     1 
ATOM 7765  C CA    . LEU N  4 12  ? 45.751  -99.775  -13.636 1.00 234.76 ? 19  LEU B CA    1 
ATOM 7766  C C     . LEU N  4 12  ? 46.706  -100.351 -14.717 1.00 245.31 ? 19  LEU B C     1 
ATOM 7767  O O     . LEU N  4 12  ? 47.914  -100.097 -14.658 1.00 246.05 ? 19  LEU B O     1 
ATOM 7768  C CB    . LEU N  4 12  ? 45.543  -100.698 -12.417 1.00 228.07 ? 19  LEU B CB    1 
ATOM 7769  C CG    . LEU N  4 12  ? 45.065  -99.910  -11.171 1.00 219.78 ? 19  LEU B CG    1 
ATOM 7770  C CD1   . LEU N  4 12  ? 44.302  -100.750 -10.151 1.00 220.52 ? 19  LEU B CD1   1 
ATOM 7771  C CD2   . LEU N  4 12  ? 46.245  -99.210  -10.501 1.00 214.25 ? 19  LEU B CD2   1 
ATOM 7772  N N     . HIS N  4 13  ? 46.169  -101.071 -15.710 1.00 259.21 ? 20  HIS B N     1 
ATOM 7773  C CA    . HIS N  4 13  ? 46.988  -101.652 -16.805 1.00 271.95 ? 20  HIS B CA    1 
ATOM 7774  C C     . HIS N  4 13  ? 47.541  -100.612 -17.792 1.00 271.03 ? 20  HIS B C     1 
ATOM 7775  O O     . HIS N  4 13  ? 48.381  -100.927 -18.640 1.00 272.87 ? 20  HIS B O     1 
ATOM 7776  C CB    . HIS N  4 13  ? 46.230  -102.755 -17.559 1.00 286.70 ? 20  HIS B CB    1 
ATOM 7777  C CG    . HIS N  4 13  ? 46.535  -104.146 -17.082 1.00 300.56 ? 20  HIS B CG    1 
ATOM 7778  N ND1   . HIS N  4 13  ? 45.649  -104.886 -16.330 1.00 306.68 ? 20  HIS B ND1   1 
ATOM 7779  C CD2   . HIS N  4 13  ? 47.623  -104.933 -17.260 1.00 308.07 ? 20  HIS B CD2   1 
ATOM 7780  C CE1   . HIS N  4 13  ? 46.175  -106.067 -16.063 1.00 312.70 ? 20  HIS B CE1   1 
ATOM 7781  N NE2   . HIS N  4 13  ? 47.372  -106.123 -16.618 1.00 314.79 ? 20  HIS B NE2   1 
ATOM 7782  N N     . LEU N  4 14  ? 47.072  -99.373  -17.678 1.00 268.30 ? 21  LEU B N     1 
ATOM 7783  C CA    . LEU N  4 14  ? 47.661  -98.279  -18.447 1.00 268.61 ? 21  LEU B CA    1 
ATOM 7784  C C     . LEU N  4 14  ? 49.023  -97.786  -17.914 1.00 264.57 ? 21  LEU B C     1 
ATOM 7785  O O     . LEU N  4 14  ? 49.797  -97.207  -18.673 1.00 267.86 ? 21  LEU B O     1 
ATOM 7786  C CB    . LEU N  4 14  ? 46.694  -97.094  -18.580 1.00 267.27 ? 21  LEU B CB    1 
ATOM 7787  C CG    . LEU N  4 14  ? 45.881  -96.871  -19.857 1.00 269.17 ? 21  LEU B CG    1 
ATOM 7788  C CD1   . LEU N  4 14  ? 45.545  -95.398  -19.980 1.00 265.24 ? 21  LEU B CD1   1 
ATOM 7789  C CD2   . LEU N  4 14  ? 46.603  -97.373  -21.094 1.00 274.81 ? 21  LEU B CD2   1 
ATOM 7790  N N     . HIS N  4 15  ? 49.316  -98.009  -16.631 1.00 255.18 ? 22  HIS B N     1 
ATOM 7791  C CA    . HIS N  4 15  ? 50.510  -97.425  -16.022 1.00 246.07 ? 22  HIS B CA    1 
ATOM 7792  C C     . HIS N  4 15  ? 51.554  -98.445  -15.557 1.00 242.40 ? 22  HIS B C     1 
ATOM 7793  O O     . HIS N  4 15  ? 52.677  -98.075  -15.241 1.00 231.66 ? 22  HIS B O     1 
ATOM 7794  C CB    . HIS N  4 15  ? 50.117  -96.449  -14.909 1.00 245.52 ? 22  HIS B CB    1 
ATOM 7795  C CG    . HIS N  4 15  ? 49.097  -95.428  -15.329 1.00 249.36 ? 22  HIS B CG    1 
ATOM 7796  N ND1   . HIS N  4 15  ? 49.325  -94.508  -16.332 1.00 252.72 ? 22  HIS B ND1   1 
ATOM 7797  C CD2   . HIS N  4 15  ? 47.850  -95.170  -14.865 1.00 249.28 ? 22  HIS B CD2   1 
ATOM 7798  C CE1   . HIS N  4 15  ? 48.259  -93.739  -16.477 1.00 253.38 ? 22  HIS B CE1   1 
ATOM 7799  N NE2   . HIS N  4 15  ? 47.351  -94.119  -15.597 1.00 250.06 ? 22  HIS B NE2   1 
ATOM 7800  N N     . PHE N  4 16  ? 51.180  -99.724  -15.526 1.00 249.50 ? 23  PHE B N     1 
ATOM 7801  C CA    . PHE N  4 16  ? 52.140  -100.823 -15.388 1.00 259.93 ? 23  PHE B CA    1 
ATOM 7802  C C     . PHE N  4 16  ? 53.159  -100.696 -16.510 1.00 267.02 ? 23  PHE B C     1 
ATOM 7803  O O     . PHE N  4 16  ? 52.769  -100.431 -17.655 1.00 270.99 ? 23  PHE B O     1 
ATOM 7804  C CB    . PHE N  4 16  ? 51.458  -102.193 -15.574 1.00 267.24 ? 23  PHE B CB    1 
ATOM 7805  C CG    . PHE N  4 16  ? 50.495  -102.597 -14.472 1.00 272.83 ? 23  PHE B CG    1 
ATOM 7806  C CD1   . PHE N  4 16  ? 50.710  -102.267 -13.132 1.00 275.96 ? 23  PHE B CD1   1 
ATOM 7807  C CD2   . PHE N  4 16  ? 49.384  -103.379 -14.783 1.00 277.47 ? 23  PHE B CD2   1 
ATOM 7808  C CE1   . PHE N  4 16  ? 49.814  -102.674 -12.146 1.00 281.56 ? 23  PHE B CE1   1 
ATOM 7809  C CE2   . PHE N  4 16  ? 48.484  -103.787 -13.805 1.00 281.52 ? 23  PHE B CE2   1 
ATOM 7810  C CZ    . PHE N  4 16  ? 48.697  -103.435 -12.480 1.00 283.84 ? 23  PHE B CZ    1 
ATOM 7811  N N     . LYS N  4 17  ? 54.443  -100.904 -16.204 1.00 274.50 ? 24  LYS B N     1 
ATOM 7812  C CA    . LYS N  4 17  ? 55.486  -100.939 -17.256 1.00 286.86 ? 24  LYS B CA    1 
ATOM 7813  C C     . LYS N  4 17  ? 55.972  -102.350 -17.711 1.00 306.97 ? 24  LYS B C     1 
ATOM 7814  O O     . LYS N  4 17  ? 56.768  -102.443 -18.645 1.00 313.18 ? 24  LYS B O     1 
ATOM 7815  C CB    . LYS N  4 17  ? 56.665  -99.982  -16.958 1.00 275.41 ? 24  LYS B CB    1 
ATOM 7816  C CG    . LYS N  4 17  ? 56.296  -98.494  -16.879 1.00 261.17 ? 24  LYS B CG    1 
ATOM 7817  C CD    . LYS N  4 17  ? 55.689  -97.931  -18.169 1.00 256.95 ? 24  LYS B CD    1 
ATOM 7818  C CE    . LYS N  4 17  ? 54.490  -97.009  -17.931 1.00 247.78 ? 24  LYS B CE    1 
ATOM 7819  N NZ    . LYS N  4 17  ? 54.799  -95.573  -17.670 1.00 242.32 ? 24  LYS B NZ    1 
ATOM 7820  N N     . ASP N  4 18  ? 55.509  -103.428 -17.055 1.00 323.47 ? 25  ASP B N     1 
ATOM 7821  C CA    . ASP N  4 18  ? 55.486  -104.802 -17.681 1.00 341.53 ? 25  ASP B CA    1 
ATOM 7822  C C     . ASP N  4 18  ? 54.039  -105.327 -17.966 1.00 350.67 ? 25  ASP B C     1 
ATOM 7823  O O     . ASP N  4 18  ? 53.197  -105.376 -17.056 1.00 349.48 ? 25  ASP B O     1 
ATOM 7824  C CB    . ASP N  4 18  ? 56.313  -105.867 -16.898 1.00 343.20 ? 25  ASP B CB    1 
ATOM 7825  C CG    . ASP N  4 18  ? 56.485  -107.201 -17.686 1.00 348.82 ? 25  ASP B CG    1 
ATOM 7826  O OD1   . ASP N  4 18  ? 56.041  -107.289 -18.856 1.00 352.77 ? 25  ASP B OD1   1 
ATOM 7827  O OD2   . ASP N  4 18  ? 57.064  -108.167 -17.146 1.00 348.44 ? 25  ASP B OD2   1 
ATOM 7828  N N     . ASP N  4 19  ? 53.764  -105.737 -19.219 1.00 362.26 ? 26  ASP B N     1 
ATOM 7829  C CA    . ASP N  4 19  ? 52.431  -106.244 -19.641 1.00 365.83 ? 26  ASP B CA    1 
ATOM 7830  C C     . ASP N  4 19  ? 52.167  -107.732 -19.385 1.00 370.89 ? 26  ASP B C     1 
ATOM 7831  O O     . ASP N  4 19  ? 51.050  -108.208 -19.638 1.00 371.59 ? 26  ASP B O     1 
ATOM 7832  C CB    . ASP N  4 19  ? 52.155  -105.927 -21.112 1.00 365.76 ? 26  ASP B CB    1 
ATOM 7833  C CG    . ASP N  4 19  ? 51.723  -104.500 -21.323 1.00 359.26 ? 26  ASP B CG    1 
ATOM 7834  O OD1   . ASP N  4 19  ? 51.137  -103.893 -20.400 1.00 352.66 ? 26  ASP B OD1   1 
ATOM 7835  O OD2   . ASP N  4 19  ? 51.981  -103.971 -22.418 1.00 359.71 ? 26  ASP B OD2   1 
ATOM 7836  N N     . LYS N  4 20  ? 53.189  -108.449 -18.900 1.00 371.47 ? 27  LYS B N     1 
ATOM 7837  C CA    . LYS N  4 20  ? 53.061  -109.858 -18.488 1.00 366.63 ? 27  LYS B CA    1 
ATOM 7838  C C     . LYS N  4 20  ? 52.162  -109.981 -17.264 1.00 361.24 ? 27  LYS B C     1 
ATOM 7839  O O     . LYS N  4 20  ? 51.509  -111.001 -17.057 1.00 361.03 ? 27  LYS B O     1 
ATOM 7840  C CB    . LYS N  4 20  ? 54.435  -110.482 -18.226 1.00 361.38 ? 27  LYS B CB    1 
ATOM 7841  C CG    . LYS N  4 20  ? 55.267  -110.584 -19.484 1.00 354.59 ? 27  LYS B CG    1 
ATOM 7842  C CD    . LYS N  4 20  ? 56.720  -110.921 -19.234 1.00 343.91 ? 27  LYS B CD    1 
ATOM 7843  C CE    . LYS N  4 20  ? 57.556  -110.187 -20.266 1.00 338.91 ? 27  LYS B CE    1 
ATOM 7844  N NZ    . LYS N  4 20  ? 59.013  -110.349 -20.029 1.00 339.17 ? 27  LYS B NZ    1 
ATOM 7845  N N     . THR N  4 21  ? 52.123  -108.913 -16.474 1.00 354.86 ? 28  THR B N     1 
ATOM 7846  C CA    . THR N  4 21  ? 51.184  -108.736 -15.351 1.00 347.09 ? 28  THR B CA    1 
ATOM 7847  C C     . THR N  4 21  ? 49.692  -109.100 -15.663 1.00 342.63 ? 28  THR B C     1 
ATOM 7848  O O     . THR N  4 21  ? 49.048  -108.465 -16.516 1.00 348.07 ? 28  THR B O     1 
ATOM 7849  C CB    . THR N  4 21  ? 51.305  -107.281 -14.786 1.00 341.09 ? 28  THR B CB    1 
ATOM 7850  O OG1   . THR N  4 21  ? 52.674  -106.988 -14.448 1.00 339.64 ? 28  THR B OG1   1 
ATOM 7851  C CG2   . THR N  4 21  ? 50.396  -107.042 -13.561 1.00 335.49 ? 28  THR B CG2   1 
ATOM 7852  N N     . LYS N  4 22  ? 49.175  -110.122 -14.966 1.00 332.42 ? 29  LYS B N     1 
ATOM 7853  C CA    . LYS N  4 22  ? 47.735  -110.456 -14.954 1.00 317.47 ? 29  LYS B CA    1 
ATOM 7854  C C     . LYS N  4 22  ? 47.175  -110.288 -13.513 1.00 304.10 ? 29  LYS B C     1 
ATOM 7855  O O     . LYS N  4 22  ? 47.877  -110.601 -12.557 1.00 303.11 ? 29  LYS B O     1 
ATOM 7856  C CB    . LYS N  4 22  ? 47.498  -111.885 -15.506 1.00 318.55 ? 29  LYS B CB    1 
ATOM 7857  C CG    . LYS N  4 22  ? 48.159  -112.223 -16.847 1.00 312.08 ? 29  LYS B CG    1 
ATOM 7858  C CD    . LYS N  4 22  ? 47.297  -111.878 -18.070 1.00 301.92 ? 29  LYS B CD    1 
ATOM 7859  C CE    . LYS N  4 22  ? 47.820  -112.576 -19.311 1.00 296.48 ? 29  LYS B CE    1 
ATOM 7860  N NZ    . LYS N  4 22  ? 47.099  -112.234 -20.585 1.00 289.96 ? 29  LYS B NZ    1 
ATOM 7861  N N     . VAL N  4 23  ? 45.951  -109.761 -13.357 1.00 288.35 ? 30  VAL B N     1 
ATOM 7862  C CA    . VAL N  4 23  ? 45.354  -109.559 -12.003 1.00 276.94 ? 30  VAL B CA    1 
ATOM 7863  C C     . VAL N  4 23  ? 44.192  -110.516 -11.720 1.00 287.09 ? 30  VAL B C     1 
ATOM 7864  O O     . VAL N  4 23  ? 43.202  -110.562 -12.461 1.00 288.65 ? 30  VAL B O     1 
ATOM 7865  C CB    . VAL N  4 23  ? 44.916  -108.089 -11.703 1.00 260.32 ? 30  VAL B CB    1 
ATOM 7866  C CG1   . VAL N  4 23  ? 44.489  -107.936 -10.239 1.00 256.53 ? 30  VAL B CG1   1 
ATOM 7867  C CG2   . VAL N  4 23  ? 46.026  -107.096 -12.023 1.00 250.23 ? 30  VAL B CG2   1 
ATOM 7868  N N     . SER N  4 24  ? 44.346  -111.274 -10.635 1.00 297.59 ? 31  SER B N     1 
ATOM 7869  C CA    . SER N  4 24  ? 43.337  -112.210 -10.156 1.00 306.87 ? 31  SER B CA    1 
ATOM 7870  C C     . SER N  4 24  ? 42.050  -111.471 -9.794  1.00 314.90 ? 31  SER B C     1 
ATOM 7871  O O     . SER N  4 24  ? 42.084  -110.304 -9.366  1.00 329.07 ? 31  SER B O     1 
ATOM 7872  C CB    . SER N  4 24  ? 43.862  -112.978 -8.942  1.00 304.23 ? 31  SER B CB    1 
ATOM 7873  O OG    . SER N  4 24  ? 44.026  -112.110 -7.830  1.00 301.06 ? 31  SER B OG    1 
ATOM 7874  N N     . GLY N  4 25  ? 40.926  -112.168 -9.961  1.00 316.06 ? 32  GLY B N     1 
ATOM 7875  C CA    . GLY N  4 25  ? 39.579  -111.598 -9.788  1.00 311.88 ? 32  GLY B CA    1 
ATOM 7876  C C     . GLY N  4 25  ? 39.215  -111.098 -8.400  1.00 306.08 ? 32  GLY B C     1 
ATOM 7877  O O     . GLY N  4 25  ? 38.569  -110.062 -8.246  1.00 300.70 ? 32  GLY B O     1 
ATOM 7878  N N     . ASP N  4 26  ? 39.627  -111.831 -7.383  1.00 304.68 ? 33  ASP B N     1 
ATOM 7879  C CA    . ASP N  4 26  ? 39.421  -111.364 -6.033  1.00 303.41 ? 33  ASP B CA    1 
ATOM 7880  C C     . ASP N  4 26  ? 40.284  -110.148 -5.676  1.00 302.50 ? 33  ASP B C     1 
ATOM 7881  O O     . ASP N  4 26  ? 39.775  -109.274 -4.994  1.00 302.72 ? 33  ASP B O     1 
ATOM 7882  C CB    . ASP N  4 26  ? 39.570  -112.506 -5.044  1.00 307.53 ? 33  ASP B CB    1 
ATOM 7883  C CG    . ASP N  4 26  ? 38.621  -113.642 -5.337  1.00 309.05 ? 33  ASP B CG    1 
ATOM 7884  O OD1   . ASP N  4 26  ? 37.603  -113.409 -6.039  1.00 300.60 ? 33  ASP B OD1   1 
ATOM 7885  O OD2   . ASP N  4 26  ? 38.905  -114.761 -4.861  1.00 316.51 ? 33  ASP B OD2   1 
ATOM 7886  N N     . ALA N  4 27  ? 41.541  -110.063 -6.160  1.00 301.69 ? 34  ALA B N     1 
ATOM 7887  C CA    . ALA N  4 27  ? 42.387  -108.836 -6.022  1.00 295.72 ? 34  ALA B CA    1 
ATOM 7888  C C     . ALA N  4 27  ? 41.778  -107.562 -6.666  1.00 291.69 ? 34  ALA B C     1 
ATOM 7889  O O     . ALA N  4 27  ? 41.939  -106.458 -6.127  1.00 283.12 ? 34  ALA B O     1 
ATOM 7890  C CB    . ALA N  4 27  ? 43.811  -109.068 -6.533  1.00 295.93 ? 34  ALA B CB    1 
ATOM 7891  N N     . LEU N  4 28  ? 41.086  -107.723 -7.807  1.00 294.54 ? 35  LEU B N     1 
ATOM 7892  C CA    . LEU N  4 28  ? 40.316  -106.629 -8.474  1.00 288.25 ? 35  LEU B CA    1 
ATOM 7893  C C     . LEU N  4 28  ? 39.011  -106.258 -7.725  1.00 280.04 ? 35  LEU B C     1 
ATOM 7894  O O     . LEU N  4 28  ? 38.649  -105.069 -7.640  1.00 274.92 ? 35  LEU B O     1 
ATOM 7895  C CB    . LEU N  4 28  ? 40.038  -106.951 -9.960  1.00 293.58 ? 35  LEU B CB    1 
ATOM 7896  C CG    . LEU N  4 28  ? 39.434  -105.886 -10.887 1.00 293.38 ? 35  LEU B CG    1 
ATOM 7897  C CD1   . LEU N  4 28  ? 40.319  -104.648 -10.984 1.00 291.65 ? 35  LEU B CD1   1 
ATOM 7898  C CD2   . LEU N  4 28  ? 39.172  -106.483 -12.263 1.00 294.39 ? 35  LEU B CD2   1 
ATOM 7899  N N     . GLN N  4 29  ? 38.319  -107.280 -7.203  1.00 274.70 ? 36  GLN B N     1 
ATOM 7900  C CA    A GLN N  4 29  ? 37.169  -107.076 -6.320  0.50 274.09 ? 36  GLN B CA    1 
ATOM 7901  C CA    B GLN N  4 29  ? 37.173  -107.081 -6.318  0.50 273.79 ? 36  GLN B CA    1 
ATOM 7902  C C     . GLN N  4 29  ? 37.615  -106.242 -5.116  1.00 280.14 ? 36  GLN B C     1 
ATOM 7903  O O     . GLN N  4 29  ? 36.886  -105.367 -4.670  1.00 279.10 ? 36  GLN B O     1 
ATOM 7904  C CB    A GLN N  4 29  ? 36.573  -108.411 -5.854  0.50 268.61 ? 36  GLN B CB    1 
ATOM 7905  C CB    B GLN N  4 29  ? 36.595  -108.424 -5.857  0.50 267.95 ? 36  GLN B CB    1 
ATOM 7906  C CG    A GLN N  4 29  ? 35.814  -109.206 -6.909  0.50 265.44 ? 36  GLN B CG    1 
ATOM 7907  C CG    B GLN N  4 29  ? 35.690  -109.122 -6.864  0.50 264.05 ? 36  GLN B CG    1 
ATOM 7908  C CD    A GLN N  4 29  ? 34.438  -108.645 -7.205  0.50 263.43 ? 36  GLN B CD    1 
ATOM 7909  C CD    B GLN N  4 29  ? 34.413  -108.352 -7.118  0.50 261.32 ? 36  GLN B CD    1 
ATOM 7910  O OE1   A GLN N  4 29  ? 34.138  -107.497 -6.886  0.50 259.97 ? 36  GLN B OE1   1 
ATOM 7911  O OE1   B GLN N  4 29  ? 34.322  -107.168 -6.807  0.50 257.11 ? 36  GLN B OE1   1 
ATOM 7912  N NE2   A GLN N  4 29  ? 33.592  -109.458 -7.824  0.50 265.12 ? 36  GLN B NE2   1 
ATOM 7913  N NE2   B GLN N  4 29  ? 33.420  -109.020 -7.690  0.50 262.76 ? 36  GLN B NE2   1 
ATOM 7914  N N     . LEU N  4 30  ? 38.829  -106.528 -4.616  1.00 300.55 ? 37  LEU B N     1 
ATOM 7915  C CA    . LEU N  4 30  ? 39.530  -105.762 -3.564  1.00 319.60 ? 37  LEU B CA    1 
ATOM 7916  C C     . LEU N  4 30  ? 39.780  -104.314 -3.983  1.00 319.19 ? 37  LEU B C     1 
ATOM 7917  O O     . LEU N  4 30  ? 39.652  -103.397 -3.174  1.00 324.74 ? 37  LEU B O     1 
ATOM 7918  C CB    . LEU N  4 30  ? 40.895  -106.402 -3.225  1.00 326.81 ? 37  LEU B CB    1 
ATOM 7919  C CG    . LEU N  4 30  ? 41.109  -107.420 -2.085  1.00 335.26 ? 37  LEU B CG    1 
ATOM 7920  C CD1   . LEU N  4 30  ? 42.497  -108.052 -2.177  1.00 337.95 ? 37  LEU B CD1   1 
ATOM 7921  C CD2   . LEU N  4 30  ? 40.912  -106.809 -0.698  1.00 336.74 ? 37  LEU B CD2   1 
ATOM 7922  N N     . MET N  4 31  ? 40.157  -104.114 -5.241  1.00 306.36 ? 38  MET B N     1 
ATOM 7923  C CA    . MET N  4 31  ? 40.429  -102.775 -5.748  1.00 289.85 ? 38  MET B CA    1 
ATOM 7924  C C     . MET N  4 31  ? 39.191  -101.911 -5.911  1.00 286.87 ? 38  MET B C     1 
ATOM 7925  O O     . MET N  4 31  ? 39.253  -100.697 -5.682  1.00 286.40 ? 38  MET B O     1 
ATOM 7926  C CB    . MET N  4 31  ? 41.235  -102.842 -7.030  1.00 278.32 ? 38  MET B CB    1 
ATOM 7927  C CG    . MET N  4 31  ? 42.689  -103.139 -6.730  1.00 269.77 ? 38  MET B CG    1 
ATOM 7928  S SD    . MET N  4 31  ? 43.285  -102.150 -5.339  1.00 256.81 ? 38  MET B SD    1 
ATOM 7929  C CE    . MET N  4 31  ? 43.381  -100.522 -6.087  1.00 260.66 ? 38  MET B CE    1 
ATOM 7930  N N     . VAL N  4 32  ? 38.084  -102.547 -6.297  1.00 279.45 ? 39  VAL B N     1 
ATOM 7931  C CA    . VAL N  4 32  ? 36.745  -101.953 -6.217  1.00 272.77 ? 39  VAL B CA    1 
ATOM 7932  C C     . VAL N  4 32  ? 36.484  -101.362 -4.814  1.00 283.39 ? 39  VAL B C     1 
ATOM 7933  O O     . VAL N  4 32  ? 36.117  -100.185 -4.694  1.00 281.77 ? 39  VAL B O     1 
ATOM 7934  C CB    . VAL N  4 32  ? 35.673  -102.991 -6.599  1.00 262.58 ? 39  VAL B CB    1 
ATOM 7935  C CG1   . VAL N  4 32  ? 34.282  -102.543 -6.174  1.00 260.62 ? 39  VAL B CG1   1 
ATOM 7936  C CG2   . VAL N  4 32  ? 35.742  -103.264 -8.089  1.00 254.36 ? 39  VAL B CG2   1 
ATOM 7937  N N     . GLU N  4 33  ? 36.715  -102.174 -3.767  1.00 296.62 ? 40  GLU B N     1 
ATOM 7938  C CA    . GLU N  4 33  ? 36.643  -101.749 -2.333  1.00 301.35 ? 40  GLU B CA    1 
ATOM 7939  C C     . GLU N  4 33  ? 37.635  -100.621 -1.952  1.00 301.36 ? 40  GLU B C     1 
ATOM 7940  O O     . GLU N  4 33  ? 37.234  -99.623  -1.346  1.00 302.07 ? 40  GLU B O     1 
ATOM 7941  C CB    . GLU N  4 33  ? 36.860  -102.931 -1.352  1.00 301.27 ? 40  GLU B CB    1 
ATOM 7942  C CG    . GLU N  4 33  ? 35.972  -104.159 -1.530  1.00 299.52 ? 40  GLU B CG    1 
ATOM 7943  C CD    . GLU N  4 33  ? 34.662  -104.075 -0.771  1.00 299.99 ? 40  GLU B CD    1 
ATOM 7944  O OE1   . GLU N  4 33  ? 33.918  -105.073 -0.804  1.00 300.93 ? 40  GLU B OE1   1 
ATOM 7945  O OE2   . GLU N  4 33  ? 34.373  -103.034 -0.136  1.00 299.83 ? 40  GLU B OE2   1 
ATOM 7946  N N     . LEU N  4 34  ? 38.917  -100.799 -2.285  1.00 297.54 ? 41  LEU B N     1 
ATOM 7947  C CA    . LEU N  4 34  ? 39.969  -99.828  -1.936  1.00 282.99 ? 41  LEU B CA    1 
ATOM 7948  C C     . LEU N  4 34  ? 39.744  -98.437  -2.552  1.00 272.02 ? 41  LEU B C     1 
ATOM 7949  O O     . LEU N  4 34  ? 39.902  -97.416  -1.875  1.00 270.18 ? 41  LEU B O     1 
ATOM 7950  C CB    . LEU N  4 34  ? 41.336  -100.387 -2.318  1.00 279.15 ? 41  LEU B CB    1 
ATOM 7951  C CG    . LEU N  4 34  ? 42.610  -99.574  -2.090  1.00 273.42 ? 41  LEU B CG    1 
ATOM 7952  C CD1   . LEU N  4 34  ? 42.656  -98.851  -0.750  1.00 274.30 ? 41  LEU B CD1   1 
ATOM 7953  C CD2   . LEU N  4 34  ? 43.783  -100.524 -2.216  1.00 272.39 ? 41  LEU B CD2   1 
ATOM 7954  N N     . LEU N  4 35  ? 39.363  -98.406  -3.824  1.00 261.63 ? 42  LEU B N     1 
ATOM 7955  C CA    . LEU N  4 35  ? 39.014  -97.162  -4.486  1.00 254.35 ? 42  LEU B CA    1 
ATOM 7956  C C     . LEU N  4 35  ? 37.719  -96.569  -3.949  1.00 257.69 ? 42  LEU B C     1 
ATOM 7957  O O     . LEU N  4 35  ? 37.631  -95.361  -3.764  1.00 262.62 ? 42  LEU B O     1 
ATOM 7958  C CB    . LEU N  4 35  ? 38.915  -97.380  -5.983  1.00 249.23 ? 42  LEU B CB    1 
ATOM 7959  C CG    . LEU N  4 35  ? 40.221  -97.455  -6.768  1.00 244.06 ? 42  LEU B CG    1 
ATOM 7960  C CD1   . LEU N  4 35  ? 39.907  -97.674  -8.238  1.00 244.22 ? 42  LEU B CD1   1 
ATOM 7961  C CD2   . LEU N  4 35  ? 41.033  -96.184  -6.578  1.00 240.09 ? 42  LEU B CD2   1 
ATOM 7962  N N     . LYS N  4 36  ? 36.729  -97.425  -3.696  1.00 257.02 ? 43  LYS B N     1 
ATOM 7963  C CA    . LYS N  4 36  ? 35.489  -97.024  -3.033  1.00 257.57 ? 43  LYS B CA    1 
ATOM 7964  C C     . LYS N  4 36  ? 35.841  -96.274  -1.749  1.00 265.94 ? 43  LYS B C     1 
ATOM 7965  O O     . LYS N  4 36  ? 35.446  -95.123  -1.567  1.00 269.81 ? 43  LYS B O     1 
ATOM 7966  C CB    . LYS N  4 36  ? 34.599  -98.255  -2.780  1.00 250.74 ? 43  LYS B CB    1 
ATOM 7967  C CG    . LYS N  4 36  ? 33.535  -98.133  -1.694  1.00 249.37 ? 43  LYS B CG    1 
ATOM 7968  C CD    . LYS N  4 36  ? 33.315  -99.479  -1.009  1.00 250.20 ? 43  LYS B CD    1 
ATOM 7969  C CE    . LYS N  4 36  ? 32.661  -99.330  0.359   1.00 253.85 ? 43  LYS B CE    1 
ATOM 7970  N NZ    . LYS N  4 36  ? 31.178  -99.302  0.292   1.00 252.37 ? 43  LYS B NZ    1 
ATOM 7971  N N     . VAL N  4 37  ? 36.635  -96.916  -0.893  1.00 274.34 ? 44  VAL B N     1 
ATOM 7972  C CA    . VAL N  4 37  ? 37.031  -96.335  0.397   1.00 284.02 ? 44  VAL B CA    1 
ATOM 7973  C C     . VAL N  4 37  ? 37.956  -95.111  0.236   1.00 289.31 ? 44  VAL B C     1 
ATOM 7974  O O     . VAL N  4 37  ? 37.902  -94.186  1.053   1.00 296.58 ? 44  VAL B O     1 
ATOM 7975  C CB    . VAL N  4 37  ? 37.627  -97.391  1.379   1.00 283.77 ? 44  VAL B CB    1 
ATOM 7976  C CG1   . VAL N  4 37  ? 37.794  -96.798  2.773   1.00 285.55 ? 44  VAL B CG1   1 
ATOM 7977  C CG2   . VAL N  4 37  ? 36.734  -98.625  1.478   1.00 280.87 ? 44  VAL B CG2   1 
ATOM 7978  N N     . PHE N  4 38  ? 38.774  -95.084  -0.817  1.00 288.44 ? 45  PHE B N     1 
ATOM 7979  C CA    . PHE N  4 38  ? 39.592  -93.900  -1.105  1.00 286.89 ? 45  PHE B CA    1 
ATOM 7980  C C     . PHE N  4 38  ? 38.725  -92.646  -1.225  1.00 285.29 ? 45  PHE B C     1 
ATOM 7981  O O     . PHE N  4 38  ? 38.931  -91.665  -0.504  1.00 282.93 ? 45  PHE B O     1 
ATOM 7982  C CB    . PHE N  4 38  ? 40.415  -94.071  -2.389  1.00 286.06 ? 45  PHE B CB    1 
ATOM 7983  C CG    . PHE N  4 38  ? 41.256  -92.856  -2.741  1.00 290.02 ? 45  PHE B CG    1 
ATOM 7984  C CD1   . PHE N  4 38  ? 42.616  -92.842  -2.468  1.00 295.77 ? 45  PHE B CD1   1 
ATOM 7985  C CD2   . PHE N  4 38  ? 40.691  -91.714  -3.338  1.00 289.27 ? 45  PHE B CD2   1 
ATOM 7986  C CE1   . PHE N  4 38  ? 43.399  -91.730  -2.779  1.00 299.16 ? 45  PHE B CE1   1 
ATOM 7987  C CE2   . PHE N  4 38  ? 41.470  -90.596  -3.649  1.00 292.51 ? 45  PHE B CE2   1 
ATOM 7988  C CZ    . PHE N  4 38  ? 42.828  -90.606  -3.369  1.00 296.44 ? 45  PHE B CZ    1 
ATOM 7989  N N     . VAL N  4 39  ? 37.766  -92.694  -2.152  1.00 284.35 ? 46  VAL B N     1 
ATOM 7990  C CA    . VAL N  4 39  ? 36.891  -91.559  -2.457  1.00 283.38 ? 46  VAL B CA    1 
ATOM 7991  C C     . VAL N  4 39  ? 36.011  -91.240  -1.258  1.00 287.10 ? 46  VAL B C     1 
ATOM 7992  O O     . VAL N  4 39  ? 35.828  -90.071  -0.946  1.00 281.10 ? 46  VAL B O     1 
ATOM 7993  C CB    . VAL N  4 39  ? 36.015  -91.791  -3.720  1.00 284.60 ? 46  VAL B CB    1 
ATOM 7994  C CG1   . VAL N  4 39  ? 35.159  -90.568  -4.022  1.00 283.92 ? 46  VAL B CG1   1 
ATOM 7995  C CG2   . VAL N  4 39  ? 36.878  -92.114  -4.929  1.00 284.74 ? 46  VAL B CG2   1 
ATOM 7996  N N     . VAL N  4 40  ? 35.493  -92.283  -0.597  1.00 295.22 ? 47  VAL B N     1 
ATOM 7997  C CA    . VAL N  4 40  ? 34.716  -92.174  0.659   1.00 303.97 ? 47  VAL B CA    1 
ATOM 7998  C C     . VAL N  4 40  ? 35.420  -91.294  1.706   1.00 311.71 ? 47  VAL B C     1 
ATOM 7999  O O     . VAL N  4 40  ? 34.844  -90.320  2.187   1.00 321.09 ? 47  VAL B O     1 
ATOM 8000  C CB    . VAL N  4 40  ? 34.335  -93.585  1.245   1.00 300.22 ? 47  VAL B CB    1 
ATOM 8001  C CG1   . VAL N  4 40  ? 34.034  -93.567  2.750   1.00 297.94 ? 47  VAL B CG1   1 
ATOM 8002  C CG2   . VAL N  4 40  ? 33.161  -94.190  0.489   1.00 298.80 ? 47  VAL B CG2   1 
ATOM 8003  N N     . GLU N  4 41  ? 36.664  -91.620  2.049   1.00 310.09 ? 48  GLU B N     1 
ATOM 8004  C CA    . GLU N  4 41  ? 37.347  -90.884  3.112   1.00 305.58 ? 48  GLU B CA    1 
ATOM 8005  C C     . GLU N  4 41  ? 37.879  -89.547  2.611   1.00 297.55 ? 48  GLU B C     1 
ATOM 8006  O O     . GLU N  4 41  ? 37.957  -88.594  3.380   1.00 300.25 ? 48  GLU B O     1 
ATOM 8007  C CB    . GLU N  4 41  ? 38.408  -91.742  3.818   1.00 305.72 ? 48  GLU B CB    1 
ATOM 8008  C CG    . GLU N  4 41  ? 37.821  -92.871  4.687   1.00 298.31 ? 48  GLU B CG    1 
ATOM 8009  C CD    . GLU N  4 41  ? 37.369  -92.410  6.073   1.00 293.58 ? 48  GLU B CD    1 
ATOM 8010  O OE1   . GLU N  4 41  ? 38.121  -91.638  6.707   1.00 292.38 ? 48  GLU B OE1   1 
ATOM 8011  O OE2   . GLU N  4 41  ? 36.280  -92.826  6.535   1.00 284.86 ? 48  GLU B OE2   1 
ATOM 8012  N N     . ALA N  4 42  ? 38.187  -89.472  1.314   1.00 280.18 ? 49  ALA B N     1 
ATOM 8013  C CA    . ALA N  4 42  ? 38.416  -88.189  0.648   1.00 266.14 ? 49  ALA B CA    1 
ATOM 8014  C C     . ALA N  4 42  ? 37.199  -87.278  0.875   1.00 264.78 ? 49  ALA B C     1 
ATOM 8015  O O     . ALA N  4 42  ? 37.347  -86.160  1.375   1.00 263.82 ? 49  ALA B O     1 
ATOM 8016  C CB    . ALA N  4 42  ? 38.706  -88.377  -0.839  1.00 256.45 ? 49  ALA B CB    1 
ATOM 8017  N N     . ALA N  4 43  ? 36.001  -87.776  0.553   1.00 263.20 ? 50  ALA B N     1 
ATOM 8018  C CA    . ALA N  4 43  ? 34.744  -87.043  0.779   1.00 267.06 ? 50  ALA B CA    1 
ATOM 8019  C C     . ALA N  4 43  ? 34.435  -86.795  2.262   1.00 272.46 ? 50  ALA B C     1 
ATOM 8020  O O     . ALA N  4 43  ? 34.103  -85.672  2.614   1.00 274.70 ? 50  ALA B O     1 
ATOM 8021  C CB    . ALA N  4 43  ? 33.568  -87.730  0.086   1.00 266.34 ? 50  ALA B CB    1 
ATOM 8022  N N     . VAL N  4 44  ? 34.554  -87.828  3.111   1.00 276.18 ? 51  VAL B N     1 
ATOM 8023  C CA    . VAL N  4 44  ? 34.288  -87.726  4.562   1.00 280.80 ? 51  VAL B CA    1 
ATOM 8024  C C     . VAL N  4 44  ? 35.144  -86.638  5.170   1.00 287.77 ? 51  VAL B C     1 
ATOM 8025  O O     . VAL N  4 44  ? 34.646  -85.810  5.911   1.00 294.10 ? 51  VAL B O     1 
ATOM 8026  C CB    . VAL N  4 44  ? 34.530  -89.049  5.343   1.00 276.28 ? 51  VAL B CB    1 
ATOM 8027  C CG1   . VAL N  4 44  ? 34.391  -88.831  6.834   1.00 274.11 ? 51  VAL B CG1   1 
ATOM 8028  C CG2   . VAL N  4 44  ? 33.525  -90.112  4.948   1.00 278.86 ? 51  VAL B CG2   1 
ATOM 8029  N N     . ARG N  4 45  ? 36.427  -86.630  4.837   1.00 290.34 ? 52  ARG B N     1 
ATOM 8030  C CA    . ARG N  4 45  ? 37.334  -85.608  5.357   1.00 297.20 ? 52  ARG B CA    1 
ATOM 8031  C C     . ARG N  4 45  ? 37.117  -84.208  4.772   1.00 311.09 ? 52  ARG B C     1 
ATOM 8032  O O     . ARG N  4 45  ? 37.312  -83.207  5.478   1.00 324.78 ? 52  ARG B O     1 
ATOM 8033  C CB    . ARG N  4 45  ? 38.782  -86.057  5.223   1.00 280.37 ? 52  ARG B CB    1 
ATOM 8034  C CG    . ARG N  4 45  ? 39.071  -87.233  6.125   1.00 274.32 ? 52  ARG B CG    1 
ATOM 8035  C CD    . ARG N  4 45  ? 40.488  -87.714  5.983   1.00 267.02 ? 52  ARG B CD    1 
ATOM 8036  N NE    . ARG N  4 45  ? 40.555  -89.066  6.499   1.00 272.64 ? 52  ARG B NE    1 
ATOM 8037  C CZ    . ARG N  4 45  ? 41.681  -89.712  6.723   1.00 275.05 ? 52  ARG B CZ    1 
ATOM 8038  N NH1   . ARG N  4 45  ? 42.835  -89.116  6.466   1.00 272.20 ? 52  ARG B NH1   1 
ATOM 8039  N NH2   . ARG N  4 45  ? 41.647  -90.948  7.202   1.00 280.12 ? 52  ARG B NH2   1 
ATOM 8040  N N     . GLY N  4 46  ? 36.719  -84.148  3.499   1.00 315.15 ? 53  GLY B N     1 
ATOM 8041  C CA    . GLY N  4 46  ? 36.251  -82.913  2.862   1.00 321.59 ? 53  GLY B CA    1 
ATOM 8042  C C     . GLY N  4 46  ? 35.066  -82.353  3.627   1.00 333.41 ? 53  GLY B C     1 
ATOM 8043  O O     . GLY N  4 46  ? 35.060  -81.169  3.973   1.00 334.75 ? 53  GLY B O     1 
ATOM 8044  N N     . VAL N  4 47  ? 34.079  -83.223  3.888   1.00 337.22 ? 54  VAL B N     1 
ATOM 8045  C CA    . VAL N  4 47  ? 32.906  -82.941  4.751   1.00 344.85 ? 54  VAL B CA    1 
ATOM 8046  C C     . VAL N  4 47  ? 33.298  -82.403  6.139   1.00 360.11 ? 54  VAL B C     1 
ATOM 8047  O O     . VAL N  4 47  ? 32.781  -81.364  6.545   1.00 366.29 ? 54  VAL B O     1 
ATOM 8048  C CB    . VAL N  4 47  ? 31.930  -84.164  4.865   1.00 335.05 ? 54  VAL B CB    1 
ATOM 8049  C CG1   . VAL N  4 47  ? 30.977  -84.062  6.058   1.00 338.31 ? 54  VAL B CG1   1 
ATOM 8050  C CG2   . VAL N  4 47  ? 31.133  -84.337  3.581   1.00 326.29 ? 54  VAL B CG2   1 
ATOM 8051  N N     . ARG N  4 48  ? 34.213  -83.076  6.844   1.00 369.54 ? 55  ARG B N     1 
ATOM 8052  C CA    . ARG N  4 48  ? 34.602  -82.669  8.219   1.00 376.76 ? 55  ARG B CA    1 
ATOM 8053  C C     . ARG N  4 48  ? 35.285  -81.296  8.339   1.00 380.85 ? 55  ARG B C     1 
ATOM 8054  O O     . ARG N  4 48  ? 35.104  -80.594  9.338   1.00 379.66 ? 55  ARG B O     1 
ATOM 8055  C CB    . ARG N  4 48  ? 35.432  -83.751  8.913   1.00 376.84 ? 55  ARG B CB    1 
ATOM 8056  C CG    . ARG N  4 48  ? 34.686  -85.058  9.107   1.00 375.62 ? 55  ARG B CG    1 
ATOM 8057  C CD    . ARG N  4 48  ? 35.439  -85.947  10.079  1.00 381.27 ? 55  ARG B CD    1 
ATOM 8058  N NE    . ARG N  4 48  ? 35.660  -87.312  9.580   1.00 379.92 ? 55  ARG B NE    1 
ATOM 8059  C CZ    . ARG N  4 48  ? 36.847  -87.812  9.223   1.00 379.77 ? 55  ARG B CZ    1 
ATOM 8060  N NH1   . ARG N  4 48  ? 37.944  -87.068  9.292   1.00 387.84 ? 55  ARG B NH1   1 
ATOM 8061  N NH2   . ARG N  4 48  ? 36.939  -89.066  8.794   1.00 370.82 ? 55  ARG B NH2   1 
ATOM 8062  N N     . GLN N  4 49  ? 36.043  -80.900  7.320   1.00 383.54 ? 56  GLN B N     1 
ATOM 8063  C CA    . GLN N  4 49  ? 36.635  -79.558  7.295   1.00 385.45 ? 56  GLN B CA    1 
ATOM 8064  C C     . GLN N  4 49  ? 35.627  -78.421  6.983   1.00 390.08 ? 56  GLN B C     1 
ATOM 8065  O O     . GLN N  4 49  ? 35.683  -77.359  7.610   1.00 400.63 ? 56  GLN B O     1 
ATOM 8066  C CB    . GLN N  4 49  ? 37.863  -79.525  6.376   1.00 378.69 ? 56  GLN B CB    1 
ATOM 8067  C CG    . GLN N  4 49  ? 38.705  -78.250  6.462   1.00 375.98 ? 56  GLN B CG    1 
ATOM 8068  C CD    . GLN N  4 49  ? 39.610  -78.162  7.683   1.00 375.39 ? 56  GLN B CD    1 
ATOM 8069  O OE1   . GLN N  4 49  ? 39.821  -79.146  8.392   1.00 376.58 ? 56  GLN B OE1   1 
ATOM 8070  N NE2   . GLN N  4 49  ? 40.166  -76.968  7.926   1.00 373.41 ? 56  GLN B NE2   1 
ATOM 8071  N N     . ALA N  4 50  ? 34.717  -78.645  6.031   1.00 382.99 ? 57  ALA B N     1 
ATOM 8072  C CA    . ALA N  4 50  ? 33.638  -77.693  5.709   1.00 384.92 ? 57  ALA B CA    1 
ATOM 8073  C C     . ALA N  4 50  ? 32.797  -77.361  6.938   1.00 398.25 ? 57  ALA B C     1 
ATOM 8074  O O     . ALA N  4 50  ? 32.537  -76.194  7.221   1.00 401.72 ? 57  ALA B O     1 
ATOM 8075  C CB    . ALA N  4 50  ? 32.758  -78.251  4.607   1.00 373.16 ? 57  ALA B CB    1 
ATOM 8076  N N     . GLN N  4 51  ? 32.392  -78.413  7.655   1.00 412.60 ? 58  GLN B N     1 
ATOM 8077  C CA    . GLN N  4 51  ? 31.736  -78.332  8.973   1.00 437.97 ? 58  GLN B CA    1 
ATOM 8078  C C     . GLN N  4 51  ? 32.557  -77.470  9.939   1.00 452.18 ? 58  GLN B C     1 
ATOM 8079  O O     . GLN N  4 51  ? 32.010  -76.600  10.626  1.00 462.19 ? 58  GLN B O     1 
ATOM 8080  C CB    . GLN N  4 51  ? 31.577  -79.742  9.619   1.00 439.86 ? 58  GLN B CB    1 
ATOM 8081  C CG    . GLN N  4 51  ? 30.472  -80.676  9.088   1.00 442.00 ? 58  GLN B CG    1 
ATOM 8082  C CD    . GLN N  4 51  ? 30.342  -82.022  9.838   1.00 440.67 ? 58  GLN B CD    1 
ATOM 8083  O OE1   . GLN N  4 51  ? 31.305  -82.790  9.967   1.00 432.98 ? 58  GLN B OE1   1 
ATOM 8084  N NE2   . GLN N  4 51  ? 29.130  -82.315  10.311  1.00 442.22 ? 58  GLN B NE2   1 
ATOM 8085  N N     . ALA N  4 52  ? 33.868  -77.742  9.982   1.00 457.76 ? 59  ALA B N     1 
ATOM 8086  C CA    . ALA N  4 52  ? 34.766  -77.255  11.039  1.00 467.68 ? 59  ALA B CA    1 
ATOM 8087  C C     . ALA N  4 52  ? 34.991  -75.752  11.023  1.00 470.82 ? 59  ALA B C     1 
ATOM 8088  O O     . ALA N  4 52  ? 34.864  -75.099  12.056  1.00 480.01 ? 59  ALA B O     1 
ATOM 8089  C CB    . ALA N  4 52  ? 36.099  -78.001  11.022  1.00 463.89 ? 59  ALA B CB    1 
ATOM 8090  N N     . GLU N  4 53  ? 35.323  -75.191  9.869   1.00 462.39 ? 60  GLU B N     1 
ATOM 8091  C CA    . GLU N  4 53  ? 35.445  -73.738  9.789   1.00 452.63 ? 60  GLU B CA    1 
ATOM 8092  C C     . GLU N  4 53  ? 34.085  -73.144  9.460   1.00 436.35 ? 60  GLU B C     1 
ATOM 8093  O O     . GLU N  4 53  ? 33.953  -71.928  9.295   1.00 424.44 ? 60  GLU B O     1 
ATOM 8094  C CB    . GLU N  4 53  ? 36.507  -73.326  8.778   1.00 469.58 ? 60  GLU B CB    1 
ATOM 8095  C CG    . GLU N  4 53  ? 36.412  -74.062  7.451   1.00 484.23 ? 60  GLU B CG    1 
ATOM 8096  C CD    . GLU N  4 53  ? 37.714  -74.045  6.657   1.00 489.22 ? 60  GLU B CD    1 
ATOM 8097  O OE1   . GLU N  4 53  ? 37.773  -73.307  5.646   1.00 495.77 ? 60  GLU B OE1   1 
ATOM 8098  O OE2   . GLU N  4 53  ? 38.674  -74.765  7.035   1.00 485.45 ? 60  GLU B OE2   1 
ATOM 8099  N N     . ASP N  4 54  ? 33.092  -74.037  9.391   1.00 426.78 ? 61  ASP B N     1 
ATOM 8100  C CA    . ASP N  4 54  ? 31.671  -73.717  9.208   1.00 430.65 ? 61  ASP B CA    1 
ATOM 8101  C C     . ASP N  4 54  ? 31.361  -73.198  7.800   1.00 426.50 ? 61  ASP B C     1 
ATOM 8102  O O     . ASP N  4 54  ? 30.874  -72.071  7.631   1.00 435.81 ? 61  ASP B O     1 
ATOM 8103  C CB    . ASP N  4 54  ? 31.158  -72.762  10.308  1.00 443.62 ? 61  ASP B CB    1 
ATOM 8104  C CG    . ASP N  4 54  ? 29.649  -72.812  10.478  1.00 455.30 ? 61  ASP B CG    1 
ATOM 8105  O OD1   . ASP N  4 54  ? 29.081  -73.916  10.357  1.00 451.64 ? 61  ASP B OD1   1 
ATOM 8106  O OD2   . ASP N  4 54  ? 29.041  -71.750  10.742  1.00 466.10 ? 61  ASP B OD2   1 
ATOM 8107  N N     . ALA N  4 55  ? 31.642  -74.026  6.793   1.00 412.80 ? 62  ALA B N     1 
ATOM 8108  C CA    . ALA N  4 55  ? 31.431  -73.636  5.402   1.00 404.32 ? 62  ALA B CA    1 
ATOM 8109  C C     . ALA N  4 55  ? 30.006  -73.862  4.959   1.00 403.60 ? 62  ALA B C     1 
ATOM 8110  O O     . ALA N  4 55  ? 29.291  -74.694  5.531   1.00 404.93 ? 62  ALA B O     1 
ATOM 8111  C CB    . ALA N  4 55  ? 32.381  -74.372  4.487   1.00 393.51 ? 62  ALA B CB    1 
ATOM 8112  N N     . LEU N  4 56  ? 29.631  -73.117  3.917   1.00 399.53 ? 63  LEU B N     1 
ATOM 8113  C CA    . LEU N  4 56  ? 28.292  -73.134  3.322   1.00 400.74 ? 63  LEU B CA    1 
ATOM 8114  C C     . LEU N  4 56  ? 28.009  -74.439  2.574   1.00 401.58 ? 63  LEU B C     1 
ATOM 8115  O O     . LEU N  4 56  ? 26.845  -74.778  2.323   1.00 401.55 ? 63  LEU B O     1 
ATOM 8116  C CB    . LEU N  4 56  ? 28.113  -71.976  2.347   1.00 396.18 ? 63  LEU B CB    1 
ATOM 8117  C CG    . LEU N  4 56  ? 29.070  -70.792  2.357   1.00 391.83 ? 63  LEU B CG    1 
ATOM 8118  C CD1   . LEU N  4 56  ? 28.974  -70.091  1.020   1.00 389.39 ? 63  LEU B CD1   1 
ATOM 8119  C CD2   . LEU N  4 56  ? 28.774  -69.840  3.504   1.00 399.51 ? 63  LEU B CD2   1 
ATOM 8120  N N     . ARG N  4 57  ? 29.084  -75.142  2.196   1.00 405.79 ? 64  ARG B N     1 
ATOM 8121  C CA    . ARG N  4 57  ? 29.053  -76.475  1.543   1.00 410.41 ? 64  ARG B CA    1 
ATOM 8122  C C     . ARG N  4 57  ? 30.431  -77.151  1.737   1.00 406.57 ? 64  ARG B C     1 
ATOM 8123  O O     . ARG N  4 57  ? 31.301  -76.593  2.420   1.00 408.17 ? 64  ARG B O     1 
ATOM 8124  C CB    . ARG N  4 57  ? 28.697  -76.362  0.050   1.00 410.95 ? 64  ARG B CB    1 
ATOM 8125  C CG    . ARG N  4 57  ? 29.446  -75.259  -0.683  1.00 410.90 ? 64  ARG B CG    1 
ATOM 8126  C CD    . ARG N  4 57  ? 29.411  -75.480  -2.168  1.00 403.61 ? 64  ARG B CD    1 
ATOM 8127  N NE    . ARG N  4 57  ? 28.095  -75.137  -2.669  1.00 404.25 ? 64  ARG B NE    1 
ATOM 8128  C CZ    . ARG N  4 57  ? 27.565  -75.676  -3.750  1.00 398.66 ? 64  ARG B CZ    1 
ATOM 8129  N NH1   . ARG N  4 57  ? 28.241  -76.584  -4.435  1.00 390.40 ? 64  ARG B NH1   1 
ATOM 8130  N NH2   . ARG N  4 57  ? 26.356  -75.314  -4.146  1.00 400.43 ? 64  ARG B NH2   1 
ATOM 8131  N N     . VAL N  4 58  ? 30.641  -78.327  1.137   1.00 400.56 ? 65  VAL B N     1 
ATOM 8132  C CA    . VAL N  4 58  ? 32.014  -78.829  0.924   1.00 391.98 ? 65  VAL B CA    1 
ATOM 8133  C C     . VAL N  4 58  ? 32.602  -78.266  -0.413  1.00 402.75 ? 65  VAL B C     1 
ATOM 8134  O O     . VAL N  4 58  ? 32.221  -78.698  -1.515  1.00 397.88 ? 65  VAL B O     1 
ATOM 8135  C CB    . VAL N  4 58  ? 32.078  -80.376  1.011   1.00 375.15 ? 65  VAL B CB    1 
ATOM 8136  C CG1   . VAL N  4 58  ? 33.519  -80.870  0.949   1.00 362.04 ? 65  VAL B CG1   1 
ATOM 8137  C CG2   . VAL N  4 58  ? 31.379  -80.868  2.271   1.00 372.56 ? 65  VAL B CG2   1 
ATOM 8138  N N     . ASP N  4 59  ? 33.509  -77.280  -0.297  1.00 418.20 ? 66  ASP B N     1 
ATOM 8139  C CA    . ASP N  4 59  ? 34.141  -76.553  -1.452  1.00 419.02 ? 66  ASP B CA    1 
ATOM 8140  C C     . ASP N  4 59  ? 35.706  -76.661  -1.406  1.00 421.31 ? 66  ASP B C     1 
ATOM 8141  O O     . ASP N  4 59  ? 36.283  -77.078  -0.375  1.00 434.65 ? 66  ASP B O     1 
ATOM 8142  C CB    . ASP N  4 59  ? 33.672  -75.079  -1.468  1.00 408.46 ? 66  ASP B CB    1 
ATOM 8143  C CG    . ASP N  4 59  ? 33.422  -74.518  -2.858  1.00 390.39 ? 66  ASP B CG    1 
ATOM 8144  O OD1   . ASP N  4 59  ? 33.901  -75.068  -3.859  1.00 377.33 ? 66  ASP B OD1   1 
ATOM 8145  O OD2   . ASP N  4 59  ? 32.743  -73.469  -2.928  1.00 383.52 ? 66  ASP B OD2   1 
ATOM 8146  N N     . VAL N  4 60  ? 36.389  -76.280  -2.498  1.00 406.24 ? 67  VAL B N     1 
ATOM 8147  C CA    . VAL N  4 60  ? 37.820  -76.667  -2.732  1.00 378.01 ? 67  VAL B CA    1 
ATOM 8148  C C     . VAL N  4 60  ? 38.850  -76.387  -1.569  1.00 366.09 ? 67  VAL B C     1 
ATOM 8149  O O     . VAL N  4 60  ? 39.707  -77.246  -1.277  1.00 358.01 ? 67  VAL B O     1 
ATOM 8150  C CB    . VAL N  4 60  ? 38.332  -76.244  -4.160  1.00 368.76 ? 67  VAL B CB    1 
ATOM 8151  C CG1   . VAL N  4 60  ? 39.328  -77.253  -4.671  1.00 357.39 ? 67  VAL B CG1   1 
ATOM 8152  C CG2   . VAL N  4 60  ? 37.196  -76.163  -5.178  1.00 366.02 ? 67  VAL B CG2   1 
ATOM 8153  N N     . ASP N  4 61  ? 38.726  -75.231  -0.904  1.00 359.43 ? 68  ASP B N     1 
ATOM 8154  C CA    . ASP N  4 61  ? 39.610  -74.788  0.203   1.00 345.59 ? 68  ASP B CA    1 
ATOM 8155  C C     . ASP N  4 61  ? 39.775  -75.770  1.324   1.00 329.98 ? 68  ASP B C     1 
ATOM 8156  O O     . ASP N  4 61  ? 40.877  -75.982  1.824   1.00 316.43 ? 68  ASP B O     1 
ATOM 8157  C CB    . ASP N  4 61  ? 39.047  -73.535  0.860   1.00 364.44 ? 68  ASP B CB    1 
ATOM 8158  C CG    . ASP N  4 61  ? 39.592  -72.269  0.267   1.00 379.67 ? 68  ASP B CG    1 
ATOM 8159  O OD1   . ASP N  4 61  ? 40.104  -72.308  -0.875  1.00 387.56 ? 68  ASP B OD1   1 
ATOM 8160  O OD2   . ASP N  4 61  ? 39.461  -71.219  0.918   1.00 389.60 ? 68  ASP B OD2   1 
ATOM 8161  N N     . GLN N  4 62  ? 38.635  -76.303  1.745   1.00 328.85 ? 69  GLN B N     1 
ATOM 8162  C CA    . GLN N  4 62  ? 38.549  -77.226  2.844   1.00 331.88 ? 69  GLN B CA    1 
ATOM 8163  C C     . GLN N  4 62  ? 39.263  -78.506  2.477   1.00 331.21 ? 69  GLN B C     1 
ATOM 8164  O O     . GLN N  4 62  ? 40.156  -78.966  3.202   1.00 334.79 ? 69  GLN B O     1 
ATOM 8165  C CB    . GLN N  4 62  ? 37.084  -77.513  3.179   1.00 336.08 ? 69  GLN B CB    1 
ATOM 8166  C CG    . GLN N  4 62  ? 36.415  -76.408  3.982   1.00 346.83 ? 69  GLN B CG    1 
ATOM 8167  C CD    . GLN N  4 62  ? 35.793  -75.329  3.119   1.00 353.27 ? 69  GLN B CD    1 
ATOM 8168  O OE1   . GLN N  4 62  ? 35.152  -75.621  2.125   1.00 359.98 ? 69  GLN B OE1   1 
ATOM 8169  N NE2   . GLN N  4 62  ? 35.963  -74.075  3.515   1.00 356.18 ? 69  GLN B NE2   1 
ATOM 8170  N N     . LEU N  4 63  ? 38.869  -79.076  1.343   1.00 335.24 ? 70  LEU B N     1 
ATOM 8171  C CA    . LEU N  4 63  ? 39.514  -80.285  0.848   1.00 341.74 ? 70  LEU B CA    1 
ATOM 8172  C C     . LEU N  4 63  ? 41.030  -80.113  0.793   1.00 344.59 ? 70  LEU B C     1 
ATOM 8173  O O     . LEU N  4 63  ? 41.777  -80.982  1.240   1.00 346.44 ? 70  LEU B O     1 
ATOM 8174  C CB    . LEU N  4 63  ? 38.989  -80.662  -0.536  1.00 347.77 ? 70  LEU B CB    1 
ATOM 8175  C CG    . LEU N  4 63  ? 39.653  -81.885  -1.183  1.00 351.78 ? 70  LEU B CG    1 
ATOM 8176  C CD1   . LEU N  4 63  ? 39.064  -83.189  -0.659  1.00 350.20 ? 70  LEU B CD1   1 
ATOM 8177  C CD2   . LEU N  4 63  ? 39.568  -81.805  -2.697  1.00 361.35 ? 70  LEU B CD2   1 
ATOM 8178  N N     . GLU N  4 64  ? 41.482  -78.988  0.256   1.00 347.63 ? 71  GLU B N     1 
ATOM 8179  C CA    . GLU N  4 64  ? 42.916  -78.789  0.058   1.00 334.27 ? 71  GLU B CA    1 
ATOM 8180  C C     . GLU N  4 64  ? 43.697  -78.593  1.378   1.00 310.43 ? 71  GLU B C     1 
ATOM 8181  O O     . GLU N  4 64  ? 44.903  -78.861  1.453   1.00 296.83 ? 71  GLU B O     1 
ATOM 8182  C CB    . GLU N  4 64  ? 43.145  -77.697  -0.992  1.00 363.56 ? 71  GLU B CB    1 
ATOM 8183  C CG    . GLU N  4 64  ? 42.566  -78.062  -2.365  1.00 407.06 ? 71  GLU B CG    1 
ATOM 8184  C CD    . GLU N  4 64  ? 42.563  -76.900  -3.377  1.00 443.84 ? 71  GLU B CD    1 
ATOM 8185  O OE1   . GLU N  4 64  ? 42.506  -75.705  -2.990  1.00 464.30 ? 71  GLU B OE1   1 
ATOM 8186  O OE2   . GLU N  4 64  ? 42.607  -77.177  -4.596  1.00 459.79 ? 71  GLU B OE2   1 
ATOM 8187  N N     . LYS N  4 65  ? 42.976  -78.172  2.414   1.00 297.10 ? 72  LYS B N     1 
ATOM 8188  C CA    . LYS N  4 65  ? 43.484  -78.204  3.779   1.00 287.11 ? 72  LYS B CA    1 
ATOM 8189  C C     . LYS N  4 65  ? 43.666  -79.647  4.307   1.00 284.75 ? 72  LYS B C     1 
ATOM 8190  O O     . LYS N  4 65  ? 44.503  -79.886  5.182   1.00 278.01 ? 72  LYS B O     1 
ATOM 8191  C CB    . LYS N  4 65  ? 42.566  -77.400  4.709   1.00 284.39 ? 72  LYS B CB    1 
ATOM 8192  C CG    . LYS N  4 65  ? 42.564  -75.903  4.457   1.00 279.23 ? 72  LYS B CG    1 
ATOM 8193  C CD    . LYS N  4 65  ? 41.935  -75.129  5.599   1.00 277.91 ? 72  LYS B CD    1 
ATOM 8194  C CE    . LYS N  4 65  ? 41.849  -73.666  5.212   1.00 276.99 ? 72  LYS B CE    1 
ATOM 8195  N NZ    . LYS N  4 65  ? 41.683  -72.776  6.388   1.00 279.83 ? 72  LYS B NZ    1 
ATOM 8196  N N     . VAL N  4 66  ? 42.880  -80.598  3.786   1.00 290.02 ? 73  VAL B N     1 
ATOM 8197  C CA    . VAL N  4 66  ? 42.958  -82.024  4.196   1.00 287.12 ? 73  VAL B CA    1 
ATOM 8198  C C     . VAL N  4 66  ? 43.562  -82.895  3.093   1.00 279.89 ? 73  VAL B C     1 
ATOM 8199  O O     . VAL N  4 66  ? 43.612  -84.120  3.240   1.00 284.89 ? 73  VAL B O     1 
ATOM 8200  C CB    . VAL N  4 66  ? 41.590  -82.664  4.620   1.00 286.05 ? 73  VAL B CB    1 
ATOM 8201  C CG1   . VAL N  4 66  ? 40.817  -81.801  5.617   1.00 289.91 ? 73  VAL B CG1   1 
ATOM 8202  C CG2   . VAL N  4 66  ? 40.721  -83.003  3.407   1.00 282.22 ? 73  VAL B CG2   1 
ATOM 8203  N N     . LEU N  4 67  ? 43.988  -82.269  1.989   1.00 266.53 ? 74  LEU B N     1 
ATOM 8204  C CA    . LEU N  4 67  ? 44.722  -82.969  0.919   1.00 252.27 ? 74  LEU B CA    1 
ATOM 8205  C C     . LEU N  4 67  ? 46.079  -83.461  1.409   1.00 252.36 ? 74  LEU B C     1 
ATOM 8206  O O     . LEU N  4 67  ? 46.520  -84.558  1.014   1.00 253.93 ? 74  LEU B O     1 
ATOM 8207  C CB    . LEU N  4 67  ? 44.895  -82.110  -0.338  1.00 240.25 ? 74  LEU B CB    1 
ATOM 8208  C CG    . LEU N  4 67  ? 43.722  -82.120  -1.307  1.00 238.30 ? 74  LEU B CG    1 
ATOM 8209  C CD1   . LEU N  4 67  ? 44.194  -81.701  -2.678  1.00 233.92 ? 74  LEU B CD1   1 
ATOM 8210  C CD2   . LEU N  4 67  ? 43.081  -83.498  -1.368  1.00 237.57 ? 74  LEU B CD2   1 
ATOM 8211  N N     . PRO N  4 68  ? 46.745  -82.645  2.259   1.00 254.62 ? 75  PRO B N     1 
ATOM 8212  C CA    . PRO N  4 68  ? 47.876  -83.145  3.040   1.00 261.45 ? 75  PRO B CA    1 
ATOM 8213  C C     . PRO N  4 68  ? 47.533  -84.484  3.720   1.00 272.42 ? 75  PRO B C     1 
ATOM 8214  O O     . PRO N  4 68  ? 48.189  -85.498  3.455   1.00 281.81 ? 75  PRO B O     1 
ATOM 8215  C CB    . PRO N  4 68  ? 48.082  -82.045  4.084   1.00 258.09 ? 75  PRO B CB    1 
ATOM 8216  C CG    . PRO N  4 68  ? 47.607  -80.791  3.417   1.00 254.22 ? 75  PRO B CG    1 
ATOM 8217  C CD    . PRO N  4 68  ? 46.545  -81.186  2.434   1.00 251.93 ? 75  PRO B CD    1 
ATOM 8218  N N     . GLN N  4 69  ? 46.483  -84.468  4.548   1.00 277.79 ? 76  GLN B N     1 
ATOM 8219  C CA    . GLN N  4 69  ? 46.019  -85.640  5.286   1.00 278.60 ? 76  GLN B CA    1 
ATOM 8220  C C     . GLN N  4 69  ? 45.698  -86.860  4.402   1.00 276.33 ? 76  GLN B C     1 
ATOM 8221  O O     . GLN N  4 69  ? 46.059  -87.986  4.747   1.00 276.58 ? 76  GLN B O     1 
ATOM 8222  C CB    . GLN N  4 69  ? 44.828  -85.270  6.182   1.00 280.01 ? 76  GLN B CB    1 
ATOM 8223  C CG    . GLN N  4 69  ? 44.565  -86.274  7.293   1.00 282.82 ? 76  GLN B CG    1 
ATOM 8224  C CD    . GLN N  4 69  ? 45.842  -86.779  7.966   1.00 286.31 ? 76  GLN B CD    1 
ATOM 8225  O OE1   . GLN N  4 69  ? 46.680  -85.999  8.431   1.00 288.16 ? 76  GLN B OE1   1 
ATOM 8226  N NE2   . GLN N  4 69  ? 45.992  -88.100  8.020   1.00 289.48 ? 76  GLN B NE2   1 
ATOM 8227  N N     . LEU N  4 70  ? 45.045  -86.636  3.264   1.00 272.13 ? 77  LEU B N     1 
ATOM 8228  C CA    . LEU N  4 70  ? 44.679  -87.729  2.338   1.00 258.80 ? 77  LEU B CA    1 
ATOM 8229  C C     . LEU N  4 70  ? 45.868  -88.389  1.641   1.00 248.01 ? 77  LEU B C     1 
ATOM 8230  O O     . LEU N  4 70  ? 45.906  -89.608  1.495   1.00 242.44 ? 77  LEU B O     1 
ATOM 8231  C CB    . LEU N  4 70  ? 43.666  -87.253  1.283   1.00 258.45 ? 77  LEU B CB    1 
ATOM 8232  C CG    . LEU N  4 70  ? 43.125  -88.241  0.230   1.00 252.22 ? 77  LEU B CG    1 
ATOM 8233  C CD1   . LEU N  4 70  ? 42.245  -89.329  0.832   1.00 248.95 ? 77  LEU B CD1   1 
ATOM 8234  C CD2   . LEU N  4 70  ? 42.361  -87.490  -0.847  1.00 253.20 ? 77  LEU B CD2   1 
ATOM 8235  N N     . LEU N  4 71  ? 46.836  -87.595  1.205   1.00 238.98 ? 78  LEU B N     1 
ATOM 8236  C CA    . LEU N  4 71  ? 47.924  -88.169  0.420   1.00 229.31 ? 78  LEU B CA    1 
ATOM 8237  C C     . LEU N  4 71  ? 49.063  -88.742  1.265   1.00 237.25 ? 78  LEU B C     1 
ATOM 8238  O O     . LEU N  4 71  ? 49.842  -89.569  0.768   1.00 235.40 ? 78  LEU B O     1 
ATOM 8239  C CB    . LEU N  4 71  ? 48.395  -87.210  -0.665  1.00 215.22 ? 78  LEU B CB    1 
ATOM 8240  C CG    . LEU N  4 71  ? 47.300  -87.098  -1.727  1.00 207.97 ? 78  LEU B CG    1 
ATOM 8241  C CD1   . LEU N  4 71  ? 47.387  -85.775  -2.468  1.00 203.70 ? 78  LEU B CD1   1 
ATOM 8242  C CD2   . LEU N  4 71  ? 47.333  -88.273  -2.679  1.00 205.20 ? 78  LEU B CD2   1 
ATOM 8243  N N     . LEU N  4 72  ? 49.134  -88.321  2.540   1.00 250.51 ? 79  LEU B N     1 
ATOM 8244  C CA    . LEU N  4 72  ? 49.897  -89.044  3.597   1.00 261.12 ? 79  LEU B CA    1 
ATOM 8245  C C     . LEU N  4 72  ? 49.346  -90.474  3.802   1.00 275.30 ? 79  LEU B C     1 
ATOM 8246  O O     . LEU N  4 72  ? 50.118  -91.429  3.963   1.00 278.76 ? 79  LEU B O     1 
ATOM 8247  C CB    . LEU N  4 72  ? 49.887  -88.335  4.984   1.00 256.59 ? 79  LEU B CB    1 
ATOM 8248  C CG    . LEU N  4 72  ? 50.251  -86.904  5.411   1.00 251.59 ? 79  LEU B CG    1 
ATOM 8249  C CD1   . LEU N  4 72  ? 49.938  -86.768  6.896   1.00 251.17 ? 79  LEU B CD1   1 
ATOM 8250  C CD2   . LEU N  4 72  ? 51.706  -86.542  5.156   1.00 246.52 ? 79  LEU B CD2   1 
ATOM 8251  N N     . ASP N  4 73  ? 48.012  -90.611  3.833   1.00 290.95 ? 80  ASP B N     1 
ATOM 8252  C CA    . ASP N  4 73  ? 47.347  -91.917  4.015   1.00 304.39 ? 80  ASP B CA    1 
ATOM 8253  C C     . ASP N  4 73  ? 47.402  -92.786  2.749   1.00 303.31 ? 80  ASP B C     1 
ATOM 8254  O O     . ASP N  4 73  ? 47.099  -93.990  2.795   1.00 309.22 ? 80  ASP B O     1 
ATOM 8255  C CB    . ASP N  4 73  ? 45.894  -91.741  4.493   1.00 311.52 ? 80  ASP B CB    1 
ATOM 8256  C CG    . ASP N  4 73  ? 45.782  -91.524  6.007   1.00 320.41 ? 80  ASP B CG    1 
ATOM 8257  O OD1   . ASP N  4 73  ? 46.788  -91.625  6.748   1.00 325.41 ? 80  ASP B OD1   1 
ATOM 8258  O OD2   . ASP N  4 73  ? 44.655  -91.258  6.468   1.00 326.54 ? 80  ASP B OD2   1 
ATOM 8259  N N     . PHE N  4 74  ? 47.806  -92.161  1.641   1.00 295.84 ? 81  PHE B N     1 
ATOM 8260  C CA    . PHE N  4 74  ? 47.891  -92.790  0.331   1.00 287.75 ? 81  PHE B CA    1 
ATOM 8261  C C     . PHE N  4 74  ? 49.173  -92.445  -0.417  1.00 276.66 ? 81  PHE B C     1 
ATOM 8262  O O     . PHE N  4 74  ? 50.039  -93.299  -0.577  1.00 264.93 ? 81  PHE B O     1 
ATOM 8263  C CB    . PHE N  4 74  ? 46.667  -92.408  -0.493  1.00 291.74 ? 81  PHE B CB    1 
ATOM 8264  C CG    . PHE N  4 74  ? 45.402  -93.050  -0.006  1.00 296.94 ? 81  PHE B CG    1 
ATOM 8265  C CD1   . PHE N  4 74  ? 45.297  -94.447  0.052   1.00 297.94 ? 81  PHE B CD1   1 
ATOM 8266  C CD2   . PHE N  4 74  ? 44.320  -92.272  0.412   1.00 296.60 ? 81  PHE B CD2   1 
ATOM 8267  C CE1   . PHE N  4 74  ? 44.131  -95.055  0.502   1.00 297.29 ? 81  PHE B CE1   1 
ATOM 8268  C CE2   . PHE N  4 74  ? 43.153  -92.877  0.865   1.00 297.39 ? 81  PHE B CE2   1 
ATOM 8269  C CZ    . PHE N  4 74  ? 43.061  -94.266  0.907   1.00 298.06 ? 81  PHE B CZ    1 
ATOM 8270  N N     . SER O  3 1   ? 65.001  36.244   51.676  1.00 271.62 ? 14  SER I N     1 
ATOM 8271  C CA    . SER O  3 1   ? 66.281  35.673   51.169  1.00 265.78 ? 14  SER I CA    1 
ATOM 8272  C C     . SER O  3 1   ? 67.499  36.593   51.390  1.00 261.78 ? 14  SER I C     1 
ATOM 8273  O O     . SER O  3 1   ? 67.391  37.815   51.636  1.00 264.80 ? 14  SER I O     1 
ATOM 8274  C CB    . SER O  3 1   ? 66.145  35.294   49.682  1.00 260.47 ? 14  SER I CB    1 
ATOM 8275  O OG    . SER O  3 1   ? 67.249  34.530   49.226  1.00 252.14 ? 14  SER I OG    1 
ATOM 8276  N N     . TYR O  3 2   ? 68.661  35.956   51.318  1.00 250.78 ? 15  TYR I N     1 
ATOM 8277  C CA    . TYR O  3 2   ? 69.952  36.608   51.255  1.00 238.97 ? 15  TYR I CA    1 
ATOM 8278  C C     . TYR O  3 2   ? 69.993  37.883   50.383  1.00 230.00 ? 15  TYR I C     1 
ATOM 8279  O O     . TYR O  3 2   ? 70.659  38.884   50.703  1.00 224.41 ? 15  TYR I O     1 
ATOM 8280  C CB    . TYR O  3 2   ? 70.923  35.586   50.703  1.00 240.80 ? 15  TYR I CB    1 
ATOM 8281  C CG    . TYR O  3 2   ? 72.309  35.812   51.149  1.00 249.07 ? 15  TYR I CG    1 
ATOM 8282  C CD1   . TYR O  3 2   ? 72.746  35.331   52.382  1.00 257.36 ? 15  TYR I CD1   1 
ATOM 8283  C CD2   . TYR O  3 2   ? 73.201  36.511   50.346  1.00 251.80 ? 15  TYR I CD2   1 
ATOM 8284  C CE1   . TYR O  3 2   ? 74.052  35.541   52.803  1.00 266.78 ? 15  TYR I CE1   1 
ATOM 8285  C CE2   . TYR O  3 2   ? 74.507  36.732   50.752  1.00 261.64 ? 15  TYR I CE2   1 
ATOM 8286  C CZ    . TYR O  3 2   ? 74.936  36.248   51.980  1.00 266.64 ? 15  TYR I CZ    1 
ATOM 8287  O OH    . TYR O  3 2   ? 76.248  36.482   52.375  1.00 268.31 ? 15  TYR I OH    1 
ATOM 8288  N N     . GLN O  3 3   ? 69.272  37.851   49.280  1.00 227.88 ? 16  GLN I N     1 
ATOM 8289  C CA    . GLN O  3 3   ? 69.307  38.980   48.388  1.00 229.68 ? 16  GLN I CA    1 
ATOM 8290  C C     . GLN O  3 3   ? 68.429  40.128   48.812  1.00 232.59 ? 16  GLN I C     1 
ATOM 8291  O O     . GLN O  3 3   ? 68.837  41.248   48.583  1.00 235.65 ? 16  GLN I O     1 
ATOM 8292  C CB    . GLN O  3 3   ? 69.054  38.552   46.971  1.00 231.13 ? 16  GLN I CB    1 
ATOM 8293  C CG    . GLN O  3 3   ? 70.176  37.683   46.490  1.00 239.33 ? 16  GLN I CG    1 
ATOM 8294  C CD    . GLN O  3 3   ? 69.683  36.467   45.741  1.00 249.94 ? 16  GLN I CD    1 
ATOM 8295  O OE1   . GLN O  3 3   ? 68.985  36.562   44.713  1.00 258.21 ? 16  GLN I OE1   1 
ATOM 8296  N NE2   . GLN O  3 3   ? 70.025  35.302   46.277  1.00 254.83 ? 16  GLN I NE2   1 
ATOM 8297  N N     . GLN O  3 4   ? 67.264  39.863   49.431  1.00 235.32 ? 17  GLN I N     1 
ATOM 8298  C CA    . GLN O  3 4   ? 66.389  40.889   50.083  1.00 235.59 ? 17  GLN I CA    1 
ATOM 8299  C C     . GLN O  3 4   ? 67.187  41.745   51.007  1.00 240.71 ? 17  GLN I C     1 
ATOM 8300  O O     . GLN O  3 4   ? 66.953  42.951   51.151  1.00 237.31 ? 17  GLN I O     1 
ATOM 8301  C CB    . GLN O  3 4   ? 65.437  40.233   51.063  1.00 231.75 ? 17  GLN I CB    1 
ATOM 8302  C CG    . GLN O  3 4   ? 64.005  40.042   50.661  1.00 226.77 ? 17  GLN I CG    1 
ATOM 8303  C CD    . GLN O  3 4   ? 63.304  39.174   51.655  1.00 225.75 ? 17  GLN I CD    1 
ATOM 8304  O OE1   . GLN O  3 4   ? 63.780  38.090   51.947  1.00 228.86 ? 17  GLN I OE1   1 
ATOM 8305  N NE2   . GLN O  3 4   ? 62.206  39.655   52.211  1.00 222.06 ? 17  GLN I NE2   1 
ATOM 8306  N N     . ARG O  3 5   ? 68.054  41.029   51.710  1.00 250.15 ? 18  ARG I N     1 
ATOM 8307  C CA    . ARG O  3 5   ? 68.994  41.522   52.688  1.00 258.87 ? 18  ARG I CA    1 
ATOM 8308  C C     . ARG O  3 5   ? 69.947  42.528   52.013  1.00 258.13 ? 18  ARG I C     1 
ATOM 8309  O O     . ARG O  3 5   ? 70.040  43.702   52.425  1.00 260.80 ? 18  ARG I O     1 
ATOM 8310  C CB    . ARG O  3 5   ? 69.776  40.313   53.171  1.00 267.07 ? 18  ARG I CB    1 
ATOM 8311  C CG    . ARG O  3 5   ? 69.702  39.938   54.643  1.00 277.43 ? 18  ARG I CG    1 
ATOM 8312  C CD    . ARG O  3 5   ? 70.504  38.663   54.785  1.00 286.88 ? 18  ARG I CD    1 
ATOM 8313  N NE    . ARG O  3 5   ? 71.725  38.894   54.043  1.00 297.80 ? 18  ARG I NE    1 
ATOM 8314  C CZ    . ARG O  3 5   ? 72.936  38.851   54.560  1.00 310.48 ? 18  ARG I CZ    1 
ATOM 8315  N NH1   . ARG O  3 5   ? 73.983  39.142   53.792  1.00 314.87 ? 18  ARG I NH1   1 
ATOM 8316  N NH2   . ARG O  3 5   ? 73.106  38.517   55.833  1.00 319.19 ? 18  ARG I NH2   1 
ATOM 8317  N N     . LEU O  3 6   ? 70.621  42.080   50.946  1.00 253.94 ? 19  LEU I N     1 
ATOM 8318  C CA    . LEU O  3 6   ? 71.610  42.907   50.228  1.00 252.11 ? 19  LEU I CA    1 
ATOM 8319  C C     . LEU O  3 6   ? 71.009  44.058   49.401  1.00 261.82 ? 19  LEU I C     1 
ATOM 8320  O O     . LEU O  3 6   ? 71.631  45.119   49.260  1.00 259.42 ? 19  LEU I O     1 
ATOM 8321  C CB    . LEU O  3 6   ? 72.519  42.033   49.378  1.00 241.16 ? 19  LEU I CB    1 
ATOM 8322  C CG    . LEU O  3 6   ? 73.434  41.165   50.241  1.00 237.78 ? 19  LEU I CG    1 
ATOM 8323  C CD1   . LEU O  3 6   ? 74.165  40.195   49.332  1.00 236.32 ? 19  LEU I CD1   1 
ATOM 8324  C CD2   . LEU O  3 6   ? 74.417  41.977   51.067  1.00 236.85 ? 19  LEU I CD2   1 
ATOM 8325  N N     . LYS O  3 7   ? 69.802  43.836   48.873  1.00 280.52 ? 20  LYS I N     1 
ATOM 8326  C CA    . LYS O  3 7   ? 68.966  44.877   48.219  1.00 297.02 ? 20  LYS I CA    1 
ATOM 8327  C C     . LYS O  3 7   ? 68.662  46.086   49.131  1.00 308.73 ? 20  LYS I C     1 
ATOM 8328  O O     . LYS O  3 7   ? 68.812  47.255   48.732  1.00 317.94 ? 20  LYS I O     1 
ATOM 8329  C CB    . LYS O  3 7   ? 67.610  44.289   47.761  1.00 299.71 ? 20  LYS I CB    1 
ATOM 8330  C CG    . LYS O  3 7   ? 67.618  43.342   46.564  1.00 297.50 ? 20  LYS I CG    1 
ATOM 8331  C CD    . LYS O  3 7   ? 66.249  42.693   46.363  1.00 296.48 ? 20  LYS I CD    1 
ATOM 8332  C CE    . LYS O  3 7   ? 66.353  41.420   45.536  1.00 293.38 ? 20  LYS I CE    1 
ATOM 8333  N NZ    . LYS O  3 7   ? 65.400  40.353   45.964  1.00 286.57 ? 20  LYS I NZ    1 
ATOM 8334  N N     . ALA O  3 8   ? 68.191  45.801   50.342  1.00 312.40 ? 21  ALA I N     1 
ATOM 8335  C CA    . ALA O  3 8   ? 67.825  46.861   51.272  1.00 311.96 ? 21  ALA I CA    1 
ATOM 8336  C C     . ALA O  3 8   ? 69.079  47.658   51.704  1.00 316.17 ? 21  ALA I C     1 
ATOM 8337  O O     . ALA O  3 8   ? 68.984  48.843   52.022  1.00 317.74 ? 21  ALA I O     1 
ATOM 8338  C CB    . ALA O  3 8   ? 67.051  46.296   52.460  1.00 306.41 ? 21  ALA I CB    1 
ATOM 8339  N N     . ALA O  3 9   ? 70.252  47.014   51.664  1.00 315.83 ? 22  ALA I N     1 
ATOM 8340  C CA    . ALA O  3 9   ? 71.542  47.656   51.975  1.00 312.81 ? 22  ALA I CA    1 
ATOM 8341  C C     . ALA O  3 9   ? 71.872  48.760   50.988  1.00 304.83 ? 22  ALA I C     1 
ATOM 8342  O O     . ALA O  3 9   ? 72.336  49.842   51.362  1.00 307.53 ? 22  ALA I O     1 
ATOM 8343  C CB    . ALA O  3 9   ? 72.657  46.625   51.985  1.00 313.21 ? 22  ALA I CB    1 
ATOM 8344  N N     . VAL O  3 10  ? 71.633  48.468   49.720  1.00 290.56 ? 23  VAL I N     1 
ATOM 8345  C CA    . VAL O  3 10  ? 71.769  49.451   48.670  1.00 275.82 ? 23  VAL I CA    1 
ATOM 8346  C C     . VAL O  3 10  ? 70.928  50.687   49.004  1.00 274.67 ? 23  VAL I C     1 
ATOM 8347  O O     . VAL O  3 10  ? 71.432  51.809   48.959  1.00 273.68 ? 23  VAL I O     1 
ATOM 8348  C CB    . VAL O  3 10  ? 71.358  48.863   47.301  1.00 267.47 ? 23  VAL I CB    1 
ATOM 8349  C CG1   . VAL O  3 10  ? 71.596  49.867   46.192  1.00 262.76 ? 23  VAL I CG1   1 
ATOM 8350  C CG2   . VAL O  3 10  ? 72.134  47.594   47.004  1.00 263.38 ? 23  VAL I CG2   1 
ATOM 8351  N N     . HIS O  3 11  ? 69.662  50.472   49.370  1.00 273.83 ? 24  HIS I N     1 
ATOM 8352  C CA    . HIS O  3 11  ? 68.732  51.570   49.665  1.00 272.62 ? 24  HIS I CA    1 
ATOM 8353  C C     . HIS O  3 11  ? 69.253  52.533   50.698  1.00 266.82 ? 24  HIS I C     1 
ATOM 8354  O O     . HIS O  3 11  ? 69.065  53.743   50.589  1.00 260.45 ? 24  HIS I O     1 
ATOM 8355  C CB    . HIS O  3 11  ? 67.383  51.052   50.163  1.00 278.59 ? 24  HIS I CB    1 
ATOM 8356  C CG    . HIS O  3 11  ? 66.365  52.137   50.358  1.00 286.67 ? 24  HIS I CG    1 
ATOM 8357  N ND1   . HIS O  3 11  ? 65.878  52.886   49.308  1.00 291.98 ? 24  HIS I ND1   1 
ATOM 8358  C CD2   . HIS O  3 11  ? 65.753  52.608   51.472  1.00 291.90 ? 24  HIS I CD2   1 
ATOM 8359  C CE1   . HIS O  3 11  ? 65.000  53.763   49.762  1.00 298.00 ? 24  HIS I CE1   1 
ATOM 8360  N NE2   . HIS O  3 11  ? 64.910  53.619   51.073  1.00 299.93 ? 24  HIS I NE2   1 
ATOM 8361  N N     . TYR O  3 12  ? 69.884  51.972   51.718  1.00 266.02 ? 25  TYR I N     1 
ATOM 8362  C CA    . TYR O  3 12  ? 70.393  52.743   52.827  1.00 271.91 ? 25  TYR I CA    1 
ATOM 8363  C C     . TYR O  3 12  ? 71.319  53.861   52.323  1.00 269.54 ? 25  TYR I C     1 
ATOM 8364  O O     . TYR O  3 12  ? 71.074  55.045   52.604  1.00 271.37 ? 25  TYR I O     1 
ATOM 8365  C CB    . TYR O  3 12  ? 71.067  51.806   53.865  1.00 283.51 ? 25  TYR I CB    1 
ATOM 8366  C CG    . TYR O  3 12  ? 72.036  52.482   54.828  1.00 295.82 ? 25  TYR I CG    1 
ATOM 8367  C CD1   . TYR O  3 12  ? 71.593  53.048   56.035  1.00 300.44 ? 25  TYR I CD1   1 
ATOM 8368  C CD2   . TYR O  3 12  ? 73.404  52.545   54.532  1.00 300.11 ? 25  TYR I CD2   1 
ATOM 8369  C CE1   . TYR O  3 12  ? 72.485  53.676   56.894  1.00 305.63 ? 25  TYR I CE1   1 
ATOM 8370  C CE2   . TYR O  3 12  ? 74.294  53.173   55.379  1.00 304.12 ? 25  TYR I CE2   1 
ATOM 8371  C CZ    . TYR O  3 12  ? 73.838  53.729   56.556  1.00 306.43 ? 25  TYR I CZ    1 
ATOM 8372  O OH    . TYR O  3 12  ? 74.757  54.339   57.372  1.00 310.19 ? 25  TYR I OH    1 
ATOM 8373  N N     . THR O  3 13  ? 72.357  53.502   51.560  1.00 265.24 ? 26  THR I N     1 
ATOM 8374  C CA    . THR O  3 13  ? 73.341  54.523   51.151  1.00 263.18 ? 26  THR I CA    1 
ATOM 8375  C C     . THR O  3 13  ? 72.797  55.452   50.078  1.00 264.59 ? 26  THR I C     1 
ATOM 8376  O O     . THR O  3 13  ? 73.154  56.622   50.038  1.00 266.76 ? 26  THR I O     1 
ATOM 8377  C CB    . THR O  3 13  ? 74.724  53.991   50.710  1.00 258.99 ? 26  THR I CB    1 
ATOM 8378  O OG1   . THR O  3 13  ? 75.021  52.735   51.338  1.00 257.03 ? 26  THR I OG1   1 
ATOM 8379  C CG2   . THR O  3 13  ? 75.803  55.023   51.065  1.00 259.47 ? 26  THR I CG2   1 
ATOM 8380  N N     . VAL O  3 14  ? 71.932  54.928   49.218  1.00 263.62 ? 27  VAL I N     1 
ATOM 8381  C CA    . VAL O  3 14  ? 71.186  55.757   48.277  1.00 262.22 ? 27  VAL I CA    1 
ATOM 8382  C C     . VAL O  3 14  ? 70.419  56.837   49.043  1.00 262.08 ? 27  VAL I C     1 
ATOM 8383  O O     . VAL O  3 14  ? 70.493  57.997   48.670  1.00 263.28 ? 27  VAL I O     1 
ATOM 8384  C CB    . VAL O  3 14  ? 70.267  54.918   47.357  1.00 257.86 ? 27  VAL I CB    1 
ATOM 8385  C CG1   . VAL O  3 14  ? 69.448  55.799   46.424  1.00 256.28 ? 27  VAL I CG1   1 
ATOM 8386  C CG2   . VAL O  3 14  ? 71.105  53.982   46.509  1.00 255.15 ? 27  VAL I CG2   1 
ATOM 8387  N N     . GLY O  3 15  ? 69.729  56.460   50.124  1.00 258.91 ? 28  GLY I N     1 
ATOM 8388  C CA    . GLY O  3 15  ? 69.024  57.417   50.996  1.00 261.85 ? 28  GLY I CA    1 
ATOM 8389  C C     . GLY O  3 15  ? 69.915  58.561   51.455  1.00 270.68 ? 28  GLY I C     1 
ATOM 8390  O O     . GLY O  3 15  ? 69.552  59.729   51.342  1.00 270.75 ? 28  GLY I O     1 
ATOM 8391  N N     . CYS O  3 16  ? 71.100  58.211   51.949  1.00 279.57 ? 29  CYS I N     1 
ATOM 8392  C CA    . CYS O  3 16  ? 72.111  59.171   52.405  1.00 288.69 ? 29  CYS I CA    1 
ATOM 8393  C C     . CYS O  3 16  ? 72.652  60.136   51.314  1.00 284.14 ? 29  CYS I C     1 
ATOM 8394  O O     . CYS O  3 16  ? 72.597  61.356   51.473  1.00 296.51 ? 29  CYS I O     1 
ATOM 8395  C CB    . CYS O  3 16  ? 73.291  58.427   53.081  1.00 292.21 ? 29  CYS I CB    1 
ATOM 8396  S SG    . CYS O  3 16  ? 73.133  57.920   54.816  1.00 298.90 ? 29  CYS I SG    1 
ATOM 8397  N N     . LEU O  3 17  ? 73.194  59.601   50.224  1.00 265.81 ? 30  LEU I N     1 
ATOM 8398  C CA    . LEU O  3 17  ? 73.912  60.435   49.255  1.00 254.37 ? 30  LEU I CA    1 
ATOM 8399  C C     . LEU O  3 17  ? 72.952  61.280   48.417  1.00 258.73 ? 30  LEU I C     1 
ATOM 8400  O O     . LEU O  3 17  ? 73.295  62.359   47.928  1.00 254.57 ? 30  LEU I O     1 
ATOM 8401  C CB    . LEU O  3 17  ? 74.826  59.578   48.376  1.00 238.98 ? 30  LEU I CB    1 
ATOM 8402  C CG    . LEU O  3 17  ? 75.664  58.494   49.073  1.00 230.09 ? 30  LEU I CG    1 
ATOM 8403  C CD1   . LEU O  3 17  ? 76.506  57.733   48.060  1.00 223.96 ? 30  LEU I CD1   1 
ATOM 8404  C CD2   . LEU O  3 17  ? 76.541  59.053   50.184  1.00 230.70 ? 30  LEU I CD2   1 
ATOM 8405  N N     . CYS O  3 18  ? 71.731  60.780   48.266  1.00 269.03 ? 31  CYS I N     1 
ATOM 8406  C CA    . CYS O  3 18  ? 70.676  61.563   47.633  1.00 285.63 ? 31  CYS I CA    1 
ATOM 8407  C C     . CYS O  3 18  ? 70.265  62.730   48.526  1.00 290.42 ? 31  CYS I C     1 
ATOM 8408  O O     . CYS O  3 18  ? 69.782  63.761   48.034  1.00 291.14 ? 31  CYS I O     1 
ATOM 8409  C CB    . CYS O  3 18  ? 69.450  60.700   47.305  1.00 296.04 ? 31  CYS I CB    1 
ATOM 8410  S SG    . CYS O  3 18  ? 69.261  60.161   45.584  1.00 322.70 ? 31  CYS I SG    1 
ATOM 8411  N N     . GLU O  3 19  ? 70.443  62.567   49.835  1.00 296.56 ? 32  GLU I N     1 
ATOM 8412  C CA    . GLU O  3 19  ? 70.241  63.678   50.745  1.00 304.01 ? 32  GLU I CA    1 
ATOM 8413  C C     . GLU O  3 19  ? 71.243  64.800   50.517  1.00 299.00 ? 32  GLU I C     1 
ATOM 8414  O O     . GLU O  3 19  ? 70.857  65.968   50.598  1.00 300.56 ? 32  GLU I O     1 
ATOM 8415  C CB    . GLU O  3 19  ? 70.159  63.227   52.201  1.00 314.46 ? 32  GLU I CB    1 
ATOM 8416  C CG    . GLU O  3 19  ? 68.748  62.761   52.529  1.00 315.43 ? 32  GLU I CG    1 
ATOM 8417  C CD    . GLU O  3 19  ? 67.714  63.841   52.235  1.00 317.44 ? 32  GLU I CD    1 
ATOM 8418  O OE1   . GLU O  3 19  ? 67.876  64.959   52.772  1.00 323.72 ? 32  GLU I OE1   1 
ATOM 8419  O OE2   . GLU O  3 19  ? 66.752  63.592   51.477  1.00 315.83 ? 32  GLU I OE2   1 
ATOM 8420  N N     . GLU O  3 20  ? 72.486  64.442   50.182  1.00 290.31 ? 33  GLU I N     1 
ATOM 8421  C CA    . GLU O  3 20  ? 73.505  65.409   49.704  1.00 288.94 ? 33  GLU I CA    1 
ATOM 8422  C C     . GLU O  3 20  ? 73.004  66.354   48.577  1.00 288.92 ? 33  GLU I C     1 
ATOM 8423  O O     . GLU O  3 20  ? 73.172  67.577   48.658  1.00 294.68 ? 33  GLU I O     1 
ATOM 8424  C CB    . GLU O  3 20  ? 74.781  64.676   49.265  1.00 286.90 ? 33  GLU I CB    1 
ATOM 8425  C CG    . GLU O  3 20  ? 75.545  64.000   50.403  1.00 293.11 ? 33  GLU I CG    1 
ATOM 8426  C CD    . GLU O  3 20  ? 77.016  63.770   50.103  1.00 298.43 ? 33  GLU I CD    1 
ATOM 8427  O OE1   . GLU O  3 20  ? 77.525  64.350   49.121  1.00 303.30 ? 33  GLU I OE1   1 
ATOM 8428  O OE2   . GLU O  3 20  ? 77.660  63.009   50.856  1.00 301.58 ? 33  GLU I OE2   1 
ATOM 8429  N N     . VAL O  3 21  ? 72.393  65.775   47.538  1.00 283.84 ? 34  VAL I N     1 
ATOM 8430  C CA    . VAL O  3 21  ? 71.770  66.537   46.425  1.00 283.88 ? 34  VAL I CA    1 
ATOM 8431  C C     . VAL O  3 21  ? 70.444  67.293   46.777  1.00 285.97 ? 34  VAL I C     1 
ATOM 8432  O O     . VAL O  3 21  ? 70.211  68.409   46.273  1.00 290.62 ? 34  VAL I O     1 
ATOM 8433  C CB    . VAL O  3 21  ? 71.607  65.661   45.151  1.00 277.46 ? 34  VAL I CB    1 
ATOM 8434  C CG1   . VAL O  3 21  ? 71.117  66.497   43.975  1.00 276.64 ? 34  VAL I CG1   1 
ATOM 8435  C CG2   . VAL O  3 21  ? 72.926  64.986   44.783  1.00 274.96 ? 34  VAL I CG2   1 
ATOM 8436  N N     . ALA O  3 22  ? 69.591  66.711   47.628  1.00 283.07 ? 35  ALA I N     1 
ATOM 8437  C CA    . ALA O  3 22  ? 68.379  67.400   48.121  1.00 287.80 ? 35  ALA I CA    1 
ATOM 8438  C C     . ALA O  3 22  ? 68.766  68.694   48.839  1.00 304.93 ? 35  ALA I C     1 
ATOM 8439  O O     . ALA O  3 22  ? 68.118  69.725   48.657  1.00 311.52 ? 35  ALA I O     1 
ATOM 8440  C CB    . ALA O  3 22  ? 67.561  66.496   49.034  1.00 278.47 ? 35  ALA I CB    1 
ATOM 8441  N N     . LEU O  3 23  ? 69.845  68.621   49.629  1.00 321.12 ? 36  LEU I N     1 
ATOM 8442  C CA    . LEU O  3 23  ? 70.463  69.766   50.352  1.00 337.98 ? 36  LEU I CA    1 
ATOM 8443  C C     . LEU O  3 23  ? 70.920  70.876   49.395  1.00 345.38 ? 36  LEU I C     1 
ATOM 8444  O O     . LEU O  3 23  ? 70.584  72.058   49.548  1.00 347.77 ? 36  LEU I O     1 
ATOM 8445  C CB    . LEU O  3 23  ? 71.664  69.292   51.236  1.00 338.15 ? 36  LEU I CB    1 
ATOM 8446  C CG    . LEU O  3 23  ? 71.689  69.075   52.786  1.00 339.41 ? 36  LEU I CG    1 
ATOM 8447  C CD1   . LEU O  3 23  ? 71.129  67.743   53.272  1.00 334.04 ? 36  LEU I CD1   1 
ATOM 8448  C CD2   . LEU O  3 23  ? 73.093  69.257   53.367  1.00 341.08 ? 36  LEU I CD2   1 
ATOM 8449  N N     . ASP O  3 24  ? 71.693  70.445   48.407  1.00 348.78 ? 37  ASP I N     1 
ATOM 8450  C CA    . ASP O  3 24  ? 72.357  71.281   47.421  1.00 353.50 ? 37  ASP I CA    1 
ATOM 8451  C C     . ASP O  3 24  ? 71.364  72.131   46.577  1.00 355.69 ? 37  ASP I C     1 
ATOM 8452  O O     . ASP O  3 24  ? 71.643  73.299   46.273  1.00 353.23 ? 37  ASP I O     1 
ATOM 8453  C CB    . ASP O  3 24  ? 73.311  70.346   46.608  1.00 351.26 ? 37  ASP I CB    1 
ATOM 8454  C CG    . ASP O  3 24  ? 73.751  70.903   45.246  1.00 353.72 ? 37  ASP I CG    1 
ATOM 8455  O OD1   . ASP O  3 24  ? 74.370  71.992   45.192  1.00 356.97 ? 37  ASP I OD1   1 
ATOM 8456  O OD2   . ASP O  3 24  ? 73.524  70.211   44.218  1.00 354.88 ? 37  ASP I OD2   1 
ATOM 8457  N N     . LYS O  3 25  ? 70.188  71.580   46.277  1.00 357.46 ? 38  LYS I N     1 
ATOM 8458  C CA    . LYS O  3 25  ? 69.328  72.142   45.226  1.00 359.39 ? 38  LYS I CA    1 
ATOM 8459  C C     . LYS O  3 25  ? 68.094  72.906   45.702  1.00 365.89 ? 38  LYS I C     1 
ATOM 8460  O O     . LYS O  3 25  ? 67.384  73.521   44.901  1.00 376.02 ? 38  LYS I O     1 
ATOM 8461  C CB    . LYS O  3 25  ? 68.902  71.030   44.254  1.00 348.36 ? 38  LYS I CB    1 
ATOM 8462  C CG    . LYS O  3 25  ? 69.850  70.777   43.080  1.00 339.67 ? 38  LYS I CG    1 
ATOM 8463  C CD    . LYS O  3 25  ? 69.496  71.638   41.862  1.00 337.65 ? 38  LYS I CD    1 
ATOM 8464  C CE    . LYS O  3 25  ? 69.956  71.030   40.538  1.00 329.60 ? 38  LYS I CE    1 
ATOM 8465  N NZ    . LYS O  3 25  ? 69.519  71.832   39.355  1.00 329.07 ? 38  LYS I NZ    1 
ATOM 8466  N N     . ALA O  3 26  ? 67.837  72.871   47.001  1.00 362.95 ? 39  ALA I N     1 
ATOM 8467  C CA    . ALA O  3 26  ? 66.564  73.377   47.553  1.00 357.72 ? 39  ALA I CA    1 
ATOM 8468  C C     . ALA O  3 26  ? 65.284  72.708   46.960  1.00 350.03 ? 39  ALA I C     1 
ATOM 8469  O O     . ALA O  3 26  ? 64.245  73.376   46.792  1.00 344.31 ? 39  ALA I O     1 
ATOM 8470  C CB    . ALA O  3 26  ? 66.491  74.909   47.479  1.00 359.72 ? 39  ALA I CB    1 
ATOM 8471  N N     . MET O  3 27  ? 65.370  71.392   46.691  1.00 338.17 ? 40  MET I N     1 
ATOM 8472  C CA    . MET O  3 27  ? 64.233  70.533   46.262  1.00 323.36 ? 40  MET I CA    1 
ATOM 8473  C C     . MET O  3 27  ? 64.278  69.078   46.851  1.00 319.86 ? 40  MET I C     1 
ATOM 8474  O O     . MET O  3 27  ? 65.297  68.370   46.740  1.00 314.86 ? 40  MET I O     1 
ATOM 8475  C CB    . MET O  3 27  ? 64.113  70.558   44.719  1.00 305.48 ? 40  MET I CB    1 
ATOM 8476  C CG    . MET O  3 27  ? 62.707  70.645   44.140  1.00 288.52 ? 40  MET I CG    1 
ATOM 8477  S SD    . MET O  3 27  ? 62.286  72.173   43.303  1.00 275.89 ? 40  MET I SD    1 
ATOM 8478  C CE    . MET O  3 27  ? 61.785  73.160   44.699  1.00 287.66 ? 40  MET I CE    1 
ATOM 8479  N N     . GLN O  3 28  ? 63.173  68.661   47.490  1.00 317.30 ? 41  GLN I N     1 
ATOM 8480  C CA    . GLN O  3 28  ? 63.075  67.381   48.227  1.00 306.87 ? 41  GLN I CA    1 
ATOM 8481  C C     . GLN O  3 28  ? 62.438  66.265   47.419  1.00 300.20 ? 41  GLN I C     1 
ATOM 8482  O O     . GLN O  3 28  ? 61.553  66.502   46.610  1.00 300.37 ? 41  GLN I O     1 
ATOM 8483  C CB    . GLN O  3 28  ? 62.251  67.538   49.498  1.00 305.49 ? 41  GLN I CB    1 
ATOM 8484  C CG    . GLN O  3 28  ? 60.988  68.351   49.297  1.00 304.77 ? 41  GLN I CG    1 
ATOM 8485  C CD    . GLN O  3 28  ? 61.189  69.771   49.700  1.00 307.66 ? 41  GLN I CD    1 
ATOM 8486  O OE1   . GLN O  3 28  ? 61.557  70.021   50.834  1.00 307.93 ? 41  GLN I OE1   1 
ATOM 8487  N NE2   . GLN O  3 28  ? 60.965  70.710   48.784  1.00 307.74 ? 41  GLN I NE2   1 
ATOM 8488  N N     . PHE O  3 29  ? 62.854  65.038   47.701  1.00 292.47 ? 42  PHE I N     1 
ATOM 8489  C CA    . PHE O  3 29  ? 62.507  63.904   46.855  1.00 284.89 ? 42  PHE I CA    1 
ATOM 8490  C C     . PHE O  3 29  ? 61.400  63.075   47.460  1.00 278.15 ? 42  PHE I C     1 
ATOM 8491  O O     . PHE O  3 29  ? 61.313  62.966   48.682  1.00 270.07 ? 42  PHE I O     1 
ATOM 8492  C CB    . PHE O  3 29  ? 63.735  63.010   46.625  1.00 289.53 ? 42  PHE I CB    1 
ATOM 8493  C CG    . PHE O  3 29  ? 64.721  63.560   45.606  1.00 294.66 ? 42  PHE I CG    1 
ATOM 8494  C CD1   . PHE O  3 29  ? 65.230  64.866   45.724  1.00 299.73 ? 42  PHE I CD1   1 
ATOM 8495  C CD2   . PHE O  3 29  ? 65.156  62.770   44.527  1.00 292.73 ? 42  PHE I CD2   1 
ATOM 8496  C CE1   . PHE O  3 29  ? 66.144  65.352   44.783  1.00 299.97 ? 42  PHE I CE1   1 
ATOM 8497  C CE2   . PHE O  3 29  ? 66.052  63.256   43.586  1.00 295.13 ? 42  PHE I CE2   1 
ATOM 8498  C CZ    . PHE O  3 29  ? 66.551  64.551   43.715  1.00 298.16 ? 42  PHE I CZ    1 
ATOM 8499  N N     . SER O  3 30  ? 60.561  62.499   46.598  1.00 279.59 ? 43  SER I N     1 
ATOM 8500  C CA    . SER O  3 30  ? 59.591  61.502   47.031  1.00 287.20 ? 43  SER I CA    1 
ATOM 8501  C C     . SER O  3 30  ? 60.311  60.189   47.432  1.00 289.44 ? 43  SER I C     1 
ATOM 8502  O O     . SER O  3 30  ? 61.393  59.879   46.913  1.00 289.91 ? 43  SER I O     1 
ATOM 8503  C CB    . SER O  3 30  ? 58.546  61.252   45.935  1.00 289.64 ? 43  SER I CB    1 
ATOM 8504  O OG    . SER O  3 30  ? 59.115  60.551   44.846  1.00 290.71 ? 43  SER I OG    1 
ATOM 8505  N N     . LYS O  3 31  ? 59.720  59.450   48.380  1.00 289.75 ? 44  LYS I N     1 
ATOM 8506  C CA    . LYS O  3 31  ? 60.298  58.196   48.904  1.00 285.44 ? 44  LYS I CA    1 
ATOM 8507  C C     . LYS O  3 31  ? 60.407  57.129   47.801  1.00 282.31 ? 44  LYS I C     1 
ATOM 8508  O O     . LYS O  3 31  ? 61.392  56.383   47.754  1.00 280.03 ? 44  LYS I O     1 
ATOM 8509  C CB    . LYS O  3 31  ? 59.505  57.689   50.135  1.00 282.17 ? 44  LYS I CB    1 
ATOM 8510  C CG    . LYS O  3 31  ? 60.084  56.450   50.831  1.00 277.55 ? 44  LYS I CG    1 
ATOM 8511  C CD    . LYS O  3 31  ? 61.389  56.708   51.576  1.00 279.43 ? 44  LYS I CD    1 
ATOM 8512  C CE    . LYS O  3 31  ? 61.173  56.964   53.065  1.00 284.52 ? 44  LYS I CE    1 
ATOM 8513  N NZ    . LYS O  3 31  ? 62.155  56.169   53.828  1.00 287.16 ? 44  LYS I NZ    1 
ATOM 8514  N N     . GLN O  3 32  ? 59.412  57.089   46.905  1.00 275.83 ? 45  GLN I N     1 
ATOM 8515  C CA    . GLN O  3 32  ? 59.444  56.200   45.737  1.00 259.59 ? 45  GLN I CA    1 
ATOM 8516  C C     . GLN O  3 32  ? 60.626  56.514   44.801  1.00 248.73 ? 45  GLN I C     1 
ATOM 8517  O O     . GLN O  3 32  ? 61.198  55.589   44.252  1.00 240.46 ? 45  GLN I O     1 
ATOM 8518  C CB    . GLN O  3 32  ? 58.117  56.203   44.950  1.00 259.94 ? 45  GLN I CB    1 
ATOM 8519  C CG    . GLN O  3 32  ? 56.853  56.030   45.779  1.00 266.52 ? 45  GLN I CG    1 
ATOM 8520  C CD    . GLN O  3 32  ? 56.211  57.356   46.138  1.00 273.94 ? 45  GLN I CD    1 
ATOM 8521  O OE1   . GLN O  3 32  ? 56.832  58.214   46.769  1.00 282.31 ? 45  GLN I OE1   1 
ATOM 8522  N NE2   . GLN O  3 32  ? 54.955  57.530   45.739  1.00 275.02 ? 45  GLN I NE2   1 
ATOM 8523  N N     . THR O  3 33  ? 60.978  57.798   44.629  1.00 244.18 ? 46  THR I N     1 
ATOM 8524  C CA    . THR O  3 33  ? 62.185  58.208   43.902  1.00 235.18 ? 46  THR I CA    1 
ATOM 8525  C C     . THR O  3 33  ? 63.394  57.592   44.533  1.00 228.73 ? 46  THR I C     1 
ATOM 8526  O O     . THR O  3 33  ? 64.212  56.982   43.871  1.00 223.66 ? 46  THR I O     1 
ATOM 8527  C CB    . THR O  3 33  ? 62.401  59.716   43.976  1.00 238.40 ? 46  THR I CB    1 
ATOM 8528  O OG1   . THR O  3 33  ? 61.461  60.362   43.120  1.00 240.92 ? 46  THR I OG1   1 
ATOM 8529  C CG2   . THR O  3 33  ? 63.820  60.074   43.553  1.00 234.77 ? 46  THR I CG2   1 
ATOM 8530  N N     . ILE O  3 34  ? 63.486  57.766   45.836  1.00 226.61 ? 47  ILE I N     1 
ATOM 8531  C CA    . ILE O  3 34  ? 64.500  57.125   46.614  1.00 220.25 ? 47  ILE I CA    1 
ATOM 8532  C C     . ILE O  3 34  ? 64.439  55.599   46.372  1.00 215.14 ? 47  ILE I C     1 
ATOM 8533  O O     . ILE O  3 34  ? 65.413  55.018   45.876  1.00 213.34 ? 47  ILE I O     1 
ATOM 8534  C CB    . ILE O  3 34  ? 64.340  57.511   48.102  1.00 221.87 ? 47  ILE I CB    1 
ATOM 8535  C CG1   . ILE O  3 34  ? 64.110  59.024   48.269  1.00 222.61 ? 47  ILE I CG1   1 
ATOM 8536  C CG2   . ILE O  3 34  ? 65.529  57.040   48.920  1.00 221.96 ? 47  ILE I CG2   1 
ATOM 8537  C CD1   . ILE O  3 34  ? 65.225  59.927   47.771  1.00 221.51 ? 47  ILE I CD1   1 
ATOM 8538  N N     . ALA O  3 35  ? 63.293  54.971   46.677  1.00 211.39 ? 48  ALA I N     1 
ATOM 8539  C CA    . ALA O  3 35  ? 63.073  53.522   46.459  1.00 207.09 ? 48  ALA I CA    1 
ATOM 8540  C C     . ALA O  3 35  ? 63.378  53.106   45.014  1.00 207.90 ? 48  ALA I C     1 
ATOM 8541  O O     . ALA O  3 35  ? 63.942  52.035   44.760  1.00 206.30 ? 48  ALA I O     1 
ATOM 8542  C CB    . ALA O  3 35  ? 61.648  53.120   46.845  1.00 202.94 ? 48  ALA I CB    1 
ATOM 8543  N N     . ALA O  3 36  ? 63.023  53.976   44.073  1.00 212.80 ? 49  ALA I N     1 
ATOM 8544  C CA    . ALA O  3 36  ? 63.257  53.729   42.654  1.00 216.92 ? 49  ALA I CA    1 
ATOM 8545  C C     . ALA O  3 36  ? 64.738  53.661   42.303  1.00 217.29 ? 49  ALA I C     1 
ATOM 8546  O O     . ALA O  3 36  ? 65.137  52.737   41.600  1.00 216.65 ? 49  ALA I O     1 
ATOM 8547  C CB    . ALA O  3 36  ? 62.541  54.758   41.781  1.00 218.43 ? 49  ALA I CB    1 
ATOM 8548  N N     . ILE O  3 37  ? 65.540  54.623   42.786  1.00 215.94 ? 50  ILE I N     1 
ATOM 8549  C CA    . ILE O  3 37  ? 66.973  54.689   42.429  1.00 213.56 ? 50  ILE I CA    1 
ATOM 8550  C C     . ILE O  3 37  ? 67.705  53.463   42.949  1.00 220.62 ? 50  ILE I C     1 
ATOM 8551  O O     . ILE O  3 37  ? 68.694  53.024   42.366  1.00 222.86 ? 50  ILE I O     1 
ATOM 8552  C CB    . ILE O  3 37  ? 67.691  55.959   42.944  1.00 207.66 ? 50  ILE I CB    1 
ATOM 8553  C CG1   . ILE O  3 37  ? 66.940  57.218   42.509  1.00 203.57 ? 50  ILE I CG1   1 
ATOM 8554  C CG2   . ILE O  3 37  ? 69.118  56.010   42.410  1.00 203.44 ? 50  ILE I CG2   1 
ATOM 8555  C CD1   . ILE O  3 37  ? 67.326  58.460   43.276  1.00 202.83 ? 50  ILE I CD1   1 
ATOM 8556  N N     . SER O  3 38  ? 67.190  52.905   44.036  1.00 225.71 ? 51  SER I N     1 
ATOM 8557  C CA    . SER O  3 38  ? 67.767  51.722   44.646  1.00 225.61 ? 51  SER I CA    1 
ATOM 8558  C C     . SER O  3 38  ? 67.560  50.472   43.791  1.00 225.90 ? 51  SER I C     1 
ATOM 8559  O O     . SER O  3 38  ? 68.523  49.803   43.403  1.00 226.33 ? 51  SER I O     1 
ATOM 8560  C CB    . SER O  3 38  ? 67.195  51.562   46.049  1.00 224.59 ? 51  SER I CB    1 
ATOM 8561  O OG    . SER O  3 38  ? 67.469  52.737   46.799  1.00 224.97 ? 51  SER I OG    1 
ATOM 8562  N N     . GLU O  3 39  ? 66.309  50.181   43.465  1.00 225.83 ? 52  GLU I N     1 
ATOM 8563  C CA    . GLU O  3 39  ? 66.006  49.067   42.582  1.00 226.20 ? 52  GLU I CA    1 
ATOM 8564  C C     . GLU O  3 39  ? 66.660  49.211   41.210  1.00 230.68 ? 52  GLU I C     1 
ATOM 8565  O O     . GLU O  3 39  ? 67.021  48.203   40.600  1.00 235.03 ? 52  GLU I O     1 
ATOM 8566  C CB    . GLU O  3 39  ? 64.510  48.943   42.390  1.00 222.08 ? 52  GLU I CB    1 
ATOM 8567  C CG    . GLU O  3 39  ? 63.749  48.558   43.645  1.00 220.68 ? 52  GLU I CG    1 
ATOM 8568  C CD    . GLU O  3 39  ? 62.304  49.021   43.600  1.00 221.44 ? 52  GLU I CD    1 
ATOM 8569  O OE1   . GLU O  3 39  ? 61.836  49.366   42.494  1.00 221.01 ? 52  GLU I OE1   1 
ATOM 8570  O OE2   . GLU O  3 39  ? 61.636  49.045   44.660  1.00 224.25 ? 52  GLU I OE2   1 
ATOM 8571  N N     . LEU O  3 40  ? 66.787  50.454   40.727  1.00 233.53 ? 53  LEU I N     1 
ATOM 8572  C CA    . LEU O  3 40  ? 67.425  50.776   39.427  1.00 234.85 ? 53  LEU I CA    1 
ATOM 8573  C C     . LEU O  3 40  ? 68.922  50.409   39.366  1.00 241.92 ? 53  LEU I C     1 
ATOM 8574  O O     . LEU O  3 40  ? 69.407  49.866   38.355  1.00 240.15 ? 53  LEU I O     1 
ATOM 8575  C CB    . LEU O  3 40  ? 67.228  52.269   39.084  1.00 230.37 ? 53  LEU I CB    1 
ATOM 8576  C CG    . LEU O  3 40  ? 68.124  52.988   38.065  1.00 228.24 ? 53  LEU I CG    1 
ATOM 8577  C CD1   . LEU O  3 40  ? 67.503  52.914   36.679  1.00 229.76 ? 53  LEU I CD1   1 
ATOM 8578  C CD2   . LEU O  3 40  ? 68.379  54.433   38.482  1.00 228.34 ? 53  LEU I CD2   1 
ATOM 8579  N N     . THR O  3 41  ? 69.642  50.727   40.445  1.00 252.59 ? 54  THR I N     1 
ATOM 8580  C CA    . THR O  3 41  ? 71.079  50.444   40.542  1.00 259.63 ? 54  THR I CA    1 
ATOM 8581  C C     . THR O  3 41  ? 71.277  48.939   40.582  1.00 270.85 ? 54  THR I C     1 
ATOM 8582  O O     . THR O  3 41  ? 72.217  48.423   39.988  1.00 269.08 ? 54  THR I O     1 
ATOM 8583  C CB    . THR O  3 41  ? 71.724  51.103   41.786  1.00 255.13 ? 54  THR I CB    1 
ATOM 8584  O OG1   . THR O  3 41  ? 71.301  52.475   41.888  1.00 250.53 ? 54  THR I OG1   1 
ATOM 8585  C CG2   . THR O  3 41  ? 73.259  51.032   41.716  1.00 252.05 ? 54  THR I CG2   1 
ATOM 8586  N N     . PHE O  3 42  ? 70.370  48.262   41.285  1.00 284.17 ? 55  PHE I N     1 
ATOM 8587  C CA    . PHE O  3 42  ? 70.293  46.806   41.323  1.00 290.70 ? 55  PHE I CA    1 
ATOM 8588  C C     . PHE O  3 42  ? 70.134  46.173   39.915  1.00 281.29 ? 55  PHE I C     1 
ATOM 8589  O O     . PHE O  3 42  ? 70.891  45.258   39.560  1.00 282.18 ? 55  PHE I O     1 
ATOM 8590  C CB    . PHE O  3 42  ? 69.171  46.365   42.290  1.00 299.31 ? 55  PHE I CB    1 
ATOM 8591  C CG    . PHE O  3 42  ? 69.223  44.903   42.655  1.00 304.75 ? 55  PHE I CG    1 
ATOM 8592  C CD1   . PHE O  3 42  ? 70.184  44.426   43.550  1.00 302.90 ? 55  PHE I CD1   1 
ATOM 8593  C CD2   . PHE O  3 42  ? 68.313  43.996   42.101  1.00 310.10 ? 55  PHE I CD2   1 
ATOM 8594  C CE1   . PHE O  3 42  ? 70.241  43.077   43.884  1.00 305.19 ? 55  PHE I CE1   1 
ATOM 8595  C CE2   . PHE O  3 42  ? 68.370  42.646   42.428  1.00 312.37 ? 55  PHE I CE2   1 
ATOM 8596  C CZ    . PHE O  3 42  ? 69.332  42.187   43.322  1.00 309.89 ? 55  PHE I CZ    1 
ATOM 8597  N N     . ARG O  3 43  ? 69.168  46.667   39.125  1.00 264.51 ? 56  ARG I N     1 
ATOM 8598  C CA    . ARG O  3 43  ? 68.976  46.256   37.710  1.00 247.44 ? 56  ARG I CA    1 
ATOM 8599  C C     . ARG O  3 43  ? 70.286  46.497   36.962  1.00 235.85 ? 56  ARG I C     1 
ATOM 8600  O O     . ARG O  3 43  ? 70.756  45.641   36.193  1.00 228.62 ? 56  ARG I O     1 
ATOM 8601  C CB    . ARG O  3 43  ? 67.840  47.072   37.049  1.00 254.09 ? 56  ARG I CB    1 
ATOM 8602  C CG    . ARG O  3 43  ? 67.016  46.339   35.979  1.00 262.21 ? 56  ARG I CG    1 
ATOM 8603  C CD    . ARG O  3 43  ? 66.631  47.215   34.790  1.00 271.22 ? 56  ARG I CD    1 
ATOM 8604  N NE    . ARG O  3 43  ? 65.254  47.748   34.835  1.00 273.32 ? 56  ARG I NE    1 
ATOM 8605  C CZ    . ARG O  3 43  ? 64.936  49.040   34.958  1.00 275.43 ? 56  ARG I CZ    1 
ATOM 8606  N NH1   . ARG O  3 43  ? 65.886  49.963   35.047  1.00 282.89 ? 56  ARG I NH1   1 
ATOM 8607  N NH2   . ARG O  3 43  ? 63.660  49.412   34.990  1.00 270.16 ? 56  ARG I NH2   1 
ATOM 8608  N N     . GLN O  3 44  ? 70.872  47.661   37.243  1.00 228.19 ? 57  GLN I N     1 
ATOM 8609  C CA    . GLN O  3 44  ? 72.072  48.146   36.596  1.00 225.35 ? 57  GLN I CA    1 
ATOM 8610  C C     . GLN O  3 44  ? 73.235  47.209   36.825  1.00 225.99 ? 57  GLN I C     1 
ATOM 8611  O O     . GLN O  3 44  ? 74.075  47.014   35.948  1.00 227.08 ? 57  GLN I O     1 
ATOM 8612  C CB    . GLN O  3 44  ? 72.401  49.533   37.139  1.00 223.15 ? 57  GLN I CB    1 
ATOM 8613  C CG    . GLN O  3 44  ? 73.141  50.417   36.166  1.00 225.90 ? 57  GLN I CG    1 
ATOM 8614  C CD    . GLN O  3 44  ? 72.553  50.410   34.767  1.00 228.41 ? 57  GLN I CD    1 
ATOM 8615  O OE1   . GLN O  3 44  ? 71.335  50.350   34.579  1.00 229.24 ? 57  GLN I OE1   1 
ATOM 8616  N NE2   . GLN O  3 44  ? 73.427  50.470   33.770  1.00 231.81 ? 57  GLN I NE2   1 
ATOM 8617  N N     . CYS O  3 45  ? 73.255  46.612   38.008  1.00 227.37 ? 58  CYS I N     1 
ATOM 8618  C CA    . CYS O  3 45  ? 74.331  45.718   38.417  1.00 230.49 ? 58  CYS I CA    1 
ATOM 8619  C C     . CYS O  3 45  ? 74.364  44.384   37.649  1.00 235.21 ? 58  CYS I C     1 
ATOM 8620  O O     . CYS O  3 45  ? 75.436  43.775   37.505  1.00 236.15 ? 58  CYS I O     1 
ATOM 8621  C CB    . CYS O  3 45  ? 74.326  45.526   39.948  1.00 229.58 ? 58  CYS I CB    1 
ATOM 8622  S SG    . CYS O  3 45  ? 74.745  46.997   40.937  1.00 228.66 ? 58  CYS I SG    1 
ATOM 8623  N N     . GLU O  3 46  ? 73.207  43.946   37.146  1.00 238.99 ? 59  GLU I N     1 
ATOM 8624  C CA    . GLU O  3 46  ? 73.172  42.794   36.266  1.00 245.37 ? 59  GLU I CA    1 
ATOM 8625  C C     . GLU O  3 46  ? 73.918  43.152   35.005  1.00 244.12 ? 59  GLU I C     1 
ATOM 8626  O O     . GLU O  3 46  ? 74.789  42.405   34.564  1.00 246.82 ? 59  GLU I O     1 
ATOM 8627  C CB    . GLU O  3 46  ? 71.748  42.332   35.956  1.00 254.85 ? 59  GLU I CB    1 
ATOM 8628  C CG    . GLU O  3 46  ? 71.709  41.117   35.017  1.00 277.21 ? 59  GLU I CG    1 
ATOM 8629  C CD    . GLU O  3 46  ? 70.646  40.072   35.390  1.00 296.08 ? 59  GLU I CD    1 
ATOM 8630  O OE1   . GLU O  3 46  ? 69.868  40.309   36.347  1.00 304.90 ? 59  GLU I OE1   1 
ATOM 8631  O OE2   . GLU O  3 46  ? 70.586  38.994   34.737  1.00 309.54 ? 59  GLU I OE2   1 
ATOM 8632  N N     . ASN O  3 47  ? 73.583  44.311   34.451  1.00 239.57 ? 60  ASN I N     1 
ATOM 8633  C CA    . ASN O  3 47  ? 74.284  44.829   33.294  1.00 236.88 ? 60  ASN I CA    1 
ATOM 8634  C C     . ASN O  3 47  ? 75.761  45.122   33.559  1.00 234.47 ? 60  ASN I C     1 
ATOM 8635  O O     . ASN O  3 47  ? 76.599  44.856   32.690  1.00 235.80 ? 60  ASN I O     1 
ATOM 8636  C CB    . ASN O  3 47  ? 73.560  46.043   32.740  1.00 235.59 ? 60  ASN I CB    1 
ATOM 8637  C CG    . ASN O  3 47  ? 72.123  45.730   32.377  1.00 234.25 ? 60  ASN I CG    1 
ATOM 8638  O OD1   . ASN O  3 47  ? 71.834  44.715   31.734  1.00 232.93 ? 60  ASN I OD1   1 
ATOM 8639  N ND2   . ASN O  3 47  ? 71.207  46.593   32.805  1.00 233.32 ? 60  ASN I ND2   1 
ATOM 8640  N N     . PHE O  3 48  ? 76.084  45.640   34.751  1.00 227.08 ? 61  PHE I N     1 
ATOM 8641  C CA    . PHE O  3 48  ? 77.492  45.812   35.169  1.00 220.88 ? 61  PHE I CA    1 
ATOM 8642  C C     . PHE O  3 48  ? 78.258  44.490   35.227  1.00 225.43 ? 61  PHE I C     1 
ATOM 8643  O O     . PHE O  3 48  ? 79.304  44.367   34.599  1.00 225.26 ? 61  PHE I O     1 
ATOM 8644  C CB    . PHE O  3 48  ? 77.617  46.532   36.513  1.00 211.20 ? 61  PHE I CB    1 
ATOM 8645  C CG    . PHE O  3 48  ? 77.152  47.956   36.490  1.00 205.85 ? 61  PHE I CG    1 
ATOM 8646  C CD1   . PHE O  3 48  ? 77.202  48.707   35.329  1.00 206.38 ? 61  PHE I CD1   1 
ATOM 8647  C CD2   . PHE O  3 48  ? 76.684  48.557   37.650  1.00 201.03 ? 61  PHE I CD2   1 
ATOM 8648  C CE1   . PHE O  3 48  ? 76.775  50.024   35.326  1.00 205.19 ? 61  PHE I CE1   1 
ATOM 8649  C CE2   . PHE O  3 48  ? 76.253  49.871   37.657  1.00 199.54 ? 61  PHE I CE2   1 
ATOM 8650  C CZ    . PHE O  3 48  ? 76.308  50.609   36.493  1.00 202.34 ? 61  PHE I CZ    1 
ATOM 8651  N N     . ALA O  3 49  ? 77.730  43.518   35.973  1.00 230.88 ? 62  ALA I N     1 
ATOM 8652  C CA    . ALA O  3 49  ? 78.289  42.160   36.056  1.00 238.91 ? 62  ALA I CA    1 
ATOM 8653  C C     . ALA O  3 49  ? 78.498  41.471   34.700  1.00 245.58 ? 62  ALA I C     1 
ATOM 8654  O O     . ALA O  3 49  ? 79.626  41.109   34.377  1.00 253.75 ? 62  ALA I O     1 
ATOM 8655  C CB    . ALA O  3 49  ? 77.426  41.301   36.950  1.00 238.66 ? 62  ALA I CB    1 
ATOM 8656  N N     . LYS O  3 50  ? 77.421  41.294   33.925  1.00 242.66 ? 63  LYS I N     1 
ATOM 8657  C CA    . LYS O  3 50  ? 77.470  40.794   32.524  1.00 240.09 ? 63  LYS I CA    1 
ATOM 8658  C C     . LYS O  3 50  ? 78.560  41.446   31.663  1.00 245.18 ? 63  LYS I C     1 
ATOM 8659  O O     . LYS O  3 50  ? 79.360  40.742   31.059  1.00 249.12 ? 63  LYS I O     1 
ATOM 8660  C CB    . LYS O  3 50  ? 76.141  41.045   31.797  1.00 229.74 ? 63  LYS I CB    1 
ATOM 8661  C CG    . LYS O  3 50  ? 75.144  39.890   31.707  1.00 220.08 ? 63  LYS I CG    1 
ATOM 8662  C CD    . LYS O  3 50  ? 74.149  40.162   30.603  1.00 215.17 ? 63  LYS I CD    1 
ATOM 8663  C CE    . LYS O  3 50  ? 72.921  39.277   30.728  1.00 211.92 ? 63  LYS I CE    1 
ATOM 8664  N NZ    . LYS O  3 50  ? 72.108  39.657   31.913  1.00 206.34 ? 63  LYS I NZ    1 
ATOM 8665  N N     . ASP O  3 51  ? 78.558  42.781   31.586  1.00 244.20 ? 64  ASP I N     1 
ATOM 8666  C CA    . ASP O  3 51  ? 79.450  43.515   30.686  1.00 244.78 ? 64  ASP I CA    1 
ATOM 8667  C C     . ASP O  3 51  ? 80.878  43.370   31.090  1.00 253.73 ? 64  ASP I C     1 
ATOM 8668  O O     . ASP O  3 51  ? 81.740  43.160   30.239  1.00 260.38 ? 64  ASP I O     1 
ATOM 8669  C CB    . ASP O  3 51  ? 79.108  44.993   30.642  1.00 231.60 ? 64  ASP I CB    1 
ATOM 8670  C CG    . ASP O  3 51  ? 77.905  45.265   29.816  1.00 223.84 ? 64  ASP I CG    1 
ATOM 8671  O OD1   . ASP O  3 51  ? 77.244  44.296   29.414  1.00 221.30 ? 64  ASP I OD1   1 
ATOM 8672  O OD2   . ASP O  3 51  ? 77.605  46.435   29.563  1.00 218.74 ? 64  ASP I OD2   1 
ATOM 8673  N N     . LEU O  3 52  ? 81.120  43.499   32.392  1.00 257.76 ? 65  LEU I N     1 
ATOM 8674  C CA    . LEU O  3 52  ? 82.463  43.350   32.937  1.00 260.68 ? 65  LEU I CA    1 
ATOM 8675  C C     . LEU O  3 52  ? 83.000  41.912   32.697  1.00 268.34 ? 65  LEU I C     1 
ATOM 8676  O O     . LEU O  3 52  ? 84.215  41.715   32.467  1.00 272.36 ? 65  LEU I O     1 
ATOM 8677  C CB    . LEU O  3 52  ? 82.521  43.796   34.418  1.00 251.02 ? 65  LEU I CB    1 
ATOM 8678  C CG    . LEU O  3 52  ? 82.300  45.283   34.762  1.00 241.76 ? 65  LEU I CG    1 
ATOM 8679  C CD1   . LEU O  3 52  ? 81.925  45.459   36.230  1.00 235.32 ? 65  LEU I CD1   1 
ATOM 8680  C CD2   . LEU O  3 52  ? 83.493  46.153   34.394  1.00 241.09 ? 65  LEU I CD2   1 
ATOM 8681  N N     . GLU O  3 53  ? 82.087  40.929   32.704  1.00 270.59 ? 66  GLU I N     1 
ATOM 8682  C CA    . GLU O  3 53  ? 82.427  39.536   32.378  1.00 270.96 ? 66  GLU I CA    1 
ATOM 8683  C C     . GLU O  3 53  ? 83.066  39.451   31.008  1.00 273.14 ? 66  GLU I C     1 
ATOM 8684  O O     . GLU O  3 53  ? 84.184  38.960   30.842  1.00 277.80 ? 66  GLU I O     1 
ATOM 8685  C CB    . GLU O  3 53  ? 81.194  38.626   32.383  1.00 268.88 ? 66  GLU I CB    1 
ATOM 8686  C CG    . GLU O  3 53  ? 81.501  37.246   31.798  1.00 270.79 ? 66  GLU I CG    1 
ATOM 8687  C CD    . GLU O  3 53  ? 80.282  36.392   31.541  1.00 270.65 ? 66  GLU I CD    1 
ATOM 8688  O OE1   . GLU O  3 53  ? 79.160  36.937   31.606  1.00 267.80 ? 66  GLU I OE1   1 
ATOM 8689  O OE2   . GLU O  3 53  ? 80.462  35.176   31.284  1.00 275.69 ? 66  GLU I OE2   1 
ATOM 8690  N N     . MET O  3 54  ? 82.336  39.964   30.036  1.00 271.19 ? 67  MET I N     1 
ATOM 8691  C CA    . MET O  3 54  ? 82.686  39.819   28.655  1.00 274.02 ? 67  MET I CA    1 
ATOM 8692  C C     . MET O  3 54  ? 83.925  40.660   28.300  1.00 271.23 ? 67  MET I C     1 
ATOM 8693  O O     . MET O  3 54  ? 84.616  40.345   27.342  1.00 276.05 ? 67  MET I O     1 
ATOM 8694  C CB    . MET O  3 54  ? 81.431  40.069   27.811  1.00 279.72 ? 67  MET I CB    1 
ATOM 8695  C CG    . MET O  3 54  ? 80.254  39.216   28.339  1.00 284.17 ? 67  MET I CG    1 
ATOM 8696  S SD    . MET O  3 54  ? 78.559  39.343   27.763  1.00 293.09 ? 67  MET I SD    1 
ATOM 8697  C CE    . MET O  3 54  ? 77.997  40.961   28.254  1.00 288.93 ? 67  MET I CE    1 
ATOM 8698  N N     . PHE O  3 55  ? 84.204  41.694   29.114  1.00 262.35 ? 68  PHE I N     1 
ATOM 8699  C CA    . PHE O  3 55  ? 85.480  42.467   29.089  1.00 258.99 ? 68  PHE I CA    1 
ATOM 8700  C C     . PHE O  3 55  ? 86.704  41.663   29.596  1.00 262.57 ? 68  PHE I C     1 
ATOM 8701  O O     . PHE O  3 55  ? 87.764  41.673   28.961  1.00 262.83 ? 68  PHE I O     1 
ATOM 8702  C CB    . PHE O  3 55  ? 85.430  43.770   29.943  1.00 252.19 ? 68  PHE I CB    1 
ATOM 8703  C CG    . PHE O  3 55  ? 84.357  44.776   29.564  1.00 249.90 ? 68  PHE I CG    1 
ATOM 8704  C CD1   . PHE O  3 55  ? 83.931  44.936   28.257  1.00 250.69 ? 68  PHE I CD1   1 
ATOM 8705  C CD2   . PHE O  3 55  ? 83.818  45.617   30.542  1.00 248.09 ? 68  PHE I CD2   1 
ATOM 8706  C CE1   . PHE O  3 55  ? 82.956  45.876   27.947  1.00 249.84 ? 68  PHE I CE1   1 
ATOM 8707  C CE2   . PHE O  3 55  ? 82.845  46.554   30.239  1.00 247.35 ? 68  PHE I CE2   1 
ATOM 8708  C CZ    . PHE O  3 55  ? 82.416  46.687   28.935  1.00 247.99 ? 68  PHE I CZ    1 
ATOM 8709  N N     . ALA O  3 56  ? 86.577  41.022   30.761  1.00 267.47 ? 69  ALA I N     1 
ATOM 8710  C CA    . ALA O  3 56  ? 87.691  40.286   31.373  1.00 279.42 ? 69  ALA I CA    1 
ATOM 8711  C C     . ALA O  3 56  ? 87.976  38.965   30.653  1.00 293.51 ? 69  ALA I C     1 
ATOM 8712  O O     . ALA O  3 56  ? 89.141  38.582   30.515  1.00 304.59 ? 69  ALA I O     1 
ATOM 8713  C CB    . ALA O  3 56  ? 87.420  40.038   32.839  1.00 274.25 ? 69  ALA I CB    1 
ATOM 8714  N N     . ARG O  3 57  ? 86.895  38.281   30.233  1.00 299.85 ? 70  ARG I N     1 
ATOM 8715  C CA    . ARG O  3 57  ? 86.884  37.147   29.250  1.00 305.33 ? 70  ARG I CA    1 
ATOM 8716  C C     . ARG O  3 57  ? 87.620  37.469   27.939  1.00 319.35 ? 70  ARG I C     1 
ATOM 8717  O O     . ARG O  3 57  ? 88.293  36.597   27.346  1.00 325.45 ? 70  ARG I O     1 
ATOM 8718  C CB    . ARG O  3 57  ? 85.424  36.701   28.919  1.00 291.04 ? 70  ARG I CB    1 
ATOM 8719  C CG    . ARG O  3 57  ? 85.048  36.682   27.423  1.00 278.79 ? 70  ARG I CG    1 
ATOM 8720  C CD    . ARG O  3 57  ? 83.740  35.965   27.114  1.00 270.79 ? 70  ARG I CD    1 
ATOM 8721  N NE    . ARG O  3 57  ? 83.692  34.616   27.694  1.00 267.79 ? 70  ARG I NE    1 
ATOM 8722  C CZ    . ARG O  3 57  ? 84.503  33.596   27.396  1.00 268.60 ? 70  ARG I CZ    1 
ATOM 8723  N NH1   . ARG O  3 57  ? 85.493  33.712   26.516  1.00 269.48 ? 70  ARG I NH1   1 
ATOM 8724  N NH2   . ARG O  3 57  ? 84.329  32.430   28.006  1.00 268.05 ? 70  ARG I NH2   1 
ATOM 8725  N N     . HIS O  3 58  ? 87.456  38.724   27.506  1.00 330.29 ? 71  HIS I N     1 
ATOM 8726  C CA    . HIS O  3 58  ? 87.952  39.253   26.223  1.00 347.27 ? 71  HIS I CA    1 
ATOM 8727  C C     . HIS O  3 58  ? 89.483  39.553   26.227  1.00 351.40 ? 71  HIS I C     1 
ATOM 8728  O O     . HIS O  3 58  ? 90.144  39.545   25.162  1.00 351.48 ? 71  HIS I O     1 
ATOM 8729  C CB    . HIS O  3 58  ? 87.080  40.474   25.856  1.00 354.62 ? 71  HIS I CB    1 
ATOM 8730  C CG    . HIS O  3 58  ? 87.714  41.418   24.892  1.00 362.62 ? 71  HIS I CG    1 
ATOM 8731  N ND1   . HIS O  3 58  ? 87.822  41.148   23.546  1.00 368.44 ? 71  HIS I ND1   1 
ATOM 8732  C CD2   . HIS O  3 58  ? 88.269  42.636   25.083  1.00 362.65 ? 71  HIS I CD2   1 
ATOM 8733  C CE1   . HIS O  3 58  ? 88.417  42.162   22.947  1.00 368.60 ? 71  HIS I CE1   1 
ATOM 8734  N NE2   . HIS O  3 58  ? 88.695  43.080   23.856  1.00 365.85 ? 71  HIS I NE2   1 
ATOM 8735  N N     . ALA O  3 59  ? 90.023  39.766   27.435  1.00 353.25 ? 72  ALA I N     1 
ATOM 8736  C CA    . ALA O  3 59  ? 91.443  40.075   27.668  1.00 359.24 ? 72  ALA I CA    1 
ATOM 8737  C C     . ALA O  3 59  ? 92.314  38.874   28.157  1.00 366.59 ? 72  ALA I C     1 
ATOM 8738  O O     . ALA O  3 59  ? 93.440  39.082   28.616  1.00 373.86 ? 72  ALA I O     1 
ATOM 8739  C CB    . ALA O  3 59  ? 91.559  41.266   28.628  1.00 351.60 ? 72  ALA I CB    1 
ATOM 8740  N N     . LYS O  3 60  ? 91.798  37.638   28.047  1.00 365.77 ? 73  LYS I N     1 
ATOM 8741  C CA    . LYS O  3 60  ? 92.500  36.377   28.444  1.00 357.98 ? 73  LYS I CA    1 
ATOM 8742  C C     . LYS O  3 60  ? 93.029  36.368   29.905  1.00 353.34 ? 73  LYS I C     1 
ATOM 8743  O O     . LYS O  3 60  ? 94.141  35.888   30.187  1.00 347.99 ? 73  LYS I O     1 
ATOM 8744  C CB    . LYS O  3 60  ? 93.597  35.998   27.414  1.00 350.35 ? 73  LYS I CB    1 
ATOM 8745  C CG    . LYS O  3 60  ? 93.135  35.929   25.947  1.00 334.65 ? 73  LYS I CG    1 
ATOM 8746  C CD    . LYS O  3 60  ? 94.239  35.523   24.967  1.00 323.34 ? 73  LYS I CD    1 
ATOM 8747  C CE    . LYS O  3 60  ? 95.143  36.687   24.574  1.00 315.26 ? 73  LYS I CE    1 
ATOM 8748  N NZ    . LYS O  3 60  ? 94.423  37.789   23.876  1.00 304.29 ? 73  LYS I NZ    1 
ATOM 8749  N N     . ARG O  3 61  ? 92.206  36.910   30.813  1.00 349.43 ? 74  ARG I N     1 
ATOM 8750  C CA    . ARG O  3 61  ? 92.504  37.052   32.268  1.00 347.08 ? 74  ARG I CA    1 
ATOM 8751  C C     . ARG O  3 61  ? 91.213  36.849   33.144  1.00 349.82 ? 74  ARG I C     1 
ATOM 8752  O O     . ARG O  3 61  ? 90.078  36.863   32.595  1.00 356.69 ? 74  ARG I O     1 
ATOM 8753  C CB    . ARG O  3 61  ? 93.180  38.424   32.583  1.00 334.49 ? 74  ARG I CB    1 
ATOM 8754  C CG    . ARG O  3 61  ? 94.582  38.708   32.023  1.00 324.77 ? 74  ARG I CG    1 
ATOM 8755  C CD    . ARG O  3 61  ? 95.019  40.152   32.326  1.00 318.92 ? 74  ARG I CD    1 
ATOM 8756  N NE    . ARG O  3 61  ? 94.427  41.180   31.434  1.00 319.51 ? 74  ARG I NE    1 
ATOM 8757  C CZ    . ARG O  3 61  ? 93.401  41.992   31.738  1.00 318.43 ? 74  ARG I CZ    1 
ATOM 8758  N NH1   . ARG O  3 61  ? 92.816  41.916   32.922  1.00 316.03 ? 74  ARG I NH1   1 
ATOM 8759  N NH2   . ARG O  3 61  ? 92.942  42.885   30.860  1.00 320.73 ? 74  ARG I NH2   1 
ATOM 8760  N N     . THR O  3 62  ? 91.394  36.644   34.473  1.00 344.01 ? 75  THR I N     1 
ATOM 8761  C CA    . THR O  3 62  ? 90.285  36.590   35.507  1.00 322.82 ? 75  THR I CA    1 
ATOM 8762  C C     . THR O  3 62  ? 90.328  37.617   36.687  1.00 307.80 ? 75  THR I C     1 
ATOM 8763  O O     . THR O  3 62  ? 89.352  37.695   37.435  1.00 304.72 ? 75  THR I O     1 
ATOM 8764  C CB    . THR O  3 62  ? 89.997  35.167   36.115  1.00 320.70 ? 75  THR I CB    1 
ATOM 8765  O OG1   . THR O  3 62  ? 91.072  34.759   36.971  1.00 325.12 ? 75  THR I OG1   1 
ATOM 8766  C CG2   . THR O  3 62  ? 89.714  34.099   35.036  1.00 316.50 ? 75  THR I CG2   1 
ATOM 8767  N N     . THR O  3 63  ? 91.418  38.385   36.841  1.00 290.77 ? 76  THR I N     1 
ATOM 8768  C CA    . THR O  3 63  ? 91.461  39.544   37.777  1.00 270.41 ? 76  THR I CA    1 
ATOM 8769  C C     . THR O  3 63  ? 91.321  40.910   37.082  1.00 267.75 ? 76  THR I C     1 
ATOM 8770  O O     . THR O  3 63  ? 92.309  41.429   36.560  1.00 269.03 ? 76  THR I O     1 
ATOM 8771  C CB    . THR O  3 63  ? 92.759  39.571   38.581  1.00 263.14 ? 76  THR I CB    1 
ATOM 8772  O OG1   . THR O  3 63  ? 93.864  39.672   37.678  1.00 260.68 ? 76  THR I OG1   1 
ATOM 8773  C CG2   . THR O  3 63  ? 92.861  38.320   39.379  1.00 258.76 ? 76  THR I CG2   1 
ATOM 8774  N N     . ILE O  3 64  ? 90.098  41.475   37.103  1.00 262.59 ? 77  ILE I N     1 
ATOM 8775  C CA    . ILE O  3 64  ? 89.688  42.704   36.347  1.00 258.76 ? 77  ILE I CA    1 
ATOM 8776  C C     . ILE O  3 64  ? 90.408  43.976   36.848  1.00 266.09 ? 77  ILE I C     1 
ATOM 8777  O O     . ILE O  3 64  ? 90.616  44.135   38.049  1.00 275.40 ? 77  ILE I O     1 
ATOM 8778  C CB    . ILE O  3 64  ? 88.133  42.919   36.383  1.00 248.87 ? 77  ILE I CB    1 
ATOM 8779  C CG1   . ILE O  3 64  ? 87.369  41.676   35.916  1.00 245.57 ? 77  ILE I CG1   1 
ATOM 8780  C CG2   . ILE O  3 64  ? 87.704  44.109   35.535  1.00 244.60 ? 77  ILE I CG2   1 
ATOM 8781  C CD1   . ILE O  3 64  ? 85.888  41.737   36.182  1.00 242.63 ? 77  ILE I CD1   1 
ATOM 8782  N N     . ASN O  3 65  ? 90.786  44.869   35.927  1.00 269.61 ? 78  ASN I N     1 
ATOM 8783  C CA    . ASN O  3 65  ? 91.501  46.124   36.263  1.00 270.77 ? 78  ASN I CA    1 
ATOM 8784  C C     . ASN O  3 65  ? 90.775  47.391   35.772  1.00 265.68 ? 78  ASN I C     1 
ATOM 8785  O O     . ASN O  3 65  ? 89.663  47.307   35.246  1.00 264.55 ? 78  ASN I O     1 
ATOM 8786  C CB    . ASN O  3 65  ? 92.978  46.082   35.783  1.00 278.91 ? 78  ASN I CB    1 
ATOM 8787  C CG    . ASN O  3 65  ? 93.119  45.984   34.261  1.00 286.00 ? 78  ASN I CG    1 
ATOM 8788  O OD1   . ASN O  3 65  ? 92.343  46.582   33.521  1.00 290.58 ? 78  ASN I OD1   1 
ATOM 8789  N ND2   . ASN O  3 65  ? 94.115  45.222   33.793  1.00 292.20 ? 78  ASN I ND2   1 
ATOM 8790  N N     . THR O  3 66  ? 91.419  48.547   35.933  1.00 261.74 ? 79  THR I N     1 
ATOM 8791  C CA    . THR O  3 66  ? 90.819  49.855   35.627  1.00 259.58 ? 79  THR I CA    1 
ATOM 8792  C C     . THR O  3 66  ? 90.297  50.037   34.211  1.00 263.45 ? 79  THR I C     1 
ATOM 8793  O O     . THR O  3 66  ? 89.345  50.765   34.015  1.00 262.92 ? 79  THR I O     1 
ATOM 8794  C CB    . THR O  3 66  ? 91.808  51.008   35.846  1.00 257.32 ? 79  THR I CB    1 
ATOM 8795  O OG1   . THR O  3 66  ? 93.102  50.601   35.390  1.00 255.48 ? 79  THR I OG1   1 
ATOM 8796  C CG2   . THR O  3 66  ? 91.879  51.412   37.312  1.00 257.14 ? 79  THR I CG2   1 
ATOM 8797  N N     . GLU O  3 67  ? 90.924  49.397   33.228  1.00 271.48 ? 80  GLU I N     1 
ATOM 8798  C CA    . GLU O  3 67  ? 90.623  49.674   31.811  1.00 278.72 ? 80  GLU I CA    1 
ATOM 8799  C C     . GLU O  3 67  ? 89.292  49.095   31.315  1.00 273.30 ? 80  GLU I C     1 
ATOM 8800  O O     . GLU O  3 67  ? 88.564  49.768   30.585  1.00 271.35 ? 80  GLU I O     1 
ATOM 8801  C CB    . GLU O  3 67  ? 91.771  49.226   30.894  1.00 293.35 ? 80  GLU I CB    1 
ATOM 8802  C CG    . GLU O  3 67  ? 93.184  49.438   31.437  1.00 307.05 ? 80  GLU I CG    1 
ATOM 8803  C CD    . GLU O  3 67  ? 93.532  50.890   31.741  1.00 312.64 ? 80  GLU I CD    1 
ATOM 8804  O OE1   . GLU O  3 67  ? 94.153  51.118   32.798  1.00 315.88 ? 80  GLU I OE1   1 
ATOM 8805  O OE2   . GLU O  3 67  ? 93.202  51.793   30.933  1.00 316.16 ? 80  GLU I OE2   1 
ATOM 8806  N N     . ASP O  3 68  ? 89.001  47.845   31.697  1.00 269.89 ? 81  ASP I N     1 
ATOM 8807  C CA    . ASP O  3 68  ? 87.679  47.217   31.520  1.00 264.27 ? 81  ASP I CA    1 
ATOM 8808  C C     . ASP O  3 68  ? 86.589  48.123   32.153  1.00 259.96 ? 81  ASP I C     1 
ATOM 8809  O O     . ASP O  3 68  ? 85.524  48.335   31.578  1.00 260.20 ? 81  ASP I O     1 
ATOM 8810  C CB    . ASP O  3 68  ? 87.650  45.788   32.146  1.00 261.84 ? 81  ASP I CB    1 
ATOM 8811  C CG    . ASP O  3 68  ? 88.653  44.783   31.489  1.00 262.50 ? 81  ASP I CG    1 
ATOM 8812  O OD1   . ASP O  3 68  ? 88.992  44.945   30.295  1.00 261.71 ? 81  ASP I OD1   1 
ATOM 8813  O OD2   . ASP O  3 68  ? 89.077  43.803   32.164  1.00 260.62 ? 81  ASP I OD2   1 
ATOM 8814  N N     . VAL O  3 69  ? 86.884  48.671   33.332  1.00 256.30 ? 82  VAL I N     1 
ATOM 8815  C CA    . VAL O  3 69  ? 85.974  49.557   34.073  1.00 251.35 ? 82  VAL I CA    1 
ATOM 8816  C C     . VAL O  3 69  ? 85.746  50.945   33.440  1.00 250.26 ? 82  VAL I C     1 
ATOM 8817  O O     . VAL O  3 69  ? 84.598  51.378   33.290  1.00 246.11 ? 82  VAL I O     1 
ATOM 8818  C CB    . VAL O  3 69  ? 86.451  49.749   35.524  1.00 252.56 ? 82  VAL I CB    1 
ATOM 8819  C CG1   . VAL O  3 69  ? 85.433  50.575   36.289  1.00 252.24 ? 82  VAL I CG1   1 
ATOM 8820  C CG2   . VAL O  3 69  ? 86.663  48.405   36.216  1.00 250.46 ? 82  VAL I CG2   1 
ATOM 8821  N N     . LYS O  3 70  ? 86.832  51.648   33.098  1.00 251.31 ? 83  LYS I N     1 
ATOM 8822  C CA    . LYS O  3 70  ? 86.757  52.937   32.384  1.00 251.80 ? 83  LYS I CA    1 
ATOM 8823  C C     . LYS O  3 70  ? 85.975  52.768   31.097  1.00 261.30 ? 83  LYS I C     1 
ATOM 8824  O O     . LYS O  3 70  ? 85.289  53.690   30.653  1.00 259.68 ? 83  LYS I O     1 
ATOM 8825  C CB    . LYS O  3 70  ? 88.149  53.484   32.048  1.00 245.51 ? 83  LYS I CB    1 
ATOM 8826  C CG    . LYS O  3 70  ? 88.976  53.869   33.258  1.00 240.93 ? 83  LYS I CG    1 
ATOM 8827  C CD    . LYS O  3 70  ? 89.811  55.105   32.990  1.00 240.14 ? 83  LYS I CD    1 
ATOM 8828  C CE    . LYS O  3 70  ? 91.230  54.757   32.589  1.00 242.87 ? 83  LYS I CE    1 
ATOM 8829  N NZ    . LYS O  3 70  ? 92.032  56.000   32.439  1.00 247.37 ? 83  LYS I NZ    1 
ATOM 8830  N N     . LEU O  3 71  ? 86.098  51.578   30.502  1.00 276.61 ? 84  LEU I N     1 
ATOM 8831  C CA    . LEU O  3 71  ? 85.287  51.172   29.351  1.00 291.61 ? 84  LEU I CA    1 
ATOM 8832  C C     . LEU O  3 71  ? 83.783  50.937   29.667  1.00 291.87 ? 84  LEU I C     1 
ATOM 8833  O O     . LEU O  3 71  ? 82.964  51.042   28.754  1.00 297.42 ? 84  LEU I O     1 
ATOM 8834  C CB    . LEU O  3 71  ? 85.905  49.965   28.634  1.00 299.31 ? 84  LEU I CB    1 
ATOM 8835  C CG    . LEU O  3 71  ? 85.526  49.797   27.170  1.00 305.60 ? 84  LEU I CG    1 
ATOM 8836  C CD1   . LEU O  3 71  ? 86.339  50.735   26.288  1.00 308.50 ? 84  LEU I CD1   1 
ATOM 8837  C CD2   . LEU O  3 71  ? 85.750  48.346   26.803  1.00 307.38 ? 84  LEU I CD2   1 
ATOM 8838  N N     . LEU O  3 72  ? 83.416  50.634   30.923  1.00 284.38 ? 85  LEU I N     1 
ATOM 8839  C CA    . LEU O  3 72  ? 81.989  50.443   31.303  1.00 272.90 ? 85  LEU I CA    1 
ATOM 8840  C C     . LEU O  3 72  ? 81.162  51.753   31.424  1.00 269.18 ? 85  LEU I C     1 
ATOM 8841  O O     . LEU O  3 72  ? 79.977  51.777   31.081  1.00 263.49 ? 85  LEU I O     1 
ATOM 8842  C CB    . LEU O  3 72  ? 81.828  49.526   32.539  1.00 264.30 ? 85  LEU I CB    1 
ATOM 8843  C CG    . LEU O  3 72  ? 80.423  48.927   32.770  1.00 257.27 ? 85  LEU I CG    1 
ATOM 8844  C CD1   . LEU O  3 72  ? 79.844  48.254   31.525  1.00 256.07 ? 85  LEU I CD1   1 
ATOM 8845  C CD2   . LEU O  3 72  ? 80.385  47.979   33.955  1.00 250.77 ? 85  LEU I CD2   1 
ATOM 8846  N N     . ALA O  3 73  ? 81.793  52.832   31.879  1.00 268.19 ? 86  ALA I N     1 
ATOM 8847  C CA    . ALA O  3 73  ? 81.180  54.157   31.827  1.00 269.19 ? 86  ALA I CA    1 
ATOM 8848  C C     . ALA O  3 73  ? 81.574  54.926   30.537  1.00 275.43 ? 86  ALA I C     1 
ATOM 8849  O O     . ALA O  3 73  ? 81.871  56.126   30.588  1.00 280.03 ? 86  ALA I O     1 
ATOM 8850  C CB    . ALA O  3 73  ? 81.563  54.946   33.067  1.00 265.35 ? 86  ALA I CB    1 
ATOM 8851  N N     . ARG O  3 74  ? 81.570  54.234   29.385  1.00 277.97 ? 87  ARG I N     1 
ATOM 8852  C CA    . ARG O  3 74  ? 82.101  54.769   28.082  1.00 283.06 ? 87  ARG I CA    1 
ATOM 8853  C C     . ARG O  3 74  ? 81.167  55.724   27.339  1.00 293.46 ? 87  ARG I C     1 
ATOM 8854  O O     . ARG O  3 74  ? 81.590  56.501   26.457  1.00 297.97 ? 87  ARG I O     1 
ATOM 8855  C CB    . ARG O  3 74  ? 82.490  53.613   27.123  1.00 274.10 ? 87  ARG I CB    1 
ATOM 8856  C CG    . ARG O  3 74  ? 81.368  53.024   26.252  1.00 263.91 ? 87  ARG I CG    1 
ATOM 8857  C CD    . ARG O  3 74  ? 81.659  51.608   25.779  1.00 255.75 ? 87  ARG I CD    1 
ATOM 8858  N NE    . ARG O  3 74  ? 81.209  50.671   26.789  1.00 245.04 ? 87  ARG I NE    1 
ATOM 8859  C CZ    . ARG O  3 74  ? 79.988  50.172   26.854  1.00 239.74 ? 87  ARG I CZ    1 
ATOM 8860  N NH1   . ARG O  3 74  ? 79.082  50.487   25.942  1.00 241.03 ? 87  ARG I NH1   1 
ATOM 8861  N NH2   . ARG O  3 74  ? 79.676  49.347   27.830  1.00 233.60 ? 87  ARG I NH2   1 
ATOM 8862  N N     . ARG O  3 75  ? 79.898  55.643   27.725  1.00 300.42 ? 88  ARG I N     1 
ATOM 8863  C CA    . ARG O  3 75  ? 78.765  55.992   26.870  1.00 311.73 ? 88  ARG I CA    1 
ATOM 8864  C C     . ARG O  3 75  ? 78.466  57.485   26.764  1.00 332.90 ? 88  ARG I C     1 
ATOM 8865  O O     . ARG O  3 75  ? 78.440  58.017   25.640  1.00 335.78 ? 88  ARG I O     1 
ATOM 8866  C CB    . ARG O  3 75  ? 77.548  55.185   27.303  1.00 293.33 ? 88  ARG I CB    1 
ATOM 8867  C CG    . ARG O  3 75  ? 77.904  53.727   27.429  1.00 275.22 ? 88  ARG I CG    1 
ATOM 8868  C CD    . ARG O  3 75  ? 77.175  53.071   28.562  1.00 261.18 ? 88  ARG I CD    1 
ATOM 8869  N NE    . ARG O  3 75  ? 76.930  51.682   28.219  1.00 255.96 ? 88  ARG I NE    1 
ATOM 8870  C CZ    . ARG O  3 75  ? 75.975  51.273   27.391  1.00 257.41 ? 88  ARG I CZ    1 
ATOM 8871  N NH1   . ARG O  3 75  ? 75.154  52.146   26.811  1.00 253.06 ? 88  ARG I NH1   1 
ATOM 8872  N NH2   . ARG O  3 75  ? 75.840  49.979   27.144  1.00 261.23 ? 88  ARG I NH2   1 
ATOM 8873  N N     . SER O  3 76  ? 78.217  58.141   27.912  1.00 356.35 ? 89  SER I N     1 
ATOM 8874  C CA    . SER O  3 76  ? 78.259  59.621   28.008  1.00 378.69 ? 89  SER I CA    1 
ATOM 8875  C C     . SER O  3 76  ? 79.696  60.065   28.239  1.00 392.96 ? 89  SER I C     1 
ATOM 8876  O O     . SER O  3 76  ? 80.405  59.523   29.096  1.00 399.62 ? 89  SER I O     1 
ATOM 8877  C CB    . SER O  3 76  ? 77.289  60.224   29.053  1.00 376.63 ? 89  SER I CB    1 
ATOM 8878  O OG    . SER O  3 76  ? 77.704  60.087   30.403  1.00 367.33 ? 89  SER I OG    1 
ATOM 8879  N N     . ASN O  3 77  ? 80.126  61.034   27.447  1.00 402.71 ? 90  ASN I N     1 
ATOM 8880  C CA    . ASN O  3 77  ? 81.532  61.382   27.429  1.00 399.65 ? 90  ASN I CA    1 
ATOM 8881  C C     . ASN O  3 77  ? 81.967  62.273   28.651  1.00 392.87 ? 90  ASN I C     1 
ATOM 8882  O O     . ASN O  3 77  ? 83.172  62.316   28.983  1.00 401.09 ? 90  ASN I O     1 
ATOM 8883  C CB    . ASN O  3 77  ? 81.947  61.908   26.021  1.00 400.81 ? 90  ASN I CB    1 
ATOM 8884  C CG    . ASN O  3 77  ? 81.445  61.021   24.866  1.00 393.57 ? 90  ASN I CG    1 
ATOM 8885  O OD1   . ASN O  3 77  ? 80.419  61.319   24.249  1.00 389.54 ? 90  ASN I OD1   1 
ATOM 8886  N ND2   . ASN O  3 77  ? 82.187  59.949   24.554  1.00 386.79 ? 90  ASN I ND2   1 
ATOM 8887  N N     . SER O  3 78  ? 80.992  62.924   29.329  1.00 370.69 ? 91  SER I N     1 
ATOM 8888  C CA    . SER O  3 78  ? 81.188  63.699   30.625  1.00 344.41 ? 91  SER I CA    1 
ATOM 8889  C C     . SER O  3 78  ? 81.712  62.780   31.745  1.00 330.92 ? 91  SER I C     1 
ATOM 8890  O O     . SER O  3 78  ? 82.572  63.143   32.579  1.00 321.91 ? 91  SER I O     1 
ATOM 8891  C CB    . SER O  3 78  ? 79.894  64.449   31.066  1.00 338.04 ? 91  SER I CB    1 
ATOM 8892  O OG    . SER O  3 78  ? 78.851  63.597   31.538  1.00 323.65 ? 91  SER I OG    1 
ATOM 8893  N N     . LEU O  3 79  ? 81.186  61.568   31.694  1.00 324.12 ? 92  LEU I N     1 
ATOM 8894  C CA    . LEU O  3 79  ? 81.506  60.499   32.584  1.00 322.47 ? 92  LEU I CA    1 
ATOM 8895  C C     . LEU O  3 79  ? 82.907  59.881   32.345  1.00 323.75 ? 92  LEU I C     1 
ATOM 8896  O O     . LEU O  3 79  ? 83.623  59.673   33.303  1.00 331.75 ? 92  LEU I O     1 
ATOM 8897  C CB    . LEU O  3 79  ? 80.421  59.456   32.405  1.00 318.06 ? 92  LEU I CB    1 
ATOM 8898  C CG    . LEU O  3 79  ? 79.642  58.934   33.581  1.00 313.41 ? 92  LEU I CG    1 
ATOM 8899  C CD1   . LEU O  3 79  ? 79.034  57.675   33.021  1.00 307.10 ? 92  LEU I CD1   1 
ATOM 8900  C CD2   . LEU O  3 79  ? 80.590  58.634   34.725  1.00 319.19 ? 92  LEU I CD2   1 
ATOM 8901  N N     . LEU O  3 80  ? 83.292  59.581   31.098  1.00 314.32 ? 93  LEU I N     1 
ATOM 8902  C CA    . LEU O  3 80  ? 84.610  58.975   30.787  1.00 297.36 ? 93  LEU I CA    1 
ATOM 8903  C C     . LEU O  3 80  ? 85.768  59.941   31.112  1.00 299.01 ? 93  LEU I C     1 
ATOM 8904  O O     . LEU O  3 80  ? 86.831  59.539   31.593  1.00 299.33 ? 93  LEU I O     1 
ATOM 8905  C CB    . LEU O  3 80  ? 84.649  58.497   29.321  1.00 281.59 ? 93  LEU I CB    1 
ATOM 8906  C CG    . LEU O  3 80  ? 85.818  57.675   28.753  1.00 268.97 ? 93  LEU I CG    1 
ATOM 8907  C CD1   . LEU O  3 80  ? 86.301  56.614   29.730  1.00 260.17 ? 93  LEU I CD1   1 
ATOM 8908  C CD2   . LEU O  3 80  ? 85.454  57.052   27.411  1.00 263.69 ? 93  LEU I CD2   1 
ATOM 8909  N N     . LYS O  3 81  ? 85.521  61.223   30.859  1.00 296.22 ? 94  LYS I N     1 
ATOM 8910  C CA    . LYS O  3 81  ? 86.361  62.338   31.284  1.00 290.14 ? 94  LYS I CA    1 
ATOM 8911  C C     . LYS O  3 81  ? 86.493  62.410   32.836  1.00 292.27 ? 94  LYS I C     1 
ATOM 8912  O O     . LYS O  3 81  ? 87.619  62.505   33.373  1.00 297.37 ? 94  LYS I O     1 
ATOM 8913  C CB    . LYS O  3 81  ? 85.731  63.601   30.694  1.00 280.98 ? 94  LYS I CB    1 
ATOM 8914  C CG    . LYS O  3 81  ? 86.512  64.895   30.777  1.00 273.46 ? 94  LYS I CG    1 
ATOM 8915  C CD    . LYS O  3 81  ? 86.001  65.834   29.705  1.00 270.43 ? 94  LYS I CD    1 
ATOM 8916  C CE    . LYS O  3 81  ? 85.640  67.205   30.258  1.00 269.99 ? 94  LYS I CE    1 
ATOM 8917  N NZ    . LYS O  3 81  ? 84.271  67.230   30.854  1.00 265.68 ? 94  LYS I NZ    1 
ATOM 8918  N N     . TYR O  3 82  ? 85.355  62.360   33.542  1.00 290.52 ? 95  TYR I N     1 
ATOM 8919  C CA    . TYR O  3 82  ? 85.299  62.280   35.032  1.00 288.10 ? 95  TYR I CA    1 
ATOM 8920  C C     . TYR O  3 82  ? 86.115  61.098   35.567  1.00 282.12 ? 95  TYR I C     1 
ATOM 8921  O O     . TYR O  3 82  ? 86.911  61.244   36.505  1.00 283.62 ? 95  TYR I O     1 
ATOM 8922  C CB    . TYR O  3 82  ? 83.838  62.124   35.498  1.00 289.11 ? 95  TYR I CB    1 
ATOM 8923  C CG    . TYR O  3 82  ? 83.540  62.206   37.009  1.00 290.24 ? 95  TYR I CG    1 
ATOM 8924  C CD1   . TYR O  3 82  ? 83.878  61.171   37.903  1.00 286.60 ? 95  TYR I CD1   1 
ATOM 8925  C CD2   . TYR O  3 82  ? 82.847  63.307   37.525  1.00 294.59 ? 95  TYR I CD2   1 
ATOM 8926  C CE1   . TYR O  3 82  ? 83.561  61.266   39.274  1.00 286.17 ? 95  TYR I CE1   1 
ATOM 8927  C CE2   . TYR O  3 82  ? 82.535  63.410   38.879  1.00 293.14 ? 95  TYR I CE2   1 
ATOM 8928  C CZ    . TYR O  3 82  ? 82.883  62.405   39.753  1.00 288.61 ? 95  TYR I CZ    1 
ATOM 8929  O OH    . TYR O  3 82  ? 82.535  62.586   41.078  1.00 286.83 ? 95  TYR I OH    1 
ATOM 8930  N N     . ILE O  3 83  ? 85.905  59.940   34.939  1.00 271.63 ? 96  ILE I N     1 
ATOM 8931  C CA    . ILE O  3 83  ? 86.508  58.668   35.328  1.00 258.68 ? 96  ILE I CA    1 
ATOM 8932  C C     . ILE O  3 83  ? 88.034  58.707   35.252  1.00 265.08 ? 96  ILE I C     1 
ATOM 8933  O O     . ILE O  3 83  ? 88.704  58.298   36.207  1.00 263.94 ? 96  ILE I O     1 
ATOM 8934  C CB    . ILE O  3 83  ? 85.933  57.495   34.487  1.00 247.17 ? 96  ILE I CB    1 
ATOM 8935  C CG1   . ILE O  3 83  ? 84.452  57.267   34.797  1.00 240.11 ? 96  ILE I CG1   1 
ATOM 8936  C CG2   . ILE O  3 83  ? 86.667  56.205   34.769  1.00 241.02 ? 96  ILE I CG2   1 
ATOM 8937  C CD1   . ILE O  3 83  ? 84.123  57.270   36.274  1.00 236.70 ? 96  ILE I CD1   1 
ATOM 8938  N N     . THR O  3 84  ? 88.566  59.216   34.133  1.00 271.38 ? 97  THR I N     1 
ATOM 8939  C CA    . THR O  3 84  ? 90.015  59.350   33.953  1.00 275.61 ? 97  THR I CA    1 
ATOM 8940  C C     . THR O  3 84  ? 90.649  60.170   35.078  1.00 279.35 ? 97  THR I C     1 
ATOM 8941  O O     . THR O  3 84  ? 91.598  59.702   35.661  1.00 278.68 ? 97  THR I O     1 
ATOM 8942  C CB    . THR O  3 84  ? 90.437  59.874   32.560  1.00 276.10 ? 97  THR I CB    1 
ATOM 8943  O OG1   . THR O  3 84  ? 89.909  61.185   32.347  1.00 275.52 ? 97  THR I OG1   1 
ATOM 8944  C CG2   . THR O  3 84  ? 89.928  58.958   31.478  1.00 273.74 ? 97  THR I CG2   1 
ATOM 8945  N N     . ASP O  3 85  ? 90.101  61.345   35.416  1.00 283.36 ? 98  ASP I N     1 
ATOM 8946  C CA    . ASP O  3 85  ? 90.575  62.169   36.562  1.00 284.37 ? 98  ASP I CA    1 
ATOM 8947  C C     . ASP O  3 85  ? 90.718  61.353   37.823  1.00 275.21 ? 98  ASP I C     1 
ATOM 8948  O O     . ASP O  3 85  ? 91.734  61.400   38.521  1.00 271.06 ? 98  ASP I O     1 
ATOM 8949  C CB    . ASP O  3 85  ? 89.584  63.294   36.876  1.00 296.96 ? 98  ASP I CB    1 
ATOM 8950  C CG    . ASP O  3 85  ? 89.800  64.513   36.022  1.00 311.65 ? 98  ASP I CG    1 
ATOM 8951  O OD1   . ASP O  3 85  ? 90.436  64.371   34.958  1.00 321.03 ? 98  ASP I OD1   1 
ATOM 8952  O OD2   . ASP O  3 85  ? 89.283  65.590   36.365  1.00 319.00 ? 98  ASP I OD2   1 
ATOM 8953  N N     . LYS O  3 86  ? 89.649  60.622   38.102  1.00 269.24 ? 99  LYS I N     1 
ATOM 8954  C CA    . LYS O  3 86  ? 89.524  59.819   39.293  1.00 267.54 ? 99  LYS I CA    1 
ATOM 8955  C C     . LYS O  3 86  ? 90.378  58.542   39.256  1.00 265.88 ? 99  LYS I C     1 
ATOM 8956  O O     . LYS O  3 86  ? 90.828  58.044   40.302  1.00 270.35 ? 99  LYS I O     1 
ATOM 8957  C CB    . LYS O  3 86  ? 88.043  59.534   39.545  1.00 263.92 ? 99  LYS I CB    1 
ATOM 8958  C CG    . LYS O  3 86  ? 87.360  60.546   40.481  1.00 264.78 ? 99  LYS I CG    1 
ATOM 8959  C CD    . LYS O  3 86  ? 87.289  61.994   39.963  1.00 263.67 ? 99  LYS I CD    1 
ATOM 8960  C CE    . LYS O  3 86  ? 86.683  63.018   40.918  1.00 263.62 ? 99  LYS I CE    1 
ATOM 8961  N NZ    . LYS O  3 86  ? 87.332  63.198   42.240  1.00 264.13 ? 99  LYS I NZ    1 
ATOM 8962  N N     . SER O  3 87  ? 90.616  58.016   38.057  1.00 261.84 ? 100 SER I N     1 
ATOM 8963  C CA    . SER O  3 87  ? 91.587  56.930   37.873  1.00 262.09 ? 100 SER I CA    1 
ATOM 8964  C C     . SER O  3 87  ? 93.041  57.413   38.079  1.00 271.73 ? 100 SER I C     1 
ATOM 8965  O O     . SER O  3 87  ? 93.924  56.638   38.460  1.00 267.80 ? 100 SER I O     1 
ATOM 8966  C CB    . SER O  3 87  ? 91.441  56.329   36.482  1.00 258.20 ? 100 SER I CB    1 
ATOM 8967  O OG    . SER O  3 87  ? 92.037  57.192   35.534  1.00 260.24 ? 100 SER I OG    1 
ATOM 8968  N N     . GLU O  3 88  ? 93.295  58.695   37.828  1.00 289.12 ? 101 GLU I N     1 
ATOM 8969  C CA    . GLU O  3 88  ? 94.637  59.253   38.023  1.00 312.39 ? 101 GLU I CA    1 
ATOM 8970  C C     . GLU O  3 88  ? 94.959  59.514   39.509  1.00 318.04 ? 101 GLU I C     1 
ATOM 8971  O O     . GLU O  3 88  ? 96.088  59.257   39.962  1.00 318.15 ? 101 GLU I O     1 
ATOM 8972  C CB    . GLU O  3 88  ? 94.840  60.477   37.121  1.00 332.40 ? 101 GLU I CB    1 
ATOM 8973  C CG    . GLU O  3 88  ? 94.988  60.116   35.629  1.00 351.21 ? 101 GLU I CG    1 
ATOM 8974  C CD    . GLU O  3 88  ? 94.729  61.296   34.658  1.00 365.52 ? 101 GLU I CD    1 
ATOM 8975  O OE1   . GLU O  3 88  ? 94.673  62.467   35.110  1.00 375.27 ? 101 GLU I OE1   1 
ATOM 8976  O OE2   . GLU O  3 88  ? 94.585  61.065   33.425  1.00 368.82 ? 101 GLU I OE2   1 
ATOM 8977  N N     . GLU O  3 89  ? 93.954  59.977   40.263  1.00 324.69 ? 102 GLU I N     1 
ATOM 8978  C CA    . GLU O  3 89  ? 93.980  59.960   41.747  1.00 335.61 ? 102 GLU I CA    1 
ATOM 8979  C C     . GLU O  3 89  ? 94.314  58.531   42.320  1.00 332.25 ? 102 GLU I C     1 
ATOM 8980  O O     . GLU O  3 89  ? 95.047  58.414   43.328  1.00 338.09 ? 102 GLU I O     1 
ATOM 8981  C CB    . GLU O  3 89  ? 92.658  60.540   42.319  1.00 344.56 ? 102 GLU I CB    1 
ATOM 8982  C CG    . GLU O  3 89  ? 92.527  60.627   43.849  1.00 351.79 ? 102 GLU I CG    1 
ATOM 8983  C CD    . GLU O  3 89  ? 91.128  61.036   44.328  1.00 349.16 ? 102 GLU I CD    1 
ATOM 8984  O OE1   . GLU O  3 89  ? 90.635  60.428   45.301  1.00 344.49 ? 102 GLU I OE1   1 
ATOM 8985  O OE2   . GLU O  3 89  ? 90.489  61.972   43.783  1.00 347.11 ? 102 GLU I OE2   1 
ATOM 8986  N N     . ILE O  3 90  ? 93.769  57.476   41.677  1.00 317.97 ? 103 ILE I N     1 
ATOM 8987  C CA    . ILE O  3 90  ? 94.066  56.043   41.969  1.00 299.94 ? 103 ILE I CA    1 
ATOM 8988  C C     . ILE O  3 90  ? 95.539  55.728   41.798  1.00 302.23 ? 103 ILE I C     1 
ATOM 8989  O O     . ILE O  3 90  ? 96.094  55.016   42.634  1.00 306.28 ? 103 ILE I O     1 
ATOM 8990  C CB    . ILE O  3 90  ? 93.179  55.068   41.145  1.00 283.28 ? 103 ILE I CB    1 
ATOM 8991  C CG1   . ILE O  3 90  ? 91.812  54.967   41.819  1.00 270.35 ? 103 ILE I CG1   1 
ATOM 8992  C CG2   . ILE O  3 90  ? 93.822  53.697   40.967  1.00 281.21 ? 103 ILE I CG2   1 
ATOM 8993  C CD1   . ILE O  3 90  ? 90.867  54.057   41.115  1.00 255.03 ? 103 ILE I CD1   1 
ATOM 8994  N N     . ALA O  3 91  ? 96.144  56.277   40.738  1.00 300.44 ? 104 ALA I N     1 
ATOM 8995  C CA    . ALA O  3 91  ? 97.589  56.224   40.503  1.00 305.33 ? 104 ALA I CA    1 
ATOM 8996  C C     . ALA O  3 91  ? 98.372  56.938   41.620  1.00 316.20 ? 104 ALA I C     1 
ATOM 8997  O O     . ALA O  3 91  ? 99.500  56.543   41.942  1.00 321.88 ? 104 ALA I O     1 
ATOM 8998  C CB    . ALA O  3 91  ? 97.922  56.824   39.146  1.00 301.92 ? 104 ALA I CB    1 
ATOM 8999  N N     . GLN O  3 92  ? 97.775  57.980   42.208  1.00 326.25 ? 105 GLN I N     1 
ATOM 9000  C CA    . GLN O  3 92  ? 98.346  58.659   43.390  1.00 341.17 ? 105 GLN I CA    1 
ATOM 9001  C C     . GLN O  3 92  ? 98.149  57.899   44.723  1.00 349.25 ? 105 GLN I C     1 
ATOM 9002  O O     . GLN O  3 92  ? 99.034  57.940   45.592  1.00 358.06 ? 105 GLN I O     1 
ATOM 9003  C CB    . GLN O  3 92  ? 97.823  60.079   43.502  1.00 343.38 ? 105 GLN I CB    1 
ATOM 9004  C CG    . GLN O  3 92  ? 97.964  60.888   42.227  1.00 343.89 ? 105 GLN I CG    1 
ATOM 9005  C CD    . GLN O  3 92  ? 97.409  62.285   42.413  1.00 348.85 ? 105 GLN I CD    1 
ATOM 9006  O OE1   . GLN O  3 92  ? 97.485  62.860   43.500  1.00 356.95 ? 105 GLN I OE1   1 
ATOM 9007  N NE2   . GLN O  3 92  ? 96.795  62.821   41.365  1.00 347.77 ? 105 GLN I NE2   1 
ATOM 9008  N N     . ALA O  3 93  ? 97.007  57.209   44.868  1.00 348.98 ? 106 ALA I N     1 
ATOM 9009  C CA    . ALA O  3 93  ? 96.805  56.187   45.921  1.00 352.77 ? 106 ALA I CA    1 
ATOM 9010  C C     . ALA O  3 93  ? 97.747  54.966   45.750  1.00 367.04 ? 106 ALA I C     1 
ATOM 9011  O O     . ALA O  3 93  ? 98.106  54.313   46.751  1.00 372.74 ? 106 ALA I O     1 
ATOM 9012  C CB    . ALA O  3 93  ? 95.349  55.744   45.975  1.00 337.08 ? 106 ALA I CB    1 
ATOM 9013  N N     . ASN O  3 94  ? 98.124  54.671   44.489  1.00 377.21 ? 107 ASN I N     1 
ATOM 9014  C CA    . ASN O  3 94  ? 99.239  53.738   44.116  1.00 378.52 ? 107 ASN I CA    1 
ATOM 9015  C C     . ASN O  3 94  ? 100.637 54.125   44.697  1.00 388.54 ? 107 ASN I C     1 
ATOM 9016  O O     . ASN O  3 94  ? 101.358 53.253   45.215  1.00 397.90 ? 107 ASN I O     1 
ATOM 9017  C CB    . ASN O  3 94  ? 99.361  53.548   42.579  1.00 361.56 ? 107 ASN I CB    1 
ATOM 9018  C CG    . ASN O  3 94  ? 98.133  52.906   41.935  1.00 346.03 ? 107 ASN I CG    1 
ATOM 9019  O OD1   . ASN O  3 94  ? 97.134  52.590   42.592  1.00 343.64 ? 107 ASN I OD1   1 
ATOM 9020  N ND2   . ASN O  3 94  ? 98.207  52.722   40.625  1.00 332.92 ? 107 ASN I ND2   1 
ATOM 9021  N N     . LEU O  3 95  ? 101.008 55.415   44.597  1.00 383.79 ? 108 LEU I N     1 
ATOM 9022  C CA    . LEU O  3 95  ? 102.249 55.977   45.206  1.00 374.80 ? 108 LEU I CA    1 
ATOM 9023  C C     . LEU O  3 95  ? 102.346 55.712   46.716  1.00 381.82 ? 108 LEU I C     1 
ATOM 9024  O O     . LEU O  3 95  ? 103.446 55.471   47.249  1.00 384.11 ? 108 LEU I O     1 
ATOM 9025  C CB    . LEU O  3 95  ? 102.365 57.484   44.950  1.00 361.37 ? 108 LEU I CB    1 
ATOM 9026  C CG    . LEU O  3 95  ? 102.315 57.976   43.507  1.00 350.60 ? 108 LEU I CG    1 
ATOM 9027  C CD1   . LEU O  3 95  ? 102.343 59.489   43.494  1.00 346.29 ? 108 LEU I CD1   1 
ATOM 9028  C CD2   . LEU O  3 95  ? 103.455 57.392   42.690  1.00 348.54 ? 108 LEU I CD2   1 
ATOM 9029  N N     . GLU O  3 96  ? 101.183 55.747   47.384  1.00 386.74 ? 109 GLU I N     1 
ATOM 9030  C CA    . GLU O  3 96  ? 101.033 55.366   48.805  1.00 393.84 ? 109 GLU I CA    1 
ATOM 9031  C C     . GLU O  3 96  ? 101.530 53.955   49.130  1.00 393.58 ? 109 GLU I C     1 
ATOM 9032  O O     . GLU O  3 96  ? 102.092 53.764   50.208  1.00 399.15 ? 109 GLU I O     1 
ATOM 9033  C CB    . GLU O  3 96  ? 99.586  55.548   49.328  1.00 395.16 ? 109 GLU I CB    1 
ATOM 9034  C CG    . GLU O  3 96  ? 98.921  56.900   49.031  1.00 403.98 ? 109 GLU I CG    1 
ATOM 9035  C CD    . GLU O  3 96  ? 99.516  58.090   49.797  1.00 419.66 ? 109 GLU I CD    1 
ATOM 9036  O OE1   . GLU O  3 96  ? 100.317 57.870   50.734  1.00 434.65 ? 109 GLU I OE1   1 
ATOM 9037  O OE2   . GLU O  3 96  ? 99.189  59.255   49.462  1.00 423.71 ? 109 GLU I OE2   1 
ATOM 9038  N N     . ARG O  3 97  ? 101.319 52.982   48.223  1.00 388.98 ? 110 ARG I N     1 
ATOM 9039  C CA    . ARG O  3 97  ? 101.899 51.611   48.359  1.00 388.31 ? 110 ARG I CA    1 
ATOM 9040  C C     . ARG O  3 97  ? 103.442 51.579   48.370  1.00 402.77 ? 110 ARG I C     1 
ATOM 9041  O O     . ARG O  3 97  ? 104.027 50.834   49.174  1.00 414.93 ? 110 ARG I O     1 
ATOM 9042  C CB    . ARG O  3 97  ? 101.349 50.599   47.327  1.00 371.51 ? 110 ARG I CB    1 
ATOM 9043  C CG    . ARG O  3 97  ? 101.697 49.144   47.655  1.00 357.41 ? 110 ARG I CG    1 
ATOM 9044  C CD    . ARG O  3 97  ? 102.134 48.353   46.429  1.00 340.56 ? 110 ARG I CD    1 
ATOM 9045  N NE    . ARG O  3 97  ? 103.062 47.249   46.760  1.00 325.84 ? 110 ARG I NE    1 
ATOM 9046  C CZ    . ARG O  3 97  ? 103.328 46.187   45.990  1.00 312.18 ? 110 ARG I CZ    1 
ATOM 9047  N NH1   . ARG O  3 97  ? 102.735 46.027   44.812  1.00 303.28 ? 110 ARG I NH1   1 
ATOM 9048  N NH2   . ARG O  3 97  ? 104.194 45.260   46.403  1.00 306.07 ? 110 ARG I NH2   1 
ATOM 9049  N N     . LYS O  3 98  ? 104.085 52.367   47.496  1.00 402.95 ? 111 LYS I N     1 
ATOM 9050  C CA    . LYS O  3 98  ? 105.565 52.480   47.474  1.00 399.64 ? 111 LYS I CA    1 
ATOM 9051  C C     . LYS O  3 98  ? 106.186 53.113   48.739  1.00 407.75 ? 111 LYS I C     1 
ATOM 9052  O O     . LYS O  3 98  ? 107.305 52.749   49.125  1.00 413.66 ? 111 LYS I O     1 
ATOM 9053  C CB    . LYS O  3 98  ? 106.088 53.149   46.184  1.00 384.08 ? 111 LYS I CB    1 
ATOM 9054  C CG    . LYS O  3 98  ? 106.276 52.206   45.000  1.00 369.43 ? 111 LYS I CG    1 
ATOM 9055  C CD    . LYS O  3 98  ? 107.418 51.212   45.202  1.00 363.63 ? 111 LYS I CD    1 
ATOM 9056  C CE    . LYS O  3 98  ? 107.399 50.109   44.148  1.00 353.80 ? 111 LYS I CE    1 
ATOM 9057  N NZ    . LYS O  3 98  ? 108.257 48.937   44.488  1.00 349.24 ? 111 LYS I NZ    1 
ATOM 9058  N N     . ALA O  3 99  ? 105.463 54.028   49.392  1.00 406.36 ? 112 ALA I N     1 
ATOM 9059  C CA    . ALA O  3 99  ? 105.866 54.543   50.711  1.00 402.75 ? 112 ALA I CA    1 
ATOM 9060  C C     . ALA O  3 99  ? 105.723 53.503   51.847  1.00 396.26 ? 112 ALA I C     1 
ATOM 9061  O O     . ALA O  3 99  ? 106.574 53.456   52.747  1.00 393.95 ? 112 ALA I O     1 
ATOM 9062  C CB    . ALA O  3 99  ? 105.102 55.823   51.042  1.00 406.38 ? 112 ALA I CB    1 
ATOM 9063  N N     . GLN O  3 100 ? 104.658 52.683   51.785  1.00 385.74 ? 113 GLN I N     1 
ATOM 9064  C CA    . GLN O  3 100 ? 104.294 51.670   52.818  1.00 380.31 ? 113 GLN I CA    1 
ATOM 9065  C C     . GLN O  3 100 ? 105.402 50.654   53.066  1.00 384.56 ? 113 GLN I C     1 
ATOM 9066  O O     . GLN O  3 100 ? 105.963 50.566   54.157  1.00 392.92 ? 113 GLN I O     1 
ATOM 9067  C CB    . GLN O  3 100 ? 103.025 50.878   52.426  1.00 365.79 ? 113 GLN I CB    1 
ATOM 9068  C CG    . GLN O  3 100 ? 101.680 51.563   52.641  1.00 354.68 ? 113 GLN I CG    1 
ATOM 9069  C CD    . GLN O  3 100 ? 100.521 50.744   52.089  1.00 342.06 ? 113 GLN I CD    1 
ATOM 9070  O OE1   . GLN O  3 100 ? 100.570 49.519   52.085  1.00 337.23 ? 113 GLN I OE1   1 
ATOM 9071  N NE2   . GLN O  3 100 ? 99.468  51.424   51.640  1.00 333.90 ? 113 GLN I NE2   1 
ATOM 9072  N N     . LYS O  3 101 ? 105.686 49.856   52.049  1.00 380.40 ? 114 LYS I N     1 
ATOM 9073  C CA    . LYS O  3 101 ? 106.784 48.923   52.112  1.00 383.58 ? 114 LYS I CA    1 
ATOM 9074  C C     . LYS O  3 101 ? 108.070 49.715   51.760  1.00 388.14 ? 114 LYS I C     1 
ATOM 9075  O O     . LYS O  3 101 ? 108.169 50.324   50.700  1.00 390.90 ? 114 LYS I O     1 
ATOM 9076  C CB    . LYS O  3 101 ? 106.494 47.753   51.165  1.00 375.95 ? 114 LYS I CB    1 
ATOM 9077  C CG    . LYS O  3 101 ? 107.467 46.593   51.244  1.00 378.27 ? 114 LYS I CG    1 
ATOM 9078  C CD    . LYS O  3 101 ? 107.030 45.476   50.306  1.00 371.32 ? 114 LYS I CD    1 
ATOM 9079  C CE    . LYS O  3 101 ? 108.179 44.548   49.950  1.00 374.61 ? 114 LYS I CE    1 
ATOM 9080  N NZ    . LYS O  3 101 ? 107.899 43.855   48.664  1.00 369.31 ? 114 LYS I NZ    1 
ATOM 9081  N N     . LYS O  3 102 ? 109.033 49.778   52.678  1.00 388.61 ? 115 LYS I N     1 
ATOM 9082  C CA    . LYS O  3 102 ? 110.241 50.607   52.451  1.00 382.69 ? 115 LYS I CA    1 
ATOM 9083  C C     . LYS O  3 102 ? 111.354 49.816   51.749  1.00 381.70 ? 115 LYS I C     1 
ATOM 9084  O O     . LYS O  3 102 ? 111.463 48.604   51.943  1.00 383.62 ? 115 LYS I O     1 
ATOM 9085  C CB    . LYS O  3 102 ? 110.731 51.310   53.746  1.00 382.75 ? 115 LYS I CB    1 
ATOM 9086  C CG    . LYS O  3 102 ? 111.050 50.408   54.934  1.00 376.73 ? 115 LYS I CG    1 
ATOM 9087  C CD    . LYS O  3 102 ? 112.498 49.955   54.955  1.00 371.68 ? 115 LYS I CD    1 
ATOM 9088  C CE    . LYS O  3 102 ? 112.643 48.797   55.923  1.00 365.02 ? 115 LYS I CE    1 
ATOM 9089  N NZ    . LYS O  3 102 ? 113.770 48.987   56.879  1.00 364.40 ? 115 LYS I NZ    1 
ATOM 9090  N N     . LYS O  3 103 ? 112.163 50.505   50.937  1.00 375.93 ? 116 LYS I N     1 
ATOM 9091  C CA    . LYS O  3 103 ? 113.281 49.890   50.184  1.00 372.75 ? 116 LYS I CA    1 
ATOM 9092  C C     . LYS O  3 103 ? 114.714 50.170   50.719  1.00 387.75 ? 116 LYS I C     1 
ATOM 9093  O O     . LYS O  3 103 ? 114.883 50.925   51.678  1.00 394.51 ? 116 LYS I O     1 
ATOM 9094  C CB    . LYS O  3 103 ? 113.166 50.223   48.682  1.00 358.84 ? 116 LYS I CB    1 
ATOM 9095  C CG    . LYS O  3 103 ? 111.994 49.556   47.972  1.00 344.69 ? 116 LYS I CG    1 
ATOM 9096  C CD    . LYS O  3 103 ? 112.082 48.037   47.995  1.00 338.29 ? 116 LYS I CD    1 
ATOM 9097  C CE    . LYS O  3 103 ? 113.011 47.488   46.923  1.00 336.30 ? 116 LYS I CE    1 
ATOM 9098  N NZ    . LYS O  3 103 ? 112.965 46.005   46.935  1.00 332.04 ? 116 LYS I NZ    1 
ATOM 9099  N N     . LYS O  3 104 ? 115.719 49.592   50.039  1.00 398.40 ? 117 LYS I N     1 
ATOM 9100  C CA    . LYS O  3 104 ? 117.115 49.332   50.526  1.00 416.47 ? 117 LYS I CA    1 
ATOM 9101  C C     . LYS O  3 104 ? 117.911 50.212   51.563  1.00 430.61 ? 117 LYS I C     1 
ATOM 9102  O O     . LYS O  3 104 ? 118.134 49.778   52.697  1.00 448.68 ? 117 LYS I O     1 
ATOM 9103  C CB    . LYS O  3 104 ? 118.012 48.942   49.324  1.00 414.68 ? 117 LYS I CB    1 
ATOM 9104  C CG    . LYS O  3 104 ? 117.659 47.587   48.739  1.00 408.28 ? 117 LYS I CG    1 
ATOM 9105  C CD    . LYS O  3 104 ? 117.623 47.622   47.229  1.00 402.44 ? 117 LYS I CD    1 
ATOM 9106  C CE    . LYS O  3 104 ? 116.996 46.341   46.726  1.00 397.82 ? 117 LYS I CE    1 
ATOM 9107  N NZ    . LYS O  3 104 ? 116.654 46.411   45.283  1.00 394.02 ? 117 LYS I NZ    1 
ATOM 9108  N N     . SER O  3 105 ? 118.391 51.396   51.182  1.00 428.43 ? 118 SER I N     1 
ATOM 9109  C CA    . SER O  3 105 ? 119.375 52.105   52.027  1.00 428.24 ? 118 SER I CA    1 
ATOM 9110  C C     . SER O  3 105 ? 118.767 53.211   52.872  1.00 425.81 ? 118 SER I C     1 
ATOM 9111  O O     . SER O  3 105 ? 119.490 53.921   53.567  1.00 426.40 ? 118 SER I O     1 
ATOM 9112  C CB    . SER O  3 105 ? 120.562 52.632   51.207  1.00 428.03 ? 118 SER I CB    1 
ATOM 9113  O OG    . SER O  3 105 ? 120.121 53.337   50.058  1.00 423.95 ? 118 SER I OG    1 
ATOM 9114  N N     . SER P  3 1   ? 73.043  66.652   1.120   1.00 383.52 ? 14  SER J N     1 
ATOM 9115  C CA    . SER P  3 1   ? 74.137  65.943   1.823   1.00 376.00 ? 14  SER J CA    1 
ATOM 9116  C C     . SER P  3 1   ? 74.008  64.409   1.763   1.00 367.70 ? 14  SER J C     1 
ATOM 9117  O O     . SER P  3 1   ? 72.896  63.840   1.675   1.00 366.51 ? 14  SER J O     1 
ATOM 9118  C CB    . SER P  3 1   ? 74.212  66.432   3.270   1.00 373.46 ? 14  SER J CB    1 
ATOM 9119  O OG    . SER P  3 1   ? 75.381  65.957   3.889   1.00 363.00 ? 14  SER J OG    1 
ATOM 9120  N N     . TYR P  3 2   ? 75.169  63.764   1.804   1.00 359.12 ? 15  TYR J N     1 
ATOM 9121  C CA    . TYR P  3 2   ? 75.302  62.310   1.751   1.00 352.72 ? 15  TYR J CA    1 
ATOM 9122  C C     . TYR P  3 2   ? 74.406  61.562   2.774   1.00 336.52 ? 15  TYR J C     1 
ATOM 9123  O O     . TYR P  3 2   ? 73.685  60.627   2.401   1.00 335.17 ? 15  TYR J O     1 
ATOM 9124  C CB    . TYR P  3 2   ? 76.787  61.955   1.932   1.00 366.68 ? 15  TYR J CB    1 
ATOM 9125  C CG    . TYR P  3 2   ? 77.246  60.632   1.340   1.00 379.25 ? 15  TYR J CG    1 
ATOM 9126  C CD1   . TYR P  3 2   ? 77.733  60.557   0.031   1.00 380.56 ? 15  TYR J CD1   1 
ATOM 9127  C CD2   . TYR P  3 2   ? 77.240  59.458   2.103   1.00 383.62 ? 15  TYR J CD2   1 
ATOM 9128  C CE1   . TYR P  3 2   ? 78.165  59.345   -0.505  1.00 380.32 ? 15  TYR J CE1   1 
ATOM 9129  C CE2   . TYR P  3 2   ? 77.678  58.247   1.577   1.00 381.50 ? 15  TYR J CE2   1 
ATOM 9130  C CZ    . TYR P  3 2   ? 78.149  58.194   0.280   1.00 378.78 ? 15  TYR J CZ    1 
ATOM 9131  O OH    . TYR P  3 2   ? 78.565  56.990   -0.239  1.00 371.25 ? 15  TYR J OH    1 
ATOM 9132  N N     . GLN P  3 3   ? 74.431  61.987   4.038   1.00 318.28 ? 16  GLN J N     1 
ATOM 9133  C CA    . GLN P  3 3   ? 73.737  61.281   5.141   1.00 302.96 ? 16  GLN J CA    1 
ATOM 9134  C C     . GLN P  3 3   ? 72.207  61.316   5.008   1.00 306.64 ? 16  GLN J C     1 
ATOM 9135  O O     . GLN P  3 3   ? 71.517  60.344   5.370   1.00 305.61 ? 16  GLN J O     1 
ATOM 9136  C CB    . GLN P  3 3   ? 74.175  61.827   6.513   1.00 291.44 ? 16  GLN J CB    1 
ATOM 9137  C CG    . GLN P  3 3   ? 75.676  61.912   6.746   1.00 283.57 ? 16  GLN J CG    1 
ATOM 9138  C CD    . GLN P  3 3   ? 76.059  62.888   7.854   1.00 283.24 ? 16  GLN J CD    1 
ATOM 9139  O OE1   . GLN P  3 3   ? 75.186  63.456   8.525   1.00 284.79 ? 16  GLN J OE1   1 
ATOM 9140  N NE2   . GLN P  3 3   ? 77.371  63.095   8.046   1.00 281.54 ? 16  GLN J NE2   1 
ATOM 9141  N N     . GLN P  3 4   ? 71.687  62.428   4.474   1.00 315.62 ? 17  GLN J N     1 
ATOM 9142  C CA    . GLN P  3 4   ? 70.240  62.618   4.238   1.00 324.12 ? 17  GLN J CA    1 
ATOM 9143  C C     . GLN P  3 4   ? 69.661  61.643   3.224   1.00 326.73 ? 17  GLN J C     1 
ATOM 9144  O O     . GLN P  3 4   ? 68.531  61.144   3.379   1.00 328.05 ? 17  GLN J O     1 
ATOM 9145  C CB    . GLN P  3 4   ? 69.968  64.017   3.681   1.00 335.27 ? 17  GLN J CB    1 
ATOM 9146  C CG    . GLN P  3 4   ? 70.139  65.185   4.632   1.00 349.21 ? 17  GLN J CG    1 
ATOM 9147  C CD    . GLN P  3 4   ? 69.975  66.514   3.921   1.00 363.65 ? 17  GLN J CD    1 
ATOM 9148  O OE1   . GLN P  3 4   ? 70.763  66.868   3.048   1.00 375.43 ? 17  GLN J OE1   1 
ATOM 9149  N NE2   . GLN P  3 4   ? 68.935  67.247   4.285   1.00 366.58 ? 17  GLN J NE2   1 
ATOM 9150  N N     . ARG P  3 5   ? 70.431  61.432   2.164   1.00 332.67 ? 18  ARG J N     1 
ATOM 9151  C CA    . ARG P  3 5   ? 70.053  60.593   1.044   1.00 341.84 ? 18  ARG J CA    1 
ATOM 9152  C C     . ARG P  3 5   ? 69.842  59.137   1.508   1.00 346.56 ? 18  ARG J C     1 
ATOM 9153  O O     . ARG P  3 5   ? 68.899  58.449   1.072   1.00 345.01 ? 18  ARG J O     1 
ATOM 9154  C CB    . ARG P  3 5   ? 71.173  60.689   0.022   1.00 338.42 ? 18  ARG J CB    1 
ATOM 9155  C CG    . ARG P  3 5   ? 70.778  60.586   -1.427  1.00 334.62 ? 18  ARG J CG    1 
ATOM 9156  C CD    . ARG P  3 5   ? 72.024  60.846   -2.257  1.00 328.12 ? 18  ARG J CD    1 
ATOM 9157  N NE    . ARG P  3 5   ? 73.164  60.097   -1.730  1.00 312.98 ? 18  ARG J NE    1 
ATOM 9158  C CZ    . ARG P  3 5   ? 73.513  58.887   -2.150  1.00 302.41 ? 18  ARG J CZ    1 
ATOM 9159  N NH1   . ARG P  3 5   ? 74.552  58.278   -1.604  1.00 295.23 ? 18  ARG J NH1   1 
ATOM 9160  N NH2   . ARG P  3 5   ? 72.826  58.274   -3.108  1.00 298.43 ? 18  ARG J NH2   1 
ATOM 9161  N N     . LEU P  3 6   ? 70.700  58.689   2.429   1.00 354.92 ? 19  LEU J N     1 
ATOM 9162  C CA    . LEU P  3 6   ? 70.633  57.318   2.969   1.00 361.48 ? 19  LEU J CA    1 
ATOM 9163  C C     . LEU P  3 6   ? 69.529  57.092   4.022   1.00 373.97 ? 19  LEU J C     1 
ATOM 9164  O O     . LEU P  3 6   ? 69.048  55.959   4.197   1.00 386.64 ? 19  LEU J O     1 
ATOM 9165  C CB    . LEU P  3 6   ? 72.006  56.869   3.489   1.00 350.89 ? 19  LEU J CB    1 
ATOM 9166  C CG    . LEU P  3 6   ? 73.204  57.052   2.546   1.00 341.55 ? 19  LEU J CG    1 
ATOM 9167  C CD1   . LEU P  3 6   ? 74.453  56.504   3.206   1.00 338.10 ? 19  LEU J CD1   1 
ATOM 9168  C CD2   . LEU P  3 6   ? 72.984  56.403   1.184   1.00 333.67 ? 19  LEU J CD2   1 
ATOM 9169  N N     . LYS P  3 7   ? 69.132  58.168   4.710   1.00 371.77 ? 20  LYS J N     1 
ATOM 9170  C CA    . LYS P  3 7   ? 67.954  58.143   5.594   1.00 352.10 ? 20  LYS J CA    1 
ATOM 9171  C C     . LYS P  3 7   ? 66.653  57.813   4.833   1.00 341.55 ? 20  LYS J C     1 
ATOM 9172  O O     . LYS P  3 7   ? 65.773  57.159   5.395   1.00 344.24 ? 20  LYS J O     1 
ATOM 9173  C CB    . LYS P  3 7   ? 67.815  59.443   6.403   1.00 342.34 ? 20  LYS J CB    1 
ATOM 9174  C CG    . LYS P  3 7   ? 68.845  59.582   7.516   1.00 324.25 ? 20  LYS J CG    1 
ATOM 9175  C CD    . LYS P  3 7   ? 68.616  60.843   8.331   1.00 314.11 ? 20  LYS J CD    1 
ATOM 9176  C CE    . LYS P  3 7   ? 69.778  61.124   9.282   1.00 309.87 ? 20  LYS J CE    1 
ATOM 9177  N NZ    . LYS P  3 7   ? 70.933  61.891   8.718   1.00 310.26 ? 20  LYS J NZ    1 
ATOM 9178  N N     . ALA P  3 8   ? 66.554  58.239   3.563   1.00 323.92 ? 21  ALA J N     1 
ATOM 9179  C CA    . ALA P  3 8   ? 65.413  57.901   2.671   1.00 299.58 ? 21  ALA J CA    1 
ATOM 9180  C C     . ALA P  3 8   ? 65.344  56.422   2.280   1.00 282.74 ? 21  ALA J C     1 
ATOM 9181  O O     . ALA P  3 8   ? 64.264  55.824   2.253   1.00 272.87 ? 21  ALA J O     1 
ATOM 9182  C CB    . ALA P  3 8   ? 65.416  58.772   1.418   1.00 303.27 ? 21  ALA J CB    1 
ATOM 9183  N N     . ALA P  3 9   ? 66.496  55.841   1.972   1.00 273.04 ? 22  ALA J N     1 
ATOM 9184  C CA    . ALA P  3 9   ? 66.563  54.418   1.729   1.00 268.93 ? 22  ALA J CA    1 
ATOM 9185  C C     . ALA P  3 9   ? 66.288  53.631   3.017   1.00 268.25 ? 22  ALA J C     1 
ATOM 9186  O O     . ALA P  3 9   ? 65.728  52.549   2.955   1.00 273.32 ? 22  ALA J O     1 
ATOM 9187  C CB    . ALA P  3 9   ? 67.905  54.044   1.130   1.00 264.37 ? 22  ALA J CB    1 
ATOM 9188  N N     . VAL P  3 10  ? 66.671  54.180   4.174   1.00 262.71 ? 23  VAL J N     1 
ATOM 9189  C CA    . VAL P  3 10  ? 66.367  53.577   5.488   1.00 251.86 ? 23  VAL J CA    1 
ATOM 9190  C C     . VAL P  3 10  ? 64.854  53.519   5.711   1.00 258.93 ? 23  VAL J C     1 
ATOM 9191  O O     . VAL P  3 10  ? 64.325  52.489   6.134   1.00 250.38 ? 23  VAL J O     1 
ATOM 9192  C CB    . VAL P  3 10  ? 67.073  54.322   6.664   1.00 242.44 ? 23  VAL J CB    1 
ATOM 9193  C CG1   . VAL P  3 10  ? 66.504  53.936   8.025   1.00 233.69 ? 23  VAL J CG1   1 
ATOM 9194  C CG2   . VAL P  3 10  ? 68.565  54.049   6.658   1.00 233.65 ? 23  VAL J CG2   1 
ATOM 9195  N N     . HIS P  3 11  ? 64.172  54.625   5.416   1.00 272.92 ? 24  HIS J N     1 
ATOM 9196  C CA    . HIS P  3 11  ? 62.713  54.728   5.571   1.00 284.42 ? 24  HIS J CA    1 
ATOM 9197  C C     . HIS P  3 11  ? 62.039  53.675   4.719   1.00 285.53 ? 24  HIS J C     1 
ATOM 9198  O O     . HIS P  3 11  ? 61.084  53.038   5.159   1.00 280.17 ? 24  HIS J O     1 
ATOM 9199  C CB    . HIS P  3 11  ? 62.220  56.139   5.190   1.00 290.52 ? 24  HIS J CB    1 
ATOM 9200  C CG    . HIS P  3 11  ? 60.772  56.423   5.516   1.00 294.64 ? 24  HIS J CG    1 
ATOM 9201  N ND1   . HIS P  3 11  ? 60.233  56.289   6.783   1.00 300.38 ? 24  HIS J ND1   1 
ATOM 9202  C CD2   . HIS P  3 11  ? 59.770  56.907   4.738   1.00 292.50 ? 24  HIS J CD2   1 
ATOM 9203  C CE1   . HIS P  3 11  ? 58.958  56.644   6.761   1.00 299.51 ? 24  HIS J CE1   1 
ATOM 9204  N NE2   . HIS P  3 11  ? 58.650  57.012   5.529   1.00 295.23 ? 24  HIS J NE2   1 
ATOM 9205  N N     . TYR P  3 12  ? 62.556  53.484   3.510   1.00 294.55 ? 25  TYR J N     1 
ATOM 9206  C CA    . TYR P  3 12  ? 62.066  52.451   2.605   1.00 308.54 ? 25  TYR J CA    1 
ATOM 9207  C C     . TYR P  3 12  ? 62.026  51.066   3.269   1.00 295.25 ? 25  TYR J C     1 
ATOM 9208  O O     . TYR P  3 12  ? 60.981  50.404   3.261   1.00 294.67 ? 25  TYR J O     1 
ATOM 9209  C CB    . TYR P  3 12  ? 62.943  52.421   1.351   1.00 332.17 ? 25  TYR J CB    1 
ATOM 9210  C CG    . TYR P  3 12  ? 62.665  51.300   0.349   1.00 351.95 ? 25  TYR J CG    1 
ATOM 9211  C CD1   . TYR P  3 12  ? 61.744  51.481   -0.696  1.00 361.63 ? 25  TYR J CD1   1 
ATOM 9212  C CD2   . TYR P  3 12  ? 63.351  50.073   0.412   1.00 356.47 ? 25  TYR J CD2   1 
ATOM 9213  C CE1   . TYR P  3 12  ? 61.485  50.482   -1.635  1.00 365.58 ? 25  TYR J CE1   1 
ATOM 9214  C CE2   . TYR P  3 12  ? 63.097  49.058   -0.531  1.00 360.91 ? 25  TYR J CE2   1 
ATOM 9215  C CZ    . TYR P  3 12  ? 62.166  49.270   -1.549  1.00 363.47 ? 25  TYR J CZ    1 
ATOM 9216  O OH    . TYR P  3 12  ? 61.902  48.287   -2.480  1.00 364.79 ? 25  TYR J OH    1 
ATOM 9217  N N     . THR P  3 13  ? 63.156  50.644   3.843   1.00 279.54 ? 26  THR J N     1 
ATOM 9218  C CA    . THR P  3 13  ? 63.319  49.296   4.418   1.00 264.93 ? 26  THR J CA    1 
ATOM 9219  C C     . THR P  3 13  ? 62.594  49.148   5.759   1.00 262.74 ? 26  THR J C     1 
ATOM 9220  O O     . THR P  3 13  ? 62.040  48.087   6.090   1.00 268.63 ? 26  THR J O     1 
ATOM 9221  C CB    . THR P  3 13  ? 64.812  48.985   4.598   1.00 256.93 ? 26  THR J CB    1 
ATOM 9222  O OG1   . THR P  3 13  ? 65.429  48.929   3.309   1.00 254.71 ? 26  THR J OG1   1 
ATOM 9223  C CG2   . THR P  3 13  ? 64.998  47.670   5.281   1.00 254.75 ? 26  THR J CG2   1 
ATOM 9224  N N     . VAL P  3 14  ? 62.604  50.226   6.527   1.00 255.92 ? 27  VAL J N     1 
ATOM 9225  C CA    . VAL P  3 14  ? 61.761  50.310   7.693   1.00 253.91 ? 27  VAL J CA    1 
ATOM 9226  C C     . VAL P  3 14  ? 60.291  50.102   7.279   1.00 276.13 ? 27  VAL J C     1 
ATOM 9227  O O     . VAL P  3 14  ? 59.568  49.343   7.923   1.00 288.35 ? 27  VAL J O     1 
ATOM 9228  C CB    . VAL P  3 14  ? 61.986  51.641   8.423   1.00 239.24 ? 27  VAL J CB    1 
ATOM 9229  C CG1   . VAL P  3 14  ? 60.830  51.938   9.357   1.00 234.15 ? 27  VAL J CG1   1 
ATOM 9230  C CG2   . VAL P  3 14  ? 63.307  51.598   9.177   1.00 227.38 ? 27  VAL J CG2   1 
ATOM 9231  N N     . GLY P  3 15  ? 59.873  50.738   6.183   1.00 293.33 ? 28  GLY J N     1 
ATOM 9232  C CA    . GLY P  3 15  ? 58.561  50.480   5.572   1.00 305.40 ? 28  GLY J CA    1 
ATOM 9233  C C     . GLY P  3 15  ? 58.316  49.018   5.214   1.00 306.19 ? 28  GLY J C     1 
ATOM 9234  O O     . GLY P  3 15  ? 57.190  48.526   5.380   1.00 305.91 ? 28  GLY J O     1 
ATOM 9235  N N     . CYS P  3 16  ? 59.369  48.339   4.732   1.00 303.11 ? 29  CYS J N     1 
ATOM 9236  C CA    . CYS P  3 16  ? 59.349  46.901   4.360   1.00 296.47 ? 29  CYS J CA    1 
ATOM 9237  C C     . CYS P  3 16  ? 58.791  46.003   5.457   1.00 295.69 ? 29  CYS J C     1 
ATOM 9238  O O     . CYS P  3 16  ? 57.747  45.363   5.295   1.00 288.88 ? 29  CYS J O     1 
ATOM 9239  C CB    . CYS P  3 16  ? 60.760  46.393   4.017   1.00 290.53 ? 29  CYS J CB    1 
ATOM 9240  S SG    . CYS P  3 16  ? 61.218  46.354   2.263   1.00 280.19 ? 29  CYS J SG    1 
ATOM 9241  N N     . LEU P  3 17  ? 59.508  45.971   6.573   1.00 298.21 ? 30  LEU J N     1 
ATOM 9242  C CA    . LEU P  3 17  ? 59.219  45.047   7.668   1.00 301.18 ? 30  LEU J CA    1 
ATOM 9243  C C     . LEU P  3 17  ? 57.954  45.372   8.470   1.00 316.38 ? 30  LEU J C     1 
ATOM 9244  O O     . LEU P  3 17  ? 57.304  44.454   8.991   1.00 323.49 ? 30  LEU J O     1 
ATOM 9245  C CB    . LEU P  3 17  ? 60.417  44.971   8.605   1.00 287.11 ? 30  LEU J CB    1 
ATOM 9246  C CG    . LEU P  3 17  ? 61.767  44.815   7.930   1.00 276.51 ? 30  LEU J CG    1 
ATOM 9247  C CD1   . LEU P  3 17  ? 62.795  45.176   8.970   1.00 269.89 ? 30  LEU J CD1   1 
ATOM 9248  C CD2   . LEU P  3 17  ? 61.944  43.389   7.430   1.00 271.26 ? 30  LEU J CD2   1 
ATOM 9249  N N     . CYS P  3 18  ? 57.611  46.666   8.569   1.00 328.47 ? 31  CYS J N     1 
ATOM 9250  C CA    . CYS P  3 18  ? 56.368  47.127   9.246   1.00 333.68 ? 31  CYS J CA    1 
ATOM 9251  C C     . CYS P  3 18  ? 55.109  46.497   8.630   1.00 339.18 ? 31  CYS J C     1 
ATOM 9252  O O     . CYS P  3 18  ? 54.103  46.270   9.326   1.00 343.70 ? 31  CYS J O     1 
ATOM 9253  C CB    . CYS P  3 18  ? 56.226  48.663   9.223   1.00 332.80 ? 31  CYS J CB    1 
ATOM 9254  S SG    . CYS P  3 18  ? 57.471  49.627   10.125  1.00 320.91 ? 31  CYS J SG    1 
ATOM 9255  N N     . GLU P  3 19  ? 55.181  46.234   7.327   1.00 338.17 ? 32  GLU J N     1 
ATOM 9256  C CA    . GLU P  3 19  ? 54.091  45.627   6.595   1.00 342.39 ? 32  GLU J CA    1 
ATOM 9257  C C     . GLU P  3 19  ? 53.834  44.166   6.884   1.00 350.63 ? 32  GLU J C     1 
ATOM 9258  O O     . GLU P  3 19  ? 52.677  43.758   6.903   1.00 362.35 ? 32  GLU J O     1 
ATOM 9259  C CB    . GLU P  3 19  ? 54.286  45.843   5.120   1.00 336.25 ? 32  GLU J CB    1 
ATOM 9260  C CG    . GLU P  3 19  ? 53.627  47.126   4.716   1.00 335.26 ? 32  GLU J CG    1 
ATOM 9261  C CD    . GLU P  3 19  ? 52.166  46.925   4.467   1.00 338.97 ? 32  GLU J CD    1 
ATOM 9262  O OE1   . GLU P  3 19  ? 51.827  45.932   3.805   1.00 339.86 ? 32  GLU J OE1   1 
ATOM 9263  O OE2   . GLU P  3 19  ? 51.380  47.772   4.909   1.00 340.02 ? 32  GLU J OE2   1 
ATOM 9264  N N     . GLU P  3 20  ? 54.897  43.386   7.092   1.00 348.20 ? 33  GLU J N     1 
ATOM 9265  C CA    . GLU P  3 20  ? 54.763  41.986   7.528   1.00 343.02 ? 33  GLU J CA    1 
ATOM 9266  C C     . GLU P  3 20  ? 54.016  41.890   8.873   1.00 340.57 ? 33  GLU J C     1 
ATOM 9267  O O     . GLU P  3 20  ? 53.154  41.011   9.042   1.00 332.93 ? 33  GLU J O     1 
ATOM 9268  C CB    . GLU P  3 20  ? 56.121  41.257   7.528   1.00 339.50 ? 33  GLU J CB    1 
ATOM 9269  C CG    . GLU P  3 20  ? 56.474  40.595   6.197   1.00 338.75 ? 33  GLU J CG    1 
ATOM 9270  C CD    . GLU P  3 20  ? 57.975  40.375   5.976   1.00 335.75 ? 33  GLU J CD    1 
ATOM 9271  O OE1   . GLU P  3 20  ? 58.791  40.677   6.880   1.00 335.89 ? 33  GLU J OE1   1 
ATOM 9272  O OE2   . GLU P  3 20  ? 58.371  39.895   4.876   1.00 333.99 ? 33  GLU J OE2   1 
ATOM 9273  N N     . VAL P  3 21  ? 54.320  42.838   9.778   1.00 338.48 ? 34  VAL J N     1 
ATOM 9274  C CA    . VAL P  3 21  ? 53.606  43.055   11.065  1.00 330.08 ? 34  VAL J CA    1 
ATOM 9275  C C     . VAL P  3 21  ? 52.127  43.453   10.860  1.00 341.22 ? 34  VAL J C     1 
ATOM 9276  O O     . VAL P  3 21  ? 51.259  43.062   11.644  1.00 349.05 ? 34  VAL J O     1 
ATOM 9277  C CB    . VAL P  3 21  ? 54.293  44.133   11.975  1.00 311.75 ? 34  VAL J CB    1 
ATOM 9278  C CG1   . VAL P  3 21  ? 53.689  44.150   13.377  1.00 295.71 ? 34  VAL J CG1   1 
ATOM 9279  C CG2   . VAL P  3 21  ? 55.796  43.927   12.077  1.00 302.94 ? 34  VAL J CG2   1 
ATOM 9280  N N     . ALA P  3 22  ? 51.848  44.237   9.817   1.00 342.34 ? 35  ALA J N     1 
ATOM 9281  C CA    . ALA P  3 22  ? 50.478  44.676   9.510   1.00 338.07 ? 35  ALA J CA    1 
ATOM 9282  C C     . ALA P  3 22  ? 49.559  43.531   9.082   1.00 342.84 ? 35  ALA J C     1 
ATOM 9283  O O     . ALA P  3 22  ? 48.358  43.626   9.262   1.00 338.92 ? 35  ALA J O     1 
ATOM 9284  C CB    . ALA P  3 22  ? 50.491  45.768   8.451   1.00 330.98 ? 35  ALA J CB    1 
ATOM 9285  N N     . LEU P  3 23  ? 50.117  42.460   8.509   1.00 349.79 ? 36  LEU J N     1 
ATOM 9286  C CA    . LEU P  3 23  ? 49.293  41.301   8.116   1.00 356.75 ? 36  LEU J CA    1 
ATOM 9287  C C     . LEU P  3 23  ? 49.192  40.260   9.208   1.00 355.54 ? 36  LEU J C     1 
ATOM 9288  O O     . LEU P  3 23  ? 48.210  39.515   9.270   1.00 356.39 ? 36  LEU J O     1 
ATOM 9289  C CB    . LEU P  3 23  ? 49.764  40.634   6.825   1.00 360.00 ? 36  LEU J CB    1 
ATOM 9290  C CG    . LEU P  3 23  ? 48.500  40.120   6.115   1.00 366.63 ? 36  LEU J CG    1 
ATOM 9291  C CD1   . LEU P  3 23  ? 47.900  41.188   5.213   1.00 372.15 ? 36  LEU J CD1   1 
ATOM 9292  C CD2   . LEU P  3 23  ? 48.786  38.886   5.305   1.00 366.78 ? 36  LEU J CD2   1 
ATOM 9293  N N     . ASP P  3 24  ? 50.219  40.226   10.057  1.00 353.18 ? 37  ASP J N     1 
ATOM 9294  C CA    . ASP P  3 24  ? 50.242  39.439   11.296  1.00 355.97 ? 37  ASP J CA    1 
ATOM 9295  C C     . ASP P  3 24  ? 49.063  39.741   12.263  1.00 347.94 ? 37  ASP J C     1 
ATOM 9296  O O     . ASP P  3 24  ? 48.422  38.802   12.758  1.00 350.83 ? 37  ASP J O     1 
ATOM 9297  C CB    . ASP P  3 24  ? 51.626  39.595   11.982  1.00 366.95 ? 37  ASP J CB    1 
ATOM 9298  C CG    . ASP P  3 24  ? 51.690  38.978   13.388  1.00 379.06 ? 37  ASP J CG    1 
ATOM 9299  O OD1   . ASP P  3 24  ? 51.286  37.801   13.570  1.00 386.51 ? 37  ASP J OD1   1 
ATOM 9300  O OD2   . ASP P  3 24  ? 52.182  39.672   14.305  1.00 383.48 ? 37  ASP J OD2   1 
ATOM 9301  N N     . LYS P  3 25  ? 48.771  41.027   12.511  1.00 332.89 ? 38  LYS J N     1 
ATOM 9302  C CA    . LYS P  3 25  ? 47.691  41.437   13.447  1.00 317.07 ? 38  LYS J CA    1 
ATOM 9303  C C     . LYS P  3 25  ? 46.404  41.869   12.726  1.00 311.03 ? 38  LYS J C     1 
ATOM 9304  O O     . LYS P  3 25  ? 45.392  42.153   13.385  1.00 306.12 ? 38  LYS J O     1 
ATOM 9305  C CB    . LYS P  3 25  ? 48.167  42.542   14.415  1.00 312.63 ? 38  LYS J CB    1 
ATOM 9306  C CG    . LYS P  3 25  ? 49.375  42.171   15.278  1.00 304.71 ? 38  LYS J CG    1 
ATOM 9307  C CD    . LYS P  3 25  ? 49.019  41.723   16.686  1.00 300.70 ? 38  LYS J CD    1 
ATOM 9308  C CE    . LYS P  3 25  ? 50.265  41.306   17.449  1.00 294.49 ? 38  LYS J CE    1 
ATOM 9309  N NZ    . LYS P  3 25  ? 50.022  41.455   18.903  1.00 293.74 ? 38  LYS J NZ    1 
ATOM 9310  N N     . ALA P  3 26  ? 46.466  41.874   11.387  1.00 306.41 ? 39  ALA J N     1 
ATOM 9311  C CA    . ALA P  3 26  ? 45.387  42.266   10.463  1.00 307.28 ? 39  ALA J CA    1 
ATOM 9312  C C     . ALA P  3 26  ? 44.909  43.702   10.711  1.00 307.14 ? 39  ALA J C     1 
ATOM 9313  O O     . ALA P  3 26  ? 43.715  44.009   10.645  1.00 316.18 ? 39  ALA J O     1 
ATOM 9314  C CB    . ALA P  3 26  ? 44.238  41.258   10.494  1.00 309.22 ? 39  ALA J CB    1 
ATOM 9315  N N     . MET P  3 27  ? 45.860  44.587   10.997  1.00 299.12 ? 40  MET J N     1 
ATOM 9316  C CA    . MET P  3 27  ? 45.512  45.934   11.423  1.00 296.69 ? 40  MET J CA    1 
ATOM 9317  C C     . MET P  3 27  ? 46.554  46.983   11.036  1.00 282.72 ? 40  MET J C     1 
ATOM 9318  O O     . MET P  3 27  ? 47.676  46.659   10.618  1.00 269.35 ? 40  MET J O     1 
ATOM 9319  C CB    . MET P  3 27  ? 45.242  45.956   12.946  1.00 308.01 ? 40  MET J CB    1 
ATOM 9320  C CG    . MET P  3 27  ? 44.044  46.799   13.402  1.00 325.03 ? 40  MET J CG    1 
ATOM 9321  S SD    . MET P  3 27  ? 42.608  45.903   14.023  1.00 334.79 ? 40  MET J SD    1 
ATOM 9322  C CE    . MET P  3 27  ? 41.586  45.657   12.570  1.00 333.82 ? 40  MET J CE    1 
ATOM 9323  N N     . GLN P  3 28  ? 46.161  48.238   11.257  1.00 278.86 ? 41  GLN J N     1 
ATOM 9324  C CA    . GLN P  3 28  ? 46.734  49.410   10.611  1.00 276.21 ? 41  GLN J CA    1 
ATOM 9325  C C     . GLN P  3 28  ? 47.647  50.314   11.427  1.00 269.60 ? 41  GLN J C     1 
ATOM 9326  O O     . GLN P  3 28  ? 47.420  50.592   12.606  1.00 257.74 ? 41  GLN J O     1 
ATOM 9327  C CB    . GLN P  3 28  ? 45.612  50.237   9.956   1.00 285.26 ? 41  GLN J CB    1 
ATOM 9328  C CG    . GLN P  3 28  ? 44.171  49.896   10.366  1.00 294.42 ? 41  GLN J CG    1 
ATOM 9329  C CD    . GLN P  3 28  ? 43.468  48.876   9.456   1.00 302.97 ? 41  GLN J CD    1 
ATOM 9330  O OE1   . GLN P  3 28  ? 43.777  48.747   8.266   1.00 309.27 ? 41  GLN J OE1   1 
ATOM 9331  N NE2   . GLN P  3 28  ? 42.496  48.170   10.014  1.00 305.08 ? 41  GLN J NE2   1 
ATOM 9332  N N     . PHE P  3 29  ? 48.669  50.785   10.719  1.00 276.26 ? 42  PHE J N     1 
ATOM 9333  C CA    . PHE P  3 29  ? 49.792  51.541   11.253  1.00 282.13 ? 42  PHE J CA    1 
ATOM 9334  C C     . PHE P  3 29  ? 49.720  52.959   10.724  1.00 288.52 ? 42  PHE J C     1 
ATOM 9335  O O     . PHE P  3 29  ? 49.332  53.162   9.573   1.00 300.72 ? 42  PHE J O     1 
ATOM 9336  C CB    . PHE P  3 29  ? 51.099  50.929   10.730  1.00 282.12 ? 42  PHE J CB    1 
ATOM 9337  C CG    . PHE P  3 29  ? 51.489  49.618   11.385  1.00 281.47 ? 42  PHE J CG    1 
ATOM 9338  C CD1   . PHE P  3 29  ? 50.526  48.671   11.759  1.00 283.26 ? 42  PHE J CD1   1 
ATOM 9339  C CD2   . PHE P  3 29  ? 52.841  49.311   11.592  1.00 277.86 ? 42  PHE J CD2   1 
ATOM 9340  C CE1   . PHE P  3 29  ? 50.911  47.473   12.355  1.00 281.47 ? 42  PHE J CE1   1 
ATOM 9341  C CE2   . PHE P  3 29  ? 53.222  48.116   12.187  1.00 275.30 ? 42  PHE J CE2   1 
ATOM 9342  C CZ    . PHE P  3 29  ? 52.255  47.198   12.565  1.00 276.88 ? 42  PHE J CZ    1 
ATOM 9343  N N     . SER P  3 30  ? 50.119  53.938   11.532  1.00 285.05 ? 43  SER J N     1 
ATOM 9344  C CA    . SER P  3 30  ? 50.225  55.303   11.024  1.00 287.41 ? 43  SER J CA    1 
ATOM 9345  C C     . SER P  3 30  ? 51.545  55.506   10.282  1.00 294.01 ? 43  SER J C     1 
ATOM 9346  O O     . SER P  3 30  ? 52.545  54.873   10.606  1.00 287.73 ? 43  SER J O     1 
ATOM 9347  C CB    . SER P  3 30  ? 50.006  56.352   12.124  1.00 279.48 ? 43  SER J CB    1 
ATOM 9348  O OG    . SER P  3 30  ? 51.032  56.381   13.086  1.00 265.66 ? 43  SER J OG    1 
ATOM 9349  N N     . LYS P  3 31  ? 51.526  56.362   9.259   1.00 311.71 ? 44  LYS J N     1 
ATOM 9350  C CA    . LYS P  3 31  ? 52.720  56.659   8.452   1.00 329.07 ? 44  LYS J CA    1 
ATOM 9351  C C     . LYS P  3 31  ? 53.758  57.459   9.260   1.00 332.38 ? 44  LYS J C     1 
ATOM 9352  O O     . LYS P  3 31  ? 54.968  57.272   9.063   1.00 333.77 ? 44  LYS J O     1 
ATOM 9353  C CB    . LYS P  3 31  ? 52.347  57.362   7.118   1.00 335.87 ? 44  LYS J CB    1 
ATOM 9354  C CG    . LYS P  3 31  ? 53.507  57.942   6.298   1.00 338.94 ? 44  LYS J CG    1 
ATOM 9355  C CD    . LYS P  3 31  ? 54.003  57.028   5.189   1.00 337.92 ? 44  LYS J CD    1 
ATOM 9356  C CE    . LYS P  3 31  ? 53.169  57.211   3.933   1.00 342.09 ? 44  LYS J CE    1 
ATOM 9357  N NZ    . LYS P  3 31  ? 53.864  56.654   2.744   1.00 340.34 ? 44  LYS J NZ    1 
ATOM 9358  N N     . GLN P  3 32  ? 53.298  58.333   10.167  1.00 335.01 ? 45  GLN J N     1 
ATOM 9359  C CA    . GLN P  3 32  ? 54.231  59.045   11.054  1.00 336.80 ? 45  GLN J CA    1 
ATOM 9360  C C     . GLN P  3 32  ? 54.945  58.055   11.994  1.00 342.45 ? 45  GLN J C     1 
ATOM 9361  O O     . GLN P  3 32  ? 56.081  58.307   12.417  1.00 349.28 ? 45  GLN J O     1 
ATOM 9362  C CB    . GLN P  3 32  ? 53.578  60.181   11.875  1.00 330.20 ? 45  GLN J CB    1 
ATOM 9363  C CG    . GLN P  3 32  ? 52.434  60.957   11.242  1.00 323.54 ? 45  GLN J CG    1 
ATOM 9364  C CD    . GLN P  3 32  ? 51.098  60.368   11.626  1.00 319.06 ? 45  GLN J CD    1 
ATOM 9365  O OE1   . GLN P  3 32  ? 50.680  59.364   11.063  1.00 312.52 ? 45  GLN J OE1   1 
ATOM 9366  N NE2   . GLN P  3 32  ? 50.421  60.988   12.589  1.00 321.17 ? 45  GLN J NE2   1 
ATOM 9367  N N     . THR P  3 33  ? 54.277  56.941   12.313  1.00 341.83 ? 46  THR J N     1 
ATOM 9368  C CA    . THR P  3 33  ? 54.897  55.855   13.080  1.00 333.28 ? 46  THR J CA    1 
ATOM 9369  C C     . THR P  3 33  ? 56.034  55.200   12.252  1.00 325.49 ? 46  THR J C     1 
ATOM 9370  O O     . THR P  3 33  ? 57.134  54.984   12.767  1.00 330.00 ? 46  THR J O     1 
ATOM 9371  C CB    . THR P  3 33  ? 53.843  54.838   13.606  1.00 328.63 ? 46  THR J CB    1 
ATOM 9372  O OG1   . THR P  3 33  ? 52.816  55.530   14.334  1.00 324.15 ? 46  THR J OG1   1 
ATOM 9373  C CG2   . THR P  3 33  ? 54.477  53.812   14.531  1.00 323.97 ? 46  THR J CG2   1 
ATOM 9374  N N     . ILE P  3 34  ? 55.778  54.927   10.970  1.00 313.21 ? 47  ILE J N     1 
ATOM 9375  C CA    . ILE P  3 34  ? 56.828  54.462   10.052  1.00 299.91 ? 47  ILE J CA    1 
ATOM 9376  C C     . ILE P  3 34  ? 57.995  55.460   10.007  1.00 298.62 ? 47  ILE J C     1 
ATOM 9377  O O     . ILE P  3 34  ? 59.161  55.052   10.054  1.00 291.08 ? 47  ILE J O     1 
ATOM 9378  C CB    . ILE P  3 34  ? 56.307  54.230   8.609   1.00 298.64 ? 47  ILE J CB    1 
ATOM 9379  C CG1   . ILE P  3 34  ? 54.925  53.536   8.588   1.00 295.18 ? 47  ILE J CG1   1 
ATOM 9380  C CG2   . ILE P  3 34  ? 57.368  53.527   7.759   1.00 298.09 ? 47  ILE J CG2   1 
ATOM 9381  C CD1   . ILE P  3 34  ? 54.902  52.073   8.991   1.00 287.80 ? 47  ILE J CD1   1 
ATOM 9382  N N     . ALA P  3 35  ? 57.669  56.756   9.918   1.00 306.07 ? 48  ALA J N     1 
ATOM 9383  C CA    . ALA P  3 35  ? 58.659  57.846   9.973   1.00 315.75 ? 48  ALA J CA    1 
ATOM 9384  C C     . ALA P  3 35  ? 59.492  57.884   11.286  1.00 320.07 ? 48  ALA J C     1 
ATOM 9385  O O     . ALA P  3 35  ? 60.726  58.069   11.237  1.00 329.75 ? 48  ALA J O     1 
ATOM 9386  C CB    . ALA P  3 35  ? 58.016  59.208   9.661   1.00 315.88 ? 48  ALA J CB    1 
ATOM 9387  N N     . ALA P  3 36  ? 58.859  57.685   12.448  1.00 324.13 ? 49  ALA J N     1 
ATOM 9388  C CA    . ALA P  3 36  ? 59.607  57.699   13.729  1.00 329.78 ? 49  ALA J CA    1 
ATOM 9389  C C     . ALA P  3 36  ? 60.617  56.543   13.915  1.00 338.71 ? 49  ALA J C     1 
ATOM 9390  O O     . ALA P  3 36  ? 61.626  56.719   14.625  1.00 338.98 ? 49  ALA J O     1 
ATOM 9391  C CB    . ALA P  3 36  ? 58.669  57.820   14.928  1.00 325.94 ? 49  ALA J CB    1 
ATOM 9392  N N     . ILE P  3 37  ? 60.347  55.395   13.266  1.00 349.88 ? 50  ILE J N     1 
ATOM 9393  C CA    . ILE P  3 37  ? 61.226  54.193   13.283  1.00 349.65 ? 50  ILE J CA    1 
ATOM 9394  C C     . ILE P  3 37  ? 62.571  54.392   12.582  1.00 350.01 ? 50  ILE J C     1 
ATOM 9395  O O     . ILE P  3 37  ? 63.608  53.948   13.074  1.00 350.76 ? 50  ILE J O     1 
ATOM 9396  C CB    . ILE P  3 37  ? 60.570  52.946   12.648  1.00 339.98 ? 50  ILE J CB    1 
ATOM 9397  C CG1   . ILE P  3 37  ? 59.270  52.587   13.357  1.00 341.53 ? 50  ILE J CG1   1 
ATOM 9398  C CG2   . ILE P  3 37  ? 61.526  51.761   12.708  1.00 328.49 ? 50  ILE J CG2   1 
ATOM 9399  C CD1   . ILE P  3 37  ? 58.509  51.466   12.693  1.00 335.52 ? 50  ILE J CD1   1 
ATOM 9400  N N     . SER P  3 38  ? 62.540  55.031   11.416  1.00 351.31 ? 51  SER J N     1 
ATOM 9401  C CA    . SER P  3 38  ? 63.758  55.311   10.652  1.00 347.84 ? 51  SER J CA    1 
ATOM 9402  C C     . SER P  3 38  ? 64.697  56.304   11.391  1.00 338.53 ? 51  SER J C     1 
ATOM 9403  O O     . SER P  3 38  ? 65.917  56.123   11.387  1.00 331.79 ? 51  SER J O     1 
ATOM 9404  C CB    . SER P  3 38  ? 63.386  55.770   9.232   1.00 361.23 ? 51  SER J CB    1 
ATOM 9405  O OG    . SER P  3 38  ? 62.374  54.923   8.678   1.00 362.80 ? 51  SER J OG    1 
ATOM 9406  N N     . GLU P  3 39  ? 64.103  57.314   12.040  1.00 330.97 ? 52  GLU J N     1 
ATOM 9407  C CA    . GLU P  3 39  ? 64.802  58.273   12.906  1.00 317.45 ? 52  GLU J CA    1 
ATOM 9408  C C     . GLU P  3 39  ? 65.562  57.611   14.034  1.00 295.04 ? 52  GLU J C     1 
ATOM 9409  O O     . GLU P  3 39  ? 66.752  57.838   14.162  1.00 292.54 ? 52  GLU J O     1 
ATOM 9410  C CB    . GLU P  3 39  ? 63.826  59.250   13.533  1.00 330.97 ? 52  GLU J CB    1 
ATOM 9411  C CG    . GLU P  3 39  ? 63.549  60.476   12.698  1.00 354.54 ? 52  GLU J CG    1 
ATOM 9412  C CD    . GLU P  3 39  ? 62.254  61.158   13.103  1.00 370.26 ? 52  GLU J CD    1 
ATOM 9413  O OE1   . GLU P  3 39  ? 61.915  61.098   14.309  1.00 367.94 ? 52  GLU J OE1   1 
ATOM 9414  O OE2   . GLU P  3 39  ? 61.575  61.745   12.217  1.00 387.37 ? 52  GLU J OE2   1 
ATOM 9415  N N     . LEU P  3 40  ? 64.883  56.822   14.871  1.00 272.77 ? 53  LEU J N     1 
ATOM 9416  C CA    . LEU P  3 40  ? 65.585  56.096   15.963  1.00 254.64 ? 53  LEU J CA    1 
ATOM 9417  C C     . LEU P  3 40  ? 66.525  54.987   15.472  1.00 251.26 ? 53  LEU J C     1 
ATOM 9418  O O     . LEU P  3 40  ? 67.555  54.754   16.106  1.00 247.02 ? 53  LEU J O     1 
ATOM 9419  C CB    . LEU P  3 40  ? 64.655  55.544   17.071  1.00 243.77 ? 53  LEU J CB    1 
ATOM 9420  C CG    . LEU P  3 40  ? 65.361  54.898   18.295  1.00 234.52 ? 53  LEU J CG    1 
ATOM 9421  C CD1   . LEU P  3 40  ? 65.971  55.942   19.226  1.00 233.22 ? 53  LEU J CD1   1 
ATOM 9422  C CD2   . LEU P  3 40  ? 64.457  53.962   19.086  1.00 231.06 ? 53  LEU J CD2   1 
ATOM 9423  N N     . THR P  3 41  ? 66.160  54.315   14.369  1.00 252.64 ? 54  THR J N     1 
ATOM 9424  C CA    . THR P  3 41  ? 67.028  53.330   13.711  1.00 252.06 ? 54  THR J CA    1 
ATOM 9425  C C     . THR P  3 41  ? 68.364  54.005   13.464  1.00 256.11 ? 54  THR J C     1 
ATOM 9426  O O     . THR P  3 41  ? 69.392  53.559   13.966  1.00 261.56 ? 54  THR J O     1 
ATOM 9427  C CB    . THR P  3 41  ? 66.435  52.818   12.376  1.00 250.60 ? 54  THR J CB    1 
ATOM 9428  O OG1   . THR P  3 41  ? 65.334  51.937   12.642  1.00 246.91 ? 54  THR J OG1   1 
ATOM 9429  C CG2   . THR P  3 41  ? 67.489  52.085   11.542  1.00 249.24 ? 54  THR J CG2   1 
ATOM 9430  N N     . PHE P  3 42  ? 68.314  55.110   12.721  1.00 255.58 ? 55  PHE J N     1 
ATOM 9431  C CA    . PHE P  3 42  ? 69.488  55.928   12.437  1.00 247.70 ? 55  PHE J CA    1 
ATOM 9432  C C     . PHE P  3 42  ? 70.157  56.505   13.718  1.00 248.08 ? 55  PHE J C     1 
ATOM 9433  O O     . PHE P  3 42  ? 71.381  56.439   13.826  1.00 255.87 ? 55  PHE J O     1 
ATOM 9434  C CB    . PHE P  3 42  ? 69.140  57.011   11.399  1.00 238.38 ? 55  PHE J CB    1 
ATOM 9435  C CG    . PHE P  3 42  ? 70.210  57.246   10.363  1.00 224.07 ? 55  PHE J CG    1 
ATOM 9436  C CD1   . PHE P  3 42  ? 70.186  56.577   9.134   1.00 216.42 ? 55  PHE J CD1   1 
ATOM 9437  C CD2   . PHE P  3 42  ? 71.229  58.164   10.602  1.00 221.29 ? 55  PHE J CD2   1 
ATOM 9438  C CE1   . PHE P  3 42  ? 71.171  56.819   8.180   1.00 211.75 ? 55  PHE J CE1   1 
ATOM 9439  C CE2   . PHE P  3 42  ? 72.209  58.412   9.645   1.00 215.66 ? 55  PHE J CE2   1 
ATOM 9440  C CZ    . PHE P  3 42  ? 72.181  57.734   8.438   1.00 212.37 ? 55  PHE J CZ    1 
ATOM 9441  N N     . ARG P  3 43  ? 69.370  57.028   14.682  1.00 237.14 ? 56  ARG J N     1 
ATOM 9442  C CA    . ARG P  3 43  ? 69.859  57.477   16.024  1.00 221.88 ? 56  ARG J CA    1 
ATOM 9443  C C     . ARG P  3 43  ? 70.541  56.374   16.781  1.00 212.92 ? 56  ARG J C     1 
ATOM 9444  O O     . ARG P  3 43  ? 71.563  56.597   17.429  1.00 205.95 ? 56  ARG J O     1 
ATOM 9445  C CB    . ARG P  3 43  ? 68.723  57.971   16.923  1.00 218.95 ? 56  ARG J CB    1 
ATOM 9446  C CG    . ARG P  3 43  ? 68.708  59.464   17.110  1.00 219.00 ? 56  ARG J CG    1 
ATOM 9447  C CD    . ARG P  3 43  ? 67.629  59.920   18.059  1.00 217.85 ? 56  ARG J CD    1 
ATOM 9448  N NE    . ARG P  3 43  ? 66.349  60.060   17.386  1.00 218.67 ? 56  ARG J NE    1 
ATOM 9449  C CZ    . ARG P  3 43  ? 65.231  59.535   17.859  1.00 218.00 ? 56  ARG J CZ    1 
ATOM 9450  N NH1   . ARG P  3 43  ? 65.293  58.874   18.998  1.00 219.34 ? 56  ARG J NH1   1 
ATOM 9451  N NH2   . ARG P  3 43  ? 64.071  59.682   17.224  1.00 216.70 ? 56  ARG J NH2   1 
ATOM 9452  N N     . GLN P  3 44  ? 69.933  55.197   16.694  1.00 208.50 ? 57  GLN J N     1 
ATOM 9453  C CA    . GLN P  3 44  ? 70.361  54.023   17.411  1.00 204.32 ? 57  GLN J CA    1 
ATOM 9454  C C     . GLN P  3 44  ? 71.670  53.482   16.879  1.00 204.66 ? 57  GLN J C     1 
ATOM 9455  O O     . GLN P  3 44  ? 72.515  53.052   17.644  1.00 200.22 ? 57  GLN J O     1 
ATOM 9456  C CB    . GLN P  3 44  ? 69.302  52.943   17.291  1.00 200.36 ? 57  GLN J CB    1 
ATOM 9457  C CG    . GLN P  3 44  ? 69.275  52.021   18.489  1.00 195.82 ? 57  GLN J CG    1 
ATOM 9458  C CD    . GLN P  3 44  ? 68.580  52.657   19.682  1.00 193.66 ? 57  GLN J CD    1 
ATOM 9459  O OE1   . GLN P  3 44  ? 68.754  53.841   19.939  1.00 194.11 ? 57  GLN J OE1   1 
ATOM 9460  N NE2   . GLN P  3 44  ? 67.787  51.874   20.413  1.00 190.16 ? 57  GLN J NE2   1 
ATOM 9461  N N     . CYS P  3 45  ? 71.821  53.501   15.558  1.00 211.37 ? 58  CYS J N     1 
ATOM 9462  C CA    . CYS P  3 45  ? 72.995  52.948   14.873  1.00 216.15 ? 58  CYS J CA    1 
ATOM 9463  C C     . CYS P  3 45  ? 74.257  53.736   15.167  1.00 212.56 ? 58  CYS J C     1 
ATOM 9464  O O     . CYS P  3 45  ? 75.361  53.213   15.095  1.00 211.43 ? 58  CYS J O     1 
ATOM 9465  C CB    . CYS P  3 45  ? 72.774  52.922   13.358  1.00 227.84 ? 58  CYS J CB    1 
ATOM 9466  S SG    . CYS P  3 45  ? 71.493  51.795   12.742  1.00 239.94 ? 58  CYS J SG    1 
ATOM 9467  N N     . GLU P  3 46  ? 74.066  55.014   15.454  1.00 209.40 ? 59  GLU J N     1 
ATOM 9468  C CA    . GLU P  3 46  ? 75.108  55.900   15.898  1.00 209.80 ? 59  GLU J CA    1 
ATOM 9469  C C     . GLU P  3 46  ? 75.760  55.290   17.122  1.00 212.81 ? 59  GLU J C     1 
ATOM 9470  O O     . GLU P  3 46  ? 76.965  55.053   17.145  1.00 217.14 ? 59  GLU J O     1 
ATOM 9471  C CB    . GLU P  3 46  ? 74.460  57.224   16.249  1.00 206.80 ? 59  GLU J CB    1 
ATOM 9472  C CG    . GLU P  3 46  ? 75.369  58.245   16.876  1.00 209.07 ? 59  GLU J CG    1 
ATOM 9473  C CD    . GLU P  3 46  ? 74.913  59.633   16.633  1.00 214.13 ? 59  GLU J CD    1 
ATOM 9474  O OE1   . GLU P  3 46  ? 73.693  59.849   16.569  1.00 213.00 ? 59  GLU J OE1   1 
ATOM 9475  O OE2   . GLU P  3 46  ? 75.792  60.509   16.511  1.00 220.95 ? 59  GLU J OE2   1 
ATOM 9476  N N     . ASN P  3 47  ? 74.938  55.009   18.121  1.00 216.44 ? 60  ASN J N     1 
ATOM 9477  C CA    . ASN P  3 47  ? 75.407  54.418   19.351  1.00 224.00 ? 60  ASN J CA    1 
ATOM 9478  C C     . ASN P  3 47  ? 75.908  53.039   19.161  1.00 221.65 ? 60  ASN J C     1 
ATOM 9479  O O     . ASN P  3 47  ? 76.921  52.709   19.727  1.00 224.64 ? 60  ASN J O     1 
ATOM 9480  C CB    . ASN P  3 47  ? 74.303  54.409   20.365  1.00 231.57 ? 60  ASN J CB    1 
ATOM 9481  C CG    . ASN P  3 47  ? 73.677  55.755   20.479  1.00 240.26 ? 60  ASN J CG    1 
ATOM 9482  O OD1   . ASN P  3 47  ? 74.378  56.741   20.692  1.00 244.55 ? 60  ASN J OD1   1 
ATOM 9483  N ND2   . ASN P  3 47  ? 72.363  55.833   20.271  1.00 245.69 ? 60  ASN J ND2   1 
ATOM 9484  N N     . PHE P  3 48  ? 75.224  52.231   18.366  1.00 216.13 ? 61  PHE J N     1 
ATOM 9485  C CA    . PHE P  3 48  ? 75.730  50.907   18.060  1.00 212.90 ? 61  PHE J CA    1 
ATOM 9486  C C     . PHE P  3 48  ? 77.120  50.927   17.441  1.00 215.48 ? 61  PHE J C     1 
ATOM 9487  O O     . PHE P  3 48  ? 78.014  50.238   17.931  1.00 211.48 ? 61  PHE J O     1 
ATOM 9488  C CB    . PHE P  3 48  ? 74.772  50.170   17.151  1.00 209.97 ? 61  PHE J CB    1 
ATOM 9489  C CG    . PHE P  3 48  ? 73.509  49.769   17.825  1.00 209.87 ? 61  PHE J CG    1 
ATOM 9490  C CD1   . PHE P  3 48  ? 73.446  49.689   19.210  1.00 210.84 ? 61  PHE J CD1   1 
ATOM 9491  C CD2   . PHE P  3 48  ? 72.387  49.437   17.083  1.00 209.67 ? 61  PHE J CD2   1 
ATOM 9492  C CE1   . PHE P  3 48  ? 72.279  49.297   19.842  1.00 211.91 ? 61  PHE J CE1   1 
ATOM 9493  C CE2   . PHE P  3 48  ? 71.211  49.048   17.707  1.00 209.81 ? 61  PHE J CE2   1 
ATOM 9494  C CZ    . PHE P  3 48  ? 71.161  48.969   19.089  1.00 211.16 ? 61  PHE J CZ    1 
ATOM 9495  N N     . ALA P  3 49  ? 77.294  51.724   16.380  1.00 221.57 ? 62  ALA J N     1 
ATOM 9496  C CA    . ALA P  3 49  ? 78.595  51.883   15.695  1.00 227.45 ? 62  ALA J CA    1 
ATOM 9497  C C     . ALA P  3 49  ? 79.721  52.435   16.605  1.00 231.65 ? 62  ALA J C     1 
ATOM 9498  O O     . ALA P  3 49  ? 80.827  51.887   16.651  1.00 233.67 ? 62  ALA J O     1 
ATOM 9499  C CB    . ALA P  3 49  ? 78.444  52.734   14.427  1.00 227.43 ? 62  ALA J CB    1 
ATOM 9500  N N     . LYS P  3 50  ? 79.443  53.509   17.335  1.00 231.82 ? 63  LYS J N     1 
ATOM 9501  C CA    . LYS P  3 50  ? 80.460  54.067   18.217  1.00 227.45 ? 63  LYS J CA    1 
ATOM 9502  C C     . LYS P  3 50  ? 80.756  53.134   19.394  1.00 221.86 ? 63  LYS J C     1 
ATOM 9503  O O     . LYS P  3 50  ? 81.899  53.007   19.805  1.00 220.16 ? 63  LYS J O     1 
ATOM 9504  C CB    . LYS P  3 50  ? 80.105  55.489   18.631  1.00 230.11 ? 63  LYS J CB    1 
ATOM 9505  C CG    . LYS P  3 50  ? 80.224  56.456   17.466  1.00 234.88 ? 63  LYS J CG    1 
ATOM 9506  C CD    . LYS P  3 50  ? 79.501  57.761   17.756  1.00 240.20 ? 63  LYS J CD    1 
ATOM 9507  C CE    . LYS P  3 50  ? 79.584  58.719   16.574  1.00 246.02 ? 63  LYS J CE    1 
ATOM 9508  N NZ    . LYS P  3 50  ? 78.441  58.557   15.631  1.00 245.45 ? 63  LYS J NZ    1 
ATOM 9509  N N     . ASP P  3 51  ? 79.741  52.428   19.884  1.00 217.31 ? 64  ASP J N     1 
ATOM 9510  C CA    . ASP P  3 51  ? 79.951  51.358   20.852  1.00 214.71 ? 64  ASP J CA    1 
ATOM 9511  C C     . ASP P  3 51  ? 80.796  50.271   20.259  1.00 212.16 ? 64  ASP J C     1 
ATOM 9512  O O     . ASP P  3 51  ? 81.769  49.865   20.866  1.00 215.51 ? 64  ASP J O     1 
ATOM 9513  C CB    . ASP P  3 51  ? 78.633  50.740   21.302  1.00 215.85 ? 64  ASP J CB    1 
ATOM 9514  C CG    . ASP P  3 51  ? 77.920  51.572   22.354  1.00 220.07 ? 64  ASP J CG    1 
ATOM 9515  O OD1   . ASP P  3 51  ? 78.493  52.578   22.832  1.00 223.11 ? 64  ASP J OD1   1 
ATOM 9516  O OD2   . ASP P  3 51  ? 76.770  51.222   22.699  1.00 221.56 ? 64  ASP J OD2   1 
ATOM 9517  N N     . LEU P  3 52  ? 80.419  49.782   19.085  1.00 207.48 ? 65  LEU J N     1 
ATOM 9518  C CA    . LEU P  3 52  ? 81.194  48.737   18.456  1.00 207.21 ? 65  LEU J CA    1 
ATOM 9519  C C     . LEU P  3 52  ? 82.633  49.192   18.260  1.00 216.98 ? 65  LEU J C     1 
ATOM 9520  O O     . LEU P  3 52  ? 83.541  48.376   18.393  1.00 221.26 ? 65  LEU J O     1 
ATOM 9521  C CB    . LEU P  3 52  ? 80.570  48.290   17.149  1.00 198.27 ? 65  LEU J CB    1 
ATOM 9522  C CG    . LEU P  3 52  ? 79.215  47.648   17.359  1.00 190.99 ? 65  LEU J CG    1 
ATOM 9523  C CD1   . LEU P  3 52  ? 78.480  47.582   16.044  1.00 188.60 ? 65  LEU J CD1   1 
ATOM 9524  C CD2   . LEU P  3 52  ? 79.365  46.273   17.957  1.00 188.51 ? 65  LEU J CD2   1 
ATOM 9525  N N     . GLU P  3 53  ? 82.829  50.489   17.980  1.00 224.67 ? 66  GLU J N     1 
ATOM 9526  C CA    . GLU P  3 53  ? 84.170  51.103   17.820  1.00 231.14 ? 66  GLU J CA    1 
ATOM 9527  C C     . GLU P  3 53  ? 85.017  50.874   19.063  1.00 242.69 ? 66  GLU J C     1 
ATOM 9528  O O     . GLU P  3 53  ? 86.109  50.318   18.975  1.00 248.63 ? 66  GLU J O     1 
ATOM 9529  C CB    . GLU P  3 53  ? 84.092  52.616   17.487  1.00 222.65 ? 66  GLU J CB    1 
ATOM 9530  C CG    . GLU P  3 53  ? 85.444  53.324   17.323  1.00 214.78 ? 66  GLU J CG    1 
ATOM 9531  C CD    . GLU P  3 53  ? 85.406  54.818   17.575  1.00 211.15 ? 66  GLU J CD    1 
ATOM 9532  O OE1   . GLU P  3 53  ? 84.306  55.421   17.624  1.00 206.19 ? 66  GLU J OE1   1 
ATOM 9533  O OE2   . GLU P  3 53  ? 86.507  55.391   17.727  1.00 211.42 ? 66  GLU J OE2   1 
ATOM 9534  N N     . MET P  3 54  ? 84.501  51.288   20.213  1.00 249.12 ? 67  MET J N     1 
ATOM 9535  C CA    . MET P  3 54  ? 85.194  51.101   21.475  1.00 252.54 ? 67  MET J CA    1 
ATOM 9536  C C     . MET P  3 54  ? 85.467  49.640   21.756  1.00 251.55 ? 67  MET J C     1 
ATOM 9537  O O     . MET P  3 54  ? 86.465  49.326   22.377  1.00 253.81 ? 67  MET J O     1 
ATOM 9538  C CB    . MET P  3 54  ? 84.395  51.696   22.620  1.00 251.97 ? 67  MET J CB    1 
ATOM 9539  C CG    . MET P  3 54  ? 84.682  53.176   22.815  1.00 253.83 ? 67  MET J CG    1 
ATOM 9540  S SD    . MET P  3 54  ? 83.538  54.016   23.910  1.00 250.96 ? 67  MET J SD    1 
ATOM 9541  C CE    . MET P  3 54  ? 82.103  54.273   22.866  1.00 248.83 ? 67  MET J CE    1 
ATOM 9542  N N     . PHE P  3 55  ? 84.589  48.759   21.283  1.00 247.67 ? 68  PHE J N     1 
ATOM 9543  C CA    . PHE P  3 55  ? 84.696  47.323   21.545  1.00 242.07 ? 68  PHE J CA    1 
ATOM 9544  C C     . PHE P  3 55  ? 85.807  46.717   20.713  1.00 233.14 ? 68  PHE J C     1 
ATOM 9545  O O     . PHE P  3 55  ? 86.595  45.904   21.187  1.00 224.14 ? 68  PHE J O     1 
ATOM 9546  C CB    . PHE P  3 55  ? 83.392  46.595   21.174  1.00 250.08 ? 68  PHE J CB    1 
ATOM 9547  C CG    . PHE P  3 55  ? 82.154  47.035   21.949  1.00 260.58 ? 68  PHE J CG    1 
ATOM 9548  C CD1   . PHE P  3 55  ? 82.236  47.690   23.194  1.00 267.44 ? 68  PHE J CD1   1 
ATOM 9549  C CD2   . PHE P  3 55  ? 80.874  46.740   21.444  1.00 261.02 ? 68  PHE J CD2   1 
ATOM 9550  C CE1   . PHE P  3 55  ? 81.075  48.071   23.889  1.00 270.35 ? 68  PHE J CE1   1 
ATOM 9551  C CE2   . PHE P  3 55  ? 79.718  47.105   22.138  1.00 262.81 ? 68  PHE J CE2   1 
ATOM 9552  C CZ    . PHE P  3 55  ? 79.817  47.767   23.364  1.00 267.64 ? 68  PHE J CZ    1 
ATOM 9553  N N     . ALA P  3 56  ? 85.825  47.114   19.449  1.00 231.75 ? 69  ALA J N     1 
ATOM 9554  C CA    . ALA P  3 56  ? 86.771  46.598   18.485  1.00 236.05 ? 69  ALA J CA    1 
ATOM 9555  C C     . ALA P  3 56  ? 88.122  47.199   18.754  1.00 244.22 ? 69  ALA J C     1 
ATOM 9556  O O     . ALA P  3 56  ? 89.134  46.522   18.684  1.00 248.46 ? 69  ALA J O     1 
ATOM 9557  C CB    . ALA P  3 56  ? 86.325  46.939   17.075  1.00 234.49 ? 69  ALA J CB    1 
ATOM 9558  N N     . ARG P  3 57  ? 88.126  48.492   19.044  1.00 250.54 ? 70  ARG J N     1 
ATOM 9559  C CA    . ARG P  3 57  ? 89.312  49.205   19.427  1.00 258.91 ? 70  ARG J CA    1 
ATOM 9560  C C     . ARG P  3 57  ? 89.952  48.592   20.645  1.00 271.51 ? 70  ARG J C     1 
ATOM 9561  O O     . ARG P  3 57  ? 91.191  48.512   20.732  1.00 271.83 ? 70  ARG J O     1 
ATOM 9562  C CB    . ARG P  3 57  ? 88.895  50.619   19.742  1.00 252.80 ? 70  ARG J CB    1 
ATOM 9563  C CG    . ARG P  3 57  ? 89.931  51.478   20.390  1.00 251.14 ? 70  ARG J CG    1 
ATOM 9564  C CD    . ARG P  3 57  ? 89.989  52.774   19.601  1.00 251.16 ? 70  ARG J CD    1 
ATOM 9565  N NE    . ARG P  3 57  ? 89.995  52.534   18.148  1.00 247.52 ? 70  ARG J NE    1 
ATOM 9566  C CZ    . ARG P  3 57  ? 90.966  51.920   17.464  1.00 247.26 ? 70  ARG J CZ    1 
ATOM 9567  N NH1   . ARG P  3 57  ? 92.047  51.437   18.083  1.00 249.83 ? 70  ARG J NH1   1 
ATOM 9568  N NH2   . ARG P  3 57  ? 90.833  51.757   16.157  1.00 242.84 ? 70  ARG J NH2   1 
ATOM 9569  N N     . HIS P  3 58  ? 89.075  48.168   21.568  1.00 286.98 ? 71  HIS J N     1 
ATOM 9570  C CA    . HIS P  3 58  ? 89.436  47.446   22.821  1.00 308.28 ? 71  HIS J CA    1 
ATOM 9571  C C     . HIS P  3 58  ? 89.976  46.029   22.597  1.00 304.37 ? 71  HIS J C     1 
ATOM 9572  O O     . HIS P  3 58  ? 90.633  45.460   23.496  1.00 320.80 ? 71  HIS J O     1 
ATOM 9573  C CB    . HIS P  3 58  ? 88.250  47.374   23.836  1.00 322.55 ? 71  HIS J CB    1 
ATOM 9574  C CG    . HIS P  3 58  ? 88.620  46.806   25.196  1.00 335.37 ? 71  HIS J CG    1 
ATOM 9575  N ND1   . HIS P  3 58  ? 89.559  47.384   26.029  1.00 341.61 ? 71  HIS J ND1   1 
ATOM 9576  C CD2   . HIS P  3 58  ? 88.150  45.725   25.868  1.00 335.97 ? 71  HIS J CD2   1 
ATOM 9577  C CE1   . HIS P  3 58  ? 89.667  46.673   27.140  1.00 341.52 ? 71  HIS J CE1   1 
ATOM 9578  N NE2   . HIS P  3 58  ? 88.821  45.661   27.068  1.00 338.28 ? 71  HIS J NE2   1 
ATOM 9579  N N     . ALA P  3 59  ? 89.692  45.476   21.412  1.00 283.81 ? 72  ALA J N     1 
ATOM 9580  C CA    . ALA P  3 59  ? 89.994  44.078   21.077  1.00 269.74 ? 72  ALA J CA    1 
ATOM 9581  C C     . ALA P  3 59  ? 91.401  43.850   20.502  1.00 271.79 ? 72  ALA J C     1 
ATOM 9582  O O     . ALA P  3 59  ? 91.708  42.759   20.000  1.00 263.73 ? 72  ALA J O     1 
ATOM 9583  C CB    . ALA P  3 59  ? 88.924  43.527   20.148  1.00 256.76 ? 72  ALA J CB    1 
ATOM 9584  N N     . LYS P  3 60  ? 92.249  44.878   20.611  1.00 283.05 ? 73  LYS J N     1 
ATOM 9585  C CA    . LYS P  3 60  ? 93.593  44.875   20.038  1.00 295.99 ? 73  LYS J CA    1 
ATOM 9586  C C     . LYS P  3 60  ? 93.442  44.955   18.514  1.00 305.94 ? 73  LYS J C     1 
ATOM 9587  O O     . LYS P  3 60  ? 94.289  44.442   17.785  1.00 302.08 ? 73  LYS J O     1 
ATOM 9588  C CB    . LYS P  3 60  ? 94.392  43.604   20.461  1.00 296.36 ? 73  LYS J CB    1 
ATOM 9589  C CG    . LYS P  3 60  ? 94.565  43.376   21.968  1.00 300.35 ? 73  LYS J CG    1 
ATOM 9590  C CD    . LYS P  3 60  ? 95.158  41.993   22.311  1.00 297.71 ? 73  LYS J CD    1 
ATOM 9591  C CE    . LYS P  3 60  ? 94.134  40.981   22.838  1.00 290.74 ? 73  LYS J CE    1 
ATOM 9592  N NZ    . LYS P  3 60  ? 93.823  41.166   24.281  1.00 289.11 ? 73  LYS J NZ    1 
ATOM 9593  N N     . ARG P  3 61  ? 92.364  45.591   18.036  1.00 328.17 ? 74  ARG J N     1 
ATOM 9594  C CA    . ARG P  3 61  ? 91.960  45.461   16.613  1.00 354.44 ? 74  ARG J CA    1 
ATOM 9595  C C     . ARG P  3 61  ? 91.427  46.750   15.938  1.00 369.78 ? 74  ARG J C     1 
ATOM 9596  O O     . ARG P  3 61  ? 91.160  47.737   16.630  1.00 379.57 ? 74  ARG J O     1 
ATOM 9597  C CB    . ARG P  3 61  ? 90.910  44.337   16.443  1.00 346.85 ? 74  ARG J CB    1 
ATOM 9598  C CG    . ARG P  3 61  ? 91.424  42.900   16.385  1.00 332.77 ? 74  ARG J CG    1 
ATOM 9599  C CD    . ARG P  3 61  ? 90.285  41.956   16.016  1.00 320.46 ? 74  ARG J CD    1 
ATOM 9600  N NE    . ARG P  3 61  ? 89.356  41.743   17.126  1.00 313.04 ? 74  ARG J NE    1 
ATOM 9601  C CZ    . ARG P  3 61  ? 88.118  42.235   17.207  1.00 309.69 ? 74  ARG J CZ    1 
ATOM 9602  N NH1   . ARG P  3 61  ? 87.631  42.983   16.240  1.00 312.32 ? 74  ARG J NH1   1 
ATOM 9603  N NH2   . ARG P  3 61  ? 87.352  41.973   18.263  1.00 304.25 ? 74  ARG J NH2   1 
ATOM 9604  N N     . THR P  3 62  ? 91.264  46.691   14.593  1.00 373.58 ? 75  THR J N     1 
ATOM 9605  C CA    . THR P  3 62  ? 90.621  47.736   13.705  1.00 361.41 ? 75  THR J CA    1 
ATOM 9606  C C     . THR P  3 62  ? 89.202  47.403   13.003  1.00 352.72 ? 75  THR J C     1 
ATOM 9607  O O     . THR P  3 62  ? 88.427  48.336   12.750  1.00 348.83 ? 75  THR J O     1 
ATOM 9608  C CB    . THR P  3 62  ? 91.663  48.427   12.714  1.00 361.11 ? 75  THR J CB    1 
ATOM 9609  O OG1   . THR P  3 62  ? 91.971  47.588   11.585  1.00 356.35 ? 75  THR J OG1   1 
ATOM 9610  C CG2   . THR P  3 62  ? 92.984  48.803   13.420  1.00 360.61 ? 75  THR J CG2   1 
ATOM 9611  N N     . THR P  3 63  ? 88.860  46.114   12.757  1.00 344.71 ? 76  THR J N     1 
ATOM 9612  C CA    . THR P  3 63  ? 87.623  45.668   12.000  1.00 339.02 ? 76  THR J CA    1 
ATOM 9613  C C     . THR P  3 63  ? 86.654  44.757   12.759  1.00 352.83 ? 76  THR J C     1 
ATOM 9614  O O     . THR P  3 63  ? 87.091  43.832   13.454  1.00 360.30 ? 76  THR J O     1 
ATOM 9615  C CB    . THR P  3 63  ? 87.949  44.876   10.706  1.00 323.25 ? 76  THR J CB    1 
ATOM 9616  O OG1   . THR P  3 63  ? 88.450  43.567   11.040  1.00 316.84 ? 76  THR J OG1   1 
ATOM 9617  C CG2   . THR P  3 63  ? 88.941  45.623   9.819   1.00 313.01 ? 76  THR J CG2   1 
ATOM 9618  N N     . ILE P  3 64  ? 85.346  44.984   12.564  1.00 363.52 ? 77  ILE J N     1 
ATOM 9619  C CA    . ILE P  3 64  ? 84.281  44.268   13.326  1.00 368.67 ? 77  ILE J CA    1 
ATOM 9620  C C     . ILE P  3 64  ? 84.170  42.740   13.081  1.00 379.30 ? 77  ILE J C     1 
ATOM 9621  O O     . ILE P  3 64  ? 84.130  42.291   11.917  1.00 384.88 ? 77  ILE J O     1 
ATOM 9622  C CB    . ILE P  3 64  ? 82.848  44.870   13.122  1.00 359.07 ? 77  ILE J CB    1 
ATOM 9623  C CG1   . ILE P  3 64  ? 82.862  46.396   12.981  1.00 356.92 ? 77  ILE J CG1   1 
ATOM 9624  C CG2   . ILE P  3 64  ? 81.913  44.465   14.271  1.00 357.58 ? 77  ILE J CG2   1 
ATOM 9625  C CD1   . ILE P  3 64  ? 81.542  46.988   12.523  1.00 355.68 ? 77  ILE J CD1   1 
ATOM 9626  N N     . ASN P  3 65  ? 84.097  41.967   14.186  1.00 382.92 ? 78  ASN J N     1 
ATOM 9627  C CA    . ASN P  3 65  ? 83.710  40.515   14.191  1.00 372.67 ? 78  ASN J CA    1 
ATOM 9628  C C     . ASN P  3 65  ? 82.379  40.170   14.915  1.00 353.89 ? 78  ASN J C     1 
ATOM 9629  O O     . ASN P  3 65  ? 81.682  41.056   15.423  1.00 355.36 ? 78  ASN J O     1 
ATOM 9630  C CB    . ASN P  3 65  ? 84.876  39.553   14.601  1.00 384.28 ? 78  ASN J CB    1 
ATOM 9631  C CG    . ASN P  3 65  ? 85.294  39.658   16.072  1.00 392.19 ? 78  ASN J CG    1 
ATOM 9632  O OD1   . ASN P  3 65  ? 84.488  39.887   16.948  1.00 394.45 ? 78  ASN J OD1   1 
ATOM 9633  N ND2   . ASN P  3 65  ? 86.575  39.439   16.334  1.00 397.22 ? 78  ASN J ND2   1 
ATOM 9634  N N     . THR P  3 66  ? 82.049  38.879   14.950  1.00 330.30 ? 79  THR J N     1 
ATOM 9635  C CA    . THR P  3 66  ? 80.772  38.388   15.500  1.00 306.82 ? 79  THR J CA    1 
ATOM 9636  C C     . THR P  3 66  ? 80.616  38.615   17.005  1.00 289.36 ? 79  THR J C     1 
ATOM 9637  O O     . THR P  3 66  ? 79.503  38.760   17.497  1.00 282.75 ? 79  THR J O     1 
ATOM 9638  C CB    . THR P  3 66  ? 80.540  36.880   15.210  1.00 310.71 ? 79  THR J CB    1 
ATOM 9639  O OG1   . THR P  3 66  ? 81.540  36.093   15.876  1.00 313.35 ? 79  THR J OG1   1 
ATOM 9640  C CG2   . THR P  3 66  ? 80.561  36.589   13.700  1.00 317.14 ? 79  THR J CG2   1 
ATOM 9641  N N     . GLU P  3 67  ? 81.735  38.642   17.722  1.00 276.62 ? 80  GLU J N     1 
ATOM 9642  C CA    . GLU P  3 67  ? 81.724  38.758   19.178  1.00 269.44 ? 80  GLU J CA    1 
ATOM 9643  C C     . GLU P  3 67  ? 81.386  40.172   19.673  1.00 265.92 ? 80  GLU J C     1 
ATOM 9644  O O     . GLU P  3 67  ? 80.701  40.306   20.695  1.00 261.12 ? 80  GLU J O     1 
ATOM 9645  C CB    . GLU P  3 67  ? 83.052  38.262   19.767  1.00 271.54 ? 80  GLU J CB    1 
ATOM 9646  C CG    . GLU P  3 67  ? 83.492  36.889   19.267  1.00 273.08 ? 80  GLU J CG    1 
ATOM 9647  C CD    . GLU P  3 67  ? 82.396  35.847   19.358  1.00 272.63 ? 80  GLU J CD    1 
ATOM 9648  O OE1   . GLU P  3 67  ? 82.261  35.055   18.403  1.00 272.83 ? 80  GLU J OE1   1 
ATOM 9649  O OE2   . GLU P  3 67  ? 81.670  35.818   20.371  1.00 272.98 ? 80  GLU J OE2   1 
ATOM 9650  N N     . ASP P  3 68  ? 81.871  41.203   18.957  1.00 266.96 ? 81  ASP J N     1 
ATOM 9651  C CA    . ASP P  3 68  ? 81.571  42.624   19.237  1.00 269.08 ? 81  ASP J CA    1 
ATOM 9652  C C     . ASP P  3 68  ? 80.066  42.885   19.111  1.00 274.23 ? 81  ASP J C     1 
ATOM 9653  O O     . ASP P  3 68  ? 79.459  43.521   19.981  1.00 269.27 ? 81  ASP J O     1 
ATOM 9654  C CB    . ASP P  3 68  ? 82.363  43.569   18.302  1.00 262.77 ? 81  ASP J CB    1 
ATOM 9655  C CG    . ASP P  3 68  ? 83.865  43.629   18.628  1.00 259.90 ? 81  ASP J CG    1 
ATOM 9656  O OD1   . ASP P  3 68  ? 84.288  43.446   19.790  1.00 257.96 ? 81  ASP J OD1   1 
ATOM 9657  O OD2   . ASP P  3 68  ? 84.647  43.877   17.701  1.00 256.90 ? 81  ASP J OD2   1 
ATOM 9658  N N     . VAL P  3 69  ? 79.485  42.363   18.026  1.00 287.54 ? 82  VAL J N     1 
ATOM 9659  C CA    . VAL P  3 69  ? 78.040  42.434   17.736  1.00 299.89 ? 82  VAL J CA    1 
ATOM 9660  C C     . VAL P  3 69  ? 77.219  41.765   18.860  1.00 302.69 ? 82  VAL J C     1 
ATOM 9661  O O     . VAL P  3 69  ? 76.278  42.365   19.396  1.00 313.35 ? 82  VAL J O     1 
ATOM 9662  C CB    . VAL P  3 69  ? 77.679  41.802   16.344  1.00 303.34 ? 82  VAL J CB    1 
ATOM 9663  C CG1   . VAL P  3 69  ? 76.171  41.835   16.085  1.00 303.39 ? 82  VAL J CG1   1 
ATOM 9664  C CG2   . VAL P  3 69  ? 78.436  42.473   15.195  1.00 305.19 ? 82  VAL J CG2   1 
ATOM 9665  N N     . LYS P  3 70  ? 77.589  40.534   19.224  1.00 295.27 ? 83  LYS J N     1 
ATOM 9666  C CA    . LYS P  3 70  ? 76.850  39.773   20.241  1.00 283.36 ? 83  LYS J CA    1 
ATOM 9667  C C     . LYS P  3 70  ? 77.033  40.333   21.657  1.00 278.67 ? 83  LYS J C     1 
ATOM 9668  O O     . LYS P  3 70  ? 76.189  40.109   22.523  1.00 281.45 ? 83  LYS J O     1 
ATOM 9669  C CB    . LYS P  3 70  ? 77.097  38.253   20.116  1.00 276.38 ? 83  LYS J CB    1 
ATOM 9670  C CG    . LYS P  3 70  ? 76.536  37.693   18.804  1.00 267.79 ? 83  LYS J CG    1 
ATOM 9671  C CD    . LYS P  3 70  ? 76.186  36.220   18.837  1.00 258.37 ? 83  LYS J CD    1 
ATOM 9672  C CE    . LYS P  3 70  ? 77.322  35.357   18.315  1.00 253.78 ? 83  LYS J CE    1 
ATOM 9673  N NZ    . LYS P  3 70  ? 77.205  33.987   18.863  1.00 248.76 ? 83  LYS J NZ    1 
ATOM 9674  N N     . LEU P  3 71  ? 78.088  41.130   21.848  1.00 268.87 ? 84  LEU J N     1 
ATOM 9675  C CA    . LEU P  3 71  ? 78.244  41.953   23.046  1.00 259.75 ? 84  LEU J CA    1 
ATOM 9676  C C     . LEU P  3 71  ? 77.205  43.042   23.103  1.00 256.50 ? 84  LEU J C     1 
ATOM 9677  O O     . LEU P  3 71  ? 76.652  43.306   24.152  1.00 255.35 ? 84  LEU J O     1 
ATOM 9678  C CB    . LEU P  3 71  ? 79.591  42.653   23.069  1.00 257.75 ? 84  LEU J CB    1 
ATOM 9679  C CG    . LEU P  3 71  ? 80.152  42.684   24.485  1.00 258.70 ? 84  LEU J CG    1 
ATOM 9680  C CD1   . LEU P  3 71  ? 81.380  41.786   24.499  1.00 264.03 ? 84  LEU J CD1   1 
ATOM 9681  C CD2   . LEU P  3 71  ? 80.489  44.089   24.970  1.00 259.29 ? 84  LEU J CD2   1 
ATOM 9682  N N     . LEU P  3 72  ? 76.977  43.682   21.965  1.00 255.25 ? 85  LEU J N     1 
ATOM 9683  C CA    . LEU P  3 72  ? 76.161  44.891   21.863  1.00 255.33 ? 85  LEU J CA    1 
ATOM 9684  C C     . LEU P  3 72  ? 74.651  44.767   22.244  1.00 261.20 ? 85  LEU J C     1 
ATOM 9685  O O     . LEU P  3 72  ? 74.072  45.740   22.715  1.00 261.61 ? 85  LEU J O     1 
ATOM 9686  C CB    . LEU P  3 72  ? 76.354  45.492   20.463  1.00 246.99 ? 85  LEU J CB    1 
ATOM 9687  C CG    . LEU P  3 72  ? 75.844  46.875   20.076  1.00 240.61 ? 85  LEU J CG    1 
ATOM 9688  C CD1   . LEU P  3 72  ? 76.627  47.983   20.756  1.00 238.04 ? 85  LEU J CD1   1 
ATOM 9689  C CD2   . LEU P  3 72  ? 75.947  47.025   18.569  1.00 236.03 ? 85  LEU J CD2   1 
ATOM 9690  N N     . ALA P  3 73  ? 74.007  43.610   22.058  1.00 267.50 ? 86  ALA J N     1 
ATOM 9691  C CA    . ALA P  3 73  ? 72.591  43.467   22.492  1.00 266.52 ? 86  ALA J CA    1 
ATOM 9692  C C     . ALA P  3 73  ? 72.417  42.414   23.606  1.00 265.64 ? 86  ALA J C     1 
ATOM 9693  O O     . ALA P  3 73  ? 71.610  41.480   23.502  1.00 262.87 ? 86  ALA J O     1 
ATOM 9694  C CB    . ALA P  3 73  ? 71.654  43.207   21.308  1.00 267.60 ? 86  ALA J CB    1 
ATOM 9695  N N     . ARG P  3 74  ? 73.191  42.592   24.680  1.00 264.47 ? 87  ARG J N     1 
ATOM 9696  C CA    . ARG P  3 74  ? 73.248  41.666   25.847  1.00 261.95 ? 87  ARG J CA    1 
ATOM 9697  C C     . ARG P  3 74  ? 72.065  41.829   26.797  1.00 261.16 ? 87  ARG J C     1 
ATOM 9698  O O     . ARG P  3 74  ? 71.906  41.058   27.754  1.00 264.26 ? 87  ARG J O     1 
ATOM 9699  C CB    . ARG P  3 74  ? 74.534  41.932   26.651  1.00 258.16 ? 87  ARG J CB    1 
ATOM 9700  C CG    . ARG P  3 74  ? 74.538  43.285   27.374  1.00 247.80 ? 87  ARG J CG    1 
ATOM 9701  C CD    . ARG P  3 74  ? 75.914  43.962   27.446  1.00 238.46 ? 87  ARG J CD    1 
ATOM 9702  N NE    . ARG P  3 74  ? 76.217  44.943   26.384  1.00 231.64 ? 87  ARG J NE    1 
ATOM 9703  C CZ    . ARG P  3 74  ? 75.937  46.250   26.415  1.00 230.59 ? 87  ARG J CZ    1 
ATOM 9704  N NH1   . ARG P  3 74  ? 75.321  46.793   27.461  1.00 230.46 ? 87  ARG J NH1   1 
ATOM 9705  N NH2   . ARG P  3 74  ? 76.271  47.020   25.383  1.00 230.84 ? 87  ARG J NH2   1 
ATOM 9706  N N     . ARG P  3 75  ? 71.252  42.841   26.511  1.00 255.75 ? 88  ARG J N     1 
ATOM 9707  C CA    . ARG P  3 75  ? 70.364  43.456   27.492  1.00 253.45 ? 88  ARG J CA    1 
ATOM 9708  C C     . ARG P  3 75  ? 69.021  42.763   27.647  1.00 263.46 ? 88  ARG J C     1 
ATOM 9709  O O     . ARG P  3 75  ? 68.623  42.507   28.772  1.00 275.50 ? 88  ARG J O     1 
ATOM 9710  C CB    . ARG P  3 75  ? 70.164  44.932   27.168  1.00 237.69 ? 88  ARG J CB    1 
ATOM 9711  C CG    . ARG P  3 75  ? 71.461  45.679   26.938  1.00 229.40 ? 88  ARG J CG    1 
ATOM 9712  C CD    . ARG P  3 75  ? 71.307  46.599   25.749  1.00 226.25 ? 88  ARG J CD    1 
ATOM 9713  N NE    . ARG P  3 75  ? 72.353  47.609   25.696  1.00 228.40 ? 88  ARG J NE    1 
ATOM 9714  C CZ    . ARG P  3 75  ? 72.426  48.662   26.506  1.00 230.74 ? 88  ARG J CZ    1 
ATOM 9715  N NH1   . ARG P  3 75  ? 71.529  48.855   27.471  1.00 229.62 ? 88  ARG J NH1   1 
ATOM 9716  N NH2   . ARG P  3 75  ? 73.405  49.529   26.348  1.00 234.88 ? 88  ARG J NH2   1 
ATOM 9717  N N     . SER P  3 76  ? 68.322  42.471   26.540  1.00 267.54 ? 89  SER J N     1 
ATOM 9718  C CA    . SER P  3 76  ? 67.102  41.621   26.570  1.00 270.43 ? 89  SER J CA    1 
ATOM 9719  C C     . SER P  3 76  ? 67.416  40.169   26.173  1.00 278.33 ? 89  SER J C     1 
ATOM 9720  O O     . SER P  3 76  ? 68.097  39.907   25.176  1.00 271.68 ? 89  SER J O     1 
ATOM 9721  C CB    . SER P  3 76  ? 65.925  42.217   25.764  1.00 264.02 ? 89  SER J CB    1 
ATOM 9722  O OG    . SER P  3 76  ? 65.720  41.621   24.493  1.00 255.73 ? 89  SER J OG    1 
ATOM 9723  N N     . ASN P  3 77  ? 66.933  39.230   26.983  1.00 295.17 ? 90  ASN J N     1 
ATOM 9724  C CA    . ASN P  3 77  ? 67.406  37.846   26.898  1.00 307.19 ? 90  ASN J CA    1 
ATOM 9725  C C     . ASN P  3 77  ? 66.694  36.999   25.795  1.00 301.38 ? 90  ASN J C     1 
ATOM 9726  O O     . ASN P  3 77  ? 67.284  36.051   25.271  1.00 306.81 ? 90  ASN J O     1 
ATOM 9727  C CB    . ASN P  3 77  ? 67.470  37.152   28.301  1.00 319.14 ? 90  ASN J CB    1 
ATOM 9728  C CG    . ASN P  3 77  ? 67.995  38.070   29.431  1.00 317.97 ? 90  ASN J CG    1 
ATOM 9729  O OD1   . ASN P  3 77  ? 67.236  38.840   30.014  1.00 311.30 ? 90  ASN J OD1   1 
ATOM 9730  N ND2   . ASN P  3 77  ? 69.277  37.935   29.776  1.00 320.93 ? 90  ASN J ND2   1 
ATOM 9731  N N     . SER P  3 78  ? 65.454  37.374   25.429  1.00 283.91 ? 91  SER J N     1 
ATOM 9732  C CA    . SER P  3 78  ? 64.736  36.822   24.243  1.00 265.40 ? 91  SER J CA    1 
ATOM 9733  C C     . SER P  3 78  ? 65.545  37.067   22.979  1.00 259.68 ? 91  SER J C     1 
ATOM 9734  O O     . SER P  3 78  ? 65.597  36.235   22.063  1.00 251.06 ? 91  SER J O     1 
ATOM 9735  C CB    . SER P  3 78  ? 63.348  37.476   24.079  1.00 256.81 ? 91  SER J CB    1 
ATOM 9736  O OG    . SER P  3 78  ? 63.428  38.827   23.631  1.00 241.95 ? 91  SER J OG    1 
ATOM 9737  N N     . LEU P  3 79  ? 66.181  38.231   22.968  1.00 262.87 ? 92  LEU J N     1 
ATOM 9738  C CA    . LEU P  3 79  ? 67.060  38.690   21.913  1.00 276.81 ? 92  LEU J CA    1 
ATOM 9739  C C     . LEU P  3 79  ? 68.402  37.894   21.814  1.00 274.29 ? 92  LEU J C     1 
ATOM 9740  O O     . LEU P  3 79  ? 68.812  37.474   20.717  1.00 281.40 ? 92  LEU J O     1 
ATOM 9741  C CB    . LEU P  3 79  ? 67.303  40.172   22.180  1.00 293.11 ? 92  LEU J CB    1 
ATOM 9742  C CG    . LEU P  3 79  ? 67.466  41.197   21.077  1.00 311.40 ? 92  LEU J CG    1 
ATOM 9743  C CD1   . LEU P  3 79  ? 67.648  42.547   21.742  1.00 314.54 ? 92  LEU J CD1   1 
ATOM 9744  C CD2   . LEU P  3 79  ? 68.669  40.874   20.207  1.00 319.52 ? 92  LEU J CD2   1 
ATOM 9745  N N     . LEU P  3 80  ? 69.080  37.715   22.952  1.00 263.95 ? 93  LEU J N     1 
ATOM 9746  C CA    . LEU P  3 80  ? 70.324  36.939   23.062  1.00 255.35 ? 93  LEU J CA    1 
ATOM 9747  C C     . LEU P  3 80  ? 70.238  35.536   22.417  1.00 256.94 ? 93  LEU J C     1 
ATOM 9748  O O     . LEU P  3 80  ? 71.091  35.172   21.573  1.00 259.64 ? 93  LEU J O     1 
ATOM 9749  C CB    . LEU P  3 80  ? 70.722  36.869   24.550  1.00 247.81 ? 93  LEU J CB    1 
ATOM 9750  C CG    . LEU P  3 80  ? 71.371  35.648   25.199  1.00 246.36 ? 93  LEU J CG    1 
ATOM 9751  C CD1   . LEU P  3 80  ? 72.852  35.690   24.880  1.00 243.51 ? 93  LEU J CD1   1 
ATOM 9752  C CD2   . LEU P  3 80  ? 71.135  35.605   26.708  1.00 247.79 ? 93  LEU J CD2   1 
ATOM 9753  N N     . LYS P  3 81  ? 69.209  34.769   22.810  1.00 254.88 ? 94  LYS J N     1 
ATOM 9754  C CA    . LYS P  3 81  ? 68.981  33.422   22.265  1.00 254.60 ? 94  LYS J CA    1 
ATOM 9755  C C     . LYS P  3 81  ? 68.713  33.514   20.767  1.00 262.31 ? 94  LYS J C     1 
ATOM 9756  O O     . LYS P  3 81  ? 69.364  32.826   19.997  1.00 267.37 ? 94  LYS J O     1 
ATOM 9757  C CB    . LYS P  3 81  ? 67.850  32.646   22.970  1.00 247.14 ? 94  LYS J CB    1 
ATOM 9758  C CG    . LYS P  3 81  ? 68.064  31.126   22.931  1.00 243.99 ? 94  LYS J CG    1 
ATOM 9759  C CD    . LYS P  3 81  ? 66.807  30.319   22.643  1.00 245.57 ? 94  LYS J CD    1 
ATOM 9760  C CE    . LYS P  3 81  ? 66.988  28.816   22.929  1.00 247.72 ? 94  LYS J CE    1 
ATOM 9761  N NZ    . LYS P  3 81  ? 68.189  28.196   22.287  1.00 248.31 ? 94  LYS J NZ    1 
ATOM 9762  N N     . TYR P  3 82  ? 67.765  34.368   20.377  1.00 268.95 ? 95  TYR J N     1 
ATOM 9763  C CA    . TYR P  3 82  ? 67.391  34.656   18.978  1.00 275.98 ? 95  TYR J CA    1 
ATOM 9764  C C     . TYR P  3 82  ? 68.595  34.801   18.050  1.00 274.98 ? 95  TYR J C     1 
ATOM 9765  O O     . TYR P  3 82  ? 68.681  34.186   16.975  1.00 278.82 ? 95  TYR J O     1 
ATOM 9766  C CB    . TYR P  3 82  ? 66.648  35.991   18.994  1.00 279.53 ? 95  TYR J CB    1 
ATOM 9767  C CG    . TYR P  3 82  ? 66.011  36.449   17.715  1.00 287.53 ? 95  TYR J CG    1 
ATOM 9768  C CD1   . TYR P  3 82  ? 66.750  36.584   16.537  1.00 293.34 ? 95  TYR J CD1   1 
ATOM 9769  C CD2   . TYR P  3 82  ? 64.659  36.799   17.695  1.00 288.70 ? 95  TYR J CD2   1 
ATOM 9770  C CE1   . TYR P  3 82  ? 66.153  37.020   15.366  1.00 300.64 ? 95  TYR J CE1   1 
ATOM 9771  C CE2   . TYR P  3 82  ? 64.053  37.234   16.529  1.00 297.88 ? 95  TYR J CE2   1 
ATOM 9772  C CZ    . TYR P  3 82  ? 64.794  37.349   15.367  1.00 302.65 ? 95  TYR J CZ    1 
ATOM 9773  O OH    . TYR P  3 82  ? 64.182  37.780   14.200  1.00 307.33 ? 95  TYR J OH    1 
ATOM 9774  N N     . ILE P  3 83  ? 69.522  35.636   18.487  1.00 268.41 ? 96  ILE J N     1 
ATOM 9775  C CA    . ILE P  3 83  ? 70.665  35.986   17.688  1.00 258.03 ? 96  ILE J CA    1 
ATOM 9776  C C     . ILE P  3 83  ? 71.753  34.913   17.626  1.00 264.43 ? 96  ILE J C     1 
ATOM 9777  O O     . ILE P  3 83  ? 72.290  34.696   16.536  1.00 269.95 ? 96  ILE J O     1 
ATOM 9778  C CB    . ILE P  3 83  ? 71.186  37.381   18.065  1.00 246.19 ? 96  ILE J CB    1 
ATOM 9779  C CG1   . ILE P  3 83  ? 70.290  38.437   17.395  1.00 237.74 ? 96  ILE J CG1   1 
ATOM 9780  C CG2   . ILE P  3 83  ? 72.659  37.558   17.703  1.00 241.64 ? 96  ILE J CG2   1 
ATOM 9781  C CD1   . ILE P  3 83  ? 70.127  38.285   15.892  1.00 232.40 ? 96  ILE J CD1   1 
ATOM 9782  N N     . THR P  3 84  ? 72.071  34.240   18.747  1.00 265.90 ? 97  THR J N     1 
ATOM 9783  C CA    . THR P  3 84  ? 73.019  33.085   18.704  1.00 268.36 ? 97  THR J CA    1 
ATOM 9784  C C     . THR P  3 84  ? 72.574  32.014   17.657  1.00 283.53 ? 97  THR J C     1 
ATOM 9785  O O     . THR P  3 84  ? 73.407  31.458   16.924  1.00 284.51 ? 97  THR J O     1 
ATOM 9786  C CB    . THR P  3 84  ? 73.355  32.454   20.100  1.00 259.35 ? 97  THR J CB    1 
ATOM 9787  O OG1   . THR P  3 84  ? 72.176  31.941   20.729  1.00 253.14 ? 97  THR J OG1   1 
ATOM 9788  C CG2   . THR P  3 84  ? 73.993  33.456   21.021  1.00 253.86 ? 97  THR J CG2   1 
ATOM 9789  N N     . ASP P  3 85  ? 71.257  31.793   17.556  1.00 303.25 ? 98  ASP J N     1 
ATOM 9790  C CA    . ASP P  3 85  ? 70.626  30.814   16.625  1.00 319.65 ? 98  ASP J CA    1 
ATOM 9791  C C     . ASP P  3 85  ? 70.775  31.173   15.151  1.00 308.86 ? 98  ASP J C     1 
ATOM 9792  O O     . ASP P  3 85  ? 71.247  30.371   14.326  1.00 304.75 ? 98  ASP J O     1 
ATOM 9793  C CB    . ASP P  3 85  ? 69.122  30.679   16.945  1.00 346.64 ? 98  ASP J CB    1 
ATOM 9794  C CG    . ASP P  3 85  ? 68.841  30.274   18.414  1.00 367.71 ? 98  ASP J CG    1 
ATOM 9795  O OD1   . ASP P  3 85  ? 69.791  29.882   19.146  1.00 380.74 ? 98  ASP J OD1   1 
ATOM 9796  O OD2   . ASP P  3 85  ? 67.655  30.352   18.831  1.00 380.81 ? 98  ASP J OD2   1 
ATOM 9797  N N     . LYS P  3 86  ? 70.321  32.385   14.852  1.00 299.30 ? 99  LYS J N     1 
ATOM 9798  C CA    . LYS P  3 86  ? 70.580  33.068   13.602  1.00 296.87 ? 99  LYS J CA    1 
ATOM 9799  C C     . LYS P  3 86  ? 72.065  33.047   13.177  1.00 308.24 ? 99  LYS J C     1 
ATOM 9800  O O     . LYS P  3 86  ? 72.366  33.062   11.976  1.00 312.64 ? 99  LYS J O     1 
ATOM 9801  C CB    . LYS P  3 86  ? 70.073  34.511   13.717  1.00 285.90 ? 99  LYS J CB    1 
ATOM 9802  C CG    . LYS P  3 86  ? 68.813  34.818   12.913  1.00 277.87 ? 99  LYS J CG    1 
ATOM 9803  C CD    . LYS P  3 86  ? 67.548  34.128   13.408  1.00 276.99 ? 99  LYS J CD    1 
ATOM 9804  C CE    . LYS P  3 86  ? 66.312  34.584   12.638  1.00 274.58 ? 99  LYS J CE    1 
ATOM 9805  N NZ    . LYS P  3 86  ? 66.294  34.325   11.171  1.00 270.26 ? 99  LYS J NZ    1 
ATOM 9806  N N     . SER P  3 87  ? 72.980  33.022   14.152  1.00 319.64 ? 100 SER J N     1 
ATOM 9807  C CA    . SER P  3 87  ? 74.415  33.038   13.854  1.00 324.83 ? 100 SER J CA    1 
ATOM 9808  C C     . SER P  3 87  ? 74.896  31.682   13.344  1.00 325.36 ? 100 SER J C     1 
ATOM 9809  O O     . SER P  3 87  ? 75.825  31.620   12.539  1.00 324.55 ? 100 SER J O     1 
ATOM 9810  C CB    . SER P  3 87  ? 75.260  33.514   15.047  1.00 326.22 ? 100 SER J CB    1 
ATOM 9811  O OG    . SER P  3 87  ? 75.493  32.461   15.965  1.00 322.70 ? 100 SER J OG    1 
ATOM 9812  N N     . GLU P  3 88  ? 74.272  30.593   13.786  1.00 325.55 ? 101 GLU J N     1 
ATOM 9813  C CA    . GLU P  3 88  ? 74.596  29.294   13.188  1.00 329.97 ? 101 GLU J CA    1 
ATOM 9814  C C     . GLU P  3 88  ? 74.076  29.128   11.745  1.00 337.01 ? 101 GLU J C     1 
ATOM 9815  O O     . GLU P  3 88  ? 74.678  28.389   10.949  1.00 335.76 ? 101 GLU J O     1 
ATOM 9816  C CB    . GLU P  3 88  ? 74.136  28.147   14.068  1.00 334.43 ? 101 GLU J CB    1 
ATOM 9817  C CG    . GLU P  3 88  ? 75.230  27.568   14.930  1.00 344.09 ? 101 GLU J CG    1 
ATOM 9818  C CD    . GLU P  3 88  ? 74.681  27.049   16.238  1.00 359.29 ? 101 GLU J CD    1 
ATOM 9819  O OE1   . GLU P  3 88  ? 73.900  26.073   16.222  1.00 368.38 ? 101 GLU J OE1   1 
ATOM 9820  O OE2   . GLU P  3 88  ? 75.015  27.621   17.296  1.00 368.91 ? 101 GLU J OE2   1 
ATOM 9821  N N     . GLU P  3 89  ? 72.981  29.820   11.411  1.00 347.11 ? 102 GLU J N     1 
ATOM 9822  C CA    . GLU P  3 89  ? 72.459  29.881   10.038  1.00 357.72 ? 102 GLU J CA    1 
ATOM 9823  C C     . GLU P  3 89  ? 73.425  30.613   9.069   1.00 352.22 ? 102 GLU J C     1 
ATOM 9824  O O     . GLU P  3 89  ? 73.770  30.099   8.004   1.00 360.45 ? 102 GLU J O     1 
ATOM 9825  C CB    . GLU P  3 89  ? 71.075  30.542   10.062  1.00 366.50 ? 102 GLU J CB    1 
ATOM 9826  C CG    . GLU P  3 89  ? 70.616  31.182   8.751   1.00 381.88 ? 102 GLU J CG    1 
ATOM 9827  C CD    . GLU P  3 89  ? 69.683  32.374   8.956   1.00 388.48 ? 102 GLU J CD    1 
ATOM 9828  O OE1   . GLU P  3 89  ? 69.789  33.328   8.152   1.00 400.95 ? 102 GLU J OE1   1 
ATOM 9829  O OE2   . GLU P  3 89  ? 68.855  32.343   9.895   1.00 383.54 ? 102 GLU J OE2   1 
ATOM 9830  N N     . ILE P  3 90  ? 73.858  31.812   9.456   1.00 332.62 ? 103 ILE J N     1 
ATOM 9831  C CA    . ILE P  3 90  ? 74.807  32.609   8.675   1.00 304.69 ? 103 ILE J CA    1 
ATOM 9832  C C     . ILE P  3 90  ? 76.206  31.916   8.603   1.00 308.50 ? 103 ILE J C     1 
ATOM 9833  O O     . ILE P  3 90  ? 76.932  32.068   7.609   1.00 308.26 ? 103 ILE J O     1 
ATOM 9834  C CB    . ILE P  3 90  ? 74.796  34.079   9.188   1.00 281.73 ? 103 ILE J CB    1 
ATOM 9835  C CG1   . ILE P  3 90  ? 73.377  34.652   9.046   1.00 267.23 ? 103 ILE J CG1   1 
ATOM 9836  C CG2   . ILE P  3 90  ? 75.771  34.956   8.429   1.00 272.96 ? 103 ILE J CG2   1 
ATOM 9837  C CD1   . ILE P  3 90  ? 73.058  35.789   9.992   1.00 252.36 ? 103 ILE J CD1   1 
ATOM 9838  N N     . ALA P  3 91  ? 76.539  31.106   9.622   1.00 308.79 ? 104 ALA J N     1 
ATOM 9839  C CA    . ALA P  3 91  ? 77.810  30.324   9.712   1.00 304.98 ? 104 ALA J CA    1 
ATOM 9840  C C     . ALA P  3 91  ? 77.959  29.156   8.723   1.00 302.67 ? 104 ALA J C     1 
ATOM 9841  O O     . ALA P  3 91  ? 79.057  28.608   8.567   1.00 304.65 ? 104 ALA J O     1 
ATOM 9842  C CB    . ALA P  3 91  ? 78.066  29.841   11.144  1.00 306.29 ? 104 ALA J CB    1 
ATOM 9843  N N     . GLN P  3 92  ? 76.865  28.774   8.069   1.00 296.97 ? 105 GLN J N     1 
ATOM 9844  C CA    . GLN P  3 92  ? 76.929  27.878   6.911   1.00 291.63 ? 105 GLN J CA    1 
ATOM 9845  C C     . GLN P  3 92  ? 77.971  28.295   5.868   1.00 290.53 ? 105 GLN J C     1 
ATOM 9846  O O     . GLN P  3 92  ? 78.524  27.440   5.175   1.00 289.84 ? 105 GLN J O     1 
ATOM 9847  C CB    . GLN P  3 92  ? 75.559  27.772   6.248   1.00 292.06 ? 105 GLN J CB    1 
ATOM 9848  C CG    . GLN P  3 92  ? 74.754  26.605   6.768   1.00 292.98 ? 105 GLN J CG    1 
ATOM 9849  C CD    . GLN P  3 92  ? 73.264  26.834   6.659   1.00 297.43 ? 105 GLN J CD    1 
ATOM 9850  O OE1   . GLN P  3 92  ? 72.564  26.886   7.669   1.00 300.08 ? 105 GLN J OE1   1 
ATOM 9851  N NE2   . GLN P  3 92  ? 72.769  26.982   5.433   1.00 298.78 ? 105 GLN J NE2   1 
ATOM 9852  N N     . ALA P  3 93  ? 78.214  29.605   5.754   1.00 288.76 ? 106 ALA J N     1 
ATOM 9853  C CA    . ALA P  3 93  ? 79.228  30.158   4.847   1.00 285.62 ? 106 ALA J CA    1 
ATOM 9854  C C     . ALA P  3 93  ? 80.610  30.162   5.497   1.00 282.93 ? 106 ALA J C     1 
ATOM 9855  O O     . ALA P  3 93  ? 81.287  29.135   5.541   1.00 284.40 ? 106 ALA J O     1 
ATOM 9856  C CB    . ALA P  3 93  ? 78.842  31.568   4.404   1.00 285.04 ? 106 ALA J CB    1 
ATOM 9857  N N     . SER Q  3 1   ? 90.352  11.725   54.214  1.00 420.95 ? 14  SER K N     1 
ATOM 9858  C CA    . SER Q  3 1   ? 91.829  11.591   54.199  1.00 419.42 ? 14  SER K CA    1 
ATOM 9859  C C     . SER Q  3 1   ? 92.469  12.500   53.133  1.00 423.25 ? 14  SER K C     1 
ATOM 9860  O O     . SER Q  3 1   ? 91.782  13.085   52.275  1.00 433.47 ? 14  SER K O     1 
ATOM 9861  C CB    . SER Q  3 1   ? 92.228  10.120   54.006  1.00 413.45 ? 14  SER K CB    1 
ATOM 9862  O OG    . SER Q  3 1   ? 93.610  9.936    54.252  1.00 410.30 ? 14  SER K OG    1 
ATOM 9863  N N     . TYR Q  3 2   ? 93.789  12.628   53.204  1.00 419.68 ? 15  TYR K N     1 
ATOM 9864  C CA    . TYR Q  3 2   ? 94.536  13.435   52.247  1.00 423.43 ? 15  TYR K CA    1 
ATOM 9865  C C     . TYR Q  3 2   ? 94.300  13.006   50.782  1.00 438.70 ? 15  TYR K C     1 
ATOM 9866  O O     . TYR Q  3 2   ? 94.119  13.865   49.928  1.00 436.60 ? 15  TYR K O     1 
ATOM 9867  C CB    . TYR Q  3 2   ? 96.014  13.416   52.600  1.00 415.23 ? 15  TYR K CB    1 
ATOM 9868  C CG    . TYR Q  3 2   ? 96.773  14.593   52.085  1.00 418.81 ? 15  TYR K CG    1 
ATOM 9869  C CD1   . TYR Q  3 2   ? 96.820  15.780   52.812  1.00 422.54 ? 15  TYR K CD1   1 
ATOM 9870  C CD2   . TYR Q  3 2   ? 97.475  14.519   50.891  1.00 423.23 ? 15  TYR K CD2   1 
ATOM 9871  C CE1   . TYR Q  3 2   ? 97.542  16.874   52.345  1.00 431.19 ? 15  TYR K CE1   1 
ATOM 9872  C CE2   . TYR Q  3 2   ? 98.200  15.599   50.415  1.00 431.22 ? 15  TYR K CE2   1 
ATOM 9873  C CZ    . TYR Q  3 2   ? 98.233  16.776   51.139  1.00 433.27 ? 15  TYR K CZ    1 
ATOM 9874  O OH    . TYR Q  3 2   ? 98.965  17.838   50.645  1.00 433.61 ? 15  TYR K OH    1 
ATOM 9875  N N     . GLN Q  3 3   ? 94.278  11.689   50.520  1.00 462.42 ? 16  GLN K N     1 
ATOM 9876  C CA    . GLN Q  3 3   ? 93.953  11.081   49.195  1.00 479.16 ? 16  GLN K CA    1 
ATOM 9877  C C     . GLN Q  3 3   ? 92.630  11.523   48.527  1.00 481.80 ? 16  GLN K C     1 
ATOM 9878  O O     . GLN Q  3 3   ? 92.605  11.855   47.327  1.00 481.37 ? 16  GLN K O     1 
ATOM 9879  C CB    . GLN Q  3 3   ? 93.950  9.535    49.287  1.00 485.39 ? 16  GLN K CB    1 
ATOM 9880  C CG    . GLN Q  3 3   ? 95.054  8.795    48.500  1.00 481.46 ? 16  GLN K CG    1 
ATOM 9881  C CD    . GLN Q  3 3   ? 94.785  7.300    48.286  1.00 474.61 ? 16  GLN K CD    1 
ATOM 9882  O OE1   . GLN Q  3 3   ? 93.753  6.776    48.704  1.00 472.27 ? 16  GLN K OE1   1 
ATOM 9883  N NE2   . GLN Q  3 3   ? 95.742  6.604    47.675  1.00 469.53 ? 16  GLN K NE2   1 
ATOM 9884  N N     . GLN Q  3 4   ? 91.527  11.486   49.279  1.00 478.32 ? 17  GLN K N     1 
ATOM 9885  C CA    . GLN Q  3 4   ? 90.199  11.787   48.696  1.00 458.88 ? 17  GLN K CA    1 
ATOM 9886  C C     . GLN Q  3 4   ? 90.018  13.286   48.434  1.00 451.39 ? 17  GLN K C     1 
ATOM 9887  O O     . GLN Q  3 4   ? 89.193  13.686   47.604  1.00 443.79 ? 17  GLN K O     1 
ATOM 9888  C CB    . GLN Q  3 4   ? 89.023  11.234   49.534  1.00 452.00 ? 17  GLN K CB    1 
ATOM 9889  C CG    . GLN Q  3 4   ? 88.830  9.717    49.545  1.00 440.28 ? 17  GLN K CG    1 
ATOM 9890  C CD    . GLN Q  3 4   ? 89.362  9.043    50.815  1.00 437.93 ? 17  GLN K CD    1 
ATOM 9891  O OE1   . GLN Q  3 4   ? 89.286  9.585    51.938  1.00 435.15 ? 17  GLN K OE1   1 
ATOM 9892  N NE2   . GLN Q  3 4   ? 89.892  7.841    50.643  1.00 435.34 ? 17  GLN K NE2   1 
ATOM 9893  N N     . ARG Q  3 5   ? 90.798  14.103   49.146  1.00 442.21 ? 18  ARG K N     1 
ATOM 9894  C CA    . ARG Q  3 5   ? 90.852  15.541   48.906  1.00 422.73 ? 18  ARG K CA    1 
ATOM 9895  C C     . ARG Q  3 5   ? 91.546  15.857   47.563  1.00 407.83 ? 18  ARG K C     1 
ATOM 9896  O O     . ARG Q  3 5   ? 91.117  16.759   46.839  1.00 399.30 ? 18  ARG K O     1 
ATOM 9897  C CB    . ARG Q  3 5   ? 91.536  16.241   50.087  1.00 422.14 ? 18  ARG K CB    1 
ATOM 9898  C CG    . ARG Q  3 5   ? 91.025  17.635   50.375  1.00 418.86 ? 18  ARG K CG    1 
ATOM 9899  C CD    . ARG Q  3 5   ? 92.098  18.482   51.052  1.00 416.35 ? 18  ARG K CD    1 
ATOM 9900  N NE    . ARG Q  3 5   ? 93.405  18.338   50.391  1.00 416.91 ? 18  ARG K NE    1 
ATOM 9901  C CZ    . ARG Q  3 5   ? 93.810  19.004   49.306  1.00 422.39 ? 18  ARG K CZ    1 
ATOM 9902  N NH1   . ARG Q  3 5   ? 95.019  18.767   48.807  1.00 424.92 ? 18  ARG K NH1   1 
ATOM 9903  N NH2   . ARG Q  3 5   ? 93.029  19.909   48.713  1.00 427.16 ? 18  ARG K NH2   1 
ATOM 9904  N N     . LEU Q  3 6   ? 92.592  15.093   47.228  1.00 396.07 ? 19  LEU K N     1 
ATOM 9905  C CA    . LEU Q  3 6   ? 93.249  15.156   45.910  1.00 387.78 ? 19  LEU K CA    1 
ATOM 9906  C C     . LEU Q  3 6   ? 92.349  14.619   44.818  1.00 377.46 ? 19  LEU K C     1 
ATOM 9907  O O     . LEU Q  3 6   ? 92.387  15.107   43.697  1.00 374.73 ? 19  LEU K O     1 
ATOM 9908  C CB    . LEU Q  3 6   ? 94.545  14.341   45.890  1.00 391.83 ? 19  LEU K CB    1 
ATOM 9909  C CG    . LEU Q  3 6   ? 95.731  14.814   46.736  1.00 398.75 ? 19  LEU K CG    1 
ATOM 9910  C CD1   . LEU Q  3 6   ? 96.785  13.723   46.863  1.00 398.28 ? 19  LEU K CD1   1 
ATOM 9911  C CD2   . LEU Q  3 6   ? 96.330  16.097   46.182  1.00 407.08 ? 19  LEU K CD2   1 
ATOM 9912  N N     . LYS Q  3 7   ? 91.574  13.585   45.144  1.00 367.59 ? 20  LYS K N     1 
ATOM 9913  C CA    . LYS Q  3 7   ? 90.503  13.107   44.275  1.00 362.25 ? 20  LYS K CA    1 
ATOM 9914  C C     . LYS Q  3 7   ? 89.555  14.266   43.928  1.00 371.32 ? 20  LYS K C     1 
ATOM 9915  O O     . LYS Q  3 7   ? 89.187  14.407   42.766  1.00 377.29 ? 20  LYS K O     1 
ATOM 9916  C CB    . LYS Q  3 7   ? 89.725  11.935   44.907  1.00 345.92 ? 20  LYS K CB    1 
ATOM 9917  C CG    . LYS Q  3 7   ? 90.468  10.604   45.004  1.00 333.15 ? 20  LYS K CG    1 
ATOM 9918  C CD    . LYS Q  3 7   ? 89.581  9.532    45.630  1.00 320.18 ? 20  LYS K CD    1 
ATOM 9919  C CE    . LYS Q  3 7   ? 90.389  8.342    46.117  1.00 315.34 ? 20  LYS K CE    1 
ATOM 9920  N NZ    . LYS Q  3 7   ? 89.520  7.162    46.399  1.00 309.04 ? 20  LYS K NZ    1 
ATOM 9921  N N     . ALA Q  3 8   ? 89.190  15.095   44.916  1.00 379.65 ? 21  ALA K N     1 
ATOM 9922  C CA    . ALA Q  3 8   ? 88.293  16.261   44.719  1.00 390.71 ? 21  ALA K CA    1 
ATOM 9923  C C     . ALA Q  3 8   ? 88.900  17.459   43.950  1.00 398.91 ? 21  ALA K C     1 
ATOM 9924  O O     . ALA Q  3 8   ? 88.175  18.176   43.238  1.00 409.58 ? 21  ALA K O     1 
ATOM 9925  C CB    . ALA Q  3 8   ? 87.707  16.718   46.048  1.00 391.39 ? 21  ALA K CB    1 
ATOM 9926  N N     . ALA Q  3 9   ? 90.210  17.669   44.104  1.00 400.17 ? 22  ALA K N     1 
ATOM 9927  C CA    . ALA Q  3 9   ? 90.960  18.678   43.333  1.00 406.49 ? 22  ALA K CA    1 
ATOM 9928  C C     . ALA Q  3 9   ? 91.040  18.333   41.825  1.00 412.85 ? 22  ALA K C     1 
ATOM 9929  O O     . ALA Q  3 9   ? 90.925  19.221   40.961  1.00 423.70 ? 22  ALA K O     1 
ATOM 9930  C CB    . ALA Q  3 9   ? 92.351  18.872   43.926  1.00 401.75 ? 22  ALA K CB    1 
ATOM 9931  N N     . VAL Q  3 10  ? 91.243  17.040   41.535  1.00 413.90 ? 23  VAL K N     1 
ATOM 9932  C CA    . VAL Q  3 10  ? 91.186  16.451   40.164  1.00 417.79 ? 23  VAL K CA    1 
ATOM 9933  C C     . VAL Q  3 10  ? 89.780  16.616   39.531  1.00 426.52 ? 23  VAL K C     1 
ATOM 9934  O O     . VAL Q  3 10  ? 89.635  16.980   38.353  1.00 432.95 ? 23  VAL K O     1 
ATOM 9935  C CB    . VAL Q  3 10  ? 91.623  14.942   40.182  1.00 410.94 ? 23  VAL K CB    1 
ATOM 9936  C CG1   . VAL Q  3 10  ? 91.334  14.222   38.859  1.00 409.33 ? 23  VAL K CG1   1 
ATOM 9937  C CG2   . VAL Q  3 10  ? 93.096  14.804   40.556  1.00 405.39 ? 23  VAL K CG2   1 
ATOM 9938  N N     . HIS Q  3 11  ? 88.756  16.367   40.345  1.00 431.29 ? 24  HIS K N     1 
ATOM 9939  C CA    . HIS Q  3 11  ? 87.348  16.498   39.968  1.00 432.53 ? 24  HIS K CA    1 
ATOM 9940  C C     . HIS Q  3 11  ? 86.993  17.888   39.418  1.00 433.39 ? 24  HIS K C     1 
ATOM 9941  O O     . HIS Q  3 11  ? 86.203  17.990   38.473  1.00 428.25 ? 24  HIS K O     1 
ATOM 9942  C CB    . HIS Q  3 11  ? 86.499  16.173   41.193  1.00 435.66 ? 24  HIS K CB    1 
ATOM 9943  C CG    . HIS Q  3 11  ? 85.116  15.700   40.879  1.00 435.11 ? 24  HIS K CG    1 
ATOM 9944  N ND1   . HIS Q  3 11  ? 84.851  14.683   39.988  1.00 430.83 ? 24  HIS K ND1   1 
ATOM 9945  C CD2   . HIS Q  3 11  ? 83.919  16.078   41.386  1.00 437.59 ? 24  HIS K CD2   1 
ATOM 9946  C CE1   . HIS Q  3 11  ? 83.547  14.476   39.939  1.00 429.55 ? 24  HIS K CE1   1 
ATOM 9947  N NE2   . HIS Q  3 11  ? 82.959  15.309   40.777  1.00 434.46 ? 24  HIS K NE2   1 
ATOM 9948  N N     . TYR Q  3 12  ? 87.585  18.938   40.003  1.00 439.05 ? 25  TYR K N     1 
ATOM 9949  C CA    . TYR Q  3 12  ? 87.460  20.325   39.508  1.00 447.73 ? 25  TYR K CA    1 
ATOM 9950  C C     . TYR Q  3 12  ? 87.825  20.499   38.032  1.00 437.08 ? 25  TYR K C     1 
ATOM 9951  O O     . TYR Q  3 12  ? 86.990  20.949   37.239  1.00 427.70 ? 25  TYR K O     1 
ATOM 9952  C CB    . TYR Q  3 12  ? 88.308  21.301   40.351  1.00 472.45 ? 25  TYR K CB    1 
ATOM 9953  C CG    . TYR Q  3 12  ? 88.532  22.706   39.735  1.00 491.59 ? 25  TYR K CG    1 
ATOM 9954  C CD1   . TYR Q  3 12  ? 87.534  23.696   39.799  1.00 497.72 ? 25  TYR K CD1   1 
ATOM 9955  C CD2   . TYR Q  3 12  ? 89.753  23.055   39.117  1.00 498.16 ? 25  TYR K CD2   1 
ATOM 9956  C CE1   . TYR Q  3 12  ? 87.735  24.972   39.257  1.00 503.02 ? 25  TYR K CE1   1 
ATOM 9957  C CE2   . TYR Q  3 12  ? 89.956  24.334   38.571  1.00 501.54 ? 25  TYR K CE2   1 
ATOM 9958  C CZ    . TYR Q  3 12  ? 88.945  25.291   38.649  1.00 503.02 ? 25  TYR K CZ    1 
ATOM 9959  O OH    . TYR Q  3 12  ? 89.113  26.558   38.123  1.00 504.12 ? 25  TYR K OH    1 
ATOM 9960  N N     . THR Q  3 13  ? 89.071  20.170   37.678  1.00 431.53 ? 26  THR K N     1 
ATOM 9961  C CA    . THR Q  3 13  ? 89.599  20.467   36.344  1.00 428.53 ? 26  THR K CA    1 
ATOM 9962  C C     . THR Q  3 13  ? 88.906  19.636   35.268  1.00 435.74 ? 26  THR K C     1 
ATOM 9963  O O     . THR Q  3 13  ? 88.651  20.123   34.167  1.00 431.29 ? 26  THR K O     1 
ATOM 9964  C CB    . THR Q  3 13  ? 91.127  20.286   36.248  1.00 421.91 ? 26  THR K CB    1 
ATOM 9965  O OG1   . THR Q  3 13  ? 91.761  20.713   37.466  1.00 418.97 ? 26  THR K OG1   1 
ATOM 9966  C CG2   . THR Q  3 13  ? 91.660  21.101   35.093  1.00 418.72 ? 26  THR K CG2   1 
ATOM 9967  N N     . VAL Q  3 14  ? 88.591  18.390   35.610  1.00 452.49 ? 27  VAL K N     1 
ATOM 9968  C CA    . VAL Q  3 14  ? 87.832  17.496   34.734  1.00 471.34 ? 27  VAL K CA    1 
ATOM 9969  C C     . VAL Q  3 14  ? 86.403  18.013   34.476  1.00 477.95 ? 27  VAL K C     1 
ATOM 9970  O O     . VAL Q  3 14  ? 85.868  17.851   33.369  1.00 483.07 ? 27  VAL K O     1 
ATOM 9971  C CB    . VAL Q  3 14  ? 87.822  16.040   35.274  1.00 476.75 ? 27  VAL K CB    1 
ATOM 9972  C CG1   . VAL Q  3 14  ? 86.965  15.129   34.404  1.00 480.82 ? 27  VAL K CG1   1 
ATOM 9973  C CG2   . VAL Q  3 14  ? 89.242  15.492   35.351  1.00 479.58 ? 27  VAL K CG2   1 
ATOM 9974  N N     . GLY Q  3 15  ? 85.794  18.638   35.487  1.00 480.08 ? 28  GLY K N     1 
ATOM 9975  C CA    . GLY Q  3 15  ? 84.466  19.267   35.336  1.00 477.46 ? 28  GLY K CA    1 
ATOM 9976  C C     . GLY Q  3 15  ? 84.473  20.427   34.345  1.00 471.92 ? 28  GLY K C     1 
ATOM 9977  O O     . GLY Q  3 15  ? 83.517  20.618   33.558  1.00 467.16 ? 28  GLY K O     1 
ATOM 9978  N N     . CYS Q  3 16  ? 85.568  21.193   34.394  1.00 468.60 ? 29  CYS K N     1 
ATOM 9979  C CA    . CYS Q  3 16  ? 85.861  22.277   33.447  1.00 468.56 ? 29  CYS K CA    1 
ATOM 9980  C C     . CYS Q  3 16  ? 85.920  21.763   32.014  1.00 467.35 ? 29  CYS K C     1 
ATOM 9981  O O     . CYS Q  3 16  ? 85.223  22.278   31.132  1.00 465.98 ? 29  CYS K O     1 
ATOM 9982  C CB    . CYS Q  3 16  ? 87.207  22.943   33.769  1.00 470.10 ? 29  CYS K CB    1 
ATOM 9983  S SG    . CYS Q  3 16  ? 87.268  23.925   35.283  1.00 466.60 ? 29  CYS K SG    1 
ATOM 9984  N N     . LEU Q  3 17  ? 86.769  20.756   31.790  1.00 466.96 ? 30  LEU K N     1 
ATOM 9985  C CA    . LEU Q  3 17  ? 86.987  20.195   30.447  1.00 467.09 ? 30  LEU K CA    1 
ATOM 9986  C C     . LEU Q  3 17  ? 85.772  19.412   29.882  1.00 458.64 ? 30  LEU K C     1 
ATOM 9987  O O     . LEU Q  3 17  ? 85.585  19.345   28.651  1.00 472.75 ? 30  LEU K O     1 
ATOM 9988  C CB    . LEU Q  3 17  ? 88.298  19.380   30.374  1.00 464.47 ? 30  LEU K CB    1 
ATOM 9989  C CG    . LEU Q  3 17  ? 89.656  19.977   30.795  1.00 457.13 ? 30  LEU K CG    1 
ATOM 9990  C CD1   . LEU Q  3 17  ? 90.677  18.860   30.756  1.00 448.96 ? 30  LEU K CD1   1 
ATOM 9991  C CD2   . LEU Q  3 17  ? 90.134  21.169   29.966  1.00 457.08 ? 30  LEU K CD2   1 
ATOM 9992  N N     . CYS Q  3 18  ? 84.947  18.848   30.770  1.00 430.68 ? 31  CYS K N     1 
ATOM 9993  C CA    . CYS Q  3 18  ? 83.721  18.145   30.356  1.00 405.40 ? 31  CYS K CA    1 
ATOM 9994  C C     . CYS Q  3 18  ? 82.674  19.100   29.794  1.00 406.62 ? 31  CYS K C     1 
ATOM 9995  O O     . CYS Q  3 18  ? 82.006  18.790   28.809  1.00 411.85 ? 31  CYS K O     1 
ATOM 9996  C CB    . CYS Q  3 18  ? 83.155  17.301   31.494  1.00 387.08 ? 31  CYS K CB    1 
ATOM 9997  S SG    . CYS Q  3 18  ? 83.875  15.643   31.555  1.00 354.94 ? 31  CYS K SG    1 
ATOM 9998  N N     . GLU Q  3 19  ? 82.561  20.268   30.406  1.00 404.10 ? 32  GLU K N     1 
ATOM 9999  C CA    . GLU Q  3 19  ? 81.744  21.330   29.859  1.00 406.78 ? 32  GLU K CA    1 
ATOM 10000 C C     . GLU Q  3 19  ? 82.247  21.988   28.548  1.00 418.39 ? 32  GLU K C     1 
ATOM 10001 O O     . GLU Q  3 19  ? 81.424  22.435   27.748  1.00 424.85 ? 32  GLU K O     1 
ATOM 10002 C CB    . GLU Q  3 19  ? 81.473  22.367   30.938  1.00 399.04 ? 32  GLU K CB    1 
ATOM 10003 C CG    . GLU Q  3 19  ? 80.200  22.078   31.700  1.00 388.85 ? 32  GLU K CG    1 
ATOM 10004 C CD    . GLU Q  3 19  ? 78.963  22.458   30.903  1.00 383.53 ? 32  GLU K CD    1 
ATOM 10005 O OE1   . GLU Q  3 19  ? 78.882  23.622   30.445  1.00 382.46 ? 32  GLU K OE1   1 
ATOM 10006 O OE2   . GLU Q  3 19  ? 78.078  21.594   30.733  1.00 374.25 ? 32  GLU K OE2   1 
ATOM 10007 N N     . GLU Q  3 20  ? 83.569  22.065   28.333  1.00 421.72 ? 33  GLU K N     1 
ATOM 10008 C CA    . GLU Q  3 20  ? 84.150  22.601   27.064  1.00 422.10 ? 33  GLU K CA    1 
ATOM 10009 C C     . GLU Q  3 20  ? 83.837  21.707   25.845  1.00 423.54 ? 33  GLU K C     1 
ATOM 10010 O O     . GLU Q  3 20  ? 83.621  22.213   24.732  1.00 424.15 ? 33  GLU K O     1 
ATOM 10011 C CB    . GLU Q  3 20  ? 85.679  22.805   27.170  1.00 415.42 ? 33  GLU K CB    1 
ATOM 10012 C CG    . GLU Q  3 20  ? 86.189  24.223   27.433  1.00 410.65 ? 33  GLU K CG    1 
ATOM 10013 C CD    . GLU Q  3 20  ? 87.716  24.315   27.463  1.00 404.67 ? 33  GLU K CD    1 
ATOM 10014 O OE1   . GLU Q  3 20  ? 88.391  23.777   26.554  1.00 399.82 ? 33  GLU K OE1   1 
ATOM 10015 O OE2   . GLU Q  3 20  ? 88.251  24.936   28.403  1.00 401.72 ? 33  GLU K OE2   1 
ATOM 10016 N N     . VAL Q  3 21  ? 83.843  20.386   26.074  1.00 424.29 ? 34  VAL K N     1 
ATOM 10017 C CA    . VAL Q  3 21  ? 83.471  19.375   25.063  1.00 422.69 ? 34  VAL K CA    1 
ATOM 10018 C C     . VAL Q  3 21  ? 81.941  19.367   24.879  1.00 426.64 ? 34  VAL K C     1 
ATOM 10019 O O     . VAL Q  3 21  ? 81.448  19.130   23.779  1.00 429.27 ? 34  VAL K O     1 
ATOM 10020 C CB    . VAL Q  3 21  ? 83.998  17.943   25.402  1.00 416.27 ? 34  VAL K CB    1 
ATOM 10021 C CG1   . VAL Q  3 21  ? 83.487  16.911   24.401  1.00 412.56 ? 34  VAL K CG1   1 
ATOM 10022 C CG2   . VAL Q  3 21  ? 85.525  17.896   25.454  1.00 411.68 ? 34  VAL K CG2   1 
ATOM 10023 N N     . ALA Q  3 22  ? 81.205  19.638   25.962  1.00 427.98 ? 35  ALA K N     1 
ATOM 10024 C CA    . ALA Q  3 22  ? 79.748  19.830   25.910  1.00 425.12 ? 35  ALA K CA    1 
ATOM 10025 C C     . ALA Q  3 22  ? 79.355  21.030   25.034  1.00 427.02 ? 35  ALA K C     1 
ATOM 10026 O O     . ALA Q  3 22  ? 78.285  21.025   24.429  1.00 424.07 ? 35  ALA K O     1 
ATOM 10027 C CB    . ALA Q  3 22  ? 79.181  19.990   27.313  1.00 425.49 ? 35  ALA K CB    1 
ATOM 10028 N N     . LEU Q  3 23  ? 80.227  22.046   24.976  1.00 431.00 ? 36  LEU K N     1 
ATOM 10029 C CA    . LEU Q  3 23  ? 80.058  23.235   24.103  1.00 437.60 ? 36  LEU K CA    1 
ATOM 10030 C C     . LEU Q  3 23  ? 80.294  22.961   22.601  1.00 449.04 ? 36  LEU K C     1 
ATOM 10031 O O     . LEU Q  3 23  ? 79.574  23.500   21.746  1.00 455.35 ? 36  LEU K O     1 
ATOM 10032 C CB    . LEU Q  3 23  ? 80.941  24.414   24.581  1.00 429.71 ? 36  LEU K CB    1 
ATOM 10033 C CG    . LEU Q  3 23  ? 80.301  25.635   25.278  1.00 423.65 ? 36  LEU K CG    1 
ATOM 10034 C CD1   . LEU Q  3 23  ? 79.493  25.277   26.520  1.00 416.97 ? 36  LEU K CD1   1 
ATOM 10035 C CD2   . LEU Q  3 23  ? 81.357  26.682   25.609  1.00 421.69 ? 36  LEU K CD2   1 
ATOM 10036 N N     . ASP Q  3 24  ? 81.296  22.132   22.292  1.00 457.27 ? 37  ASP K N     1 
ATOM 10037 C CA    . ASP Q  3 24  ? 81.646  21.784   20.899  1.00 461.65 ? 37  ASP K CA    1 
ATOM 10038 C C     . ASP Q  3 24  ? 80.623  20.861   20.180  1.00 461.90 ? 37  ASP K C     1 
ATOM 10039 O O     . ASP Q  3 24  ? 80.321  21.097   18.993  1.00 469.12 ? 37  ASP K O     1 
ATOM 10040 C CB    . ASP Q  3 24  ? 83.090  21.230   20.818  1.00 457.14 ? 37  ASP K CB    1 
ATOM 10041 C CG    . ASP Q  3 24  ? 83.504  20.836   19.400  1.00 450.91 ? 37  ASP K CG    1 
ATOM 10042 O OD1   . ASP Q  3 24  ? 83.453  21.688   18.485  1.00 445.94 ? 37  ASP K OD1   1 
ATOM 10043 O OD2   . ASP Q  3 24  ? 83.888  19.662   19.217  1.00 447.06 ? 37  ASP K OD2   1 
ATOM 10044 N N     . LYS Q  3 25  ? 80.089  19.853   20.899  1.00 449.70 ? 38  LYS K N     1 
ATOM 10045 C CA    . LYS Q  3 25  ? 79.163  18.822   20.352  1.00 431.46 ? 38  LYS K CA    1 
ATOM 10046 C C     . LYS Q  3 25  ? 77.669  19.097   20.622  1.00 429.03 ? 38  LYS K C     1 
ATOM 10047 O O     . LYS Q  3 25  ? 76.815  18.267   20.306  1.00 429.41 ? 38  LYS K O     1 
ATOM 10048 C CB    . LYS Q  3 25  ? 79.546  17.413   20.854  1.00 414.89 ? 38  LYS K CB    1 
ATOM 10049 C CG    . LYS Q  3 25  ? 80.937  16.935   20.443  1.00 399.43 ? 38  LYS K CG    1 
ATOM 10050 C CD    . LYS Q  3 25  ? 81.000  16.420   19.004  1.00 382.62 ? 38  LYS K CD    1 
ATOM 10051 C CE    . LYS Q  3 25  ? 82.432  16.118   18.575  1.00 368.01 ? 38  LYS K CE    1 
ATOM 10052 N NZ    . LYS Q  3 25  ? 82.577  15.971   17.098  1.00 356.70 ? 38  LYS K NZ    1 
ATOM 10053 N N     . ALA Q  3 26  ? 77.378  20.269   21.193  1.00 423.36 ? 39  ALA K N     1 
ATOM 10054 C CA    . ALA Q  3 26  ? 76.017  20.733   21.517  1.00 415.70 ? 39  ALA K CA    1 
ATOM 10055 C C     . ALA Q  3 26  ? 75.197  19.751   22.357  1.00 407.93 ? 39  ALA K C     1 
ATOM 10056 O O     . ALA Q  3 26  ? 73.964  19.738   22.259  1.00 408.93 ? 39  ALA K O     1 
ATOM 10057 C CB    . ALA Q  3 26  ? 75.256  21.150   20.256  1.00 417.07 ? 39  ALA K CB    1 
ATOM 10058 N N     . MET Q  3 27  ? 75.894  18.958   23.183  1.00 395.17 ? 40  MET K N     1 
ATOM 10059 C CA    . MET Q  3 27  ? 75.277  17.969   24.089  1.00 382.06 ? 40  MET K CA    1 
ATOM 10060 C C     . MET Q  3 27  ? 76.064  17.841   25.428  1.00 370.76 ? 40  MET K C     1 
ATOM 10061 O O     . MET Q  3 27  ? 77.258  17.501   25.425  1.00 363.46 ? 40  MET K O     1 
ATOM 10062 C CB    . MET Q  3 27  ? 75.125  16.610   23.375  1.00 377.41 ? 40  MET K CB    1 
ATOM 10063 C CG    . MET Q  3 27  ? 73.780  15.906   23.587  1.00 372.59 ? 40  MET K CG    1 
ATOM 10064 S SD    . MET Q  3 27  ? 72.514  16.154   22.310  1.00 364.67 ? 40  MET K SD    1 
ATOM 10065 C CE    . MET Q  3 27  ? 71.629  17.606   22.905  1.00 364.83 ? 40  MET K CE    1 
ATOM 10066 N N     . GLN Q  3 28  ? 75.381  18.124   26.549  1.00 361.66 ? 41  GLN K N     1 
ATOM 10067 C CA    . GLN Q  3 28  ? 75.982  18.188   27.905  1.00 347.86 ? 41  GLN K CA    1 
ATOM 10068 C C     . GLN Q  3 28  ? 76.053  16.836   28.637  1.00 340.85 ? 41  GLN K C     1 
ATOM 10069 O O     . GLN Q  3 28  ? 75.516  15.821   28.170  1.00 335.67 ? 41  GLN K O     1 
ATOM 10070 C CB    . GLN Q  3 28  ? 75.336  19.309   28.780  1.00 343.60 ? 41  GLN K CB    1 
ATOM 10071 C CG    . GLN Q  3 28  ? 74.231  18.923   29.771  1.00 337.39 ? 41  GLN K CG    1 
ATOM 10072 C CD    . GLN Q  3 28  ? 72.818  19.320   29.325  1.00 338.43 ? 41  GLN K CD    1 
ATOM 10073 O OE1   . GLN Q  3 28  ? 72.466  20.496   29.217  1.00 339.95 ? 41  GLN K OE1   1 
ATOM 10074 N NE2   . GLN Q  3 28  ? 72.017  18.318   29.039  1.00 337.98 ? 41  GLN K NE2   1 
ATOM 10075 N N     . PHE Q  3 29  ? 76.730  16.837   29.781  1.00 337.91 ? 42  PHE K N     1 
ATOM 10076 C CA    . PHE Q  3 29  ? 77.063  15.609   30.488  1.00 337.34 ? 42  PHE K CA    1 
ATOM 10077 C C     . PHE Q  3 29  ? 76.207  15.426   31.721  1.00 341.07 ? 42  PHE K C     1 
ATOM 10078 O O     . PHE Q  3 29  ? 75.783  16.403   32.335  1.00 341.01 ? 42  PHE K O     1 
ATOM 10079 C CB    . PHE Q  3 29  ? 78.526  15.650   30.919  1.00 334.04 ? 42  PHE K CB    1 
ATOM 10080 C CG    . PHE Q  3 29  ? 79.501  15.574   29.781  1.00 334.54 ? 42  PHE K CG    1 
ATOM 10081 C CD1   . PHE Q  3 29  ? 79.165  16.045   28.509  1.00 338.37 ? 42  PHE K CD1   1 
ATOM 10082 C CD2   . PHE Q  3 29  ? 80.769  15.046   29.982  1.00 332.52 ? 42  PHE K CD2   1 
ATOM 10083 C CE1   . PHE Q  3 29  ? 80.070  15.979   27.459  1.00 341.02 ? 42  PHE K CE1   1 
ATOM 10084 C CE2   . PHE Q  3 29  ? 81.684  14.983   28.940  1.00 336.25 ? 42  PHE K CE2   1 
ATOM 10085 C CZ    . PHE Q  3 29  ? 81.335  15.447   27.676  1.00 340.83 ? 42  PHE K CZ    1 
ATOM 10086 N N     . SER Q  3 30  ? 75.963  14.169   32.088  1.00 346.47 ? 43  SER K N     1 
ATOM 10087 C CA    . SER Q  3 30  ? 75.358  13.869   33.386  1.00 351.29 ? 43  SER K CA    1 
ATOM 10088 C C     . SER Q  3 30  ? 76.397  14.109   34.495  1.00 347.45 ? 43  SER K C     1 
ATOM 10089 O O     . SER Q  3 30  ? 77.612  13.996   34.254  1.00 352.35 ? 43  SER K O     1 
ATOM 10090 C CB    . SER Q  3 30  ? 74.764  12.447   33.427  1.00 354.84 ? 43  SER K CB    1 
ATOM 10091 O OG    . SER Q  3 30  ? 75.755  11.437   33.557  1.00 360.64 ? 43  SER K OG    1 
ATOM 10092 N N     . LYS Q  3 31  ? 75.925  14.452   35.695  1.00 335.87 ? 44  LYS K N     1 
ATOM 10093 C CA    . LYS Q  3 31  ? 76.820  14.784   36.806  1.00 320.59 ? 44  LYS K CA    1 
ATOM 10094 C C     . LYS Q  3 31  ? 77.608  13.520   37.229  1.00 320.07 ? 44  LYS K C     1 
ATOM 10095 O O     . LYS Q  3 31  ? 78.789  13.583   37.612  1.00 312.90 ? 44  LYS K O     1 
ATOM 10096 C CB    . LYS Q  3 31  ? 76.022  15.408   37.960  1.00 309.73 ? 44  LYS K CB    1 
ATOM 10097 C CG    . LYS Q  3 31  ? 76.538  16.748   38.439  1.00 300.54 ? 44  LYS K CG    1 
ATOM 10098 C CD    . LYS Q  3 31  ? 76.035  17.874   37.577  1.00 297.38 ? 44  LYS K CD    1 
ATOM 10099 C CE    . LYS Q  3 31  ? 74.713  18.390   38.129  1.00 293.67 ? 44  LYS K CE    1 
ATOM 10100 N NZ    . LYS Q  3 31  ? 74.427  19.821   37.803  1.00 293.59 ? 44  LYS K NZ    1 
ATOM 10101 N N     . GLN Q  3 32  ? 76.944  12.377   37.087  1.00 326.80 ? 45  GLN K N     1 
ATOM 10102 C CA    . GLN Q  3 32  ? 77.535  11.060   37.299  1.00 334.16 ? 45  GLN K CA    1 
ATOM 10103 C C     . GLN Q  3 32  ? 78.695  10.726   36.303  1.00 345.56 ? 45  GLN K C     1 
ATOM 10104 O O     . GLN Q  3 32  ? 79.669  10.049   36.677  1.00 348.22 ? 45  GLN K O     1 
ATOM 10105 C CB    . GLN Q  3 32  ? 76.417  9.995    37.283  1.00 329.21 ? 45  GLN K CB    1 
ATOM 10106 C CG    . GLN Q  3 32  ? 75.343  10.162   38.373  1.00 324.30 ? 45  GLN K CG    1 
ATOM 10107 C CD    . GLN Q  3 32  ? 74.323  11.256   38.075  1.00 323.57 ? 45  GLN K CD    1 
ATOM 10108 O OE1   . GLN Q  3 32  ? 74.258  11.774   36.958  1.00 325.39 ? 45  GLN K OE1   1 
ATOM 10109 N NE2   . GLN Q  3 32  ? 73.530  11.618   39.080  1.00 319.61 ? 45  GLN K NE2   1 
ATOM 10110 N N     . THR Q  3 33  ? 78.595  11.211   35.056  1.00 359.00 ? 46  THR K N     1 
ATOM 10111 C CA    . THR Q  3 33  ? 79.658  11.062   34.021  1.00 366.83 ? 46  THR K CA    1 
ATOM 10112 C C     . THR Q  3 33  ? 80.928  11.828   34.390  1.00 368.11 ? 46  THR K C     1 
ATOM 10113 O O     . THR Q  3 33  ? 82.050  11.339   34.196  1.00 374.77 ? 46  THR K O     1 
ATOM 10114 C CB    . THR Q  3 33  ? 79.177  11.529   32.622  1.00 370.24 ? 46  THR K CB    1 
ATOM 10115 O OG1   . THR Q  3 33  ? 78.157  10.646   32.148  1.00 375.09 ? 46  THR K OG1   1 
ATOM 10116 C CG2   . THR Q  3 33  ? 80.324  11.536   31.604  1.00 368.53 ? 46  THR K CG2   1 
ATOM 10117 N N     . ILE Q  3 34  ? 80.735  13.031   34.919  1.00 363.85 ? 47  ILE K N     1 
ATOM 10118 C CA    . ILE Q  3 34  ? 81.832  13.835   35.411  1.00 359.62 ? 47  ILE K CA    1 
ATOM 10119 C C     . ILE Q  3 34  ? 82.592  13.077   36.501  1.00 357.74 ? 47  ILE K C     1 
ATOM 10120 O O     . ILE Q  3 34  ? 83.824  13.017   36.465  1.00 357.75 ? 47  ILE K O     1 
ATOM 10121 C CB    . ILE Q  3 34  ? 81.338  15.187   35.964  1.00 359.24 ? 47  ILE K CB    1 
ATOM 10122 C CG1   . ILE Q  3 34  ? 80.320  15.861   35.013  1.00 358.63 ? 47  ILE K CG1   1 
ATOM 10123 C CG2   . ILE Q  3 34  ? 82.525  16.068   36.321  1.00 363.60 ? 47  ILE K CG2   1 
ATOM 10124 C CD1   . ILE Q  3 34  ? 80.844  16.319   33.661  1.00 354.85 ? 47  ILE K CD1   1 
ATOM 10125 N N     . ALA Q  3 35  ? 81.850  12.486   37.444  1.00 355.80 ? 48  ALA K N     1 
ATOM 10126 C CA    . ALA Q  3 35  ? 82.422  11.680   38.540  1.00 358.60 ? 48  ALA K CA    1 
ATOM 10127 C C     . ALA Q  3 35  ? 83.273  10.479   38.078  1.00 365.13 ? 48  ALA K C     1 
ATOM 10128 O O     . ALA Q  3 35  ? 84.318  10.180   38.683  1.00 363.89 ? 48  ALA K O     1 
ATOM 10129 C CB    . ALA Q  3 35  ? 81.328  11.230   39.509  1.00 352.54 ? 48  ALA K CB    1 
ATOM 10130 N N     . ALA Q  3 36  ? 82.836  9.817    37.001  1.00 375.95 ? 49  ALA K N     1 
ATOM 10131 C CA    . ALA Q  3 36  ? 83.469  8.577    36.474  1.00 380.39 ? 49  ALA K CA    1 
ATOM 10132 C C     . ALA Q  3 36  ? 84.810  8.747    35.721  1.00 382.02 ? 49  ALA K C     1 
ATOM 10133 O O     . ALA Q  3 36  ? 85.700  7.875    35.817  1.00 376.21 ? 49  ALA K O     1 
ATOM 10134 C CB    . ALA Q  3 36  ? 82.475  7.813    35.606  1.00 383.23 ? 49  ALA K CB    1 
ATOM 10135 N N     . ILE Q  3 37  ? 84.924  9.846    34.958  1.00 386.21 ? 50  ILE K N     1 
ATOM 10136 C CA    . ILE Q  3 37  ? 86.172  10.260   34.267  1.00 381.46 ? 50  ILE K CA    1 
ATOM 10137 C C     . ILE Q  3 37  ? 87.257  10.718   35.281  1.00 380.19 ? 50  ILE K C     1 
ATOM 10138 O O     . ILE Q  3 37  ? 88.458  10.535   35.032  1.00 377.79 ? 50  ILE K O     1 
ATOM 10139 C CB    . ILE Q  3 37  ? 85.924  11.357   33.172  1.00 379.61 ? 50  ILE K CB    1 
ATOM 10140 C CG1   . ILE Q  3 37  ? 84.833  10.929   32.174  1.00 376.27 ? 50  ILE K CG1   1 
ATOM 10141 C CG2   . ILE Q  3 37  ? 87.207  11.718   32.418  1.00 375.94 ? 50  ILE K CG2   1 
ATOM 10142 C CD1   . ILE Q  3 37  ? 84.377  12.028   31.229  1.00 371.84 ? 50  ILE K CD1   1 
ATOM 10143 N N     . SER Q  3 38  ? 86.832  11.303   36.416  1.00 377.37 ? 51  SER K N     1 
ATOM 10144 C CA    . SER Q  3 38  ? 87.755  11.697   37.519  1.00 371.15 ? 51  SER K CA    1 
ATOM 10145 C C     . SER Q  3 38  ? 88.346  10.486   38.261  1.00 363.05 ? 51  SER K C     1 
ATOM 10146 O O     . SER Q  3 38  ? 89.565  10.431   38.508  1.00 366.15 ? 51  SER K O     1 
ATOM 10147 C CB    . SER Q  3 38  ? 87.079  12.670   38.495  1.00 373.77 ? 51  SER K CB    1 
ATOM 10148 O OG    . SER Q  3 38  ? 86.781  13.900   37.857  1.00 374.47 ? 51  SER K OG    1 
ATOM 10149 N N     . GLU Q  3 39  ? 87.472  9.527    38.593  1.00 347.30 ? 52  GLU K N     1 
ATOM 10150 C CA    . GLU Q  3 39  ? 87.856  8.212    39.130  1.00 334.72 ? 52  GLU K CA    1 
ATOM 10151 C C     . GLU Q  3 39  ? 88.862  7.522    38.183  1.00 342.95 ? 52  GLU K C     1 
ATOM 10152 O O     . GLU Q  3 39  ? 89.935  7.073    38.627  1.00 354.53 ? 52  GLU K O     1 
ATOM 10153 C CB    . GLU Q  3 39  ? 86.613  7.341    39.425  1.00 312.08 ? 52  GLU K CB    1 
ATOM 10154 C CG    . GLU Q  3 39  ? 85.742  7.866    40.570  1.00 293.26 ? 52  GLU K CG    1 
ATOM 10155 C CD    . GLU Q  3 39  ? 84.583  6.956    40.907  1.00 280.74 ? 52  GLU K CD    1 
ATOM 10156 O OE1   . GLU Q  3 39  ? 84.778  5.728    40.828  1.00 275.12 ? 52  GLU K OE1   1 
ATOM 10157 O OE2   . GLU Q  3 39  ? 83.502  7.473    41.262  1.00 274.06 ? 52  GLU K OE2   1 
ATOM 10158 N N     . LEU Q  3 40  ? 88.525  7.504    36.888  1.00 342.91 ? 53  LEU K N     1 
ATOM 10159 C CA    . LEU Q  3 40  ? 89.438  7.126    35.789  1.00 338.96 ? 53  LEU K CA    1 
ATOM 10160 C C     . LEU Q  3 40  ? 90.825  7.815    35.811  1.00 339.27 ? 53  LEU K C     1 
ATOM 10161 O O     . LEU Q  3 40  ? 91.826  7.112    35.702  1.00 344.99 ? 53  LEU K O     1 
ATOM 10162 C CB    . LEU Q  3 40  ? 88.747  7.309    34.415  1.00 331.53 ? 53  LEU K CB    1 
ATOM 10163 C CG    . LEU Q  3 40  ? 89.500  7.215    33.072  1.00 326.52 ? 53  LEU K CG    1 
ATOM 10164 C CD1   . LEU Q  3 40  ? 89.716  5.773    32.623  1.00 322.26 ? 53  LEU K CD1   1 
ATOM 10165 C CD2   . LEU Q  3 40  ? 88.766  7.974    31.978  1.00 323.79 ? 53  LEU K CD2   1 
ATOM 10166 N N     . THR Q  3 41  ? 90.879  9.151    35.962  1.00 332.08 ? 54  THR K N     1 
ATOM 10167 C CA    . THR Q  3 41  ? 92.143  9.943    35.908  1.00 323.11 ? 54  THR K CA    1 
ATOM 10168 C C     . THR Q  3 41  ? 93.049  9.665    37.091  1.00 330.10 ? 54  THR K C     1 
ATOM 10169 O O     . THR Q  3 41  ? 94.254  9.497    36.925  1.00 327.99 ? 54  THR K O     1 
ATOM 10170 C CB    . THR Q  3 41  ? 91.895  11.472   35.851  1.00 314.89 ? 54  THR K CB    1 
ATOM 10171 O OG1   . THR Q  3 41  ? 91.052  11.773   34.737  1.00 307.83 ? 54  THR K OG1   1 
ATOM 10172 C CG2   . THR Q  3 41  ? 93.210  12.258   35.704  1.00 311.97 ? 54  THR K CG2   1 
ATOM 10173 N N     . PHE Q  3 42  ? 92.452  9.640    38.282  1.00 341.51 ? 55  PHE K N     1 
ATOM 10174 C CA    . PHE Q  3 42  ? 93.140  9.304    39.531  1.00 353.31 ? 55  PHE K CA    1 
ATOM 10175 C C     . PHE Q  3 42  ? 93.836  7.924    39.439  1.00 351.57 ? 55  PHE K C     1 
ATOM 10176 O O     . PHE Q  3 42  ? 95.040  7.803    39.729  1.00 353.12 ? 55  PHE K O     1 
ATOM 10177 C CB    . PHE Q  3 42  ? 92.126  9.379    40.699  1.00 363.56 ? 55  PHE K CB    1 
ATOM 10178 C CG    . PHE Q  3 42  ? 92.700  9.049    42.063  1.00 370.91 ? 55  PHE K CG    1 
ATOM 10179 C CD1   . PHE Q  3 42  ? 93.403  10.002   42.795  1.00 374.86 ? 55  PHE K CD1   1 
ATOM 10180 C CD2   . PHE Q  3 42  ? 92.488  7.793    42.632  1.00 370.76 ? 55  PHE K CD2   1 
ATOM 10181 C CE1   . PHE Q  3 42  ? 93.907  9.687    44.049  1.00 375.62 ? 55  PHE K CE1   1 
ATOM 10182 C CE2   . PHE Q  3 42  ? 92.991  7.470    43.880  1.00 371.20 ? 55  PHE K CE2   1 
ATOM 10183 C CZ    . PHE Q  3 42  ? 93.696  8.423    44.589  1.00 373.69 ? 55  PHE K CZ    1 
ATOM 10184 N N     . ARG Q  3 43  ? 93.085  6.899    39.022  1.00 346.97 ? 56  ARG K N     1 
ATOM 10185 C CA    . ARG Q  3 43  ? 93.628  5.537    38.941  1.00 338.66 ? 56  ARG K CA    1 
ATOM 10186 C C     . ARG Q  3 43  ? 94.550  5.322    37.741  1.00 340.70 ? 56  ARG K C     1 
ATOM 10187 O O     . ARG Q  3 43  ? 95.388  4.415    37.744  1.00 337.39 ? 56  ARG K O     1 
ATOM 10188 C CB    . ARG Q  3 43  ? 92.535  4.474    39.131  1.00 328.19 ? 56  ARG K CB    1 
ATOM 10189 C CG    . ARG Q  3 43  ? 92.415  4.163    40.623  1.00 318.22 ? 56  ARG K CG    1 
ATOM 10190 C CD    . ARG Q  3 43  ? 91.151  3.477    41.120  1.00 312.16 ? 56  ARG K CD    1 
ATOM 10191 N NE    . ARG Q  3 43  ? 90.211  4.382    41.807  1.00 312.07 ? 56  ARG K NE    1 
ATOM 10192 C CZ    . ARG Q  3 43  ? 88.969  4.604    41.384  1.00 313.01 ? 56  ARG K CZ    1 
ATOM 10193 N NH1   . ARG Q  3 43  ? 88.544  3.973    40.302  1.00 313.84 ? 56  ARG K NH1   1 
ATOM 10194 N NH2   . ARG Q  3 43  ? 88.140  5.423    42.040  1.00 313.34 ? 56  ARG K NH2   1 
ATOM 10195 N N     . GLN Q  3 44  ? 94.437  6.224    36.766  1.00 345.16 ? 57  GLN K N     1 
ATOM 10196 C CA    . GLN Q  3 44  ? 95.342  6.275    35.612  1.00 346.78 ? 57  GLN K CA    1 
ATOM 10197 C C     . GLN Q  3 44  ? 96.736  6.770    36.010  1.00 347.53 ? 57  GLN K C     1 
ATOM 10198 O O     . GLN Q  3 44  ? 97.749  6.261    35.512  1.00 350.03 ? 57  GLN K O     1 
ATOM 10199 C CB    . GLN Q  3 44  ? 94.765  7.179    34.514  1.00 348.69 ? 57  GLN K CB    1 
ATOM 10200 C CG    . GLN Q  3 44  ? 95.479  7.095    33.173  1.00 350.45 ? 57  GLN K CG    1 
ATOM 10201 C CD    . GLN Q  3 44  ? 95.303  5.751    32.486  1.00 348.09 ? 57  GLN K CD    1 
ATOM 10202 O OE1   . GLN Q  3 44  ? 94.272  5.084    32.633  1.00 344.42 ? 57  GLN K OE1   1 
ATOM 10203 N NE2   . GLN Q  3 44  ? 96.315  5.349    31.724  1.00 350.97 ? 57  GLN K NE2   1 
ATOM 10204 N N     . CYS Q  3 45  ? 96.770  7.764    36.904  1.00 343.64 ? 58  CYS K N     1 
ATOM 10205 C CA    . CYS Q  3 45  ? 98.019  8.323    37.403  1.00 338.36 ? 58  CYS K CA    1 
ATOM 10206 C C     . CYS Q  3 45  ? 98.757  7.318    38.257  1.00 335.08 ? 58  CYS K C     1 
ATOM 10207 O O     . CYS Q  3 45  ? 99.943  7.493    38.481  1.00 339.58 ? 58  CYS K O     1 
ATOM 10208 C CB    . CYS Q  3 45  ? 97.795  9.612    38.192  1.00 336.06 ? 58  CYS K CB    1 
ATOM 10209 S SG    . CYS Q  3 45  ? 97.318  11.009   37.164  1.00 328.60 ? 58  CYS K SG    1 
ATOM 10210 N N     . GLU Q  3 46  ? 98.064  6.276    38.732  1.00 324.65 ? 59  GLU K N     1 
ATOM 10211 C CA    . GLU Q  3 46  ? 98.726  5.128    39.382  1.00 313.35 ? 59  GLU K CA    1 
ATOM 10212 C C     . GLU Q  3 46  ? 99.663  4.442    38.374  1.00 309.01 ? 59  GLU K C     1 
ATOM 10213 O O     . GLU Q  3 46  ? 100.886 4.328    38.616  1.00 314.53 ? 59  GLU K O     1 
ATOM 10214 C CB    . GLU Q  3 46  ? 97.703  4.141    39.999  1.00 305.93 ? 59  GLU K CB    1 
ATOM 10215 C CG    . GLU Q  3 46  ? 98.301  2.928    40.721  1.00 299.70 ? 59  GLU K CG    1 
ATOM 10216 C CD    . GLU Q  3 46  ? 97.457  2.402    41.881  1.00 297.21 ? 59  GLU K CD    1 
ATOM 10217 O OE1   . GLU Q  3 46  ? 96.216  2.563    41.885  1.00 293.68 ? 59  GLU K OE1   1 
ATOM 10218 O OE2   . GLU Q  3 46  ? 98.065  1.821    42.810  1.00 298.35 ? 59  GLU K OE2   1 
ATOM 10219 N N     . ASN Q  3 47  ? 99.103  4.032    37.238  1.00 297.46 ? 60  ASN K N     1 
ATOM 10220 C CA    . ASN Q  3 47  ? 99.917  3.399    36.221  1.00 287.47 ? 60  ASN K CA    1 
ATOM 10221 C C     . ASN Q  3 47  ? 100.875 4.370    35.585  1.00 288.83 ? 60  ASN K C     1 
ATOM 10222 O O     . ASN Q  3 47  ? 101.992 4.003    35.341  1.00 289.98 ? 60  ASN K O     1 
ATOM 10223 C CB    . ASN Q  3 47  ? 99.085  2.666    35.187  1.00 278.11 ? 60  ASN K CB    1 
ATOM 10224 C CG    . ASN Q  3 47  ? 98.286  1.540    35.792  1.00 273.95 ? 60  ASN K CG    1 
ATOM 10225 O OD1   . ASN Q  3 47  ? 98.776  0.783    36.628  1.00 271.56 ? 60  ASN K OD1   1 
ATOM 10226 N ND2   . ASN Q  3 47  ? 97.040  1.432    35.380  1.00 272.53 ? 60  ASN K ND2   1 
ATOM 10227 N N     . PHE Q  3 48  ? 100.468 5.614    35.364  1.00 289.87 ? 61  PHE K N     1 
ATOM 10228 C CA    . PHE Q  3 48  ? 101.416 6.654    34.950  1.00 290.56 ? 61  PHE K CA    1 
ATOM 10229 C C     . PHE Q  3 48  ? 102.662 6.786    35.826  1.00 294.77 ? 61  PHE K C     1 
ATOM 10230 O O     . PHE Q  3 48  ? 103.784 6.680    35.339  1.00 291.79 ? 61  PHE K O     1 
ATOM 10231 C CB    . PHE Q  3 48  ? 100.735 8.014    34.883  1.00 289.87 ? 61  PHE K CB    1 
ATOM 10232 C CG    . PHE Q  3 48  ? 99.950  8.231    33.633  1.00 289.32 ? 61  PHE K CG    1 
ATOM 10233 C CD1   . PHE Q  3 48  ? 100.128 7.399    32.527  1.00 288.32 ? 61  PHE K CD1   1 
ATOM 10234 C CD2   . PHE Q  3 48  ? 99.051  9.286    33.543  1.00 290.69 ? 61  PHE K CD2   1 
ATOM 10235 C CE1   . PHE Q  3 48  ? 99.406  7.605    31.361  1.00 290.25 ? 61  PHE K CE1   1 
ATOM 10236 C CE2   . PHE Q  3 48  ? 98.328  9.503    32.376  1.00 292.06 ? 61  PHE K CE2   1 
ATOM 10237 C CZ    . PHE Q  3 48  ? 98.505  8.660    31.285  1.00 291.87 ? 61  PHE K CZ    1 
ATOM 10238 N N     . ALA Q  3 49  ? 102.446 7.034    37.118  1.00 302.79 ? 62  ALA K N     1 
ATOM 10239 C CA    . ALA Q  3 49  ? 103.529 7.326    38.078  1.00 310.59 ? 62  ALA K CA    1 
ATOM 10240 C C     . ALA Q  3 49  ? 104.448 6.140    38.346  1.00 314.27 ? 62  ALA K C     1 
ATOM 10241 O O     . ALA Q  3 49  ? 105.680 6.266    38.378  1.00 313.92 ? 62  ALA K O     1 
ATOM 10242 C CB    . ALA Q  3 49  ? 102.950 7.819    39.393  1.00 312.86 ? 62  ALA K CB    1 
ATOM 10243 N N     . LYS Q  3 50  ? 103.840 4.986    38.565  1.00 319.47 ? 63  LYS K N     1 
ATOM 10244 C CA    . LYS Q  3 50  ? 104.629 3.806    38.832  1.00 323.43 ? 63  LYS K CA    1 
ATOM 10245 C C     . LYS Q  3 50  ? 105.261 3.254    37.519  1.00 327.48 ? 63  LYS K C     1 
ATOM 10246 O O     . LYS Q  3 50  ? 106.400 2.783    37.553  1.00 326.99 ? 63  LYS K O     1 
ATOM 10247 C CB    . LYS Q  3 50  ? 103.859 2.825    39.736  1.00 319.74 ? 63  LYS K CB    1 
ATOM 10248 C CG    . LYS Q  3 50  ? 103.506 3.479    41.080  1.00 314.30 ? 63  LYS K CG    1 
ATOM 10249 C CD    . LYS Q  3 50  ? 102.567 2.604    41.914  1.00 308.01 ? 63  LYS K CD    1 
ATOM 10250 C CE    . LYS Q  3 50  ? 102.035 3.327    43.144  1.00 304.70 ? 63  LYS K CE    1 
ATOM 10251 N NZ    . LYS Q  3 50  ? 100.753 4.041    42.878  1.00 302.06 ? 63  LYS K NZ    1 
ATOM 10252 N N     . ASP Q  3 51  ? 104.581 3.411    36.369  1.00 331.03 ? 64  ASP K N     1 
ATOM 10253 C CA    . ASP Q  3 51  ? 105.244 3.243    35.040  1.00 331.05 ? 64  ASP K CA    1 
ATOM 10254 C C     . ASP Q  3 51  ? 106.397 4.256    34.827  1.00 333.47 ? 64  ASP K C     1 
ATOM 10255 O O     . ASP Q  3 51  ? 107.482 3.856    34.372  1.00 339.64 ? 64  ASP K O     1 
ATOM 10256 C CB    . ASP Q  3 51  ? 104.263 3.314    33.844  1.00 324.25 ? 64  ASP K CB    1 
ATOM 10257 C CG    . ASP Q  3 51  ? 103.329 2.101    33.741  1.00 315.83 ? 64  ASP K CG    1 
ATOM 10258 O OD1   . ASP Q  3 51  ? 103.422 1.166    34.562  1.00 314.29 ? 64  ASP K OD1   1 
ATOM 10259 O OD2   . ASP Q  3 51  ? 102.482 2.101    32.823  1.00 305.19 ? 64  ASP K OD2   1 
ATOM 10260 N N     . LEU Q  3 52  ? 106.158 5.542    35.143  1.00 327.96 ? 65  LEU K N     1 
ATOM 10261 C CA    . LEU Q  3 52  ? 107.212 6.588    35.154  1.00 324.21 ? 65  LEU K CA    1 
ATOM 10262 C C     . LEU Q  3 52  ? 108.410 6.233    36.081  1.00 331.53 ? 65  LEU K C     1 
ATOM 10263 O O     . LEU Q  3 52  ? 109.564 6.445    35.713  1.00 337.24 ? 65  LEU K O     1 
ATOM 10264 C CB    . LEU Q  3 52  ? 106.642 7.993    35.472  1.00 313.59 ? 65  LEU K CB    1 
ATOM 10265 C CG    . LEU Q  3 52  ? 105.746 8.710    34.456  1.00 304.27 ? 65  LEU K CG    1 
ATOM 10266 C CD1   . LEU Q  3 52  ? 105.010 9.891    35.069  1.00 303.36 ? 65  LEU K CD1   1 
ATOM 10267 C CD2   . LEU Q  3 52  ? 106.573 9.154    33.270  1.00 300.87 ? 65  LEU K CD2   1 
ATOM 10268 N N     . GLU Q  3 53  ? 108.139 5.672    37.259  1.00 333.48 ? 66  GLU K N     1 
ATOM 10269 C CA    . GLU Q  3 53  ? 109.194 5.208    38.179  1.00 335.91 ? 66  GLU K CA    1 
ATOM 10270 C C     . GLU Q  3 53  ? 110.181 4.167    37.590  1.00 329.46 ? 66  GLU K C     1 
ATOM 10271 O O     . GLU Q  3 53  ? 111.402 4.346    37.636  1.00 332.46 ? 66  GLU K O     1 
ATOM 10272 C CB    . GLU Q  3 53  ? 108.543 4.646    39.439  1.00 344.69 ? 66  GLU K CB    1 
ATOM 10273 C CG    . GLU Q  3 53  ? 109.522 4.034    40.419  1.00 358.60 ? 66  GLU K CG    1 
ATOM 10274 C CD    . GLU Q  3 53  ? 109.126 2.638    40.845  1.00 365.13 ? 66  GLU K CD    1 
ATOM 10275 O OE1   . GLU Q  3 53  ? 107.921 2.382    41.055  1.00 369.35 ? 66  GLU K OE1   1 
ATOM 10276 O OE2   . GLU Q  3 53  ? 110.031 1.791    40.973  1.00 367.98 ? 66  GLU K OE2   1 
ATOM 10277 N N     . MET Q  3 54  ? 109.650 3.076    37.051  1.00 315.78 ? 67  MET K N     1 
ATOM 10278 C CA    . MET Q  3 54  ? 110.483 2.027    36.465  1.00 305.76 ? 67  MET K CA    1 
ATOM 10279 C C     . MET Q  3 54  ? 111.172 2.461    35.177  1.00 308.82 ? 67  MET K C     1 
ATOM 10280 O O     . MET Q  3 54  ? 112.139 1.832    34.767  1.00 305.99 ? 67  MET K O     1 
ATOM 10281 C CB    . MET Q  3 54  ? 109.660 0.775    36.196  1.00 292.92 ? 67  MET K CB    1 
ATOM 10282 C CG    . MET Q  3 54  ? 109.093 0.109    37.439  1.00 286.53 ? 67  MET K CG    1 
ATOM 10283 S SD    . MET Q  3 54  ? 107.946 -1.209   37.001  1.00 279.01 ? 67  MET K SD    1 
ATOM 10284 C CE    . MET Q  3 54  ? 106.555 -0.275   36.396  1.00 277.37 ? 67  MET K CE    1 
ATOM 10285 N N     . PHE Q  3 55  ? 110.648 3.508    34.528  1.00 315.44 ? 68  PHE K N     1 
ATOM 10286 C CA    . PHE Q  3 55  ? 111.326 4.164    33.390  1.00 317.90 ? 68  PHE K CA    1 
ATOM 10287 C C     . PHE Q  3 55  ? 112.551 4.964    33.846  1.00 317.51 ? 68  PHE K C     1 
ATOM 10288 O O     . PHE Q  3 55  ? 113.620 4.863    33.232  1.00 314.32 ? 68  PHE K O     1 
ATOM 10289 C CB    . PHE Q  3 55  ? 110.421 5.157    32.631  1.00 322.35 ? 68  PHE K CB    1 
ATOM 10290 C CG    . PHE Q  3 55  ? 109.336 4.537    31.795  1.00 321.66 ? 68  PHE K CG    1 
ATOM 10291 C CD1   . PHE Q  3 55  ? 109.511 3.305    31.182  1.00 320.38 ? 68  PHE K CD1   1 
ATOM 10292 C CD2   . PHE Q  3 55  ? 108.146 5.236    31.579  1.00 321.72 ? 68  PHE K CD2   1 
ATOM 10293 C CE1   . PHE Q  3 55  ? 108.500 2.761    30.404  1.00 319.12 ? 68  PHE K CE1   1 
ATOM 10294 C CE2   . PHE Q  3 55  ? 107.133 4.698    30.808  1.00 319.17 ? 68  PHE K CE2   1 
ATOM 10295 C CZ    . PHE Q  3 55  ? 107.315 3.461    30.215  1.00 318.26 ? 68  PHE K CZ    1 
ATOM 10296 N N     . ALA Q  3 56  ? 112.373 5.796    34.883  1.00 316.79 ? 69  ALA K N     1 
ATOM 10297 C CA    . ALA Q  3 56  ? 113.460 6.591    35.440  1.00 315.59 ? 69  ALA K CA    1 
ATOM 10298 C C     . ALA Q  3 56  ? 114.482 5.630    36.021  1.00 317.82 ? 69  ALA K C     1 
ATOM 10299 O O     . ALA Q  3 56  ? 115.671 5.873    35.882  1.00 320.08 ? 69  ALA K O     1 
ATOM 10300 C CB    . ALA Q  3 56  ? 112.960 7.582    36.485  1.00 311.96 ? 69  ALA K CB    1 
ATOM 10301 N N     . ARG Q  3 57  ? 114.016 4.531    36.626  1.00 319.42 ? 70  ARG K N     1 
ATOM 10302 C CA    . ARG Q  3 57  ? 114.898 3.421    37.036  1.00 322.48 ? 70  ARG K CA    1 
ATOM 10303 C C     . ARG Q  3 57  ? 115.450 2.584    35.866  1.00 322.89 ? 70  ARG K C     1 
ATOM 10304 O O     . ARG Q  3 57  ? 116.572 2.086    35.944  1.00 329.48 ? 70  ARG K O     1 
ATOM 10305 C CB    . ARG Q  3 57  ? 114.237 2.500    38.079  1.00 320.98 ? 70  ARG K CB    1 
ATOM 10306 C CG    . ARG Q  3 57  ? 115.080 1.279    38.462  1.00 322.05 ? 70  ARG K CG    1 
ATOM 10307 C CD    . ARG Q  3 57  ? 115.712 1.326    39.862  1.00 329.12 ? 70  ARG K CD    1 
ATOM 10308 N NE    . ARG Q  3 57  ? 116.333 2.605    40.262  1.00 334.55 ? 70  ARG K NE    1 
ATOM 10309 C CZ    . ARG Q  3 57  ? 117.552 3.024    39.912  1.00 334.94 ? 70  ARG K CZ    1 
ATOM 10310 N NH1   . ARG Q  3 57  ? 118.318 2.287    39.118  1.00 334.39 ? 70  ARG K NH1   1 
ATOM 10311 N NH2   . ARG Q  3 57  ? 118.008 4.196    40.346  1.00 333.73 ? 70  ARG K NH2   1 
ATOM 10312 N N     . HIS Q  3 58  ? 114.674 2.420    34.798  1.00 318.57 ? 71  HIS K N     1 
ATOM 10313 C CA    . HIS Q  3 58  ? 115.171 1.791    33.553  1.00 315.43 ? 71  HIS K CA    1 
ATOM 10314 C C     . HIS Q  3 58  ? 116.265 2.609    32.804  1.00 315.44 ? 71  HIS K C     1 
ATOM 10315 O O     . HIS Q  3 58  ? 117.188 2.032    32.197  1.00 312.78 ? 71  HIS K O     1 
ATOM 10316 C CB    . HIS Q  3 58  ? 113.980 1.399    32.648  1.00 313.82 ? 71  HIS K CB    1 
ATOM 10317 C CG    . HIS Q  3 58  ? 114.192 1.657    31.186  1.00 315.51 ? 71  HIS K CG    1 
ATOM 10318 N ND1   . HIS Q  3 58  ? 115.164 1.016    30.448  1.00 316.45 ? 71  HIS K ND1   1 
ATOM 10319 C CD2   . HIS Q  3 58  ? 113.534 2.466    30.321  1.00 316.66 ? 71  HIS K CD2   1 
ATOM 10320 C CE1   . HIS Q  3 58  ? 115.110 1.433    29.195  1.00 317.54 ? 71  HIS K CE1   1 
ATOM 10321 N NE2   . HIS Q  3 58  ? 114.130 2.313    29.091  1.00 318.54 ? 71  HIS K NE2   1 
ATOM 10322 N N     . ALA Q  3 59  ? 116.173 3.940    32.878  1.00 317.26 ? 72  ALA K N     1 
ATOM 10323 C CA    . ALA Q  3 59  ? 117.160 4.831    32.255  1.00 321.76 ? 72  ALA K CA    1 
ATOM 10324 C C     . ALA Q  3 59  ? 118.250 5.209    33.270  1.00 328.55 ? 72  ALA K C     1 
ATOM 10325 O O     . ALA Q  3 59  ? 119.083 6.100    33.033  1.00 330.77 ? 72  ALA K O     1 
ATOM 10326 C CB    . ALA Q  3 59  ? 116.474 6.067    31.692  1.00 320.28 ? 72  ALA K CB    1 
ATOM 10327 N N     . LYS Q  3 60  ? 118.205 4.514    34.408  1.00 333.33 ? 73  LYS K N     1 
ATOM 10328 C CA    . LYS Q  3 60  ? 119.153 4.631    35.530  1.00 338.61 ? 73  LYS K CA    1 
ATOM 10329 C C     . LYS Q  3 60  ? 119.384 6.078    36.056  1.00 346.63 ? 73  LYS K C     1 
ATOM 10330 O O     . LYS Q  3 60  ? 120.514 6.550    36.223  1.00 353.20 ? 73  LYS K O     1 
ATOM 10331 C CB    . LYS Q  3 60  ? 120.423 3.779    35.257  1.00 331.28 ? 73  LYS K CB    1 
ATOM 10332 C CG    . LYS Q  3 60  ? 120.120 2.274    35.173  1.00 319.50 ? 73  LYS K CG    1 
ATOM 10333 C CD    . LYS Q  3 60  ? 121.270 1.437    34.601  1.00 310.66 ? 73  LYS K CD    1 
ATOM 10334 C CE    . LYS Q  3 60  ? 121.013 1.019    33.158  1.00 303.53 ? 73  LYS K CE    1 
ATOM 10335 N NZ    . LYS Q  3 60  ? 120.121 -0.168   33.078  1.00 297.98 ? 73  LYS K NZ    1 
ATOM 10336 N N     . ARG Q  3 61  ? 118.269 6.763    36.319  1.00 349.41 ? 74  ARG K N     1 
ATOM 10337 C CA    . ARG Q  3 61  ? 118.250 8.114    36.883  1.00 355.05 ? 74  ARG K CA    1 
ATOM 10338 C C     . ARG Q  3 61  ? 117.274 8.215    38.037  1.00 361.29 ? 74  ARG K C     1 
ATOM 10339 O O     . ARG Q  3 61  ? 116.444 7.340    38.230  1.00 355.22 ? 74  ARG K O     1 
ATOM 10340 C CB    . ARG Q  3 61  ? 117.776 9.095    35.841  1.00 351.48 ? 74  ARG K CB    1 
ATOM 10341 C CG    . ARG Q  3 61  ? 118.835 9.621    34.911  1.00 350.05 ? 74  ARG K CG    1 
ATOM 10342 C CD    . ARG Q  3 61  ? 118.172 10.599   33.965  1.00 350.75 ? 74  ARG K CD    1 
ATOM 10343 N NE    . ARG Q  3 61  ? 117.364 9.928    32.937  1.00 352.52 ? 74  ARG K NE    1 
ATOM 10344 C CZ    . ARG Q  3 61  ? 116.036 9.771    32.953  1.00 353.59 ? 74  ARG K CZ    1 
ATOM 10345 N NH1   . ARG Q  3 61  ? 115.304 10.227   33.958  1.00 355.12 ? 74  ARG K NH1   1 
ATOM 10346 N NH2   . ARG Q  3 61  ? 115.425 9.154    31.947  1.00 352.96 ? 74  ARG K NH2   1 
ATOM 10347 N N     . THR Q  3 62  ? 117.353 9.305    38.792  1.00 375.40 ? 75  THR K N     1 
ATOM 10348 C CA    . THR Q  3 62  ? 116.336 9.564    39.812  1.00 383.45 ? 75  THR K CA    1 
ATOM 10349 C C     . THR Q  3 62  ? 115.269 10.551   39.334  1.00 379.51 ? 75  THR K C     1 
ATOM 10350 O O     . THR Q  3 62  ? 114.123 10.466   39.769  1.00 384.02 ? 75  THR K O     1 
ATOM 10351 C CB    . THR Q  3 62  ? 116.917 10.020   41.184  1.00 393.26 ? 75  THR K CB    1 
ATOM 10352 O OG1   . THR Q  3 62  ? 117.694 11.219   41.040  1.00 397.69 ? 75  THR K OG1   1 
ATOM 10353 C CG2   . THR Q  3 62  ? 117.766 8.915    41.824  1.00 398.33 ? 75  THR K CG2   1 
ATOM 10354 N N     . THR Q  3 63  ? 115.644 11.458   38.425  1.00 369.54 ? 76  THR K N     1 
ATOM 10355 C CA    . THR Q  3 63  ? 114.784 12.591   38.032  1.00 356.73 ? 76  THR K CA    1 
ATOM 10356 C C     . THR Q  3 63  ? 114.171 12.450   36.615  1.00 353.16 ? 76  THR K C     1 
ATOM 10357 O O     . THR Q  3 63  ? 114.898 12.375   35.625  1.00 353.70 ? 76  THR K O     1 
ATOM 10358 C CB    . THR Q  3 63  ? 115.537 13.939   38.165  1.00 350.39 ? 76  THR K CB    1 
ATOM 10359 O OG1   . THR Q  3 63  ? 116.491 14.063   37.106  1.00 341.94 ? 76  THR K OG1   1 
ATOM 10360 C CG2   . THR Q  3 63  ? 116.268 14.035   39.499  1.00 348.28 ? 76  THR K CG2   1 
ATOM 10361 N N     . ILE Q  3 64  ? 112.836 12.420   36.537  1.00 346.13 ? 77  ILE K N     1 
ATOM 10362 C CA    . ILE Q  3 64  ? 112.103 12.168   35.283  1.00 333.89 ? 77  ILE K CA    1 
ATOM 10363 C C     . ILE Q  3 64  ? 112.093 13.393   34.382  1.00 341.41 ? 77  ILE K C     1 
ATOM 10364 O O     . ILE Q  3 64  ? 111.834 14.517   34.813  1.00 343.48 ? 77  ILE K O     1 
ATOM 10365 C CB    . ILE Q  3 64  ? 110.649 11.699   35.540  1.00 320.38 ? 77  ILE K CB    1 
ATOM 10366 C CG1   . ILE Q  3 64  ? 110.639 10.346   36.253  1.00 312.73 ? 77  ILE K CG1   1 
ATOM 10367 C CG2   . ILE Q  3 64  ? 109.852 11.618   34.241  1.00 311.93 ? 77  ILE K CG2   1 
ATOM 10368 C CD1   . ILE Q  3 64  ? 109.371 10.085   37.035  1.00 309.91 ? 77  ILE K CD1   1 
ATOM 10369 N N     . ASN Q  3 65  ? 112.374 13.149   33.116  1.00 348.50 ? 78  ASN K N     1 
ATOM 10370 C CA    . ASN Q  3 65  ? 112.402 14.196   32.127  1.00 358.11 ? 78  ASN K CA    1 
ATOM 10371 C C     . ASN Q  3 65  ? 111.433 13.841   31.001  1.00 360.14 ? 78  ASN K C     1 
ATOM 10372 O O     . ASN Q  3 65  ? 110.605 12.933   31.153  1.00 358.45 ? 78  ASN K O     1 
ATOM 10373 C CB    . ASN Q  3 65  ? 113.832 14.383   31.616  1.00 364.79 ? 78  ASN K CB    1 
ATOM 10374 C CG    . ASN Q  3 65  ? 114.487 13.069   31.221  1.00 369.45 ? 78  ASN K CG    1 
ATOM 10375 O OD1   . ASN Q  3 65  ? 113.896 12.243   30.502  1.00 372.89 ? 78  ASN K OD1   1 
ATOM 10376 N ND2   . ASN Q  3 65  ? 115.720 12.870   31.677  1.00 373.48 ? 78  ASN K ND2   1 
ATOM 10377 N N     . THR Q  3 66  ? 111.549 14.546   29.876  1.00 366.22 ? 79  THR K N     1 
ATOM 10378 C CA    . THR Q  3 66  ? 110.637 14.412   28.721  1.00 370.87 ? 79  THR K CA    1 
ATOM 10379 C C     . THR Q  3 66  ? 110.593 13.034   27.993  1.00 372.97 ? 79  THR K C     1 
ATOM 10380 O O     . THR Q  3 66  ? 109.536 12.651   27.464  1.00 374.95 ? 79  THR K O     1 
ATOM 10381 C CB    . THR Q  3 66  ? 110.864 15.550   27.682  1.00 371.62 ? 79  THR K CB    1 
ATOM 10382 O OG1   . THR Q  3 66  ? 112.045 15.301   26.908  1.00 369.27 ? 79  THR K OG1   1 
ATOM 10383 C CG2   . THR Q  3 66  ? 111.003 16.908   28.370  1.00 374.19 ? 79  THR K CG2   1 
ATOM 10384 N N     . GLU Q  3 67  ? 111.720 12.306   27.979  1.00 374.01 ? 80  GLU K N     1 
ATOM 10385 C CA    . GLU Q  3 67  ? 111.870 11.059   27.191  1.00 369.14 ? 80  GLU K CA    1 
ATOM 10386 C C     . GLU Q  3 67  ? 111.066 9.875    27.739  1.00 364.98 ? 80  GLU K C     1 
ATOM 10387 O O     . GLU Q  3 67  ? 110.492 9.081    26.975  1.00 357.08 ? 80  GLU K O     1 
ATOM 10388 C CB    . GLU Q  3 67  ? 113.354 10.685   27.025  1.00 369.99 ? 80  GLU K CB    1 
ATOM 10389 C CG    . GLU Q  3 67  ? 114.204 11.765   26.362  1.00 376.10 ? 80  GLU K CG    1 
ATOM 10390 C CD    . GLU Q  3 67  ? 113.545 12.394   25.137  1.00 379.91 ? 80  GLU K CD    1 
ATOM 10391 O OE1   . GLU Q  3 67  ? 113.543 13.642   25.030  1.00 384.46 ? 80  GLU K OE1   1 
ATOM 10392 O OE2   . GLU Q  3 67  ? 113.026 11.649   24.277  1.00 379.30 ? 80  GLU K OE2   1 
ATOM 10393 N N     . ASP Q  3 68  ? 111.041 9.768    29.063  1.00 368.22 ? 81  ASP K N     1 
ATOM 10394 C CA    . ASP Q  3 68  ? 110.238 8.772    29.764  1.00 367.13 ? 81  ASP K CA    1 
ATOM 10395 C C     . ASP Q  3 68  ? 108.738 8.957    29.466  1.00 367.81 ? 81  ASP K C     1 
ATOM 10396 O O     . ASP Q  3 68  ? 108.030 7.996    29.141  1.00 364.83 ? 81  ASP K O     1 
ATOM 10397 C CB    . ASP Q  3