data_4NKT
# 
_entry.id   4NKT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4NKT         
RCSB  RCSB083328   
WWPDB D_1000083328 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4NKU 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4NKT 
_pdbx_database_status.recvd_initial_deposition_date   2013-11-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Munoz-Tello, P.' 1 
'Gabus, C.'       2 
'Thore, S.'       3 
# 
_citation.id                        primary 
_citation.title                     
'A critical switch in the enzymatic properties of the Cid1 protein deciphered from its product-bound crystal structure.' 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_volume            42 
_citation.page_first                3372 
_citation.page_last                 3380 
_citation.year                      2014 
_citation.journal_id_ASTM           NARHAD 
_citation.country                   UK 
_citation.journal_id_ISSN           0305-1048 
_citation.journal_id_CSD            0389 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24322298 
_citation.pdbx_database_id_DOI      10.1093/nar/gkt1278 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Munoz-Tello, P.' 1 
primary 'Gabus, C.'       2 
primary 'Thore, S.'       3 
# 
_cell.entry_id           4NKT 
_cell.length_a           53.770 
_cell.length_b           77.320 
_cell.length_c           82.110 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.86 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4NKT 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Poly(A) RNA polymerase protein cid1'                                             38984.703 2   2.7.7.- D160A 
'UNP residues 40-377' ? 
2 non-polymer syn "5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]uridine" 483.156   2   ?       ?     ? 
? 
3 non-polymer syn 'BROMIDE ION'                                                                     79.904    3   ?       ?     ? 
? 
4 non-polymer syn 'MAGNESIUM ION'                                                                   24.305    4   ?       ?     ? 
? 
5 water       nat water                                                                             18.015    511 ?       ?     ? 
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Caffeine-induced death protein 1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GDMSHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDT
IALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCAIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWA
KRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFF
RFYAYKFEPREKVVTFRRPDGYLTKQEKGWTSATEHTGSADQIIKDRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMA
ASRLLNSRSYPIPYDSLFEEA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GDMSHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDT
IALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCAIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWA
KRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFF
RFYAYKFEPREKVVTFRRPDGYLTKQEKGWTSATEHTGSADQIIKDRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMA
ASRLLNSRSYPIPYDSLFEEA
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ASP n 
1 3   MET n 
1 4   SER n 
1 5   HIS n 
1 6   LYS n 
1 7   GLU n 
1 8   PHE n 
1 9   THR n 
1 10  LYS n 
1 11  PHE n 
1 12  CYS n 
1 13  TYR n 
1 14  GLU n 
1 15  VAL n 
1 16  TYR n 
1 17  ASN n 
1 18  GLU n 
1 19  ILE n 
1 20  LYS n 
1 21  ILE n 
1 22  SER n 
1 23  ASP n 
1 24  LYS n 
1 25  GLU n 
1 26  PHE n 
1 27  LYS n 
1 28  GLU n 
1 29  LYS n 
1 30  ARG n 
1 31  ALA n 
1 32  ALA n 
1 33  LEU n 
1 34  ASP n 
1 35  THR n 
1 36  LEU n 
1 37  ARG n 
1 38  LEU n 
1 39  CYS n 
1 40  LEU n 
1 41  LYS n 
1 42  ARG n 
1 43  ILE n 
1 44  SER n 
1 45  PRO n 
1 46  ASP n 
1 47  ALA n 
1 48  GLU n 
1 49  LEU n 
1 50  VAL n 
1 51  ALA n 
1 52  PHE n 
1 53  GLY n 
1 54  SER n 
1 55  LEU n 
1 56  GLU n 
1 57  SER n 
1 58  GLY n 
1 59  LEU n 
1 60  ALA n 
1 61  LEU n 
1 62  LYS n 
1 63  ASN n 
1 64  SER n 
1 65  ASP n 
1 66  MET n 
1 67  ASP n 
1 68  LEU n 
1 69  CYS n 
1 70  VAL n 
1 71  LEU n 
1 72  MET n 
1 73  ASP n 
1 74  SER n 
1 75  ARG n 
1 76  VAL n 
1 77  GLN n 
1 78  SER n 
1 79  ASP n 
1 80  THR n 
1 81  ILE n 
1 82  ALA n 
1 83  LEU n 
1 84  GLN n 
1 85  PHE n 
1 86  TYR n 
1 87  GLU n 
1 88  GLU n 
1 89  LEU n 
1 90  ILE n 
1 91  ALA n 
1 92  GLU n 
1 93  GLY n 
1 94  PHE n 
1 95  GLU n 
1 96  GLY n 
1 97  LYS n 
1 98  PHE n 
1 99  LEU n 
1 100 GLN n 
1 101 ARG n 
1 102 ALA n 
1 103 ARG n 
1 104 ILE n 
1 105 PRO n 
1 106 ILE n 
1 107 ILE n 
1 108 LYS n 
1 109 LEU n 
1 110 THR n 
1 111 SER n 
1 112 ASP n 
1 113 THR n 
1 114 LYS n 
1 115 ASN n 
1 116 GLY n 
1 117 PHE n 
1 118 GLY n 
1 119 ALA n 
1 120 SER n 
1 121 PHE n 
1 122 GLN n 
1 123 CYS n 
1 124 ALA n 
1 125 ILE n 
1 126 GLY n 
1 127 PHE n 
1 128 ASN n 
1 129 ASN n 
1 130 ARG n 
1 131 LEU n 
1 132 ALA n 
1 133 ILE n 
1 134 HIS n 
1 135 ASN n 
1 136 THR n 
1 137 LEU n 
1 138 LEU n 
1 139 LEU n 
1 140 SER n 
1 141 SER n 
1 142 TYR n 
1 143 THR n 
1 144 LYS n 
1 145 LEU n 
1 146 ASP n 
1 147 ALA n 
1 148 ARG n 
1 149 LEU n 
1 150 LYS n 
1 151 PRO n 
1 152 MET n 
1 153 VAL n 
1 154 LEU n 
1 155 LEU n 
1 156 VAL n 
1 157 LYS n 
1 158 HIS n 
1 159 TRP n 
1 160 ALA n 
1 161 LYS n 
1 162 ARG n 
1 163 LYS n 
1 164 GLN n 
1 165 ILE n 
1 166 ASN n 
1 167 SER n 
1 168 PRO n 
1 169 TYR n 
1 170 PHE n 
1 171 GLY n 
1 172 THR n 
1 173 LEU n 
1 174 SER n 
1 175 SER n 
1 176 TYR n 
1 177 GLY n 
1 178 TYR n 
1 179 VAL n 
1 180 LEU n 
1 181 MET n 
1 182 VAL n 
1 183 LEU n 
1 184 TYR n 
1 185 TYR n 
1 186 LEU n 
1 187 ILE n 
1 188 HIS n 
1 189 VAL n 
1 190 ILE n 
1 191 LYS n 
1 192 PRO n 
1 193 PRO n 
1 194 VAL n 
1 195 PHE n 
1 196 PRO n 
1 197 ASN n 
1 198 LEU n 
1 199 LEU n 
1 200 LEU n 
1 201 SER n 
1 202 PRO n 
1 203 LEU n 
1 204 LYS n 
1 205 GLN n 
1 206 GLU n 
1 207 LYS n 
1 208 ILE n 
1 209 VAL n 
1 210 ASP n 
1 211 GLY n 
1 212 PHE n 
1 213 ASP n 
1 214 VAL n 
1 215 GLY n 
1 216 PHE n 
1 217 ASP n 
1 218 ASP n 
1 219 LYS n 
1 220 LEU n 
1 221 GLU n 
1 222 ASP n 
1 223 ILE n 
1 224 PRO n 
1 225 PRO n 
1 226 SER n 
1 227 GLN n 
1 228 ASN n 
1 229 TYR n 
1 230 SER n 
1 231 SER n 
1 232 LEU n 
1 233 GLY n 
1 234 SER n 
1 235 LEU n 
1 236 LEU n 
1 237 HIS n 
1 238 GLY n 
1 239 PHE n 
1 240 PHE n 
1 241 ARG n 
1 242 PHE n 
1 243 TYR n 
1 244 ALA n 
1 245 TYR n 
1 246 LYS n 
1 247 PHE n 
1 248 GLU n 
1 249 PRO n 
1 250 ARG n 
1 251 GLU n 
1 252 LYS n 
1 253 VAL n 
1 254 VAL n 
1 255 THR n 
1 256 PHE n 
1 257 ARG n 
1 258 ARG n 
1 259 PRO n 
1 260 ASP n 
1 261 GLY n 
1 262 TYR n 
1 263 LEU n 
1 264 THR n 
1 265 LYS n 
1 266 GLN n 
1 267 GLU n 
1 268 LYS n 
1 269 GLY n 
1 270 TRP n 
1 271 THR n 
1 272 SER n 
1 273 ALA n 
1 274 THR n 
1 275 GLU n 
1 276 HIS n 
1 277 THR n 
1 278 GLY n 
1 279 SER n 
1 280 ALA n 
1 281 ASP n 
1 282 GLN n 
1 283 ILE n 
1 284 ILE n 
1 285 LYS n 
1 286 ASP n 
1 287 ARG n 
1 288 TYR n 
1 289 ILE n 
1 290 LEU n 
1 291 ALA n 
1 292 ILE n 
1 293 GLU n 
1 294 ASP n 
1 295 PRO n 
1 296 PHE n 
1 297 GLU n 
1 298 ILE n 
1 299 SER n 
1 300 HIS n 
1 301 ASN n 
1 302 VAL n 
1 303 GLY n 
1 304 ARG n 
1 305 THR n 
1 306 VAL n 
1 307 SER n 
1 308 SER n 
1 309 SER n 
1 310 GLY n 
1 311 LEU n 
1 312 TYR n 
1 313 ARG n 
1 314 ILE n 
1 315 ARG n 
1 316 GLY n 
1 317 GLU n 
1 318 PHE n 
1 319 MET n 
1 320 ALA n 
1 321 ALA n 
1 322 SER n 
1 323 ARG n 
1 324 LEU n 
1 325 LEU n 
1 326 ASN n 
1 327 SER n 
1 328 ARG n 
1 329 SER n 
1 330 TYR n 
1 331 PRO n 
1 332 ILE n 
1 333 PRO n 
1 334 TYR n 
1 335 ASP n 
1 336 SER n 
1 337 LEU n 
1 338 PHE n 
1 339 GLU n 
1 340 GLU n 
1 341 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Fission yeast' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'cid1, SPAC19D5.03' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Schizosaccharomyces pombe' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     4896 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 Star' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET42-based 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CID1_SCHPO 
_struct_ref.pdbx_db_accession          O13833 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIAL
QFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRK
QINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFY
AYKFEPREKVVTFRRPDGYLTKQEKGWTSATEHTGSADQIIKDRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASR
LLNSRSYPIPYDSLFEEA
;
_struct_ref.pdbx_align_begin           40 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4NKT A 4 ? 341 ? O13833 40 ? 377 ? 40 377 
2 1 4NKT B 4 ? 341 ? O13833 40 ? 377 ? 40 377 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4NKT GLY A 1   ? UNP O13833 ?   ?   'EXPRESSION TAG'      37  1 
1 4NKT ASP A 2   ? UNP O13833 ?   ?   'EXPRESSION TAG'      38  2 
1 4NKT MET A 3   ? UNP O13833 ?   ?   'EXPRESSION TAG'      39  3 
1 4NKT ALA A 124 ? UNP O13833 ASP 160 'ENGINEERED MUTATION' 160 4 
2 4NKT GLY B 1   ? UNP O13833 ?   ?   'EXPRESSION TAG'      37  5 
2 4NKT ASP B 2   ? UNP O13833 ?   ?   'EXPRESSION TAG'      38  6 
2 4NKT MET B 3   ? UNP O13833 ?   ?   'EXPRESSION TAG'      39  7 
2 4NKT ALA B 124 ? UNP O13833 ASP 160 'ENGINEERED MUTATION' 160 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2KH non-polymer         . "5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]uridine" ? 'C9 H16 N3 O14 P3' 
483.156 
ALA 'L-peptide linking' y ALANINE                                                                           ? 'C3 H7 N O2'       
89.093  
ARG 'L-peptide linking' y ARGININE                                                                          ? 'C6 H15 N4 O2 1'   
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                        ? 'C4 H8 N2 O3'      
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                   ? 'C4 H7 N O4'       
133.103 
BR  non-polymer         . 'BROMIDE ION'                                                                     ? 'Br -1'            
79.904  
CYS 'L-peptide linking' y CYSTEINE                                                                          ? 'C3 H7 N O2 S'     
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                         ? 'C5 H10 N2 O3'     
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                   ? 'C5 H9 N O4'       
147.129 
GLY 'peptide linking'   y GLYCINE                                                                           ? 'C2 H5 N O2'       
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                         ? 'C6 H10 N3 O2 1'   
156.162 
HOH non-polymer         . WATER                                                                             ? 'H2 O'             
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                        ? 'C6 H13 N O2'      
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                           ? 'C6 H13 N O2'      
131.173 
LYS 'L-peptide linking' y LYSINE                                                                            ? 'C6 H15 N2 O2 1'   
147.195 
MET 'L-peptide linking' y METHIONINE                                                                        ? 'C5 H11 N O2 S'    
149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                                   ? 'Mg 2'             
24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                                                     ? 'C9 H11 N O2'      
165.189 
PRO 'L-peptide linking' y PROLINE                                                                           ? 'C5 H9 N O2'       
115.130 
SER 'L-peptide linking' y SERINE                                                                            ? 'C3 H7 N O3'       
105.093 
THR 'L-peptide linking' y THREONINE                                                                         ? 'C4 H9 N O3'       
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                        ? 'C11 H12 N2 O2'    
204.225 
TYR 'L-peptide linking' y TYROSINE                                                                          ? 'C9 H11 N O3'      
181.189 
VAL 'L-peptide linking' y VALINE                                                                            ? 'C5 H11 N O2'      
117.146 
# 
_exptl.entry_id          4NKT 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.19 
_exptl_crystal.density_percent_sol   43.81 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.1 
_exptl_crystal_grow.pdbx_details    
;0.1 M imidazole/MES, pH 6.1, 20% glycerol, 10% PEG4000, 126 mM halogens (sodium iodide, sodium bromide, sodium fluoride), 10 mM TCEP, VAPOR DIFFUSION, SITTING DROP, temperature 291K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2012-06-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'channel cut Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9394 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9394 
# 
_reflns.entry_id                     4NKT 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             45.0 
_reflns.d_resolution_high            1.90 
_reflns.number_obs                   52778 
_reflns.number_all                   53096 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            0.044 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        27.41 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.9 
_reflns_shell.d_res_low              ? 
_reflns_shell.percent_possible_all   99.7 
_reflns_shell.Rmerge_I_obs           0.044 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    11.19 
_reflns_shell.pdbx_redundancy        4.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4NKT 
_refine.ls_number_reflns_obs                     52778 
_refine.ls_number_reflns_all                     53096 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.99 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.838 
_refine.ls_d_res_high                            1.900 
_refine.ls_percent_reflns_obs                    99.4 
_refine.ls_R_factor_obs                          0.1801 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1794 
_refine.ls_R_factor_R_free                       0.2125 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.07 
_refine.ls_number_reflns_R_free                  1091 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 4EP7' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.15 
_refine.pdbx_overall_phase_error                 21.42 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5089 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         65 
_refine_hist.number_atoms_solvent             511 
_refine_hist.number_atoms_total               5665 
_refine_hist.d_res_high                       1.900 
_refine_hist.d_res_low                        19.838 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.008  ? ? 5297 ? 'X-RAY DIFFRACTION' 
f_angle_d          1.082  ? ? 7162 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 14.898 ? ? 1999 ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.077  ? ? 785  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.004  ? ? 892  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 1.9000 1.9864  6480 0.1955 100.0 0.2337 . . 133 . . . . 'X-RAY DIFFRACTION' 
. 1.9864 2.0910  6444 0.1879 100.0 0.2557 . . 148 . . . . 'X-RAY DIFFRACTION' 
. 2.0910 2.2219  6443 0.1861 100.0 0.2105 . . 135 . . . . 'X-RAY DIFFRACTION' 
. 2.2219 2.3932  6443 0.1831 100.0 0.2264 . . 130 . . . . 'X-RAY DIFFRACTION' 
. 2.3932 2.6335  6495 0.1851 100.0 0.2596 . . 136 . . . . 'X-RAY DIFFRACTION' 
. 2.6335 3.0135  6484 0.1933 100.0 0.2307 . . 137 . . . . 'X-RAY DIFFRACTION' 
. 3.0135 3.7923  6510 0.1714 100.0 0.1935 . . 142 . . . . 'X-RAY DIFFRACTION' 
. 3.7923 19.8392 6388 0.1677 97.0  0.1819 . . 130 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4NKT 
_struct.title                     'Structure of Cid1 in complex with the UTP analog UMPNPP' 
_struct.pdbx_descriptor           'Poly(A) RNA polymerase protein cid1 (E.C.2.7.7.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4NKT 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'poly(U) polymerase, nucleotidyl tranfer domain, PAP-associated domain, UTP binding, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 5 ? 
M N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  HIS A 5   ? LYS A 20  ? HIS A 41  LYS A 56  1 ? 16 
HELX_P HELX_P2  2  SER A 22  ? ARG A 42  ? SER A 58  ARG A 78  1 ? 21 
HELX_P HELX_P3  3  GLY A 53  ? GLY A 58  ? GLY A 89  GLY A 94  1 ? 6  
HELX_P HELX_P4  4  ILE A 81  ? GLU A 92  ? ILE A 117 GLU A 128 1 ? 12 
HELX_P HELX_P5  5  ASN A 129 ? ASP A 146 ? ASN A 165 ASP A 182 1 ? 18 
HELX_P HELX_P6  6  ARG A 148 ? LYS A 163 ? ARG A 184 LYS A 199 1 ? 16 
HELX_P HELX_P7  7  SER A 167 ? GLY A 171 ? SER A 203 GLY A 207 5 ? 5  
HELX_P HELX_P8  8  SER A 174 ? VAL A 189 ? SER A 210 VAL A 225 1 ? 16 
HELX_P HELX_P9  9  LYS A 219 ? ILE A 223 ? LYS A 255 ILE A 259 5 ? 5  
HELX_P HELX_P10 10 SER A 231 ? LYS A 246 ? SER A 267 LYS A 282 1 ? 16 
HELX_P HELX_P11 11 THR A 264 ? GLY A 269 ? THR A 300 GLY A 305 1 ? 6  
HELX_P HELX_P12 12 SER A 307 ? ASN A 326 ? SER A 343 ASN A 362 1 ? 20 
HELX_P HELX_P13 13 PRO A 333 ? GLU A 339 ? PRO A 369 GLU A 375 5 ? 7  
HELX_P HELX_P14 14 HIS B 5   ? LYS B 20  ? HIS B 41  LYS B 56  1 ? 16 
HELX_P HELX_P15 15 SER B 22  ? SER B 44  ? SER B 58  SER B 80  1 ? 23 
HELX_P HELX_P16 16 GLY B 53  ? GLY B 58  ? GLY B 89  GLY B 94  1 ? 6  
HELX_P HELX_P17 17 ILE B 81  ? ALA B 91  ? ILE B 117 ALA B 127 1 ? 11 
HELX_P HELX_P18 18 ASN B 129 ? ASP B 146 ? ASN B 165 ASP B 182 1 ? 18 
HELX_P HELX_P19 19 ARG B 148 ? LYS B 163 ? ARG B 184 LYS B 199 1 ? 16 
HELX_P HELX_P20 20 SER B 167 ? GLY B 171 ? SER B 203 GLY B 207 5 ? 5  
HELX_P HELX_P21 21 SER B 174 ? VAL B 189 ? SER B 210 VAL B 225 1 ? 16 
HELX_P HELX_P22 22 ASN B 197 ? SER B 201 ? ASN B 233 SER B 237 5 ? 5  
HELX_P HELX_P23 23 LYS B 219 ? ILE B 223 ? LYS B 255 ILE B 259 5 ? 5  
HELX_P HELX_P24 24 SER B 231 ? LYS B 246 ? SER B 267 LYS B 282 1 ? 16 
HELX_P HELX_P25 25 THR B 264 ? GLY B 269 ? THR B 300 GLY B 305 1 ? 6  
HELX_P HELX_P26 26 ASN B 301 ? VAL B 306 ? ASN B 337 VAL B 342 5 ? 6  
HELX_P HELX_P27 27 SER B 307 ? ASN B 326 ? SER B 343 ASN B 362 1 ? 20 
HELX_P HELX_P28 28 PRO B 333 ? GLU B 339 ? PRO B 369 GLU B 375 5 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            metalc1 
_struct_conn.conn_type_id                  metalc 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           B 
_struct_conn.ptnr1_label_comp_id           ASN 
_struct_conn.ptnr1_label_seq_id            326 
_struct_conn.ptnr1_label_atom_id           OD1 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           I 
_struct_conn.ptnr2_label_comp_id           MG 
_struct_conn.ptnr2_label_seq_id            . 
_struct_conn.ptnr2_label_atom_id           MG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            B 
_struct_conn.ptnr1_auth_comp_id            ASN 
_struct_conn.ptnr1_auth_seq_id             362 
_struct_conn.ptnr2_auth_asym_id            B 
_struct_conn.ptnr2_auth_comp_id            MG 
_struct_conn.ptnr2_auth_seq_id             403 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.916 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 191 A . ? LYS 227 A PRO 192 A ? PRO 228 A 1 -4.64 
2 TYR 330 A . ? TYR 366 A PRO 331 A ? PRO 367 A 1 -6.35 
3 LYS 191 B . ? LYS 227 B PRO 192 B ? PRO 228 B 1 -6.13 
4 TYR 330 B . ? TYR 366 B PRO 331 B ? PRO 367 B 1 1.36  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 5 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 48  ? PHE A 52  ? GLU A 84  PHE A 88  
A 2 MET A 66  ? LEU A 71  ? MET A 102 LEU A 107 
A 3 CYS A 123 ? PHE A 127 ? CYS A 159 PHE A 163 
A 4 ILE A 107 ? ASP A 112 ? ILE A 143 ASP A 148 
A 5 PHE A 94  ? PHE A 98  ? PHE A 130 PHE A 134 
B 1 ILE A 208 ? VAL A 209 ? ILE A 244 VAL A 245 
B 2 PHE A 212 ? ASP A 213 ? PHE A 248 ASP A 249 
C 1 GLU B 48  ? PHE B 52  ? GLU B 84  PHE B 88  
C 2 MET B 66  ? LEU B 71  ? MET B 102 LEU B 107 
C 3 CYS B 123 ? PHE B 127 ? CYS B 159 PHE B 163 
C 4 ILE B 106 ? SER B 111 ? ILE B 142 SER B 147 
C 5 GLU B 95  ? LEU B 99  ? GLU B 131 LEU B 135 
D 1 ILE B 208 ? VAL B 209 ? ILE B 244 VAL B 245 
D 2 PHE B 212 ? ASP B 213 ? PHE B 248 ASP B 249 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 50  ? N VAL A 86  O CYS A 69  ? O CYS A 105 
A 2 3 N LEU A 68  ? N LEU A 104 O ALA A 124 ? O ALA A 160 
A 3 4 O ILE A 125 ? O ILE A 161 N ILE A 107 ? N ILE A 143 
A 4 5 O THR A 110 ? O THR A 146 N GLU A 95  ? N GLU A 131 
B 1 2 N VAL A 209 ? N VAL A 245 O PHE A 212 ? O PHE A 248 
C 1 2 N VAL B 50  ? N VAL B 86  O CYS B 69  ? O CYS B 105 
C 2 3 N VAL B 70  ? N VAL B 106 O GLY B 126 ? O GLY B 162 
C 3 4 O CYS B 123 ? O CYS B 159 N LEU B 109 ? N LEU B 145 
C 4 5 O LYS B 108 ? O LYS B 144 N LYS B 97  ? N LYS B 133 
D 1 2 N VAL B 209 ? N VAL B 245 O PHE B 212 ? O PHE B 248 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 28 'BINDING SITE FOR RESIDUE 2KH A 401' 
AC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE BR A 402'  
AC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE BR A 403'  
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG A 404'  
AC5 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE 2KH B 401' 
AC6 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE BR B 402'  
AC7 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG B 403'  
AC8 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG B 404'  
AC9 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG B 405'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 28 PHE A 52  ? PHE A 88  . ? 1_555 ? 
2  AC1 28 GLY A 53  ? GLY A 89  . ? 1_555 ? 
3  AC1 28 SER A 54  ? SER A 90  . ? 1_555 ? 
4  AC1 28 ASP A 67  ? ASP A 103 . ? 1_555 ? 
5  AC1 28 ALA A 132 ? ALA A 168 . ? 1_555 ? 
6  AC1 28 ASN A 135 ? ASN A 171 . ? 1_555 ? 
7  AC1 28 THR A 136 ? THR A 172 . ? 1_555 ? 
8  AC1 28 LYS A 157 ? LYS A 193 . ? 1_555 ? 
9  AC1 28 LYS A 161 ? LYS A 197 . ? 1_555 ? 
10 AC1 28 ASN A 166 ? ASN A 202 . ? 1_555 ? 
11 AC1 28 SER A 174 ? SER A 210 . ? 1_555 ? 
12 AC1 28 SER A 175 ? SER A 211 . ? 1_555 ? 
13 AC1 28 TYR A 176 ? TYR A 212 . ? 1_555 ? 
14 AC1 28 HIS A 300 ? HIS A 336 . ? 1_555 ? 
15 AC1 28 BR  E .   ? BR  A 403 . ? 1_555 ? 
16 AC1 28 MG  F .   ? MG  A 404 . ? 1_555 ? 
17 AC1 28 HOH L .   ? HOH A 512 . ? 1_555 ? 
18 AC1 28 HOH L .   ? HOH A 532 . ? 1_555 ? 
19 AC1 28 HOH L .   ? HOH A 537 . ? 1_555 ? 
20 AC1 28 HOH L .   ? HOH A 562 . ? 1_555 ? 
21 AC1 28 HOH L .   ? HOH A 583 . ? 1_555 ? 
22 AC1 28 HOH L .   ? HOH A 628 . ? 1_555 ? 
23 AC1 28 HOH L .   ? HOH A 673 . ? 1_555 ? 
24 AC1 28 HOH L .   ? HOH A 688 . ? 1_555 ? 
25 AC1 28 HOH L .   ? HOH A 701 . ? 1_555 ? 
26 AC1 28 HOH L .   ? HOH A 772 . ? 1_555 ? 
27 AC1 28 HOH L .   ? HOH A 792 . ? 1_555 ? 
28 AC1 28 HOH L .   ? HOH A 793 . ? 1_555 ? 
29 AC2 2  ARG A 241 ? ARG A 277 . ? 1_555 ? 
30 AC2 2  HOH L .   ? HOH A 784 . ? 1_555 ? 
31 AC3 1  2KH C .   ? 2KH A 401 . ? 1_555 ? 
32 AC4 2  ASN A 129 ? ASN A 165 . ? 1_555 ? 
33 AC4 2  2KH C .   ? 2KH A 401 . ? 1_555 ? 
34 AC5 22 PHE B 52  ? PHE B 88  . ? 1_555 ? 
35 AC5 22 GLY B 53  ? GLY B 89  . ? 1_555 ? 
36 AC5 22 SER B 54  ? SER B 90  . ? 1_555 ? 
37 AC5 22 ASP B 65  ? ASP B 101 . ? 1_555 ? 
38 AC5 22 ALA B 132 ? ALA B 168 . ? 1_555 ? 
39 AC5 22 ASN B 135 ? ASN B 171 . ? 1_555 ? 
40 AC5 22 THR B 136 ? THR B 172 . ? 1_555 ? 
41 AC5 22 LYS B 157 ? LYS B 193 . ? 1_555 ? 
42 AC5 22 LYS B 161 ? LYS B 197 . ? 1_555 ? 
43 AC5 22 ASN B 166 ? ASN B 202 . ? 1_555 ? 
44 AC5 22 SER B 174 ? SER B 210 . ? 1_555 ? 
45 AC5 22 SER B 175 ? SER B 211 . ? 1_555 ? 
46 AC5 22 TYR B 176 ? TYR B 212 . ? 1_555 ? 
47 AC5 22 HIS B 300 ? HIS B 336 . ? 1_555 ? 
48 AC5 22 BR  H .   ? BR  B 402 . ? 1_555 ? 
49 AC5 22 MG  J .   ? MG  B 404 . ? 1_555 ? 
50 AC5 22 HOH M .   ? HOH B 507 . ? 1_555 ? 
51 AC5 22 HOH M .   ? HOH B 546 . ? 1_555 ? 
52 AC5 22 HOH M .   ? HOH B 573 . ? 1_555 ? 
53 AC5 22 HOH M .   ? HOH B 648 . ? 1_555 ? 
54 AC5 22 HOH M .   ? HOH B 658 . ? 1_555 ? 
55 AC5 22 HOH M .   ? HOH B 693 . ? 1_555 ? 
56 AC6 1  2KH G .   ? 2KH B 401 . ? 1_555 ? 
57 AC7 1  ASN B 326 ? ASN B 362 . ? 1_555 ? 
58 AC8 2  ASN B 129 ? ASN B 165 . ? 1_555 ? 
59 AC8 2  2KH G .   ? 2KH B 401 . ? 1_555 ? 
60 AC9 1  THR B 9   ? THR B 45  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4NKT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4NKT 
_atom_sites.fract_transf_matrix[1][1]   0.018598 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000280 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012933 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012180 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ASP A 1 2   ? 68.816 -8.162  76.280  1.00 35.25 ? 38  ASP A N     1 
ATOM   2    C  CA    . ASP A 1 2   ? 69.401 -8.117  77.618  1.00 27.94 ? 38  ASP A CA    1 
ATOM   3    C  C     . ASP A 1 2   ? 68.513 -8.799  78.655  1.00 24.00 ? 38  ASP A C     1 
ATOM   4    O  O     . ASP A 1 2   ? 67.599 -8.172  79.198  1.00 28.79 ? 38  ASP A O     1 
ATOM   5    C  CB    . ASP A 1 2   ? 69.650 -6.669  78.032  1.00 24.19 ? 38  ASP A CB    1 
ATOM   6    C  CG    . ASP A 1 2   ? 70.137 -6.552  79.455  1.00 20.52 ? 38  ASP A CG    1 
ATOM   7    O  OD1   . ASP A 1 2   ? 70.732 -7.524  79.975  1.00 22.79 ? 38  ASP A OD1   1 
ATOM   8    O  OD2   . ASP A 1 2   ? 69.934 -5.484  80.058  1.00 18.60 ? 38  ASP A OD2   1 
ATOM   9    N  N     . MET A 1 3   ? 68.783 -10.072 78.945  1.00 20.32 ? 39  MET A N     1 
ATOM   10   C  CA    . MET A 1 3   ? 68.030 -10.786 79.980  1.00 20.98 ? 39  MET A CA    1 
ATOM   11   C  C     . MET A 1 3   ? 68.804 -10.918 81.297  1.00 20.03 ? 39  MET A C     1 
ATOM   12   O  O     . MET A 1 3   ? 68.381 -11.635 82.205  1.00 21.91 ? 39  MET A O     1 
ATOM   13   C  CB    . MET A 1 3   ? 67.580 -12.163 79.476  1.00 24.48 ? 39  MET A CB    1 
ATOM   14   C  CG    . MET A 1 3   ? 66.655 -12.112 78.270  1.00 23.79 ? 39  MET A CG    1 
ATOM   15   S  SD    . MET A 1 3   ? 65.155 -11.126 78.580  1.00 30.33 ? 39  MET A SD    1 
ATOM   16   C  CE    . MET A 1 3   ? 65.073 -10.238 77.015  1.00 21.38 ? 39  MET A CE    1 
ATOM   17   N  N     . SER A 1 4   ? 69.917 -10.197 81.403  1.00 20.14 ? 40  SER A N     1 
ATOM   18   C  CA    . SER A 1 4   ? 70.800 -10.274 82.574  1.00 22.64 ? 40  SER A CA    1 
ATOM   19   C  C     . SER A 1 4   ? 70.102 -9.923  83.899  1.00 28.34 ? 40  SER A C     1 
ATOM   20   O  O     . SER A 1 4   ? 70.444 -10.450 84.969  1.00 27.83 ? 40  SER A O     1 
ATOM   21   C  CB    . SER A 1 4   ? 72.007 -9.351  82.371  1.00 22.26 ? 40  SER A CB    1 
ATOM   22   O  OG    . SER A 1 4   ? 71.606 -7.989  82.216  1.00 22.51 ? 40  SER A OG    1 
ATOM   23   N  N     . HIS A 1 5   ? 69.117 -9.035  83.819  1.00 20.52 ? 41  HIS A N     1 
ATOM   24   C  CA    . HIS A 1 5   ? 68.464 -8.501  85.012  1.00 17.62 ? 41  HIS A CA    1 
ATOM   25   C  C     . HIS A 1 5   ? 66.953 -8.623  84.915  1.00 17.10 ? 41  HIS A C     1 
ATOM   26   O  O     . HIS A 1 5   ? 66.219 -7.723  85.319  1.00 13.65 ? 41  HIS A O     1 
ATOM   27   C  CB    . HIS A 1 5   ? 68.852 -7.033  85.199  1.00 15.13 ? 41  HIS A CB    1 
ATOM   28   C  CG    . HIS A 1 5   ? 70.282 -6.836  85.605  1.00 15.92 ? 41  HIS A CG    1 
ATOM   29   N  ND1   . HIS A 1 5   ? 71.332 -7.017  84.732  1.00 16.95 ? 41  HIS A ND1   1 
ATOM   30   C  CD2   . HIS A 1 5   ? 70.835 -6.484  86.791  1.00 19.53 ? 41  HIS A CD2   1 
ATOM   31   C  CE1   . HIS A 1 5   ? 72.472 -6.776  85.359  1.00 22.79 ? 41  HIS A CE1   1 
ATOM   32   N  NE2   . HIS A 1 5   ? 72.198 -6.455  86.612  1.00 20.74 ? 41  HIS A NE2   1 
ATOM   33   N  N     . LYS A 1 6   ? 66.490 -9.745  84.379  1.00 15.68 ? 42  LYS A N     1 
ATOM   34   C  CA    . LYS A 1 6   ? 65.064 -9.920  84.108  1.00 18.87 ? 42  LYS A CA    1 
ATOM   35   C  C     . LYS A 1 6   ? 64.205 -9.789  85.370  1.00 15.33 ? 42  LYS A C     1 
ATOM   36   O  O     . LYS A 1 6   ? 63.241 -9.017  85.385  1.00 15.51 ? 42  LYS A O     1 
ATOM   37   C  CB    . LYS A 1 6   ? 64.799 -11.261 83.408  1.00 17.61 ? 42  LYS A CB    1 
ATOM   38   C  CG    . LYS A 1 6   ? 63.356 -11.419 82.946  1.00 24.20 ? 42  LYS A CG    1 
ATOM   39   C  CD    . LYS A 1 6   ? 63.146 -12.714 82.155  1.00 29.90 ? 42  LYS A CD    1 
ATOM   40   C  CE    . LYS A 1 6   ? 63.074 -13.912 83.075  1.00 25.82 ? 42  LYS A CE    1 
ATOM   41   N  NZ    . LYS A 1 6   ? 63.247 -15.204 82.343  1.00 37.60 ? 42  LYS A NZ    1 
ATOM   42   N  N     . GLU A 1 7   ? 64.548 -10.518 86.434  1.00 15.01 ? 43  GLU A N     1 
ATOM   43   C  CA    . GLU A 1 7   ? 63.734 -10.470 87.657  1.00 12.84 ? 43  GLU A CA    1 
ATOM   44   C  C     . GLU A 1 7   ? 63.780 -9.120  88.368  1.00 16.72 ? 43  GLU A C     1 
ATOM   45   O  O     . GLU A 1 7   ? 62.766 -8.648  88.902  1.00 13.42 ? 43  GLU A O     1 
ATOM   46   C  CB    . GLU A 1 7   ? 64.115 -11.594 88.635  1.00 23.82 ? 43  GLU A CB    1 
ATOM   47   C  CG    . GLU A 1 7   ? 63.489 -12.959 88.301  1.00 29.72 ? 43  GLU A CG    1 
ATOM   48   C  CD    . GLU A 1 7   ? 61.970 -12.893 88.077  1.00 41.66 ? 43  GLU A CD    1 
ATOM   49   O  OE1   . GLU A 1 7   ? 61.219 -12.617 89.052  1.00 34.26 ? 43  GLU A OE1   1 
ATOM   50   O  OE2   . GLU A 1 7   ? 61.527 -13.123 86.920  1.00 37.97 ? 43  GLU A OE2   1 
ATOM   51   N  N     . PHE A 1 8   ? 64.958 -8.504  88.395  1.00 11.73 ? 44  PHE A N     1 
ATOM   52   C  CA    . PHE A 1 8   ? 65.089 -7.201  89.048  1.00 15.14 ? 44  PHE A CA    1 
ATOM   53   C  C     . PHE A 1 8   ? 64.274 -6.156  88.293  1.00 11.06 ? 44  PHE A C     1 
ATOM   54   O  O     . PHE A 1 8   ? 63.616 -5.297  88.906  1.00 11.92 ? 44  PHE A O     1 
ATOM   55   C  CB    . PHE A 1 8   ? 66.566 -6.798  89.153  1.00 13.65 ? 44  PHE A CB    1 
ATOM   56   C  CG    . PHE A 1 8   ? 66.787 -5.425  89.752  1.00 12.35 ? 44  PHE A CG    1 
ATOM   57   C  CD1   . PHE A 1 8   ? 66.160 -5.048  90.926  1.00 14.32 ? 44  PHE A CD1   1 
ATOM   58   C  CD2   . PHE A 1 8   ? 67.653 -4.526  89.141  1.00 11.89 ? 44  PHE A CD2   1 
ATOM   59   C  CE1   . PHE A 1 8   ? 66.367 -3.777  91.481  1.00 14.11 ? 44  PHE A CE1   1 
ATOM   60   C  CE2   . PHE A 1 8   ? 67.872 -3.263  89.687  1.00 13.37 ? 44  PHE A CE2   1 
ATOM   61   C  CZ    . PHE A 1 8   ? 67.225 -2.891  90.862  1.00 14.84 ? 44  PHE A CZ    1 
ATOM   62   N  N     . THR A 1 9   ? 64.309 -6.242  86.964  1.00 10.94 ? 45  THR A N     1 
ATOM   63   C  CA    . THR A 1 9   ? 63.547 -5.330  86.112  1.00 12.41 ? 45  THR A CA    1 
ATOM   64   C  C     . THR A 1 9   ? 62.048 -5.486  86.338  1.00 12.57 ? 45  THR A C     1 
ATOM   65   O  O     . THR A 1 9   ? 61.329 -4.495  86.449  1.00 11.19 ? 45  THR A O     1 
ATOM   66   C  CB    . THR A 1 9   ? 63.884 -5.523  84.620  1.00 12.15 ? 45  THR A CB    1 
ATOM   67   O  OG1   . THR A 1 9   ? 65.270 -5.233  84.417  1.00 10.73 ? 45  THR A OG1   1 
ATOM   68   C  CG2   . THR A 1 9   ? 63.060 -4.566  83.754  1.00 10.84 ? 45  THR A CG2   1 
ATOM   69   N  N     . LYS A 1 10  ? 61.573 -6.726  86.427  1.00 12.49 ? 46  LYS A N     1 
ATOM   70   C  CA    . LYS A 1 10  ? 60.169 -6.960  86.770  1.00 13.28 ? 46  LYS A CA    1 
ATOM   71   C  C     . LYS A 1 10  ? 59.789 -6.256  88.073  1.00 13.35 ? 46  LYS A C     1 
ATOM   72   O  O     . LYS A 1 10  ? 58.788 -5.539  88.132  1.00 14.12 ? 46  LYS A O     1 
ATOM   73   C  CB    . LYS A 1 10  ? 59.876 -8.467  86.861  1.00 18.42 ? 46  LYS A CB    1 
ATOM   74   C  CG    . LYS A 1 10  ? 58.466 -8.804  87.353  1.00 19.24 ? 46  LYS A CG    1 
ATOM   75   C  CD    . LYS A 1 10  ? 58.184 -10.312 87.203  1.00 22.00 ? 46  LYS A CD    1 
ATOM   76   C  CE    . LYS A 1 10  ? 56.710 -10.618 87.474  1.00 23.58 ? 46  LYS A CE    1 
ATOM   77   N  NZ    . LYS A 1 10  ? 56.365 -10.507 88.924  1.00 28.79 ? 46  LYS A NZ    1 
ATOM   78   N  N     . PHE A 1 11  ? 60.606 -6.445  89.104  1.00 12.02 ? 47  PHE A N     1 
ATOM   79   C  CA    . PHE A 1 11  ? 60.412 -5.780  90.387  1.00 14.95 ? 47  PHE A CA    1 
ATOM   80   C  C     . PHE A 1 11  ? 60.423 -4.255  90.229  1.00 12.30 ? 47  PHE A C     1 
ATOM   81   O  O     . PHE A 1 11  ? 59.567 -3.552  90.789  1.00 12.09 ? 47  PHE A O     1 
ATOM   82   C  CB    . PHE A 1 11  ? 61.502 -6.243  91.363  1.00 14.87 ? 47  PHE A CB    1 
ATOM   83   C  CG    . PHE A 1 11  ? 61.634 -5.386  92.597  1.00 17.08 ? 47  PHE A CG    1 
ATOM   84   C  CD1   . PHE A 1 11  ? 60.827 -5.609  93.701  1.00 19.30 ? 47  PHE A CD1   1 
ATOM   85   C  CD2   . PHE A 1 11  ? 62.593 -4.381  92.657  1.00 17.65 ? 47  PHE A CD2   1 
ATOM   86   C  CE1   . PHE A 1 11  ? 60.961 -4.833  94.843  1.00 21.62 ? 47  PHE A CE1   1 
ATOM   87   C  CE2   . PHE A 1 11  ? 62.729 -3.602  93.793  1.00 18.84 ? 47  PHE A CE2   1 
ATOM   88   C  CZ    . PHE A 1 11  ? 61.912 -3.833  94.884  1.00 17.43 ? 47  PHE A CZ    1 
ATOM   89   N  N     . CYS A 1 12  ? 61.391 -3.739  89.474  1.00 12.20 ? 48  CYS A N     1 
ATOM   90   C  CA    . CYS A 1 12  ? 61.485 -2.292  89.262  1.00 12.64 ? 48  CYS A CA    1 
ATOM   91   C  C     . CYS A 1 12  ? 60.194 -1.680  88.712  1.00 12.86 ? 48  CYS A C     1 
ATOM   92   O  O     . CYS A 1 12  ? 59.748 -0.626  89.180  1.00 9.99  ? 48  CYS A O     1 
ATOM   93   C  CB    . CYS A 1 12  ? 62.643 -1.956  88.317  1.00 10.83 ? 48  CYS A CB    1 
ATOM   94   S  SG    . CYS A 1 12  ? 64.277 -2.073  89.118  1.00 13.57 ? 48  CYS A SG    1 
ATOM   95   N  N     . TYR A 1 13  ? 59.611 -2.317  87.697  1.00 10.71 ? 49  TYR A N     1 
ATOM   96   C  CA    . TYR A 1 13  ? 58.367 -1.790  87.122  1.00 13.56 ? 49  TYR A CA    1 
ATOM   97   C  C     . TYR A 1 13  ? 57.191 -1.931  88.078  1.00 14.05 ? 49  TYR A C     1 
ATOM   98   O  O     . TYR A 1 13  ? 56.284 -1.090  88.085  1.00 13.64 ? 49  TYR A O     1 
ATOM   99   C  CB    . TYR A 1 13  ? 58.065 -2.421  85.749  1.00 12.43 ? 49  TYR A CB    1 
ATOM   100  C  CG    . TYR A 1 13  ? 58.921 -1.845  84.652  1.00 11.48 ? 49  TYR A CG    1 
ATOM   101  C  CD1   . TYR A 1 13  ? 58.751 -0.527  84.230  1.00 9.43  ? 49  TYR A CD1   1 
ATOM   102  C  CD2   . TYR A 1 13  ? 59.915 -2.604  84.051  1.00 9.99  ? 49  TYR A CD2   1 
ATOM   103  C  CE1   . TYR A 1 13  ? 59.551 0.014   83.212  1.00 8.56  ? 49  TYR A CE1   1 
ATOM   104  C  CE2   . TYR A 1 13  ? 60.710 -2.073  83.038  1.00 12.73 ? 49  TYR A CE2   1 
ATOM   105  C  CZ    . TYR A 1 13  ? 60.525 -0.764  82.637  1.00 9.41  ? 49  TYR A CZ    1 
ATOM   106  O  OH    . TYR A 1 13  ? 61.322 -0.250  81.633  1.00 9.58  ? 49  TYR A OH    1 
ATOM   107  N  N     . GLU A 1 14  ? 57.193 -2.989  88.881  1.00 13.98 ? 50  GLU A N     1 
ATOM   108  C  CA    . GLU A 1 14  ? 56.153 -3.124  89.911  1.00 12.62 ? 50  GLU A CA    1 
ATOM   109  C  C     . GLU A 1 14  ? 56.212 -1.981  90.909  1.00 16.83 ? 50  GLU A C     1 
ATOM   110  O  O     . GLU A 1 14  ? 55.190 -1.369  91.211  1.00 17.14 ? 50  GLU A O     1 
ATOM   111  C  CB    . GLU A 1 14  ? 56.238 -4.470  90.629  1.00 13.71 ? 50  GLU A CB    1 
ATOM   112  C  CG    . GLU A 1 14  ? 55.849 -5.634  89.714  1.00 16.24 ? 50  GLU A CG    1 
ATOM   113  C  CD    . GLU A 1 14  ? 56.159 -6.980  90.328  1.00 25.51 ? 50  GLU A CD    1 
ATOM   114  O  OE1   . GLU A 1 14  ? 56.683 -6.996  91.462  1.00 25.63 ? 50  GLU A OE1   1 
ATOM   115  O  OE2   . GLU A 1 14  ? 55.882 -8.012  89.673  1.00 26.52 ? 50  GLU A OE2   1 
ATOM   116  N  N     . VAL A 1 15  ? 57.404 -1.683  91.415  1.00 14.47 ? 51  VAL A N     1 
ATOM   117  C  CA    . VAL A 1 15  ? 57.561 -0.568  92.354  1.00 11.83 ? 51  VAL A CA    1 
ATOM   118  C  C     . VAL A 1 15  ? 57.243 0.768   91.671  1.00 13.55 ? 51  VAL A C     1 
ATOM   119  O  O     . VAL A 1 15  ? 56.532 1.609   92.222  1.00 11.74 ? 51  VAL A O     1 
ATOM   120  C  CB    . VAL A 1 15  ? 58.981 -0.552  92.959  1.00 12.22 ? 51  VAL A CB    1 
ATOM   121  C  CG1   . VAL A 1 15  ? 59.153 0.634   93.906  1.00 15.94 ? 51  VAL A CG1   1 
ATOM   122  C  CG2   . VAL A 1 15  ? 59.246 -1.853  93.695  1.00 12.39 ? 51  VAL A CG2   1 
ATOM   123  N  N     . TYR A 1 16  ? 57.770 0.960   90.466  1.00 12.06 ? 52  TYR A N     1 
ATOM   124  C  CA    . TYR A 1 16  ? 57.462 2.143   89.669  1.00 11.64 ? 52  TYR A CA    1 
ATOM   125  C  C     . TYR A 1 16  ? 55.963 2.448   89.576  1.00 15.38 ? 52  TYR A C     1 
ATOM   126  O  O     . TYR A 1 16  ? 55.535 3.584   89.801  1.00 12.65 ? 52  TYR A O     1 
ATOM   127  C  CB    . TYR A 1 16  ? 58.068 2.003   88.257  1.00 11.95 ? 52  TYR A CB    1 
ATOM   128  C  CG    . TYR A 1 16  ? 57.486 2.970   87.248  1.00 11.55 ? 52  TYR A CG    1 
ATOM   129  C  CD1   . TYR A 1 16  ? 57.797 4.320   87.297  1.00 12.50 ? 52  TYR A CD1   1 
ATOM   130  C  CD2   . TYR A 1 16  ? 56.641 2.530   86.232  1.00 11.71 ? 52  TYR A CD2   1 
ATOM   131  C  CE1   . TYR A 1 16  ? 57.269 5.216   86.368  1.00 11.06 ? 52  TYR A CE1   1 
ATOM   132  C  CE2   . TYR A 1 16  ? 56.108 3.426   85.298  1.00 11.34 ? 52  TYR A CE2   1 
ATOM   133  C  CZ    . TYR A 1 16  ? 56.426 4.762   85.384  1.00 15.47 ? 52  TYR A CZ    1 
ATOM   134  O  OH    . TYR A 1 16  ? 55.915 5.664   84.484  1.00 12.87 ? 52  TYR A OH    1 
ATOM   135  N  N     . ASN A 1 17  ? 55.164 1.442   89.239  1.00 13.59 ? 53  ASN A N     1 
ATOM   136  C  CA    . ASN A 1 17  ? 53.722 1.645   89.130  1.00 16.55 ? 53  ASN A CA    1 
ATOM   137  C  C     . ASN A 1 17  ? 53.058 1.984   90.474  1.00 18.10 ? 53  ASN A C     1 
ATOM   138  O  O     . ASN A 1 17  ? 51.983 2.581   90.492  1.00 21.56 ? 53  ASN A O     1 
ATOM   139  C  CB    . ASN A 1 17  ? 53.033 0.438   88.456  1.00 15.53 ? 53  ASN A CB    1 
ATOM   140  C  CG    . ASN A 1 17  ? 53.280 0.384   86.957  1.00 20.88 ? 53  ASN A CG    1 
ATOM   141  O  OD1   . ASN A 1 17  ? 53.179 1.394   86.261  1.00 25.53 ? 53  ASN A OD1   1 
ATOM   142  N  ND2   . ASN A 1 17  ? 53.598 -0.802  86.451  1.00 24.00 ? 53  ASN A ND2   1 
ATOM   143  N  N     . GLU A 1 18  ? 53.701 1.631   91.590  1.00 16.05 ? 54  GLU A N     1 
ATOM   144  C  CA    . GLU A 1 18  ? 53.176 1.972   92.922  1.00 19.55 ? 54  GLU A CA    1 
ATOM   145  C  C     . GLU A 1 18  ? 53.527 3.384   93.342  1.00 21.90 ? 54  GLU A C     1 
ATOM   146  O  O     . GLU A 1 18  ? 52.788 4.009   94.095  1.00 18.53 ? 54  GLU A O     1 
ATOM   147  C  CB    . GLU A 1 18  ? 53.731 1.056   94.025  1.00 23.08 ? 54  GLU A CB    1 
ATOM   148  C  CG    . GLU A 1 18  ? 53.780 -0.403  93.708  1.00 29.16 ? 54  GLU A CG    1 
ATOM   149  C  CD    . GLU A 1 18  ? 52.443 -0.972  93.316  1.00 37.43 ? 54  GLU A CD    1 
ATOM   150  O  OE1   . GLU A 1 18  ? 51.410 -0.494  93.830  1.00 45.22 ? 54  GLU A OE1   1 
ATOM   151  O  OE2   . GLU A 1 18  ? 52.431 -1.906  92.486  1.00 45.68 ? 54  GLU A OE2   1 
ATOM   152  N  N     . ILE A 1 19  ? 54.680 3.877   92.899  1.00 14.10 ? 55  ILE A N     1 
ATOM   153  C  CA    . ILE A 1 19  ? 55.169 5.170   93.405  1.00 14.17 ? 55  ILE A CA    1 
ATOM   154  C  C     . ILE A 1 19  ? 54.907 6.358   92.476  1.00 15.05 ? 55  ILE A C     1 
ATOM   155  O  O     . ILE A 1 19  ? 55.015 7.509   92.898  1.00 14.94 ? 55  ILE A O     1 
ATOM   156  C  CB    . ILE A 1 19  ? 56.676 5.116   93.735  1.00 11.47 ? 55  ILE A CB    1 
ATOM   157  C  CG1   . ILE A 1 19  ? 57.495 4.939   92.454  1.00 13.27 ? 55  ILE A CG1   1 
ATOM   158  C  CG2   . ILE A 1 19  ? 56.961 3.993   94.737  1.00 13.25 ? 55  ILE A CG2   1 
ATOM   159  C  CD1   . ILE A 1 19  ? 59.018 4.916   92.676  1.00 12.17 ? 55  ILE A CD1   1 
ATOM   160  N  N     . LYS A 1 20  ? 54.581 6.095   91.215  1.00 15.16 ? 56  LYS A N     1 
ATOM   161  C  CA    . LYS A 1 20  ? 54.426 7.185   90.239  1.00 13.72 ? 56  LYS A CA    1 
ATOM   162  C  C     . LYS A 1 20  ? 53.151 7.978   90.510  1.00 17.17 ? 56  LYS A C     1 
ATOM   163  O  O     . LYS A 1 20  ? 52.181 7.445   91.049  1.00 15.00 ? 56  LYS A O     1 
ATOM   164  C  CB    . LYS A 1 20  ? 54.399 6.653   88.801  1.00 12.77 ? 56  LYS A CB    1 
ATOM   165  C  CG    . LYS A 1 20  ? 53.200 5.725   88.486  1.00 15.70 ? 56  LYS A CG    1 
ATOM   166  C  CD    . LYS A 1 20  ? 53.276 5.170   87.065  1.00 17.64 ? 56  LYS A CD    1 
ATOM   167  C  CE    . LYS A 1 20  ? 51.974 4.423   86.688  1.00 21.93 ? 56  LYS A CE    1 
ATOM   168  N  NZ    . LYS A 1 20  ? 52.101 3.595   85.430  1.00 22.55 ? 56  LYS A NZ    1 
ATOM   169  N  N     . ILE A 1 21  ? 53.155 9.261   90.164  1.00 17.22 ? 57  ILE A N     1 
ATOM   170  C  CA    . ILE A 1 21  ? 51.951 10.078  90.336  1.00 20.92 ? 57  ILE A CA    1 
ATOM   171  C  C     . ILE A 1 21  ? 50.802 9.549   89.470  1.00 17.45 ? 57  ILE A C     1 
ATOM   172  O  O     . ILE A 1 21  ? 50.994 9.206   88.299  1.00 19.79 ? 57  ILE A O     1 
ATOM   173  C  CB    . ILE A 1 21  ? 52.227 11.584  90.065  1.00 18.15 ? 57  ILE A CB    1 
ATOM   174  C  CG1   . ILE A 1 21  ? 51.042 12.439  90.524  1.00 20.49 ? 57  ILE A CG1   1 
ATOM   175  C  CG2   . ILE A 1 21  ? 52.592 11.835  88.613  1.00 19.59 ? 57  ILE A CG2   1 
ATOM   176  C  CD1   . ILE A 1 21  ? 51.312 13.939  90.490  1.00 20.66 ? 57  ILE A CD1   1 
ATOM   177  N  N     . SER A 1 22  ? 49.610 9.466   90.055  1.00 17.20 ? 58  SER A N     1 
ATOM   178  C  CA    . SER A 1 22  ? 48.442 8.983   89.315  1.00 25.25 ? 58  SER A CA    1 
ATOM   179  C  C     . SER A 1 22  ? 47.914 10.052  88.366  1.00 28.45 ? 58  SER A C     1 
ATOM   180  O  O     . SER A 1 22  ? 48.185 11.245  88.551  1.00 23.47 ? 58  SER A O     1 
ATOM   181  C  CB    . SER A 1 22  ? 47.336 8.571   90.281  1.00 27.81 ? 58  SER A CB    1 
ATOM   182  O  OG    . SER A 1 22  ? 46.894 9.673   91.053  1.00 26.05 ? 58  SER A OG    1 
ATOM   183  N  N     . ASP A 1 23  ? 47.161 9.637   87.350  1.00 27.40 ? 59  ASP A N     1 
ATOM   184  C  CA    . ASP A 1 23  ? 46.536 10.607  86.459  1.00 27.00 ? 59  ASP A CA    1 
ATOM   185  C  C     . ASP A 1 23  ? 45.563 11.492  87.241  1.00 30.00 ? 59  ASP A C     1 
ATOM   186  O  O     . ASP A 1 23  ? 45.472 12.684  86.974  1.00 28.16 ? 59  ASP A O     1 
ATOM   187  C  CB    . ASP A 1 23  ? 45.831 9.930   85.284  1.00 37.21 ? 59  ASP A CB    1 
ATOM   188  C  CG    . ASP A 1 23  ? 45.535 10.897  84.146  1.00 45.32 ? 59  ASP A CG    1 
ATOM   189  O  OD1   . ASP A 1 23  ? 46.241 11.925  84.033  1.00 48.63 ? 59  ASP A OD1   1 
ATOM   190  O  OD2   . ASP A 1 23  ? 44.604 10.630  83.356  1.00 52.51 ? 59  ASP A OD2   1 
ATOM   191  N  N     . LYS A 1 24  ? 44.858 10.916  88.215  1.00 26.45 ? 60  LYS A N     1 
ATOM   192  C  CA    . LYS A 1 24  ? 43.975 11.703  89.089  1.00 26.35 ? 60  LYS A CA    1 
ATOM   193  C  C     . LYS A 1 24  ? 44.704 12.835  89.814  1.00 27.83 ? 60  LYS A C     1 
ATOM   194  O  O     . LYS A 1 24  ? 44.228 13.981  89.857  1.00 23.26 ? 60  LYS A O     1 
ATOM   195  C  CB    . LYS A 1 24  ? 43.293 10.803  90.124  1.00 32.06 ? 60  LYS A CB    1 
ATOM   196  C  CG    . LYS A 1 24  ? 42.746 11.547  91.347  1.00 36.66 ? 60  LYS A CG    1 
ATOM   197  C  CD    . LYS A 1 24  ? 41.228 11.504  91.402  1.00 45.32 ? 60  LYS A CD    1 
ATOM   198  C  CE    . LYS A 1 24  ? 40.739 10.083  91.615  1.00 54.82 ? 60  LYS A CE    1 
ATOM   199  N  NZ    . LYS A 1 24  ? 39.376 9.860   91.039  1.00 59.71 ? 60  LYS A NZ    1 
ATOM   200  N  N     . GLU A 1 25  ? 45.846 12.519  90.414  1.00 21.25 ? 61  GLU A N     1 
ATOM   201  C  CA    . GLU A 1 25  ? 46.577 13.539  91.146  1.00 22.79 ? 61  GLU A CA    1 
ATOM   202  C  C     . GLU A 1 25  ? 47.171 14.558  90.173  1.00 21.11 ? 61  GLU A C     1 
ATOM   203  O  O     . GLU A 1 25  ? 47.253 15.743  90.483  1.00 19.74 ? 61  GLU A O     1 
ATOM   204  C  CB    . GLU A 1 25  ? 47.665 12.929  92.037  1.00 24.93 ? 61  GLU A CB    1 
ATOM   205  C  CG    . GLU A 1 25  ? 48.300 13.941  92.978  1.00 23.87 ? 61  GLU A CG    1 
ATOM   206  C  CD    . GLU A 1 25  ? 49.511 13.407  93.723  1.00 32.57 ? 61  GLU A CD    1 
ATOM   207  O  OE1   . GLU A 1 25  ? 49.649 12.165  93.877  1.00 28.07 ? 61  GLU A OE1   1 
ATOM   208  O  OE2   . GLU A 1 25  ? 50.329 14.244  94.161  1.00 30.12 ? 61  GLU A OE2   1 
ATOM   209  N  N     . PHE A 1 26  ? 47.579 14.096  88.994  1.00 20.09 ? 62  PHE A N     1 
ATOM   210  C  CA    . PHE A 1 26  ? 48.148 15.004  88.009  1.00 24.05 ? 62  PHE A CA    1 
ATOM   211  C  C     . PHE A 1 26  ? 47.094 16.029  87.591  1.00 23.11 ? 62  PHE A C     1 
ATOM   212  O  O     . PHE A 1 26  ? 47.383 17.230  87.509  1.00 19.37 ? 62  PHE A O     1 
ATOM   213  C  CB    . PHE A 1 26  ? 48.677 14.232  86.794  1.00 26.38 ? 62  PHE A CB    1 
ATOM   214  C  CG    . PHE A 1 26  ? 49.462 15.077  85.834  1.00 28.06 ? 62  PHE A CG    1 
ATOM   215  C  CD1   . PHE A 1 26  ? 50.789 15.410  86.101  1.00 28.54 ? 62  PHE A CD1   1 
ATOM   216  C  CD2   . PHE A 1 26  ? 48.884 15.527  84.655  1.00 30.07 ? 62  PHE A CD2   1 
ATOM   217  C  CE1   . PHE A 1 26  ? 51.514 16.193  85.212  1.00 35.12 ? 62  PHE A CE1   1 
ATOM   218  C  CE2   . PHE A 1 26  ? 49.605 16.308  83.762  1.00 29.72 ? 62  PHE A CE2   1 
ATOM   219  C  CZ    . PHE A 1 26  ? 50.917 16.644  84.041  1.00 31.67 ? 62  PHE A CZ    1 
ATOM   220  N  N     . LYS A 1 27  ? 45.869 15.559  87.339  1.00 21.07 ? 63  LYS A N     1 
ATOM   221  C  CA    . LYS A 1 27  ? 44.782 16.462  86.927  1.00 21.74 ? 63  LYS A CA    1 
ATOM   222  C  C     . LYS A 1 27  ? 44.482 17.479  88.008  1.00 20.80 ? 63  LYS A C     1 
ATOM   223  O  O     . LYS A 1 27  ? 44.224 18.646  87.708  1.00 24.61 ? 63  LYS A O     1 
ATOM   224  C  CB    . LYS A 1 27  ? 43.487 15.697  86.626  1.00 27.88 ? 63  LYS A CB    1 
ATOM   225  C  CG    . LYS A 1 27  ? 43.590 14.562  85.623  1.00 34.17 ? 63  LYS A CG    1 
ATOM   226  C  CD    . LYS A 1 27  ? 43.766 15.023  84.185  1.00 40.00 ? 63  LYS A CD    1 
ATOM   227  C  CE    . LYS A 1 27  ? 43.563 13.835  83.235  1.00 45.74 ? 63  LYS A CE    1 
ATOM   228  N  NZ    . LYS A 1 27  ? 44.143 14.048  81.871  1.00 54.46 ? 63  LYS A NZ    1 
ATOM   229  N  N     . GLU A 1 28  ? 44.502 17.032  89.262  1.00 22.40 ? 64  GLU A N     1 
ATOM   230  C  CA    . GLU A 1 28  ? 44.234 17.905  90.405  1.00 21.59 ? 64  GLU A CA    1 
ATOM   231  C  C     . GLU A 1 28  ? 45.246 19.039  90.485  1.00 20.89 ? 64  GLU A C     1 
ATOM   232  O  O     . GLU A 1 28  ? 44.886 20.192  90.730  1.00 19.07 ? 64  GLU A O     1 
ATOM   233  C  CB    . GLU A 1 28  ? 44.293 17.122  91.716  1.00 25.26 ? 64  GLU A CB    1 
ATOM   234  C  CG    . GLU A 1 28  ? 43.095 16.236  92.008  1.00 34.06 ? 64  GLU A CG    1 
ATOM   235  C  CD    . GLU A 1 28  ? 43.185 15.589  93.383  1.00 41.00 ? 64  GLU A CD    1 
ATOM   236  O  OE1   . GLU A 1 28  ? 44.067 14.724  93.583  1.00 41.23 ? 64  GLU A OE1   1 
ATOM   237  O  OE2   . GLU A 1 28  ? 42.378 15.949  94.266  1.00 47.48 ? 64  GLU A OE2   1 
ATOM   238  N  N     . LYS A 1 29  ? 46.518 18.699  90.299  1.00 21.09 ? 65  LYS A N     1 
ATOM   239  C  CA    . LYS A 1 29  ? 47.580 19.702  90.329  1.00 20.00 ? 65  LYS A CA    1 
ATOM   240  C  C     . LYS A 1 29  ? 47.446 20.669  89.154  1.00 16.74 ? 65  LYS A C     1 
ATOM   241  O  O     . LYS A 1 29  ? 47.668 21.863  89.310  1.00 18.72 ? 65  LYS A O     1 
ATOM   242  C  CB    . LYS A 1 29  ? 48.964 19.032  90.309  1.00 18.70 ? 65  LYS A CB    1 
ATOM   243  C  CG    . LYS A 1 29  ? 49.249 18.108  91.486  1.00 26.01 ? 65  LYS A CG    1 
ATOM   244  C  CD    . LYS A 1 29  ? 48.982 18.786  92.815  1.00 31.74 ? 65  LYS A CD    1 
ATOM   245  C  CE    . LYS A 1 29  ? 49.185 17.806  93.979  1.00 35.48 ? 65  LYS A CE    1 
ATOM   246  N  NZ    . LYS A 1 29  ? 48.831 18.430  95.295  1.00 36.64 ? 65  LYS A NZ    1 
ATOM   247  N  N     . ARG A 1 30  ? 47.116 20.151  87.973  1.00 15.88 ? 66  ARG A N     1 
ATOM   248  C  CA    . ARG A 1 30  ? 46.836 21.021  86.832  1.00 19.07 ? 66  ARG A CA    1 
ATOM   249  C  C     . ARG A 1 30  ? 45.692 21.961  87.181  1.00 17.47 ? 66  ARG A C     1 
ATOM   250  O  O     . ARG A 1 30  ? 45.739 23.148  86.877  1.00 15.40 ? 66  ARG A O     1 
ATOM   251  C  CB    . ARG A 1 30  ? 46.463 20.213  85.581  1.00 20.78 ? 66  ARG A CB    1 
ATOM   252  C  CG    . ARG A 1 30  ? 47.649 19.614  84.839  1.00 26.08 ? 66  ARG A CG    1 
ATOM   253  C  CD    . ARG A 1 30  ? 48.564 20.703  84.268  1.00 38.39 ? 66  ARG A CD    1 
ATOM   254  N  NE    . ARG A 1 30  ? 49.966 20.464  84.620  1.00 44.89 ? 66  ARG A NE    1 
ATOM   255  C  CZ    . ARG A 1 30  ? 50.979 21.253  84.271  1.00 44.01 ? 66  ARG A CZ    1 
ATOM   256  N  NH1   . ARG A 1 30  ? 50.761 22.341  83.543  1.00 41.48 ? 66  ARG A NH1   1 
ATOM   257  N  NH2   . ARG A 1 30  ? 52.218 20.950  84.647  1.00 39.94 ? 66  ARG A NH2   1 
ATOM   258  N  N     . ALA A 1 31  ? 44.661 21.426  87.828  1.00 18.52 ? 67  ALA A N     1 
ATOM   259  C  CA    . ALA A 1 31  ? 43.529 22.259  88.221  1.00 18.73 ? 67  ALA A CA    1 
ATOM   260  C  C     . ALA A 1 31  ? 43.940 23.322  89.243  1.00 18.69 ? 67  ALA A C     1 
ATOM   261  O  O     . ALA A 1 31  ? 43.441 24.450  89.212  1.00 15.08 ? 67  ALA A O     1 
ATOM   262  C  CB    . ALA A 1 31  ? 42.390 21.393  88.756  1.00 23.16 ? 67  ALA A CB    1 
ATOM   263  N  N     . ALA A 1 32  ? 44.839 22.971  90.160  1.00 16.32 ? 68  ALA A N     1 
ATOM   264  C  CA    . ALA A 1 32  ? 45.318 23.947  91.136  1.00 17.66 ? 68  ALA A CA    1 
ATOM   265  C  C     . ALA A 1 32  ? 46.105 25.048  90.443  1.00 16.50 ? 68  ALA A C     1 
ATOM   266  O  O     . ALA A 1 32  ? 45.989 26.213  90.807  1.00 13.93 ? 68  ALA A O     1 
ATOM   267  C  CB    . ALA A 1 32  ? 46.158 23.284  92.223  1.00 20.64 ? 68  ALA A CB    1 
ATOM   268  N  N     . LEU A 1 33  ? 46.910 24.677  89.452  1.00 14.82 ? 69  LEU A N     1 
ATOM   269  C  CA    . LEU A 1 33  ? 47.635 25.672  88.677  1.00 11.97 ? 69  LEU A CA    1 
ATOM   270  C  C     . LEU A 1 33  ? 46.661 26.608  87.942  1.00 13.10 ? 69  LEU A C     1 
ATOM   271  O  O     . LEU A 1 33  ? 46.868 27.823  87.915  1.00 14.48 ? 69  LEU A O     1 
ATOM   272  C  CB    . LEU A 1 33  ? 48.586 24.990  87.697  1.00 12.73 ? 69  LEU A CB    1 
ATOM   273  C  CG    . LEU A 1 33  ? 49.254 25.910  86.678  1.00 15.06 ? 69  LEU A CG    1 
ATOM   274  C  CD1   . LEU A 1 33  ? 50.027 27.026  87.351  1.00 15.59 ? 69  LEU A CD1   1 
ATOM   275  C  CD2   . LEU A 1 33  ? 50.177 25.098  85.758  1.00 16.99 ? 69  LEU A CD2   1 
ATOM   276  N  N     . ASP A 1 34  ? 45.597 26.056  87.367  1.00 15.11 ? 70  ASP A N     1 
ATOM   277  C  CA    . ASP A 1 34  ? 44.597 26.901  86.695  1.00 13.97 ? 70  ASP A CA    1 
ATOM   278  C  C     . ASP A 1 34  ? 44.003 27.932  87.651  1.00 14.86 ? 70  ASP A C     1 
ATOM   279  O  O     . ASP A 1 34  ? 43.838 29.097  87.294  1.00 13.45 ? 70  ASP A O     1 
ATOM   280  C  CB    . ASP A 1 34  ? 43.458 26.063  86.097  1.00 14.38 ? 70  ASP A CB    1 
ATOM   281  C  CG    . ASP A 1 34  ? 43.902 25.172  84.969  1.00 17.76 ? 70  ASP A CG    1 
ATOM   282  O  OD1   . ASP A 1 34  ? 44.867 25.527  84.265  1.00 17.06 ? 70  ASP A OD1   1 
ATOM   283  O  OD2   . ASP A 1 34  ? 43.258 24.113  84.767  1.00 22.58 ? 70  ASP A OD2   1 
ATOM   284  N  N     . THR A 1 35  ? 43.680 27.497  88.864  1.00 13.93 ? 71  THR A N     1 
ATOM   285  C  CA    . THR A 1 35  ? 43.072 28.365  89.878  1.00 13.79 ? 71  THR A CA    1 
ATOM   286  C  C     . THR A 1 35  ? 44.034 29.456  90.321  1.00 15.01 ? 71  THR A C     1 
ATOM   287  O  O     . THR A 1 35  ? 43.651 30.616  90.508  1.00 12.65 ? 71  THR A O     1 
ATOM   288  C  CB    . THR A 1 35  ? 42.633 27.525  91.115  1.00 16.79 ? 71  THR A CB    1 
ATOM   289  O  OG1   . THR A 1 35  ? 41.542 26.681  90.741  1.00 18.80 ? 71  THR A OG1   1 
ATOM   290  C  CG2   . THR A 1 35  ? 42.194 28.398  92.270  1.00 18.42 ? 71  THR A CG2   1 
ATOM   291  N  N     . LEU A 1 36  ? 45.299 29.087  90.488  1.00 11.76 ? 72  LEU A N     1 
ATOM   292  C  CA    . LEU A 1 36  ? 46.290 30.045  90.967  1.00 12.87 ? 72  LEU A CA    1 
ATOM   293  C  C     . LEU A 1 36  ? 46.638 31.062  89.886  1.00 12.36 ? 72  LEU A C     1 
ATOM   294  O  O     . LEU A 1 36  ? 46.944 32.218  90.182  1.00 11.78 ? 72  LEU A O     1 
ATOM   295  C  CB    . LEU A 1 36  ? 47.552 29.312  91.430  1.00 14.36 ? 72  LEU A CB    1 
ATOM   296  C  CG    . LEU A 1 36  ? 47.406 28.424  92.666  1.00 14.79 ? 72  LEU A CG    1 
ATOM   297  C  CD1   . LEU A 1 36  ? 48.694 27.666  92.898  1.00 15.68 ? 72  LEU A CD1   1 
ATOM   298  C  CD2   . LEU A 1 36  ? 47.068 29.259  93.883  1.00 14.86 ? 72  LEU A CD2   1 
ATOM   299  N  N     . ARG A 1 37  ? 46.596 30.627  88.632  1.00 13.39 ? 73  ARG A N     1 
ATOM   300  C  CA    . ARG A 1 37  ? 46.884 31.503  87.512  1.00 11.09 ? 73  ARG A CA    1 
ATOM   301  C  C     . ARG A 1 37  ? 45.773 32.547  87.402  1.00 14.17 ? 73  ARG A C     1 
ATOM   302  O  O     . ARG A 1 37  ? 46.039 33.738  87.217  1.00 12.51 ? 73  ARG A O     1 
ATOM   303  C  CB    . ARG A 1 37  ? 47.018 30.670  86.221  1.00 13.62 ? 73  ARG A CB    1 
ATOM   304  C  CG    . ARG A 1 37  ? 47.338 31.477  84.968  1.00 21.59 ? 73  ARG A CG    1 
ATOM   305  C  CD    . ARG A 1 37  ? 47.535 30.574  83.753  1.00 21.56 ? 73  ARG A CD    1 
ATOM   306  N  NE    . ARG A 1 37  ? 48.823 29.875  83.764  1.00 21.04 ? 73  ARG A NE    1 
ATOM   307  C  CZ    . ARG A 1 37  ? 48.975 28.570  83.568  1.00 25.46 ? 73  ARG A CZ    1 
ATOM   308  N  NH1   . ARG A 1 37  ? 47.917 27.808  83.356  1.00 24.63 ? 73  ARG A NH1   1 
ATOM   309  N  NH2   . ARG A 1 37  ? 50.186 28.030  83.582  1.00 23.74 ? 73  ARG A NH2   1 
ATOM   310  N  N     . LEU A 1 38  ? 44.525 32.103  87.545  1.00 13.79 ? 74  LEU A N     1 
ATOM   311  C  CA    . LEU A 1 38  ? 43.392 33.032  87.505  1.00 14.84 ? 74  LEU A CA    1 
ATOM   312  C  C     . LEU A 1 38  ? 43.544 34.084  88.607  1.00 18.13 ? 74  LEU A C     1 
ATOM   313  O  O     . LEU A 1 38  ? 43.302 35.279  88.390  1.00 14.96 ? 74  LEU A O     1 
ATOM   314  C  CB    . LEU A 1 38  ? 42.065 32.261  87.634  1.00 15.27 ? 74  LEU A CB    1 
ATOM   315  C  CG    . LEU A 1 38  ? 40.758 33.055  87.501  1.00 23.96 ? 74  LEU A CG    1 
ATOM   316  C  CD1   . LEU A 1 38  ? 40.570 33.571  86.077  1.00 18.44 ? 74  LEU A CD1   1 
ATOM   317  C  CD2   . LEU A 1 38  ? 39.553 32.217  87.933  1.00 25.65 ? 74  LEU A CD2   1 
ATOM   318  N  N     . CYS A 1 39  ? 43.996 33.648  89.781  1.00 12.55 ? 75  CYS A N     1 
ATOM   319  C  CA    A CYS A 1 39  ? 44.196 34.563  90.893  0.61 13.97 ? 75  CYS A CA    1 
ATOM   320  C  CA    B CYS A 1 39  ? 44.206 34.563  90.902  0.39 13.99 ? 75  CYS A CA    1 
ATOM   321  C  C     . CYS A 1 39  ? 45.278 35.601  90.594  1.00 15.34 ? 75  CYS A C     1 
ATOM   322  O  O     . CYS A 1 39  ? 45.135 36.769  90.941  1.00 14.62 ? 75  CYS A O     1 
ATOM   323  C  CB    A CYS A 1 39  ? 44.551 33.782  92.153  0.61 14.99 ? 75  CYS A CB    1 
ATOM   324  C  CB    B CYS A 1 39  ? 44.593 33.805  92.176  0.39 15.01 ? 75  CYS A CB    1 
ATOM   325  S  SG    A CYS A 1 39  ? 44.887 34.811  93.561  0.61 17.40 ? 75  CYS A SG    1 
ATOM   326  S  SG    B CYS A 1 39  ? 43.238 32.966  93.014  0.39 18.05 ? 75  CYS A SG    1 
ATOM   327  N  N     . LEU A 1 40  ? 46.359 35.172  89.944  1.00 11.05 ? 76  LEU A N     1 
ATOM   328  C  CA    . LEU A 1 40  ? 47.474 36.076  89.642  1.00 10.06 ? 76  LEU A CA    1 
ATOM   329  C  C     . LEU A 1 40  ? 47.049 37.133  88.645  1.00 11.85 ? 76  LEU A C     1 
ATOM   330  O  O     . LEU A 1 40  ? 47.428 38.300  88.766  1.00 13.63 ? 76  LEU A O     1 
ATOM   331  C  CB    . LEU A 1 40  ? 48.674 35.304  89.085  1.00 9.76  ? 76  LEU A CB    1 
ATOM   332  C  CG    . LEU A 1 40  ? 49.852 36.143  88.570  1.00 10.91 ? 76  LEU A CG    1 
ATOM   333  C  CD1   . LEU A 1 40  ? 50.499 36.839  89.728  1.00 13.52 ? 76  LEU A CD1   1 
ATOM   334  C  CD2   . LEU A 1 40  ? 50.880 35.260  87.849  1.00 11.36 ? 76  LEU A CD2   1 
ATOM   335  N  N     . LYS A 1 41  ? 46.235 36.730  87.672  1.00 9.36  ? 77  LYS A N     1 
ATOM   336  C  CA    . LYS A 1 41  ? 45.742 37.662  86.655  1.00 11.08 ? 77  LYS A CA    1 
ATOM   337  C  C     . LYS A 1 41  ? 44.800 38.714  87.234  1.00 16.24 ? 77  LYS A C     1 
ATOM   338  O  O     . LYS A 1 41  ? 44.544 39.742  86.598  1.00 14.77 ? 77  LYS A O     1 
ATOM   339  C  CB    . LYS A 1 41  ? 45.066 36.903  85.507  1.00 10.86 ? 77  LYS A CB    1 
ATOM   340  C  CG    . LYS A 1 41  ? 46.041 36.069  84.658  1.00 10.27 ? 77  LYS A CG    1 
ATOM   341  C  CD    . LYS A 1 41  ? 47.134 36.968  84.037  1.00 11.12 ? 77  LYS A CD    1 
ATOM   342  C  CE    . LYS A 1 41  ? 47.792 36.293  82.828  1.00 15.96 ? 77  LYS A CE    1 
ATOM   343  N  NZ    . LYS A 1 41  ? 48.925 37.143  82.303  1.00 17.62 ? 77  LYS A NZ    1 
ATOM   344  N  N     . ARG A 1 42  ? 44.296 38.470  88.442  1.00 15.62 ? 78  ARG A N     1 
ATOM   345  C  CA    . ARG A 1 42  ? 43.597 39.521  89.191  1.00 17.71 ? 78  ARG A CA    1 
ATOM   346  C  C     . ARG A 1 42  ? 44.543 40.612  89.667  1.00 22.19 ? 78  ARG A C     1 
ATOM   347  O  O     . ARG A 1 42  ? 44.127 41.746  89.909  1.00 24.54 ? 78  ARG A O     1 
ATOM   348  C  CB    . ARG A 1 42  ? 42.865 38.928  90.396  1.00 26.68 ? 78  ARG A CB    1 
ATOM   349  C  CG    . ARG A 1 42  ? 41.426 38.576  90.111  1.00 26.86 ? 78  ARG A CG    1 
ATOM   350  C  CD    . ARG A 1 42  ? 40.800 37.744  91.219  1.00 31.58 ? 78  ARG A CD    1 
ATOM   351  N  NE    . ARG A 1 42  ? 39.856 36.793  90.632  1.00 34.92 ? 78  ARG A NE    1 
ATOM   352  C  CZ    . ARG A 1 42  ? 39.900 35.474  90.797  1.00 32.90 ? 78  ARG A CZ    1 
ATOM   353  N  NH1   . ARG A 1 42  ? 40.829 34.916  91.570  1.00 33.52 ? 78  ARG A NH1   1 
ATOM   354  N  NH2   . ARG A 1 42  ? 38.994 34.708  90.199  1.00 36.45 ? 78  ARG A NH2   1 
ATOM   355  N  N     . ILE A 1 43  ? 45.820 40.271  89.811  1.00 15.90 ? 79  ILE A N     1 
ATOM   356  C  CA    . ILE A 1 43  ? 46.793 41.229  90.323  1.00 18.96 ? 79  ILE A CA    1 
ATOM   357  C  C     . ILE A 1 43  ? 47.440 42.013  89.189  1.00 20.08 ? 79  ILE A C     1 
ATOM   358  O  O     . ILE A 1 43  ? 47.643 43.213  89.292  1.00 16.20 ? 79  ILE A O     1 
ATOM   359  C  CB    . ILE A 1 43  ? 47.912 40.540  91.143  1.00 20.58 ? 79  ILE A CB    1 
ATOM   360  C  CG1   . ILE A 1 43  ? 47.313 39.638  92.220  1.00 23.09 ? 79  ILE A CG1   1 
ATOM   361  C  CG2   . ILE A 1 43  ? 48.823 41.576  91.757  1.00 23.76 ? 79  ILE A CG2   1 
ATOM   362  C  CD1   . ILE A 1 43  ? 46.405 40.364  93.193  1.00 24.75 ? 79  ILE A CD1   1 
ATOM   363  N  N     . SER A 1 44  ? 47.785 41.321  88.112  1.00 15.94 ? 80  SER A N     1 
ATOM   364  C  CA    . SER A 1 44  ? 48.496 41.947  87.017  1.00 14.77 ? 80  SER A CA    1 
ATOM   365  C  C     . SER A 1 44  ? 48.244 41.174  85.737  1.00 14.01 ? 80  SER A C     1 
ATOM   366  O  O     . SER A 1 44  ? 48.270 39.934  85.729  1.00 15.02 ? 80  SER A O     1 
ATOM   367  C  CB    . SER A 1 44  ? 50.003 41.968  87.302  1.00 17.70 ? 80  SER A CB    1 
ATOM   368  O  OG    . SER A 1 44  ? 50.742 42.394  86.164  1.00 17.91 ? 80  SER A OG    1 
ATOM   369  N  N     . PRO A 1 45  ? 48.035 41.900  84.631  1.00 13.18 ? 81  PRO A N     1 
ATOM   370  C  CA    . PRO A 1 45  ? 47.865 41.250  83.333  1.00 13.89 ? 81  PRO A CA    1 
ATOM   371  C  C     . PRO A 1 45  ? 49.224 40.836  82.779  1.00 11.92 ? 81  PRO A C     1 
ATOM   372  O  O     . PRO A 1 45  ? 49.296 40.009  81.866  1.00 14.21 ? 81  PRO A O     1 
ATOM   373  C  CB    . PRO A 1 45  ? 47.258 42.368  82.475  1.00 12.28 ? 81  PRO A CB    1 
ATOM   374  C  CG    . PRO A 1 45  ? 47.823 43.616  83.067  1.00 13.47 ? 81  PRO A CG    1 
ATOM   375  C  CD    . PRO A 1 45  ? 47.880 43.365  84.546  1.00 17.66 ? 81  PRO A CD    1 
ATOM   376  N  N     . ASP A 1 46  ? 50.289 41.399  83.350  1.00 12.31 ? 82  ASP A N     1 
ATOM   377  C  CA    . ASP A 1 46  ? 51.644 41.247  82.813  1.00 14.85 ? 82  ASP A CA    1 
ATOM   378  C  C     . ASP A 1 46  ? 52.463 40.220  83.585  1.00 19.73 ? 82  ASP A C     1 
ATOM   379  O  O     . ASP A 1 46  ? 53.673 40.104  83.403  1.00 24.72 ? 82  ASP A O     1 
ATOM   380  C  CB    . ASP A 1 46  ? 52.367 42.596  82.858  1.00 17.18 ? 82  ASP A CB    1 
ATOM   381  C  CG    . ASP A 1 46  ? 51.670 43.641  82.030  1.00 18.53 ? 82  ASP A CG    1 
ATOM   382  O  OD1   . ASP A 1 46  ? 51.372 43.345  80.845  1.00 15.20 ? 82  ASP A OD1   1 
ATOM   383  O  OD2   . ASP A 1 46  ? 51.397 44.732  82.566  1.00 22.18 ? 82  ASP A OD2   1 
ATOM   384  N  N     . ALA A 1 47  ? 51.796 39.477  84.450  1.00 13.03 ? 83  ALA A N     1 
ATOM   385  C  CA    . ALA A 1 47  ? 52.455 38.421  85.212  1.00 16.20 ? 83  ALA A CA    1 
ATOM   386  C  C     . ALA A 1 47  ? 51.947 37.094  84.699  1.00 18.12 ? 83  ALA A C     1 
ATOM   387  O  O     . ALA A 1 47  ? 50.747 36.954  84.438  1.00 16.06 ? 83  ALA A O     1 
ATOM   388  C  CB    . ALA A 1 47  ? 52.120 38.555  86.692  1.00 16.19 ? 83  ALA A CB    1 
ATOM   389  N  N     . GLU A 1 48  ? 52.838 36.112  84.565  1.00 13.71 ? 84  GLU A N     1 
ATOM   390  C  CA    . GLU A 1 48  ? 52.410 34.779  84.178  1.00 15.26 ? 84  GLU A CA    1 
ATOM   391  C  C     . GLU A 1 48  ? 52.857 33.793  85.244  1.00 16.01 ? 84  GLU A C     1 
ATOM   392  O  O     . GLU A 1 48  ? 53.820 34.035  85.967  1.00 14.16 ? 84  GLU A O     1 
ATOM   393  C  CB    . GLU A 1 48  ? 52.982 34.381  82.819  1.00 22.49 ? 84  GLU A CB    1 
ATOM   394  C  CG    . GLU A 1 48  ? 52.251 33.181  82.228  1.00 26.74 ? 84  GLU A CG    1 
ATOM   395  C  CD    . GLU A 1 48  ? 50.722 33.343  82.286  1.00 27.30 ? 84  GLU A CD    1 
ATOM   396  O  OE1   . GLU A 1 48  ? 50.195 34.283  81.657  1.00 32.60 ? 84  GLU A OE1   1 
ATOM   397  O  OE2   . GLU A 1 48  ? 50.045 32.550  82.969  1.00 17.93 ? 84  GLU A OE2   1 
ATOM   398  N  N     . LEU A 1 49  ? 52.141 32.693  85.352  1.00 13.24 ? 85  LEU A N     1 
ATOM   399  C  CA    . LEU A 1 49  ? 52.453 31.687  86.346  1.00 14.78 ? 85  LEU A CA    1 
ATOM   400  C  C     . LEU A 1 49  ? 52.839 30.426  85.601  1.00 16.89 ? 85  LEU A C     1 
ATOM   401  O  O     . LEU A 1 49  ? 52.047 29.897  84.812  1.00 16.45 ? 85  LEU A O     1 
ATOM   402  C  CB    . LEU A 1 49  ? 51.229 31.426  87.216  1.00 11.94 ? 85  LEU A CB    1 
ATOM   403  C  CG    . LEU A 1 49  ? 51.474 30.502  88.407  1.00 13.12 ? 85  LEU A CG    1 
ATOM   404  C  CD1   . LEU A 1 49  ? 52.552 31.102  89.306  1.00 12.29 ? 85  LEU A CD1   1 
ATOM   405  C  CD2   . LEU A 1 49  ? 50.177 30.292  89.194  1.00 9.47  ? 85  LEU A CD2   1 
ATOM   406  N  N     . VAL A 1 50  ? 54.053 29.944  85.855  1.00 13.91 ? 86  VAL A N     1 
ATOM   407  C  CA    . VAL A 1 50  ? 54.640 28.850  85.087  1.00 19.13 ? 86  VAL A CA    1 
ATOM   408  C  C     . VAL A 1 50  ? 55.008 27.702  86.028  1.00 18.95 ? 86  VAL A C     1 
ATOM   409  O  O     . VAL A 1 50  ? 55.613 27.935  87.068  1.00 17.75 ? 86  VAL A O     1 
ATOM   410  C  CB    . VAL A 1 50  ? 55.928 29.348  84.383  1.00 20.83 ? 86  VAL A CB    1 
ATOM   411  C  CG1   . VAL A 1 50  ? 56.642 28.214  83.659  1.00 19.85 ? 86  VAL A CG1   1 
ATOM   412  C  CG2   . VAL A 1 50  ? 55.609 30.508  83.418  1.00 25.75 ? 86  VAL A CG2   1 
ATOM   413  N  N     . ALA A 1 51  ? 54.631 26.470  85.684  1.00 16.72 ? 87  ALA A N     1 
ATOM   414  C  CA    . ALA A 1 51  ? 55.060 25.304  86.461  1.00 13.43 ? 87  ALA A CA    1 
ATOM   415  C  C     . ALA A 1 51  ? 56.459 24.862  86.018  1.00 15.92 ? 87  ALA A C     1 
ATOM   416  O  O     . ALA A 1 51  ? 56.817 24.988  84.843  1.00 15.27 ? 87  ALA A O     1 
ATOM   417  C  CB    . ALA A 1 51  ? 54.060 24.146  86.314  1.00 16.37 ? 87  ALA A CB    1 
ATOM   418  N  N     . PHE A 1 52  ? 57.257 24.367  86.964  1.00 12.04 ? 88  PHE A N     1 
ATOM   419  C  CA    . PHE A 1 52  ? 58.547 23.772  86.631  1.00 13.40 ? 88  PHE A CA    1 
ATOM   420  C  C     . PHE A 1 52  ? 58.775 22.582  87.545  1.00 14.26 ? 88  PHE A C     1 
ATOM   421  O  O     . PHE A 1 52  ? 57.881 22.209  88.320  1.00 12.84 ? 88  PHE A O     1 
ATOM   422  C  CB    . PHE A 1 52  ? 59.702 24.797  86.678  1.00 11.67 ? 88  PHE A CB    1 
ATOM   423  C  CG    . PHE A 1 52  ? 60.042 25.304  88.058  1.00 12.81 ? 88  PHE A CG    1 
ATOM   424  C  CD1   . PHE A 1 52  ? 59.335 26.357  88.629  1.00 12.34 ? 88  PHE A CD1   1 
ATOM   425  C  CD2   . PHE A 1 52  ? 61.102 24.758  88.771  1.00 13.46 ? 88  PHE A CD2   1 
ATOM   426  C  CE1   . PHE A 1 52  ? 59.664 26.835  89.890  1.00 12.60 ? 88  PHE A CE1   1 
ATOM   427  C  CE2   . PHE A 1 52  ? 61.427 25.230  90.036  1.00 13.52 ? 88  PHE A CE2   1 
ATOM   428  C  CZ    . PHE A 1 52  ? 60.712 26.274  90.595  1.00 18.60 ? 88  PHE A CZ    1 
ATOM   429  N  N     . GLY A 1 53  ? 59.942 21.958  87.456  1.00 11.04 ? 89  GLY A N     1 
ATOM   430  C  CA    . GLY A 1 53  ? 60.237 20.857  88.367  1.00 14.00 ? 89  GLY A CA    1 
ATOM   431  C  C     . GLY A 1 53  ? 59.565 19.562  87.953  1.00 18.42 ? 89  GLY A C     1 
ATOM   432  O  O     . GLY A 1 53  ? 59.120 19.431  86.815  1.00 14.90 ? 89  GLY A O     1 
ATOM   433  N  N     . SER A 1 54  ? 59.451 18.618  88.883  1.00 17.81 ? 90  SER A N     1 
ATOM   434  C  CA    . SER A 1 54  ? 59.160 17.225  88.535  1.00 18.64 ? 90  SER A CA    1 
ATOM   435  C  C     . SER A 1 54  ? 57.776 17.001  87.928  1.00 18.43 ? 90  SER A C     1 
ATOM   436  O  O     . SER A 1 54  ? 57.624 16.131  87.076  1.00 19.59 ? 90  SER A O     1 
ATOM   437  C  CB    . SER A 1 54  ? 59.349 16.329  89.753  1.00 18.43 ? 90  SER A CB    1 
ATOM   438  O  OG    . SER A 1 54  ? 58.450 16.713  90.779  1.00 26.47 ? 90  SER A OG    1 
ATOM   439  N  N     . LEU A 1 55  ? 56.778 17.775  88.361  1.00 17.82 ? 91  LEU A N     1 
ATOM   440  C  CA    . LEU A 1 55  ? 55.435 17.679  87.774  1.00 21.25 ? 91  LEU A CA    1 
ATOM   441  C  C     . LEU A 1 55  ? 55.461 17.995  86.289  1.00 24.20 ? 91  LEU A C     1 
ATOM   442  O  O     . LEU A 1 55  ? 54.838 17.303  85.479  1.00 24.97 ? 91  LEU A O     1 
ATOM   443  C  CB    . LEU A 1 55  ? 54.457 18.644  88.457  1.00 22.41 ? 91  LEU A CB    1 
ATOM   444  C  CG    . LEU A 1 55  ? 53.566 18.166  89.612  1.00 32.48 ? 91  LEU A CG    1 
ATOM   445  C  CD1   . LEU A 1 55  ? 53.194 16.704  89.449  1.00 30.36 ? 91  LEU A CD1   1 
ATOM   446  C  CD2   . LEU A 1 55  ? 54.207 18.398  90.960  1.00 32.72 ? 91  LEU A CD2   1 
ATOM   447  N  N     . GLU A 1 56  ? 56.189 19.052  85.942  1.00 18.59 ? 92  GLU A N     1 
ATOM   448  C  CA    . GLU A 1 56  ? 56.263 19.537  84.563  1.00 17.65 ? 92  GLU A CA    1 
ATOM   449  C  C     . GLU A 1 56  ? 57.123 18.627  83.675  1.00 19.74 ? 92  GLU A C     1 
ATOM   450  O  O     . GLU A 1 56  ? 56.840 18.432  82.490  1.00 18.23 ? 92  GLU A O     1 
ATOM   451  C  CB    . GLU A 1 56  ? 56.807 20.971  84.576  1.00 17.52 ? 92  GLU A CB    1 
ATOM   452  C  CG    . GLU A 1 56  ? 56.849 21.650  83.222  1.00 19.70 ? 92  GLU A CG    1 
ATOM   453  C  CD    . GLU A 1 56  ? 55.455 21.960  82.695  1.00 31.05 ? 92  GLU A CD    1 
ATOM   454  O  OE1   . GLU A 1 56  ? 54.482 21.925  83.495  1.00 24.71 ? 92  GLU A OE1   1 
ATOM   455  O  OE2   . GLU A 1 56  ? 55.339 22.231  81.478  1.00 32.97 ? 92  GLU A OE2   1 
ATOM   456  N  N     . SER A 1 57  ? 58.172 18.053  84.251  1.00 15.35 ? 93  SER A N     1 
ATOM   457  C  CA    . SER A 1 57  ? 59.062 17.204  83.480  1.00 15.17 ? 93  SER A CA    1 
ATOM   458  C  C     . SER A 1 57  ? 58.516 15.773  83.370  1.00 18.69 ? 93  SER A C     1 
ATOM   459  O  O     . SER A 1 57  ? 58.951 15.001  82.514  1.00 20.52 ? 93  SER A O     1 
ATOM   460  C  CB    . SER A 1 57  ? 60.476 17.222  84.081  1.00 15.97 ? 93  SER A CB    1 
ATOM   461  O  OG    . SER A 1 57  ? 60.467 16.688  85.396  1.00 19.33 ? 93  SER A OG    1 
ATOM   462  N  N     . GLY A 1 58  ? 57.558 15.425  84.228  1.00 18.83 ? 94  GLY A N     1 
ATOM   463  C  CA    . GLY A 1 58  ? 57.002 14.076  84.240  1.00 17.90 ? 94  GLY A CA    1 
ATOM   464  C  C     . GLY A 1 58  ? 57.765 13.139  85.161  1.00 20.76 ? 94  GLY A C     1 
ATOM   465  O  O     . GLY A 1 58  ? 57.657 11.914  85.051  1.00 23.26 ? 94  GLY A O     1 
ATOM   466  N  N     . LEU A 1 59  ? 58.533 13.713  86.083  1.00 15.01 ? 95  LEU A N     1 
ATOM   467  C  CA    . LEU A 1 59  ? 59.407 12.922  86.950  1.00 14.10 ? 95  LEU A CA    1 
ATOM   468  C  C     . LEU A 1 59  ? 58.918 12.952  88.399  1.00 14.47 ? 95  LEU A C     1 
ATOM   469  O  O     . LEU A 1 59  ? 59.703 12.860  89.338  1.00 16.06 ? 95  LEU A O     1 
ATOM   470  C  CB    . LEU A 1 59  ? 60.856 13.420  86.827  1.00 15.03 ? 95  LEU A CB    1 
ATOM   471  C  CG    . LEU A 1 59  ? 61.447 13.249  85.417  1.00 10.26 ? 95  LEU A CG    1 
ATOM   472  C  CD1   . LEU A 1 59  ? 62.791 13.925  85.314  1.00 9.70  ? 95  LEU A CD1   1 
ATOM   473  C  CD2   . LEU A 1 59  ? 61.580 11.741  85.077  1.00 9.22  ? 95  LEU A CD2   1 
ATOM   474  N  N     . ALA A 1 60  ? 57.602 13.048  88.566  1.00 12.33 ? 96  ALA A N     1 
ATOM   475  C  CA    . ALA A 1 60  ? 56.999 13.217  89.886  1.00 15.53 ? 96  ALA A CA    1 
ATOM   476  C  C     . ALA A 1 60  ? 56.561 11.905  90.532  1.00 18.58 ? 96  ALA A C     1 
ATOM   477  O  O     . ALA A 1 60  ? 55.997 11.027  89.863  1.00 17.42 ? 96  ALA A O     1 
ATOM   478  C  CB    . ALA A 1 60  ? 55.818 14.162  89.797  1.00 20.48 ? 96  ALA A CB    1 
ATOM   479  N  N     . LEU A 1 61  ? 56.825 11.790  91.830  1.00 18.12 ? 97  LEU A N     1 
ATOM   480  C  CA    . LEU A 1 61  ? 56.274 10.717  92.659  1.00 21.51 ? 97  LEU A CA    1 
ATOM   481  C  C     . LEU A 1 61  ? 54.879 11.125  93.151  1.00 22.89 ? 97  LEU A C     1 
ATOM   482  O  O     . LEU A 1 61  ? 54.519 12.310  93.127  1.00 20.05 ? 97  LEU A O     1 
ATOM   483  C  CB    . LEU A 1 61  ? 57.187 10.462  93.861  1.00 20.69 ? 97  LEU A CB    1 
ATOM   484  C  CG    . LEU A 1 61  ? 58.605 9.966   93.564  1.00 19.85 ? 97  LEU A CG    1 
ATOM   485  C  CD1   . LEU A 1 61  ? 59.509 10.080  94.792  1.00 22.63 ? 97  LEU A CD1   1 
ATOM   486  C  CD2   . LEU A 1 61  ? 58.533 8.526   93.102  1.00 16.67 ? 97  LEU A CD2   1 
ATOM   487  N  N     . LYS A 1 62  ? 54.083 10.159  93.605  1.00 20.48 ? 98  LYS A N     1 
ATOM   488  C  CA    . LYS A 1 62  ? 52.758 10.512  94.118  1.00 25.11 ? 98  LYS A CA    1 
ATOM   489  C  C     . LYS A 1 62  ? 52.875 11.368  95.387  1.00 26.67 ? 98  LYS A C     1 
ATOM   490  O  O     . LYS A 1 62  ? 53.901 11.334  96.068  1.00 19.45 ? 98  LYS A O     1 
ATOM   491  C  CB    . LYS A 1 62  ? 51.881 9.274   94.331  1.00 28.65 ? 98  LYS A CB    1 
ATOM   492  C  CG    . LYS A 1 62  ? 52.439 8.209   95.238  1.00 29.19 ? 98  LYS A CG    1 
ATOM   493  C  CD    . LYS A 1 62  ? 51.477 7.016   95.268  1.00 30.40 ? 98  LYS A CD    1 
ATOM   494  C  CE    . LYS A 1 62  ? 51.842 6.006   96.362  1.00 36.47 ? 98  LYS A CE    1 
ATOM   495  N  NZ    . LYS A 1 62  ? 50.914 4.822   96.335  1.00 40.81 ? 98  LYS A NZ    1 
ATOM   496  N  N     . ASN A 1 63  ? 51.845 12.169  95.668  1.00 29.37 ? 99  ASN A N     1 
ATOM   497  C  CA    . ASN A 1 63  ? 51.884 13.119  96.783  1.00 27.73 ? 99  ASN A CA    1 
ATOM   498  C  C     . ASN A 1 63  ? 53.019 14.143  96.661  1.00 29.11 ? 99  ASN A C     1 
ATOM   499  O  O     . ASN A 1 63  ? 53.678 14.477  97.644  1.00 31.92 ? 99  ASN A O     1 
ATOM   500  C  CB    . ASN A 1 63  ? 51.961 12.379  98.121  1.00 30.56 ? 99  ASN A CB    1 
ATOM   501  C  CG    . ASN A 1 63  ? 50.834 11.379  98.294  1.00 36.21 ? 99  ASN A CG    1 
ATOM   502  O  OD1   . ASN A 1 63  ? 49.719 11.589  97.810  1.00 41.55 ? 99  ASN A OD1   1 
ATOM   503  N  ND2   . ASN A 1 63  ? 51.123 10.276  98.976  1.00 43.10 ? 99  ASN A ND2   1 
ATOM   504  N  N     . SER A 1 64  ? 53.241 14.639  95.450  1.00 30.64 ? 100 SER A N     1 
ATOM   505  C  CA    . SER A 1 64  ? 54.324 15.587  95.210  1.00 30.56 ? 100 SER A CA    1 
ATOM   506  C  C     . SER A 1 64  ? 53.869 17.016  95.468  1.00 25.91 ? 100 SER A C     1 
ATOM   507  O  O     . SER A 1 64  ? 52.681 17.331  95.345  1.00 30.11 ? 100 SER A O     1 
ATOM   508  C  CB    . SER A 1 64  ? 54.845 15.461  93.774  1.00 29.89 ? 100 SER A CB    1 
ATOM   509  O  OG    . SER A 1 64  ? 55.736 14.374  93.659  1.00 38.31 ? 100 SER A OG    1 
ATOM   510  N  N     . ASP A 1 65  ? 54.817 17.870  95.839  1.00 23.03 ? 101 ASP A N     1 
ATOM   511  C  CA    . ASP A 1 65  ? 54.542 19.295  95.971  1.00 28.67 ? 101 ASP A CA    1 
ATOM   512  C  C     . ASP A 1 65  ? 54.684 19.917  94.593  1.00 25.50 ? 101 ASP A C     1 
ATOM   513  O  O     . ASP A 1 65  ? 55.362 19.359  93.727  1.00 24.62 ? 101 ASP A O     1 
ATOM   514  C  CB    . ASP A 1 65  ? 55.531 19.943  96.938  1.00 29.66 ? 101 ASP A CB    1 
ATOM   515  C  CG    . ASP A 1 65  ? 55.230 19.620  98.384  1.00 39.25 ? 101 ASP A CG    1 
ATOM   516  O  OD1   . ASP A 1 65  ? 54.429 18.691  98.640  1.00 40.46 ? 101 ASP A OD1   1 
ATOM   517  O  OD2   . ASP A 1 65  ? 55.793 20.305  99.267  1.00 44.39 ? 101 ASP A OD2   1 
ATOM   518  N  N     . MET A 1 66  ? 54.033 21.055  94.382  1.00 21.48 ? 102 MET A N     1 
ATOM   519  C  CA    . MET A 1 66  ? 54.145 21.765  93.119  1.00 18.64 ? 102 MET A CA    1 
ATOM   520  C  C     . MET A 1 66  ? 55.228 22.827  93.249  1.00 16.01 ? 102 MET A C     1 
ATOM   521  O  O     . MET A 1 66  ? 55.426 23.392  94.324  1.00 14.07 ? 102 MET A O     1 
ATOM   522  C  CB    . MET A 1 66  ? 52.827 22.451  92.767  1.00 19.39 ? 102 MET A CB    1 
ATOM   523  C  CG    . MET A 1 66  ? 51.627 21.528  92.773  1.00 30.30 ? 102 MET A CG    1 
ATOM   524  S  SD    . MET A 1 66  ? 50.152 22.429  92.271  1.00 34.73 ? 102 MET A SD    1 
ATOM   525  C  CE    . MET A 1 66  ? 50.639 22.842  90.583  1.00 15.59 ? 102 MET A CE    1 
ATOM   526  N  N     . ASP A 1 67  ? 55.928 23.085  92.158  1.00 16.72 ? 103 ASP A N     1 
ATOM   527  C  CA    . ASP A 1 67  ? 56.873 24.188  92.103  1.00 13.14 ? 103 ASP A CA    1 
ATOM   528  C  C     . ASP A 1 67  ? 56.372 25.099  91.017  1.00 14.24 ? 103 ASP A C     1 
ATOM   529  O  O     . ASP A 1 67  ? 56.266 24.689  89.859  1.00 13.77 ? 103 ASP A O     1 
ATOM   530  C  CB    . ASP A 1 67  ? 58.257 23.682  91.704  1.00 19.13 ? 103 ASP A CB    1 
ATOM   531  C  CG    . ASP A 1 67  ? 58.998 23.032  92.854  1.00 24.57 ? 103 ASP A CG    1 
ATOM   532  O  OD1   . ASP A 1 67  ? 59.059 23.640  93.945  1.00 28.82 ? 103 ASP A OD1   1 
ATOM   533  O  OD2   . ASP A 1 67  ? 59.514 21.916  92.660  1.00 28.63 ? 103 ASP A OD2   1 
ATOM   534  N  N     . LEU A 1 68  ? 56.063 26.336  91.377  1.00 15.09 ? 104 LEU A N     1 
ATOM   535  C  CA    . LEU A 1 68  ? 55.589 27.304  90.396  1.00 12.50 ? 104 LEU A CA    1 
ATOM   536  C  C     . LEU A 1 68  ? 56.466 28.530  90.423  1.00 13.77 ? 104 LEU A C     1 
ATOM   537  O  O     . LEU A 1 68  ? 57.169 28.800  91.406  1.00 11.81 ? 104 LEU A O     1 
ATOM   538  C  CB    . LEU A 1 68  ? 54.158 27.738  90.715  1.00 12.84 ? 104 LEU A CB    1 
ATOM   539  C  CG    . LEU A 1 68  ? 53.103 26.637  90.807  1.00 15.92 ? 104 LEU A CG    1 
ATOM   540  C  CD1   . LEU A 1 68  ? 51.738 27.284  91.091  1.00 14.46 ? 104 LEU A CD1   1 
ATOM   541  C  CD2   . LEU A 1 68  ? 53.082 25.834  89.505  1.00 14.20 ? 104 LEU A CD2   1 
ATOM   542  N  N     . CYS A 1 69  ? 56.364 29.310  89.357  1.00 10.88 ? 105 CYS A N     1 
ATOM   543  C  CA    . CYS A 1 69  ? 57.212 30.452  89.154  1.00 12.57 ? 105 CYS A CA    1 
ATOM   544  C  C     . CYS A 1 69  ? 56.400 31.592  88.544  1.00 12.66 ? 105 CYS A C     1 
ATOM   545  O  O     . CYS A 1 69  ? 55.829 31.416  87.471  1.00 14.19 ? 105 CYS A O     1 
ATOM   546  C  CB    . CYS A 1 69  ? 58.267 30.024  88.138  1.00 17.31 ? 105 CYS A CB    1 
ATOM   547  S  SG    . CYS A 1 69  ? 59.437 31.274  87.785  1.00 24.96 ? 105 CYS A SG    1 
ATOM   548  N  N     . VAL A 1 70  ? 56.356 32.741  89.215  1.00 14.96 ? 106 VAL A N     1 
ATOM   549  C  CA    . VAL A 1 70  ? 55.777 33.961  88.630  1.00 13.05 ? 106 VAL A CA    1 
ATOM   550  C  C     . VAL A 1 70  ? 56.806 34.700  87.770  1.00 13.85 ? 106 VAL A C     1 
ATOM   551  O  O     . VAL A 1 70  ? 57.877 35.094  88.265  1.00 13.60 ? 106 VAL A O     1 
ATOM   552  C  CB    . VAL A 1 70  ? 55.289 34.935  89.713  1.00 11.57 ? 106 VAL A CB    1 
ATOM   553  C  CG1   . VAL A 1 70  ? 54.927 36.309  89.100  1.00 12.91 ? 106 VAL A CG1   1 
ATOM   554  C  CG2   . VAL A 1 70  ? 54.078 34.370  90.461  1.00 12.36 ? 106 VAL A CG2   1 
ATOM   555  N  N     . LEU A 1 71  ? 56.480 34.907  86.494  1.00 13.25 ? 107 LEU A N     1 
ATOM   556  C  CA    . LEU A 1 71  ? 57.365 35.644  85.584  1.00 14.16 ? 107 LEU A CA    1 
ATOM   557  C  C     . LEU A 1 71  ? 56.828 37.025  85.251  1.00 20.10 ? 107 LEU A C     1 
ATOM   558  O  O     . LEU A 1 71  ? 55.664 37.169  84.879  1.00 16.98 ? 107 LEU A O     1 
ATOM   559  C  CB    . LEU A 1 71  ? 57.558 34.883  84.275  1.00 17.50 ? 107 LEU A CB    1 
ATOM   560  C  CG    . LEU A 1 71  ? 58.201 33.510  84.418  1.00 22.88 ? 107 LEU A CG    1 
ATOM   561  C  CD1   . LEU A 1 71  ? 58.411 32.863  83.060  1.00 29.59 ? 107 LEU A CD1   1 
ATOM   562  C  CD2   . LEU A 1 71  ? 59.514 33.669  85.147  1.00 18.03 ? 107 LEU A CD2   1 
ATOM   563  N  N     . MET A 1 72  ? 57.686 38.032  85.368  1.00 21.72 ? 108 MET A N     1 
ATOM   564  C  CA    . MET A 1 72  ? 57.345 39.390  84.963  1.00 28.22 ? 108 MET A CA    1 
ATOM   565  C  C     . MET A 1 72  ? 58.501 40.011  84.198  1.00 33.96 ? 108 MET A C     1 
ATOM   566  O  O     . MET A 1 72  ? 58.295 40.841  83.321  1.00 40.84 ? 108 MET A O     1 
ATOM   567  C  CB    . MET A 1 72  ? 57.012 40.256  86.173  1.00 25.80 ? 108 MET A CB    1 
ATOM   568  C  CG    . MET A 1 72  ? 55.762 39.821  86.920  1.00 27.35 ? 108 MET A CG    1 
ATOM   569  S  SD    . MET A 1 72  ? 54.950 41.210  87.739  1.00 41.15 ? 108 MET A SD    1 
ATOM   570  C  CE    . MET A 1 72  ? 54.436 42.198  86.322  1.00 20.52 ? 108 MET A CE    1 
ATOM   571  N  N     . THR A 1 80  ? 57.264 44.721  94.802  1.00 46.03 ? 116 THR A N     1 
ATOM   572  C  CA    . THR A 1 80  ? 56.941 43.620  93.904  1.00 46.18 ? 116 THR A CA    1 
ATOM   573  C  C     . THR A 1 80  ? 55.463 43.233  93.917  1.00 45.48 ? 116 THR A C     1 
ATOM   574  O  O     . THR A 1 80  ? 54.656 43.753  94.694  1.00 48.83 ? 116 THR A O     1 
ATOM   575  C  CB    . THR A 1 80  ? 57.777 42.340  94.207  1.00 41.44 ? 116 THR A CB    1 
ATOM   576  O  OG1   . THR A 1 80  ? 58.402 42.451  95.493  1.00 49.08 ? 116 THR A OG1   1 
ATOM   577  C  CG2   . THR A 1 80  ? 58.838 42.125  93.140  1.00 42.81 ? 116 THR A CG2   1 
ATOM   578  N  N     . ILE A 1 81  ? 55.139 42.295  93.036  1.00 37.10 ? 117 ILE A N     1 
ATOM   579  C  CA    . ILE A 1 81  ? 53.815 41.713  92.918  1.00 31.81 ? 117 ILE A CA    1 
ATOM   580  C  C     . ILE A 1 81  ? 53.673 40.608  93.965  1.00 25.07 ? 117 ILE A C     1 
ATOM   581  O  O     . ILE A 1 81  ? 52.568 40.125  94.244  1.00 27.69 ? 117 ILE A O     1 
ATOM   582  C  CB    . ILE A 1 81  ? 53.652 41.129  91.494  1.00 35.34 ? 117 ILE A CB    1 
ATOM   583  C  CG1   . ILE A 1 81  ? 52.211 40.724  91.207  1.00 30.42 ? 117 ILE A CG1   1 
ATOM   584  C  CG2   . ILE A 1 81  ? 54.598 39.948  91.269  1.00 32.59 ? 117 ILE A CG2   1 
ATOM   585  C  CD1   . ILE A 1 81  ? 52.004 40.274  89.784  1.00 32.61 ? 117 ILE A CD1   1 
ATOM   586  N  N     . ALA A 1 82  ? 54.808 40.217  94.539  1.00 21.77 ? 118 ALA A N     1 
ATOM   587  C  CA    . ALA A 1 82  ? 54.866 39.087  95.462  1.00 24.33 ? 118 ALA A CA    1 
ATOM   588  C  C     . ALA A 1 82  ? 53.908 39.264  96.635  1.00 21.61 ? 118 ALA A C     1 
ATOM   589  O  O     . ALA A 1 82  ? 53.123 38.365  96.943  1.00 20.88 ? 118 ALA A O     1 
ATOM   590  C  CB    . ALA A 1 82  ? 56.282 38.879  95.954  1.00 21.58 ? 118 ALA A CB    1 
ATOM   591  N  N     . LEU A 1 83  ? 53.975 40.424  97.285  1.00 23.38 ? 119 LEU A N     1 
ATOM   592  C  CA    . LEU A 1 83  ? 53.118 40.710  98.439  1.00 24.22 ? 119 LEU A CA    1 
ATOM   593  C  C     . LEU A 1 83  ? 51.641 40.720  98.049  1.00 21.38 ? 119 LEU A C     1 
ATOM   594  O  O     . LEU A 1 83  ? 50.796 40.152  98.743  1.00 18.94 ? 119 LEU A O     1 
ATOM   595  C  CB    . LEU A 1 83  ? 53.488 42.065  99.043  1.00 23.87 ? 119 LEU A CB    1 
ATOM   596  C  CG    . LEU A 1 83  ? 53.404 42.297  100.555 1.00 28.44 ? 119 LEU A CG    1 
ATOM   597  C  CD1   . LEU A 1 83  ? 53.131 43.766  100.843 1.00 30.87 ? 119 LEU A CD1   1 
ATOM   598  C  CD2   . LEU A 1 83  ? 52.396 41.405  101.273 1.00 26.39 ? 119 LEU A CD2   1 
ATOM   599  N  N     . GLN A 1 84  ? 51.334 41.374  96.934  1.00 21.89 ? 120 GLN A N     1 
ATOM   600  C  CA    . GLN A 1 84  ? 49.953 41.488  96.477  1.00 24.70 ? 120 GLN A CA    1 
ATOM   601  C  C     . GLN A 1 84  ? 49.370 40.126  96.127  1.00 20.72 ? 120 GLN A C     1 
ATOM   602  O  O     . GLN A 1 84  ? 48.217 39.823  96.458  1.00 21.52 ? 120 GLN A O     1 
ATOM   603  C  CB    . GLN A 1 84  ? 49.879 42.401  95.255  1.00 24.72 ? 120 GLN A CB    1 
ATOM   604  C  CG    . GLN A 1 84  ? 49.449 43.817  95.567  1.00 33.06 ? 120 GLN A CG    1 
ATOM   605  C  CD    . GLN A 1 84  ? 49.230 44.610  94.301  1.00 40.46 ? 120 GLN A CD    1 
ATOM   606  O  OE1   . GLN A 1 84  ? 48.102 44.732  93.815  1.00 37.84 ? 120 GLN A OE1   1 
ATOM   607  N  NE2   . GLN A 1 84  ? 50.315 45.130  93.741  1.00 36.03 ? 120 GLN A NE2   1 
ATOM   608  N  N     . PHE A 1 85  ? 50.174 39.309  95.454  1.00 17.98 ? 121 PHE A N     1 
ATOM   609  C  CA    . PHE A 1 85  ? 49.758 37.966  95.101  1.00 15.86 ? 121 PHE A CA    1 
ATOM   610  C  C     . PHE A 1 85  ? 49.496 37.186  96.391  1.00 16.49 ? 121 PHE A C     1 
ATOM   611  O  O     . PHE A 1 85  ? 48.438 36.581  96.552  1.00 14.82 ? 121 PHE A O     1 
ATOM   612  C  CB    . PHE A 1 85  ? 50.843 37.282  94.258  1.00 16.74 ? 121 PHE A CB    1 
ATOM   613  C  CG    . PHE A 1 85  ? 50.403 35.989  93.606  1.00 14.28 ? 121 PHE A CG    1 
ATOM   614  C  CD1   . PHE A 1 85  ? 49.058 35.743  93.342  1.00 15.56 ? 121 PHE A CD1   1 
ATOM   615  C  CD2   . PHE A 1 85  ? 51.343 35.022  93.243  1.00 12.41 ? 121 PHE A CD2   1 
ATOM   616  C  CE1   . PHE A 1 85  ? 48.650 34.555  92.737  1.00 12.16 ? 121 PHE A CE1   1 
ATOM   617  C  CE2   . PHE A 1 85  ? 50.949 33.826  92.628  1.00 12.76 ? 121 PHE A CE2   1 
ATOM   618  C  CZ    . PHE A 1 85  ? 49.597 33.589  92.378  1.00 12.13 ? 121 PHE A CZ    1 
ATOM   619  N  N     . TYR A 1 86  ? 50.457 37.213  97.313  1.00 15.67 ? 122 TYR A N     1 
ATOM   620  C  CA    . TYR A 1 86  ? 50.314 36.477  98.568  1.00 17.36 ? 122 TYR A CA    1 
ATOM   621  C  C     . TYR A 1 86  ? 49.043 36.871  99.337  1.00 18.38 ? 122 TYR A C     1 
ATOM   622  O  O     . TYR A 1 86  ? 48.298 36.010  99.811  1.00 18.53 ? 122 TYR A O     1 
ATOM   623  C  CB    . TYR A 1 86  ? 51.545 36.687  99.448  1.00 17.74 ? 122 TYR A CB    1 
ATOM   624  C  CG    . TYR A 1 86  ? 51.412 36.034  100.809 1.00 20.11 ? 122 TYR A CG    1 
ATOM   625  C  CD1   . TYR A 1 86  ? 51.459 34.656  100.942 1.00 21.80 ? 122 TYR A CD1   1 
ATOM   626  C  CD2   . TYR A 1 86  ? 51.239 36.796  101.955 1.00 25.30 ? 122 TYR A CD2   1 
ATOM   627  C  CE1   . TYR A 1 86  ? 51.342 34.050  102.182 1.00 20.96 ? 122 TYR A CE1   1 
ATOM   628  C  CE2   . TYR A 1 86  ? 51.120 36.196  103.204 1.00 19.93 ? 122 TYR A CE2   1 
ATOM   629  C  CZ    . TYR A 1 86  ? 51.171 34.828  103.303 1.00 25.14 ? 122 TYR A CZ    1 
ATOM   630  O  OH    . TYR A 1 86  ? 51.050 34.218  104.530 1.00 29.10 ? 122 TYR A OH    1 
ATOM   631  N  N     . GLU A 1 87  ? 48.793 38.169  99.458  1.00 22.74 ? 123 GLU A N     1 
ATOM   632  C  CA    . GLU A 1 87  ? 47.622 38.621  100.205 1.00 24.26 ? 123 GLU A CA    1 
ATOM   633  C  C     . GLU A 1 87  ? 46.332 38.217  99.512  1.00 23.83 ? 123 GLU A C     1 
ATOM   634  O  O     . GLU A 1 87  ? 45.336 37.932  100.169 1.00 20.24 ? 123 GLU A O     1 
ATOM   635  C  CB    . GLU A 1 87  ? 47.668 40.130  100.433 1.00 24.36 ? 123 GLU A CB    1 
ATOM   636  C  CG    . GLU A 1 87  ? 48.895 40.575  101.213 1.00 32.01 ? 123 GLU A CG    1 
ATOM   637  C  CD    . GLU A 1 87  ? 48.863 42.048  101.573 1.00 36.31 ? 123 GLU A CD    1 
ATOM   638  O  OE1   . GLU A 1 87  ? 48.249 42.837  100.822 1.00 39.69 ? 123 GLU A OE1   1 
ATOM   639  O  OE2   . GLU A 1 87  ? 49.463 42.413  102.608 1.00 36.68 ? 123 GLU A OE2   1 
ATOM   640  N  N     . GLU A 1 88  ? 46.360 38.161  98.183  1.00 19.05 ? 124 GLU A N     1 
ATOM   641  C  CA    . GLU A 1 88  ? 45.186 37.753  97.421  1.00 23.72 ? 124 GLU A CA    1 
ATOM   642  C  C     . GLU A 1 88  ? 44.926 36.250  97.553  1.00 25.39 ? 124 GLU A C     1 
ATOM   643  O  O     . GLU A 1 88  ? 43.776 35.814  97.642  1.00 23.05 ? 124 GLU A O     1 
ATOM   644  C  CB    . GLU A 1 88  ? 45.355 38.147  95.949  1.00 23.84 ? 124 GLU A CB    1 
ATOM   645  C  CG    . GLU A 1 88  ? 44.149 37.854  95.077  1.00 30.77 ? 124 GLU A CG    1 
ATOM   646  C  CD    . GLU A 1 88  ? 42.914 38.637  95.489  1.00 38.96 ? 124 GLU A CD    1 
ATOM   647  O  OE1   . GLU A 1 88  ? 43.057 39.742  96.069  1.00 39.50 ? 124 GLU A OE1   1 
ATOM   648  O  OE2   . GLU A 1 88  ? 41.795 38.140  95.225  1.00 42.95 ? 124 GLU A OE2   1 
ATOM   649  N  N     . LEU A 1 89  ? 45.999 35.460  97.565  1.00 18.17 ? 125 LEU A N     1 
ATOM   650  C  CA    . LEU A 1 89  ? 45.892 34.018  97.782  1.00 21.18 ? 125 LEU A CA    1 
ATOM   651  C  C     . LEU A 1 89  ? 45.250 33.696  99.131  1.00 19.89 ? 125 LEU A C     1 
ATOM   652  O  O     . LEU A 1 89  ? 44.390 32.818  99.231  1.00 20.34 ? 125 LEU A O     1 
ATOM   653  C  CB    . LEU A 1 89  ? 47.279 33.384  97.690  1.00 17.79 ? 125 LEU A CB    1 
ATOM   654  C  CG    . LEU A 1 89  ? 47.796 33.459  96.255  1.00 17.35 ? 125 LEU A CG    1 
ATOM   655  C  CD1   . LEU A 1 89  ? 49.231 32.980  96.169  1.00 17.06 ? 125 LEU A CD1   1 
ATOM   656  C  CD2   . LEU A 1 89  ? 46.892 32.599  95.387  1.00 17.41 ? 125 LEU A CD2   1 
ATOM   657  N  N     . ILE A 1 90  ? 45.670 34.418  100.161 1.00 20.98 ? 126 ILE A N     1 
ATOM   658  C  CA    . ILE A 1 90  ? 45.109 34.225  101.499 1.00 26.02 ? 126 ILE A CA    1 
ATOM   659  C  C     . ILE A 1 90  ? 43.618 34.577  101.507 1.00 29.51 ? 126 ILE A C     1 
ATOM   660  O  O     . ILE A 1 90  ? 42.793 33.818  102.020 1.00 27.65 ? 126 ILE A O     1 
ATOM   661  C  CB    . ILE A 1 90  ? 45.850 35.071  102.553 1.00 24.79 ? 126 ILE A CB    1 
ATOM   662  C  CG1   . ILE A 1 90  ? 47.314 34.622  102.681 1.00 23.56 ? 126 ILE A CG1   1 
ATOM   663  C  CG2   . ILE A 1 90  ? 45.141 34.990  103.901 1.00 26.73 ? 126 ILE A CG2   1 
ATOM   664  C  CD1   . ILE A 1 90  ? 47.484 33.139  102.917 1.00 26.69 ? 126 ILE A CD1   1 
ATOM   665  N  N     . ALA A 1 91  ? 43.283 35.725  100.926 1.00 29.86 ? 127 ALA A N     1 
ATOM   666  C  CA    . ALA A 1 91  ? 41.894 36.160  100.817 1.00 24.98 ? 127 ALA A CA    1 
ATOM   667  C  C     . ALA A 1 91  ? 41.025 35.101  100.144 1.00 32.36 ? 127 ALA A C     1 
ATOM   668  O  O     . ALA A 1 91  ? 39.842 34.960  100.466 1.00 32.41 ? 127 ALA A O     1 
ATOM   669  C  CB    . ALA A 1 91  ? 41.816 37.471  100.058 1.00 28.37 ? 127 ALA A CB    1 
ATOM   670  N  N     . GLU A 1 92  ? 41.612 34.349  99.216  1.00 24.96 ? 128 GLU A N     1 
ATOM   671  C  CA    . GLU A 1 92  ? 40.862 33.327  98.496  1.00 24.85 ? 128 GLU A CA    1 
ATOM   672  C  C     . GLU A 1 92  ? 40.897 31.953  99.166  1.00 29.28 ? 128 GLU A C     1 
ATOM   673  O  O     . GLU A 1 92  ? 40.512 30.950  98.561  1.00 25.85 ? 128 GLU A O     1 
ATOM   674  C  CB    . GLU A 1 92  ? 41.315 33.258  97.036  1.00 26.70 ? 128 GLU A CB    1 
ATOM   675  C  CG    . GLU A 1 92  ? 41.195 34.621  96.347  1.00 27.74 ? 128 GLU A CG    1 
ATOM   676  C  CD    . GLU A 1 92  ? 40.972 34.521  94.854  1.00 36.73 ? 128 GLU A CD    1 
ATOM   677  O  OE1   . GLU A 1 92  ? 40.440 33.486  94.397  1.00 41.28 ? 128 GLU A OE1   1 
ATOM   678  O  OE2   . GLU A 1 92  ? 41.325 35.486  94.135  1.00 39.90 ? 128 GLU A OE2   1 
ATOM   679  N  N     . GLY A 1 93  ? 41.352 31.917  100.415 1.00 26.91 ? 129 GLY A N     1 
ATOM   680  C  CA    . GLY A 1 93  ? 41.200 30.729  101.233 1.00 26.28 ? 129 GLY A CA    1 
ATOM   681  C  C     . GLY A 1 93  ? 42.389 29.793  101.286 1.00 31.46 ? 129 GLY A C     1 
ATOM   682  O  O     . GLY A 1 93  ? 42.306 28.734  101.913 1.00 24.59 ? 129 GLY A O     1 
ATOM   683  N  N     . PHE A 1 94  ? 43.488 30.155  100.623 1.00 27.05 ? 130 PHE A N     1 
ATOM   684  C  CA    . PHE A 1 94  ? 44.709 29.368  100.761 1.00 27.61 ? 130 PHE A CA    1 
ATOM   685  C  C     . PHE A 1 94  ? 45.388 29.748  102.070 1.00 21.97 ? 130 PHE A C     1 
ATOM   686  O  O     . PHE A 1 94  ? 45.179 30.850  102.591 1.00 22.10 ? 130 PHE A O     1 
ATOM   687  C  CB    . PHE A 1 94  ? 45.663 29.586  99.574  1.00 23.12 ? 130 PHE A CB    1 
ATOM   688  C  CG    . PHE A 1 94  ? 45.189 28.961  98.292  1.00 22.42 ? 130 PHE A CG    1 
ATOM   689  C  CD1   . PHE A 1 94  ? 45.452 27.623  98.014  1.00 22.11 ? 130 PHE A CD1   1 
ATOM   690  C  CD2   . PHE A 1 94  ? 44.491 29.714  97.354  1.00 21.77 ? 130 PHE A CD2   1 
ATOM   691  C  CE1   . PHE A 1 94  ? 45.011 27.036  96.827  1.00 21.95 ? 130 PHE A CE1   1 
ATOM   692  C  CE2   . PHE A 1 94  ? 44.048 29.135  96.165  1.00 22.63 ? 130 PHE A CE2   1 
ATOM   693  C  CZ    . PHE A 1 94  ? 44.310 27.795  95.901  1.00 24.60 ? 130 PHE A CZ    1 
ATOM   694  N  N     . GLU A 1 95  ? 46.178 28.824  102.607 1.00 18.59 ? 131 GLU A N     1 
ATOM   695  C  CA    . GLU A 1 95  ? 47.017 29.108  103.765 1.00 24.33 ? 131 GLU A CA    1 
ATOM   696  C  C     . GLU A 1 95  ? 48.462 29.016  103.313 1.00 17.44 ? 131 GLU A C     1 
ATOM   697  O  O     . GLU A 1 95  ? 48.811 28.157  102.501 1.00 20.81 ? 131 GLU A O     1 
ATOM   698  C  CB    . GLU A 1 95  ? 46.797 28.071  104.869 1.00 27.58 ? 131 GLU A CB    1 
ATOM   699  C  CG    . GLU A 1 95  ? 45.686 28.398  105.845 1.00 35.95 ? 131 GLU A CG    1 
ATOM   700  C  CD    . GLU A 1 95  ? 45.281 27.188  106.664 1.00 46.32 ? 131 GLU A CD    1 
ATOM   701  O  OE1   . GLU A 1 95  ? 46.158 26.341  106.958 1.00 43.78 ? 131 GLU A OE1   1 
ATOM   702  O  OE2   . GLU A 1 95  ? 44.082 27.077  106.997 1.00 47.52 ? 131 GLU A OE2   1 
ATOM   703  N  N     . GLY A 1 96  ? 49.310 29.876  103.849 1.00 19.99 ? 132 GLY A N     1 
ATOM   704  C  CA    . GLY A 1 96  ? 50.701 29.810  103.458 1.00 21.85 ? 132 GLY A CA    1 
ATOM   705  C  C     . GLY A 1 96  ? 51.606 30.726  104.241 1.00 22.44 ? 132 GLY A C     1 
ATOM   706  O  O     . GLY A 1 96  ? 51.187 31.332  105.228 1.00 25.47 ? 132 GLY A O     1 
ATOM   707  N  N     . LYS A 1 97  ? 52.852 30.821  103.780 1.00 15.26 ? 133 LYS A N     1 
ATOM   708  C  CA    . LYS A 1 97  ? 53.896 31.584  104.441 1.00 16.51 ? 133 LYS A CA    1 
ATOM   709  C  C     . LYS A 1 97  ? 54.620 32.416  103.401 1.00 21.65 ? 133 LYS A C     1 
ATOM   710  O  O     . LYS A 1 97  ? 54.743 32.008  102.237 1.00 15.89 ? 133 LYS A O     1 
ATOM   711  C  CB    . LYS A 1 97  ? 54.908 30.633  105.095 1.00 18.74 ? 133 LYS A CB    1 
ATOM   712  C  CG    . LYS A 1 97  ? 54.318 29.674  106.133 1.00 20.13 ? 133 LYS A CG    1 
ATOM   713  C  CD    . LYS A 1 97  ? 55.400 28.771  106.709 1.00 20.80 ? 133 LYS A CD    1 
ATOM   714  C  CE    . LYS A 1 97  ? 54.851 27.847  107.795 1.00 29.05 ? 133 LYS A CE    1 
ATOM   715  N  NZ    . LYS A 1 97  ? 54.181 26.636  107.233 1.00 27.55 ? 133 LYS A NZ    1 
ATOM   716  N  N     . PHE A 1 98  ? 55.122 33.570  103.821 1.00 15.79 ? 134 PHE A N     1 
ATOM   717  C  CA    . PHE A 1 98  ? 55.832 34.460  102.909 1.00 17.21 ? 134 PHE A CA    1 
ATOM   718  C  C     . PHE A 1 98  ? 56.692 35.397  103.725 1.00 18.24 ? 134 PHE A C     1 
ATOM   719  O  O     . PHE A 1 98  ? 56.242 35.926  104.747 1.00 20.37 ? 134 PHE A O     1 
ATOM   720  C  CB    . PHE A 1 98  ? 54.821 35.266  102.080 1.00 18.53 ? 134 PHE A CB    1 
ATOM   721  C  CG    . PHE A 1 98  ? 55.444 36.316  101.192 1.00 16.81 ? 134 PHE A CG    1 
ATOM   722  C  CD1   . PHE A 1 98  ? 56.342 35.960  100.191 1.00 18.04 ? 134 PHE A CD1   1 
ATOM   723  C  CD2   . PHE A 1 98  ? 55.107 37.658  101.346 1.00 20.97 ? 134 PHE A CD2   1 
ATOM   724  C  CE1   . PHE A 1 98  ? 56.910 36.930  99.370  1.00 16.97 ? 134 PHE A CE1   1 
ATOM   725  C  CE2   . PHE A 1 98  ? 55.660 38.634  100.530 1.00 20.58 ? 134 PHE A CE2   1 
ATOM   726  C  CZ    . PHE A 1 98  ? 56.562 38.275  99.541  1.00 20.76 ? 134 PHE A CZ    1 
ATOM   727  N  N     . LEU A 1 99  ? 57.927 35.616  103.291 1.00 19.15 ? 135 LEU A N     1 
ATOM   728  C  CA    . LEU A 1 99  ? 58.746 36.625  103.950 1.00 20.16 ? 135 LEU A CA    1 
ATOM   729  C  C     . LEU A 1 99  ? 59.055 37.769  102.991 1.00 23.54 ? 135 LEU A C     1 
ATOM   730  O  O     . LEU A 1 99  ? 59.828 37.600  102.042 1.00 25.28 ? 135 LEU A O     1 
ATOM   731  C  CB    . LEU A 1 99  ? 60.029 36.007  104.518 1.00 18.49 ? 135 LEU A CB    1 
ATOM   732  C  CG    . LEU A 1 99  ? 60.960 36.921  105.322 1.00 28.16 ? 135 LEU A CG    1 
ATOM   733  C  CD1   . LEU A 1 99  ? 60.176 37.780  106.310 1.00 26.59 ? 135 LEU A CD1   1 
ATOM   734  C  CD2   . LEU A 1 99  ? 62.014 36.081  106.056 1.00 29.82 ? 135 LEU A CD2   1 
ATOM   735  N  N     . GLN A 1 100 ? 58.446 38.929  103.242 1.00 24.71 ? 136 GLN A N     1 
ATOM   736  C  CA    . GLN A 1 100 ? 58.654 40.108  102.405 1.00 25.42 ? 136 GLN A CA    1 
ATOM   737  C  C     . GLN A 1 100 ? 60.108 40.562  102.449 1.00 26.12 ? 136 GLN A C     1 
ATOM   738  O  O     . GLN A 1 100 ? 60.772 40.439  103.484 1.00 27.12 ? 136 GLN A O     1 
ATOM   739  C  CB    . GLN A 1 100 ? 57.782 41.278  102.878 1.00 27.95 ? 136 GLN A CB    1 
ATOM   740  C  CG    . GLN A 1 100 ? 56.417 40.907  103.447 1.00 33.03 ? 136 GLN A CG    1 
ATOM   741  C  CD    . GLN A 1 100 ? 55.638 42.125  103.935 1.00 37.98 ? 136 GLN A CD    1 
ATOM   742  O  OE1   . GLN A 1 100 ? 55.933 43.266  103.554 1.00 38.14 ? 136 GLN A OE1   1 
ATOM   743  N  NE2   . GLN A 1 100 ? 54.642 41.887  104.784 1.00 36.27 ? 136 GLN A NE2   1 
ATOM   744  N  N     . ARG A 1 101 ? 60.576 41.109  101.327 1.00 27.31 ? 137 ARG A N     1 
ATOM   745  C  CA    . ARG A 1 101 ? 61.922 41.681  101.206 1.00 30.03 ? 137 ARG A CA    1 
ATOM   746  C  C     . ARG A 1 101 ? 63.062 40.668  101.198 1.00 29.08 ? 137 ARG A C     1 
ATOM   747  O  O     . ARG A 1 101 ? 64.229 41.057  101.183 1.00 36.78 ? 137 ARG A O     1 
ATOM   748  C  CB    . ARG A 1 101 ? 62.186 42.760  102.268 1.00 26.93 ? 137 ARG A CB    1 
ATOM   749  C  CG    . ARG A 1 101 ? 61.307 43.991  102.133 1.00 33.00 ? 137 ARG A CG    1 
ATOM   750  C  CD    . ARG A 1 101 ? 61.617 45.029  103.209 1.00 32.69 ? 137 ARG A CD    1 
ATOM   751  N  NE    . ARG A 1 101 ? 61.521 44.466  104.554 1.00 34.71 ? 137 ARG A NE    1 
ATOM   752  C  CZ    . ARG A 1 101 ? 62.547 44.351  105.394 1.00 32.83 ? 137 ARG A CZ    1 
ATOM   753  N  NH1   . ARG A 1 101 ? 63.749 44.778  105.037 1.00 32.37 ? 137 ARG A NH1   1 
ATOM   754  N  NH2   . ARG A 1 101 ? 62.368 43.817  106.596 1.00 35.59 ? 137 ARG A NH2   1 
ATOM   755  N  N     . ALA A 1 102 ? 62.736 39.378  101.207 1.00 28.82 ? 138 ALA A N     1 
ATOM   756  C  CA    . ALA A 1 102 ? 63.758 38.347  101.039 1.00 33.84 ? 138 ALA A CA    1 
ATOM   757  C  C     . ALA A 1 102 ? 64.442 38.556  99.685  1.00 31.74 ? 138 ALA A C     1 
ATOM   758  O  O     . ALA A 1 102 ? 63.821 39.069  98.743  1.00 34.18 ? 138 ALA A O     1 
ATOM   759  C  CB    . ALA A 1 102 ? 63.141 36.946  101.135 1.00 30.60 ? 138 ALA A CB    1 
ATOM   760  N  N     . ARG A 1 103 ? 65.723 38.203  99.590  1.00 33.70 ? 139 ARG A N     1 
ATOM   761  C  CA    . ARG A 1 103 ? 66.446 38.339  98.323  1.00 37.52 ? 139 ARG A CA    1 
ATOM   762  C  C     . ARG A 1 103 ? 65.931 37.313  97.307  1.00 32.46 ? 139 ARG A C     1 
ATOM   763  O  O     . ARG A 1 103 ? 65.911 37.572  96.099  1.00 34.23 ? 139 ARG A O     1 
ATOM   764  C  CB    . ARG A 1 103 ? 67.962 38.211  98.531  1.00 45.24 ? 139 ARG A CB    1 
ATOM   765  C  CG    . ARG A 1 103 ? 68.392 36.903  99.182  1.00 46.41 ? 139 ARG A CG    1 
ATOM   766  C  CD    . ARG A 1 103 ? 69.903 36.720  99.232  1.00 47.89 ? 139 ARG A CD    1 
ATOM   767  N  NE    . ARG A 1 103 ? 70.247 35.312  99.433  1.00 52.02 ? 139 ARG A NE    1 
ATOM   768  C  CZ    . ARG A 1 103 ? 70.505 34.457  98.446  1.00 54.34 ? 139 ARG A CZ    1 
ATOM   769  N  NH1   . ARG A 1 103 ? 70.471 34.867  97.183  1.00 54.15 ? 139 ARG A NH1   1 
ATOM   770  N  NH2   . ARG A 1 103 ? 70.801 33.192  98.718  1.00 57.69 ? 139 ARG A NH2   1 
ATOM   771  N  N     . ILE A 1 104 ? 65.509 36.157  97.815  1.00 34.43 ? 140 ILE A N     1 
ATOM   772  C  CA    . ILE A 1 104 ? 64.796 35.167  97.022  1.00 28.99 ? 140 ILE A CA    1 
ATOM   773  C  C     . ILE A 1 104 ? 63.402 34.971  97.629  1.00 24.78 ? 140 ILE A C     1 
ATOM   774  O  O     . ILE A 1 104 ? 63.204 34.078  98.458  1.00 22.47 ? 140 ILE A O     1 
ATOM   775  C  CB    . ILE A 1 104 ? 65.534 33.815  97.022  1.00 31.07 ? 140 ILE A CB    1 
ATOM   776  C  CG1   . ILE A 1 104 ? 66.998 33.995  96.599  1.00 32.55 ? 140 ILE A CG1   1 
ATOM   777  C  CG2   . ILE A 1 104 ? 64.819 32.802  96.116  1.00 22.84 ? 140 ILE A CG2   1 
ATOM   778  C  CD1   . ILE A 1 104 ? 67.848 32.762  96.831  1.00 39.94 ? 140 ILE A CD1   1 
ATOM   779  N  N     . PRO A 1 105 ? 62.437 35.816  97.227  1.00 24.69 ? 141 PRO A N     1 
ATOM   780  C  CA    . PRO A 1 105 ? 61.083 35.734  97.794  1.00 20.77 ? 141 PRO A CA    1 
ATOM   781  C  C     . PRO A 1 105 ? 60.410 34.428  97.396  1.00 20.75 ? 141 PRO A C     1 
ATOM   782  O  O     . PRO A 1 105 ? 60.530 33.998  96.244  1.00 16.32 ? 141 PRO A O     1 
ATOM   783  C  CB    . PRO A 1 105 ? 60.352 36.923  97.157  1.00 23.54 ? 141 PRO A CB    1 
ATOM   784  C  CG    . PRO A 1 105 ? 61.151 37.259  95.925  1.00 24.84 ? 141 PRO A CG    1 
ATOM   785  C  CD    . PRO A 1 105 ? 62.573 36.927  96.268  1.00 26.39 ? 141 PRO A CD    1 
ATOM   786  N  N     . ILE A 1 106 ? 59.738 33.804  98.356  1.00 14.38 ? 142 ILE A N     1 
ATOM   787  C  CA    . ILE A 1 106 ? 59.038 32.553  98.135  1.00 14.26 ? 142 ILE A CA    1 
ATOM   788  C  C     . ILE A 1 106 ? 57.691 32.600  98.849  1.00 16.55 ? 142 ILE A C     1 
ATOM   789  O  O     . ILE A 1 106 ? 57.622 32.933  100.037 1.00 14.21 ? 142 ILE A O     1 
ATOM   790  C  CB    . ILE A 1 106 ? 59.823 31.367  98.752  1.00 16.78 ? 142 ILE A CB    1 
ATOM   791  C  CG1   . ILE A 1 106 ? 61.213 31.237  98.122  1.00 20.41 ? 142 ILE A CG1   1 
ATOM   792  C  CG2   . ILE A 1 106 ? 59.035 30.069  98.605  1.00 20.93 ? 142 ILE A CG2   1 
ATOM   793  C  CD1   . ILE A 1 106 ? 61.188 30.713  96.723  1.00 21.74 ? 142 ILE A CD1   1 
ATOM   794  N  N     . ILE A 1 107 ? 56.624 32.273  98.131  1.00 14.76 ? 143 ILE A N     1 
ATOM   795  C  CA    . ILE A 1 107 ? 55.342 31.990  98.764  1.00 11.36 ? 143 ILE A CA    1 
ATOM   796  C  C     . ILE A 1 107 ? 55.203 30.487  98.901  1.00 15.62 ? 143 ILE A C     1 
ATOM   797  O  O     . ILE A 1 107 ? 55.297 29.762  97.905  1.00 17.57 ? 143 ILE A O     1 
ATOM   798  C  CB    . ILE A 1 107 ? 54.157 32.510  97.914  1.00 13.45 ? 143 ILE A CB    1 
ATOM   799  C  CG1   . ILE A 1 107 ? 54.210 34.036  97.817  1.00 16.27 ? 143 ILE A CG1   1 
ATOM   800  C  CG2   . ILE A 1 107 ? 52.818 32.061  98.531  1.00 16.36 ? 143 ILE A CG2   1 
ATOM   801  C  CD1   . ILE A 1 107 ? 53.207 34.625  96.833  1.00 13.49 ? 143 ILE A CD1   1 
ATOM   802  N  N     . LYS A 1 108 ? 55.004 29.996  100.124 1.00 14.65 ? 144 LYS A N     1 
ATOM   803  C  CA    . LYS A 1 108 ? 54.770 28.567  100.307 1.00 14.09 ? 144 LYS A CA    1 
ATOM   804  C  C     . LYS A 1 108 ? 53.335 28.370  100.730 1.00 19.52 ? 144 LYS A C     1 
ATOM   805  O  O     . LYS A 1 108 ? 52.955 28.775  101.830 1.00 17.23 ? 144 LYS A O     1 
ATOM   806  C  CB    . LYS A 1 108 ? 55.696 27.972  101.378 1.00 17.32 ? 144 LYS A CB    1 
ATOM   807  C  CG    . LYS A 1 108 ? 55.564 26.443  101.489 1.00 24.75 ? 144 LYS A CG    1 
ATOM   808  C  CD    . LYS A 1 108 ? 56.606 25.818  102.408 1.00 32.31 ? 144 LYS A CD    1 
ATOM   809  C  CE    . LYS A 1 108 ? 56.668 24.304  102.182 1.00 35.06 ? 144 LYS A CE    1 
ATOM   810  N  NZ    . LYS A 1 108 ? 57.672 23.631  103.053 1.00 41.19 ? 144 LYS A NZ    1 
ATOM   811  N  N     . LEU A 1 109 ? 52.530 27.752  99.871  1.00 12.59 ? 145 LEU A N     1 
ATOM   812  C  CA    . LEU A 1 109 ? 51.154 27.437  100.248 1.00 15.80 ? 145 LEU A CA    1 
ATOM   813  C  C     . LEU A 1 109 ? 51.165 26.070  100.931 1.00 19.42 ? 145 LEU A C     1 
ATOM   814  O  O     . LEU A 1 109 ? 51.857 25.145  100.487 1.00 16.67 ? 145 LEU A O     1 
ATOM   815  C  CB    . LEU A 1 109 ? 50.228 27.439  99.024  1.00 14.88 ? 145 LEU A CB    1 
ATOM   816  C  CG    . LEU A 1 109 ? 50.134 28.780  98.289  1.00 15.08 ? 145 LEU A CG    1 
ATOM   817  C  CD1   . LEU A 1 109 ? 49.181 28.669  97.088  1.00 15.32 ? 145 LEU A CD1   1 
ATOM   818  C  CD2   . LEU A 1 109 ? 49.692 29.912  99.203  1.00 15.13 ? 145 LEU A CD2   1 
ATOM   819  N  N     . THR A 1 110 ? 50.422 25.948  102.026 1.00 21.33 ? 146 THR A N     1 
ATOM   820  C  CA    . THR A 1 110 ? 50.471 24.730  102.836 1.00 22.65 ? 146 THR A CA    1 
ATOM   821  C  C     . THR A 1 110 ? 49.106 24.077  102.999 1.00 27.57 ? 146 THR A C     1 
ATOM   822  O  O     . THR A 1 110 ? 48.998 22.947  103.491 1.00 27.17 ? 146 THR A O     1 
ATOM   823  C  CB    . THR A 1 110 ? 51.026 25.027  104.236 1.00 22.22 ? 146 THR A CB    1 
ATOM   824  O  OG1   . THR A 1 110 ? 50.295 26.120  104.815 1.00 25.98 ? 146 THR A OG1   1 
ATOM   825  C  CG2   . THR A 1 110 ? 52.505 25.397  104.148 1.00 23.64 ? 146 THR A CG2   1 
ATOM   826  N  N     . SER A 1 111 ? 48.065 24.787  102.586 1.00 26.64 ? 147 SER A N     1 
ATOM   827  C  CA    . SER A 1 111 ? 46.702 24.315  102.792 1.00 27.84 ? 147 SER A CA    1 
ATOM   828  C  C     . SER A 1 111 ? 45.725 25.078  101.911 1.00 28.78 ? 147 SER A C     1 
ATOM   829  O  O     . SER A 1 111 ? 46.006 26.208  101.486 1.00 23.83 ? 147 SER A O     1 
ATOM   830  C  CB    . SER A 1 111 ? 46.300 24.504  104.259 1.00 28.65 ? 147 SER A CB    1 
ATOM   831  O  OG    . SER A 1 111 ? 45.099 23.821  104.536 1.00 32.94 ? 147 SER A OG    1 
ATOM   832  N  N     . ASP A 1 112 ? 44.581 24.457  101.642 1.00 28.91 ? 148 ASP A N     1 
ATOM   833  C  CA    . ASP A 1 112 ? 43.503 25.117  100.915 1.00 29.72 ? 148 ASP A CA    1 
ATOM   834  C  C     . ASP A 1 112 ? 42.214 24.862  101.681 1.00 30.06 ? 148 ASP A C     1 
ATOM   835  O  O     . ASP A 1 112 ? 41.883 23.709  101.966 1.00 27.52 ? 148 ASP A O     1 
ATOM   836  C  CB    . ASP A 1 112 ? 43.402 24.549  99.495  1.00 27.64 ? 148 ASP A CB    1 
ATOM   837  C  CG    . ASP A 1 112 ? 42.199 25.081  98.728  1.00 29.02 ? 148 ASP A CG    1 
ATOM   838  O  OD1   . ASP A 1 112 ? 41.716 26.196  99.041  1.00 30.57 ? 148 ASP A OD1   1 
ATOM   839  O  OD2   . ASP A 1 112 ? 41.747 24.375  97.800  1.00 30.24 ? 148 ASP A OD2   1 
ATOM   840  N  N     . THR A 1 113 ? 41.498 25.929  102.019 1.00 30.89 ? 149 THR A N     1 
ATOM   841  C  CA    . THR A 1 113 ? 40.246 25.802  102.770 1.00 35.65 ? 149 THR A CA    1 
ATOM   842  C  C     . THR A 1 113 ? 38.996 26.091  101.928 1.00 36.74 ? 149 THR A C     1 
ATOM   843  O  O     . THR A 1 113 ? 37.885 26.103  102.460 1.00 38.45 ? 149 THR A O     1 
ATOM   844  C  CB    . THR A 1 113 ? 40.227 26.741  104.005 1.00 33.25 ? 149 THR A CB    1 
ATOM   845  O  OG1   . THR A 1 113 ? 40.070 28.103  103.582 1.00 31.72 ? 149 THR A OG1   1 
ATOM   846  C  CG2   . THR A 1 113 ? 41.514 26.600  104.805 1.00 30.33 ? 149 THR A CG2   1 
ATOM   847  N  N     . LYS A 1 114 ? 39.170 26.336  100.629 1.00 33.98 ? 150 LYS A N     1 
ATOM   848  C  CA    . LYS A 1 114 ? 38.047 26.779  99.786  1.00 34.75 ? 150 LYS A CA    1 
ATOM   849  C  C     . LYS A 1 114 ? 37.983 26.193  98.376  1.00 34.83 ? 150 LYS A C     1 
ATOM   850  O  O     . LYS A 1 114 ? 36.898 26.071  97.811  1.00 32.70 ? 150 LYS A O     1 
ATOM   851  C  CB    . LYS A 1 114 ? 38.025 28.307  99.663  1.00 34.73 ? 150 LYS A CB    1 
ATOM   852  C  CG    . LYS A 1 114 ? 37.549 29.058  100.888 1.00 39.51 ? 150 LYS A CG    1 
ATOM   853  C  CD    . LYS A 1 114 ? 37.107 30.468  100.503 1.00 40.40 ? 150 LYS A CD    1 
ATOM   854  C  CE    . LYS A 1 114 ? 37.262 31.448  101.662 1.00 44.74 ? 150 LYS A CE    1 
ATOM   855  N  NZ    . LYS A 1 114 ? 36.581 30.977  102.900 1.00 47.62 ? 150 LYS A NZ    1 
ATOM   856  N  N     . ASN A 1 115 ? 39.134 25.855  97.802  1.00 30.05 ? 151 ASN A N     1 
ATOM   857  C  CA    . ASN A 1 115 ? 39.194 25.523  96.381  1.00 34.54 ? 151 ASN A CA    1 
ATOM   858  C  C     . ASN A 1 115 ? 39.294 24.019  96.123  1.00 31.33 ? 151 ASN A C     1 
ATOM   859  O  O     . ASN A 1 115 ? 39.500 23.585  94.987  1.00 34.66 ? 151 ASN A O     1 
ATOM   860  C  CB    . ASN A 1 115 ? 40.357 26.270  95.705  1.00 29.72 ? 151 ASN A CB    1 
ATOM   861  C  CG    . ASN A 1 115 ? 40.351 27.765  95.998  1.00 36.35 ? 151 ASN A CG    1 
ATOM   862  O  OD1   . ASN A 1 115 ? 39.849 28.569  95.204  1.00 36.81 ? 151 ASN A OD1   1 
ATOM   863  N  ND2   . ASN A 1 115 ? 40.922 28.146  97.141  1.00 30.97 ? 151 ASN A ND2   1 
ATOM   864  N  N     . GLY A 1 116 ? 39.159 23.230  97.187  1.00 28.24 ? 152 GLY A N     1 
ATOM   865  C  CA    . GLY A 1 116 ? 39.072 21.784  97.075  1.00 30.96 ? 152 GLY A CA    1 
ATOM   866  C  C     . GLY A 1 116 ? 40.350 21.041  96.719  1.00 32.82 ? 152 GLY A C     1 
ATOM   867  O  O     . GLY A 1 116 ? 40.293 19.942  96.168  1.00 29.91 ? 152 GLY A O     1 
ATOM   868  N  N     . PHE A 1 117 ? 41.506 21.613  97.040  1.00 31.35 ? 153 PHE A N     1 
ATOM   869  C  CA    . PHE A 1 117 ? 42.766 20.949  96.705  1.00 29.69 ? 153 PHE A CA    1 
ATOM   870  C  C     . PHE A 1 117 ? 43.370 20.228  97.901  1.00 33.65 ? 153 PHE A C     1 
ATOM   871  O  O     . PHE A 1 117 ? 44.396 19.554  97.777  1.00 34.61 ? 153 PHE A O     1 
ATOM   872  C  CB    . PHE A 1 117 ? 43.758 21.937  96.080  1.00 29.49 ? 153 PHE A CB    1 
ATOM   873  C  CG    . PHE A 1 117 ? 43.255 22.555  94.813  1.00 29.71 ? 153 PHE A CG    1 
ATOM   874  C  CD1   . PHE A 1 117 ? 43.075 21.779  93.674  1.00 30.62 ? 153 PHE A CD1   1 
ATOM   875  C  CD2   . PHE A 1 117 ? 42.949 23.908  94.759  1.00 31.57 ? 153 PHE A CD2   1 
ATOM   876  C  CE1   . PHE A 1 117 ? 42.596 22.343  92.504  1.00 31.64 ? 153 PHE A CE1   1 
ATOM   877  C  CE2   . PHE A 1 117 ? 42.473 24.480  93.590  1.00 29.23 ? 153 PHE A CE2   1 
ATOM   878  C  CZ    . PHE A 1 117 ? 42.291 23.697  92.465  1.00 28.34 ? 153 PHE A CZ    1 
ATOM   879  N  N     . GLY A 1 118 ? 42.730 20.374  99.058  1.00 31.55 ? 154 GLY A N     1 
ATOM   880  C  CA    . GLY A 1 118 ? 43.068 19.549  100.203 1.00 33.82 ? 154 GLY A CA    1 
ATOM   881  C  C     . GLY A 1 118 ? 43.666 20.251  101.407 1.00 32.52 ? 154 GLY A C     1 
ATOM   882  O  O     . GLY A 1 118 ? 44.277 21.319  101.291 1.00 26.80 ? 154 GLY A O     1 
ATOM   883  N  N     . ALA A 1 119 ? 43.495 19.629  102.573 1.00 34.73 ? 155 ALA A N     1 
ATOM   884  C  CA    . ALA A 1 119 ? 44.096 20.106  103.815 1.00 34.15 ? 155 ALA A CA    1 
ATOM   885  C  C     . ALA A 1 119 ? 45.625 20.158  103.717 1.00 31.65 ? 155 ALA A C     1 
ATOM   886  O  O     . ALA A 1 119 ? 46.269 21.035  104.302 1.00 33.91 ? 155 ALA A O     1 
ATOM   887  C  CB    . ALA A 1 119 ? 43.669 19.207  104.975 1.00 34.63 ? 155 ALA A CB    1 
ATOM   888  N  N     . SER A 1 120 ? 46.193 19.209  102.977 1.00 30.19 ? 156 SER A N     1 
ATOM   889  C  CA    . SER A 1 120 ? 47.646 19.081  102.836 1.00 36.54 ? 156 SER A CA    1 
ATOM   890  C  C     . SER A 1 120 ? 48.182 19.512  101.458 1.00 33.31 ? 156 SER A C     1 
ATOM   891  O  O     . SER A 1 120 ? 49.235 19.046  101.016 1.00 35.57 ? 156 SER A O     1 
ATOM   892  C  CB    . SER A 1 120 ? 48.068 17.637  103.130 1.00 38.01 ? 156 SER A CB    1 
ATOM   893  O  OG    . SER A 1 120 ? 49.347 17.353  102.583 1.00 45.03 ? 156 SER A OG    1 
ATOM   894  N  N     . PHE A 1 121 ? 47.459 20.396  100.781 1.00 31.67 ? 157 PHE A N     1 
ATOM   895  C  CA    . PHE A 1 121 ? 47.925 20.954  99.511  1.00 25.84 ? 157 PHE A CA    1 
ATOM   896  C  C     . PHE A 1 121 ? 49.222 21.742  99.713  1.00 23.48 ? 157 PHE A C     1 
ATOM   897  O  O     . PHE A 1 121 ? 49.246 22.706  100.481 1.00 32.44 ? 157 PHE A O     1 
ATOM   898  C  CB    . PHE A 1 121 ? 46.854 21.877  98.936  1.00 27.61 ? 157 PHE A CB    1 
ATOM   899  C  CG    . PHE A 1 121 ? 47.309 22.663  97.736  1.00 25.15 ? 157 PHE A CG    1 
ATOM   900  C  CD1   . PHE A 1 121 ? 47.442 22.050  96.499  1.00 26.22 ? 157 PHE A CD1   1 
ATOM   901  C  CD2   . PHE A 1 121 ? 47.584 24.019  97.843  1.00 23.85 ? 157 PHE A CD2   1 
ATOM   902  C  CE1   . PHE A 1 121 ? 47.853 22.777  95.383  1.00 21.82 ? 157 PHE A CE1   1 
ATOM   903  C  CE2   . PHE A 1 121 ? 47.990 24.753  96.729  1.00 22.31 ? 157 PHE A CE2   1 
ATOM   904  C  CZ    . PHE A 1 121 ? 48.126 24.129  95.505  1.00 19.56 ? 157 PHE A CZ    1 
ATOM   905  N  N     . GLN A 1 122 ? 50.289 21.352  99.019  1.00 25.29 ? 158 GLN A N     1 
ATOM   906  C  CA    . GLN A 1 122 ? 51.586 22.025  99.177  1.00 23.44 ? 158 GLN A CA    1 
ATOM   907  C  C     . GLN A 1 122 ? 52.130 22.559  97.853  1.00 24.07 ? 158 GLN A C     1 
ATOM   908  O  O     . GLN A 1 122 ? 52.303 21.802  96.885  1.00 22.00 ? 158 GLN A O     1 
ATOM   909  C  CB    . GLN A 1 122 ? 52.615 21.078  99.804  1.00 30.16 ? 158 GLN A CB    1 
ATOM   910  C  CG    . GLN A 1 122 ? 52.198 20.450  101.135 1.00 36.06 ? 158 GLN A CG    1 
ATOM   911  C  CD    . GLN A 1 122 ? 52.320 21.406  102.309 1.00 37.74 ? 158 GLN A CD    1 
ATOM   912  O  OE1   . GLN A 1 122 ? 53.238 22.230  102.363 1.00 43.78 ? 158 GLN A OE1   1 
ATOM   913  N  NE2   . GLN A 1 122 ? 51.395 21.295  103.264 1.00 40.16 ? 158 GLN A NE2   1 
ATOM   914  N  N     . CYS A 1 123 ? 52.432 23.853  97.824  1.00 15.86 ? 159 CYS A N     1 
ATOM   915  C  CA    . CYS A 1 123 ? 52.902 24.501  96.608  1.00 13.88 ? 159 CYS A CA    1 
ATOM   916  C  C     . CYS A 1 123 ? 53.914 25.606  96.933  1.00 19.43 ? 159 CYS A C     1 
ATOM   917  O  O     . CYS A 1 123 ? 53.651 26.452  97.786  1.00 21.94 ? 159 CYS A O     1 
ATOM   918  C  CB    . CYS A 1 123 ? 51.688 25.106  95.896  1.00 20.90 ? 159 CYS A CB    1 
ATOM   919  S  SG    . CYS A 1 123 ? 52.024 25.924  94.346  1.00 27.42 ? 159 CYS A SG    1 
ATOM   920  N  N     . ALA A 1 124 ? 55.063 25.606  96.254  1.00 12.28 ? 160 ALA A N     1 
ATOM   921  C  CA    . ALA A 1 124 ? 56.060 26.672  96.422  1.00 12.38 ? 160 ALA A CA    1 
ATOM   922  C  C     . ALA A 1 124 ? 56.058 27.579  95.199  1.00 15.45 ? 160 ALA A C     1 
ATOM   923  O  O     . ALA A 1 124 ? 56.182 27.097  94.071  1.00 14.51 ? 160 ALA A O     1 
ATOM   924  C  CB    . ALA A 1 124 ? 57.459 26.069  96.623  1.00 15.84 ? 160 ALA A CB    1 
ATOM   925  N  N     . ILE A 1 125 ? 55.933 28.883  95.419  1.00 13.70 ? 161 ILE A N     1 
ATOM   926  C  CA    . ILE A 1 125 ? 55.885 29.840  94.321  1.00 12.13 ? 161 ILE A CA    1 
ATOM   927  C  C     . ILE A 1 125 ? 57.065 30.797  94.406  1.00 14.45 ? 161 ILE A C     1 
ATOM   928  O  O     . ILE A 1 125 ? 57.165 31.584  95.353  1.00 14.55 ? 161 ILE A O     1 
ATOM   929  C  CB    . ILE A 1 125 ? 54.578 30.668  94.362  1.00 11.97 ? 161 ILE A CB    1 
ATOM   930  C  CG1   . ILE A 1 125 ? 53.364 29.738  94.381  1.00 16.44 ? 161 ILE A CG1   1 
ATOM   931  C  CG2   . ILE A 1 125 ? 54.495 31.597  93.144  1.00 11.16 ? 161 ILE A CG2   1 
ATOM   932  C  CD1   . ILE A 1 125 ? 52.031 30.477  94.534  1.00 17.35 ? 161 ILE A CD1   1 
ATOM   933  N  N     . GLY A 1 126 ? 57.951 30.748  93.409  1.00 12.83 ? 162 GLY A N     1 
ATOM   934  C  CA    . GLY A 1 126 ? 59.060 31.683  93.349  1.00 11.63 ? 162 GLY A CA    1 
ATOM   935  C  C     . GLY A 1 126 ? 58.822 32.739  92.290  1.00 18.74 ? 162 GLY A C     1 
ATOM   936  O  O     . GLY A 1 126 ? 57.762 32.765  91.647  1.00 12.41 ? 162 GLY A O     1 
ATOM   937  N  N     . PHE A 1 127 ? 59.804 33.618  92.113  1.00 12.22 ? 163 PHE A N     1 
ATOM   938  C  CA    . PHE A 1 127 ? 59.650 34.771  91.241  1.00 13.38 ? 163 PHE A CA    1 
ATOM   939  C  C     . PHE A 1 127 ? 60.832 34.910  90.312  1.00 16.17 ? 163 PHE A C     1 
ATOM   940  O  O     . PHE A 1 127 ? 61.977 34.960  90.765  1.00 15.68 ? 163 PHE A O     1 
ATOM   941  C  CB    . PHE A 1 127 ? 59.469 36.027  92.101  1.00 14.54 ? 163 PHE A CB    1 
ATOM   942  C  CG    . PHE A 1 127 ? 58.188 36.017  92.868  1.00 15.38 ? 163 PHE A CG    1 
ATOM   943  C  CD1   . PHE A 1 127 ? 58.094 35.350  94.081  1.00 17.04 ? 163 PHE A CD1   1 
ATOM   944  C  CD2   . PHE A 1 127 ? 57.056 36.615  92.341  1.00 15.01 ? 163 PHE A CD2   1 
ATOM   945  C  CE1   . PHE A 1 127 ? 56.890 35.295  94.767  1.00 20.56 ? 163 PHE A CE1   1 
ATOM   946  C  CE2   . PHE A 1 127 ? 55.850 36.570  93.028  1.00 20.01 ? 163 PHE A CE2   1 
ATOM   947  C  CZ    . PHE A 1 127 ? 55.765 35.909  94.231  1.00 20.42 ? 163 PHE A CZ    1 
ATOM   948  N  N     . ASN A 1 128 ? 60.537 34.952  89.013  1.00 14.36 ? 164 ASN A N     1 
ATOM   949  C  CA    . ASN A 1 128 ? 61.531 35.124  87.960  1.00 12.68 ? 164 ASN A CA    1 
ATOM   950  C  C     . ASN A 1 128 ? 62.704 34.149  88.005  1.00 21.51 ? 164 ASN A C     1 
ATOM   951  O  O     . ASN A 1 128 ? 63.834 34.522  87.726  1.00 22.74 ? 164 ASN A O     1 
ATOM   952  C  CB    . ASN A 1 128 ? 62.026 36.571  87.927  1.00 22.13 ? 164 ASN A CB    1 
ATOM   953  C  CG    . ASN A 1 128 ? 60.951 37.538  87.459  1.00 26.58 ? 164 ASN A CG    1 
ATOM   954  O  OD1   . ASN A 1 128 ? 60.197 37.246  86.522  1.00 25.58 ? 164 ASN A OD1   1 
ATOM   955  N  ND2   . ASN A 1 128 ? 60.861 38.684  88.122  1.00 32.23 ? 164 ASN A ND2   1 
ATOM   956  N  N     . ASN A 1 129 ? 62.418 32.897  88.336  1.00 15.19 ? 165 ASN A N     1 
ATOM   957  C  CA    . ASN A 1 129 ? 63.429 31.848  88.330  1.00 21.92 ? 165 ASN A CA    1 
ATOM   958  C  C     . ASN A 1 129 ? 63.466 31.221  86.941  1.00 16.46 ? 165 ASN A C     1 
ATOM   959  O  O     . ASN A 1 129 ? 63.051 30.074  86.764  1.00 16.06 ? 165 ASN A O     1 
ATOM   960  C  CB    . ASN A 1 129 ? 63.038 30.784  89.358  1.00 20.06 ? 165 ASN A CB    1 
ATOM   961  C  CG    . ASN A 1 129 ? 64.130 29.778  89.618  1.00 24.14 ? 165 ASN A CG    1 
ATOM   962  O  OD1   . ASN A 1 129 ? 65.135 29.722  88.901  1.00 23.08 ? 165 ASN A OD1   1 
ATOM   963  N  ND2   . ASN A 1 129 ? 63.930 28.957  90.648  1.00 28.07 ? 165 ASN A ND2   1 
ATOM   964  N  N     . ARG A 1 130 ? 63.949 31.969  85.950  1.00 13.27 ? 166 ARG A N     1 
ATOM   965  C  CA    . ARG A 1 130 ? 63.910 31.480  84.573  1.00 14.36 ? 166 ARG A CA    1 
ATOM   966  C  C     . ARG A 1 130 ? 64.830 30.292  84.352  1.00 12.56 ? 166 ARG A C     1 
ATOM   967  O  O     . ARG A 1 130 ? 64.531 29.433  83.531  1.00 12.92 ? 166 ARG A O     1 
ATOM   968  C  CB    . ARG A 1 130 ? 64.215 32.610  83.575  1.00 16.60 ? 166 ARG A CB    1 
ATOM   969  C  CG    . ARG A 1 130 ? 63.057 33.604  83.457  1.00 19.00 ? 166 ARG A CG    1 
ATOM   970  C  CD    . ARG A 1 130 ? 63.286 34.679  82.392  1.00 26.83 ? 166 ARG A CD    1 
ATOM   971  N  NE    . ARG A 1 130 ? 62.086 35.504  82.228  1.00 28.92 ? 166 ARG A NE    1 
ATOM   972  C  CZ    . ARG A 1 130 ? 61.774 36.532  83.013  1.00 29.45 ? 166 ARG A CZ    1 
ATOM   973  N  NH1   . ARG A 1 130 ? 62.577 36.879  84.010  1.00 31.02 ? 166 ARG A NH1   1 
ATOM   974  N  NH2   . ARG A 1 130 ? 60.657 37.216  82.799  1.00 28.24 ? 166 ARG A NH2   1 
ATOM   975  N  N     . LEU A 1 131 ? 65.932 30.224  85.096  1.00 9.95  ? 167 LEU A N     1 
ATOM   976  C  CA    . LEU A 1 131 ? 66.885 29.128  84.907  1.00 13.56 ? 167 LEU A CA    1 
ATOM   977  C  C     . LEU A 1 131 ? 66.256 27.781  85.263  1.00 10.19 ? 167 LEU A C     1 
ATOM   978  O  O     . LEU A 1 131 ? 66.516 26.769  84.603  1.00 10.66 ? 167 LEU A O     1 
ATOM   979  C  CB    . LEU A 1 131 ? 68.165 29.372  85.719  1.00 13.09 ? 167 LEU A CB    1 
ATOM   980  C  CG    . LEU A 1 131 ? 68.936 30.596  85.214  1.00 17.49 ? 167 LEU A CG    1 
ATOM   981  C  CD1   . LEU A 1 131 ? 70.126 30.918  86.110  1.00 20.21 ? 167 LEU A CD1   1 
ATOM   982  C  CD2   . LEU A 1 131 ? 69.398 30.369  83.786  1.00 19.37 ? 167 LEU A CD2   1 
ATOM   983  N  N     . ALA A 1 132 ? 65.421 27.769  86.300  1.00 10.56 ? 168 ALA A N     1 
ATOM   984  C  CA    . ALA A 1 132 ? 64.731 26.535  86.698  1.00 11.33 ? 168 ALA A CA    1 
ATOM   985  C  C     . ALA A 1 132 ? 63.732 26.093  85.624  1.00 11.44 ? 168 ALA A C     1 
ATOM   986  O  O     . ALA A 1 132 ? 63.512 24.901  85.410  1.00 10.33 ? 168 ALA A O     1 
ATOM   987  C  CB    . ALA A 1 132 ? 64.037 26.718  88.036  1.00 14.03 ? 168 ALA A CB    1 
ATOM   988  N  N     . ILE A 1 133 ? 63.118 27.050  84.944  1.00 8.60  ? 169 ILE A N     1 
ATOM   989  C  CA    . ILE A 1 133 ? 62.205 26.706  83.859  1.00 9.09  ? 169 ILE A CA    1 
ATOM   990  C  C     . ILE A 1 133 ? 62.985 26.062  82.715  1.00 11.76 ? 169 ILE A C     1 
ATOM   991  O  O     . ILE A 1 133 ? 62.537 25.080  82.107  1.00 11.35 ? 169 ILE A O     1 
ATOM   992  C  CB    . ILE A 1 133 ? 61.433 27.959  83.386  1.00 14.59 ? 169 ILE A CB    1 
ATOM   993  C  CG1   . ILE A 1 133 ? 60.506 28.445  84.511  1.00 14.04 ? 169 ILE A CG1   1 
ATOM   994  C  CG2   . ILE A 1 133 ? 60.654 27.685  82.111  1.00 17.38 ? 169 ILE A CG2   1 
ATOM   995  C  CD1   . ILE A 1 133 ? 59.988 29.857  84.285  1.00 17.98 ? 169 ILE A CD1   1 
ATOM   996  N  N     . HIS A 1 134 ? 64.170 26.589  82.433  1.00 9.63  ? 170 HIS A N     1 
ATOM   997  C  CA    . HIS A 1 134 ? 64.980 26.017  81.364  1.00 10.22 ? 170 HIS A CA    1 
ATOM   998  C  C     . HIS A 1 134 ? 65.561 24.665  81.726  1.00 11.23 ? 170 HIS A C     1 
ATOM   999  O  O     . HIS A 1 134 ? 65.582 23.761  80.888  1.00 10.74 ? 170 HIS A O     1 
ATOM   1000 C  CB    . HIS A 1 134 ? 66.050 27.004  80.897  1.00 12.15 ? 170 HIS A CB    1 
ATOM   1001 C  CG    . HIS A 1 134 ? 65.489 28.129  80.081  1.00 12.29 ? 170 HIS A CG    1 
ATOM   1002 N  ND1   . HIS A 1 134 ? 65.316 28.035  78.718  1.00 16.20 ? 170 HIS A ND1   1 
ATOM   1003 C  CD2   . HIS A 1 134 ? 65.032 29.354  80.439  1.00 15.75 ? 170 HIS A CD2   1 
ATOM   1004 C  CE1   . HIS A 1 134 ? 64.785 29.160  78.266  1.00 13.19 ? 170 HIS A CE1   1 
ATOM   1005 N  NE2   . HIS A 1 134 ? 64.610 29.977  79.291  1.00 16.97 ? 170 HIS A NE2   1 
ATOM   1006 N  N     . ASN A 1 135 ? 66.022 24.482  82.963  1.00 11.64 ? 171 ASN A N     1 
ATOM   1007 C  CA    . ASN A 1 135 ? 66.536 23.151  83.280  1.00 9.57  ? 171 ASN A CA    1 
ATOM   1008 C  C     . ASN A 1 135 ? 65.411 22.107  83.329  1.00 10.96 ? 171 ASN A C     1 
ATOM   1009 O  O     . ASN A 1 135 ? 65.617 20.922  83.049  1.00 8.51  ? 171 ASN A O     1 
ATOM   1010 C  CB    . ASN A 1 135 ? 67.520 23.132  84.475  1.00 13.71 ? 171 ASN A CB    1 
ATOM   1011 C  CG    . ASN A 1 135 ? 66.860 23.343  85.819  1.00 13.54 ? 171 ASN A CG    1 
ATOM   1012 O  OD1   . ASN A 1 135 ? 65.846 22.712  86.142  1.00 16.51 ? 171 ASN A OD1   1 
ATOM   1013 N  ND2   . ASN A 1 135 ? 67.467 24.206  86.642  1.00 11.33 ? 171 ASN A ND2   1 
ATOM   1014 N  N     . THR A 1 136 ? 64.200 22.565  83.615  1.00 11.70 ? 172 THR A N     1 
ATOM   1015 C  CA    . THR A 1 136 ? 63.029 21.692  83.490  1.00 10.52 ? 172 THR A CA    1 
ATOM   1016 C  C     . THR A 1 136 ? 62.758 21.311  82.022  1.00 9.61  ? 172 THR A C     1 
ATOM   1017 O  O     . THR A 1 136 ? 62.413 20.168  81.724  1.00 12.27 ? 172 THR A O     1 
ATOM   1018 C  CB    . THR A 1 136 ? 61.816 22.349  84.157  1.00 10.88 ? 172 THR A CB    1 
ATOM   1019 O  OG1   . THR A 1 136 ? 62.105 22.488  85.559  1.00 12.24 ? 172 THR A OG1   1 
ATOM   1020 C  CG2   . THR A 1 136 ? 60.551 21.485  83.970  1.00 12.01 ? 172 THR A CG2   1 
ATOM   1021 N  N     . LEU A 1 137 ? 62.929 22.265  81.107  1.00 11.73 ? 173 LEU A N     1 
ATOM   1022 C  CA    . LEU A 1 137 ? 62.794 21.990  79.677  1.00 9.61  ? 173 LEU A CA    1 
ATOM   1023 C  C     . LEU A 1 137 ? 63.791 20.929  79.267  1.00 11.14 ? 173 LEU A C     1 
ATOM   1024 O  O     . LEU A 1 137 ? 63.462 20.021  78.513  1.00 10.33 ? 173 LEU A O     1 
ATOM   1025 C  CB    . LEU A 1 137 ? 63.069 23.250  78.842  1.00 13.29 ? 173 LEU A CB    1 
ATOM   1026 C  CG    . LEU A 1 137 ? 61.896 24.172  78.497  1.00 22.11 ? 173 LEU A CG    1 
ATOM   1027 C  CD1   . LEU A 1 137 ? 62.367 25.360  77.643  1.00 22.35 ? 173 LEU A CD1   1 
ATOM   1028 C  CD2   . LEU A 1 137 ? 60.806 23.393  77.774  1.00 18.99 ? 173 LEU A CD2   1 
ATOM   1029 N  N     . LEU A 1 138 ? 65.024 21.054  79.752  1.00 8.89  ? 174 LEU A N     1 
ATOM   1030 C  CA    . LEU A 1 138 ? 66.047 20.057  79.450  1.00 8.55  ? 174 LEU A CA    1 
ATOM   1031 C  C     . LEU A 1 138 ? 65.644 18.668  79.957  1.00 10.00 ? 174 LEU A C     1 
ATOM   1032 O  O     . LEU A 1 138 ? 65.693 17.684  79.215  1.00 9.18  ? 174 LEU A O     1 
ATOM   1033 C  CB    . LEU A 1 138 ? 67.386 20.470  80.073  1.00 9.28  ? 174 LEU A CB    1 
ATOM   1034 C  CG    . LEU A 1 138 ? 68.561 19.508  79.823  1.00 10.35 ? 174 LEU A CG    1 
ATOM   1035 C  CD1   . LEU A 1 138 ? 68.967 19.516  78.340  1.00 9.73  ? 174 LEU A CD1   1 
ATOM   1036 C  CD2   . LEU A 1 138 ? 69.751 19.911  80.698  1.00 11.29 ? 174 LEU A CD2   1 
ATOM   1037 N  N     . LEU A 1 139 ? 65.258 18.578  81.224  1.00 8.50  ? 175 LEU A N     1 
ATOM   1038 C  CA    . LEU A 1 139 ? 64.878 17.285  81.790  1.00 7.37  ? 175 LEU A CA    1 
ATOM   1039 C  C     . LEU A 1 139 ? 63.631 16.721  81.088  1.00 9.15  ? 175 LEU A C     1 
ATOM   1040 O  O     . LEU A 1 139 ? 63.546 15.507  80.833  1.00 10.04 ? 175 LEU A O     1 
ATOM   1041 C  CB    . LEU A 1 139 ? 64.701 17.404  83.320  1.00 12.19 ? 175 LEU A CB    1 
ATOM   1042 C  CG    . LEU A 1 139 ? 65.944 17.140  84.207  1.00 11.38 ? 175 LEU A CG    1 
ATOM   1043 C  CD1   . LEU A 1 139 ? 67.195 17.911  83.761  1.00 10.30 ? 175 LEU A CD1   1 
ATOM   1044 C  CD2   . LEU A 1 139 ? 65.659 17.452  85.679  1.00 15.08 ? 175 LEU A CD2   1 
ATOM   1045 N  N     . SER A 1 140 ? 62.671 17.588  80.756  1.00 10.32 ? 176 SER A N     1 
ATOM   1046 C  CA    . SER A 1 140 ? 61.493 17.157  79.990  1.00 12.13 ? 176 SER A CA    1 
ATOM   1047 C  C     . SER A 1 140 ? 61.877 16.526  78.651  1.00 11.46 ? 176 SER A C     1 
ATOM   1048 O  O     . SER A 1 140 ? 61.297 15.520  78.243  1.00 13.75 ? 176 SER A O     1 
ATOM   1049 C  CB    . SER A 1 140 ? 60.549 18.339  79.735  1.00 14.12 ? 176 SER A CB    1 
ATOM   1050 O  OG    . SER A 1 140 ? 60.022 18.824  80.957  1.00 21.15 ? 176 SER A OG    1 
ATOM   1051 N  N     . SER A 1 141 ? 62.840 17.128  77.956  1.00 10.09 ? 177 SER A N     1 
ATOM   1052 C  CA    . SER A 1 141 ? 63.273 16.588  76.673  1.00 9.65  ? 177 SER A CA    1 
ATOM   1053 C  C     . SER A 1 141 ? 63.898 15.221  76.818  1.00 10.68 ? 177 SER A C     1 
ATOM   1054 O  O     . SER A 1 141 ? 63.611 14.322  76.029  1.00 12.07 ? 177 SER A O     1 
ATOM   1055 C  CB    . SER A 1 141 ? 64.266 17.514  75.976  1.00 12.91 ? 177 SER A CB    1 
ATOM   1056 O  OG    . SER A 1 141 ? 63.632 18.721  75.613  1.00 14.65 ? 177 SER A OG    1 
ATOM   1057 N  N     . TYR A 1 142 ? 64.762 15.056  77.811  1.00 9.31  ? 178 TYR A N     1 
ATOM   1058 C  CA    . TYR A 1 142 ? 65.350 13.739  78.046  1.00 8.54  ? 178 TYR A CA    1 
ATOM   1059 C  C     . TYR A 1 142 ? 64.296 12.670  78.370  1.00 10.04 ? 178 TYR A C     1 
ATOM   1060 O  O     . TYR A 1 142 ? 64.391 11.520  77.905  1.00 10.65 ? 178 TYR A O     1 
ATOM   1061 C  CB    . TYR A 1 142 ? 66.443 13.826  79.126  1.00 9.19  ? 178 TYR A CB    1 
ATOM   1062 C  CG    . TYR A 1 142 ? 67.804 14.251  78.576  1.00 9.67  ? 178 TYR A CG    1 
ATOM   1063 C  CD1   . TYR A 1 142 ? 68.469 13.460  77.641  1.00 8.07  ? 178 TYR A CD1   1 
ATOM   1064 C  CD2   . TYR A 1 142 ? 68.432 15.418  79.012  1.00 9.36  ? 178 TYR A CD2   1 
ATOM   1065 C  CE1   . TYR A 1 142 ? 69.717 13.825  77.143  1.00 10.07 ? 178 TYR A CE1   1 
ATOM   1066 C  CE2   . TYR A 1 142 ? 69.692 15.793  78.513  1.00 10.55 ? 178 TYR A CE2   1 
ATOM   1067 C  CZ    . TYR A 1 142 ? 70.318 14.987  77.581  1.00 10.82 ? 178 TYR A CZ    1 
ATOM   1068 O  OH    . TYR A 1 142 ? 71.559 15.348  77.098  1.00 10.67 ? 178 TYR A OH    1 
ATOM   1069 N  N     . THR A 1 143 ? 63.266 13.015  79.141  1.00 11.22 ? 179 THR A N     1 
ATOM   1070 C  CA    A THR A 1 143 ? 62.243 12.029  79.484  0.75 11.62 ? 179 THR A CA    1 
ATOM   1071 C  CA    B THR A 1 143 ? 62.260 12.006  79.487  0.25 11.56 ? 179 THR A CA    1 
ATOM   1072 C  C     . THR A 1 143 ? 61.454 11.601  78.249  1.00 14.17 ? 179 THR A C     1 
ATOM   1073 O  O     . THR A 1 143 ? 60.984 10.454  78.153  1.00 13.35 ? 179 THR A O     1 
ATOM   1074 C  CB    A THR A 1 143 ? 61.287 12.555  80.573  0.75 14.44 ? 179 THR A CB    1 
ATOM   1075 C  CB    B THR A 1 143 ? 61.339 12.434  80.681  0.25 14.29 ? 179 THR A CB    1 
ATOM   1076 O  OG1   A THR A 1 143 ? 60.507 13.630  80.041  0.75 19.74 ? 179 THR A OG1   1 
ATOM   1077 O  OG1   B THR A 1 143 ? 60.466 11.359  81.050  0.25 13.10 ? 179 THR A OG1   1 
ATOM   1078 C  CG2   A THR A 1 143 ? 62.089 13.047  81.761  0.75 6.71  ? 179 THR A CG2   1 
ATOM   1079 C  CG2   B THR A 1 143 ? 60.504 13.601  80.314  0.25 18.27 ? 179 THR A CG2   1 
ATOM   1080 N  N     . LYS A 1 144 ? 61.326 12.516  77.287  1.00 12.55 ? 180 LYS A N     1 
ATOM   1081 C  CA    . LYS A 1 144 ? 60.656 12.207  76.011  1.00 13.25 ? 180 LYS A CA    1 
ATOM   1082 C  C     . LYS A 1 144 ? 61.533 11.403  75.062  1.00 16.11 ? 180 LYS A C     1 
ATOM   1083 O  O     . LYS A 1 144 ? 61.032 10.702  74.170  1.00 14.97 ? 180 LYS A O     1 
ATOM   1084 C  CB    . LYS A 1 144 ? 60.169 13.500  75.313  1.00 14.18 ? 180 LYS A CB    1 
ATOM   1085 C  CG    . LYS A 1 144 ? 59.021 14.183  76.067  1.00 15.42 ? 180 LYS A CG    1 
ATOM   1086 C  CD    . LYS A 1 144 ? 58.489 15.398  75.317  1.00 24.47 ? 180 LYS A CD    1 
ATOM   1087 C  CE    . LYS A 1 144 ? 57.591 16.245  76.213  1.00 25.70 ? 180 LYS A CE    1 
ATOM   1088 N  NZ    . LYS A 1 144 ? 57.302 17.559  75.566  1.00 28.32 ? 180 LYS A NZ    1 
ATOM   1089 N  N     . LEU A 1 145 ? 62.847 11.493  75.252  1.00 11.35 ? 181 LEU A N     1 
ATOM   1090 C  CA    . LEU A 1 145 ? 63.795 10.818  74.363  1.00 11.56 ? 181 LEU A CA    1 
ATOM   1091 C  C     . LEU A 1 145 ? 63.941 9.328   74.643  1.00 17.34 ? 181 LEU A C     1 
ATOM   1092 O  O     . LEU A 1 145 ? 64.252 8.551   73.737  1.00 16.07 ? 181 LEU A O     1 
ATOM   1093 C  CB    . LEU A 1 145 ? 65.183 11.482  74.418  1.00 14.20 ? 181 LEU A CB    1 
ATOM   1094 C  CG    . LEU A 1 145 ? 65.346 12.791  73.644  1.00 20.18 ? 181 LEU A CG    1 
ATOM   1095 C  CD1   . LEU A 1 145 ? 66.740 13.371  73.873  1.00 18.97 ? 181 LEU A CD1   1 
ATOM   1096 C  CD2   . LEU A 1 145 ? 65.090 12.571  72.147  1.00 20.37 ? 181 LEU A CD2   1 
ATOM   1097 N  N     . ASP A 1 146 ? 63.740 8.913   75.890  1.00 11.68 ? 182 ASP A N     1 
ATOM   1098 C  CA    . ASP A 1 146 ? 63.887 7.486   76.190  1.00 11.75 ? 182 ASP A CA    1 
ATOM   1099 C  C     . ASP A 1 146 ? 62.967 7.031   77.302  1.00 12.25 ? 182 ASP A C     1 
ATOM   1100 O  O     . ASP A 1 146 ? 62.937 7.600   78.399  1.00 9.76  ? 182 ASP A O     1 
ATOM   1101 C  CB    . ASP A 1 146 ? 65.339 7.136   76.533  1.00 12.45 ? 182 ASP A CB    1 
ATOM   1102 C  CG    . ASP A 1 146 ? 65.590 5.643   76.540  1.00 14.27 ? 182 ASP A CG    1 
ATOM   1103 O  OD1   . ASP A 1 146 ? 66.157 5.131   75.547  1.00 13.78 ? 182 ASP A OD1   1 
ATOM   1104 O  OD2   . ASP A 1 146 ? 65.212 4.967   77.528  1.00 12.77 ? 182 ASP A OD2   1 
ATOM   1105 N  N     . ALA A 1 147 ? 62.209 5.985   77.008  1.00 9.57  ? 183 ALA A N     1 
ATOM   1106 C  CA    . ALA A 1 147 ? 61.165 5.511   77.912  1.00 11.90 ? 183 ALA A CA    1 
ATOM   1107 C  C     . ALA A 1 147 ? 61.691 4.914   79.230  1.00 11.49 ? 183 ALA A C     1 
ATOM   1108 O  O     . ALA A 1 147 ? 60.915 4.671   80.170  1.00 10.33 ? 183 ALA A O     1 
ATOM   1109 C  CB    . ALA A 1 147 ? 60.272 4.502   77.183  1.00 15.36 ? 183 ALA A CB    1 
ATOM   1110 N  N     . ARG A 1 148 ? 62.995 4.668   79.319  1.00 9.39  ? 184 ARG A N     1 
ATOM   1111 C  CA    . ARG A 1 148 ? 63.548 4.101   80.558  1.00 10.41 ? 184 ARG A CA    1 
ATOM   1112 C  C     . ARG A 1 148 ? 63.892 5.159   81.594  1.00 10.20 ? 184 ARG A C     1 
ATOM   1113 O  O     . ARG A 1 148 ? 64.090 4.845   82.765  1.00 6.97  ? 184 ARG A O     1 
ATOM   1114 C  CB    . ARG A 1 148 ? 64.787 3.248   80.257  1.00 8.82  ? 184 ARG A CB    1 
ATOM   1115 C  CG    . ARG A 1 148 ? 64.477 2.036   79.382  1.00 10.86 ? 184 ARG A CG    1 
ATOM   1116 C  CD    . ARG A 1 148 ? 65.725 1.428   78.779  1.00 10.07 ? 184 ARG A CD    1 
ATOM   1117 N  NE    . ARG A 1 148 ? 66.332 2.305   77.779  1.00 14.25 ? 184 ARG A NE    1 
ATOM   1118 C  CZ    . ARG A 1 148 ? 67.480 2.033   77.161  1.00 14.05 ? 184 ARG A CZ    1 
ATOM   1119 N  NH1   . ARG A 1 148 ? 68.132 0.914   77.460  1.00 13.27 ? 184 ARG A NH1   1 
ATOM   1120 N  NH2   . ARG A 1 148 ? 67.986 2.889   76.269  1.00 12.44 ? 184 ARG A NH2   1 
ATOM   1121 N  N     . LEU A 1 149 ? 63.979 6.414   81.168  1.00 8.02  ? 185 LEU A N     1 
ATOM   1122 C  CA    . LEU A 1 149 ? 64.436 7.470   82.063  1.00 7.05  ? 185 LEU A CA    1 
ATOM   1123 C  C     . LEU A 1 149 ? 63.459 7.744   83.195  1.00 9.01  ? 185 LEU A C     1 
ATOM   1124 O  O     . LEU A 1 149 ? 63.845 7.805   84.371  1.00 5.31  ? 185 LEU A O     1 
ATOM   1125 C  CB    . LEU A 1 149 ? 64.729 8.773   81.289  1.00 7.68  ? 185 LEU A CB    1 
ATOM   1126 C  CG    . LEU A 1 149 ? 65.158 9.939   82.203  1.00 8.54  ? 185 LEU A CG    1 
ATOM   1127 C  CD1   . LEU A 1 149 ? 66.452 9.614   82.941  1.00 6.22  ? 185 LEU A CD1   1 
ATOM   1128 C  CD2   . LEU A 1 149 ? 65.322 11.240  81.425  1.00 7.99  ? 185 LEU A CD2   1 
ATOM   1129 N  N     . LYS A 1 150 ? 62.180 7.892   82.863  1.00 9.29  ? 186 LYS A N     1 
ATOM   1130 C  CA    . LYS A 1 150 ? 61.185 8.173   83.908  1.00 11.01 ? 186 LYS A CA    1 
ATOM   1131 C  C     . LYS A 1 150 ? 61.156 7.144   85.066  1.00 8.56  ? 186 LYS A C     1 
ATOM   1132 O  O     . LYS A 1 150 ? 61.263 7.537   86.238  1.00 6.55  ? 186 LYS A O     1 
ATOM   1133 C  CB    . LYS A 1 150 ? 59.786 8.383   83.299  1.00 10.34 ? 186 LYS A CB    1 
ATOM   1134 C  CG    . LYS A 1 150 ? 58.713 8.688   84.327  1.00 13.89 ? 186 LYS A CG    1 
ATOM   1135 C  CD    . LYS A 1 150 ? 57.338 8.709   83.660  1.00 21.38 ? 186 LYS A CD    1 
ATOM   1136 C  CE    . LYS A 1 150 ? 56.227 8.917   84.688  1.00 27.06 ? 186 LYS A CE    1 
ATOM   1137 N  NZ    . LYS A 1 150 ? 54.884 8.774   84.042  1.00 29.86 ? 186 LYS A NZ    1 
ATOM   1138 N  N     . PRO A 1 151 ? 61.018 5.828   84.764  1.00 6.93  ? 187 PRO A N     1 
ATOM   1139 C  CA    . PRO A 1 151 ? 61.022 4.901   85.901  1.00 8.82  ? 187 PRO A CA    1 
ATOM   1140 C  C     . PRO A 1 151 ? 62.370 4.842   86.640  1.00 8.16  ? 187 PRO A C     1 
ATOM   1141 O  O     . PRO A 1 151 ? 62.373 4.711   87.867  1.00 6.66  ? 187 PRO A O     1 
ATOM   1142 C  CB    . PRO A 1 151 ? 60.677 3.546   85.262  1.00 6.53  ? 187 PRO A CB    1 
ATOM   1143 C  CG    . PRO A 1 151 ? 61.062 3.710   83.813  1.00 7.94  ? 187 PRO A CG    1 
ATOM   1144 C  CD    . PRO A 1 151 ? 60.712 5.131   83.501  1.00 9.09  ? 187 PRO A CD    1 
ATOM   1145 N  N     . MET A 1 152 ? 63.481 4.975   85.924  1.00 7.23  ? 188 MET A N     1 
ATOM   1146 C  CA    . MET A 1 152 ? 64.795 4.984   86.576  1.00 7.81  ? 188 MET A CA    1 
ATOM   1147 C  C     . MET A 1 152 ? 64.894 6.129   87.587  1.00 7.82  ? 188 MET A C     1 
ATOM   1148 O  O     . MET A 1 152 ? 65.352 5.931   88.730  1.00 6.07  ? 188 MET A O     1 
ATOM   1149 C  CB    . MET A 1 152 ? 65.913 5.127   85.535  1.00 7.14  ? 188 MET A CB    1 
ATOM   1150 C  CG    . MET A 1 152 ? 67.304 5.032   86.151  1.00 10.12 ? 188 MET A CG    1 
ATOM   1151 S  SD    . MET A 1 152 ? 68.532 4.971   84.848  1.00 8.86  ? 188 MET A SD    1 
ATOM   1152 C  CE    . MET A 1 152 ? 70.002 4.718   85.848  1.00 8.68  ? 188 MET A CE    1 
ATOM   1153 N  N     . VAL A 1 153 ? 64.442 7.313   87.175  1.00 6.53  ? 189 VAL A N     1 
ATOM   1154 C  CA    . VAL A 1 153 ? 64.466 8.489   88.042  1.00 5.36  ? 189 VAL A CA    1 
ATOM   1155 C  C     . VAL A 1 153 ? 63.550 8.337   89.252  1.00 8.13  ? 189 VAL A C     1 
ATOM   1156 O  O     . VAL A 1 153 ? 63.960 8.639   90.378  1.00 8.78  ? 189 VAL A O     1 
ATOM   1157 C  CB    . VAL A 1 153 ? 64.106 9.790   87.289  1.00 9.40  ? 189 VAL A CB    1 
ATOM   1158 C  CG1   . VAL A 1 153 ? 63.909 10.935  88.278  1.00 9.86  ? 189 VAL A CG1   1 
ATOM   1159 C  CG2   . VAL A 1 153 ? 65.202 10.141  86.272  1.00 7.95  ? 189 VAL A CG2   1 
ATOM   1160 N  N     . LEU A 1 154 ? 62.313 7.888   89.039  1.00 6.98  ? 190 LEU A N     1 
ATOM   1161 C  CA    . LEU A 1 154 ? 61.412 7.693   90.181  1.00 7.02  ? 190 LEU A CA    1 
ATOM   1162 C  C     . LEU A 1 154 ? 61.989 6.722   91.203  1.00 9.21  ? 190 LEU A C     1 
ATOM   1163 O  O     . LEU A 1 154 ? 61.858 6.923   92.415  1.00 8.72  ? 190 LEU A O     1 
ATOM   1164 C  CB    . LEU A 1 154 ? 60.038 7.181   89.738  1.00 8.68  ? 190 LEU A CB    1 
ATOM   1165 C  CG    . LEU A 1 154 ? 59.203 8.099   88.846  1.00 15.61 ? 190 LEU A CG    1 
ATOM   1166 C  CD1   . LEU A 1 154 ? 57.740 7.719   88.925  1.00 15.06 ? 190 LEU A CD1   1 
ATOM   1167 C  CD2   . LEU A 1 154 ? 59.401 9.558   89.208  1.00 11.33 ? 190 LEU A CD2   1 
ATOM   1168 N  N     . LEU A 1 155 ? 62.598 5.650   90.713  1.00 9.08  ? 191 LEU A N     1 
ATOM   1169 C  CA    . LEU A 1 155 ? 63.113 4.618   91.591  1.00 7.96  ? 191 LEU A CA    1 
ATOM   1170 C  C     . LEU A 1 155 ? 64.330 5.125   92.370  1.00 8.04  ? 191 LEU A C     1 
ATOM   1171 O  O     . LEU A 1 155 ? 64.475 4.830   93.555  1.00 7.80  ? 191 LEU A O     1 
ATOM   1172 C  CB    . LEU A 1 155 ? 63.428 3.341   90.803  1.00 7.62  ? 191 LEU A CB    1 
ATOM   1173 C  CG    . LEU A 1 155 ? 62.208 2.600   90.244  1.00 10.38 ? 191 LEU A CG    1 
ATOM   1174 C  CD1   . LEU A 1 155 ? 62.640 1.601   89.159  1.00 11.38 ? 191 LEU A CD1   1 
ATOM   1175 C  CD2   . LEU A 1 155 ? 61.444 1.868   91.363  1.00 11.87 ? 191 LEU A CD2   1 
ATOM   1176 N  N     . VAL A 1 156 ? 65.176 5.921   91.724  1.00 8.40  ? 192 VAL A N     1 
ATOM   1177 C  CA    . VAL A 1 156 ? 66.316 6.529   92.414  1.00 6.85  ? 192 VAL A CA    1 
ATOM   1178 C  C     . VAL A 1 156 ? 65.845 7.539   93.474  1.00 7.03  ? 192 VAL A C     1 
ATOM   1179 O  O     . VAL A 1 156 ? 66.370 7.565   94.578  1.00 8.99  ? 192 VAL A O     1 
ATOM   1180 C  CB    . VAL A 1 156 ? 67.305 7.178   91.409  1.00 7.08  ? 192 VAL A CB    1 
ATOM   1181 C  CG1   . VAL A 1 156 ? 68.376 8.041   92.144  1.00 8.57  ? 192 VAL A CG1   1 
ATOM   1182 C  CG2   . VAL A 1 156 ? 67.981 6.098   90.588  1.00 10.70 ? 192 VAL A CG2   1 
ATOM   1183 N  N     . LYS A 1 157 ? 64.843 8.350   93.143  1.00 9.16  ? 193 LYS A N     1 
ATOM   1184 C  CA    . LYS A 1 157 ? 64.275 9.294   94.123  1.00 9.94  ? 193 LYS A CA    1 
ATOM   1185 C  C     . LYS A 1 157 ? 63.645 8.579   95.324  1.00 10.40 ? 193 LYS A C     1 
ATOM   1186 O  O     . LYS A 1 157 ? 63.781 9.014   96.483  1.00 12.98 ? 193 LYS A O     1 
ATOM   1187 C  CB    . LYS A 1 157 ? 63.223 10.171  93.460  1.00 8.76  ? 193 LYS A CB    1 
ATOM   1188 C  CG    . LYS A 1 157 ? 63.759 11.243  92.502  1.00 8.97  ? 193 LYS A CG    1 
ATOM   1189 C  CD    . LYS A 1 157 ? 62.542 11.925  91.882  1.00 16.62 ? 193 LYS A CD    1 
ATOM   1190 C  CE    . LYS A 1 157 ? 62.829 13.192  91.115  1.00 21.91 ? 193 LYS A CE    1 
ATOM   1191 N  NZ    . LYS A 1 157 ? 61.535 13.990  91.029  1.00 20.99 ? 193 LYS A NZ    1 
ATOM   1192 N  N     . HIS A 1 158 ? 62.932 7.500   95.039  1.00 9.87  ? 194 HIS A N     1 
ATOM   1193 C  CA    . HIS A 1 158 ? 62.274 6.707   96.080  1.00 10.06 ? 194 HIS A CA    1 
ATOM   1194 C  C     . HIS A 1 158 ? 63.331 6.093   97.004  1.00 11.79 ? 194 HIS A C     1 
ATOM   1195 O  O     . HIS A 1 158 ? 63.213 6.130   98.233  1.00 11.93 ? 194 HIS A O     1 
ATOM   1196 C  CB    . HIS A 1 158 ? 61.448 5.613   95.391  1.00 10.99 ? 194 HIS A CB    1 
ATOM   1197 C  CG    . HIS A 1 158 ? 60.593 4.793   96.311  1.00 13.35 ? 194 HIS A CG    1 
ATOM   1198 N  ND1   . HIS A 1 158 ? 59.705 5.351   97.212  1.00 16.68 ? 194 HIS A ND1   1 
ATOM   1199 C  CD2   . HIS A 1 158 ? 60.443 3.450   96.415  1.00 14.67 ? 194 HIS A CD2   1 
ATOM   1200 C  CE1   . HIS A 1 158 ? 59.070 4.383   97.852  1.00 18.24 ? 194 HIS A CE1   1 
ATOM   1201 N  NE2   . HIS A 1 158 ? 59.499 3.220   97.393  1.00 16.63 ? 194 HIS A NE2   1 
ATOM   1202 N  N     . TRP A 1 159 ? 64.367 5.516   96.404  1.00 9.95  ? 195 TRP A N     1 
ATOM   1203 C  CA    . TRP A 1 159 ? 65.493 4.952   97.154  1.00 10.11 ? 195 TRP A CA    1 
ATOM   1204 C  C     . TRP A 1 159 ? 66.173 6.030   97.996  1.00 13.43 ? 195 TRP A C     1 
ATOM   1205 O  O     . TRP A 1 159 ? 66.423 5.828   99.180  1.00 13.22 ? 195 TRP A O     1 
ATOM   1206 C  CB    . TRP A 1 159 ? 66.482 4.303   96.173  1.00 9.92  ? 195 TRP A CB    1 
ATOM   1207 C  CG    . TRP A 1 159 ? 67.873 4.017   96.695  1.00 10.63 ? 195 TRP A CG    1 
ATOM   1208 C  CD1   . TRP A 1 159 ? 68.266 2.949   97.447  1.00 9.54  ? 195 TRP A CD1   1 
ATOM   1209 C  CD2   . TRP A 1 159 ? 69.055 4.790   96.449  1.00 11.74 ? 195 TRP A CD2   1 
ATOM   1210 N  NE1   . TRP A 1 159 ? 69.626 3.009   97.687  1.00 11.88 ? 195 TRP A NE1   1 
ATOM   1211 C  CE2   . TRP A 1 159 ? 70.129 4.140   97.094  1.00 13.67 ? 195 TRP A CE2   1 
ATOM   1212 C  CE3   . TRP A 1 159 ? 69.306 5.975   95.748  1.00 10.75 ? 195 TRP A CE3   1 
ATOM   1213 C  CZ2   . TRP A 1 159 ? 71.445 4.631   97.053  1.00 13.26 ? 195 TRP A CZ2   1 
ATOM   1214 C  CZ3   . TRP A 1 159 ? 70.605 6.468   95.716  1.00 10.86 ? 195 TRP A CZ3   1 
ATOM   1215 C  CH2   . TRP A 1 159 ? 71.660 5.791   96.358  1.00 13.47 ? 195 TRP A CH2   1 
ATOM   1216 N  N     . ALA A 1 160 ? 66.470 7.178   97.397  1.00 11.67 ? 196 ALA A N     1 
ATOM   1217 C  CA    . ALA A 1 160 ? 67.105 8.262   98.154  1.00 12.51 ? 196 ALA A CA    1 
ATOM   1218 C  C     . ALA A 1 160 ? 66.257 8.722   99.357  1.00 14.07 ? 196 ALA A C     1 
ATOM   1219 O  O     . ALA A 1 160 ? 66.792 9.001   100.434 1.00 17.38 ? 196 ALA A O     1 
ATOM   1220 C  CB    . ALA A 1 160 ? 67.420 9.427   97.254  1.00 11.83 ? 196 ALA A CB    1 
ATOM   1221 N  N     . LYS A 1 161 ? 64.943 8.799   99.181  1.00 11.49 ? 197 LYS A N     1 
ATOM   1222 C  CA    . LYS A 1 161 ? 64.072 9.230   100.269 1.00 14.80 ? 197 LYS A CA    1 
ATOM   1223 C  C     . LYS A 1 161 ? 64.042 8.183   101.378 1.00 20.96 ? 197 LYS A C     1 
ATOM   1224 O  O     . LYS A 1 161 ? 64.133 8.513   102.569 1.00 16.91 ? 197 LYS A O     1 
ATOM   1225 C  CB    . LYS A 1 161 ? 62.653 9.473   99.753  1.00 14.12 ? 197 LYS A CB    1 
ATOM   1226 C  CG    . LYS A 1 161 ? 62.473 10.800  99.063  1.00 25.62 ? 197 LYS A CG    1 
ATOM   1227 C  CD    . LYS A 1 161 ? 61.115 10.920  98.374  1.00 27.31 ? 197 LYS A CD    1 
ATOM   1228 C  CE    . LYS A 1 161 ? 61.092 12.170  97.509  1.00 24.90 ? 197 LYS A CE    1 
ATOM   1229 N  NZ    . LYS A 1 161 ? 61.647 13.326  98.271  1.00 33.24 ? 197 LYS A NZ    1 
ATOM   1230 N  N     . ARG A 1 162 ? 63.929 6.919   100.975 1.00 15.43 ? 198 ARG A N     1 
ATOM   1231 C  CA    . ARG A 1 162 ? 63.833 5.810   101.923 1.00 16.44 ? 198 ARG A CA    1 
ATOM   1232 C  C     . ARG A 1 162 ? 65.107 5.654   102.733 1.00 17.04 ? 198 ARG A C     1 
ATOM   1233 O  O     . ARG A 1 162 ? 65.059 5.304   103.912 1.00 19.74 ? 198 ARG A O     1 
ATOM   1234 C  CB    . ARG A 1 162 ? 63.564 4.499   101.188 1.00 15.21 ? 198 ARG A CB    1 
ATOM   1235 C  CG    . ARG A 1 162 ? 62.135 4.330   100.734 1.00 18.30 ? 198 ARG A CG    1 
ATOM   1236 C  CD    . ARG A 1 162 ? 61.228 4.151   101.942 1.00 25.47 ? 198 ARG A CD    1 
ATOM   1237 N  NE    . ARG A 1 162 ? 60.040 3.371   101.613 1.00 35.10 ? 198 ARG A NE    1 
ATOM   1238 C  CZ    . ARG A 1 162 ? 58.876 3.920   101.311 1.00 26.98 ? 198 ARG A CZ    1 
ATOM   1239 N  NH1   . ARG A 1 162 ? 58.769 5.239   101.312 1.00 37.59 ? 198 ARG A NH1   1 
ATOM   1240 N  NH2   . ARG A 1 162 ? 57.830 3.161   101.013 1.00 27.45 ? 198 ARG A NH2   1 
ATOM   1241 N  N     . LYS A 1 163 ? 66.249 5.915   102.106 1.00 13.58 ? 199 LYS A N     1 
ATOM   1242 C  CA    . LYS A 1 163 ? 67.534 5.780   102.795 1.00 17.13 ? 199 LYS A CA    1 
ATOM   1243 C  C     . LYS A 1 163 ? 68.002 7.057   103.500 1.00 17.30 ? 199 LYS A C     1 
ATOM   1244 O  O     . LYS A 1 163 ? 69.137 7.103   103.980 1.00 18.40 ? 199 LYS A O     1 
ATOM   1245 C  CB    . LYS A 1 163 ? 68.636 5.307   101.838 1.00 14.77 ? 199 LYS A CB    1 
ATOM   1246 C  CG    . LYS A 1 163 ? 68.342 3.995   101.108 1.00 15.22 ? 199 LYS A CG    1 
ATOM   1247 C  CD    . LYS A 1 163 ? 67.984 2.864   102.062 1.00 15.61 ? 199 LYS A CD    1 
ATOM   1248 C  CE    . LYS A 1 163 ? 67.800 1.544   101.282 1.00 15.28 ? 199 LYS A CE    1 
ATOM   1249 N  NZ    . LYS A 1 163 ? 67.478 0.406   102.219 1.00 18.94 ? 199 LYS A NZ    1 
ATOM   1250 N  N     . GLN A 1 164 ? 67.156 8.081   103.544 1.00 18.99 ? 200 GLN A N     1 
ATOM   1251 C  CA    . GLN A 1 164 ? 67.471 9.312   104.284 1.00 21.83 ? 200 GLN A CA    1 
ATOM   1252 C  C     . GLN A 1 164 ? 68.649 10.091  103.715 1.00 23.37 ? 200 GLN A C     1 
ATOM   1253 O  O     . GLN A 1 164 ? 69.377 10.755  104.463 1.00 19.31 ? 200 GLN A O     1 
ATOM   1254 C  CB    . GLN A 1 164 ? 67.763 9.004   105.762 1.00 25.94 ? 200 GLN A CB    1 
ATOM   1255 C  CG    . GLN A 1 164 ? 66.788 9.626   106.709 1.00 33.23 ? 200 GLN A CG    1 
ATOM   1256 C  CD    . GLN A 1 164 ? 65.401 9.102   106.477 1.00 33.15 ? 200 GLN A CD    1 
ATOM   1257 O  OE1   . GLN A 1 164 ? 65.204 7.896   106.303 1.00 41.87 ? 200 GLN A OE1   1 
ATOM   1258 N  NE2   . GLN A 1 164 ? 64.424 10.004  106.451 1.00 32.46 ? 200 GLN A NE2   1 
ATOM   1259 N  N     . ILE A 1 165 ? 68.838 10.030  102.399 1.00 19.99 ? 201 ILE A N     1 
ATOM   1260 C  CA    . ILE A 1 165 ? 69.933 10.765  101.769 1.00 17.39 ? 201 ILE A CA    1 
ATOM   1261 C  C     . ILE A 1 165 ? 69.414 11.799  100.768 1.00 14.35 ? 201 ILE A C     1 
ATOM   1262 O  O     . ILE A 1 165 ? 70.134 12.220  99.867  1.00 15.63 ? 201 ILE A O     1 
ATOM   1263 C  CB    . ILE A 1 165 ? 70.928 9.811   101.074 1.00 16.12 ? 201 ILE A CB    1 
ATOM   1264 C  CG1   . ILE A 1 165 ? 70.200 8.909   100.087 1.00 13.96 ? 201 ILE A CG1   1 
ATOM   1265 C  CG2   . ILE A 1 165 ? 71.695 8.977   102.094 1.00 16.52 ? 201 ILE A CG2   1 
ATOM   1266 C  CD1   . ILE A 1 165 ? 71.127 7.908   99.418  1.00 14.13 ? 201 ILE A CD1   1 
ATOM   1267 N  N     . ASN A 1 166 ? 68.164 12.203  100.958 1.00 16.34 ? 202 ASN A N     1 
ATOM   1268 C  CA    . ASN A 1 166 ? 67.472 13.156  100.098 1.00 18.33 ? 202 ASN A CA    1 
ATOM   1269 C  C     . ASN A 1 166 ? 67.065 14.382  100.925 1.00 16.79 ? 202 ASN A C     1 
ATOM   1270 O  O     . ASN A 1 166 ? 65.982 14.935  100.751 1.00 21.38 ? 202 ASN A O     1 
ATOM   1271 C  CB    . ASN A 1 166 ? 66.246 12.454  99.486  1.00 16.56 ? 202 ASN A CB    1 
ATOM   1272 C  CG    . ASN A 1 166 ? 65.469 13.319  98.516  1.00 19.10 ? 202 ASN A CG    1 
ATOM   1273 O  OD1   . ASN A 1 166 ? 64.241 13.238  98.459  1.00 20.59 ? 202 ASN A OD1   1 
ATOM   1274 N  ND2   . ASN A 1 166 ? 66.171 14.150  97.748  1.00 20.05 ? 202 ASN A ND2   1 
ATOM   1275 N  N     . SER A 1 167 ? 67.944 14.794  101.838 1.00 17.43 ? 203 SER A N     1 
ATOM   1276 C  CA    . SER A 1 167 ? 67.671 15.953  102.683 1.00 22.76 ? 203 SER A CA    1 
ATOM   1277 C  C     . SER A 1 167 ? 68.756 17.038  102.586 1.00 22.00 ? 203 SER A C     1 
ATOM   1278 O  O     . SER A 1 167 ? 69.701 17.053  103.383 1.00 22.04 ? 203 SER A O     1 
ATOM   1279 C  CB    . SER A 1 167 ? 67.489 15.521  104.137 1.00 24.74 ? 203 SER A CB    1 
ATOM   1280 O  OG    . SER A 1 167 ? 66.343 14.701  104.292 1.00 28.91 ? 203 SER A OG    1 
ATOM   1281 N  N     . PRO A 1 168 ? 68.608 17.953  101.615 1.00 18.95 ? 204 PRO A N     1 
ATOM   1282 C  CA    . PRO A 1 168 ? 69.569 19.045  101.413 1.00 21.43 ? 204 PRO A CA    1 
ATOM   1283 C  C     . PRO A 1 168 ? 69.693 19.902  102.668 1.00 30.90 ? 204 PRO A C     1 
ATOM   1284 O  O     . PRO A 1 168 ? 70.807 20.264  103.065 1.00 30.15 ? 204 PRO A O     1 
ATOM   1285 C  CB    . PRO A 1 168 ? 68.943 19.875  100.283 1.00 22.34 ? 204 PRO A CB    1 
ATOM   1286 C  CG    . PRO A 1 168 ? 67.921 19.005  99.657  1.00 25.32 ? 204 PRO A CG    1 
ATOM   1287 C  CD    . PRO A 1 168 ? 67.441 18.064  100.722 1.00 19.91 ? 204 PRO A CD    1 
ATOM   1288 N  N     . TYR A 1 169 ? 68.559 20.202  103.296 1.00 27.89 ? 205 TYR A N     1 
ATOM   1289 C  CA    . TYR A 1 169 ? 68.549 21.063  104.479 1.00 34.56 ? 205 TYR A CA    1 
ATOM   1290 C  C     . TYR A 1 169 ? 69.239 20.393  105.663 1.00 33.15 ? 205 TYR A C     1 
ATOM   1291 O  O     . TYR A 1 169 ? 69.554 21.045  106.656 1.00 37.84 ? 205 TYR A O     1 
ATOM   1292 C  CB    . TYR A 1 169 ? 67.119 21.472  104.847 1.00 30.82 ? 205 TYR A CB    1 
ATOM   1293 C  CG    . TYR A 1 169 ? 66.530 22.550  103.962 1.00 42.78 ? 205 TYR A CG    1 
ATOM   1294 C  CD1   . TYR A 1 169 ? 65.660 22.232  102.924 1.00 41.41 ? 205 TYR A CD1   1 
ATOM   1295 C  CD2   . TYR A 1 169 ? 66.841 23.886  104.167 1.00 40.69 ? 205 TYR A CD2   1 
ATOM   1296 C  CE1   . TYR A 1 169 ? 65.121 23.219  102.116 1.00 39.84 ? 205 TYR A CE1   1 
ATOM   1297 C  CE2   . TYR A 1 169 ? 66.310 24.874  103.363 1.00 41.91 ? 205 TYR A CE2   1 
ATOM   1298 C  CZ    . TYR A 1 169 ? 65.450 24.536  102.344 1.00 43.95 ? 205 TYR A CZ    1 
ATOM   1299 O  OH    . TYR A 1 169 ? 64.917 25.521  101.545 1.00 48.29 ? 205 TYR A OH    1 
ATOM   1300 N  N     . PHE A 1 170 ? 69.494 19.094  105.549 1.00 29.80 ? 206 PHE A N     1 
ATOM   1301 C  CA    . PHE A 1 170 ? 70.137 18.367  106.628 1.00 28.73 ? 206 PHE A CA    1 
ATOM   1302 C  C     . PHE A 1 170 ? 71.341 17.546  106.174 1.00 29.27 ? 206 PHE A C     1 
ATOM   1303 O  O     . PHE A 1 170 ? 71.602 16.473  106.708 1.00 30.21 ? 206 PHE A O     1 
ATOM   1304 C  CB    . PHE A 1 170 ? 69.099 17.525  107.388 1.00 32.63 ? 206 PHE A CB    1 
ATOM   1305 C  CG    . PHE A 1 170 ? 67.922 18.333  107.896 1.00 38.24 ? 206 PHE A CG    1 
ATOM   1306 C  CD1   . PHE A 1 170 ? 68.096 19.284  108.897 1.00 37.24 ? 206 PHE A CD1   1 
ATOM   1307 C  CD2   . PHE A 1 170 ? 66.646 18.149  107.368 1.00 41.38 ? 206 PHE A CD2   1 
ATOM   1308 C  CE1   . PHE A 1 170 ? 67.020 20.037  109.370 1.00 41.15 ? 206 PHE A CE1   1 
ATOM   1309 C  CE2   . PHE A 1 170 ? 65.560 18.897  107.835 1.00 39.82 ? 206 PHE A CE2   1 
ATOM   1310 C  CZ    . PHE A 1 170 ? 65.750 19.841  108.839 1.00 42.27 ? 206 PHE A CZ    1 
ATOM   1311 N  N     . GLY A 1 171 ? 72.076 18.063  105.185 1.00 23.08 ? 207 GLY A N     1 
ATOM   1312 C  CA    . GLY A 1 171 ? 73.382 17.521  104.846 1.00 17.08 ? 207 GLY A CA    1 
ATOM   1313 C  C     . GLY A 1 171 ? 73.508 16.581  103.651 1.00 21.76 ? 207 GLY A C     1 
ATOM   1314 O  O     . GLY A 1 171 ? 74.625 16.189  103.292 1.00 21.59 ? 207 GLY A O     1 
ATOM   1315 N  N     . THR A 1 172 ? 72.392 16.179  103.049 1.00 20.91 ? 208 THR A N     1 
ATOM   1316 C  CA    . THR A 1 172 ? 72.493 15.333  101.856 1.00 17.90 ? 208 THR A CA    1 
ATOM   1317 C  C     . THR A 1 172 ? 71.974 16.041  100.600 1.00 17.49 ? 208 THR A C     1 
ATOM   1318 O  O     . THR A 1 172 ? 72.045 17.271  100.508 1.00 16.47 ? 208 THR A O     1 
ATOM   1319 C  CB    . THR A 1 172 ? 71.927 13.888  102.058 1.00 16.07 ? 208 THR A CB    1 
ATOM   1320 O  OG1   . THR A 1 172 ? 70.634 13.933  102.668 1.00 16.23 ? 208 THR A OG1   1 
ATOM   1321 C  CG2   . THR A 1 172 ? 72.863 13.076  102.930 1.00 17.71 ? 208 THR A CG2   1 
ATOM   1322 N  N     . LEU A 1 173 ? 71.443 15.282  99.645  1.00 16.07 ? 209 LEU A N     1 
ATOM   1323 C  CA    . LEU A 1 173 ? 71.279 15.802  98.280  1.00 12.68 ? 209 LEU A CA    1 
ATOM   1324 C  C     . LEU A 1 173 ? 69.835 15.993  97.817  1.00 14.92 ? 209 LEU A C     1 
ATOM   1325 O  O     . LEU A 1 173 ? 68.944 15.179  98.099  1.00 13.58 ? 209 LEU A O     1 
ATOM   1326 C  CB    . LEU A 1 173 ? 72.035 14.902  97.294  1.00 12.96 ? 209 LEU A CB    1 
ATOM   1327 C  CG    . LEU A 1 173 ? 72.106 15.343  95.834  1.00 10.06 ? 209 LEU A CG    1 
ATOM   1328 C  CD1   . LEU A 1 173 ? 72.944 16.623  95.687  1.00 9.32  ? 209 LEU A CD1   1 
ATOM   1329 C  CD2   . LEU A 1 173 ? 72.696 14.194  95.016  1.00 11.78 ? 209 LEU A CD2   1 
ATOM   1330 N  N     . SER A 1 174 ? 69.601 17.088  97.106  1.00 11.48 ? 210 SER A N     1 
ATOM   1331 C  CA    . SER A 1 174 ? 68.284 17.359  96.548  1.00 13.61 ? 210 SER A CA    1 
ATOM   1332 C  C     . SER A 1 174 ? 67.901 16.319  95.490  1.00 11.59 ? 210 SER A C     1 
ATOM   1333 O  O     . SER A 1 174 ? 68.769 15.668  94.885  1.00 10.04 ? 210 SER A O     1 
ATOM   1334 C  CB    . SER A 1 174 ? 68.254 18.755  95.931  1.00 16.49 ? 210 SER A CB    1 
ATOM   1335 O  OG    . SER A 1 174 ? 69.085 18.793  94.775  1.00 12.48 ? 210 SER A OG    1 
ATOM   1336 N  N     . SER A 1 175 ? 66.599 16.156  95.277  1.00 10.50 ? 211 SER A N     1 
ATOM   1337 C  CA    . SER A 1 175 ? 66.119 15.238  94.250  1.00 11.89 ? 211 SER A CA    1 
ATOM   1338 C  C     . SER A 1 175 ? 66.664 15.664  92.892  1.00 11.45 ? 211 SER A C     1 
ATOM   1339 O  O     . SER A 1 175 ? 67.074 14.818  92.104  1.00 9.89  ? 211 SER A O     1 
ATOM   1340 C  CB    . SER A 1 175 ? 64.596 15.199  94.237  1.00 18.71 ? 211 SER A CB    1 
ATOM   1341 O  OG    . SER A 1 175 ? 64.113 14.727  95.474  1.00 18.02 ? 211 SER A OG    1 
ATOM   1342 N  N     . TYR A 1 176 ? 66.681 16.968  92.615  1.00 10.08 ? 212 TYR A N     1 
ATOM   1343 C  CA    . TYR A 1 176 ? 67.252 17.441  91.341  1.00 12.75 ? 212 TYR A CA    1 
ATOM   1344 C  C     . TYR A 1 176 ? 68.705 16.980  91.189  1.00 10.27 ? 212 TYR A C     1 
ATOM   1345 O  O     . TYR A 1 176 ? 69.145 16.607  90.093  1.00 8.74  ? 212 TYR A O     1 
ATOM   1346 C  CB    . TYR A 1 176 ? 67.130 18.964  91.234  1.00 9.96  ? 212 TYR A CB    1 
ATOM   1347 C  CG    . TYR A 1 176 ? 67.747 19.607  89.999  1.00 12.95 ? 212 TYR A CG    1 
ATOM   1348 C  CD1   . TYR A 1 176 ? 67.289 19.310  88.722  1.00 12.34 ? 212 TYR A CD1   1 
ATOM   1349 C  CD2   . TYR A 1 176 ? 68.752 20.560  90.124  1.00 12.29 ? 212 TYR A CD2   1 
ATOM   1350 C  CE1   . TYR A 1 176 ? 67.848 19.905  87.598  1.00 11.77 ? 212 TYR A CE1   1 
ATOM   1351 C  CE2   . TYR A 1 176 ? 69.314 21.174  89.009  1.00 11.47 ? 212 TYR A CE2   1 
ATOM   1352 C  CZ    . TYR A 1 176 ? 68.855 20.849  87.755  1.00 12.28 ? 212 TYR A CZ    1 
ATOM   1353 O  OH    . TYR A 1 176 ? 69.412 21.452  86.651  1.00 10.88 ? 212 TYR A OH    1 
ATOM   1354 N  N     . GLY A 1 177 ? 69.458 17.009  92.288  1.00 10.07 ? 213 GLY A N     1 
ATOM   1355 C  CA    . GLY A 1 177 ? 70.818 16.498  92.278  1.00 8.56  ? 213 GLY A CA    1 
ATOM   1356 C  C     . GLY A 1 177 ? 70.870 15.048  91.839  1.00 9.39  ? 213 GLY A C     1 
ATOM   1357 O  O     . GLY A 1 177 ? 71.736 14.660  91.048  1.00 9.42  ? 213 GLY A O     1 
ATOM   1358 N  N     . TYR A 1 178 ? 69.956 14.226  92.345  1.00 9.47  ? 214 TYR A N     1 
ATOM   1359 C  CA    . TYR A 1 178 ? 69.963 12.811  91.948  1.00 8.23  ? 214 TYR A CA    1 
ATOM   1360 C  C     . TYR A 1 178 ? 69.627 12.647  90.464  1.00 7.41  ? 214 TYR A C     1 
ATOM   1361 O  O     . TYR A 1 178 ? 70.208 11.793  89.777  1.00 7.79  ? 214 TYR A O     1 
ATOM   1362 C  CB    . TYR A 1 178 ? 69.024 11.984  92.840  1.00 8.13  ? 214 TYR A CB    1 
ATOM   1363 C  CG    . TYR A 1 178 ? 69.652 11.701  94.190  1.00 7.70  ? 214 TYR A CG    1 
ATOM   1364 C  CD1   . TYR A 1 178 ? 70.686 10.777  94.306  1.00 10.68 ? 214 TYR A CD1   1 
ATOM   1365 C  CD2   . TYR A 1 178 ? 69.235 12.368  95.334  1.00 12.05 ? 214 TYR A CD2   1 
ATOM   1366 C  CE1   . TYR A 1 178 ? 71.285 10.507  95.539  1.00 11.79 ? 214 TYR A CE1   1 
ATOM   1367 C  CE2   . TYR A 1 178 ? 69.837 12.113  96.575  1.00 9.38  ? 214 TYR A CE2   1 
ATOM   1368 C  CZ    . TYR A 1 178 ? 70.857 11.192  96.662  1.00 13.72 ? 214 TYR A CZ    1 
ATOM   1369 O  OH    . TYR A 1 178 ? 71.446 10.943  97.877  1.00 14.67 ? 214 TYR A OH    1 
ATOM   1370 N  N     . VAL A 1 179 ? 68.689 13.449  89.968  1.00 7.87  ? 215 VAL A N     1 
ATOM   1371 C  CA    . VAL A 1 179 ? 68.324 13.372  88.551  1.00 8.25  ? 215 VAL A CA    1 
ATOM   1372 C  C     . VAL A 1 179 ? 69.531 13.685  87.675  1.00 8.29  ? 215 VAL A C     1 
ATOM   1373 O  O     . VAL A 1 179 ? 69.758 13.021  86.677  1.00 7.10  ? 215 VAL A O     1 
ATOM   1374 C  CB    . VAL A 1 179 ? 67.148 14.318  88.223  1.00 8.53  ? 215 VAL A CB    1 
ATOM   1375 C  CG1   . VAL A 1 179 ? 66.825 14.281  86.745  1.00 8.74  ? 215 VAL A CG1   1 
ATOM   1376 C  CG2   . VAL A 1 179 ? 65.924 13.889  89.005  1.00 8.42  ? 215 VAL A CG2   1 
ATOM   1377 N  N     . LEU A 1 180 ? 70.318 14.690  88.056  1.00 6.25  ? 216 LEU A N     1 
ATOM   1378 C  CA    . LEU A 1 180 ? 71.524 15.016  87.309  1.00 7.36  ? 216 LEU A CA    1 
ATOM   1379 C  C     . LEU A 1 180 ? 72.555 13.870  87.377  1.00 8.31  ? 216 LEU A C     1 
ATOM   1380 O  O     . LEU A 1 180 ? 73.216 13.550  86.371  1.00 8.76  ? 216 LEU A O     1 
ATOM   1381 C  CB    . LEU A 1 180 ? 72.108 16.353  87.792  1.00 7.02  ? 216 LEU A CB    1 
ATOM   1382 C  CG    . LEU A 1 180 ? 71.268 17.616  87.553  1.00 6.22  ? 216 LEU A CG    1 
ATOM   1383 C  CD1   . LEU A 1 180 ? 72.091 18.886  87.925  1.00 8.38  ? 216 LEU A CD1   1 
ATOM   1384 C  CD2   . LEU A 1 180 ? 70.775 17.713  86.100  1.00 7.40  ? 216 LEU A CD2   1 
ATOM   1385 N  N     . MET A 1 181 ? 72.679 13.212  88.535  1.00 7.40  ? 217 MET A N     1 
ATOM   1386 C  CA    . MET A 1 181 ? 73.591 12.064  88.629  1.00 7.50  ? 217 MET A CA    1 
ATOM   1387 C  C     . MET A 1 181 ? 73.140 10.952  87.701  1.00 8.80  ? 217 MET A C     1 
ATOM   1388 O  O     . MET A 1 181 ? 73.956 10.276  87.082  1.00 8.46  ? 217 MET A O     1 
ATOM   1389 C  CB    . MET A 1 181 ? 73.689 11.537  90.073  1.00 7.10  ? 217 MET A CB    1 
ATOM   1390 C  CG    . MET A 1 181 ? 74.448 12.517  90.996  1.00 9.58  ? 217 MET A CG    1 
ATOM   1391 S  SD    . MET A 1 181 ? 74.370 12.007  92.726  1.00 12.56 ? 217 MET A SD    1 
ATOM   1392 C  CE    . MET A 1 181 ? 75.498 10.647  92.681  1.00 9.21  ? 217 MET A CE    1 
ATOM   1393 N  N     . VAL A 1 182 ? 71.831 10.762  87.613  1.00 7.54  ? 218 VAL A N     1 
ATOM   1394 C  CA    . VAL A 1 182 ? 71.276 9.778   86.697  1.00 6.74  ? 218 VAL A CA    1 
ATOM   1395 C  C     . VAL A 1 182 ? 71.565 10.161  85.249  1.00 7.82  ? 218 VAL A C     1 
ATOM   1396 O  O     . VAL A 1 182 ? 72.051 9.336   84.469  1.00 8.16  ? 218 VAL A O     1 
ATOM   1397 C  CB    . VAL A 1 182 ? 69.765 9.592   86.940  1.00 6.57  ? 218 VAL A CB    1 
ATOM   1398 C  CG1   . VAL A 1 182 ? 69.131 8.784   85.805  1.00 9.00  ? 218 VAL A CG1   1 
ATOM   1399 C  CG2   . VAL A 1 182 ? 69.546 8.873   88.288  1.00 5.35  ? 218 VAL A CG2   1 
ATOM   1400 N  N     . LEU A 1 183 ? 71.273 11.399  84.875  1.00 6.45  ? 219 LEU A N     1 
ATOM   1401 C  CA    . LEU A 1 183 ? 71.550 11.803  83.495  1.00 6.83  ? 219 LEU A CA    1 
ATOM   1402 C  C     . LEU A 1 183 ? 73.029 11.688  83.137  1.00 9.72  ? 219 LEU A C     1 
ATOM   1403 O  O     . LEU A 1 183 ? 73.370 11.257  82.036  1.00 8.20  ? 219 LEU A O     1 
ATOM   1404 C  CB    . LEU A 1 183 ? 71.062 13.223  83.219  1.00 7.30  ? 219 LEU A CB    1 
ATOM   1405 C  CG    . LEU A 1 183 ? 69.544 13.407  83.106  1.00 14.58 ? 219 LEU A CG    1 
ATOM   1406 C  CD1   . LEU A 1 183 ? 69.193 14.903  82.951  1.00 10.80 ? 219 LEU A CD1   1 
ATOM   1407 C  CD2   . LEU A 1 183 ? 69.001 12.603  81.916  1.00 11.54 ? 219 LEU A CD2   1 
ATOM   1408 N  N     . TYR A 1 184 ? 73.907 12.090  84.054  1.00 8.08  ? 220 TYR A N     1 
ATOM   1409 C  CA    . TYR A 1 184 ? 75.338 12.050  83.776  1.00 8.58  ? 220 TYR A CA    1 
ATOM   1410 C  C     . TYR A 1 184 ? 75.758 10.618  83.479  1.00 9.29  ? 220 TYR A C     1 
ATOM   1411 O  O     . TYR A 1 184 ? 76.493 10.355  82.526  1.00 9.27  ? 220 TYR A O     1 
ATOM   1412 C  CB    . TYR A 1 184 ? 76.138 12.626  84.948  1.00 8.73  ? 220 TYR A CB    1 
ATOM   1413 C  CG    . TYR A 1 184 ? 77.638 12.470  84.773  1.00 8.72  ? 220 TYR A CG    1 
ATOM   1414 C  CD1   . TYR A 1 184 ? 78.363 13.371  84.000  1.00 11.32 ? 220 TYR A CD1   1 
ATOM   1415 C  CD2   . TYR A 1 184 ? 78.322 11.426  85.381  1.00 11.38 ? 220 TYR A CD2   1 
ATOM   1416 C  CE1   . TYR A 1 184 ? 79.740 13.232  83.831  1.00 10.84 ? 220 TYR A CE1   1 
ATOM   1417 C  CE2   . TYR A 1 184 ? 79.697 11.268  85.213  1.00 14.36 ? 220 TYR A CE2   1 
ATOM   1418 C  CZ    . TYR A 1 184 ? 80.399 12.177  84.445  1.00 17.47 ? 220 TYR A CZ    1 
ATOM   1419 O  OH    . TYR A 1 184 ? 81.766 12.022  84.295  1.00 15.48 ? 220 TYR A OH    1 
ATOM   1420 N  N     . TYR A 1 185 ? 75.259 9.685   84.279  1.00 8.21  ? 221 TYR A N     1 
ATOM   1421 C  CA    . TYR A 1 185 ? 75.591 8.283   84.076  1.00 7.38  ? 221 TYR A CA    1 
ATOM   1422 C  C     . TYR A 1 185 ? 75.103 7.806   82.711  1.00 11.99 ? 221 TYR A C     1 
ATOM   1423 O  O     . TYR A 1 185 ? 75.829 7.119   81.979  1.00 11.30 ? 221 TYR A O     1 
ATOM   1424 C  CB    . TYR A 1 185 ? 74.989 7.415   85.194  1.00 10.10 ? 221 TYR A CB    1 
ATOM   1425 C  CG    . TYR A 1 185 ? 75.083 5.937   84.886  1.00 10.25 ? 221 TYR A CG    1 
ATOM   1426 C  CD1   . TYR A 1 185 ? 76.282 5.255   85.043  1.00 12.32 ? 221 TYR A CD1   1 
ATOM   1427 C  CD2   . TYR A 1 185 ? 73.984 5.233   84.422  1.00 9.70  ? 221 TYR A CD2   1 
ATOM   1428 C  CE1   . TYR A 1 185 ? 76.382 3.900   84.748  1.00 14.49 ? 221 TYR A CE1   1 
ATOM   1429 C  CE2   . TYR A 1 185 ? 74.073 3.870   84.123  1.00 11.08 ? 221 TYR A CE2   1 
ATOM   1430 C  CZ    . TYR A 1 185 ? 75.275 3.217   84.295  1.00 12.34 ? 221 TYR A CZ    1 
ATOM   1431 O  OH    . TYR A 1 185 ? 75.380 1.880   84.000  1.00 13.05 ? 221 TYR A OH    1 
ATOM   1432 N  N     . LEU A 1 186 ? 73.868 8.163   82.363  1.00 7.16  ? 222 LEU A N     1 
ATOM   1433 C  CA    . LEU A 1 186 ? 73.293 7.678   81.109  1.00 6.62  ? 222 LEU A CA    1 
ATOM   1434 C  C     . LEU A 1 186 ? 73.907 8.314   79.855  1.00 8.67  ? 222 LEU A C     1 
ATOM   1435 O  O     . LEU A 1 186 ? 73.849 7.714   78.781  1.00 11.28 ? 222 LEU A O     1 
ATOM   1436 C  CB    . LEU A 1 186 ? 71.772 7.897   81.101  1.00 9.15  ? 222 LEU A CB    1 
ATOM   1437 C  CG    . LEU A 1 186 ? 70.991 7.099   82.146  1.00 7.95  ? 222 LEU A CG    1 
ATOM   1438 C  CD1   . LEU A 1 186 ? 69.523 7.598   82.187  1.00 11.07 ? 222 LEU A CD1   1 
ATOM   1439 C  CD2   . LEU A 1 186 ? 71.020 5.596   81.854  1.00 8.93  ? 222 LEU A CD2   1 
ATOM   1440 N  N     . ILE A 1 187 ? 74.460 9.522   79.985  1.00 9.62  ? 223 ILE A N     1 
ATOM   1441 C  CA    . ILE A 1 187 ? 75.061 10.230  78.840  1.00 9.49  ? 223 ILE A CA    1 
ATOM   1442 C  C     . ILE A 1 187 ? 76.545 9.907   78.688  1.00 12.18 ? 223 ILE A C     1 
ATOM   1443 O  O     . ILE A 1 187 ? 77.021 9.591   77.584  1.00 12.31 ? 223 ILE A O     1 
ATOM   1444 C  CB    . ILE A 1 187 ? 74.904 11.762  78.987  1.00 10.41 ? 223 ILE A CB    1 
ATOM   1445 C  CG1   . ILE A 1 187 ? 73.422 12.168  78.910  1.00 7.79  ? 223 ILE A CG1   1 
ATOM   1446 C  CG2   . ILE A 1 187 ? 75.690 12.515  77.903  1.00 12.17 ? 223 ILE A CG2   1 
ATOM   1447 C  CD1   . ILE A 1 187 ? 73.146 13.555  79.501  1.00 10.32 ? 223 ILE A CD1   1 
ATOM   1448 N  N     . HIS A 1 188 ? 77.274 9.963   79.801  1.00 11.77 ? 224 HIS A N     1 
ATOM   1449 C  CA    . HIS A 1 188 ? 78.738 10.019  79.742  1.00 12.35 ? 224 HIS A CA    1 
ATOM   1450 C  C     . HIS A 1 188 ? 79.460 8.817   80.319  1.00 14.81 ? 224 HIS A C     1 
ATOM   1451 O  O     . HIS A 1 188 ? 80.674 8.707   80.173  1.00 19.65 ? 224 HIS A O     1 
ATOM   1452 C  CB    . HIS A 1 188 ? 79.243 11.273  80.456  1.00 13.21 ? 224 HIS A CB    1 
ATOM   1453 C  CG    . HIS A 1 188 ? 79.039 12.527  79.674  1.00 11.36 ? 224 HIS A CG    1 
ATOM   1454 N  ND1   . HIS A 1 188 ? 79.615 12.727  78.437  1.00 14.88 ? 224 HIS A ND1   1 
ATOM   1455 C  CD2   . HIS A 1 188 ? 78.325 13.644  79.945  1.00 13.44 ? 224 HIS A CD2   1 
ATOM   1456 C  CE1   . HIS A 1 188 ? 79.262 13.915  77.979  1.00 17.58 ? 224 HIS A CE1   1 
ATOM   1457 N  NE2   . HIS A 1 188 ? 78.482 14.494  78.875  1.00 13.70 ? 224 HIS A NE2   1 
ATOM   1458 N  N     . VAL A 1 189 ? 78.735 7.917   80.972  1.00 12.11 ? 225 VAL A N     1 
ATOM   1459 C  CA    . VAL A 1 189 ? 79.385 6.741   81.562  1.00 12.20 ? 225 VAL A CA    1 
ATOM   1460 C  C     . VAL A 1 189 ? 79.049 5.461   80.822  1.00 16.04 ? 225 VAL A C     1 
ATOM   1461 O  O     . VAL A 1 189 ? 79.938 4.769   80.307  1.00 16.62 ? 225 VAL A O     1 
ATOM   1462 C  CB    . VAL A 1 189 ? 79.013 6.561   83.040  1.00 13.68 ? 225 VAL A CB    1 
ATOM   1463 C  CG1   . VAL A 1 189 ? 79.653 5.291   83.596  1.00 13.86 ? 225 VAL A CG1   1 
ATOM   1464 C  CG2   . VAL A 1 189 ? 79.449 7.775   83.849  1.00 12.50 ? 225 VAL A CG2   1 
ATOM   1465 N  N     . ILE A 1 190 ? 77.762 5.138   80.754  1.00 11.40 ? 226 ILE A N     1 
ATOM   1466 C  CA    . ILE A 1 190 ? 77.360 3.859   80.177  1.00 13.56 ? 226 ILE A CA    1 
ATOM   1467 C  C     . ILE A 1 190 ? 77.682 3.795   78.683  1.00 15.12 ? 226 ILE A C     1 
ATOM   1468 O  O     . ILE A 1 190 ? 77.582 4.803   77.975  1.00 16.81 ? 226 ILE A O     1 
ATOM   1469 C  CB    . ILE A 1 190 ? 75.859 3.562   80.433  1.00 12.92 ? 226 ILE A CB    1 
ATOM   1470 C  CG1   . ILE A 1 190 ? 75.539 2.107   80.113  1.00 12.62 ? 226 ILE A CG1   1 
ATOM   1471 C  CG2   . ILE A 1 190 ? 74.965 4.493   79.618  1.00 9.02  ? 226 ILE A CG2   1 
ATOM   1472 C  CD1   . ILE A 1 190 ? 74.198 1.691   80.633  1.00 19.77 ? 226 ILE A CD1   1 
ATOM   1473 N  N     . LYS A 1 191 ? 78.107 2.617   78.221  1.00 18.15 ? 227 LYS A N     1 
ATOM   1474 C  CA    . LYS A 1 191 ? 78.429 2.389   76.813  1.00 19.14 ? 227 LYS A CA    1 
ATOM   1475 C  C     . LYS A 1 191 ? 77.647 1.189   76.296  1.00 17.88 ? 227 LYS A C     1 
ATOM   1476 O  O     . LYS A 1 191 ? 77.685 0.127   76.912  1.00 16.32 ? 227 LYS A O     1 
ATOM   1477 C  CB    . LYS A 1 191 ? 79.933 2.127   76.629  1.00 20.20 ? 227 LYS A CB    1 
ATOM   1478 C  CG    . LYS A 1 191 ? 80.849 3.193   77.213  1.00 20.23 ? 227 LYS A CG    1 
ATOM   1479 C  CD    . LYS A 1 191 ? 80.661 4.550   76.510  1.00 17.18 ? 227 LYS A CD    1 
ATOM   1480 C  CE    . LYS A 1 191 ? 81.517 5.630   77.175  1.00 16.75 ? 227 LYS A CE    1 
ATOM   1481 N  NZ    . LYS A 1 191 ? 81.205 6.979   76.611  1.00 18.58 ? 227 LYS A NZ    1 
ATOM   1482 N  N     . PRO A 1 192 ? 76.927 1.345   75.166  1.00 16.54 ? 228 PRO A N     1 
ATOM   1483 C  CA    . PRO A 1 192 ? 76.700 2.560   74.375  1.00 19.27 ? 228 PRO A CA    1 
ATOM   1484 C  C     . PRO A 1 192 ? 75.907 3.546   75.219  1.00 18.47 ? 228 PRO A C     1 
ATOM   1485 O  O     . PRO A 1 192 ? 75.181 3.082   76.103  1.00 13.68 ? 228 PRO A O     1 
ATOM   1486 C  CB    . PRO A 1 192 ? 75.796 2.068   73.242  1.00 20.37 ? 228 PRO A CB    1 
ATOM   1487 C  CG    . PRO A 1 192 ? 76.005 0.599   73.181  1.00 22.74 ? 228 PRO A CG    1 
ATOM   1488 C  CD    . PRO A 1 192 ? 76.200 0.194   74.605  1.00 22.30 ? 228 PRO A CD    1 
ATOM   1489 N  N     . PRO A 1 193 ? 76.069 4.856   74.980  1.00 15.59 ? 229 PRO A N     1 
ATOM   1490 C  CA    . PRO A 1 193 ? 75.318 5.851   75.751  1.00 12.75 ? 229 PRO A CA    1 
ATOM   1491 C  C     . PRO A 1 193 ? 73.816 5.661   75.547  1.00 17.03 ? 229 PRO A C     1 
ATOM   1492 O  O     . PRO A 1 193 ? 73.370 5.235   74.466  1.00 13.41 ? 229 PRO A O     1 
ATOM   1493 C  CB    . PRO A 1 193 ? 75.752 7.181   75.123  1.00 16.28 ? 229 PRO A CB    1 
ATOM   1494 C  CG    . PRO A 1 193 ? 77.103 6.890   74.522  1.00 19.98 ? 229 PRO A CG    1 
ATOM   1495 C  CD    . PRO A 1 193 ? 76.971 5.483   73.999  1.00 17.03 ? 229 PRO A CD    1 
ATOM   1496 N  N     . VAL A 1 194 ? 73.028 5.978   76.569  1.00 12.95 ? 230 VAL A N     1 
ATOM   1497 C  CA    . VAL A 1 194 ? 71.587 5.882   76.421  1.00 12.43 ? 230 VAL A CA    1 
ATOM   1498 C  C     . VAL A 1 194 ? 71.117 7.112   75.673  1.00 10.94 ? 230 VAL A C     1 
ATOM   1499 O  O     . VAL A 1 194 ? 70.194 7.034   74.854  1.00 12.35 ? 230 VAL A O     1 
ATOM   1500 C  CB    . VAL A 1 194 ? 70.886 5.755   77.794  1.00 10.71 ? 230 VAL A CB    1 
ATOM   1501 C  CG1   . VAL A 1 194 ? 69.367 6.062   77.693  1.00 10.43 ? 230 VAL A CG1   1 
ATOM   1502 C  CG2   . VAL A 1 194 ? 71.106 4.343   78.349  1.00 8.56  ? 230 VAL A CG2   1 
ATOM   1503 N  N     . PHE A 1 195 ? 71.800 8.223   75.947  1.00 13.67 ? 231 PHE A N     1 
ATOM   1504 C  CA    . PHE A 1 195 ? 71.449 9.572   75.503  1.00 14.85 ? 231 PHE A CA    1 
ATOM   1505 C  C     . PHE A 1 195 ? 72.668 10.282  74.961  1.00 12.70 ? 231 PHE A C     1 
ATOM   1506 O  O     . PHE A 1 195 ? 73.751 10.139  75.529  1.00 15.71 ? 231 PHE A O     1 
ATOM   1507 C  CB    . PHE A 1 195 ? 71.112 10.420  76.737  1.00 16.83 ? 231 PHE A CB    1 
ATOM   1508 C  CG    . PHE A 1 195 ? 69.777 10.166  77.316  1.00 10.41 ? 231 PHE A CG    1 
ATOM   1509 C  CD1   . PHE A 1 195 ? 68.672 10.009  76.499  1.00 13.07 ? 231 PHE A CD1   1 
ATOM   1510 C  CD2   . PHE A 1 195 ? 69.611 10.137  78.698  1.00 12.77 ? 231 PHE A CD2   1 
ATOM   1511 C  CE1   . PHE A 1 195 ? 67.430 9.793   77.036  1.00 13.35 ? 231 PHE A CE1   1 
ATOM   1512 C  CE2   . PHE A 1 195 ? 68.360 9.901   79.247  1.00 9.71  ? 231 PHE A CE2   1 
ATOM   1513 C  CZ    . PHE A 1 195 ? 67.267 9.744   78.412  1.00 10.04 ? 231 PHE A CZ    1 
ATOM   1514 N  N     . PRO A 1 196 ? 72.494 11.118  73.920  1.00 14.28 ? 232 PRO A N     1 
ATOM   1515 C  CA    . PRO A 1 196 ? 73.538 12.089  73.561  1.00 13.07 ? 232 PRO A CA    1 
ATOM   1516 C  C     . PRO A 1 196 ? 73.505 13.245  74.536  1.00 13.53 ? 232 PRO A C     1 
ATOM   1517 O  O     . PRO A 1 196 ? 72.512 13.400  75.260  1.00 11.23 ? 232 PRO A O     1 
ATOM   1518 C  CB    . PRO A 1 196 ? 73.094 12.591  72.185  1.00 16.57 ? 232 PRO A CB    1 
ATOM   1519 C  CG    . PRO A 1 196 ? 71.604 12.450  72.192  1.00 18.58 ? 232 PRO A CG    1 
ATOM   1520 C  CD    . PRO A 1 196 ? 71.313 11.219  73.042  1.00 14.91 ? 232 PRO A CD    1 
ATOM   1521 N  N     . ASN A 1 197 ? 74.566 14.049  74.564  1.00 11.68 ? 233 ASN A N     1 
ATOM   1522 C  CA    . ASN A 1 197 ? 74.562 15.273  75.355  1.00 14.28 ? 233 ASN A CA    1 
ATOM   1523 C  C     . ASN A 1 197 ? 73.989 16.404  74.500  1.00 13.96 ? 233 ASN A C     1 
ATOM   1524 O  O     . ASN A 1 197 ? 74.620 16.833  73.532  1.00 14.45 ? 233 ASN A O     1 
ATOM   1525 C  CB    . ASN A 1 197 ? 75.986 15.596  75.813  1.00 13.29 ? 233 ASN A CB    1 
ATOM   1526 C  CG    . ASN A 1 197 ? 76.056 16.817  76.671  1.00 14.80 ? 233 ASN A CG    1 
ATOM   1527 O  OD1   . ASN A 1 197 ? 75.425 17.843  76.375  1.00 12.96 ? 233 ASN A OD1   1 
ATOM   1528 N  ND2   . ASN A 1 197 ? 76.834 16.737  77.751  1.00 14.26 ? 233 ASN A ND2   1 
ATOM   1529 N  N     . LEU A 1 198 ? 72.810 16.907  74.865  1.00 10.68 ? 234 LEU A N     1 
ATOM   1530 C  CA    . LEU A 1 198 ? 72.106 17.864  74.005  1.00 10.43 ? 234 LEU A CA    1 
ATOM   1531 C  C     . LEU A 1 198 ? 72.726 19.244  74.038  1.00 13.15 ? 234 LEU A C     1 
ATOM   1532 O  O     . LEU A 1 198 ? 72.486 20.055  73.140  1.00 14.36 ? 234 LEU A O     1 
ATOM   1533 C  CB    . LEU A 1 198 ? 70.627 17.951  74.382  1.00 10.05 ? 234 LEU A CB    1 
ATOM   1534 C  CG    . LEU A 1 198 ? 69.891 16.610  74.306  1.00 12.92 ? 234 LEU A CG    1 
ATOM   1535 C  CD1   . LEU A 1 198 ? 68.424 16.775  74.714  1.00 11.35 ? 234 LEU A CD1   1 
ATOM   1536 C  CD2   . LEU A 1 198 ? 69.981 16.038  72.894  1.00 15.20 ? 234 LEU A CD2   1 
ATOM   1537 N  N     . LEU A 1 199 ? 73.513 19.519  75.077  1.00 13.21 ? 235 LEU A N     1 
ATOM   1538 C  CA    . LEU A 1 199 ? 74.160 20.823  75.211  1.00 12.46 ? 235 LEU A CA    1 
ATOM   1539 C  C     . LEU A 1 199 ? 75.366 20.895  74.290  1.00 15.49 ? 235 LEU A C     1 
ATOM   1540 O  O     . LEU A 1 199 ? 75.733 21.974  73.820  1.00 13.78 ? 235 LEU A O     1 
ATOM   1541 C  CB    . LEU A 1 199 ? 74.627 21.081  76.656  1.00 10.66 ? 235 LEU A CB    1 
ATOM   1542 C  CG    . LEU A 1 199 ? 73.617 21.532  77.719  1.00 16.26 ? 235 LEU A CG    1 
ATOM   1543 C  CD1   . LEU A 1 199 ? 72.595 20.451  77.988  1.00 17.85 ? 235 LEU A CD1   1 
ATOM   1544 C  CD2   . LEU A 1 199 ? 74.333 21.895  79.003  1.00 14.36 ? 235 LEU A CD2   1 
ATOM   1545 N  N     . LEU A 1 200 ? 75.999 19.751  74.055  1.00 13.57 ? 236 LEU A N     1 
ATOM   1546 C  CA    . LEU A 1 200 ? 77.254 19.716  73.295  1.00 14.22 ? 236 LEU A CA    1 
ATOM   1547 C  C     . LEU A 1 200 ? 77.037 19.258  71.869  1.00 19.53 ? 236 LEU A C     1 
ATOM   1548 O  O     . LEU A 1 200 ? 77.991 19.115  71.102  1.00 20.52 ? 236 LEU A O     1 
ATOM   1549 C  CB    . LEU A 1 200 ? 78.296 18.811  73.964  1.00 15.79 ? 236 LEU A CB    1 
ATOM   1550 C  CG    . LEU A 1 200 ? 78.607 19.170  75.423  1.00 17.40 ? 236 LEU A CG    1 
ATOM   1551 C  CD1   . LEU A 1 200 ? 79.648 18.222  76.009  1.00 16.32 ? 236 LEU A CD1   1 
ATOM   1552 C  CD2   . LEU A 1 200 ? 79.078 20.608  75.542  1.00 17.18 ? 236 LEU A CD2   1 
ATOM   1553 N  N     . SER A 1 201 ? 75.784 19.028  71.503  1.00 14.92 ? 237 SER A N     1 
ATOM   1554 C  CA    . SER A 1 201 ? 75.477 18.697  70.115  1.00 19.66 ? 237 SER A CA    1 
ATOM   1555 C  C     . SER A 1 201 ? 75.981 19.796  69.177  1.00 19.36 ? 237 SER A C     1 
ATOM   1556 O  O     . SER A 1 201 ? 75.961 20.991  69.523  1.00 16.25 ? 237 SER A O     1 
ATOM   1557 C  CB    . SER A 1 201 ? 73.974 18.510  69.937  1.00 19.57 ? 237 SER A CB    1 
ATOM   1558 O  OG    . SER A 1 201 ? 73.619 18.529  68.571  1.00 20.58 ? 237 SER A OG    1 
ATOM   1559 N  N     . PRO A 1 202 ? 76.466 19.401  67.991  1.00 18.42 ? 238 PRO A N     1 
ATOM   1560 C  CA    . PRO A 1 202 ? 76.885 20.401  67.007  1.00 22.07 ? 238 PRO A CA    1 
ATOM   1561 C  C     . PRO A 1 202 ? 75.701 21.226  66.518  1.00 21.47 ? 238 PRO A C     1 
ATOM   1562 O  O     . PRO A 1 202 ? 75.906 22.300  65.968  1.00 22.67 ? 238 PRO A O     1 
ATOM   1563 C  CB    . PRO A 1 202 ? 77.466 19.557  65.859  1.00 24.36 ? 238 PRO A CB    1 
ATOM   1564 C  CG    . PRO A 1 202 ? 76.843 18.197  66.022  1.00 26.33 ? 238 PRO A CG    1 
ATOM   1565 C  CD    . PRO A 1 202 ? 76.679 18.019  67.515  1.00 23.06 ? 238 PRO A CD    1 
ATOM   1566 N  N     . LEU A 1 203 ? 74.480 20.741  66.727  1.00 19.38 ? 239 LEU A N     1 
ATOM   1567 C  CA    . LEU A 1 203 ? 73.299 21.486  66.294  1.00 22.79 ? 239 LEU A CA    1 
ATOM   1568 C  C     . LEU A 1 203 ? 72.798 22.446  67.367  1.00 22.93 ? 239 LEU A C     1 
ATOM   1569 O  O     . LEU A 1 203 ? 71.914 23.274  67.116  1.00 24.67 ? 239 LEU A O     1 
ATOM   1570 C  CB    . LEU A 1 203 ? 72.178 20.528  65.875  1.00 22.18 ? 239 LEU A CB    1 
ATOM   1571 C  CG    . LEU A 1 203 ? 72.069 20.149  64.392  1.00 29.87 ? 239 LEU A CG    1 
ATOM   1572 C  CD1   . LEU A 1 203 ? 73.427 20.139  63.730  1.00 28.91 ? 239 LEU A CD1   1 
ATOM   1573 C  CD2   . LEU A 1 203 ? 71.397 18.793  64.223  1.00 31.93 ? 239 LEU A CD2   1 
ATOM   1574 N  N     . LYS A 1 204 ? 73.356 22.342  68.568  1.00 21.57 ? 240 LYS A N     1 
ATOM   1575 C  CA    . LYS A 1 204 ? 72.950 23.249  69.644  1.00 19.40 ? 240 LYS A CA    1 
ATOM   1576 C  C     . LYS A 1 204 ? 73.267 24.691  69.272  1.00 20.79 ? 240 LYS A C     1 
ATOM   1577 O  O     . LYS A 1 204 ? 74.323 24.970  68.689  1.00 19.34 ? 240 LYS A O     1 
ATOM   1578 C  CB    . LYS A 1 204 ? 73.656 22.884  70.961  1.00 17.91 ? 240 LYS A CB    1 
ATOM   1579 C  CG    . LYS A 1 204 ? 73.467 23.917  72.093  1.00 16.10 ? 240 LYS A CG    1 
ATOM   1580 C  CD    . LYS A 1 204 ? 74.704 24.828  72.209  1.00 19.85 ? 240 LYS A CD    1 
ATOM   1581 C  CE    . LYS A 1 204 ? 74.543 25.865  73.315  1.00 17.80 ? 240 LYS A CE    1 
ATOM   1582 N  NZ    . LYS A 1 204 ? 75.818 26.630  73.531  1.00 20.01 ? 240 LYS A NZ    1 
ATOM   1583 N  N     . GLN A 1 205 ? 72.352 25.597  69.609  1.00 19.59 ? 241 GLN A N     1 
ATOM   1584 C  CA    . GLN A 1 205 ? 72.591 27.027  69.452  1.00 24.60 ? 241 GLN A CA    1 
ATOM   1585 C  C     . GLN A 1 205 ? 72.587 27.741  70.789  1.00 24.74 ? 241 GLN A C     1 
ATOM   1586 O  O     . GLN A 1 205 ? 71.756 27.462  71.646  1.00 19.44 ? 241 GLN A O     1 
ATOM   1587 C  CB    . GLN A 1 205 ? 71.519 27.653  68.571  1.00 23.71 ? 241 GLN A CB    1 
ATOM   1588 C  CG    . GLN A 1 205 ? 71.799 27.548  67.086  1.00 36.34 ? 241 GLN A CG    1 
ATOM   1589 C  CD    . GLN A 1 205 ? 70.817 28.364  66.273  1.00 50.68 ? 241 GLN A CD    1 
ATOM   1590 O  OE1   . GLN A 1 205 ? 69.852 27.829  65.725  1.00 52.60 ? 241 GLN A OE1   1 
ATOM   1591 N  NE2   . GLN A 1 205 ? 71.049 29.674  66.204  1.00 54.11 ? 241 GLN A NE2   1 
ATOM   1592 N  N     . GLU A 1 206 ? 73.509 28.682  70.951  1.00 20.82 ? 242 GLU A N     1 
ATOM   1593 C  CA    . GLU A 1 206 ? 73.558 29.511  72.146  1.00 21.05 ? 242 GLU A CA    1 
ATOM   1594 C  C     . GLU A 1 206 ? 72.223 30.233  72.374  1.00 22.54 ? 242 GLU A C     1 
ATOM   1595 O  O     . GLU A 1 206 ? 71.600 30.733  71.434  1.00 18.61 ? 242 GLU A O     1 
ATOM   1596 C  CB    . GLU A 1 206 ? 74.699 30.520  71.988  1.00 23.05 ? 242 GLU A CB    1 
ATOM   1597 C  CG    . GLU A 1 206 ? 74.779 31.585  73.040  1.00 28.38 ? 242 GLU A CG    1 
ATOM   1598 C  CD    . GLU A 1 206 ? 75.862 32.594  72.726  1.00 23.62 ? 242 GLU A CD    1 
ATOM   1599 O  OE1   . GLU A 1 206 ? 75.562 33.797  72.735  1.00 30.02 ? 242 GLU A OE1   1 
ATOM   1600 O  OE2   . GLU A 1 206 ? 77.015 32.179  72.473  1.00 29.65 ? 242 GLU A OE2   1 
ATOM   1601 N  N     . LYS A 1 207 ? 71.765 30.248  73.622  1.00 17.31 ? 243 LYS A N     1 
ATOM   1602 C  CA    . LYS A 1 207 ? 70.607 31.042  74.011  1.00 20.12 ? 243 LYS A CA    1 
ATOM   1603 C  C     . LYS A 1 207 ? 70.875 31.612  75.400  1.00 20.25 ? 243 LYS A C     1 
ATOM   1604 O  O     . LYS A 1 207 ? 70.915 30.872  76.387  1.00 14.53 ? 243 LYS A O     1 
ATOM   1605 C  CB    . LYS A 1 207 ? 69.331 30.193  74.012  1.00 20.19 ? 243 LYS A CB    1 
ATOM   1606 C  CG    . LYS A 1 207 ? 68.090 30.975  74.433  1.00 23.88 ? 243 LYS A CG    1 
ATOM   1607 C  CD    . LYS A 1 207 ? 66.808 30.211  74.135  1.00 31.30 ? 243 LYS A CD    1 
ATOM   1608 C  CE    . LYS A 1 207 ? 65.593 31.057  74.499  1.00 40.81 ? 243 LYS A CE    1 
ATOM   1609 N  NZ    . LYS A 1 207 ? 64.311 30.414  74.083  1.00 44.66 ? 243 LYS A NZ    1 
ATOM   1610 N  N     . ILE A 1 208 ? 71.076 32.923  75.483  1.00 17.59 ? 244 ILE A N     1 
ATOM   1611 C  CA    . ILE A 1 208 ? 71.478 33.524  76.747  1.00 15.89 ? 244 ILE A CA    1 
ATOM   1612 C  C     . ILE A 1 208 ? 70.292 33.991  77.596  1.00 18.78 ? 244 ILE A C     1 
ATOM   1613 O  O     . ILE A 1 208 ? 69.541 34.870  77.189  1.00 17.64 ? 244 ILE A O     1 
ATOM   1614 C  CB    . ILE A 1 208 ? 72.425 34.712  76.531  1.00 19.65 ? 244 ILE A CB    1 
ATOM   1615 C  CG1   . ILE A 1 208 ? 73.648 34.274  75.717  1.00 20.26 ? 244 ILE A CG1   1 
ATOM   1616 C  CG2   . ILE A 1 208 ? 72.827 35.296  77.874  1.00 15.46 ? 244 ILE A CG2   1 
ATOM   1617 C  CD1   . ILE A 1 208 ? 74.500 33.205  76.397  1.00 22.13 ? 244 ILE A CD1   1 
ATOM   1618 N  N     . VAL A 1 209 ? 70.135 33.404  78.783  1.00 17.86 ? 245 VAL A N     1 
ATOM   1619 C  CA    . VAL A 1 209 ? 69.081 33.813  79.715  1.00 15.20 ? 245 VAL A CA    1 
ATOM   1620 C  C     . VAL A 1 209 ? 69.659 34.080  81.105  1.00 17.66 ? 245 VAL A C     1 
ATOM   1621 O  O     . VAL A 1 209 ? 70.354 33.227  81.665  1.00 17.68 ? 245 VAL A O     1 
ATOM   1622 C  CB    . VAL A 1 209 ? 67.971 32.737  79.822  1.00 17.78 ? 245 VAL A CB    1 
ATOM   1623 C  CG1   . VAL A 1 209 ? 66.986 33.092  80.932  1.00 20.40 ? 245 VAL A CG1   1 
ATOM   1624 C  CG2   . VAL A 1 209 ? 67.239 32.586  78.490  1.00 20.22 ? 245 VAL A CG2   1 
ATOM   1625 N  N     . ASP A 1 210 ? 69.368 35.260  81.662  1.00 19.25 ? 246 ASP A N     1 
ATOM   1626 C  CA    . ASP A 1 210 ? 69.964 35.693  82.931  1.00 22.46 ? 246 ASP A CA    1 
ATOM   1627 C  C     . ASP A 1 210 ? 71.475 35.441  83.023  1.00 20.48 ? 246 ASP A C     1 
ATOM   1628 O  O     . ASP A 1 210 ? 71.988 35.023  84.067  1.00 23.44 ? 246 ASP A O     1 
ATOM   1629 C  CB    . ASP A 1 210 ? 69.226 35.069  84.124  1.00 26.22 ? 246 ASP A CB    1 
ATOM   1630 C  CG    . ASP A 1 210 ? 67.769 35.485  84.181  1.00 29.56 ? 246 ASP A CG    1 
ATOM   1631 O  OD1   . ASP A 1 210 ? 67.435 36.553  83.611  1.00 33.49 ? 246 ASP A OD1   1 
ATOM   1632 O  OD2   . ASP A 1 210 ? 66.965 34.741  84.782  1.00 30.89 ? 246 ASP A OD2   1 
ATOM   1633 N  N     . GLY A 1 211 ? 72.173 35.680  81.920  1.00 18.51 ? 247 GLY A N     1 
ATOM   1634 C  CA    . GLY A 1 211 ? 73.624 35.587  81.902  1.00 20.26 ? 247 GLY A CA    1 
ATOM   1635 C  C     . GLY A 1 211 ? 74.215 34.204  81.707  1.00 21.85 ? 247 GLY A C     1 
ATOM   1636 O  O     . GLY A 1 211 ? 75.442 34.044  81.734  1.00 19.02 ? 247 GLY A O     1 
ATOM   1637 N  N     . PHE A 1 212 ? 73.365 33.194  81.516  1.00 18.23 ? 248 PHE A N     1 
ATOM   1638 C  CA    . PHE A 1 212 ? 73.859 31.845  81.263  1.00 16.42 ? 248 PHE A CA    1 
ATOM   1639 C  C     . PHE A 1 212 ? 73.313 31.294  79.949  1.00 16.89 ? 248 PHE A C     1 
ATOM   1640 O  O     . PHE A 1 212 ? 72.245 31.693  79.486  1.00 16.01 ? 248 PHE A O     1 
ATOM   1641 C  CB    . PHE A 1 212 ? 73.472 30.904  82.413  1.00 19.71 ? 248 PHE A CB    1 
ATOM   1642 C  CG    . PHE A 1 212 ? 74.042 31.308  83.748  1.00 20.76 ? 248 PHE A CG    1 
ATOM   1643 C  CD1   . PHE A 1 212 ? 75.316 30.896  84.126  1.00 21.35 ? 248 PHE A CD1   1 
ATOM   1644 C  CD2   . PHE A 1 212 ? 73.303 32.083  84.627  1.00 19.79 ? 248 PHE A CD2   1 
ATOM   1645 C  CE1   . PHE A 1 212 ? 75.848 31.264  85.354  1.00 21.68 ? 248 PHE A CE1   1 
ATOM   1646 C  CE2   . PHE A 1 212 ? 73.826 32.456  85.863  1.00 19.63 ? 248 PHE A CE2   1 
ATOM   1647 C  CZ    . PHE A 1 212 ? 75.099 32.047  86.228  1.00 17.00 ? 248 PHE A CZ    1 
ATOM   1648 N  N     . ASP A 1 213 ? 74.038 30.348  79.369  1.00 16.51 ? 249 ASP A N     1 
ATOM   1649 C  CA    . ASP A 1 213 ? 73.641 29.758  78.106  1.00 15.97 ? 249 ASP A CA    1 
ATOM   1650 C  C     . ASP A 1 213 ? 72.705 28.580  78.396  1.00 15.92 ? 249 ASP A C     1 
ATOM   1651 O  O     . ASP A 1 213 ? 73.138 27.563  78.931  1.00 16.12 ? 249 ASP A O     1 
ATOM   1652 C  CB    . ASP A 1 213 ? 74.886 29.274  77.368  1.00 17.69 ? 249 ASP A CB    1 
ATOM   1653 C  CG    . ASP A 1 213 ? 74.597 28.862  75.955  1.00 19.81 ? 249 ASP A CG    1 
ATOM   1654 O  OD1   . ASP A 1 213 ? 73.403 28.798  75.588  1.00 17.02 ? 249 ASP A OD1   1 
ATOM   1655 O  OD2   . ASP A 1 213 ? 75.563 28.584  75.208  1.00 21.71 ? 249 ASP A OD2   1 
ATOM   1656 N  N     . VAL A 1 214 ? 71.427 28.726  78.050  1.00 14.44 ? 250 VAL A N     1 
ATOM   1657 C  CA    . VAL A 1 214 ? 70.452 27.665  78.301  1.00 12.69 ? 250 VAL A CA    1 
ATOM   1658 C  C     . VAL A 1 214 ? 70.130 26.901  77.028  1.00 15.37 ? 250 VAL A C     1 
ATOM   1659 O  O     . VAL A 1 214 ? 69.167 26.131  76.977  1.00 12.95 ? 250 VAL A O     1 
ATOM   1660 C  CB    . VAL A 1 214 ? 69.158 28.213  78.940  1.00 13.66 ? 250 VAL A CB    1 
ATOM   1661 C  CG1   . VAL A 1 214 ? 69.485 28.930  80.256  1.00 11.55 ? 250 VAL A CG1   1 
ATOM   1662 C  CG2   . VAL A 1 214 ? 68.452 29.175  77.984  1.00 14.78 ? 250 VAL A CG2   1 
ATOM   1663 N  N     . GLY A 1 215 ? 70.947 27.101  75.998  1.00 12.15 ? 251 GLY A N     1 
ATOM   1664 C  CA    . GLY A 1 215 ? 70.715 26.442  74.729  1.00 10.98 ? 251 GLY A CA    1 
ATOM   1665 C  C     . GLY A 1 215 ? 70.991 24.953  74.730  1.00 12.53 ? 251 GLY A C     1 
ATOM   1666 O  O     . GLY A 1 215 ? 71.934 24.480  75.384  1.00 13.47 ? 251 GLY A O     1 
ATOM   1667 N  N     . PHE A 1 216 ? 70.164 24.205  73.997  1.00 12.16 ? 252 PHE A N     1 
ATOM   1668 C  CA    . PHE A 1 216 ? 70.439 22.799  73.741  1.00 13.23 ? 252 PHE A CA    1 
ATOM   1669 C  C     . PHE A 1 216 ? 69.733 22.311  72.473  1.00 15.70 ? 252 PHE A C     1 
ATOM   1670 O  O     . PHE A 1 216 ? 68.789 22.950  71.993  1.00 17.10 ? 252 PHE A O     1 
ATOM   1671 C  CB    . PHE A 1 216 ? 70.089 21.927  74.969  1.00 11.02 ? 252 PHE A CB    1 
ATOM   1672 C  CG    . PHE A 1 216 ? 68.600 21.783  75.249  1.00 15.56 ? 252 PHE A CG    1 
ATOM   1673 C  CD1   . PHE A 1 216 ? 67.924 22.714  76.037  1.00 13.80 ? 252 PHE A CD1   1 
ATOM   1674 C  CD2   . PHE A 1 216 ? 67.891 20.685  74.774  1.00 13.67 ? 252 PHE A CD2   1 
ATOM   1675 C  CE1   . PHE A 1 216 ? 66.561 22.571  76.322  1.00 16.44 ? 252 PHE A CE1   1 
ATOM   1676 C  CE2   . PHE A 1 216 ? 66.524 20.535  75.050  1.00 14.19 ? 252 PHE A CE2   1 
ATOM   1677 C  CZ    . PHE A 1 216 ? 65.861 21.471  75.825  1.00 14.10 ? 252 PHE A CZ    1 
ATOM   1678 N  N     . ASP A 1 217 ? 70.222 21.193  71.939  1.00 14.14 ? 253 ASP A N     1 
ATOM   1679 C  CA    . ASP A 1 217 ? 69.641 20.539  70.767  1.00 16.17 ? 253 ASP A CA    1 
ATOM   1680 C  C     . ASP A 1 217 ? 68.238 20.024  71.121  1.00 14.65 ? 253 ASP A C     1 
ATOM   1681 O  O     . ASP A 1 217 ? 68.098 18.953  71.711  1.00 16.40 ? 253 ASP A O     1 
ATOM   1682 C  CB    . ASP A 1 217 ? 70.560 19.381  70.351  1.00 15.30 ? 253 ASP A CB    1 
ATOM   1683 C  CG    . ASP A 1 217 ? 70.213 18.792  68.998  1.00 23.79 ? 253 ASP A CG    1 
ATOM   1684 O  OD1   . ASP A 1 217 ? 69.216 19.225  68.377  1.00 19.10 ? 253 ASP A OD1   1 
ATOM   1685 O  OD2   . ASP A 1 217 ? 70.952 17.877  68.556  1.00 28.20 ? 253 ASP A OD2   1 
ATOM   1686 N  N     . ASP A 1 218 ? 67.200 20.787  70.779  1.00 15.13 ? 254 ASP A N     1 
ATOM   1687 C  CA    . ASP A 1 218 ? 65.860 20.465  71.254  1.00 21.09 ? 254 ASP A CA    1 
ATOM   1688 C  C     . ASP A 1 218 ? 64.910 19.903  70.192  1.00 26.12 ? 254 ASP A C     1 
ATOM   1689 O  O     . ASP A 1 218 ? 63.761 19.570  70.501  1.00 21.10 ? 254 ASP A O     1 
ATOM   1690 C  CB    . ASP A 1 218 ? 65.227 21.673  71.973  1.00 20.98 ? 254 ASP A CB    1 
ATOM   1691 C  CG    . ASP A 1 218 ? 65.058 22.888  71.072  1.00 23.86 ? 254 ASP A CG    1 
ATOM   1692 O  OD1   . ASP A 1 218 ? 65.523 22.874  69.910  1.00 22.90 ? 254 ASP A OD1   1 
ATOM   1693 O  OD2   . ASP A 1 218 ? 64.464 23.883  71.547  1.00 31.66 ? 254 ASP A OD2   1 
ATOM   1694 N  N     . LYS A 1 219 ? 65.379 19.780  68.953  1.00 22.10 ? 255 LYS A N     1 
ATOM   1695 C  CA    . LYS A 1 219 ? 64.548 19.171  67.910  1.00 24.17 ? 255 LYS A CA    1 
ATOM   1696 C  C     . LYS A 1 219 ? 64.566 17.654  68.081  1.00 22.13 ? 255 LYS A C     1 
ATOM   1697 O  O     . LYS A 1 219 ? 65.356 16.950  67.447  1.00 20.76 ? 255 LYS A O     1 
ATOM   1698 C  CB    . LYS A 1 219 ? 65.031 19.570  66.507  1.00 26.89 ? 255 LYS A CB    1 
ATOM   1699 C  CG    . LYS A 1 219 ? 63.975 19.364  65.414  1.00 35.34 ? 255 LYS A CG    1 
ATOM   1700 C  CD    . LYS A 1 219 ? 64.357 20.087  64.118  1.00 38.58 ? 255 LYS A CD    1 
ATOM   1701 C  CE    . LYS A 1 219 ? 63.163 20.252  63.177  1.00 45.18 ? 255 LYS A CE    1 
ATOM   1702 N  NZ    . LYS A 1 219 ? 62.646 18.956  62.659  1.00 42.86 ? 255 LYS A NZ    1 
ATOM   1703 N  N     . LEU A 1 220 ? 63.686 17.148  68.939  1.00 23.12 ? 256 LEU A N     1 
ATOM   1704 C  CA    . LEU A 1 220 ? 63.781 15.757  69.370  1.00 19.43 ? 256 LEU A CA    1 
ATOM   1705 C  C     . LEU A 1 220 ? 63.469 14.753  68.271  1.00 23.50 ? 256 LEU A C     1 
ATOM   1706 O  O     . LEU A 1 220 ? 63.974 13.629  68.289  1.00 20.73 ? 256 LEU A O     1 
ATOM   1707 C  CB    . LEU A 1 220 ? 62.890 15.510  70.591  1.00 26.01 ? 256 LEU A CB    1 
ATOM   1708 C  CG    . LEU A 1 220 ? 63.075 16.489  71.747  1.00 20.90 ? 256 LEU A CG    1 
ATOM   1709 C  CD1   . LEU A 1 220 ? 62.287 16.049  72.978  1.00 20.97 ? 256 LEU A CD1   1 
ATOM   1710 C  CD2   . LEU A 1 220 ? 64.542 16.661  72.093  1.00 20.29 ? 256 LEU A CD2   1 
ATOM   1711 N  N     . GLU A 1 221 ? 62.643 15.148  67.308  1.00 23.60 ? 257 GLU A N     1 
ATOM   1712 C  CA    . GLU A 1 221 ? 62.260 14.223  66.243  1.00 25.44 ? 257 GLU A CA    1 
ATOM   1713 C  C     . GLU A 1 221 ? 63.451 13.846  65.364  1.00 26.89 ? 257 GLU A C     1 
ATOM   1714 O  O     . GLU A 1 221 ? 63.428 12.826  64.680  1.00 26.22 ? 257 GLU A O     1 
ATOM   1715 C  CB    . GLU A 1 221 ? 61.101 14.784  65.405  1.00 29.86 ? 257 GLU A CB    1 
ATOM   1716 C  CG    . GLU A 1 221 ? 61.340 16.163  64.792  1.00 34.84 ? 257 GLU A CG    1 
ATOM   1717 C  CD    . GLU A 1 221 ? 61.036 17.307  65.753  1.00 41.47 ? 257 GLU A CD    1 
ATOM   1718 O  OE1   . GLU A 1 221 ? 60.890 17.064  66.974  1.00 38.13 ? 257 GLU A OE1   1 
ATOM   1719 O  OE2   . GLU A 1 221 ? 60.944 18.459  65.282  1.00 40.65 ? 257 GLU A OE2   1 
ATOM   1720 N  N     . ASP A 1 222 ? 64.502 14.659  65.399  1.00 23.23 ? 258 ASP A N     1 
ATOM   1721 C  CA    . ASP A 1 222 ? 65.703 14.371  64.614  1.00 26.03 ? 258 ASP A CA    1 
ATOM   1722 C  C     . ASP A 1 222 ? 66.749 13.545  65.370  1.00 26.20 ? 258 ASP A C     1 
ATOM   1723 O  O     . ASP A 1 222 ? 67.782 13.179  64.815  1.00 27.87 ? 258 ASP A O     1 
ATOM   1724 C  CB    . ASP A 1 222 ? 66.329 15.668  64.100  1.00 24.21 ? 258 ASP A CB    1 
ATOM   1725 C  CG    . ASP A 1 222 ? 65.498 16.322  63.021  1.00 27.12 ? 258 ASP A CG    1 
ATOM   1726 O  OD1   . ASP A 1 222 ? 64.677 15.617  62.407  1.00 30.57 ? 258 ASP A OD1   1 
ATOM   1727 O  OD2   . ASP A 1 222 ? 65.669 17.534  62.782  1.00 27.42 ? 258 ASP A OD2   1 
ATOM   1728 N  N     . ILE A 1 223 ? 66.484 13.258  66.638  1.00 23.84 ? 259 ILE A N     1 
ATOM   1729 C  CA    . ILE A 1 223 ? 67.390 12.437  67.427  1.00 23.80 ? 259 ILE A CA    1 
ATOM   1730 C  C     . ILE A 1 223 ? 66.983 10.972  67.264  1.00 25.49 ? 259 ILE A C     1 
ATOM   1731 O  O     . ILE A 1 223 ? 65.836 10.619  67.529  1.00 27.45 ? 259 ILE A O     1 
ATOM   1732 C  CB    . ILE A 1 223 ? 67.302 12.811  68.916  1.00 23.96 ? 259 ILE A CB    1 
ATOM   1733 C  CG1   . ILE A 1 223 ? 67.261 14.333  69.065  1.00 27.65 ? 259 ILE A CG1   1 
ATOM   1734 C  CG2   . ILE A 1 223 ? 68.434 12.160  69.716  1.00 25.45 ? 259 ILE A CG2   1 
ATOM   1735 C  CD1   . ILE A 1 223 ? 68.213 14.881  70.084  1.00 23.80 ? 259 ILE A CD1   1 
ATOM   1736 N  N     . PRO A 1 224 ? 67.925 10.113  66.840  1.00 27.66 ? 260 PRO A N     1 
ATOM   1737 C  CA    . PRO A 1 224 ? 67.606 8.698   66.612  1.00 32.51 ? 260 PRO A CA    1 
ATOM   1738 C  C     . PRO A 1 224 ? 67.368 7.964   67.929  1.00 33.00 ? 260 PRO A C     1 
ATOM   1739 O  O     . PRO A 1 224 ? 67.789 8.461   68.983  1.00 27.12 ? 260 PRO A O     1 
ATOM   1740 C  CB    . PRO A 1 224 ? 68.871 8.165   65.941  1.00 31.72 ? 260 PRO A CB    1 
ATOM   1741 C  CG    . PRO A 1 224 ? 69.962 9.024   66.475  1.00 31.78 ? 260 PRO A CG    1 
ATOM   1742 C  CD    . PRO A 1 224 ? 69.360 10.395  66.651  1.00 30.21 ? 260 PRO A CD    1 
ATOM   1743 N  N     . PRO A 1 225 ? 66.681 6.808   67.879  1.00 34.50 ? 261 PRO A N     1 
ATOM   1744 C  CA    . PRO A 1 225 ? 66.512 6.023   69.106  1.00 34.11 ? 261 PRO A CA    1 
ATOM   1745 C  C     . PRO A 1 225 ? 67.863 5.601   69.688  1.00 26.43 ? 261 PRO A C     1 
ATOM   1746 O  O     . PRO A 1 225 ? 68.879 5.564   68.983  1.00 20.80 ? 261 PRO A O     1 
ATOM   1747 C  CB    . PRO A 1 225 ? 65.731 4.795   68.632  1.00 34.13 ? 261 PRO A CB    1 
ATOM   1748 C  CG    . PRO A 1 225 ? 64.996 5.265   67.410  1.00 36.42 ? 261 PRO A CG    1 
ATOM   1749 C  CD    . PRO A 1 225 ? 65.930 6.236   66.745  1.00 35.14 ? 261 PRO A CD    1 
ATOM   1750 N  N     . SER A 1 226 ? 67.872 5.302   70.982  1.00 23.80 ? 262 SER A N     1 
ATOM   1751 C  CA    . SER A 1 226 ? 69.101 4.914   71.663  1.00 21.08 ? 262 SER A CA    1 
ATOM   1752 C  C     . SER A 1 226 ? 69.705 3.651   71.048  1.00 24.29 ? 262 SER A C     1 
ATOM   1753 O  O     . SER A 1 226 ? 68.986 2.705   70.713  1.00 22.85 ? 262 SER A O     1 
ATOM   1754 C  CB    . SER A 1 226 ? 68.801 4.635   73.135  1.00 19.04 ? 262 SER A CB    1 
ATOM   1755 O  OG    . SER A 1 226 ? 70.001 4.465   73.859  1.00 17.14 ? 262 SER A OG    1 
ATOM   1756 N  N     . GLN A 1 227 ? 71.029 3.626   70.928  1.00 19.44 ? 263 GLN A N     1 
ATOM   1757 C  CA    . GLN A 1 227 ? 71.723 2.399   70.553  1.00 22.61 ? 263 GLN A CA    1 
ATOM   1758 C  C     . GLN A 1 227 ? 72.057 1.542   71.778  1.00 18.73 ? 263 GLN A C     1 
ATOM   1759 O  O     . GLN A 1 227 ? 72.721 0.507   71.662  1.00 18.61 ? 263 GLN A O     1 
ATOM   1760 C  CB    . GLN A 1 227 ? 72.993 2.727   69.764  1.00 30.06 ? 263 GLN A CB    1 
ATOM   1761 C  CG    . GLN A 1 227 ? 72.718 3.371   68.407  1.00 31.65 ? 263 GLN A CG    1 
ATOM   1762 C  CD    . GLN A 1 227 ? 72.130 2.390   67.394  1.00 45.76 ? 263 GLN A CD    1 
ATOM   1763 O  OE1   . GLN A 1 227 ? 71.151 2.702   66.710  1.00 48.67 ? 263 GLN A OE1   1 
ATOM   1764 N  NE2   . GLN A 1 227 ? 72.732 1.200   67.291  1.00 37.63 ? 263 GLN A NE2   1 
ATOM   1765 N  N     . ASN A 1 228 ? 71.598 1.971   72.958  1.00 16.83 ? 264 ASN A N     1 
ATOM   1766 C  CA    . ASN A 1 228 ? 71.700 1.127   74.150  1.00 16.31 ? 264 ASN A CA    1 
ATOM   1767 C  C     . ASN A 1 228 ? 70.385 0.391   74.374  1.00 17.02 ? 264 ASN A C     1 
ATOM   1768 O  O     . ASN A 1 228 ? 69.322 1.024   74.522  1.00 13.53 ? 264 ASN A O     1 
ATOM   1769 C  CB    . ASN A 1 228 ? 72.061 1.962   75.397  1.00 14.70 ? 264 ASN A CB    1 
ATOM   1770 C  CG    . ASN A 1 228 ? 72.248 1.102   76.639  1.00 15.39 ? 264 ASN A CG    1 
ATOM   1771 O  OD1   . ASN A 1 228 ? 71.299 0.484   77.138  1.00 14.85 ? 264 ASN A OD1   1 
ATOM   1772 N  ND2   . ASN A 1 228 ? 73.471 1.072   77.156  1.00 14.56 ? 264 ASN A ND2   1 
ATOM   1773 N  N     . TYR A 1 229 ? 70.448 -0.940  74.416  1.00 13.96 ? 265 TYR A N     1 
ATOM   1774 C  CA    . TYR A 1 229 ? 69.239 -1.745  74.544  1.00 20.34 ? 265 TYR A CA    1 
ATOM   1775 C  C     . TYR A 1 229 ? 69.091 -2.423  75.906  1.00 16.59 ? 265 TYR A C     1 
ATOM   1776 O  O     . TYR A 1 229 ? 68.327 -3.370  76.036  1.00 16.27 ? 265 TYR A O     1 
ATOM   1777 C  CB    . TYR A 1 229 ? 69.164 -2.787  73.410  1.00 23.66 ? 265 TYR A CB    1 
ATOM   1778 C  CG    . TYR A 1 229 ? 69.027 -2.177  72.029  1.00 20.36 ? 265 TYR A CG    1 
ATOM   1779 C  CD1   . TYR A 1 229 ? 70.134 -1.699  71.349  1.00 24.93 ? 265 TYR A CD1   1 
ATOM   1780 C  CD2   . TYR A 1 229 ? 67.787 -2.076  71.411  1.00 29.96 ? 265 TYR A CD2   1 
ATOM   1781 C  CE1   . TYR A 1 229 ? 70.015 -1.130  70.085  1.00 29.84 ? 265 TYR A CE1   1 
ATOM   1782 C  CE2   . TYR A 1 229 ? 67.656 -1.512  70.148  1.00 30.37 ? 265 TYR A CE2   1 
ATOM   1783 C  CZ    . TYR A 1 229 ? 68.776 -1.043  69.493  1.00 30.74 ? 265 TYR A CZ    1 
ATOM   1784 O  OH    . TYR A 1 229 ? 68.668 -0.483  68.238  1.00 39.56 ? 265 TYR A OH    1 
ATOM   1785 N  N     . SER A 1 230 ? 69.796 -1.924  76.923  1.00 13.77 ? 266 SER A N     1 
ATOM   1786 C  CA    . SER A 1 230 ? 69.780 -2.563  78.244  1.00 13.57 ? 266 SER A CA    1 
ATOM   1787 C  C     . SER A 1 230 ? 68.409 -2.444  78.898  1.00 14.96 ? 266 SER A C     1 
ATOM   1788 O  O     . SER A 1 230 ? 67.669 -1.488  78.628  1.00 15.43 ? 266 SER A O     1 
ATOM   1789 C  CB    . SER A 1 230 ? 70.811 -1.903  79.163  1.00 17.00 ? 266 SER A CB    1 
ATOM   1790 O  OG    . SER A 1 230 ? 72.115 -2.124  78.669  1.00 25.68 ? 266 SER A OG    1 
ATOM   1791 N  N     . SER A 1 231 ? 68.089 -3.379  79.790  1.00 11.82 ? 267 SER A N     1 
ATOM   1792 C  CA    . SER A 1 231 ? 66.831 -3.299  80.532  1.00 10.86 ? 267 SER A CA    1 
ATOM   1793 C  C     . SER A 1 231 ? 66.928 -2.225  81.599  1.00 11.43 ? 267 SER A C     1 
ATOM   1794 O  O     . SER A 1 231 ? 68.037 -1.798  81.977  1.00 8.41  ? 267 SER A O     1 
ATOM   1795 C  CB    . SER A 1 231 ? 66.523 -4.630  81.207  1.00 12.63 ? 267 SER A CB    1 
ATOM   1796 O  OG    . SER A 1 231 ? 67.521 -4.921  82.172  1.00 12.84 ? 267 SER A OG    1 
ATOM   1797 N  N     . LEU A 1 232 ? 65.775 -1.792  82.102  1.00 10.39 ? 268 LEU A N     1 
ATOM   1798 C  CA    . LEU A 1 232 ? 65.745 -0.846  83.219  1.00 10.57 ? 268 LEU A CA    1 
ATOM   1799 C  C     . LEU A 1 232 ? 66.584 -1.353  84.387  1.00 11.79 ? 268 LEU A C     1 
ATOM   1800 O  O     . LEU A 1 232 ? 67.328 -0.585  85.006  1.00 10.63 ? 268 LEU A O     1 
ATOM   1801 C  CB    . LEU A 1 232 ? 64.300 -0.624  83.685  1.00 10.83 ? 268 LEU A CB    1 
ATOM   1802 C  CG    . LEU A 1 232 ? 64.097 0.199   84.960  1.00 9.80  ? 268 LEU A CG    1 
ATOM   1803 C  CD1   . LEU A 1 232 ? 64.685 1.588   84.795  1.00 11.61 ? 268 LEU A CD1   1 
ATOM   1804 C  CD2   . LEU A 1 232 ? 62.613 0.306   85.284  1.00 11.68 ? 268 LEU A CD2   1 
ATOM   1805 N  N     . GLY A 1 233 ? 66.443 -2.637  84.705  1.00 11.16 ? 269 GLY A N     1 
ATOM   1806 C  CA    . GLY A 1 233 ? 67.185 -3.241  85.809  1.00 12.22 ? 269 GLY A CA    1 
ATOM   1807 C  C     . GLY A 1 233 ? 68.685 -3.168  85.597  1.00 10.64 ? 269 GLY A C     1 
ATOM   1808 O  O     . GLY A 1 233 ? 69.430 -2.842  86.533  1.00 9.79  ? 269 GLY A O     1 
ATOM   1809 N  N     . SER A 1 234 ? 69.141 -3.477  84.386  1.00 10.67 ? 270 SER A N     1 
ATOM   1810 C  CA    . SER A 1 234 ? 70.562 -3.347  84.067  1.00 12.92 ? 270 SER A CA    1 
ATOM   1811 C  C     . SER A 1 234 ? 71.072 -1.907  84.221  1.00 12.74 ? 270 SER A C     1 
ATOM   1812 O  O     . SER A 1 234 ? 72.164 -1.697  84.763  1.00 12.21 ? 270 SER A O     1 
ATOM   1813 C  CB    . SER A 1 234 ? 70.866 -3.869  82.666  1.00 13.38 ? 270 SER A CB    1 
ATOM   1814 O  OG    . SER A 1 234 ? 70.685 -5.271  82.617  1.00 17.25 ? 270 SER A OG    1 
ATOM   1815 N  N     . LEU A 1 235 ? 70.285 -0.933  83.755  1.00 8.40  ? 271 LEU A N     1 
ATOM   1816 C  CA    . LEU A 1 235 ? 70.638 0.483   83.881  1.00 11.28 ? 271 LEU A CA    1 
ATOM   1817 C  C     . LEU A 1 235 ? 70.817 0.872   85.343  1.00 11.01 ? 271 LEU A C     1 
ATOM   1818 O  O     . LEU A 1 235 ? 71.798 1.541   85.712  1.00 8.80  ? 271 LEU A O     1 
ATOM   1819 C  CB    . LEU A 1 235 ? 69.562 1.379   83.252  1.00 10.32 ? 271 LEU A CB    1 
ATOM   1820 C  CG    . LEU A 1 235 ? 69.412 1.316   81.730  1.00 15.41 ? 271 LEU A CG    1 
ATOM   1821 C  CD1   . LEU A 1 235 ? 68.472 2.399   81.207  1.00 11.17 ? 271 LEU A CD1   1 
ATOM   1822 C  CD2   . LEU A 1 235 ? 70.754 1.416   81.046  1.00 14.94 ? 271 LEU A CD2   1 
ATOM   1823 N  N     . LEU A 1 236 ? 69.876 0.457   86.187  1.00 10.15 ? 272 LEU A N     1 
ATOM   1824 C  CA    . LEU A 1 236 ? 69.929 0.865   87.594  1.00 9.42  ? 272 LEU A CA    1 
ATOM   1825 C  C     . LEU A 1 236 ? 71.114 0.247   88.336  1.00 12.48 ? 272 LEU A C     1 
ATOM   1826 O  O     . LEU A 1 236 ? 71.764 0.917   89.135  1.00 8.73  ? 272 LEU A O     1 
ATOM   1827 C  CB    . LEU A 1 236 ? 68.636 0.496   88.322  1.00 11.19 ? 272 LEU A CB    1 
ATOM   1828 C  CG    . LEU A 1 236 ? 67.610 1.614   88.365  1.00 19.10 ? 272 LEU A CG    1 
ATOM   1829 C  CD1   . LEU A 1 236 ? 66.271 1.018   88.737  1.00 20.56 ? 272 LEU A CD1   1 
ATOM   1830 C  CD2   . LEU A 1 236 ? 68.052 2.708   89.376  1.00 12.08 ? 272 LEU A CD2   1 
ATOM   1831 N  N     . HIS A 1 237 ? 71.363 -1.037  88.095  1.00 10.89 ? 273 HIS A N     1 
ATOM   1832 C  CA    . HIS A 1 237 ? 72.486 -1.738  88.730  1.00 13.04 ? 273 HIS A CA    1 
ATOM   1833 C  C     . HIS A 1 237 ? 73.781 -1.037  88.336  1.00 11.45 ? 273 HIS A C     1 
ATOM   1834 O  O     . HIS A 1 237 ? 74.633 -0.781  89.182  1.00 14.59 ? 273 HIS A O     1 
ATOM   1835 C  CB    . HIS A 1 237 ? 72.512 -3.213  88.302  1.00 11.09 ? 273 HIS A CB    1 
ATOM   1836 C  CG    . HIS A 1 237 ? 73.507 -4.061  89.046  1.00 16.91 ? 273 HIS A CG    1 
ATOM   1837 N  ND1   . HIS A 1 237 ? 73.702 -5.398  88.755  1.00 20.08 ? 273 HIS A ND1   1 
ATOM   1838 C  CD2   . HIS A 1 237 ? 74.350 -3.777  90.069  1.00 17.95 ? 273 HIS A CD2   1 
ATOM   1839 C  CE1   . HIS A 1 237 ? 74.627 -5.896  89.557  1.00 20.30 ? 273 HIS A CE1   1 
ATOM   1840 N  NE2   . HIS A 1 237 ? 75.036 -4.933  90.368  1.00 17.26 ? 273 HIS A NE2   1 
ATOM   1841 N  N     . GLY A 1 238 ? 73.909 -0.715  87.048  1.00 11.22 ? 274 GLY A N     1 
ATOM   1842 C  CA    . GLY A 1 238 ? 75.067 0.003   86.545  1.00 12.34 ? 274 GLY A CA    1 
ATOM   1843 C  C     . GLY A 1 238 ? 75.236 1.367   87.199  1.00 10.53 ? 274 GLY A C     1 
ATOM   1844 O  O     . GLY A 1 238 ? 76.357 1.747   87.553  1.00 12.31 ? 274 GLY A O     1 
ATOM   1845 N  N     . PHE A 1 239 ? 74.134 2.105   87.341  1.00 9.38  ? 275 PHE A N     1 
ATOM   1846 C  CA    . PHE A 1 239 ? 74.133 3.405   87.995  1.00 9.53  ? 275 PHE A CA    1 
ATOM   1847 C  C     . PHE A 1 239 ? 74.646 3.304   89.439  1.00 10.78 ? 275 PHE A C     1 
ATOM   1848 O  O     . PHE A 1 239 ? 75.517 4.074   89.853  1.00 9.49  ? 275 PHE A O     1 
ATOM   1849 C  CB    . PHE A 1 239 ? 72.713 3.989   87.936  1.00 8.88  ? 275 PHE A CB    1 
ATOM   1850 C  CG    . PHE A 1 239 ? 72.471 5.142   88.867  1.00 8.53  ? 275 PHE A CG    1 
ATOM   1851 C  CD1   . PHE A 1 239 ? 72.852 6.443   88.525  1.00 7.80  ? 275 PHE A CD1   1 
ATOM   1852 C  CD2   . PHE A 1 239 ? 71.818 4.939   90.070  1.00 9.61  ? 275 PHE A CD2   1 
ATOM   1853 C  CE1   . PHE A 1 239 ? 72.593 7.496   89.386  1.00 6.37  ? 275 PHE A CE1   1 
ATOM   1854 C  CE2   . PHE A 1 239 ? 71.572 5.991   90.934  1.00 9.23  ? 275 PHE A CE2   1 
ATOM   1855 C  CZ    . PHE A 1 239 ? 71.950 7.261   90.598  1.00 8.85  ? 275 PHE A CZ    1 
ATOM   1856 N  N     . PHE A 1 240 ? 74.115 2.348   90.198  1.00 10.84 ? 276 PHE A N     1 
ATOM   1857 C  CA    . PHE A 1 240 ? 74.537 2.187   91.589  1.00 11.89 ? 276 PHE A CA    1 
ATOM   1858 C  C     . PHE A 1 240 ? 76.033 1.869   91.683  1.00 11.45 ? 276 PHE A C     1 
ATOM   1859 O  O     . PHE A 1 240 ? 76.740 2.428   92.542  1.00 10.94 ? 276 PHE A O     1 
ATOM   1860 C  CB    . PHE A 1 240 ? 73.718 1.081   92.279  1.00 11.65 ? 276 PHE A CB    1 
ATOM   1861 C  CG    . PHE A 1 240 ? 72.305 1.504   92.650  1.00 11.11 ? 276 PHE A CG    1 
ATOM   1862 C  CD1   . PHE A 1 240 ? 72.070 2.705   93.321  1.00 13.55 ? 276 PHE A CD1   1 
ATOM   1863 C  CD2   . PHE A 1 240 ? 71.219 0.707   92.308  1.00 11.89 ? 276 PHE A CD2   1 
ATOM   1864 C  CE1   . PHE A 1 240 ? 70.776 3.094   93.656  1.00 14.85 ? 276 PHE A CE1   1 
ATOM   1865 C  CE2   . PHE A 1 240 ? 69.912 1.094   92.643  1.00 12.69 ? 276 PHE A CE2   1 
ATOM   1866 C  CZ    . PHE A 1 240 ? 69.695 2.272   93.322  1.00 11.87 ? 276 PHE A CZ    1 
ATOM   1867 N  N     . ARG A 1 241 ? 76.502 0.969   90.815  1.00 11.59 ? 277 ARG A N     1 
ATOM   1868 C  CA    . ARG A 1 241 ? 77.906 0.529   90.817  1.00 14.72 ? 277 ARG A CA    1 
ATOM   1869 C  C     . ARG A 1 241 ? 78.849 1.667   90.463  1.00 14.52 ? 277 ARG A C     1 
ATOM   1870 O  O     . ARG A 1 241 ? 79.963 1.763   91.003  1.00 13.86 ? 277 ARG A O     1 
ATOM   1871 C  CB    . ARG A 1 241 ? 78.129 -0.633  89.833  1.00 13.47 ? 277 ARG A CB    1 
ATOM   1872 C  CG    . ARG A 1 241 ? 77.594 -1.999  90.282  1.00 16.12 ? 277 ARG A CG    1 
ATOM   1873 C  CD    . ARG A 1 241 ? 77.933 -3.080  89.249  1.00 19.78 ? 277 ARG A CD    1 
ATOM   1874 N  NE    . ARG A 1 241 ? 79.376 -3.136  89.055  1.00 18.73 ? 277 ARG A NE    1 
ATOM   1875 C  CZ    . ARG A 1 241 ? 80.201 -3.901  89.771  1.00 24.08 ? 277 ARG A CZ    1 
ATOM   1876 N  NH1   . ARG A 1 241 ? 79.724 -4.721  90.713  1.00 19.25 ? 277 ARG A NH1   1 
ATOM   1877 N  NH2   . ARG A 1 241 ? 81.507 -3.858  89.532  1.00 24.58 ? 277 ARG A NH2   1 
ATOM   1878 N  N     . PHE A 1 242 ? 78.423 2.525   89.542  1.00 12.84 ? 278 PHE A N     1 
ATOM   1879 C  CA    . PHE A 1 242 ? 79.281 3.633   89.130  1.00 12.73 ? 278 PHE A CA    1 
ATOM   1880 C  C     . PHE A 1 242 ? 79.552 4.555   90.294  1.00 13.95 ? 278 PHE A C     1 
ATOM   1881 O  O     . PHE A 1 242 ? 80.699 4.950   90.547  1.00 15.95 ? 278 PHE A O     1 
ATOM   1882 C  CB    . PHE A 1 242 ? 78.681 4.450   87.982  1.00 12.91 ? 278 PHE A CB    1 
ATOM   1883 C  CG    . PHE A 1 242 ? 79.520 5.651   87.606  1.00 11.67 ? 278 PHE A CG    1 
ATOM   1884 C  CD1   . PHE A 1 242 ? 80.715 5.484   86.926  1.00 13.77 ? 278 PHE A CD1   1 
ATOM   1885 C  CD2   . PHE A 1 242 ? 79.129 6.935   87.961  1.00 12.97 ? 278 PHE A CD2   1 
ATOM   1886 C  CE1   . PHE A 1 242 ? 81.504 6.573   86.588  1.00 15.46 ? 278 PHE A CE1   1 
ATOM   1887 C  CE2   . PHE A 1 242 ? 79.915 8.047   87.634  1.00 12.10 ? 278 PHE A CE2   1 
ATOM   1888 C  CZ    . PHE A 1 242 ? 81.109 7.860   86.950  1.00 15.08 ? 278 PHE A CZ    1 
ATOM   1889 N  N     . TYR A 1 243 ? 78.499 4.922   91.010  1.00 12.55 ? 279 TYR A N     1 
ATOM   1890 C  CA    . TYR A 1 243 ? 78.685 5.887   92.082  1.00 11.23 ? 279 TYR A CA    1 
ATOM   1891 C  C     . TYR A 1 243 ? 79.222 5.235   93.357  1.00 16.69 ? 279 TYR A C     1 
ATOM   1892 O  O     . TYR A 1 243 ? 79.754 5.917   94.227  1.00 15.60 ? 279 TYR A O     1 
ATOM   1893 C  CB    . TYR A 1 243 ? 77.414 6.695   92.325  1.00 11.21 ? 279 TYR A CB    1 
ATOM   1894 C  CG    . TYR A 1 243 ? 77.145 7.696   91.207  1.00 11.72 ? 279 TYR A CG    1 
ATOM   1895 C  CD1   . TYR A 1 243 ? 77.982 8.791   91.016  1.00 8.86  ? 279 TYR A CD1   1 
ATOM   1896 C  CD2   . TYR A 1 243 ? 76.077 7.519   90.325  1.00 11.45 ? 279 TYR A CD2   1 
ATOM   1897 C  CE1   . TYR A 1 243 ? 77.752 9.715   89.978  1.00 9.30  ? 279 TYR A CE1   1 
ATOM   1898 C  CE2   . TYR A 1 243 ? 75.839 8.423   89.289  1.00 9.79  ? 279 TYR A CE2   1 
ATOM   1899 C  CZ    . TYR A 1 243 ? 76.682 9.516   89.128  1.00 10.50 ? 279 TYR A CZ    1 
ATOM   1900 O  OH    . TYR A 1 243 ? 76.450 10.414  88.123  1.00 9.69  ? 279 TYR A OH    1 
ATOM   1901 N  N     . ALA A 1 244 ? 79.110 3.914   93.448  1.00 12.65 ? 280 ALA A N     1 
ATOM   1902 C  CA    . ALA A 1 244 ? 79.660 3.190   94.593  1.00 15.26 ? 280 ALA A CA    1 
ATOM   1903 C  C     . ALA A 1 244 ? 81.172 3.017   94.482  1.00 19.23 ? 280 ALA A C     1 
ATOM   1904 O  O     . ALA A 1 244 ? 81.887 3.158   95.469  1.00 21.02 ? 280 ALA A O     1 
ATOM   1905 C  CB    . ALA A 1 244 ? 78.990 1.827   94.744  1.00 16.48 ? 280 ALA A CB    1 
ATOM   1906 N  N     . TYR A 1 245 ? 81.652 2.704   93.280  1.00 16.67 ? 281 TYR A N     1 
ATOM   1907 C  CA    . TYR A 1 245 ? 83.018 2.198   93.113  1.00 22.80 ? 281 TYR A CA    1 
ATOM   1908 C  C     . TYR A 1 245 ? 83.906 3.008   92.184  1.00 19.83 ? 281 TYR A C     1 
ATOM   1909 O  O     . TYR A 1 245 ? 85.127 2.989   92.320  1.00 20.61 ? 281 TYR A O     1 
ATOM   1910 C  CB    . TYR A 1 245 ? 82.972 0.784   92.542  1.00 19.60 ? 281 TYR A CB    1 
ATOM   1911 C  CG    . TYR A 1 245 ? 82.155 -0.194  93.340  1.00 25.14 ? 281 TYR A CG    1 
ATOM   1912 C  CD1   . TYR A 1 245 ? 82.227 -0.228  94.728  1.00 21.87 ? 281 TYR A CD1   1 
ATOM   1913 C  CD2   . TYR A 1 245 ? 81.317 -1.100  92.699  1.00 23.26 ? 281 TYR A CD2   1 
ATOM   1914 C  CE1   . TYR A 1 245 ? 81.483 -1.144  95.458  1.00 27.90 ? 281 TYR A CE1   1 
ATOM   1915 C  CE2   . TYR A 1 245 ? 80.571 -2.017  93.423  1.00 23.75 ? 281 TYR A CE2   1 
ATOM   1916 C  CZ    . TYR A 1 245 ? 80.661 -2.034  94.795  1.00 27.88 ? 281 TYR A CZ    1 
ATOM   1917 O  OH    . TYR A 1 245 ? 79.911 -2.944  95.508  1.00 36.16 ? 281 TYR A OH    1 
ATOM   1918 N  N     . LYS A 1 246 ? 83.303 3.694   91.221  1.00 16.84 ? 282 LYS A N     1 
ATOM   1919 C  CA    . LYS A 1 246 ? 84.067 4.236   90.097  1.00 18.46 ? 282 LYS A CA    1 
ATOM   1920 C  C     . LYS A 1 246 ? 84.207 5.752   90.153  1.00 21.74 ? 282 LYS A C     1 
ATOM   1921 O  O     . LYS A 1 246 ? 85.294 6.305   89.930  1.00 19.03 ? 282 LYS A O     1 
ATOM   1922 C  CB    . LYS A 1 246 ? 83.396 3.835   88.780  1.00 21.16 ? 282 LYS A CB    1 
ATOM   1923 C  CG    . LYS A 1 246 ? 84.321 3.249   87.746  1.00 33.08 ? 282 LYS A CG    1 
ATOM   1924 C  CD    . LYS A 1 246 ? 85.155 4.310   87.066  1.00 35.29 ? 282 LYS A CD    1 
ATOM   1925 C  CE    . LYS A 1 246 ? 85.842 3.716   85.841  1.00 34.55 ? 282 LYS A CE    1 
ATOM   1926 N  NZ    . LYS A 1 246 ? 86.418 2.385   86.148  1.00 38.46 ? 282 LYS A NZ    1 
ATOM   1927 N  N     . PHE A 1 247 ? 83.102 6.431   90.429  1.00 17.86 ? 283 PHE A N     1 
ATOM   1928 C  CA    . PHE A 1 247 ? 83.138 7.879   90.537  1.00 17.68 ? 283 PHE A CA    1 
ATOM   1929 C  C     . PHE A 1 247 ? 84.028 8.289   91.708  1.00 19.47 ? 283 PHE A C     1 
ATOM   1930 O  O     . PHE A 1 247 ? 84.003 7.658   92.765  1.00 19.01 ? 283 PHE A O     1 
ATOM   1931 C  CB    . PHE A 1 247 ? 81.739 8.447   90.743  1.00 13.20 ? 283 PHE A CB    1 
ATOM   1932 C  CG    . PHE A 1 247 ? 81.711 9.941   90.801  1.00 12.49 ? 283 PHE A CG    1 
ATOM   1933 C  CD1   . PHE A 1 247 ? 82.038 10.691  89.690  1.00 17.45 ? 283 PHE A CD1   1 
ATOM   1934 C  CD2   . PHE A 1 247 ? 81.361 10.600  91.971  1.00 15.20 ? 283 PHE A CD2   1 
ATOM   1935 C  CE1   . PHE A 1 247 ? 82.021 12.089  89.750  1.00 14.30 ? 283 PHE A CE1   1 
ATOM   1936 C  CE2   . PHE A 1 247 ? 81.335 12.004  92.030  1.00 14.38 ? 283 PHE A CE2   1 
ATOM   1937 C  CZ    . PHE A 1 247 ? 81.666 12.734  90.920  1.00 16.28 ? 283 PHE A CZ    1 
ATOM   1938 N  N     . GLU A 1 248 ? 84.807 9.349   91.514  1.00 18.72 ? 284 GLU A N     1 
ATOM   1939 C  CA    . GLU A 1 248 ? 85.756 9.803   92.529  1.00 24.04 ? 284 GLU A CA    1 
ATOM   1940 C  C     . GLU A 1 248 ? 85.364 11.190  93.018  1.00 20.50 ? 284 GLU A C     1 
ATOM   1941 O  O     . GLU A 1 248 ? 85.842 12.201  92.500  1.00 21.96 ? 284 GLU A O     1 
ATOM   1942 C  CB    . GLU A 1 248 ? 87.178 9.817   91.947  1.00 28.01 ? 284 GLU A CB    1 
ATOM   1943 C  CG    . GLU A 1 248 ? 87.734 8.427   91.606  1.00 26.65 ? 284 GLU A CG    1 
ATOM   1944 C  CD    . GLU A 1 248 ? 88.826 8.451   90.535  1.00 41.15 ? 284 GLU A CD    1 
ATOM   1945 O  OE1   . GLU A 1 248 ? 89.720 7.575   90.568  1.00 49.18 ? 284 GLU A OE1   1 
ATOM   1946 O  OE2   . GLU A 1 248 ? 88.786 9.332   89.649  1.00 42.44 ? 284 GLU A OE2   1 
ATOM   1947 N  N     . PRO A 1 249 ? 84.497 11.246  94.032  1.00 20.40 ? 285 PRO A N     1 
ATOM   1948 C  CA    . PRO A 1 249 ? 83.911 12.534  94.391  1.00 19.74 ? 285 PRO A CA    1 
ATOM   1949 C  C     . PRO A 1 249 ? 84.911 13.492  95.025  1.00 26.74 ? 285 PRO A C     1 
ATOM   1950 O  O     . PRO A 1 249 ? 84.606 14.675  95.106  1.00 20.63 ? 285 PRO A O     1 
ATOM   1951 C  CB    . PRO A 1 249 ? 82.812 12.160  95.390  1.00 25.62 ? 285 PRO A CB    1 
ATOM   1952 C  CG    . PRO A 1 249 ? 83.203 10.812  95.913  1.00 24.37 ? 285 PRO A CG    1 
ATOM   1953 C  CD    . PRO A 1 249 ? 83.953 10.132  94.827  1.00 23.94 ? 285 PRO A CD    1 
ATOM   1954 N  N     . ARG A 1 250 ? 86.072 13.003  95.458  1.00 26.93 ? 286 ARG A N     1 
ATOM   1955 C  CA    . ARG A 1 250 ? 87.073 13.881  96.062  1.00 32.04 ? 286 ARG A CA    1 
ATOM   1956 C  C     . ARG A 1 250 ? 87.755 14.748  95.004  1.00 28.46 ? 286 ARG A C     1 
ATOM   1957 O  O     . ARG A 1 250 ? 88.172 15.871  95.286  1.00 30.54 ? 286 ARG A O     1 
ATOM   1958 C  CB    . ARG A 1 250 ? 88.108 13.067  96.859  1.00 33.49 ? 286 ARG A CB    1 
ATOM   1959 C  CG    . ARG A 1 250 ? 89.032 13.908  97.749  1.00 41.46 ? 286 ARG A CG    1 
ATOM   1960 C  CD    . ARG A 1 250 ? 89.703 13.065  98.841  1.00 48.76 ? 286 ARG A CD    1 
ATOM   1961 N  NE    . ARG A 1 250 ? 91.039 13.556  99.176  1.00 50.91 ? 286 ARG A NE    1 
ATOM   1962 C  CZ    . ARG A 1 250 ? 92.154 12.834  99.078  1.00 54.87 ? 286 ARG A CZ    1 
ATOM   1963 N  NH1   . ARG A 1 250 ? 92.105 11.574  98.660  1.00 44.32 ? 286 ARG A NH1   1 
ATOM   1964 N  NH2   . ARG A 1 250 ? 93.323 13.371  99.402  1.00 51.75 ? 286 ARG A NH2   1 
ATOM   1965 N  N     . GLU A 1 251 ? 87.848 14.238  93.781  1.00 21.55 ? 287 GLU A N     1 
ATOM   1966 C  CA    . GLU A 1 251 ? 88.558 14.956  92.722  1.00 27.20 ? 287 GLU A CA    1 
ATOM   1967 C  C     . GLU A 1 251 ? 87.697 15.371  91.534  1.00 26.56 ? 287 GLU A C     1 
ATOM   1968 O  O     . GLU A 1 251 ? 88.062 16.296  90.803  1.00 23.49 ? 287 GLU A O     1 
ATOM   1969 C  CB    . GLU A 1 251 ? 89.736 14.128  92.189  1.00 33.21 ? 287 GLU A CB    1 
ATOM   1970 C  CG    . GLU A 1 251 ? 90.844 13.856  93.203  1.00 40.41 ? 287 GLU A CG    1 
ATOM   1971 C  CD    . GLU A 1 251 ? 90.750 12.462  93.786  1.00 44.91 ? 287 GLU A CD    1 
ATOM   1972 O  OE1   . GLU A 1 251 ? 89.886 11.689  93.318  1.00 42.95 ? 287 GLU A OE1   1 
ATOM   1973 O  OE2   . GLU A 1 251 ? 91.534 12.136  94.706  1.00 51.30 ? 287 GLU A OE2   1 
ATOM   1974 N  N     . LYS A 1 252 ? 86.577 14.685  91.317  1.00 20.07 ? 288 LYS A N     1 
ATOM   1975 C  CA    . LYS A 1 252 ? 85.852 14.842  90.048  1.00 19.22 ? 288 LYS A CA    1 
ATOM   1976 C  C     . LYS A 1 252 ? 84.540 15.629  90.167  1.00 17.36 ? 288 LYS A C     1 
ATOM   1977 O  O     . LYS A 1 252 ? 83.956 15.745  91.253  1.00 17.24 ? 288 LYS A O     1 
ATOM   1978 C  CB    . LYS A 1 252 ? 85.628 13.479  89.372  1.00 19.64 ? 288 LYS A CB    1 
ATOM   1979 C  CG    . LYS A 1 252 ? 86.929 12.734  89.035  1.00 22.26 ? 288 LYS A CG    1 
ATOM   1980 C  CD    . LYS A 1 252 ? 87.798 13.552  88.075  1.00 28.13 ? 288 LYS A CD    1 
ATOM   1981 C  CE    . LYS A 1 252 ? 89.154 12.894  87.848  1.00 33.51 ? 288 LYS A CE    1 
ATOM   1982 N  NZ    . LYS A 1 252 ? 89.005 11.485  87.372  1.00 35.70 ? 288 LYS A NZ    1 
ATOM   1983 N  N     . VAL A 1 253 ? 84.106 16.203  89.045  1.00 16.86 ? 289 VAL A N     1 
ATOM   1984 C  CA    . VAL A 1 253 ? 82.862 16.968  89.008  1.00 17.32 ? 289 VAL A CA    1 
ATOM   1985 C  C     . VAL A 1 253 ? 81.889 16.278  88.050  1.00 14.33 ? 289 VAL A C     1 
ATOM   1986 O  O     . VAL A 1 253 ? 82.257 15.916  86.928  1.00 13.88 ? 289 VAL A O     1 
ATOM   1987 C  CB    . VAL A 1 253 ? 83.098 18.429  88.556  1.00 17.25 ? 289 VAL A CB    1 
ATOM   1988 C  CG1   . VAL A 1 253 ? 81.783 19.224  88.550  1.00 14.39 ? 289 VAL A CG1   1 
ATOM   1989 C  CG2   . VAL A 1 253 ? 84.128 19.124  89.464  1.00 17.51 ? 289 VAL A CG2   1 
ATOM   1990 N  N     . VAL A 1 254 ? 80.659 16.045  88.511  1.00 13.73 ? 290 VAL A N     1 
ATOM   1991 C  CA    . VAL A 1 254 ? 79.606 15.601  87.605  1.00 13.95 ? 290 VAL A CA    1 
ATOM   1992 C  C     . VAL A 1 254 ? 79.303 16.795  86.694  1.00 12.71 ? 290 VAL A C     1 
ATOM   1993 O  O     . VAL A 1 254 ? 78.967 17.870  87.177  1.00 13.12 ? 290 VAL A O     1 
ATOM   1994 C  CB    . VAL A 1 254 ? 78.346 15.183  88.378  1.00 11.53 ? 290 VAL A CB    1 
ATOM   1995 C  CG1   . VAL A 1 254 ? 77.184 15.012  87.422  1.00 10.00 ? 290 VAL A CG1   1 
ATOM   1996 C  CG2   . VAL A 1 254 ? 78.597 13.857  89.143  1.00 11.31 ? 290 VAL A CG2   1 
ATOM   1997 N  N     . THR A 1 255 ? 79.441 16.616  85.388  1.00 13.50 ? 291 THR A N     1 
ATOM   1998 C  CA    . THR A 1 255 ? 79.372 17.746  84.470  1.00 13.24 ? 291 THR A CA    1 
ATOM   1999 C  C     . THR A 1 255 ? 78.680 17.382  83.177  1.00 9.99  ? 291 THR A C     1 
ATOM   2000 O  O     . THR A 1 255 ? 78.750 16.235  82.722  1.00 11.90 ? 291 THR A O     1 
ATOM   2001 C  CB    . THR A 1 255 ? 80.791 18.267  84.118  1.00 16.04 ? 291 THR A CB    1 
ATOM   2002 O  OG1   . THR A 1 255 ? 80.687 19.316  83.150  1.00 14.84 ? 291 THR A OG1   1 
ATOM   2003 C  CG2   . THR A 1 255 ? 81.632 17.147  83.526  1.00 12.33 ? 291 THR A CG2   1 
ATOM   2004 N  N     . PHE A 1 256 ? 78.015 18.366  82.575  1.00 9.13  ? 292 PHE A N     1 
ATOM   2005 C  CA    . PHE A 1 256 ? 77.420 18.191  81.242  1.00 9.83  ? 292 PHE A CA    1 
ATOM   2006 C  C     . PHE A 1 256 ? 78.105 19.077  80.212  1.00 12.38 ? 292 PHE A C     1 
ATOM   2007 O  O     . PHE A 1 256 ? 77.613 19.262  79.095  1.00 12.88 ? 292 PHE A O     1 
ATOM   2008 C  CB    . PHE A 1 256 ? 75.911 18.495  81.308  1.00 12.32 ? 292 PHE A CB    1 
ATOM   2009 C  CG    . PHE A 1 256 ? 75.203 17.658  82.325  1.00 10.56 ? 292 PHE A CG    1 
ATOM   2010 C  CD1   . PHE A 1 256 ? 74.742 16.400  81.981  1.00 10.15 ? 292 PHE A CD1   1 
ATOM   2011 C  CD2   . PHE A 1 256 ? 75.067 18.096  83.643  1.00 9.58  ? 292 PHE A CD2   1 
ATOM   2012 C  CE1   . PHE A 1 256 ? 74.132 15.588  82.929  1.00 9.43  ? 292 PHE A CE1   1 
ATOM   2013 C  CE2   . PHE A 1 256 ? 74.460 17.277  84.603  1.00 8.63  ? 292 PHE A CE2   1 
ATOM   2014 C  CZ    . PHE A 1 256 ? 73.990 16.032  84.234  1.00 9.42  ? 292 PHE A CZ    1 
ATOM   2015 N  N     . ARG A 1 257 ? 79.255 19.622  80.593  1.00 10.75 ? 293 ARG A N     1 
ATOM   2016 C  CA    . ARG A 1 257 ? 79.939 20.589  79.745  1.00 15.05 ? 293 ARG A CA    1 
ATOM   2017 C  C     . ARG A 1 257 ? 81.230 20.069  79.113  1.00 17.73 ? 293 ARG A C     1 
ATOM   2018 O  O     . ARG A 1 257 ? 81.965 20.840  78.489  1.00 22.22 ? 293 ARG A O     1 
ATOM   2019 C  CB    . ARG A 1 257 ? 80.227 21.863  80.543  1.00 16.52 ? 293 ARG A CB    1 
ATOM   2020 C  CG    . ARG A 1 257 ? 78.986 22.679  80.886  1.00 21.33 ? 293 ARG A CG    1 
ATOM   2021 C  CD    . ARG A 1 257 ? 78.197 23.019  79.633  1.00 21.97 ? 293 ARG A CD    1 
ATOM   2022 N  NE    . ARG A 1 257 ? 77.095 23.937  79.913  1.00 20.99 ? 293 ARG A NE    1 
ATOM   2023 C  CZ    . ARG A 1 257 ? 77.201 25.261  79.879  1.00 28.97 ? 293 ARG A CZ    1 
ATOM   2024 N  NH1   . ARG A 1 257 ? 78.366 25.833  79.577  1.00 28.00 ? 293 ARG A NH1   1 
ATOM   2025 N  NH2   . ARG A 1 257 ? 76.142 26.018  80.145  1.00 26.66 ? 293 ARG A NH2   1 
ATOM   2026 N  N     . ARG A 1 258 ? 81.513 18.781  79.276  1.00 16.29 ? 294 ARG A N     1 
ATOM   2027 C  CA    . ARG A 1 258 ? 82.700 18.174  78.657  1.00 18.16 ? 294 ARG A CA    1 
ATOM   2028 C  C     . ARG A 1 258 ? 82.345 16.977  77.775  1.00 18.41 ? 294 ARG A C     1 
ATOM   2029 O  O     . ARG A 1 258 ? 81.541 16.119  78.168  1.00 17.52 ? 294 ARG A O     1 
ATOM   2030 C  CB    . ARG A 1 258 ? 83.715 17.744  79.721  1.00 16.63 ? 294 ARG A CB    1 
ATOM   2031 C  CG    . ARG A 1 258 ? 84.277 18.886  80.550  1.00 23.00 ? 294 ARG A CG    1 
ATOM   2032 C  CD    . ARG A 1 258 ? 85.089 19.845  79.677  1.00 27.36 ? 294 ARG A CD    1 
ATOM   2033 N  NE    . ARG A 1 258 ? 85.818 20.830  80.475  1.00 30.73 ? 294 ARG A NE    1 
ATOM   2034 C  CZ    . ARG A 1 258 ? 85.296 21.968  80.932  1.00 36.99 ? 294 ARG A CZ    1 
ATOM   2035 N  NH1   . ARG A 1 258 ? 84.024 22.272  80.687  1.00 34.71 ? 294 ARG A NH1   1 
ATOM   2036 N  NH2   . ARG A 1 258 ? 86.043 22.801  81.646  1.00 39.67 ? 294 ARG A NH2   1 
ATOM   2037 N  N     . PRO A 1 259 ? 82.967 16.893  76.585  1.00 21.09 ? 295 PRO A N     1 
ATOM   2038 C  CA    . PRO A 1 259 ? 82.642 15.822  75.634  1.00 20.25 ? 295 PRO A CA    1 
ATOM   2039 C  C     . PRO A 1 259 ? 82.856 14.433  76.232  1.00 20.10 ? 295 PRO A C     1 
ATOM   2040 O  O     . PRO A 1 259 ? 82.072 13.519  75.945  1.00 24.66 ? 295 PRO A O     1 
ATOM   2041 C  CB    . PRO A 1 259 ? 83.621 16.070  74.479  1.00 24.64 ? 295 PRO A CB    1 
ATOM   2042 C  CG    . PRO A 1 259 ? 83.972 17.518  74.587  1.00 28.23 ? 295 PRO A CG    1 
ATOM   2043 C  CD    . PRO A 1 259 ? 84.006 17.797  76.064  1.00 25.22 ? 295 PRO A CD    1 
ATOM   2044 N  N     . ASP A 1 260 ? 83.877 14.281  77.075  1.00 22.68 ? 296 ASP A N     1 
ATOM   2045 C  CA    . ASP A 1 260 ? 84.165 12.983  77.690  1.00 27.16 ? 296 ASP A CA    1 
ATOM   2046 C  C     . ASP A 1 260 ? 83.640 12.893  79.126  1.00 24.34 ? 296 ASP A C     1 
ATOM   2047 O  O     . ASP A 1 260 ? 83.854 11.893  79.817  1.00 22.78 ? 296 ASP A O     1 
ATOM   2048 C  CB    . ASP A 1 260 ? 85.674 12.705  77.672  1.00 23.38 ? 296 ASP A CB    1 
ATOM   2049 C  CG    . ASP A 1 260 ? 86.482 13.815  78.326  1.00 31.43 ? 296 ASP A CG    1 
ATOM   2050 O  OD1   . ASP A 1 260 ? 85.888 14.688  79.002  1.00 22.58 ? 296 ASP A OD1   1 
ATOM   2051 O  OD2   . ASP A 1 260 ? 87.724 13.812  78.175  1.00 34.28 ? 296 ASP A OD2   1 
ATOM   2052 N  N     . GLY A 1 261 ? 82.978 13.952  79.583  1.00 19.67 ? 297 GLY A N     1 
ATOM   2053 C  CA    . GLY A 1 261 ? 82.421 13.967  80.924  1.00 16.57 ? 297 GLY A CA    1 
ATOM   2054 C  C     . GLY A 1 261 ? 83.477 14.101  82.007  1.00 19.12 ? 297 GLY A C     1 
ATOM   2055 O  O     . GLY A 1 261 ? 83.174 13.906  83.185  1.00 16.13 ? 297 GLY A O     1 
ATOM   2056 N  N     . TYR A 1 262 ? 84.703 14.457  81.614  1.00 17.23 ? 298 TYR A N     1 
ATOM   2057 C  CA    . TYR A 1 262 ? 85.830 14.550  82.547  1.00 21.57 ? 298 TYR A CA    1 
ATOM   2058 C  C     . TYR A 1 262 ? 86.078 15.993  82.977  1.00 24.02 ? 298 TYR A C     1 
ATOM   2059 O  O     . TYR A 1 262 ? 86.339 16.854  82.134  1.00 19.12 ? 298 TYR A O     1 
ATOM   2060 C  CB    . TYR A 1 262 ? 87.106 13.989  81.897  1.00 28.27 ? 298 TYR A CB    1 
ATOM   2061 C  CG    . TYR A 1 262 ? 88.313 13.932  82.818  1.00 32.61 ? 298 TYR A CG    1 
ATOM   2062 C  CD1   . TYR A 1 262 ? 88.688 12.740  83.430  1.00 34.23 ? 298 TYR A CD1   1 
ATOM   2063 C  CD2   . TYR A 1 262 ? 89.085 15.065  83.063  1.00 30.35 ? 298 TYR A CD2   1 
ATOM   2064 C  CE1   . TYR A 1 262 ? 89.793 12.684  84.272  1.00 37.49 ? 298 TYR A CE1   1 
ATOM   2065 C  CE2   . TYR A 1 262 ? 90.182 15.018  83.901  1.00 36.76 ? 298 TYR A CE2   1 
ATOM   2066 C  CZ    . TYR A 1 262 ? 90.532 13.828  84.504  1.00 42.15 ? 298 TYR A CZ    1 
ATOM   2067 O  OH    . TYR A 1 262 ? 91.629 13.794  85.337  1.00 52.21 ? 298 TYR A OH    1 
ATOM   2068 N  N     . LEU A 1 263 ? 86.046 16.242  84.287  1.00 19.67 ? 299 LEU A N     1 
ATOM   2069 C  CA    . LEU A 1 263 ? 86.243 17.590  84.832  1.00 24.02 ? 299 LEU A CA    1 
ATOM   2070 C  C     . LEU A 1 263 ? 86.698 17.496  86.288  1.00 21.24 ? 299 LEU A C     1 
ATOM   2071 O  O     . LEU A 1 263 ? 86.054 16.815  87.087  1.00 20.93 ? 299 LEU A O     1 
ATOM   2072 C  CB    . LEU A 1 263 ? 84.928 18.371  84.745  1.00 20.94 ? 299 LEU A CB    1 
ATOM   2073 C  CG    . LEU A 1 263 ? 84.864 19.898  84.647  1.00 32.00 ? 299 LEU A CG    1 
ATOM   2074 C  CD1   . LEU A 1 263 ? 84.201 20.512  85.865  1.00 27.43 ? 299 LEU A CD1   1 
ATOM   2075 C  CD2   . LEU A 1 263 ? 86.227 20.522  84.379  1.00 27.56 ? 299 LEU A CD2   1 
ATOM   2076 N  N     . THR A 1 264 ? 87.800 18.165  86.654  1.00 21.38 ? 300 THR A N     1 
ATOM   2077 C  CA    . THR A 1 264 ? 88.279 18.080  88.045  1.00 18.24 ? 300 THR A CA    1 
ATOM   2078 C  C     . THR A 1 264 ? 87.844 19.282  88.859  1.00 19.31 ? 300 THR A C     1 
ATOM   2079 O  O     . THR A 1 264 ? 87.584 20.345  88.301  1.00 24.37 ? 300 THR A O     1 
ATOM   2080 C  CB    . THR A 1 264 ? 89.830 17.946  88.173  1.00 27.12 ? 300 THR A CB    1 
ATOM   2081 O  OG1   . THR A 1 264 ? 90.455 19.165  87.749  1.00 23.98 ? 300 THR A OG1   1 
ATOM   2082 C  CG2   . THR A 1 264 ? 90.355 16.784  87.362  1.00 26.19 ? 300 THR A CG2   1 
ATOM   2083 N  N     . LYS A 1 265 ? 87.767 19.110  90.175  1.00 18.78 ? 301 LYS A N     1 
ATOM   2084 C  CA    . LYS A 1 265 ? 87.426 20.210  91.062  1.00 24.53 ? 301 LYS A CA    1 
ATOM   2085 C  C     . LYS A 1 265 ? 88.448 21.339  90.934  1.00 27.34 ? 301 LYS A C     1 
ATOM   2086 O  O     . LYS A 1 265 ? 88.132 22.508  91.165  1.00 25.82 ? 301 LYS A O     1 
ATOM   2087 C  CB    . LYS A 1 265 ? 87.362 19.729  92.507  1.00 23.95 ? 301 LYS A CB    1 
ATOM   2088 C  CG    . LYS A 1 265 ? 86.229 18.754  92.812  1.00 23.34 ? 301 LYS A CG    1 
ATOM   2089 C  CD    . LYS A 1 265 ? 86.046 18.675  94.327  1.00 26.50 ? 301 LYS A CD    1 
ATOM   2090 C  CE    . LYS A 1 265 ? 85.048 17.621  94.716  1.00 25.69 ? 301 LYS A CE    1 
ATOM   2091 N  NZ    . LYS A 1 265 ? 85.039 17.415  96.198  1.00 23.13 ? 301 LYS A NZ    1 
ATOM   2092 N  N     . GLN A 1 266 ? 89.670 20.974  90.553  1.00 31.93 ? 302 GLN A N     1 
ATOM   2093 C  CA    . GLN A 1 266 ? 90.749 21.942  90.348  1.00 30.71 ? 302 GLN A CA    1 
ATOM   2094 C  C     . GLN A 1 266 ? 90.492 22.867  89.174  1.00 33.11 ? 302 GLN A C     1 
ATOM   2095 O  O     . GLN A 1 266 ? 90.512 24.091  89.314  1.00 36.88 ? 302 GLN A O     1 
ATOM   2096 C  CB    . GLN A 1 266 ? 92.070 21.211  90.124  1.00 33.62 ? 302 GLN A CB    1 
ATOM   2097 C  CG    . GLN A 1 266 ? 92.742 20.771  91.398  1.00 39.18 ? 302 GLN A CG    1 
ATOM   2098 C  CD    . GLN A 1 266 ? 93.138 21.947  92.263  1.00 40.77 ? 302 GLN A CD    1 
ATOM   2099 O  OE1   . GLN A 1 266 ? 93.162 23.096  91.805  1.00 42.06 ? 302 GLN A OE1   1 
ATOM   2100 N  NE2   . GLN A 1 266 ? 93.454 21.669  93.525  1.00 44.12 ? 302 GLN A NE2   1 
ATOM   2101 N  N     . GLU A 1 267 ? 90.265 22.265  88.012  1.00 27.94 ? 303 GLU A N     1 
ATOM   2102 C  CA    . GLU A 1 267 ? 89.959 22.987  86.786  1.00 32.91 ? 303 GLU A CA    1 
ATOM   2103 C  C     . GLU A 1 267 ? 88.771 23.919  86.977  1.00 37.26 ? 303 GLU A C     1 
ATOM   2104 O  O     . GLU A 1 267 ? 88.718 25.020  86.422  1.00 33.84 ? 303 GLU A O     1 
ATOM   2105 C  CB    . GLU A 1 267 ? 89.652 21.973  85.687  1.00 31.36 ? 303 GLU A CB    1 
ATOM   2106 C  CG    . GLU A 1 267 ? 89.215 22.556  84.357  1.00 35.83 ? 303 GLU A CG    1 
ATOM   2107 C  CD    . GLU A 1 267 ? 89.363 21.544  83.241  1.00 43.44 ? 303 GLU A CD    1 
ATOM   2108 O  OE1   . GLU A 1 267 ? 90.151 20.592  83.434  1.00 41.03 ? 303 GLU A OE1   1 
ATOM   2109 O  OE2   . GLU A 1 267 ? 88.699 21.688  82.188  1.00 46.54 ? 303 GLU A OE2   1 
ATOM   2110 N  N     . LYS A 1 268 ? 87.820 23.464  87.782  1.00 31.71 ? 304 LYS A N     1 
ATOM   2111 C  CA    . LYS A 1 268 ? 86.579 24.180  88.002  1.00 27.92 ? 304 LYS A CA    1 
ATOM   2112 C  C     . LYS A 1 268 ? 86.758 25.257  89.071  1.00 30.36 ? 304 LYS A C     1 
ATOM   2113 O  O     . LYS A 1 268 ? 86.021 26.245  89.099  1.00 33.49 ? 304 LYS A O     1 
ATOM   2114 C  CB    . LYS A 1 268 ? 85.494 23.170  88.405  1.00 27.58 ? 304 LYS A CB    1 
ATOM   2115 C  CG    . LYS A 1 268 ? 84.104 23.738  88.568  1.00 28.45 ? 304 LYS A CG    1 
ATOM   2116 C  CD    . LYS A 1 268 ? 83.491 24.211  87.248  1.00 25.46 ? 304 LYS A CD    1 
ATOM   2117 C  CE    . LYS A 1 268 ? 82.227 25.034  87.543  1.00 21.22 ? 304 LYS A CE    1 
ATOM   2118 N  NZ    . LYS A 1 268 ? 81.587 25.562  86.308  1.00 16.65 ? 304 LYS A NZ    1 
ATOM   2119 N  N     . GLY A 1 269 ? 87.750 25.081  89.944  1.00 26.18 ? 305 GLY A N     1 
ATOM   2120 C  CA    . GLY A 1 269 ? 87.991 26.047  90.999  1.00 29.74 ? 305 GLY A CA    1 
ATOM   2121 C  C     . GLY A 1 269 ? 87.054 25.818  92.166  1.00 30.12 ? 305 GLY A C     1 
ATOM   2122 O  O     . GLY A 1 269 ? 86.764 26.735  92.936  1.00 36.07 ? 305 GLY A O     1 
ATOM   2123 N  N     . TRP A 1 270 ? 86.586 24.579  92.288  1.00 28.74 ? 306 TRP A N     1 
ATOM   2124 C  CA    . TRP A 1 270 ? 85.670 24.168  93.346  1.00 29.99 ? 306 TRP A CA    1 
ATOM   2125 C  C     . TRP A 1 270 ? 86.379 23.279  94.369  1.00 31.46 ? 306 TRP A C     1 
ATOM   2126 O  O     . TRP A 1 270 ? 86.104 22.080  94.453  1.00 26.88 ? 306 TRP A O     1 
ATOM   2127 C  CB    . TRP A 1 270 ? 84.483 23.407  92.740  1.00 26.30 ? 306 TRP A CB    1 
ATOM   2128 C  CG    . TRP A 1 270 ? 83.443 24.307  92.119  1.00 27.42 ? 306 TRP A CG    1 
ATOM   2129 C  CD1   . TRP A 1 270 ? 83.481 25.672  92.039  1.00 25.07 ? 306 TRP A CD1   1 
ATOM   2130 C  CD2   . TRP A 1 270 ? 82.206 23.902  91.506  1.00 20.06 ? 306 TRP A CD2   1 
ATOM   2131 N  NE1   . TRP A 1 270 ? 82.346 26.141  91.411  1.00 23.12 ? 306 TRP A NE1   1 
ATOM   2132 C  CE2   . TRP A 1 270 ? 81.549 25.074  91.074  1.00 23.62 ? 306 TRP A CE2   1 
ATOM   2133 C  CE3   . TRP A 1 270 ? 81.595 22.660  91.278  1.00 20.01 ? 306 TRP A CE3   1 
ATOM   2134 C  CZ2   . TRP A 1 270 ? 80.305 25.043  90.424  1.00 23.33 ? 306 TRP A CZ2   1 
ATOM   2135 C  CZ3   . TRP A 1 270 ? 80.358 22.629  90.626  1.00 15.43 ? 306 TRP A CZ3   1 
ATOM   2136 C  CH2   . TRP A 1 270 ? 79.729 23.813  90.212  1.00 16.70 ? 306 TRP A CH2   1 
ATOM   2137 N  N     . THR A 1 271 ? 87.277 23.871  95.152  1.00 35.69 ? 307 THR A N     1 
ATOM   2138 C  CA    . THR A 1 271 ? 88.120 23.093  96.059  1.00 36.95 ? 307 THR A CA    1 
ATOM   2139 C  C     . THR A 1 271 ? 87.748 23.223  97.542  1.00 43.09 ? 307 THR A C     1 
ATOM   2140 O  O     . THR A 1 271 ? 87.402 22.228  98.186  1.00 47.13 ? 307 THR A O     1 
ATOM   2141 C  CB    . THR A 1 271 ? 89.629 23.375  95.832  1.00 38.64 ? 307 THR A CB    1 
ATOM   2142 O  OG1   . THR A 1 271 ? 89.833 24.762  95.538  1.00 35.92 ? 307 THR A OG1   1 
ATOM   2143 C  CG2   . THR A 1 271 ? 90.136 22.555  94.658  1.00 36.77 ? 307 THR A CG2   1 
ATOM   2144 N  N     . SER A 1 272 ? 87.817 24.436  98.082  1.00 37.44 ? 308 SER A N     1 
ATOM   2145 C  CA    . SER A 1 272 ? 87.471 24.660  99.493  1.00 45.18 ? 308 SER A CA    1 
ATOM   2146 C  C     . SER A 1 272 ? 85.959 24.734  99.735  1.00 45.38 ? 308 SER A C     1 
ATOM   2147 O  O     . SER A 1 272 ? 85.418 25.799  100.054 1.00 43.79 ? 308 SER A O     1 
ATOM   2148 C  CB    . SER A 1 272 ? 88.166 25.917  100.036 1.00 40.87 ? 308 SER A CB    1 
ATOM   2149 O  OG    . SER A 1 272 ? 88.346 26.883  99.014  1.00 41.69 ? 308 SER A OG    1 
ATOM   2150 N  N     . ARG A 1 287 ? 80.214 25.113  99.369  1.00 34.17 ? 323 ARG A N     1 
ATOM   2151 C  CA    . ARG A 1 287 ? 80.622 23.748  99.717  1.00 30.05 ? 323 ARG A CA    1 
ATOM   2152 C  C     . ARG A 1 287 ? 80.742 22.828  98.489  1.00 28.78 ? 323 ARG A C     1 
ATOM   2153 O  O     . ARG A 1 287 ? 79.853 22.795  97.635  1.00 23.67 ? 323 ARG A O     1 
ATOM   2154 C  CB    . ARG A 1 287 ? 79.658 23.146  100.741 1.00 34.20 ? 323 ARG A CB    1 
ATOM   2155 C  CG    . ARG A 1 287 ? 80.136 21.830  101.334 1.00 32.81 ? 323 ARG A CG    1 
ATOM   2156 C  CD    . ARG A 1 287 ? 79.813 21.746  102.824 1.00 41.11 ? 323 ARG A CD    1 
ATOM   2157 N  NE    . ARG A 1 287 ? 78.383 21.580  103.076 1.00 39.33 ? 323 ARG A NE    1 
ATOM   2158 C  CZ    . ARG A 1 287 ? 77.848 21.446  104.286 1.00 40.42 ? 323 ARG A CZ    1 
ATOM   2159 N  NH1   . ARG A 1 287 ? 78.628 21.455  105.359 1.00 45.76 ? 323 ARG A NH1   1 
ATOM   2160 N  NH2   . ARG A 1 287 ? 76.536 21.297  104.422 1.00 34.73 ? 323 ARG A NH2   1 
ATOM   2161 N  N     . TYR A 1 288 ? 81.839 22.078  98.410  1.00 24.08 ? 324 TYR A N     1 
ATOM   2162 C  CA    . TYR A 1 288 ? 82.107 21.266  97.235  1.00 22.86 ? 324 TYR A CA    1 
ATOM   2163 C  C     . TYR A 1 288 ? 82.536 19.846  97.587  1.00 23.93 ? 324 TYR A C     1 
ATOM   2164 O  O     . TYR A 1 288 ? 83.388 19.275  96.916  1.00 24.27 ? 324 TYR A O     1 
ATOM   2165 C  CB    . TYR A 1 288 ? 83.176 21.944  96.382  1.00 25.91 ? 324 TYR A CB    1 
ATOM   2166 C  CG    . TYR A 1 288 ? 82.829 23.372  96.030  1.00 25.74 ? 324 TYR A CG    1 
ATOM   2167 C  CD1   . TYR A 1 288 ? 81.886 23.656  95.049  1.00 24.26 ? 324 TYR A CD1   1 
ATOM   2168 C  CD2   . TYR A 1 288 ? 83.441 24.437  96.683  1.00 31.20 ? 324 TYR A CD2   1 
ATOM   2169 C  CE1   . TYR A 1 288 ? 81.561 24.970  94.725  1.00 26.27 ? 324 TYR A CE1   1 
ATOM   2170 C  CE2   . TYR A 1 288 ? 83.129 25.748  96.368  1.00 26.10 ? 324 TYR A CE2   1 
ATOM   2171 C  CZ    . TYR A 1 288 ? 82.189 26.010  95.390  1.00 28.32 ? 324 TYR A CZ    1 
ATOM   2172 O  OH    . TYR A 1 288 ? 81.883 27.315  95.068  1.00 28.11 ? 324 TYR A OH    1 
ATOM   2173 N  N     . ILE A 1 289 ? 81.944 19.279  98.635  1.00 22.70 ? 325 ILE A N     1 
ATOM   2174 C  CA    . ILE A 1 289 ? 82.273 17.906  99.031  1.00 21.66 ? 325 ILE A CA    1 
ATOM   2175 C  C     . ILE A 1 289 ? 81.799 16.943  97.935  1.00 20.35 ? 325 ILE A C     1 
ATOM   2176 O  O     . ILE A 1 289 ? 82.559 16.095  97.468  1.00 18.41 ? 325 ILE A O     1 
ATOM   2177 C  CB    . ILE A 1 289 ? 81.689 17.556  100.419 1.00 23.67 ? 325 ILE A CB    1 
ATOM   2178 C  CG1   . ILE A 1 289 ? 82.354 18.421  101.494 1.00 30.99 ? 325 ILE A CG1   1 
ATOM   2179 C  CG2   . ILE A 1 289 ? 81.909 16.083  100.753 1.00 25.25 ? 325 ILE A CG2   1 
ATOM   2180 C  CD1   . ILE A 1 289 ? 83.878 18.433  101.373 1.00 31.27 ? 325 ILE A CD1   1 
ATOM   2181 N  N     . LEU A 1 290 ? 80.556 17.109  97.498  1.00 19.37 ? 326 LEU A N     1 
ATOM   2182 C  CA    . LEU A 1 290 ? 80.095 16.471  96.261  1.00 15.41 ? 326 LEU A CA    1 
ATOM   2183 C  C     . LEU A 1 290 ? 79.874 17.595  95.249  1.00 13.80 ? 326 LEU A C     1 
ATOM   2184 O  O     . LEU A 1 290 ? 79.170 18.568  95.540  1.00 16.34 ? 326 LEU A O     1 
ATOM   2185 C  CB    . LEU A 1 290 ? 78.785 15.721  96.502  1.00 17.36 ? 326 LEU A CB    1 
ATOM   2186 C  CG    . LEU A 1 290 ? 78.226 14.887  95.337  1.00 12.23 ? 326 LEU A CG    1 
ATOM   2187 C  CD1   . LEU A 1 290 ? 79.202 13.774  94.924  1.00 15.22 ? 326 LEU A CD1   1 
ATOM   2188 C  CD2   . LEU A 1 290 ? 76.847 14.314  95.708  1.00 11.33 ? 326 LEU A CD2   1 
ATOM   2189 N  N     . ALA A 1 291 ? 80.502 17.486  94.085  1.00 12.92 ? 327 ALA A N     1 
ATOM   2190 C  CA    . ALA A 1 291 ? 80.444 18.548  93.075  1.00 14.96 ? 327 ALA A CA    1 
ATOM   2191 C  C     . ALA A 1 291 ? 79.582 18.123  91.886  1.00 12.22 ? 327 ALA A C     1 
ATOM   2192 O  O     . ALA A 1 291 ? 79.936 17.189  91.155  1.00 15.46 ? 327 ALA A O     1 
ATOM   2193 C  CB    . ALA A 1 291 ? 81.845 18.900  92.591  1.00 15.45 ? 327 ALA A CB    1 
ATOM   2194 N  N     . ILE A 1 292 ? 78.452 18.798  91.703  1.00 13.63 ? 328 ILE A N     1 
ATOM   2195 C  CA    . ILE A 1 292 ? 77.588 18.554  90.543  1.00 12.70 ? 328 ILE A CA    1 
ATOM   2196 C  C     . ILE A 1 292 ? 77.323 19.901  89.891  1.00 12.02 ? 328 ILE A C     1 
ATOM   2197 O  O     . ILE A 1 292 ? 76.599 20.745  90.437  1.00 12.55 ? 328 ILE A O     1 
ATOM   2198 C  CB    . ILE A 1 292 ? 76.231 17.897  90.953  1.00 12.55 ? 328 ILE A CB    1 
ATOM   2199 C  CG1   . ILE A 1 292 ? 76.456 16.521  91.612  1.00 9.68  ? 328 ILE A CG1   1 
ATOM   2200 C  CG2   . ILE A 1 292 ? 75.354 17.682  89.715  1.00 9.40  ? 328 ILE A CG2   1 
ATOM   2201 C  CD1   . ILE A 1 292 ? 75.290 16.034  92.531  1.00 11.05 ? 328 ILE A CD1   1 
ATOM   2202 N  N     . GLU A 1 293 ? 77.943 20.123  88.738  1.00 11.10 ? 329 GLU A N     1 
ATOM   2203 C  CA    . GLU A 1 293 ? 77.821 21.399  88.035  1.00 12.73 ? 329 GLU A CA    1 
ATOM   2204 C  C     . GLU A 1 293 ? 76.476 21.480  87.298  1.00 12.01 ? 329 GLU A C     1 
ATOM   2205 O  O     . GLU A 1 293 ? 76.207 20.668  86.410  1.00 15.34 ? 329 GLU A O     1 
ATOM   2206 C  CB    . GLU A 1 293 ? 78.961 21.515  87.018  1.00 12.21 ? 329 GLU A CB    1 
ATOM   2207 C  CG    . GLU A 1 293 ? 78.946 22.787  86.189  1.00 15.33 ? 329 GLU A CG    1 
ATOM   2208 C  CD    . GLU A 1 293 ? 79.909 22.714  85.025  1.00 19.17 ? 329 GLU A CD    1 
ATOM   2209 O  OE1   . GLU A 1 293 ? 80.819 23.566  84.955  1.00 21.23 ? 329 GLU A OE1   1 
ATOM   2210 O  OE2   . GLU A 1 293 ? 79.762 21.814  84.175  1.00 19.81 ? 329 GLU A OE2   1 
ATOM   2211 N  N     . ASP A 1 294 ? 75.622 22.431  87.665  1.00 10.24 ? 330 ASP A N     1 
ATOM   2212 C  CA    . ASP A 1 294 ? 74.346 22.582  86.952  1.00 10.71 ? 330 ASP A CA    1 
ATOM   2213 C  C     . ASP A 1 294 ? 74.618 22.780  85.468  1.00 12.23 ? 330 ASP A C     1 
ATOM   2214 O  O     . ASP A 1 294 ? 75.533 23.521  85.107  1.00 13.08 ? 330 ASP A O     1 
ATOM   2215 C  CB    . ASP A 1 294 ? 73.577 23.786  87.474  1.00 13.95 ? 330 ASP A CB    1 
ATOM   2216 C  CG    . ASP A 1 294 ? 72.173 23.887  86.876  1.00 19.42 ? 330 ASP A CG    1 
ATOM   2217 O  OD1   . ASP A 1 294 ? 71.253 23.239  87.434  1.00 15.68 ? 330 ASP A OD1   1 
ATOM   2218 O  OD2   . ASP A 1 294 ? 71.979 24.602  85.850  1.00 14.84 ? 330 ASP A OD2   1 
ATOM   2219 N  N     . PRO A 1 295 ? 73.840 22.116  84.595  1.00 13.42 ? 331 PRO A N     1 
ATOM   2220 C  CA    . PRO A 1 295 ? 74.180 22.166  83.164  1.00 12.56 ? 331 PRO A CA    1 
ATOM   2221 C  C     . PRO A 1 295 ? 74.082 23.569  82.564  1.00 13.61 ? 331 PRO A C     1 
ATOM   2222 O  O     . PRO A 1 295 ? 74.787 23.853  81.598  1.00 13.75 ? 331 PRO A O     1 
ATOM   2223 C  CB    . PRO A 1 295 ? 73.142 21.235  82.514  1.00 11.05 ? 331 PRO A CB    1 
ATOM   2224 C  CG    . PRO A 1 295 ? 72.013 21.132  83.523  1.00 11.40 ? 331 PRO A CG    1 
ATOM   2225 C  CD    . PRO A 1 295 ? 72.694 21.223  84.868  1.00 13.43 ? 331 PRO A CD    1 
ATOM   2226 N  N     . PHE A 1 296 ? 73.226 24.425  83.118  1.00 11.53 ? 332 PHE A N     1 
ATOM   2227 C  CA    . PHE A 1 296 ? 73.080 25.793  82.603  1.00 14.11 ? 332 PHE A CA    1 
ATOM   2228 C  C     . PHE A 1 296 ? 73.726 26.836  83.515  1.00 14.42 ? 332 PHE A C     1 
ATOM   2229 O  O     . PHE A 1 296 ? 74.575 27.613  83.075  1.00 13.44 ? 332 PHE A O     1 
ATOM   2230 C  CB    . PHE A 1 296 ? 71.604 26.127  82.383  1.00 12.20 ? 332 PHE A CB    1 
ATOM   2231 C  CG    . PHE A 1 296 ? 70.937 25.263  81.336  1.00 13.42 ? 332 PHE A CG    1 
ATOM   2232 C  CD1   . PHE A 1 296 ? 71.651 24.797  80.241  1.00 13.04 ? 332 PHE A CD1   1 
ATOM   2233 C  CD2   . PHE A 1 296 ? 69.593 24.917  81.454  1.00 13.03 ? 332 PHE A CD2   1 
ATOM   2234 C  CE1   . PHE A 1 296 ? 71.036 24.002  79.269  1.00 13.17 ? 332 PHE A CE1   1 
ATOM   2235 C  CE2   . PHE A 1 296 ? 68.970 24.127  80.484  1.00 13.53 ? 332 PHE A CE2   1 
ATOM   2236 C  CZ    . PHE A 1 296 ? 69.695 23.669  79.389  1.00 12.80 ? 332 PHE A CZ    1 
ATOM   2237 N  N     . GLU A 1 297 ? 73.339 26.846  84.787  1.00 12.53 ? 333 GLU A N     1 
ATOM   2238 C  CA    . GLU A 1 297 ? 73.923 27.791  85.737  1.00 15.33 ? 333 GLU A CA    1 
ATOM   2239 C  C     . GLU A 1 297 ? 75.227 27.187  86.255  1.00 14.32 ? 333 GLU A C     1 
ATOM   2240 O  O     . GLU A 1 297 ? 75.291 26.672  87.379  1.00 13.21 ? 333 GLU A O     1 
ATOM   2241 C  CB    . GLU A 1 297 ? 72.968 28.077  86.899  1.00 17.63 ? 333 GLU A CB    1 
ATOM   2242 C  CG    . GLU A 1 297 ? 73.450 29.211  87.804  1.00 14.98 ? 333 GLU A CG    1 
ATOM   2243 C  CD    . GLU A 1 297 ? 72.543 29.466  88.990  1.00 22.35 ? 333 GLU A CD    1 
ATOM   2244 O  OE1   . GLU A 1 297 ? 71.442 28.864  89.078  1.00 20.47 ? 333 GLU A OE1   1 
ATOM   2245 O  OE2   . GLU A 1 297 ? 72.942 30.281  89.848  1.00 22.02 ? 333 GLU A OE2   1 
ATOM   2246 N  N     . ILE A 1 298 ? 76.272 27.252  85.437  1.00 11.22 ? 334 ILE A N     1 
ATOM   2247 C  CA    . ILE A 1 298 ? 77.474 26.455  85.709  1.00 13.76 ? 334 ILE A CA    1 
ATOM   2248 C  C     . ILE A 1 298 ? 78.259 26.885  86.952  1.00 16.91 ? 334 ILE A C     1 
ATOM   2249 O  O     . ILE A 1 298 ? 79.142 26.169  87.424  1.00 18.18 ? 334 ILE A O     1 
ATOM   2250 C  CB    . ILE A 1 298 ? 78.408 26.387  84.489  1.00 17.84 ? 334 ILE A CB    1 
ATOM   2251 C  CG1   . ILE A 1 298 ? 78.921 27.765  84.104  1.00 18.68 ? 334 ILE A CG1   1 
ATOM   2252 C  CG2   . ILE A 1 298 ? 77.698 25.742  83.292  1.00 20.16 ? 334 ILE A CG2   1 
ATOM   2253 C  CD1   . ILE A 1 298 ? 80.001 27.681  83.057  1.00 19.04 ? 334 ILE A CD1   1 
ATOM   2254 N  N     . SER A 1 299 ? 77.929 28.050  87.488  1.00 16.00 ? 335 SER A N     1 
ATOM   2255 C  CA    . SER A 1 299 ? 78.598 28.534  88.687  1.00 22.64 ? 335 SER A CA    1 
ATOM   2256 C  C     . SER A 1 299 ? 77.923 27.986  89.941  1.00 22.92 ? 335 SER A C     1 
ATOM   2257 O  O     . SER A 1 299 ? 78.381 28.233  91.066  1.00 16.16 ? 335 SER A O     1 
ATOM   2258 C  CB    . SER A 1 299 ? 78.620 30.060  88.703  1.00 21.01 ? 335 SER A CB    1 
ATOM   2259 O  OG    . SER A 1 299 ? 77.318 30.587  88.523  1.00 19.60 ? 335 SER A OG    1 
ATOM   2260 N  N     . HIS A 1 300 ? 76.842 27.228  89.747  1.00 17.12 ? 336 HIS A N     1 
ATOM   2261 C  CA    . HIS A 1 300 ? 76.087 26.666  90.867  1.00 18.35 ? 336 HIS A CA    1 
ATOM   2262 C  C     . HIS A 1 300 ? 76.433 25.193  91.058  1.00 16.34 ? 336 HIS A C     1 
ATOM   2263 O  O     . HIS A 1 300 ? 76.309 24.400  90.127  1.00 16.46 ? 336 HIS A O     1 
ATOM   2264 C  CB    . HIS A 1 300 ? 74.571 26.831  90.640  1.00 13.71 ? 336 HIS A CB    1 
ATOM   2265 C  CG    . HIS A 1 300 ? 73.726 26.174  91.690  1.00 18.87 ? 336 HIS A CG    1 
ATOM   2266 N  ND1   . HIS A 1 300 ? 73.941 26.354  93.037  1.00 23.21 ? 336 HIS A ND1   1 
ATOM   2267 C  CD2   . HIS A 1 300 ? 72.668 25.333  91.585  1.00 16.24 ? 336 HIS A CD2   1 
ATOM   2268 C  CE1   . HIS A 1 300 ? 73.050 25.651  93.723  1.00 22.35 ? 336 HIS A CE1   1 
ATOM   2269 N  NE2   . HIS A 1 300 ? 72.265 25.028  92.864  1.00 22.60 ? 336 HIS A NE2   1 
ATOM   2270 N  N     . ASN A 1 301 ? 76.874 24.827  92.262  1.00 15.67 ? 337 ASN A N     1 
ATOM   2271 C  CA    . ASN A 1 301 ? 77.070 23.420  92.600  1.00 14.22 ? 337 ASN A CA    1 
ATOM   2272 C  C     . ASN A 1 301 ? 75.790 22.883  93.217  1.00 13.89 ? 337 ASN A C     1 
ATOM   2273 O  O     . ASN A 1 301 ? 75.447 23.226  94.355  1.00 13.78 ? 337 ASN A O     1 
ATOM   2274 C  CB    . ASN A 1 301 ? 78.221 23.253  93.591  1.00 16.38 ? 337 ASN A CB    1 
ATOM   2275 C  CG    . ASN A 1 301 ? 78.371 21.823  94.075  1.00 15.67 ? 337 ASN A CG    1 
ATOM   2276 O  OD1   . ASN A 1 301 ? 77.984 20.869  93.386  1.00 14.70 ? 337 ASN A OD1   1 
ATOM   2277 N  ND2   . ASN A 1 301 ? 78.947 21.659  95.269  1.00 16.66 ? 337 ASN A ND2   1 
ATOM   2278 N  N     . VAL A 1 302 ? 75.082 22.039  92.466  1.00 15.87 ? 338 VAL A N     1 
ATOM   2279 C  CA    . VAL A 1 302 ? 73.819 21.470  92.928  1.00 11.34 ? 338 VAL A CA    1 
ATOM   2280 C  C     . VAL A 1 302 ? 74.038 20.662  94.212  1.00 13.88 ? 338 VAL A C     1 
ATOM   2281 O  O     . VAL A 1 302 ? 73.139 20.533  95.047  1.00 13.56 ? 338 VAL A O     1 
ATOM   2282 C  CB    . VAL A 1 302 ? 73.167 20.601  91.812  1.00 14.12 ? 338 VAL A CB    1 
ATOM   2283 C  CG1   . VAL A 1 302 ? 71.834 19.988  92.280  1.00 12.65 ? 338 VAL A CG1   1 
ATOM   2284 C  CG2   . VAL A 1 302 ? 72.940 21.456  90.538  1.00 12.47 ? 338 VAL A CG2   1 
ATOM   2285 N  N     . GLY A 1 303 ? 75.240 20.118  94.376  1.00 11.79 ? 339 GLY A N     1 
ATOM   2286 C  CA    . GLY A 1 303 ? 75.554 19.360  95.573  1.00 12.70 ? 339 GLY A CA    1 
ATOM   2287 C  C     . GLY A 1 303 ? 76.150 20.202  96.697  1.00 15.35 ? 339 GLY A C     1 
ATOM   2288 O  O     . GLY A 1 303 ? 76.755 19.665  97.633  1.00 19.80 ? 339 GLY A O     1 
ATOM   2289 N  N     . ARG A 1 304 ? 75.978 21.514  96.621  1.00 13.30 ? 340 ARG A N     1 
ATOM   2290 C  CA    . ARG A 1 304 ? 76.489 22.410  97.670  1.00 21.16 ? 340 ARG A CA    1 
ATOM   2291 C  C     . ARG A 1 304 ? 75.976 22.082  99.088  1.00 23.52 ? 340 ARG A C     1 
ATOM   2292 O  O     . ARG A 1 304 ? 76.585 22.479  100.089 1.00 24.35 ? 340 ARG A O     1 
ATOM   2293 C  CB    . ARG A 1 304 ? 76.169 23.871  97.329  1.00 20.26 ? 340 ARG A CB    1 
ATOM   2294 C  CG    . ARG A 1 304 ? 74.669 24.159  97.266  1.00 21.41 ? 340 ARG A CG    1 
ATOM   2295 C  CD    . ARG A 1 304 ? 74.376 25.648  97.077  1.00 30.89 ? 340 ARG A CD    1 
ATOM   2296 N  NE    . ARG A 1 304 ? 74.669 26.414  98.287  1.00 38.05 ? 340 ARG A NE    1 
ATOM   2297 C  CZ    . ARG A 1 304 ? 73.866 26.483  99.349  1.00 43.44 ? 340 ARG A CZ    1 
ATOM   2298 N  NH1   . ARG A 1 304 ? 72.705 25.829  99.367  1.00 37.88 ? 340 ARG A NH1   1 
ATOM   2299 N  NH2   . ARG A 1 304 ? 74.229 27.205  100.402 1.00 38.52 ? 340 ARG A NH2   1 
ATOM   2300 N  N     . THR A 1 305 ? 74.863 21.360  99.174  1.00 21.38 ? 341 THR A N     1 
ATOM   2301 C  CA    . THR A 1 305 ? 74.246 21.068  100.464 1.00 22.72 ? 341 THR A CA    1 
ATOM   2302 C  C     . THR A 1 305 ? 74.884 19.857  101.134 1.00 26.07 ? 341 THR A C     1 
ATOM   2303 O  O     . THR A 1 305 ? 74.601 19.574  102.301 1.00 27.08 ? 341 THR A O     1 
ATOM   2304 C  CB    . THR A 1 305 ? 72.737 20.796  100.316 1.00 21.63 ? 341 THR A CB    1 
ATOM   2305 O  OG1   . THR A 1 305 ? 72.545 19.712  99.389  1.00 20.15 ? 341 THR A OG1   1 
ATOM   2306 C  CG2   . THR A 1 305 ? 72.006 22.037  99.810  1.00 23.41 ? 341 THR A CG2   1 
ATOM   2307 N  N     . VAL A 1 306 ? 75.741 19.142  100.405 1.00 20.27 ? 342 VAL A N     1 
ATOM   2308 C  CA    . VAL A 1 306 ? 76.247 17.855  100.890 1.00 22.87 ? 342 VAL A CA    1 
ATOM   2309 C  C     . VAL A 1 306 ? 77.439 18.021  101.845 1.00 26.39 ? 342 VAL A C     1 
ATOM   2310 O  O     . VAL A 1 306 ? 78.463 18.605  101.486 1.00 25.06 ? 342 VAL A O     1 
ATOM   2311 C  CB    . VAL A 1 306 ? 76.614 16.917  99.720  1.00 21.64 ? 342 VAL A CB    1 
ATOM   2312 C  CG1   . VAL A 1 306 ? 77.229 15.606  100.230 1.00 20.12 ? 342 VAL A CG1   1 
ATOM   2313 C  CG2   . VAL A 1 306 ? 75.363 16.639  98.862  1.00 14.15 ? 342 VAL A CG2   1 
ATOM   2314 N  N     . SER A 1 307 ? 77.294 17.501  103.062 1.00 25.04 ? 343 SER A N     1 
ATOM   2315 C  CA    . SER A 1 307 ? 78.360 17.575  104.060 1.00 29.45 ? 343 SER A CA    1 
ATOM   2316 C  C     . SER A 1 307 ? 79.296 16.367  103.980 1.00 31.76 ? 343 SER A C     1 
ATOM   2317 O  O     . SER A 1 307 ? 79.060 15.431  103.205 1.00 25.81 ? 343 SER A O     1 
ATOM   2318 C  CB    . SER A 1 307 ? 77.762 17.688  105.460 1.00 29.79 ? 343 SER A CB    1 
ATOM   2319 O  OG    . SER A 1 307 ? 76.964 16.558  105.765 1.00 25.48 ? 343 SER A OG    1 
ATOM   2320 N  N     . SER A 1 308 ? 80.369 16.393  104.765 1.00 25.03 ? 344 SER A N     1 
ATOM   2321 C  CA    . SER A 1 308 ? 81.294 15.263  104.811 1.00 29.37 ? 344 SER A CA    1 
ATOM   2322 C  C     . SER A 1 308 ? 80.592 13.991  105.303 1.00 28.02 ? 344 SER A C     1 
ATOM   2323 O  O     . SER A 1 308 ? 80.845 12.894  104.793 1.00 29.79 ? 344 SER A O     1 
ATOM   2324 C  CB    . SER A 1 308 ? 82.487 15.591  105.712 1.00 32.92 ? 344 SER A CB    1 
ATOM   2325 O  OG    . SER A 1 308 ? 82.044 16.106  106.957 1.00 35.50 ? 344 SER A OG    1 
ATOM   2326 N  N     . SER A 1 309 ? 79.712 14.145  106.289 1.00 26.61 ? 345 SER A N     1 
ATOM   2327 C  CA    . SER A 1 309 ? 78.969 13.008  106.834 1.00 31.13 ? 345 SER A CA    1 
ATOM   2328 C  C     . SER A 1 309 ? 77.880 12.540  105.864 1.00 28.85 ? 345 SER A C     1 
ATOM   2329 O  O     . SER A 1 309 ? 77.644 11.334  105.713 1.00 26.09 ? 345 SER A O     1 
ATOM   2330 C  CB    . SER A 1 309 ? 78.358 13.356  108.193 1.00 31.19 ? 345 SER A CB    1 
ATOM   2331 O  OG    . SER A 1 309 ? 77.544 14.515  108.118 1.00 38.21 ? 345 SER A OG    1 
ATOM   2332 N  N     . GLY A 1 310 ? 77.224 13.502  105.218 1.00 25.89 ? 346 GLY A N     1 
ATOM   2333 C  CA    . GLY A 1 310 ? 76.229 13.215  104.199 1.00 20.06 ? 346 GLY A CA    1 
ATOM   2334 C  C     . GLY A 1 310 ? 76.796 12.410  103.044 1.00 22.24 ? 346 GLY A C     1 
ATOM   2335 O  O     . GLY A 1 310 ? 76.164 11.454  102.597 1.00 24.07 ? 346 GLY A O     1 
ATOM   2336 N  N     . LEU A 1 311 ? 77.981 12.777  102.557 1.00 19.96 ? 347 LEU A N     1 
ATOM   2337 C  CA    . LEU A 1 311 ? 78.603 12.030  101.459 1.00 22.75 ? 347 LEU A CA    1 
ATOM   2338 C  C     . LEU A 1 311 ? 78.966 10.599  101.864 1.00 24.06 ? 347 LEU A C     1 
ATOM   2339 O  O     . LEU A 1 311 ? 78.772 9.660   101.096 1.00 21.24 ? 347 LEU A O     1 
ATOM   2340 C  CB    . LEU A 1 311 ? 79.836 12.757  100.905 1.00 21.66 ? 347 LEU A CB    1 
ATOM   2341 C  CG    . LEU A 1 311 ? 80.602 11.989  99.815  1.00 23.49 ? 347 LEU A CG    1 
ATOM   2342 C  CD1   . LEU A 1 311 ? 79.713 11.667  98.601  1.00 19.66 ? 347 LEU A CD1   1 
ATOM   2343 C  CD2   . LEU A 1 311 ? 81.878 12.703  99.359  1.00 25.20 ? 347 LEU A CD2   1 
ATOM   2344 N  N     . TYR A 1 312 ? 79.497 10.432  103.073 1.00 27.95 ? 348 TYR A N     1 
ATOM   2345 C  CA    . TYR A 1 312 ? 79.900 9.110   103.544 1.00 25.53 ? 348 TYR A CA    1 
ATOM   2346 C  C     . TYR A 1 312 ? 78.678 8.197   103.607 1.00 23.96 ? 348 TYR A C     1 
ATOM   2347 O  O     . TYR A 1 312 ? 78.762 7.017   103.269 1.00 23.85 ? 348 TYR A O     1 
ATOM   2348 C  CB    . TYR A 1 312 ? 80.591 9.220   104.912 1.00 30.82 ? 348 TYR A CB    1 
ATOM   2349 C  CG    . TYR A 1 312 ? 81.102 7.913   105.506 1.00 29.68 ? 348 TYR A CG    1 
ATOM   2350 C  CD1   . TYR A 1 312 ? 80.343 7.205   106.434 1.00 34.20 ? 348 TYR A CD1   1 
ATOM   2351 C  CD2   . TYR A 1 312 ? 82.348 7.406   105.164 1.00 30.41 ? 348 TYR A CD2   1 
ATOM   2352 C  CE1   . TYR A 1 312 ? 80.805 6.016   106.991 1.00 34.00 ? 348 TYR A CE1   1 
ATOM   2353 C  CE2   . TYR A 1 312 ? 82.821 6.217   105.719 1.00 38.38 ? 348 TYR A CE2   1 
ATOM   2354 C  CZ    . TYR A 1 312 ? 82.046 5.531   106.633 1.00 38.11 ? 348 TYR A CZ    1 
ATOM   2355 O  OH    . TYR A 1 312 ? 82.514 4.355   107.185 1.00 36.37 ? 348 TYR A OH    1 
ATOM   2356 N  N     . ARG A 1 313 ? 77.541 8.760   104.018 1.00 21.39 ? 349 ARG A N     1 
ATOM   2357 C  CA    . ARG A 1 313 ? 76.287 8.018   104.081 1.00 23.26 ? 349 ARG A CA    1 
ATOM   2358 C  C     . ARG A 1 313 ? 75.744 7.764   102.678 1.00 22.56 ? 349 ARG A C     1 
ATOM   2359 O  O     . ARG A 1 313 ? 75.227 6.685   102.405 1.00 21.68 ? 349 ARG A O     1 
ATOM   2360 C  CB    . ARG A 1 313 ? 75.238 8.779   104.894 1.00 28.62 ? 349 ARG A CB    1 
ATOM   2361 C  CG    . ARG A 1 313 ? 75.554 8.924   106.382 1.00 32.02 ? 349 ARG A CG    1 
ATOM   2362 C  CD    . ARG A 1 313 ? 74.387 9.581   107.125 1.00 34.20 ? 349 ARG A CD    1 
ATOM   2363 N  NE    . ARG A 1 313 ? 73.151 8.826   106.935 1.00 48.56 ? 349 ARG A NE    1 
ATOM   2364 C  CZ    . ARG A 1 313 ? 72.069 9.303   106.327 1.00 45.07 ? 349 ARG A CZ    1 
ATOM   2365 N  NH1   . ARG A 1 313 ? 72.064 10.548  105.870 1.00 36.71 ? 349 ARG A NH1   1 
ATOM   2366 N  NH2   . ARG A 1 313 ? 70.991 8.536   106.184 1.00 42.60 ? 349 ARG A NH2   1 
ATOM   2367 N  N     . ILE A 1 314 ? 75.857 8.759   101.798 1.00 19.49 ? 350 ILE A N     1 
ATOM   2368 C  CA    . ILE A 1 314 ? 75.461 8.581   100.392 1.00 17.87 ? 350 ILE A CA    1 
ATOM   2369 C  C     . ILE A 1 314 ? 76.288 7.481   99.737  1.00 18.19 ? 350 ILE A C     1 
ATOM   2370 O  O     . ILE A 1 314 ? 75.737 6.551   99.137  1.00 16.51 ? 350 ILE A O     1 
ATOM   2371 C  CB    . ILE A 1 314 ? 75.571 9.908   99.582  1.00 16.86 ? 350 ILE A CB    1 
ATOM   2372 C  CG1   . ILE A 1 314 ? 74.425 10.842  99.968  1.00 15.51 ? 350 ILE A CG1   1 
ATOM   2373 C  CG2   . ILE A 1 314 ? 75.556 9.624   98.063  1.00 14.50 ? 350 ILE A CG2   1 
ATOM   2374 C  CD1   . ILE A 1 314 ? 74.603 12.303  99.527  1.00 15.71 ? 350 ILE A CD1   1 
ATOM   2375 N  N     . ARG A 1 315 ? 77.609 7.564   99.857  1.00 16.47 ? 351 ARG A N     1 
ATOM   2376 C  CA    . ARG A 1 315 ? 78.469 6.517   99.329  1.00 17.23 ? 351 ARG A CA    1 
ATOM   2377 C  C     . ARG A 1 315 ? 78.157 5.145   99.931  1.00 17.62 ? 351 ARG A C     1 
ATOM   2378 O  O     . ARG A 1 315 ? 78.210 4.131   99.229  1.00 18.53 ? 351 ARG A O     1 
ATOM   2379 C  CB    . ARG A 1 315 ? 79.944 6.863   99.550  1.00 25.04 ? 351 ARG A CB    1 
ATOM   2380 C  CG    . ARG A 1 315 ? 80.473 7.977   98.638  1.00 25.90 ? 351 ARG A CG    1 
ATOM   2381 C  CD    . ARG A 1 315 ? 80.895 7.447   97.278  1.00 29.49 ? 351 ARG A CD    1 
ATOM   2382 N  NE    . ARG A 1 315 ? 82.288 7.004   97.270  1.00 32.31 ? 351 ARG A NE    1 
ATOM   2383 C  CZ    . ARG A 1 315 ? 82.963 6.666   96.175  1.00 31.98 ? 351 ARG A CZ    1 
ATOM   2384 N  NH1   . ARG A 1 315 ? 84.227 6.285   96.268  1.00 33.86 ? 351 ARG A NH1   1 
ATOM   2385 N  NH2   . ARG A 1 315 ? 82.382 6.715   94.981  1.00 25.91 ? 351 ARG A NH2   1 
ATOM   2386 N  N     . GLY A 1 316 ? 77.840 5.107   101.225 1.00 21.84 ? 352 GLY A N     1 
ATOM   2387 C  CA    . GLY A 1 316 ? 77.570 3.843   101.894 1.00 18.67 ? 352 GLY A CA    1 
ATOM   2388 C  C     . GLY A 1 316 ? 76.336 3.168   101.316 1.00 18.95 ? 352 GLY A C     1 
ATOM   2389 O  O     . GLY A 1 316 ? 76.301 1.947   101.120 1.00 16.59 ? 352 GLY A O     1 
ATOM   2390 N  N     . GLU A 1 317 ? 75.316 3.968   101.041 1.00 13.01 ? 353 GLU A N     1 
ATOM   2391 C  CA    . GLU A 1 317 ? 74.097 3.454   100.429 1.00 16.04 ? 353 GLU A CA    1 
ATOM   2392 C  C     . GLU A 1 317 ? 74.294 2.981   98.991  1.00 18.00 ? 353 GLU A C     1 
ATOM   2393 O  O     . GLU A 1 317 ? 73.684 1.987   98.592  1.00 15.48 ? 353 GLU A O     1 
ATOM   2394 C  CB    . GLU A 1 317 ? 72.960 4.477   100.503 1.00 13.01 ? 353 GLU A CB    1 
ATOM   2395 C  CG    . GLU A 1 317 ? 72.454 4.771   101.908 1.00 18.04 ? 353 GLU A CG    1 
ATOM   2396 C  CD    . GLU A 1 317 ? 71.923 3.536   102.633 1.00 21.91 ? 353 GLU A CD    1 
ATOM   2397 O  OE1   . GLU A 1 317 ? 71.517 2.548   101.980 1.00 19.84 ? 353 GLU A OE1   1 
ATOM   2398 O  OE2   . GLU A 1 317 ? 71.908 3.560   103.881 1.00 27.56 ? 353 GLU A OE2   1 
ATOM   2399 N  N     . PHE A 1 318 ? 75.125 3.675   98.214  1.00 15.39 ? 354 PHE A N     1 
ATOM   2400 C  CA    . PHE A 1 318 ? 75.438 3.213   96.858  1.00 14.12 ? 354 PHE A CA    1 
ATOM   2401 C  C     . PHE A 1 318 ? 76.115 1.849   96.891  1.00 15.29 ? 354 PHE A C     1 
ATOM   2402 O  O     . PHE A 1 318 ? 75.826 0.985   96.069  1.00 13.91 ? 354 PHE A O     1 
ATOM   2403 C  CB    . PHE A 1 318 ? 76.322 4.220   96.114  1.00 13.50 ? 354 PHE A CB    1 
ATOM   2404 C  CG    . PHE A 1 318 ? 75.541 5.296   95.373  1.00 13.60 ? 354 PHE A CG    1 
ATOM   2405 C  CD1   . PHE A 1 318 ? 74.800 4.974   94.234  1.00 8.80  ? 354 PHE A CD1   1 
ATOM   2406 C  CD2   . PHE A 1 318 ? 75.559 6.613   95.801  1.00 11.38 ? 354 PHE A CD2   1 
ATOM   2407 C  CE1   . PHE A 1 318 ? 74.094 5.961   93.535  1.00 9.49  ? 354 PHE A CE1   1 
ATOM   2408 C  CE2   . PHE A 1 318 ? 74.845 7.611   95.118  1.00 12.48 ? 354 PHE A CE2   1 
ATOM   2409 C  CZ    . PHE A 1 318 ? 74.111 7.279   93.983  1.00 10.29 ? 354 PHE A CZ    1 
ATOM   2410 N  N     . MET A 1 319 ? 77.033 1.659   97.837  1.00 17.57 ? 355 MET A N     1 
ATOM   2411 C  CA    . MET A 1 319 ? 77.702 0.365   97.978  1.00 18.34 ? 355 MET A CA    1 
ATOM   2412 C  C     . MET A 1 319 ? 76.716 -0.722  98.411  1.00 16.70 ? 355 MET A C     1 
ATOM   2413 O  O     . MET A 1 319 ? 76.774 -1.839  97.914  1.00 16.98 ? 355 MET A O     1 
ATOM   2414 C  CB    . MET A 1 319 ? 78.865 0.456   98.981  1.00 19.51 ? 355 MET A CB    1 
ATOM   2415 C  CG    . MET A 1 319 ? 80.030 1.334   98.525  1.00 27.99 ? 355 MET A CG    1 
ATOM   2416 S  SD    . MET A 1 319 ? 81.242 1.568   99.854  1.00 52.31 ? 355 MET A SD    1 
ATOM   2417 C  CE    . MET A 1 319 ? 82.487 2.567   99.040  1.00 46.53 ? 355 MET A CE    1 
ATOM   2418 N  N     . ALA A 1 320 ? 75.824 -0.394  99.345  1.00 16.67 ? 356 ALA A N     1 
ATOM   2419 C  CA    . ALA A 1 320 ? 74.838 -1.363  99.828  1.00 19.57 ? 356 ALA A CA    1 
ATOM   2420 C  C     . ALA A 1 320 ? 73.904 -1.791  98.696  1.00 19.66 ? 356 ALA A C     1 
ATOM   2421 O  O     . ALA A 1 320 ? 73.552 -2.967  98.583  1.00 14.68 ? 356 ALA A O     1 
ATOM   2422 C  CB    . ALA A 1 320 ? 74.037 -0.790  100.988 1.00 18.55 ? 356 ALA A CB    1 
ATOM   2423 N  N     . ALA A 1 321 ? 73.508 -0.830  97.861  1.00 14.18 ? 357 ALA A N     1 
ATOM   2424 C  CA    . ALA A 1 321 ? 72.642 -1.115  96.716  1.00 14.23 ? 357 ALA A CA    1 
ATOM   2425 C  C     . ALA A 1 321 ? 73.369 -2.019  95.730  1.00 13.84 ? 357 ALA A C     1 
ATOM   2426 O  O     . ALA A 1 321 ? 72.798 -2.986  95.189  1.00 12.76 ? 357 ALA A O     1 
ATOM   2427 C  CB    . ALA A 1 321 ? 72.213 0.202   96.039  1.00 13.20 ? 357 ALA A CB    1 
ATOM   2428 N  N     . SER A 1 322 ? 74.634 -1.708  95.484  1.00 13.32 ? 358 SER A N     1 
ATOM   2429 C  CA    . SER A 1 322 ? 75.426 -2.504  94.558  1.00 14.06 ? 358 SER A CA    1 
ATOM   2430 C  C     . SER A 1 322 ? 75.632 -3.913  95.094  1.00 18.10 ? 358 SER A C     1 
ATOM   2431 O  O     . SER A 1 322 ? 75.505 -4.885  94.349  1.00 15.77 ? 358 SER A O     1 
ATOM   2432 C  CB    . SER A 1 322 ? 76.775 -1.844  94.298  1.00 15.83 ? 358 SER A CB    1 
ATOM   2433 O  OG    . SER A 1 322 ? 76.586 -0.570  93.726  1.00 15.60 ? 358 SER A OG    1 
ATOM   2434 N  N     . ARG A 1 323 ? 75.943 -4.025  96.383  1.00 16.44 ? 359 ARG A N     1 
ATOM   2435 C  CA    . ARG A 1 323 ? 76.178 -5.347  96.976  1.00 18.68 ? 359 ARG A CA    1 
ATOM   2436 C  C     . ARG A 1 323 ? 74.927 -6.212  96.888  1.00 15.92 ? 359 ARG A C     1 
ATOM   2437 O  O     . ARG A 1 323 ? 75.005 -7.400  96.572  1.00 19.71 ? 359 ARG A O     1 
ATOM   2438 C  CB    . ARG A 1 323 ? 76.633 -5.233  98.438  1.00 24.25 ? 359 ARG A CB    1 
ATOM   2439 C  CG    . ARG A 1 323 ? 78.042 -4.660  98.631  1.00 29.82 ? 359 ARG A CG    1 
ATOM   2440 C  CD    . ARG A 1 323 ? 78.573 -4.931  100.049 1.00 32.36 ? 359 ARG A CD    1 
ATOM   2441 N  NE    . ARG A 1 323 ? 77.640 -4.509  101.094 1.00 40.97 ? 359 ARG A NE    1 
ATOM   2442 C  CZ    . ARG A 1 323 ? 77.708 -3.347  101.744 1.00 39.37 ? 359 ARG A CZ    1 
ATOM   2443 N  NH1   . ARG A 1 323 ? 78.670 -2.475  101.465 1.00 42.74 ? 359 ARG A NH1   1 
ATOM   2444 N  NH2   . ARG A 1 323 ? 76.812 -3.052  102.676 1.00 35.82 ? 359 ARG A NH2   1 
ATOM   2445 N  N     . LEU A 1 324 ? 73.776 -5.613  97.161  1.00 16.08 ? 360 LEU A N     1 
ATOM   2446 C  CA    . LEU A 1 324 ? 72.510 -6.339  97.050  1.00 18.42 ? 360 LEU A CA    1 
ATOM   2447 C  C     . LEU A 1 324 ? 72.349 -6.920  95.655  1.00 17.65 ? 360 LEU A C     1 
ATOM   2448 O  O     . LEU A 1 324 ? 72.077 -8.112  95.492  1.00 14.47 ? 360 LEU A O     1 
ATOM   2449 C  CB    . LEU A 1 324 ? 71.331 -5.421  97.378  1.00 18.62 ? 360 LEU A CB    1 
ATOM   2450 C  CG    . LEU A 1 324 ? 69.930 -6.003  97.153  1.00 19.84 ? 360 LEU A CG    1 
ATOM   2451 C  CD1   . LEU A 1 324 ? 69.597 -7.062  98.200  1.00 19.07 ? 360 LEU A CD1   1 
ATOM   2452 C  CD2   . LEU A 1 324 ? 68.880 -4.900  97.156  1.00 22.22 ? 360 LEU A CD2   1 
ATOM   2453 N  N     . LEU A 1 325 ? 72.549 -6.082  94.643  1.00 12.31 ? 361 LEU A N     1 
ATOM   2454 C  CA    . LEU A 1 325 ? 72.292 -6.485  93.261  1.00 16.65 ? 361 LEU A CA    1 
ATOM   2455 C  C     . LEU A 1 325 ? 73.380 -7.379  92.673  1.00 20.27 ? 361 LEU A C     1 
ATOM   2456 O  O     . LEU A 1 325 ? 73.170 -8.020  91.638  1.00 20.72 ? 361 LEU A O     1 
ATOM   2457 C  CB    . LEU A 1 325 ? 72.085 -5.257  92.376  1.00 14.25 ? 361 LEU A CB    1 
ATOM   2458 C  CG    . LEU A 1 325 ? 70.911 -4.367  92.771  1.00 15.22 ? 361 LEU A CG    1 
ATOM   2459 C  CD1   . LEU A 1 325 ? 70.853 -3.148  91.866  1.00 14.92 ? 361 LEU A CD1   1 
ATOM   2460 C  CD2   . LEU A 1 325 ? 69.611 -5.165  92.696  1.00 18.09 ? 361 LEU A CD2   1 
ATOM   2461 N  N     . ASN A 1 326 ? 74.541 -7.426  93.320  1.00 19.65 ? 362 ASN A N     1 
ATOM   2462 C  CA    . ASN A 1 326 ? 75.601 -8.318  92.854  1.00 22.08 ? 362 ASN A CA    1 
ATOM   2463 C  C     . ASN A 1 326 ? 75.586 -9.697  93.499  1.00 28.84 ? 362 ASN A C     1 
ATOM   2464 O  O     . ASN A 1 326 ? 76.432 -10.543 93.193  1.00 31.07 ? 362 ASN A O     1 
ATOM   2465 C  CB    . ASN A 1 326 ? 76.967 -7.665  93.007  1.00 23.88 ? 362 ASN A CB    1 
ATOM   2466 C  CG    . ASN A 1 326 ? 77.282 -6.725  91.850  1.00 29.47 ? 362 ASN A CG    1 
ATOM   2467 O  OD1   . ASN A 1 326 ? 77.308 -5.505  92.013  1.00 21.66 ? 362 ASN A OD1   1 
ATOM   2468 N  ND2   . ASN A 1 326 ? 77.500 -7.297  90.663  1.00 32.85 ? 362 ASN A ND2   1 
ATOM   2469 N  N     . SER A 1 327 ? 74.614 -9.924  94.376  1.00 24.85 ? 363 SER A N     1 
ATOM   2470 C  CA    . SER A 1 327 ? 74.491 -11.195 95.083  1.00 34.85 ? 363 SER A CA    1 
ATOM   2471 C  C     . SER A 1 327 ? 74.365 -12.360 94.102  1.00 39.77 ? 363 SER A C     1 
ATOM   2472 O  O     . SER A 1 327 ? 73.703 -12.242 93.068  1.00 36.47 ? 363 SER A O     1 
ATOM   2473 C  CB    . SER A 1 327 ? 73.285 -11.163 96.024  1.00 34.83 ? 363 SER A CB    1 
ATOM   2474 O  OG    . SER A 1 327 ? 73.210 -12.352 96.787  1.00 42.20 ? 363 SER A OG    1 
ATOM   2475 N  N     . ARG A 1 328 ? 75.018 -13.474 94.421  1.00 45.63 ? 364 ARG A N     1 
ATOM   2476 C  CA    . ARG A 1 328 ? 74.998 -14.653 93.558  1.00 47.34 ? 364 ARG A CA    1 
ATOM   2477 C  C     . ARG A 1 328 ? 73.923 -15.625 94.009  1.00 50.41 ? 364 ARG A C     1 
ATOM   2478 O  O     . ARG A 1 328 ? 73.679 -16.647 93.365  1.00 48.99 ? 364 ARG A O     1 
ATOM   2479 C  CB    . ARG A 1 328 ? 76.364 -15.337 93.566  1.00 52.55 ? 364 ARG A CB    1 
ATOM   2480 C  CG    . ARG A 1 328 ? 77.465 -14.442 93.045  1.00 51.23 ? 364 ARG A CG    1 
ATOM   2481 C  CD    . ARG A 1 328 ? 78.852 -15.048 93.181  1.00 51.13 ? 364 ARG A CD    1 
ATOM   2482 N  NE    . ARG A 1 328 ? 79.821 -14.112 92.630  1.00 44.73 ? 364 ARG A NE    1 
ATOM   2483 C  CZ    . ARG A 1 328 ? 80.238 -13.014 93.255  1.00 48.92 ? 364 ARG A CZ    1 
ATOM   2484 N  NH1   . ARG A 1 328 ? 79.797 -12.721 94.473  1.00 53.13 ? 364 ARG A NH1   1 
ATOM   2485 N  NH2   . ARG A 1 328 ? 81.107 -12.209 92.669  1.00 45.62 ? 364 ARG A NH2   1 
ATOM   2486 N  N     . SER A 1 329 ? 73.284 -15.289 95.126  1.00 49.87 ? 365 SER A N     1 
ATOM   2487 C  CA    . SER A 1 329 ? 72.196 -16.085 95.673  1.00 52.44 ? 365 SER A CA    1 
ATOM   2488 C  C     . SER A 1 329 ? 70.916 -15.904 94.861  1.00 56.35 ? 365 SER A C     1 
ATOM   2489 O  O     . SER A 1 329 ? 70.833 -15.032 93.991  1.00 59.84 ? 365 SER A O     1 
ATOM   2490 C  CB    . SER A 1 329 ? 71.936 -15.676 97.121  1.00 50.35 ? 365 SER A CB    1 
ATOM   2491 O  OG    . SER A 1 329 ? 73.154 -15.439 97.802  1.00 48.93 ? 365 SER A OG    1 
ATOM   2492 N  N     . TYR A 1 330 ? 69.919 -16.732 95.153  1.00 52.07 ? 366 TYR A N     1 
ATOM   2493 C  CA    . TYR A 1 330 ? 68.602 -16.609 94.535  1.00 57.99 ? 366 TYR A CA    1 
ATOM   2494 C  C     . TYR A 1 330 ? 67.526 -17.082 95.518  1.00 57.65 ? 366 TYR A C     1 
ATOM   2495 O  O     . TYR A 1 330 ? 67.710 -18.093 96.197  1.00 64.99 ? 366 TYR A O     1 
ATOM   2496 C  CB    . TYR A 1 330 ? 68.533 -17.416 93.231  1.00 56.49 ? 366 TYR A CB    1 
ATOM   2497 C  CG    . TYR A 1 330 ? 67.159 -17.420 92.587  1.00 61.56 ? 366 TYR A CG    1 
ATOM   2498 C  CD1   . TYR A 1 330 ? 66.827 -16.497 91.598  1.00 61.95 ? 366 TYR A CD1   1 
ATOM   2499 C  CD2   . TYR A 1 330 ? 66.189 -18.344 92.972  1.00 63.78 ? 366 TYR A CD2   1 
ATOM   2500 C  CE1   . TYR A 1 330 ? 65.568 -16.496 91.012  1.00 60.76 ? 366 TYR A CE1   1 
ATOM   2501 C  CE2   . TYR A 1 330 ? 64.931 -18.348 92.395  1.00 64.65 ? 366 TYR A CE2   1 
ATOM   2502 C  CZ    . TYR A 1 330 ? 64.625 -17.424 91.414  1.00 65.26 ? 366 TYR A CZ    1 
ATOM   2503 O  OH    . TYR A 1 330 ? 63.373 -17.434 90.839  1.00 70.89 ? 366 TYR A OH    1 
ATOM   2504 N  N     . PRO A 1 331 ? 66.404 -16.347 95.611  1.00 55.64 ? 367 PRO A N     1 
ATOM   2505 C  CA    . PRO A 1 331 ? 66.154 -15.057 94.958  1.00 51.36 ? 367 PRO A CA    1 
ATOM   2506 C  C     . PRO A 1 331 ? 66.770 -13.906 95.754  1.00 44.91 ? 367 PRO A C     1 
ATOM   2507 O  O     . PRO A 1 331 ? 66.973 -14.026 96.963  1.00 43.21 ? 367 PRO A O     1 
ATOM   2508 C  CB    . PRO A 1 331 ? 64.628 -14.952 94.984  1.00 52.21 ? 367 PRO A CB    1 
ATOM   2509 C  CG    . PRO A 1 331 ? 64.236 -15.706 96.215  1.00 52.74 ? 367 PRO A CG    1 
ATOM   2510 C  CD    . PRO A 1 331 ? 65.199 -16.860 96.291  1.00 56.73 ? 367 PRO A CD    1 
ATOM   2511 N  N     . ILE A 1 332 ? 67.080 -12.805 95.081  1.00 33.63 ? 368 ILE A N     1 
ATOM   2512 C  CA    . ILE A 1 332 ? 67.599 -11.635 95.773  1.00 29.50 ? 368 ILE A CA    1 
ATOM   2513 C  C     . ILE A 1 332 ? 66.427 -10.849 96.371  1.00 30.85 ? 368 ILE A C     1 
ATOM   2514 O  O     . ILE A 1 332 ? 65.423 -10.610 95.693  1.00 32.65 ? 368 ILE A O     1 
ATOM   2515 C  CB    . ILE A 1 332 ? 68.430 -10.738 94.829  1.00 27.06 ? 368 ILE A CB    1 
ATOM   2516 C  CG1   . ILE A 1 332 ? 69.556 -11.547 94.175  1.00 30.84 ? 368 ILE A CG1   1 
ATOM   2517 C  CG2   . ILE A 1 332 ? 68.997 -9.543  95.586  1.00 27.63 ? 368 ILE A CG2   1 
ATOM   2518 C  CD1   . ILE A 1 332 ? 70.504 -10.717 93.311  1.00 26.80 ? 368 ILE A CD1   1 
ATOM   2519 N  N     . PRO A 1 333 ? 66.541 -10.462 97.653  1.00 29.77 ? 369 PRO A N     1 
ATOM   2520 C  CA    . PRO A 1 333 ? 65.467 -9.692  98.290  1.00 26.05 ? 369 PRO A CA    1 
ATOM   2521 C  C     . PRO A 1 333 ? 65.501 -8.240  97.854  1.00 27.15 ? 369 PRO A C     1 
ATOM   2522 O  O     . PRO A 1 333 ? 66.002 -7.378  98.599  1.00 26.38 ? 369 PRO A O     1 
ATOM   2523 C  CB    . PRO A 1 333 ? 65.798 -9.806  99.783  1.00 32.84 ? 369 PRO A CB    1 
ATOM   2524 C  CG    . PRO A 1 333 ? 67.290 -9.977  99.817  1.00 28.29 ? 369 PRO A CG    1 
ATOM   2525 C  CD    . PRO A 1 333 ? 67.629 -10.787 98.595  1.00 25.34 ? 369 PRO A CD    1 
ATOM   2526 N  N     . TYR A 1 334 ? 64.959 -7.961  96.669  1.00 22.77 ? 370 TYR A N     1 
ATOM   2527 C  CA    . TYR A 1 334 ? 65.043 -6.611  96.120  1.00 19.65 ? 370 TYR A CA    1 
ATOM   2528 C  C     . TYR A 1 334 ? 64.346 -5.590  97.007  1.00 20.72 ? 370 TYR A C     1 
ATOM   2529 O  O     . TYR A 1 334 ? 64.713 -4.417  96.997  1.00 17.66 ? 370 TYR A O     1 
ATOM   2530 C  CB    . TYR A 1 334 ? 64.488 -6.563  94.697  1.00 18.08 ? 370 TYR A CB    1 
ATOM   2531 C  CG    . TYR A 1 334 ? 65.180 -7.515  93.755  1.00 20.15 ? 370 TYR A CG    1 
ATOM   2532 C  CD1   . TYR A 1 334 ? 66.543 -7.400  93.501  1.00 21.06 ? 370 TYR A CD1   1 
ATOM   2533 C  CD2   . TYR A 1 334 ? 64.470 -8.528  93.110  1.00 18.95 ? 370 TYR A CD2   1 
ATOM   2534 C  CE1   . TYR A 1 334 ? 67.190 -8.274  92.635  1.00 22.39 ? 370 TYR A CE1   1 
ATOM   2535 C  CE2   . TYR A 1 334 ? 65.105 -9.404  92.245  1.00 22.28 ? 370 TYR A CE2   1 
ATOM   2536 C  CZ    . TYR A 1 334 ? 66.460 -9.268  92.010  1.00 21.14 ? 370 TYR A CZ    1 
ATOM   2537 O  OH    . TYR A 1 334 ? 67.086 -10.137 91.155  1.00 24.77 ? 370 TYR A OH    1 
ATOM   2538 N  N     . ASP A 1 335 ? 63.358 -6.044  97.779  1.00 17.58 ? 371 ASP A N     1 
ATOM   2539 C  CA    . ASP A 1 335 ? 62.599 -5.187  98.704  1.00 20.35 ? 371 ASP A CA    1 
ATOM   2540 C  C     . ASP A 1 335 ? 63.482 -4.318  99.587  1.00 19.49 ? 371 ASP A C     1 
ATOM   2541 O  O     . ASP A 1 335 ? 63.138 -3.172  99.896  1.00 18.93 ? 371 ASP A O     1 
ATOM   2542 C  CB    . ASP A 1 335 ? 61.738 -6.049  99.631  1.00 28.07 ? 371 ASP A CB    1 
ATOM   2543 C  CG    . ASP A 1 335 ? 60.451 -6.491  98.991  1.00 36.14 ? 371 ASP A CG    1 
ATOM   2544 O  OD1   . ASP A 1 335 ? 60.123 -5.981  97.896  1.00 37.01 ? 371 ASP A OD1   1 
ATOM   2545 O  OD2   . ASP A 1 335 ? 59.756 -7.331  99.599  1.00 40.78 ? 371 ASP A OD2   1 
ATOM   2546 N  N     . SER A 1 336 ? 64.613 -4.876  100.012 1.00 17.63 ? 372 SER A N     1 
ATOM   2547 C  CA    . SER A 1 336 ? 65.507 -4.175  100.929 1.00 19.53 ? 372 SER A CA    1 
ATOM   2548 C  C     . SER A 1 336 ? 66.020 -2.866  100.319 1.00 18.19 ? 372 SER A C     1 
ATOM   2549 O  O     . SER A 1 336 ? 66.412 -1.950  101.037 1.00 13.86 ? 372 SER A O     1 
ATOM   2550 C  CB    . SER A 1 336 ? 66.674 -5.078  101.338 1.00 21.78 ? 372 SER A CB    1 
ATOM   2551 O  OG    . SER A 1 336 ? 67.477 -5.414  100.223 1.00 24.56 ? 372 SER A OG    1 
ATOM   2552 N  N     . LEU A 1 337 ? 65.999 -2.774  98.992  1.00 18.87 ? 373 LEU A N     1 
ATOM   2553 C  CA    . LEU A 1 337 ? 66.466 -1.566  98.305  1.00 15.11 ? 373 LEU A CA    1 
ATOM   2554 C  C     . LEU A 1 337 ? 65.641 -0.349  98.693  1.00 15.77 ? 373 LEU A C     1 
ATOM   2555 O  O     . LEU A 1 337 ? 66.146 0.776   98.724  1.00 20.77 ? 373 LEU A O     1 
ATOM   2556 C  CB    . LEU A 1 337 ? 66.423 -1.782  96.783  1.00 18.86 ? 373 LEU A CB    1 
ATOM   2557 C  CG    . LEU A 1 337 ? 67.075 -0.746  95.871  1.00 20.39 ? 373 LEU A CG    1 
ATOM   2558 C  CD1   . LEU A 1 337 ? 68.558 -0.608  96.193  1.00 16.20 ? 373 LEU A CD1   1 
ATOM   2559 C  CD2   . LEU A 1 337 ? 66.875 -1.138  94.405  1.00 17.95 ? 373 LEU A CD2   1 
ATOM   2560 N  N     . PHE A 1 338 ? 64.368 -0.565  99.002  1.00 16.36 ? 374 PHE A N     1 
ATOM   2561 C  CA    . PHE A 1 338 ? 63.492 0.544   99.366  1.00 16.30 ? 374 PHE A CA    1 
ATOM   2562 C  C     . PHE A 1 338 ? 63.031 0.505   100.824 1.00 22.66 ? 374 PHE A C     1 
ATOM   2563 O  O     . PHE A 1 338 ? 62.099 1.207   101.213 1.00 19.93 ? 374 PHE A O     1 
ATOM   2564 C  CB    . PHE A 1 338 ? 62.302 0.611   98.398  1.00 19.51 ? 374 PHE A CB    1 
ATOM   2565 C  CG    . PHE A 1 338 ? 62.722 0.704   96.949  1.00 17.98 ? 374 PHE A CG    1 
ATOM   2566 C  CD1   . PHE A 1 338 ? 63.414 1.817   96.488  1.00 16.04 ? 374 PHE A CD1   1 
ATOM   2567 C  CD2   . PHE A 1 338 ? 62.443 -0.317  96.060  1.00 15.99 ? 374 PHE A CD2   1 
ATOM   2568 C  CE1   . PHE A 1 338 ? 63.826 1.905   95.148  1.00 15.13 ? 374 PHE A CE1   1 
ATOM   2569 C  CE2   . PHE A 1 338 ? 62.844 -0.239  94.720  1.00 17.77 ? 374 PHE A CE2   1 
ATOM   2570 C  CZ    . PHE A 1 338 ? 63.539 0.880   94.265  1.00 16.80 ? 374 PHE A CZ    1 
ATOM   2571 N  N     . GLU A 1 339 ? 63.689 -0.312  101.638 1.00 22.29 ? 375 GLU A N     1 
ATOM   2572 C  CA    . GLU A 1 339 ? 63.403 -0.297  103.070 1.00 20.68 ? 375 GLU A CA    1 
ATOM   2573 C  C     . GLU A 1 339 ? 64.114 0.865   103.751 1.00 22.71 ? 375 GLU A C     1 
ATOM   2574 O  O     . GLU A 1 339 ? 65.242 1.217   103.395 1.00 19.66 ? 375 GLU A O     1 
ATOM   2575 C  CB    . GLU A 1 339 ? 63.744 -1.638  103.716 1.00 22.79 ? 375 GLU A CB    1 
ATOM   2576 C  CG    . GLU A 1 339 ? 62.701 -2.700  103.406 1.00 25.38 ? 375 GLU A CG    1 
ATOM   2577 C  CD    . GLU A 1 339 ? 63.129 -4.092  103.828 1.00 30.60 ? 375 GLU A CD    1 
ATOM   2578 O  OE1   . GLU A 1 339 ? 64.240 -4.237  104.385 1.00 28.82 ? 375 GLU A OE1   1 
ATOM   2579 O  OE2   . GLU A 1 339 ? 62.352 -5.043  103.593 1.00 31.21 ? 375 GLU A OE2   1 
ATOM   2580 N  N     . GLU A 1 340 ? 63.432 1.477   104.712 1.00 24.76 ? 376 GLU A N     1 
ATOM   2581 C  CA    . GLU A 1 340 ? 63.955 2.652   105.403 1.00 22.80 ? 376 GLU A CA    1 
ATOM   2582 C  C     . GLU A 1 340 ? 65.321 2.446   106.054 1.00 25.46 ? 376 GLU A C     1 
ATOM   2583 O  O     . GLU A 1 340 ? 65.721 1.315   106.325 1.00 32.42 ? 376 GLU A O     1 
ATOM   2584 C  CB    . GLU A 1 340 ? 62.969 3.107   106.469 1.00 29.03 ? 376 GLU A CB    1 
ATOM   2585 C  CG    . GLU A 1 340 ? 61.759 3.832   105.935 1.00 27.43 ? 376 GLU A CG    1 
ATOM   2586 C  CD    . GLU A 1 340 ? 61.057 4.606   107.036 1.00 39.72 ? 376 GLU A CD    1 
ATOM   2587 O  OE1   . GLU A 1 340 ? 61.073 4.126   108.191 1.00 38.81 ? 376 GLU A OE1   1 
ATOM   2588 O  OE2   . GLU A 1 340 ? 60.518 5.699   106.758 1.00 48.36 ? 376 GLU A OE2   1 
ATOM   2589 N  N     . ALA A 1 341 ? 66.026 3.562   106.263 1.00 26.64 ? 377 ALA A N     1 
ATOM   2590 C  CA    . ALA A 1 341 ? 67.269 3.637   107.039 1.00 39.19 ? 377 ALA A CA    1 
ATOM   2591 C  C     . ALA A 1 341 ? 68.485 3.102   106.301 1.00 36.63 ? 377 ALA A C     1 
ATOM   2592 O  O     . ALA A 1 341 ? 69.319 3.880   105.834 1.00 41.70 ? 377 ALA A O     1 
ATOM   2593 C  CB    . ALA A 1 341 ? 67.116 2.969   108.437 1.00 37.20 ? 377 ALA A CB    1 
ATOM   2594 N  N     . ASP B 1 2   ? 65.911 57.565  115.419 1.00 38.31 ? 38  ASP B N     1 
ATOM   2595 C  CA    . ASP B 1 2   ? 65.002 57.593  116.566 1.00 40.16 ? 38  ASP B CA    1 
ATOM   2596 C  C     . ASP B 1 2   ? 65.612 58.323  117.769 1.00 46.67 ? 38  ASP B C     1 
ATOM   2597 O  O     . ASP B 1 2   ? 66.545 57.816  118.401 1.00 42.15 ? 38  ASP B O     1 
ATOM   2598 C  CB    . ASP B 1 2   ? 64.601 56.170  116.977 1.00 32.91 ? 38  ASP B CB    1 
ATOM   2599 C  CG    . ASP B 1 2   ? 63.720 56.151  118.227 1.00 36.20 ? 38  ASP B CG    1 
ATOM   2600 O  OD1   . ASP B 1 2   ? 63.024 57.157  118.477 1.00 38.90 ? 38  ASP B OD1   1 
ATOM   2601 O  OD2   . ASP B 1 2   ? 63.721 55.145  118.968 1.00 22.28 ? 38  ASP B OD2   1 
ATOM   2602 N  N     . MET B 1 3   ? 65.061 59.493  118.099 1.00 46.97 ? 39  MET B N     1 
ATOM   2603 C  CA    . MET B 1 3   ? 65.591 60.326  119.183 1.00 44.93 ? 39  MET B CA    1 
ATOM   2604 C  C     . MET B 1 3   ? 64.626 60.472  120.372 1.00 42.45 ? 39  MET B C     1 
ATOM   2605 O  O     . MET B 1 3   ? 64.870 61.249  121.299 1.00 39.29 ? 39  MET B O     1 
ATOM   2606 C  CB    . MET B 1 3   ? 65.968 61.709  118.635 1.00 47.04 ? 39  MET B CB    1 
ATOM   2607 C  CG    . MET B 1 3   ? 66.340 61.704  117.150 1.00 53.64 ? 39  MET B CG    1 
ATOM   2608 S  SD    . MET B 1 3   ? 68.067 62.124  116.796 1.00 68.68 ? 39  MET B SD    1 
ATOM   2609 C  CE    . MET B 1 3   ? 68.110 63.868  117.237 1.00 43.42 ? 39  MET B CE    1 
ATOM   2610 N  N     . SER B 1 4   ? 63.539 59.708  120.348 1.00 42.93 ? 40  SER B N     1 
ATOM   2611 C  CA    . SER B 1 4   ? 62.473 59.831  121.345 1.00 35.49 ? 40  SER B CA    1 
ATOM   2612 C  C     . SER B 1 4   ? 62.890 59.474  122.783 1.00 36.56 ? 40  SER B C     1 
ATOM   2613 O  O     . SER B 1 4   ? 62.303 59.984  123.748 1.00 37.35 ? 40  SER B O     1 
ATOM   2614 C  CB    . SER B 1 4   ? 61.289 58.957  120.927 1.00 39.79 ? 40  SER B CB    1 
ATOM   2615 O  OG    . SER B 1 4   ? 61.728 57.634  120.677 1.00 30.70 ? 40  SER B OG    1 
ATOM   2616 N  N     . HIS B 1 5   ? 63.902 58.613  122.918 1.00 27.49 ? 41  HIS B N     1 
ATOM   2617 C  CA    . HIS B 1 5   ? 64.279 58.035  124.211 1.00 25.79 ? 41  HIS B CA    1 
ATOM   2618 C  C     . HIS B 1 5   ? 65.792 58.002  124.417 1.00 25.82 ? 41  HIS B C     1 
ATOM   2619 O  O     . HIS B 1 5   ? 66.339 56.985  124.855 1.00 21.51 ? 41  HIS B O     1 
ATOM   2620 C  CB    . HIS B 1 5   ? 63.750 56.595  124.317 1.00 18.07 ? 41  HIS B CB    1 
ATOM   2621 C  CG    . HIS B 1 5   ? 62.265 56.502  124.475 1.00 22.27 ? 41  HIS B CG    1 
ATOM   2622 N  ND1   . HIS B 1 5   ? 61.397 56.599  123.411 1.00 23.11 ? 41  HIS B ND1   1 
ATOM   2623 C  CD2   . HIS B 1 5   ? 61.496 56.328  125.577 1.00 23.47 ? 41  HIS B CD2   1 
ATOM   2624 C  CE1   . HIS B 1 5   ? 60.153 56.478  123.845 1.00 25.57 ? 41  HIS B CE1   1 
ATOM   2625 N  NE2   . HIS B 1 5   ? 60.187 56.322  125.156 1.00 23.93 ? 41  HIS B NE2   1 
ATOM   2626 N  N     . LYS B 1 6   ? 66.467 59.105  124.110 1.00 21.32 ? 42  LYS B N     1 
ATOM   2627 C  CA    . LYS B 1 6   ? 67.927 59.152  124.152 1.00 19.47 ? 42  LYS B CA    1 
ATOM   2628 C  C     . LYS B 1 6   ? 68.550 58.953  125.539 1.00 18.94 ? 42  LYS B C     1 
ATOM   2629 O  O     . LYS B 1 6   ? 69.494 58.173  125.693 1.00 19.71 ? 42  LYS B O     1 
ATOM   2630 C  CB    . LYS B 1 6   ? 68.405 60.475  123.555 1.00 21.71 ? 42  LYS B CB    1 
ATOM   2631 C  CG    . LYS B 1 6   ? 69.883 60.557  123.262 1.00 28.82 ? 42  LYS B CG    1 
ATOM   2632 C  CD    . LYS B 1 6   ? 70.149 61.864  122.517 1.00 33.96 ? 42  LYS B CD    1 
ATOM   2633 C  CE    . LYS B 1 6   ? 71.624 62.191  122.423 1.00 36.88 ? 42  LYS B CE    1 
ATOM   2634 N  NZ    . LYS B 1 6   ? 71.810 63.530  121.780 1.00 38.28 ? 42  LYS B NZ    1 
ATOM   2635 N  N     . GLU B 1 7   ? 68.053 59.675  126.544 1.00 19.47 ? 43  GLU B N     1 
ATOM   2636 C  CA    . GLU B 1 7   ? 68.589 59.533  127.904 1.00 20.50 ? 43  GLU B CA    1 
ATOM   2637 C  C     . GLU B 1 7   ? 68.271 58.170  128.532 1.00 21.28 ? 43  GLU B C     1 
ATOM   2638 O  O     . GLU B 1 7   ? 69.111 57.584  129.231 1.00 20.33 ? 43  GLU B O     1 
ATOM   2639 C  CB    . GLU B 1 7   ? 68.080 60.656  128.821 1.00 29.02 ? 43  GLU B CB    1 
ATOM   2640 C  CG    . GLU B 1 7   ? 68.747 62.012  128.590 1.00 28.71 ? 43  GLU B CG    1 
ATOM   2641 C  CD    . GLU B 1 7   ? 68.234 63.083  129.556 1.00 50.00 ? 43  GLU B CD    1 
ATOM   2642 O  OE1   . GLU B 1 7   ? 67.882 62.742  130.712 1.00 46.03 ? 43  GLU B OE1   1 
ATOM   2643 O  OE2   . GLU B 1 7   ? 68.175 64.266  129.153 1.00 57.73 ? 43  GLU B OE2   1 
ATOM   2644 N  N     . PHE B 1 8   ? 67.057 57.678  128.302 1.00 19.56 ? 44  PHE B N     1 
ATOM   2645 C  CA    . PHE B 1 8   ? 66.682 56.367  128.817 1.00 21.49 ? 44  PHE B CA    1 
ATOM   2646 C  C     . PHE B 1 8   ? 67.565 55.291  128.186 1.00 15.66 ? 44  PHE B C     1 
ATOM   2647 O  O     . PHE B 1 8   ? 68.036 54.389  128.876 1.00 18.43 ? 44  PHE B O     1 
ATOM   2648 C  CB    . PHE B 1 8   ? 65.196 56.069  128.580 1.00 20.73 ? 44  PHE B CB    1 
ATOM   2649 C  CG    . PHE B 1 8   ? 64.747 54.743  129.150 1.00 16.18 ? 44  PHE B CG    1 
ATOM   2650 C  CD1   . PHE B 1 8   ? 65.207 54.323  130.389 1.00 16.01 ? 44  PHE B CD1   1 
ATOM   2651 C  CD2   . PHE B 1 8   ? 63.876 53.921  128.446 1.00 19.89 ? 44  PHE B CD2   1 
ATOM   2652 C  CE1   . PHE B 1 8   ? 64.819 53.094  130.926 1.00 19.71 ? 44  PHE B CE1   1 
ATOM   2653 C  CE2   . PHE B 1 8   ? 63.473 52.684  128.981 1.00 16.16 ? 44  PHE B CE2   1 
ATOM   2654 C  CZ    . PHE B 1 8   ? 63.946 52.281  130.229 1.00 13.01 ? 44  PHE B CZ    1 
ATOM   2655 N  N     . THR B 1 9   ? 67.788 55.391  126.875 1.00 16.27 ? 45  THR B N     1 
ATOM   2656 C  CA    . THR B 1 9   ? 68.640 54.418  126.184 1.00 18.02 ? 45  THR B CA    1 
ATOM   2657 C  C     . THR B 1 9   ? 70.053 54.414  126.763 1.00 20.19 ? 45  THR B C     1 
ATOM   2658 O  O     . THR B 1 9   ? 70.630 53.358  127.028 1.00 13.86 ? 45  THR B O     1 
ATOM   2659 C  CB    . THR B 1 9   ? 68.678 54.667  124.675 1.00 14.95 ? 45  THR B CB    1 
ATOM   2660 O  OG1   . THR B 1 9   ? 67.363 54.491  124.135 1.00 15.30 ? 45  THR B OG1   1 
ATOM   2661 C  CG2   . THR B 1 9   ? 69.642 53.694  123.992 1.00 15.00 ? 45  THR B CG2   1 
ATOM   2662 N  N     . LYS B 1 10  ? 70.599 55.603  126.990 1.00 18.91 ? 46  LYS B N     1 
ATOM   2663 C  CA    . LYS B 1 10  ? 71.946 55.732  127.526 1.00 18.13 ? 46  LYS B CA    1 
ATOM   2664 C  C     . LYS B 1 10  ? 72.057 55.056  128.887 1.00 15.55 ? 46  LYS B C     1 
ATOM   2665 O  O     . LYS B 1 10  ? 73.059 54.396  129.183 1.00 17.29 ? 46  LYS B O     1 
ATOM   2666 C  CB    . LYS B 1 10  ? 72.328 57.215  127.638 1.00 19.81 ? 46  LYS B CB    1 
ATOM   2667 C  CG    . LYS B 1 10  ? 73.736 57.455  128.174 1.00 24.98 ? 46  LYS B CG    1 
ATOM   2668 C  CD    . LYS B 1 10  ? 74.009 58.957  128.407 1.00 22.59 ? 46  LYS B CD    1 
ATOM   2669 C  CE    . LYS B 1 10  ? 75.451 59.173  128.856 1.00 31.72 ? 46  LYS B CE    1 
ATOM   2670 N  NZ    . LYS B 1 10  ? 76.420 58.655  127.845 1.00 36.60 ? 46  LYS B NZ    1 
ATOM   2671 N  N     . PHE B 1 11  ? 71.020 55.218  129.706 1.00 19.14 ? 47  PHE B N     1 
ATOM   2672 C  CA    . PHE B 1 11  ? 70.939 54.574  131.011 1.00 18.11 ? 47  PHE B CA    1 
ATOM   2673 C  C     . PHE B 1 11  ? 70.862 53.050  130.863 1.00 19.08 ? 47  PHE B C     1 
ATOM   2674 O  O     . PHE B 1 11  ? 71.519 52.307  131.597 1.00 19.01 ? 47  PHE B O     1 
ATOM   2675 C  CB    . PHE B 1 11  ? 69.705 55.082  131.759 1.00 20.13 ? 47  PHE B CB    1 
ATOM   2676 C  CG    . PHE B 1 11  ? 69.398 54.326  133.025 1.00 24.32 ? 47  PHE B CG    1 
ATOM   2677 C  CD1   . PHE B 1 11  ? 70.165 54.503  134.166 1.00 29.79 ? 47  PHE B CD1   1 
ATOM   2678 C  CD2   . PHE B 1 11  ? 68.324 53.454  133.076 1.00 24.69 ? 47  PHE B CD2   1 
ATOM   2679 C  CE1   . PHE B 1 11  ? 69.874 53.808  135.336 1.00 26.63 ? 47  PHE B CE1   1 
ATOM   2680 C  CE2   . PHE B 1 11  ? 68.027 52.757  134.239 1.00 26.33 ? 47  PHE B CE2   1 
ATOM   2681 C  CZ    . PHE B 1 11  ? 68.801 52.941  135.370 1.00 27.69 ? 47  PHE B CZ    1 
ATOM   2682 N  N     . CYS B 1 12  ? 70.053 52.598  129.913 1.00 16.85 ? 48  CYS B N     1 
ATOM   2683 C  CA    . CYS B 1 12  ? 69.894 51.168  129.660 1.00 15.56 ? 48  CYS B CA    1 
ATOM   2684 C  C     . CYS B 1 12  ? 71.217 50.472  129.355 1.00 13.70 ? 48  CYS B C     1 
ATOM   2685 O  O     . CYS B 1 12  ? 71.499 49.393  129.886 1.00 14.93 ? 48  CYS B O     1 
ATOM   2686 C  CB    . CYS B 1 12  ? 68.897 50.949  128.523 1.00 12.86 ? 48  CYS B CB    1 
ATOM   2687 S  SG    . CYS B 1 12  ? 67.173 51.199  129.014 1.00 17.99 ? 48  CYS B SG    1 
ATOM   2688 N  N     . TYR B 1 13  ? 72.040 51.070  128.505 1.00 13.29 ? 49  TYR B N     1 
ATOM   2689 C  CA    . TYR B 1 13  ? 73.330 50.455  128.177 1.00 15.68 ? 49  TYR B CA    1 
ATOM   2690 C  C     . TYR B 1 13  ? 74.313 50.489  129.345 1.00 18.60 ? 49  TYR B C     1 
ATOM   2691 O  O     . TYR B 1 13  ? 75.143 49.588  129.492 1.00 14.96 ? 49  TYR B O     1 
ATOM   2692 C  CB    . TYR B 1 13  ? 73.939 51.060  126.897 1.00 17.10 ? 49  TYR B CB    1 
ATOM   2693 C  CG    . TYR B 1 13  ? 73.250 50.564  125.637 1.00 13.44 ? 49  TYR B CG    1 
ATOM   2694 C  CD1   . TYR B 1 13  ? 73.466 49.270  125.165 1.00 15.20 ? 49  TYR B CD1   1 
ATOM   2695 C  CD2   . TYR B 1 13  ? 72.369 51.375  124.936 1.00 10.29 ? 49  TYR B CD2   1 
ATOM   2696 C  CE1   . TYR B 1 13  ? 72.834 48.806  124.018 1.00 14.27 ? 49  TYR B CE1   1 
ATOM   2697 C  CE2   . TYR B 1 13  ? 71.742 50.925  123.788 1.00 11.95 ? 49  TYR B CE2   1 
ATOM   2698 C  CZ    . TYR B 1 13  ? 71.971 49.642  123.345 1.00 13.18 ? 49  TYR B CZ    1 
ATOM   2699 O  OH    . TYR B 1 13  ? 71.321 49.227  122.215 1.00 10.74 ? 49  TYR B OH    1 
ATOM   2700 N  N     . GLU B 1 14  ? 74.230 51.524  130.180 1.00 17.58 ? 50  GLU B N     1 
ATOM   2701 C  CA    . GLU B 1 14  ? 75.067 51.569  131.374 1.00 21.26 ? 50  GLU B CA    1 
ATOM   2702 C  C     . GLU B 1 14  ? 74.715 50.408  132.304 1.00 16.08 ? 50  GLU B C     1 
ATOM   2703 O  O     . GLU B 1 14  ? 75.607 49.710  132.818 1.00 20.07 ? 50  GLU B O     1 
ATOM   2704 C  CB    . GLU B 1 14  ? 74.905 52.909  132.100 1.00 20.02 ? 50  GLU B CB    1 
ATOM   2705 C  CG    . GLU B 1 14  ? 75.675 54.047  131.445 1.00 25.18 ? 50  GLU B CG    1 
ATOM   2706 C  CD    . GLU B 1 14  ? 75.232 55.420  131.938 1.00 29.86 ? 50  GLU B CD    1 
ATOM   2707 O  OE1   . GLU B 1 14  ? 74.370 55.488  132.846 1.00 32.06 ? 50  GLU B OE1   1 
ATOM   2708 O  OE2   . GLU B 1 14  ? 75.741 56.432  131.407 1.00 31.54 ? 50  GLU B OE2   1 
ATOM   2709 N  N     . VAL B 1 15  ? 73.419 50.204  132.519 1.00 14.43 ? 51  VAL B N     1 
ATOM   2710 C  CA    . VAL B 1 15  ? 72.955 49.128  133.389 1.00 15.13 ? 51  VAL B CA    1 
ATOM   2711 C  C     . VAL B 1 15  ? 73.292 47.786  132.752 1.00 17.26 ? 51  VAL B C     1 
ATOM   2712 O  O     . VAL B 1 15  ? 73.748 46.868  133.435 1.00 17.44 ? 51  VAL B O     1 
ATOM   2713 C  CB    . VAL B 1 15  ? 71.447 49.201  133.675 1.00 14.88 ? 51  VAL B CB    1 
ATOM   2714 C  CG1   . VAL B 1 15  ? 71.002 48.000  134.512 1.00 13.07 ? 51  VAL B CG1   1 
ATOM   2715 C  CG2   . VAL B 1 15  ? 71.101 50.504  134.423 1.00 21.25 ? 51  VAL B CG2   1 
ATOM   2716 N  N     . TYR B 1 16  ? 73.076 47.685  131.441 1.00 15.66 ? 52  TYR B N     1 
ATOM   2717 C  CA    . TYR B 1 16  ? 73.414 46.462  130.701 1.00 15.14 ? 52  TYR B CA    1 
ATOM   2718 C  C     . TYR B 1 16  ? 74.869 46.071  130.955 1.00 15.33 ? 52  TYR B C     1 
ATOM   2719 O  O     . TYR B 1 16  ? 75.172 44.912  131.250 1.00 16.24 ? 52  TYR B O     1 
ATOM   2720 C  CB    . TYR B 1 16  ? 73.150 46.637  129.194 1.00 14.14 ? 52  TYR B CB    1 
ATOM   2721 C  CG    . TYR B 1 16  ? 73.926 45.661  128.327 1.00 14.26 ? 52  TYR B CG    1 
ATOM   2722 C  CD1   . TYR B 1 16  ? 73.582 44.319  128.281 1.00 16.38 ? 52  TYR B CD1   1 
ATOM   2723 C  CD2   . TYR B 1 16  ? 75.010 46.085  127.565 1.00 13.27 ? 52  TYR B CD2   1 
ATOM   2724 C  CE1   . TYR B 1 16  ? 74.305 43.417  127.503 1.00 14.01 ? 52  TYR B CE1   1 
ATOM   2725 C  CE2   . TYR B 1 16  ? 75.731 45.194  126.776 1.00 12.47 ? 52  TYR B CE2   1 
ATOM   2726 C  CZ    . TYR B 1 16  ? 75.365 43.858  126.755 1.00 17.42 ? 52  TYR B CZ    1 
ATOM   2727 O  OH    . TYR B 1 16  ? 76.066 42.950  125.985 1.00 16.14 ? 52  TYR B OH    1 
ATOM   2728 N  N     . ASN B 1 17  ? 75.770 47.050  130.880 1.00 18.20 ? 53  ASN B N     1 
ATOM   2729 C  CA    . ASN B 1 17  ? 77.191 46.767  131.048 1.00 17.30 ? 53  ASN B CA    1 
ATOM   2730 C  C     . ASN B 1 17  ? 77.555 46.275  132.452 1.00 21.15 ? 53  ASN B C     1 
ATOM   2731 O  O     . ASN B 1 17  ? 78.514 45.510  132.630 1.00 20.09 ? 53  ASN B O     1 
ATOM   2732 C  CB    . ASN B 1 17  ? 78.032 47.974  130.623 1.00 15.92 ? 53  ASN B CB    1 
ATOM   2733 C  CG    . ASN B 1 17  ? 78.110 48.110  129.118 1.00 22.74 ? 53  ASN B CG    1 
ATOM   2734 O  OD1   . ASN B 1 17  ? 78.607 47.214  128.433 1.00 29.99 ? 53  ASN B OD1   1 
ATOM   2735 N  ND2   . ASN B 1 17  ? 77.618 49.224  128.593 1.00 29.82 ? 53  ASN B ND2   1 
ATOM   2736 N  N     . GLU B 1 18  ? 76.771 46.678  133.447 1.00 20.16 ? 54  GLU B N     1 
ATOM   2737 C  CA    . GLU B 1 18  ? 77.005 46.213  134.815 1.00 22.22 ? 54  GLU B CA    1 
ATOM   2738 C  C     . GLU B 1 18  ? 76.448 44.822  135.114 1.00 20.09 ? 54  GLU B C     1 
ATOM   2739 O  O     . GLU B 1 18  ? 76.985 44.104  135.958 1.00 23.69 ? 54  GLU B O     1 
ATOM   2740 C  CB    . GLU B 1 18  ? 76.433 47.211  135.825 1.00 26.82 ? 54  GLU B CB    1 
ATOM   2741 C  CG    . GLU B 1 18  ? 77.217 48.509  135.907 1.00 33.59 ? 54  GLU B CG    1 
ATOM   2742 C  CD    . GLU B 1 18  ? 76.606 49.490  136.892 1.00 45.36 ? 54  GLU B CD    1 
ATOM   2743 O  OE1   . GLU B 1 18  ? 75.984 49.038  137.885 1.00 42.64 ? 54  GLU B OE1   1 
ATOM   2744 O  OE2   . GLU B 1 18  ? 76.735 50.710  136.660 1.00 45.94 ? 54  GLU B OE2   1 
ATOM   2745 N  N     . ILE B 1 19  ? 75.357 44.443  134.458 1.00 17.25 ? 55  ILE B N     1 
ATOM   2746 C  CA    . ILE B 1 19  ? 74.651 43.228  134.863 1.00 16.10 ? 55  ILE B CA    1 
ATOM   2747 C  C     . ILE B 1 19  ? 74.985 42.015  134.005 1.00 22.43 ? 55  ILE B C     1 
ATOM   2748 O  O     . ILE B 1 19  ? 74.736 40.881  134.413 1.00 18.56 ? 55  ILE B O     1 
ATOM   2749 C  CB    . ILE B 1 19  ? 73.118 43.414  134.879 1.00 19.99 ? 55  ILE B CB    1 
ATOM   2750 C  CG1   . ILE B 1 19  ? 72.600 43.761  133.476 1.00 15.55 ? 55  ILE B CG1   1 
ATOM   2751 C  CG2   . ILE B 1 19  ? 72.710 44.479  135.924 1.00 23.91 ? 55  ILE B CG2   1 
ATOM   2752 C  CD1   . ILE B 1 19  ? 71.106 43.987  133.414 1.00 15.16 ? 55  ILE B CD1   1 
ATOM   2753 N  N     . LYS B 1 20  ? 75.524 42.253  132.812 1.00 19.68 ? 56  LYS B N     1 
ATOM   2754 C  CA    . LYS B 1 20  ? 75.805 41.156  131.883 1.00 18.78 ? 56  LYS B CA    1 
ATOM   2755 C  C     . LYS B 1 20  ? 76.939 40.288  132.420 1.00 21.31 ? 56  LYS B C     1 
ATOM   2756 O  O     . LYS B 1 20  ? 77.766 40.741  133.215 1.00 22.49 ? 56  LYS B O     1 
ATOM   2757 C  CB    . LYS B 1 20  ? 76.165 41.698  130.499 1.00 16.58 ? 56  LYS B CB    1 
ATOM   2758 C  CG    . LYS B 1 20  ? 77.583 42.263  130.381 1.00 18.89 ? 56  LYS B CG    1 
ATOM   2759 C  CD    . LYS B 1 20  ? 77.700 43.134  129.141 1.00 17.42 ? 56  LYS B CD    1 
ATOM   2760 C  CE    . LYS B 1 20  ? 79.117 43.655  128.960 1.00 21.94 ? 56  LYS B CE    1 
ATOM   2761 N  NZ    . LYS B 1 20  ? 79.168 44.657  127.850 1.00 29.43 ? 56  LYS B NZ    1 
ATOM   2762 N  N     . ILE B 1 21  ? 76.977 39.030  132.003 1.00 21.74 ? 57  ILE B N     1 
ATOM   2763 C  CA    . ILE B 1 21  ? 78.067 38.151  132.406 1.00 22.76 ? 57  ILE B CA    1 
ATOM   2764 C  C     . ILE B 1 21  ? 79.400 38.667  131.852 1.00 23.38 ? 57  ILE B C     1 
ATOM   2765 O  O     . ILE B 1 21  ? 79.500 39.066  130.687 1.00 26.77 ? 57  ILE B O     1 
ATOM   2766 C  CB    . ILE B 1 21  ? 77.789 36.656  132.013 1.00 21.18 ? 57  ILE B CB    1 
ATOM   2767 C  CG1   . ILE B 1 21  ? 78.615 35.696  132.878 1.00 26.38 ? 57  ILE B CG1   1 
ATOM   2768 C  CG2   . ILE B 1 21  ? 77.977 36.419  130.521 1.00 23.85 ? 57  ILE B CG2   1 
ATOM   2769 C  CD1   . ILE B 1 21  ? 78.282 34.216  132.649 1.00 29.55 ? 57  ILE B CD1   1 
ATOM   2770 N  N     . SER B 1 22  ? 80.418 38.691  132.706 1.00 25.76 ? 58  SER B N     1 
ATOM   2771 C  CA    . SER B 1 22  ? 81.745 39.142  132.298 1.00 30.00 ? 58  SER B CA    1 
ATOM   2772 C  C     . SER B 1 22  ? 82.440 38.097  131.428 1.00 35.32 ? 58  SER B C     1 
ATOM   2773 O  O     . SER B 1 22  ? 82.095 36.915  131.475 1.00 30.29 ? 58  SER B O     1 
ATOM   2774 C  CB    . SER B 1 22  ? 82.611 39.416  133.524 1.00 33.79 ? 58  SER B CB    1 
ATOM   2775 O  OG    . SER B 1 22  ? 83.024 38.203  134.120 1.00 34.32 ? 58  SER B OG    1 
ATOM   2776 N  N     . ASP B 1 23  ? 83.419 38.539  130.641 1.00 35.58 ? 59  ASP B N     1 
ATOM   2777 C  CA    . ASP B 1 23  ? 84.259 37.631  129.864 1.00 38.75 ? 59  ASP B CA    1 
ATOM   2778 C  C     . ASP B 1 23  ? 84.857 36.568  130.783 1.00 37.03 ? 59  ASP B C     1 
ATOM   2779 O  O     . ASP B 1 23  ? 84.902 35.387  130.432 1.00 37.30 ? 59  ASP B O     1 
ATOM   2780 C  CB    . ASP B 1 23  ? 85.365 38.410  129.142 1.00 40.06 ? 59  ASP B CB    1 
ATOM   2781 C  CG    . ASP B 1 23  ? 86.248 37.521  128.270 1.00 49.08 ? 59  ASP B CG    1 
ATOM   2782 O  OD1   . ASP B 1 23  ? 85.868 37.254  127.106 1.00 47.00 ? 59  ASP B OD1   1 
ATOM   2783 O  OD2   . ASP B 1 23  ? 87.330 37.098  128.741 1.00 51.48 ? 59  ASP B OD2   1 
ATOM   2784 N  N     . LYS B 1 24  ? 85.271 36.988  131.976 1.00 33.77 ? 60  LYS B N     1 
ATOM   2785 C  CA    . LYS B 1 24  ? 85.900 36.094  132.947 1.00 36.47 ? 60  LYS B CA    1 
ATOM   2786 C  C     . LYS B 1 24  ? 84.997 34.946  133.415 1.00 38.38 ? 60  LYS B C     1 
ATOM   2787 O  O     . LYS B 1 24  ? 85.371 33.773  133.302 1.00 32.75 ? 60  LYS B O     1 
ATOM   2788 C  CB    . LYS B 1 24  ? 86.410 36.877  134.162 1.00 38.44 ? 60  LYS B CB    1 
ATOM   2789 C  CG    . LYS B 1 24  ? 87.416 36.095  135.010 1.00 41.53 ? 60  LYS B CG    1 
ATOM   2790 C  CD    . LYS B 1 24  ? 87.570 36.666  136.415 1.00 50.43 ? 60  LYS B CD    1 
ATOM   2791 C  CE    . LYS B 1 24  ? 88.704 35.984  137.175 1.00 51.97 ? 60  LYS B CE    1 
ATOM   2792 N  NZ    . LYS B 1 24  ? 90.053 36.396  136.673 1.00 44.61 ? 60  LYS B NZ    1 
ATOM   2793 N  N     . GLU B 1 25  ? 83.826 35.279  133.955 1.00 33.14 ? 61  GLU B N     1 
ATOM   2794 C  CA    . GLU B 1 25  ? 82.889 34.258  134.413 1.00 29.53 ? 61  GLU B CA    1 
ATOM   2795 C  C     . GLU B 1 25  ? 82.447 33.388  133.235 1.00 29.27 ? 61  GLU B C     1 
ATOM   2796 O  O     . GLU B 1 25  ? 82.216 32.182  133.390 1.00 25.00 ? 61  GLU B O     1 
ATOM   2797 C  CB    . GLU B 1 25  ? 81.665 34.885  135.096 1.00 33.54 ? 61  GLU B CB    1 
ATOM   2798 C  CG    . GLU B 1 25  ? 80.671 33.856  135.651 1.00 31.55 ? 61  GLU B CG    1 
ATOM   2799 C  CD    . GLU B 1 25  ? 79.357 34.475  136.135 1.00 33.03 ? 61  GLU B CD    1 
ATOM   2800 O  OE1   . GLU B 1 25  ? 79.357 35.648  136.572 1.00 34.27 ? 61  GLU B OE1   1 
ATOM   2801 O  OE2   . GLU B 1 25  ? 78.318 33.782  136.074 1.00 35.16 ? 61  GLU B OE2   1 
ATOM   2802 N  N     . PHE B 1 26  ? 82.335 33.993  132.056 1.00 28.13 ? 62  PHE B N     1 
ATOM   2803 C  CA    . PHE B 1 26  ? 81.958 33.220  130.881 1.00 32.45 ? 62  PHE B CA    1 
ATOM   2804 C  C     . PHE B 1 26  ? 83.006 32.166  130.559 1.00 32.02 ? 62  PHE B C     1 
ATOM   2805 O  O     . PHE B 1 26  ? 82.659 31.007  130.316 1.00 30.12 ? 62  PHE B O     1 
ATOM   2806 C  CB    . PHE B 1 26  ? 81.708 34.095  129.656 1.00 30.83 ? 62  PHE B CB    1 
ATOM   2807 C  CG    . PHE B 1 26  ? 81.040 33.356  128.532 1.00 30.70 ? 62  PHE B CG    1 
ATOM   2808 C  CD1   . PHE B 1 26  ? 79.675 33.098  128.577 1.00 28.96 ? 62  PHE B CD1   1 
ATOM   2809 C  CD2   . PHE B 1 26  ? 81.773 32.891  127.446 1.00 32.71 ? 62  PHE B CD2   1 
ATOM   2810 C  CE1   . PHE B 1 26  ? 79.047 32.400  127.553 1.00 32.52 ? 62  PHE B CE1   1 
ATOM   2811 C  CE2   . PHE B 1 26  ? 81.147 32.197  126.414 1.00 37.45 ? 62  PHE B CE2   1 
ATOM   2812 C  CZ    . PHE B 1 26  ? 79.782 31.953  126.472 1.00 36.90 ? 62  PHE B CZ    1 
ATOM   2813 N  N     . LYS B 1 27  ? 84.275 32.569  130.567 1.00 30.62 ? 63  LYS B N     1 
ATOM   2814 C  CA    . LYS B 1 27  ? 85.384 31.643  130.343 1.00 37.49 ? 63  LYS B CA    1 
ATOM   2815 C  C     . LYS B 1 27  ? 85.365 30.519  131.367 1.00 29.86 ? 63  LYS B C     1 
ATOM   2816 O  O     . LYS B 1 27  ? 85.630 29.361  131.035 1.00 29.64 ? 63  LYS B O     1 
ATOM   2817 C  CB    . LYS B 1 27  ? 86.737 32.361  130.441 1.00 36.53 ? 63  LYS B CB    1 
ATOM   2818 C  CG    . LYS B 1 27  ? 86.984 33.466  129.425 1.00 43.79 ? 63  LYS B CG    1 
ATOM   2819 C  CD    . LYS B 1 27  ? 87.382 32.940  128.058 1.00 50.93 ? 63  LYS B CD    1 
ATOM   2820 C  CE    . LYS B 1 27  ? 87.805 34.093  127.147 1.00 51.43 ? 63  LYS B CE    1 
ATOM   2821 N  NZ    . LYS B 1 27  ? 88.261 33.630  125.799 1.00 56.20 ? 63  LYS B NZ    1 
ATOM   2822 N  N     . GLU B 1 28  ? 85.064 30.871  132.615 1.00 28.02 ? 64  GLU B N     1 
ATOM   2823 C  CA    . GLU B 1 28  ? 85.060 29.909  133.715 1.00 30.71 ? 64  GLU B CA    1 
ATOM   2824 C  C     . GLU B 1 28  ? 83.950 28.877  133.580 1.00 26.65 ? 64  GLU B C     1 
ATOM   2825 O  O     . GLU B 1 28  ? 84.138 27.707  133.913 1.00 23.35 ? 64  GLU B O     1 
ATOM   2826 C  CB    . GLU B 1 28  ? 84.941 30.628  135.063 1.00 30.36 ? 64  GLU B CB    1 
ATOM   2827 C  CG    . GLU B 1 28  ? 86.224 31.308  135.522 1.00 36.33 ? 64  GLU B CG    1 
ATOM   2828 C  CD    . GLU B 1 28  ? 85.977 32.362  136.591 1.00 44.01 ? 64  GLU B CD    1 
ATOM   2829 O  OE1   . GLU B 1 28  ? 86.863 33.221  136.785 1.00 52.52 ? 64  GLU B OE1   1 
ATOM   2830 O  OE2   . GLU B 1 28  ? 84.903 32.337  137.234 1.00 41.65 ? 64  GLU B OE2   1 
ATOM   2831 N  N     . LYS B 1 29  ? 82.791 29.323  133.108 1.00 22.69 ? 65  LYS B N     1 
ATOM   2832 C  CA    . LYS B 1 29  ? 81.655 28.435  132.880 1.00 23.61 ? 65  LYS B CA    1 
ATOM   2833 C  C     . LYS B 1 29  ? 81.939 27.460  131.751 1.00 23.86 ? 65  LYS B C     1 
ATOM   2834 O  O     . LYS B 1 29  ? 81.639 26.266  131.849 1.00 22.01 ? 65  LYS B O     1 
ATOM   2835 C  CB    . LYS B 1 29  ? 80.426 29.258  132.517 1.00 26.15 ? 65  LYS B CB    1 
ATOM   2836 C  CG    . LYS B 1 29  ? 79.877 30.101  133.644 1.00 27.95 ? 65  LYS B CG    1 
ATOM   2837 C  CD    . LYS B 1 29  ? 79.355 29.251  134.781 1.00 34.99 ? 65  LYS B CD    1 
ATOM   2838 C  CE    . LYS B 1 29  ? 78.343 30.021  135.628 1.00 36.50 ? 65  LYS B CE    1 
ATOM   2839 N  NZ    . LYS B 1 29  ? 78.936 31.196  136.324 1.00 37.87 ? 65  LYS B NZ    1 
ATOM   2840 N  N     . ARG B 1 30  ? 82.505 27.978  130.669 1.00 21.70 ? 66  ARG B N     1 
ATOM   2841 C  CA    . ARG B 1 30  ? 82.832 27.151  129.518 1.00 30.97 ? 66  ARG B CA    1 
ATOM   2842 C  C     . ARG B 1 30  ? 83.918 26.137  129.857 1.00 26.90 ? 66  ARG B C     1 
ATOM   2843 O  O     . ARG B 1 30  ? 83.879 25.003  129.382 1.00 26.75 ? 66  ARG B O     1 
ATOM   2844 C  CB    . ARG B 1 30  ? 83.244 28.018  128.332 1.00 31.87 ? 66  ARG B CB    1 
ATOM   2845 C  CG    . ARG B 1 30  ? 82.056 28.692  127.629 1.00 39.06 ? 66  ARG B CG    1 
ATOM   2846 C  CD    . ARG B 1 30  ? 81.122 27.658  126.984 1.00 44.02 ? 66  ARG B CD    1 
ATOM   2847 N  NE    . ARG B 1 30  ? 80.403 28.197  125.828 1.00 47.53 ? 66  ARG B NE    1 
ATOM   2848 C  CZ    . ARG B 1 30  ? 79.093 28.428  125.793 1.00 48.47 ? 66  ARG B CZ    1 
ATOM   2849 N  NH1   . ARG B 1 30  ? 78.338 28.153  126.848 1.00 44.50 ? 66  ARG B NH1   1 
ATOM   2850 N  NH2   . ARG B 1 30  ? 78.532 28.925  124.696 1.00 47.41 ? 66  ARG B NH2   1 
ATOM   2851 N  N     . ALA B 1 31  ? 84.875 26.544  130.687 1.00 21.17 ? 67  ALA B N     1 
ATOM   2852 C  CA    . ALA B 1 31  ? 85.904 25.625  131.162 1.00 24.90 ? 67  ALA B CA    1 
ATOM   2853 C  C     . ALA B 1 31  ? 85.304 24.505  132.011 1.00 20.41 ? 67  ALA B C     1 
ATOM   2854 O  O     . ALA B 1 31  ? 85.735 23.357  131.924 1.00 21.26 ? 67  ALA B O     1 
ATOM   2855 C  CB    . ALA B 1 31  ? 86.962 26.370  131.945 1.00 25.70 ? 67  ALA B CB    1 
ATOM   2856 N  N     . ALA B 1 32  ? 84.316 24.833  132.835 1.00 19.79 ? 68  ALA B N     1 
ATOM   2857 C  CA    . ALA B 1 32  ? 83.646 23.815  133.631 1.00 17.93 ? 68  ALA B CA    1 
ATOM   2858 C  C     . ALA B 1 32  ? 82.922 22.844  132.708 1.00 19.92 ? 68  ALA B C     1 
ATOM   2859 O  O     . ALA B 1 32  ? 82.962 21.631  132.919 1.00 18.26 ? 68  ALA B O     1 
ATOM   2860 C  CB    . ALA B 1 32  ? 82.677 24.449  134.602 1.00 24.16 ? 68  ALA B CB    1 
ATOM   2861 N  N     . LEU B 1 33  ? 82.254 23.376  131.688 1.00 17.27 ? 69  LEU B N     1 
ATOM   2862 C  CA    . LEU B 1 33  ? 81.586 22.523  130.703 1.00 22.30 ? 69  LEU B CA    1 
ATOM   2863 C  C     . LEU B 1 33  ? 82.566 21.566  130.023 1.00 19.03 ? 69  LEU B C     1 
ATOM   2864 O  O     . LEU B 1 33  ? 82.280 20.368  129.885 1.00 17.47 ? 69  LEU B O     1 
ATOM   2865 C  CB    . LEU B 1 33  ? 80.875 23.370  129.641 1.00 20.03 ? 69  LEU B CB    1 
ATOM   2866 C  CG    . LEU B 1 33  ? 80.204 22.584  128.509 1.00 20.58 ? 69  LEU B CG    1 
ATOM   2867 C  CD1   . LEU B 1 33  ? 79.297 21.499  129.069 1.00 20.25 ? 69  LEU B CD1   1 
ATOM   2868 C  CD2   . LEU B 1 33  ? 79.414 23.509  127.595 1.00 20.19 ? 69  LEU B CD2   1 
ATOM   2869 N  N     . ASP B 1 34  ? 83.703 22.090  129.578 1.00 18.56 ? 70  ASP B N     1 
ATOM   2870 C  CA    . ASP B 1 34  ? 84.710 21.249  128.928 1.00 20.21 ? 70  ASP B CA    1 
ATOM   2871 C  C     . ASP B 1 34  ? 85.240 20.172  129.877 1.00 18.65 ? 70  ASP B C     1 
ATOM   2872 O  O     . ASP B 1 34  ? 85.539 19.057  129.458 1.00 17.47 ? 70  ASP B O     1 
ATOM   2873 C  CB    . ASP B 1 34  ? 85.884 22.087  128.432 1.00 24.31 ? 70  ASP B CB    1 
ATOM   2874 C  CG    . ASP B 1 34  ? 85.493 23.090  127.352 1.00 28.63 ? 70  ASP B CG    1 
ATOM   2875 O  OD1   . ASP B 1 34  ? 84.444 22.939  126.681 1.00 28.26 ? 70  ASP B OD1   1 
ATOM   2876 O  OD2   . ASP B 1 34  ? 86.272 24.042  127.168 1.00 30.04 ? 70  ASP B OD2   1 
ATOM   2877 N  N     . THR B 1 35  ? 85.370 20.508  131.158 1.00 18.46 ? 71  THR B N     1 
ATOM   2878 C  CA    . THR B 1 35  ? 85.842 19.531  132.144 1.00 16.72 ? 71  THR B CA    1 
ATOM   2879 C  C     . THR B 1 35  ? 84.811 18.433  132.361 1.00 17.23 ? 71  THR B C     1 
ATOM   2880 O  O     . THR B 1 35  ? 85.150 17.244  132.433 1.00 15.77 ? 71  THR B O     1 
ATOM   2881 C  CB    . THR B 1 35  ? 86.156 20.212  133.477 1.00 21.05 ? 71  THR B CB    1 
ATOM   2882 O  OG1   . THR B 1 35  ? 87.180 21.193  133.268 1.00 22.38 ? 71  THR B OG1   1 
ATOM   2883 C  CG2   . THR B 1 35  ? 86.630 19.202  134.501 1.00 27.36 ? 71  THR B CG2   1 
ATOM   2884 N  N     . LEU B 1 36  ? 83.546 18.835  132.452 1.00 15.00 ? 72  LEU B N     1 
ATOM   2885 C  CA    . LEU B 1 36  ? 82.454 17.886  132.651 1.00 13.63 ? 72  LEU B CA    1 
ATOM   2886 C  C     . LEU B 1 36  ? 82.285 16.980  131.433 1.00 15.16 ? 72  LEU B C     1 
ATOM   2887 O  O     . LEU B 1 36  ? 81.920 15.806  131.561 1.00 12.58 ? 72  LEU B O     1 
ATOM   2888 C  CB    . LEU B 1 36  ? 81.148 18.636  132.946 1.00 17.45 ? 72  LEU B CB    1 
ATOM   2889 C  CG    . LEU B 1 36  ? 81.077 19.427  134.260 1.00 18.02 ? 72  LEU B CG    1 
ATOM   2890 C  CD1   . LEU B 1 36  ? 79.886 20.375  134.255 1.00 21.71 ? 72  LEU B CD1   1 
ATOM   2891 C  CD2   . LEU B 1 36  ? 80.950 18.469  135.422 1.00 21.51 ? 72  LEU B CD2   1 
ATOM   2892 N  N     . ARG B 1 37  ? 82.542 17.520  130.247 1.00 14.90 ? 73  ARG B N     1 
ATOM   2893 C  CA    . ARG B 1 37  ? 82.440 16.716  129.037 1.00 12.48 ? 73  ARG B CA    1 
ATOM   2894 C  C     . ARG B 1 37  ? 83.510 15.624  129.018 1.00 13.85 ? 73  ARG B C     1 
ATOM   2895 O  O     . ARG B 1 37  ? 83.227 14.467  128.657 1.00 13.45 ? 73  ARG B O     1 
ATOM   2896 C  CB    . ARG B 1 37  ? 82.514 17.608  127.789 1.00 18.60 ? 73  ARG B CB    1 
ATOM   2897 C  CG    . ARG B 1 37  ? 82.349 16.842  126.486 1.00 21.85 ? 73  ARG B CG    1 
ATOM   2898 C  CD    . ARG B 1 37  ? 82.345 17.760  125.270 1.00 26.93 ? 73  ARG B CD    1 
ATOM   2899 N  NE    . ARG B 1 37  ? 81.122 18.555  125.154 1.00 24.77 ? 73  ARG B NE    1 
ATOM   2900 C  CZ    . ARG B 1 37  ? 81.073 19.865  125.363 1.00 30.49 ? 73  ARG B CZ    1 
ATOM   2901 N  NH1   . ARG B 1 37  ? 82.179 20.510  125.700 1.00 34.59 ? 73  ARG B NH1   1 
ATOM   2902 N  NH2   . ARG B 1 37  ? 79.933 20.531  125.227 1.00 27.36 ? 73  ARG B NH2   1 
ATOM   2903 N  N     . LEU B 1 38  ? 84.726 15.974  129.430 1.00 13.21 ? 74  LEU B N     1 
ATOM   2904 C  CA    . LEU B 1 38  ? 85.809 14.986  129.529 1.00 14.44 ? 74  LEU B CA    1 
ATOM   2905 C  C     . LEU B 1 38  ? 85.467 13.888  130.517 1.00 15.21 ? 74  LEU B C     1 
ATOM   2906 O  O     . LEU B 1 38  ? 85.797 12.723  130.295 1.00 16.75 ? 74  LEU B O     1 
ATOM   2907 C  CB    . LEU B 1 38  ? 87.129 15.641  129.943 1.00 15.25 ? 74  LEU B CB    1 
ATOM   2908 C  CG    . LEU B 1 38  ? 87.855 16.473  128.894 1.00 20.60 ? 74  LEU B CG    1 
ATOM   2909 C  CD1   . LEU B 1 38  ? 88.895 17.365  129.568 1.00 19.73 ? 74  LEU B CD1   1 
ATOM   2910 C  CD2   . LEU B 1 38  ? 88.534 15.548  127.905 1.00 17.54 ? 74  LEU B CD2   1 
ATOM   2911 N  N     . CYS B 1 39  ? 84.821 14.256  131.616 1.00 14.31 ? 75  CYS B N     1 
ATOM   2912 C  CA    A CYS B 1 39  ? 84.388 13.277  132.619 0.58 15.61 ? 75  CYS B CA    1 
ATOM   2913 C  CA    B CYS B 1 39  ? 84.416 13.273  132.597 0.42 15.63 ? 75  CYS B CA    1 
ATOM   2914 C  C     . CYS B 1 39  ? 83.400 12.290  132.016 1.00 16.39 ? 75  CYS B C     1 
ATOM   2915 O  O     . CYS B 1 39  ? 83.492 11.084  132.243 1.00 15.20 ? 75  CYS B O     1 
ATOM   2916 C  CB    A CYS B 1 39  ? 83.708 13.962  133.813 0.58 20.64 ? 75  CYS B CB    1 
ATOM   2917 C  CB    B CYS B 1 39  ? 83.827 13.976  133.807 0.42 20.62 ? 75  CYS B CB    1 
ATOM   2918 S  SG    A CYS B 1 39  ? 84.767 14.992  134.865 0.58 22.95 ? 75  CYS B SG    1 
ATOM   2919 S  SG    B CYS B 1 39  ? 83.190 12.841  134.981 0.42 19.97 ? 75  CYS B SG    1 
ATOM   2920 N  N     . LEU B 1 40  ? 82.429 12.815  131.268 1.00 14.67 ? 76  LEU B N     1 
ATOM   2921 C  CA    . LEU B 1 40  ? 81.416 11.985  130.620 1.00 12.44 ? 76  LEU B CA    1 
ATOM   2922 C  C     . LEU B 1 40  ? 82.058 11.016  129.641 1.00 14.02 ? 76  LEU B C     1 
ATOM   2923 O  O     . LEU B 1 40  ? 81.745 9.820   129.629 1.00 13.98 ? 76  LEU B O     1 
ATOM   2924 C  CB    . LEU B 1 40  ? 80.374 12.868  129.898 1.00 10.51 ? 76  LEU B CB    1 
ATOM   2925 C  CG    . LEU B 1 40  ? 79.260 12.085  129.175 1.00 13.14 ? 76  LEU B CG    1 
ATOM   2926 C  CD1   . LEU B 1 40  ? 78.403 11.294  130.162 1.00 15.94 ? 76  LEU B CD1   1 
ATOM   2927 C  CD2   . LEU B 1 40  ? 78.390 13.017  128.327 1.00 16.58 ? 76  LEU B CD2   1 
ATOM   2928 N  N     . LYS B 1 41  ? 82.980 11.529  128.834 1.00 12.90 ? 77  LYS B N     1 
ATOM   2929 C  CA    . LYS B 1 41  ? 83.671 10.693  127.856 1.00 12.70 ? 77  LYS B CA    1 
ATOM   2930 C  C     . LYS B 1 41  ? 84.577 9.608   128.457 1.00 14.47 ? 77  LYS B C     1 
ATOM   2931 O  O     . LYS B 1 41  ? 84.966 8.674   127.752 1.00 13.14 ? 77  LYS B O     1 
ATOM   2932 C  CB    . LYS B 1 41  ? 84.466 11.554  126.870 1.00 12.22 ? 77  LYS B CB    1 
ATOM   2933 C  CG    . LYS B 1 41  ? 83.595 12.364  125.897 1.00 13.71 ? 77  LYS B CG    1 
ATOM   2934 C  CD    . LYS B 1 41  ? 82.677 11.454  125.057 1.00 12.09 ? 77  LYS B CD    1 
ATOM   2935 C  CE    . LYS B 1 41  ? 82.218 12.179  123.776 1.00 16.24 ? 77  LYS B CE    1 
ATOM   2936 N  NZ    . LYS B 1 41  ? 81.082 11.465  123.138 1.00 17.27 ? 77  LYS B NZ    1 
ATOM   2937 N  N     . ARG B 1 42  ? 84.926 9.713   129.734 1.00 12.23 ? 78  ARG B N     1 
ATOM   2938 C  CA    . ARG B 1 42  ? 85.657 8.600   130.351 1.00 18.14 ? 78  ARG B CA    1 
ATOM   2939 C  C     . ARG B 1 42  ? 84.729 7.438   130.706 1.00 17.97 ? 78  ARG B C     1 
ATOM   2940 O  O     . ARG B 1 42  ? 85.178 6.295   130.875 1.00 17.76 ? 78  ARG B O     1 
ATOM   2941 C  CB    . ARG B 1 42  ? 86.474 9.058   131.564 1.00 19.83 ? 78  ARG B CB    1 
ATOM   2942 C  CG    . ARG B 1 42  ? 87.681 9.903   131.179 1.00 20.63 ? 78  ARG B CG    1 
ATOM   2943 C  CD    . ARG B 1 42  ? 88.683 10.019  132.330 1.00 21.95 ? 78  ARG B CD    1 
ATOM   2944 N  NE    . ARG B 1 42  ? 88.096 10.577  133.543 1.00 23.41 ? 78  ARG B NE    1 
ATOM   2945 C  CZ    . ARG B 1 42  ? 87.902 11.875  133.763 1.00 27.66 ? 78  ARG B CZ    1 
ATOM   2946 N  NH1   . ARG B 1 42  ? 88.229 12.776  132.835 1.00 24.17 ? 78  ARG B NH1   1 
ATOM   2947 N  NH2   . ARG B 1 42  ? 87.376 12.273  134.913 1.00 29.52 ? 78  ARG B NH2   1 
ATOM   2948 N  N     . ILE B 1 43  ? 83.427 7.705   130.790 1.00 13.85 ? 79  ILE B N     1 
ATOM   2949 C  CA    . ILE B 1 43  ? 82.499 6.620   131.105 1.00 20.07 ? 79  ILE B CA    1 
ATOM   2950 C  C     . ILE B 1 43  ? 81.672 6.122   129.904 1.00 17.49 ? 79  ILE B C     1 
ATOM   2951 O  O     . ILE B 1 43  ? 81.235 4.977   129.890 1.00 17.43 ? 79  ILE B O     1 
ATOM   2952 C  CB    . ILE B 1 43  ? 81.642 6.913   132.375 1.00 28.40 ? 79  ILE B CB    1 
ATOM   2953 C  CG1   . ILE B 1 43  ? 80.562 7.950   132.098 1.00 27.79 ? 79  ILE B CG1   1 
ATOM   2954 C  CG2   . ILE B 1 43  ? 82.528 7.342   133.542 1.00 27.12 ? 79  ILE B CG2   1 
ATOM   2955 C  CD1   . ILE B 1 43  ? 79.203 7.323   131.957 1.00 28.46 ? 79  ILE B CD1   1 
ATOM   2956 N  N     . SER B 1 44  ? 81.484 6.970   128.892 1.00 14.08 ? 80  SER B N     1 
ATOM   2957 C  CA    . SER B 1 44  ? 80.813 6.552   127.657 1.00 13.66 ? 80  SER B CA    1 
ATOM   2958 C  C     . SER B 1 44  ? 81.364 7.299   126.444 1.00 14.29 ? 80  SER B C     1 
ATOM   2959 O  O     . SER B 1 44  ? 81.498 8.517   126.477 1.00 13.04 ? 80  SER B O     1 
ATOM   2960 C  CB    . SER B 1 44  ? 79.312 6.804   127.735 1.00 20.95 ? 80  SER B CB    1 
ATOM   2961 O  OG    . SER B 1 44  ? 78.704 6.495   126.485 1.00 16.98 ? 80  SER B OG    1 
ATOM   2962 N  N     . PRO B 1 45  ? 81.690 6.572   125.365 1.00 13.43 ? 81  PRO B N     1 
ATOM   2963 C  CA    . PRO B 1 45  ? 82.171 7.298   124.183 1.00 13.57 ? 81  PRO B CA    1 
ATOM   2964 C  C     . PRO B 1 45  ? 81.006 7.827   123.355 1.00 15.94 ? 81  PRO B C     1 
ATOM   2965 O  O     . PRO B 1 45  ? 81.193 8.710   122.504 1.00 14.98 ? 81  PRO B O     1 
ATOM   2966 C  CB    . PRO B 1 45  ? 82.936 6.220   123.402 1.00 14.24 ? 81  PRO B CB    1 
ATOM   2967 C  CG    . PRO B 1 45  ? 82.271 4.940   123.811 1.00 17.78 ? 81  PRO B CG    1 
ATOM   2968 C  CD    . PRO B 1 45  ? 81.868 5.113   125.238 1.00 14.92 ? 81  PRO B CD    1 
ATOM   2969 N  N     . ASP B 1 46  ? 79.809 7.309   123.607 1.00 9.93  ? 82  ASP B N     1 
ATOM   2970 C  CA    . ASP B 1 46  ? 78.661 7.678   122.774 1.00 13.88 ? 82  ASP B CA    1 
ATOM   2971 C  C     . ASP B 1 46  ? 77.849 8.877   123.281 1.00 19.47 ? 82  ASP B C     1 
ATOM   2972 O  O     . ASP B 1 46  ? 77.247 9.613   122.494 1.00 20.73 ? 82  ASP B O     1 
ATOM   2973 C  CB    . ASP B 1 46  ? 77.777 6.467   122.547 1.00 17.46 ? 82  ASP B CB    1 
ATOM   2974 C  CG    . ASP B 1 46  ? 78.561 5.291   121.993 1.00 19.22 ? 82  ASP B CG    1 
ATOM   2975 O  OD1   . ASP B 1 46  ? 79.263 5.474   120.975 1.00 17.24 ? 82  ASP B OD1   1 
ATOM   2976 O  OD2   . ASP B 1 46  ? 78.508 4.203   122.595 1.00 20.23 ? 82  ASP B OD2   1 
ATOM   2977 N  N     . ALA B 1 47  ? 77.868 9.097   124.584 1.00 17.34 ? 83  ALA B N     1 
ATOM   2978 C  CA    . ALA B 1 47  ? 77.098 10.188  125.182 1.00 14.79 ? 83  ALA B CA    1 
ATOM   2979 C  C     . ALA B 1 47  ? 77.756 11.542  124.933 1.00 16.25 ? 83  ALA B C     1 
ATOM   2980 O  O     . ALA B 1 47  ? 78.989 11.663  124.907 1.00 14.85 ? 83  ALA B O     1 
ATOM   2981 C  CB    . ALA B 1 47  ? 76.933 9.960   126.660 1.00 15.31 ? 83  ALA B CB    1 
ATOM   2982 N  N     . GLU B 1 48  ? 76.936 12.575  124.768 1.00 15.04 ? 84  GLU B N     1 
ATOM   2983 C  CA    . GLU B 1 48  ? 77.472 13.919  124.616 1.00 13.27 ? 84  GLU B CA    1 
ATOM   2984 C  C     . GLU B 1 48  ? 76.861 14.802  125.690 1.00 14.00 ? 84  GLU B C     1 
ATOM   2985 O  O     . GLU B 1 48  ? 75.828 14.462  126.273 1.00 14.86 ? 84  GLU B O     1 
ATOM   2986 C  CB    . GLU B 1 48  ? 77.210 14.458  123.206 1.00 20.21 ? 84  GLU B CB    1 
ATOM   2987 C  CG    . GLU B 1 48  ? 77.801 13.585  122.071 1.00 21.96 ? 84  GLU B CG    1 
ATOM   2988 C  CD    . GLU B 1 48  ? 79.330 13.706  121.886 1.00 28.69 ? 84  GLU B CD    1 
ATOM   2989 O  OE1   . GLU B 1 48  ? 79.932 12.810  121.229 1.00 24.95 ? 84  GLU B OE1   1 
ATOM   2990 O  OE2   . GLU B 1 48  ? 79.934 14.694  122.364 1.00 30.88 ? 84  GLU B OE2   1 
ATOM   2991 N  N     . LEU B 1 49  ? 77.524 15.904  125.992 1.00 13.71 ? 85  LEU B N     1 
ATOM   2992 C  CA    . LEU B 1 49  ? 77.019 16.812  127.013 1.00 16.31 ? 85  LEU B CA    1 
ATOM   2993 C  C     . LEU B 1 49  ? 76.831 18.164  126.342 1.00 17.44 ? 85  LEU B C     1 
ATOM   2994 O  O     . LEU B 1 49  ? 77.781 18.744  125.801 1.00 16.28 ? 85  LEU B O     1 
ATOM   2995 C  CB    . LEU B 1 49  ? 77.992 16.905  128.190 1.00 12.69 ? 85  LEU B CB    1 
ATOM   2996 C  CG    . LEU B 1 49  ? 77.611 17.803  129.366 1.00 17.62 ? 85  LEU B CG    1 
ATOM   2997 C  CD1   . LEU B 1 49  ? 76.432 17.221  130.129 1.00 13.52 ? 85  LEU B CD1   1 
ATOM   2998 C  CD2   . LEU B 1 49  ? 78.802 17.998  130.295 1.00 16.48 ? 85  LEU B CD2   1 
ATOM   2999 N  N     . VAL B 1 50  ? 75.593 18.644  126.377 1.00 18.09 ? 86  VAL B N     1 
ATOM   3000 C  CA    . VAL B 1 50  ? 75.177 19.824  125.630 1.00 24.13 ? 86  VAL B CA    1 
ATOM   3001 C  C     . VAL B 1 50  ? 74.674 20.892  126.591 1.00 19.33 ? 86  VAL B C     1 
ATOM   3002 O  O     . VAL B 1 50  ? 73.911 20.582  127.504 1.00 17.57 ? 86  VAL B O     1 
ATOM   3003 C  CB    . VAL B 1 50  ? 74.046 19.425  124.654 1.00 18.73 ? 86  VAL B CB    1 
ATOM   3004 C  CG1   . VAL B 1 50  ? 73.402 20.635  124.016 1.00 26.22 ? 86  VAL B CG1   1 
ATOM   3005 C  CG2   . VAL B 1 50  ? 74.604 18.500  123.580 1.00 30.67 ? 86  VAL B CG2   1 
ATOM   3006 N  N     . ALA B 1 51  ? 75.098 22.142  126.394 1.00 19.11 ? 87  ALA B N     1 
ATOM   3007 C  CA    . ALA B 1 51  ? 74.596 23.250  127.207 1.00 18.81 ? 87  ALA B CA    1 
ATOM   3008 C  C     . ALA B 1 51  ? 73.348 23.843  126.556 1.00 17.95 ? 87  ALA B C     1 
ATOM   3009 O  O     . ALA B 1 51  ? 73.281 23.926  125.331 1.00 16.18 ? 87  ALA B O     1 
ATOM   3010 C  CB    . ALA B 1 51  ? 75.658 24.320  127.360 1.00 19.93 ? 87  ALA B CB    1 
ATOM   3011 N  N     . PHE B 1 52  ? 72.369 24.249  127.364 1.00 15.10 ? 88  PHE B N     1 
ATOM   3012 C  CA    . PHE B 1 52  ? 71.212 24.988  126.847 1.00 16.96 ? 88  PHE B CA    1 
ATOM   3013 C  C     . PHE B 1 52  ? 70.883 26.164  127.768 1.00 19.59 ? 88  PHE B C     1 
ATOM   3014 O  O     . PHE B 1 52  ? 71.654 26.454  128.689 1.00 17.30 ? 88  PHE B O     1 
ATOM   3015 C  CB    . PHE B 1 52  ? 70.004 24.068  126.615 1.00 15.64 ? 88  PHE B CB    1 
ATOM   3016 C  CG    . PHE B 1 52  ? 69.423 23.470  127.872 1.00 18.68 ? 88  PHE B CG    1 
ATOM   3017 C  CD1   . PHE B 1 52  ? 69.971 22.323  128.437 1.00 17.06 ? 88  PHE B CD1   1 
ATOM   3018 C  CD2   . PHE B 1 52  ? 68.306 24.040  128.472 1.00 17.07 ? 88  PHE B CD2   1 
ATOM   3019 C  CE1   . PHE B 1 52  ? 69.422 21.766  129.591 1.00 19.05 ? 88  PHE B CE1   1 
ATOM   3020 C  CE2   . PHE B 1 52  ? 67.759 23.496  129.625 1.00 20.43 ? 88  PHE B CE2   1 
ATOM   3021 C  CZ    . PHE B 1 52  ? 68.316 22.350  130.184 1.00 22.74 ? 88  PHE B CZ    1 
ATOM   3022 N  N     . GLY B 1 53  ? 69.778 26.868  127.517 1.00 16.89 ? 89  GLY B N     1 
ATOM   3023 C  CA    . GLY B 1 53  ? 69.438 28.009  128.359 1.00 18.11 ? 89  GLY B CA    1 
ATOM   3024 C  C     . GLY B 1 53  ? 70.356 29.210  128.158 1.00 21.68 ? 89  GLY B C     1 
ATOM   3025 O  O     . GLY B 1 53  ? 71.082 29.280  127.167 1.00 17.47 ? 89  GLY B O     1 
ATOM   3026 N  N     . SER B 1 54  ? 70.345 30.150  129.108 1.00 21.13 ? 90  SER B N     1 
ATOM   3027 C  CA    . SER B 1 54  ? 70.916 31.485  128.873 1.00 18.88 ? 90  SER B CA    1 
ATOM   3028 C  C     . SER B 1 54  ? 72.414 31.547  128.550 1.00 20.08 ? 90  SER B C     1 
ATOM   3029 O  O     . SER B 1 54  ? 72.837 32.351  127.718 1.00 21.28 ? 90  SER B O     1 
ATOM   3030 C  CB    . SER B 1 54  ? 70.590 32.420  130.038 1.00 25.99 ? 90  SER B CB    1 
ATOM   3031 O  OG    . SER B 1 54  ? 71.191 31.965  131.237 1.00 26.03 ? 90  SER B OG    1 
ATOM   3032 N  N     . LEU B 1 55  ? 73.223 30.716  129.197 1.00 22.52 ? 91  LEU B N     1 
ATOM   3033 C  CA    . LEU B 1 55  ? 74.654 30.711  128.898 1.00 26.61 ? 91  LEU B CA    1 
ATOM   3034 C  C     . LEU B 1 55  ? 74.907 30.430  127.416 1.00 27.86 ? 91  LEU B C     1 
ATOM   3035 O  O     . LEU B 1 55  ? 75.771 31.046  126.785 1.00 27.75 ? 91  LEU B O     1 
ATOM   3036 C  CB    . LEU B 1 55  ? 75.348 29.640  129.722 1.00 27.15 ? 91  LEU B CB    1 
ATOM   3037 C  CG    . LEU B 1 55  ? 76.598 29.978  130.518 1.00 37.61 ? 91  LEU B CG    1 
ATOM   3038 C  CD1   . LEU B 1 55  ? 76.252 30.079  131.998 1.00 34.17 ? 91  LEU B CD1   1 
ATOM   3039 C  CD2   . LEU B 1 55  ? 77.667 28.919  130.275 1.00 36.62 ? 91  LEU B CD2   1 
ATOM   3040 N  N     . GLU B 1 56  ? 74.142 29.490  126.870 1.00 21.96 ? 92  GLU B N     1 
ATOM   3041 C  CA    . GLU B 1 56  ? 74.318 29.056  125.484 1.00 18.30 ? 92  GLU B CA    1 
ATOM   3042 C  C     . GLU B 1 56  ? 73.748 30.094  124.528 1.00 19.80 ? 92  GLU B C     1 
ATOM   3043 O  O     . GLU B 1 56  ? 74.320 30.366  123.483 1.00 19.34 ? 92  GLU B O     1 
ATOM   3044 C  CB    . GLU B 1 56  ? 73.634 27.700  125.283 1.00 23.58 ? 92  GLU B CB    1 
ATOM   3045 C  CG    . GLU B 1 56  ? 73.833 27.071  123.911 1.00 20.18 ? 92  GLU B CG    1 
ATOM   3046 C  CD    . GLU B 1 56  ? 75.247 26.533  123.687 1.00 24.99 ? 92  GLU B CD    1 
ATOM   3047 O  OE1   . GLU B 1 56  ? 76.081 26.577  124.615 1.00 26.26 ? 92  GLU B OE1   1 
ATOM   3048 O  OE2   . GLU B 1 56  ? 75.522 26.058  122.564 1.00 28.61 ? 92  GLU B OE2   1 
ATOM   3049 N  N     . SER B 1 57  ? 72.637 30.712  124.911 1.00 18.91 ? 93  SER B N     1 
ATOM   3050 C  CA    . SER B 1 57  ? 71.982 31.670  124.032 1.00 19.23 ? 93  SER B CA    1 
ATOM   3051 C  C     . SER B 1 57  ? 72.620 33.049  124.151 1.00 20.95 ? 93  SER B C     1 
ATOM   3052 O  O     . SER B 1 57  ? 72.342 33.936  123.348 1.00 21.56 ? 93  SER B O     1 
ATOM   3053 C  CB    . SER B 1 57  ? 70.494 31.752  124.353 1.00 17.19 ? 93  SER B CB    1 
ATOM   3054 O  OG    . SER B 1 57  ? 70.302 32.204  125.679 1.00 22.96 ? 93  SER B OG    1 
ATOM   3055 N  N     . GLY B 1 58  ? 73.467 33.230  125.162 1.00 20.25 ? 94  GLY B N     1 
ATOM   3056 C  CA    . GLY B 1 58  ? 74.135 34.503  125.364 1.00 21.28 ? 94  GLY B CA    1 
ATOM   3057 C  C     . GLY B 1 58  ? 73.237 35.525  126.037 1.00 23.13 ? 94  GLY B C     1 
ATOM   3058 O  O     . GLY B 1 58  ? 73.442 36.733  125.896 1.00 25.65 ? 94  GLY B O     1 
ATOM   3059 N  N     . LEU B 1 59  ? 72.231 35.034  126.757 1.00 17.65 ? 95  LEU B N     1 
ATOM   3060 C  CA    . LEU B 1 59  ? 71.268 35.886  127.454 1.00 15.62 ? 95  LEU B CA    1 
ATOM   3061 C  C     . LEU B 1 59  ? 71.410 35.763  128.964 1.00 18.97 ? 95  LEU B C     1 
ATOM   3062 O  O     . LEU B 1 59  ? 70.417 35.811  129.691 1.00 20.75 ? 95  LEU B O     1 
ATOM   3063 C  CB    . LEU B 1 59  ? 69.840 35.511  127.050 1.00 12.88 ? 95  LEU B CB    1 
ATOM   3064 C  CG    . LEU B 1 59  ? 69.484 35.678  125.569 1.00 15.12 ? 95  LEU B CG    1 
ATOM   3065 C  CD1   . LEU B 1 59  ? 68.058 35.196  125.316 1.00 15.56 ? 95  LEU B CD1   1 
ATOM   3066 C  CD2   . LEU B 1 59  ? 69.639 37.121  125.124 1.00 14.02 ? 95  LEU B CD2   1 
ATOM   3067 N  N     . ALA B 1 60  ? 72.639 35.610  129.449 1.00 17.97 ? 96  ALA B N     1 
ATOM   3068 C  CA    . ALA B 1 60  ? 72.825 35.357  130.879 1.00 20.42 ? 96  ALA B CA    1 
ATOM   3069 C  C     . ALA B 1 60  ? 73.244 36.610  131.653 1.00 18.98 ? 96  ALA B C     1 
ATOM   3070 O  O     . ALA B 1 60  ? 73.996 37.450  131.141 1.00 22.03 ? 96  ALA B O     1 
ATOM   3071 C  CB    . ALA B 1 60  ? 73.830 34.250  131.092 1.00 23.33 ? 96  ALA B CB    1 
ATOM   3072 N  N     . LEU B 1 61  ? 72.764 36.719  132.889 1.00 24.74 ? 97  LEU B N     1 
ATOM   3073 C  CA    . LEU B 1 61  ? 73.264 37.720  133.828 1.00 24.28 ? 97  LEU B CA    1 
ATOM   3074 C  C     . LEU B 1 61  ? 74.464 37.137  134.568 1.00 25.20 ? 97  LEU B C     1 
ATOM   3075 O  O     . LEU B 1 61  ? 74.736 35.940  134.466 1.00 23.92 ? 97  LEU B O     1 
ATOM   3076 C  CB    . LEU B 1 61  ? 72.169 38.098  134.825 1.00 22.35 ? 97  LEU B CB    1 
ATOM   3077 C  CG    . LEU B 1 61  ? 70.912 38.753  134.255 1.00 25.32 ? 97  LEU B CG    1 
ATOM   3078 C  CD1   . LEU B 1 61  ? 69.795 38.785  135.298 1.00 24.49 ? 97  LEU B CD1   1 
ATOM   3079 C  CD2   . LEU B 1 61  ? 71.219 40.161  133.758 1.00 17.17 ? 97  LEU B CD2   1 
ATOM   3080 N  N     . LYS B 1 62  ? 75.201 37.956  135.310 1.00 27.28 ? 98  LYS B N     1 
ATOM   3081 C  CA    . LYS B 1 62  ? 76.308 37.388  136.082 1.00 31.87 ? 98  LYS B CA    1 
ATOM   3082 C  C     . LYS B 1 62  ? 75.803 36.468  137.197 1.00 28.77 ? 98  LYS B C     1 
ATOM   3083 O  O     . LYS B 1 62  ? 74.648 36.577  137.623 1.00 27.28 ? 98  LYS B O     1 
ATOM   3084 C  CB    . LYS B 1 62  ? 77.267 38.463  136.606 1.00 32.64 ? 98  LYS B CB    1 
ATOM   3085 C  CG    . LYS B 1 62  ? 76.640 39.548  137.437 1.00 35.97 ? 98  LYS B CG    1 
ATOM   3086 C  CD    . LYS B 1 62  ? 77.633 40.692  137.647 1.00 35.27 ? 98  LYS B CD    1 
ATOM   3087 C  CE    . LYS B 1 62  ? 78.361 41.023  136.357 1.00 35.24 ? 98  LYS B CE    1 
ATOM   3088 N  NZ    . LYS B 1 62  ? 79.247 42.218  136.455 1.00 39.64 ? 98  LYS B NZ    1 
ATOM   3089 N  N     . ASN B 1 63  ? 76.656 35.533  137.617 1.00 28.66 ? 99  ASN B N     1 
ATOM   3090 C  CA    . ASN B 1 63  ? 76.311 34.517  138.621 1.00 32.54 ? 99  ASN B CA    1 
ATOM   3091 C  C     . ASN B 1 63  ? 75.141 33.616  138.209 1.00 35.29 ? 99  ASN B C     1 
ATOM   3092 O  O     . ASN B 1 63  ? 74.429 33.069  139.053 1.00 37.50 ? 99  ASN B O     1 
ATOM   3093 C  CB    . ASN B 1 63  ? 76.042 35.170  139.985 1.00 35.31 ? 99  ASN B CB    1 
ATOM   3094 C  CG    . ASN B 1 63  ? 77.097 36.206  140.354 1.00 41.61 ? 99  ASN B CG    1 
ATOM   3095 O  OD1   . ASN B 1 63  ? 76.783 37.380  140.577 1.00 42.91 ? 99  ASN B OD1   1 
ATOM   3096 N  ND2   . ASN B 1 63  ? 78.357 35.776  140.409 1.00 40.37 ? 99  ASN B ND2   1 
ATOM   3097 N  N     . SER B 1 64  ? 74.952 33.454  136.905 1.00 34.18 ? 100 SER B N     1 
ATOM   3098 C  CA    . SER B 1 64  ? 73.837 32.662  136.406 1.00 31.14 ? 100 SER B CA    1 
ATOM   3099 C  C     . SER B 1 64  ? 74.131 31.176  136.524 1.00 33.78 ? 100 SER B C     1 
ATOM   3100 O  O     . SER B 1 64  ? 75.291 30.759  136.562 1.00 31.23 ? 100 SER B O     1 
ATOM   3101 C  CB    . SER B 1 64  ? 73.527 33.010  134.952 1.00 35.42 ? 100 SER B CB    1 
ATOM   3102 O  OG    . SER B 1 64  ? 74.388 32.320  134.069 1.00 40.88 ? 100 SER B OG    1 
ATOM   3103 N  N     . ASP B 1 65  ? 73.061 30.393  136.594 1.00 34.49 ? 101 ASP B N     1 
ATOM   3104 C  CA    . ASP B 1 65  ? 73.122 28.942  136.636 1.00 34.11 ? 101 ASP B CA    1 
ATOM   3105 C  C     . ASP B 1 65  ? 73.506 28.392  135.275 1.00 32.71 ? 101 ASP B C     1 
ATOM   3106 O  O     . ASP B 1 65  ? 73.252 29.033  134.252 1.00 28.24 ? 101 ASP B O     1 
ATOM   3107 C  CB    . ASP B 1 65  ? 71.736 28.403  136.983 1.00 38.55 ? 101 ASP B CB    1 
ATOM   3108 C  CG    . ASP B 1 65  ? 70.652 28.947  136.051 1.00 45.89 ? 101 ASP B CG    1 
ATOM   3109 O  OD1   . ASP B 1 65  ? 70.782 30.111  135.607 1.00 48.94 ? 101 ASP B OD1   1 
ATOM   3110 O  OD2   . ASP B 1 65  ? 69.675 28.218  135.760 1.00 49.11 ? 101 ASP B OD2   1 
ATOM   3111 N  N     . MET B 1 66  ? 74.124 27.214  135.269 1.00 27.62 ? 102 MET B N     1 
ATOM   3112 C  CA    . MET B 1 66  ? 74.337 26.461  134.033 1.00 26.11 ? 102 MET B CA    1 
ATOM   3113 C  C     . MET B 1 66  ? 73.268 25.384  133.908 1.00 24.97 ? 102 MET B C     1 
ATOM   3114 O  O     . MET B 1 66  ? 72.888 24.757  134.897 1.00 28.23 ? 102 MET B O     1 
ATOM   3115 C  CB    . MET B 1 66  ? 75.706 25.788  134.028 1.00 26.59 ? 102 MET B CB    1 
ATOM   3116 C  CG    . MET B 1 66  ? 76.863 26.733  134.188 1.00 33.54 ? 102 MET B CG    1 
ATOM   3117 S  SD    . MET B 1 66  ? 78.425 25.841  134.162 1.00 45.42 ? 102 MET B SD    1 
ATOM   3118 C  CE    . MET B 1 66  ? 78.443 25.250  132.466 1.00 23.31 ? 102 MET B CE    1 
ATOM   3119 N  N     . ASP B 1 67  ? 72.775 25.182  132.693 1.00 20.36 ? 103 ASP B N     1 
ATOM   3120 C  CA    . ASP B 1 67  ? 71.843 24.104  132.419 1.00 20.08 ? 103 ASP B CA    1 
ATOM   3121 C  C     . ASP B 1 67  ? 72.473 23.234  131.353 1.00 21.77 ? 103 ASP B C     1 
ATOM   3122 O  O     . ASP B 1 67  ? 72.782 23.716  130.254 1.00 15.55 ? 103 ASP B O     1 
ATOM   3123 C  CB    . ASP B 1 67  ? 70.506 24.660  131.919 1.00 23.42 ? 103 ASP B CB    1 
ATOM   3124 C  CG    . ASP B 1 67  ? 69.664 25.254  133.037 1.00 31.13 ? 103 ASP B CG    1 
ATOM   3125 O  OD1   . ASP B 1 67  ? 69.381 24.533  134.019 1.00 34.72 ? 103 ASP B OD1   1 
ATOM   3126 O  OD2   . ASP B 1 67  ? 69.297 26.443  132.935 1.00 33.91 ? 103 ASP B OD2   1 
ATOM   3127 N  N     . LEU B 1 68  ? 72.681 21.961  131.680 1.00 16.03 ? 104 LEU B N     1 
ATOM   3128 C  CA    . LEU B 1 68  ? 73.306 21.035  130.749 1.00 17.79 ? 104 LEU B CA    1 
ATOM   3129 C  C     . LEU B 1 68  ? 72.435 19.806  130.592 1.00 15.86 ? 104 LEU B C     1 
ATOM   3130 O  O     . LEU B 1 68  ? 71.598 19.497  131.442 1.00 14.83 ? 104 LEU B O     1 
ATOM   3131 C  CB    . LEU B 1 68  ? 74.694 20.605  131.242 1.00 17.20 ? 104 LEU B CB    1 
ATOM   3132 C  CG    . LEU B 1 68  ? 75.686 21.688  131.658 1.00 21.63 ? 104 LEU B CG    1 
ATOM   3133 C  CD1   . LEU B 1 68  ? 76.959 21.050  132.204 1.00 21.78 ? 104 LEU B CD1   1 
ATOM   3134 C  CD2   . LEU B 1 68  ? 76.016 22.605  130.490 1.00 20.56 ? 104 LEU B CD2   1 
ATOM   3135 N  N     . CYS B 1 69  ? 72.674 19.084  129.506 1.00 15.92 ? 105 CYS B N     1 
ATOM   3136 C  CA    . CYS B 1 69  ? 71.842 17.977  129.108 1.00 17.59 ? 105 CYS B CA    1 
ATOM   3137 C  C     . CYS B 1 69  ? 72.760 16.853  128.633 1.00 15.90 ? 105 CYS B C     1 
ATOM   3138 O  O     . CYS B 1 69  ? 73.614 17.089  127.779 1.00 19.57 ? 105 CYS B O     1 
ATOM   3139 C  CB    . CYS B 1 69  ? 70.993 18.475  127.937 1.00 20.07 ? 105 CYS B CB    1 
ATOM   3140 S  SG    . CYS B 1 69  ? 69.832 17.332  127.329 1.00 31.51 ? 105 CYS B SG    1 
ATOM   3141 N  N     . VAL B 1 70  ? 72.622 15.648  129.184 1.00 17.20 ? 106 VAL B N     1 
ATOM   3142 C  CA    . VAL B 1 70  ? 73.342 14.506  128.618 1.00 18.22 ? 106 VAL B CA    1 
ATOM   3143 C  C     . VAL B 1 70  ? 72.506 13.874  127.501 1.00 17.27 ? 106 VAL B C     1 
ATOM   3144 O  O     . VAL B 1 70  ? 71.354 13.491  127.727 1.00 20.61 ? 106 VAL B O     1 
ATOM   3145 C  CB    . VAL B 1 70  ? 73.712 13.437  129.676 1.00 17.57 ? 106 VAL B CB    1 
ATOM   3146 C  CG1   . VAL B 1 70  ? 74.307 12.193  128.999 1.00 17.72 ? 106 VAL B CG1   1 
ATOM   3147 C  CG2   . VAL B 1 70  ? 74.723 14.010  130.675 1.00 17.41 ? 106 VAL B CG2   1 
ATOM   3148 N  N     . LEU B 1 71  ? 73.081 13.791  126.301 1.00 17.23 ? 107 LEU B N     1 
ATOM   3149 C  CA    . LEU B 1 71  ? 72.397 13.194  125.150 1.00 19.35 ? 107 LEU B CA    1 
ATOM   3150 C  C     . LEU B 1 71  ? 72.869 11.766  124.921 1.00 23.67 ? 107 LEU B C     1 
ATOM   3151 O  O     . LEU B 1 71  ? 74.068 11.528  124.754 1.00 21.90 ? 107 LEU B O     1 
ATOM   3152 C  CB    . LEU B 1 71  ? 72.657 14.011  123.885 1.00 22.06 ? 107 LEU B CB    1 
ATOM   3153 C  CG    . LEU B 1 71  ? 72.038 15.411  123.900 1.00 19.66 ? 107 LEU B CG    1 
ATOM   3154 C  CD1   . LEU B 1 71  ? 72.176 16.076  122.535 1.00 27.48 ? 107 LEU B CD1   1 
ATOM   3155 C  CD2   . LEU B 1 71  ? 70.580 15.345  124.326 1.00 26.41 ? 107 LEU B CD2   1 
ATOM   3156 N  N     . MET B 1 72  ? 71.927 10.823  124.900 1.00 28.52 ? 108 MET B N     1 
ATOM   3157 C  CA    . MET B 1 72  ? 72.253 9.413   124.687 1.00 39.49 ? 108 MET B CA    1 
ATOM   3158 C  C     . MET B 1 72  ? 71.042 8.629   124.185 1.00 39.88 ? 108 MET B C     1 
ATOM   3159 O  O     . MET B 1 72  ? 70.208 9.160   123.450 1.00 39.02 ? 108 MET B O     1 
ATOM   3160 C  CB    . MET B 1 72  ? 72.797 8.788   125.980 1.00 34.70 ? 108 MET B CB    1 
ATOM   3161 C  CG    . MET B 1 72  ? 71.939 9.075   127.208 1.00 38.25 ? 108 MET B CG    1 
ATOM   3162 S  SD    . MET B 1 72  ? 72.629 8.397   128.736 1.00 59.70 ? 108 MET B SD    1 
ATOM   3163 C  CE    . MET B 1 72  ? 71.287 8.718   129.883 1.00 32.12 ? 108 MET B CE    1 
ATOM   3164 N  N     . THR B 1 80  ? 72.204 3.973   134.835 1.00 50.98 ? 116 THR B N     1 
ATOM   3165 C  CA    . THR B 1 80  ? 73.200 3.413   133.925 1.00 51.39 ? 116 THR B CA    1 
ATOM   3166 C  C     . THR B 1 80  ? 74.421 4.325   133.798 1.00 47.71 ? 116 THR B C     1 
ATOM   3167 O  O     . THR B 1 80  ? 75.290 4.357   134.676 1.00 41.39 ? 116 THR B O     1 
ATOM   3168 C  CB    . THR B 1 80  ? 72.599 3.146   132.521 1.00 52.08 ? 116 THR B CB    1 
ATOM   3169 O  OG1   . THR B 1 80  ? 71.948 4.330   132.042 1.00 53.75 ? 116 THR B OG1   1 
ATOM   3170 C  CG2   . THR B 1 80  ? 71.587 2.014   132.578 1.00 57.08 ? 116 THR B CG2   1 
ATOM   3171 N  N     . ILE B 1 81  ? 74.478 5.064   132.696 1.00 46.88 ? 117 ILE B N     1 
ATOM   3172 C  CA    . ILE B 1 81  ? 75.554 6.015   132.455 1.00 35.94 ? 117 ILE B CA    1 
ATOM   3173 C  C     . ILE B 1 81  ? 75.454 7.171   133.453 1.00 31.75 ? 117 ILE B C     1 
ATOM   3174 O  O     . ILE B 1 81  ? 76.464 7.675   133.951 1.00 32.87 ? 117 ILE B O     1 
ATOM   3175 C  CB    . ILE B 1 81  ? 75.517 6.515   130.986 1.00 36.97 ? 117 ILE B CB    1 
ATOM   3176 C  CG1   . ILE B 1 81  ? 76.515 5.733   130.126 1.00 44.71 ? 117 ILE B CG1   1 
ATOM   3177 C  CG2   . ILE B 1 81  ? 75.830 7.998   130.887 1.00 33.87 ? 117 ILE B CG2   1 
ATOM   3178 C  CD1   . ILE B 1 81  ? 76.388 4.227   130.231 1.00 36.16 ? 117 ILE B CD1   1 
ATOM   3179 N  N     . ALA B 1 82  ? 74.224 7.553   133.770 1.00 30.78 ? 118 ALA B N     1 
ATOM   3180 C  CA    . ALA B 1 82  ? 73.966 8.668   134.671 1.00 31.08 ? 118 ALA B CA    1 
ATOM   3181 C  C     . ALA B 1 82  ? 74.593 8.472   136.057 1.00 35.37 ? 118 ALA B C     1 
ATOM   3182 O  O     . ALA B 1 82  ? 75.242 9.381   136.588 1.00 25.80 ? 118 ALA B O     1 
ATOM   3183 C  CB    . ALA B 1 82  ? 72.479 8.913   134.782 1.00 31.99 ? 118 ALA B CB    1 
ATOM   3184 N  N     . LEU B 1 83  ? 74.405 7.291   136.642 1.00 34.11 ? 119 LEU B N     1 
ATOM   3185 C  CA    . LEU B 1 83  ? 74.929 7.036   137.976 1.00 32.46 ? 119 LEU B CA    1 
ATOM   3186 C  C     . LEU B 1 83  ? 76.455 7.038   137.962 1.00 31.78 ? 119 LEU B C     1 
ATOM   3187 O  O     . LEU B 1 83  ? 77.076 7.697   138.806 1.00 30.25 ? 119 LEU B O     1 
ATOM   3188 C  CB    . LEU B 1 83  ? 74.362 5.732   138.560 1.00 36.20 ? 119 LEU B CB    1 
ATOM   3189 C  CG    . LEU B 1 83  ? 74.513 5.469   140.070 1.00 42.56 ? 119 LEU B CG    1 
ATOM   3190 C  CD1   . LEU B 1 83  ? 74.615 6.746   140.885 1.00 34.52 ? 119 LEU B CD1   1 
ATOM   3191 C  CD2   . LEU B 1 83  ? 73.349 4.633   140.581 1.00 42.62 ? 119 LEU B CD2   1 
ATOM   3192 N  N     . GLN B 1 84  ? 77.055 6.341   136.992 1.00 30.09 ? 120 GLN B N     1 
ATOM   3193 C  CA    . GLN B 1 84  ? 78.512 6.331   136.862 1.00 30.54 ? 120 GLN B CA    1 
ATOM   3194 C  C     . GLN B 1 84  ? 79.055 7.721   136.597 1.00 27.55 ? 120 GLN B C     1 
ATOM   3195 O  O     . GLN B 1 84  ? 80.136 8.066   137.071 1.00 27.11 ? 120 GLN B O     1 
ATOM   3196 C  CB    . GLN B 1 84  ? 78.986 5.451   135.708 1.00 29.63 ? 120 GLN B CB    1 
ATOM   3197 C  CG    . GLN B 1 84  ? 78.245 4.162   135.474 1.00 37.43 ? 120 GLN B CG    1 
ATOM   3198 C  CD    . GLN B 1 84  ? 78.926 3.340   134.398 1.00 36.86 ? 120 GLN B CD    1 
ATOM   3199 O  OE1   . GLN B 1 84  ? 80.157 3.274   134.346 1.00 34.65 ? 120 GLN B OE1   1 
ATOM   3200 N  NE2   . GLN B 1 84  ? 78.136 2.726   133.524 1.00 43.16 ? 120 GLN B NE2   1 
ATOM   3201 N  N     . PHE B 1 85  ? 78.324 8.500   135.802 1.00 28.61 ? 121 PHE B N     1 
ATOM   3202 C  CA    . PHE B 1 85  ? 78.731 9.868   135.502 1.00 26.61 ? 121 PHE B CA    1 
ATOM   3203 C  C     . PHE B 1 85  ? 78.783 10.634  136.812 1.00 24.97 ? 121 PHE B C     1 
ATOM   3204 O  O     . PHE B 1 85  ? 79.792 11.274  137.121 1.00 26.07 ? 121 PHE B O     1 
ATOM   3205 C  CB    . PHE B 1 85  ? 77.762 10.520  134.504 1.00 21.11 ? 121 PHE B CB    1 
ATOM   3206 C  CG    . PHE B 1 85  ? 78.138 11.925  134.097 1.00 17.68 ? 121 PHE B CG    1 
ATOM   3207 C  CD1   . PHE B 1 85  ? 79.465 12.281  133.880 1.00 17.24 ? 121 PHE B CD1   1 
ATOM   3208 C  CD2   . PHE B 1 85  ? 77.151 12.884  133.894 1.00 20.44 ? 121 PHE B CD2   1 
ATOM   3209 C  CE1   . PHE B 1 85  ? 79.802 13.582  133.495 1.00 15.52 ? 121 PHE B CE1   1 
ATOM   3210 C  CE2   . PHE B 1 85  ? 77.477 14.188  133.505 1.00 20.71 ? 121 PHE B CE2   1 
ATOM   3211 C  CZ    . PHE B 1 85  ? 78.806 14.533  133.299 1.00 16.44 ? 121 PHE B CZ    1 
ATOM   3212 N  N     . TYR B 1 86  ? 77.706 10.550  137.591 1.00 25.56 ? 122 TYR B N     1 
ATOM   3213 C  CA    . TYR B 1 86  ? 77.647 11.245  138.875 1.00 28.99 ? 122 TYR B CA    1 
ATOM   3214 C  C     . TYR B 1 86  ? 78.790 10.802  139.785 1.00 30.95 ? 122 TYR B C     1 
ATOM   3215 O  O     . TYR B 1 86  ? 79.490 11.640  140.352 1.00 33.91 ? 122 TYR B O     1 
ATOM   3216 C  CB    . TYR B 1 86  ? 76.301 11.023  139.575 1.00 27.04 ? 122 TYR B CB    1 
ATOM   3217 C  CG    . TYR B 1 86  ? 76.262 11.545  141.007 1.00 33.07 ? 122 TYR B CG    1 
ATOM   3218 C  CD1   . TYR B 1 86  ? 76.330 12.909  141.275 1.00 28.41 ? 122 TYR B CD1   1 
ATOM   3219 C  CD2   . TYR B 1 86  ? 76.153 10.672  142.087 1.00 34.39 ? 122 TYR B CD2   1 
ATOM   3220 C  CE1   . TYR B 1 86  ? 76.293 13.391  142.586 1.00 31.14 ? 122 TYR B CE1   1 
ATOM   3221 C  CE2   . TYR B 1 86  ? 76.114 11.145  143.396 1.00 33.66 ? 122 TYR B CE2   1 
ATOM   3222 C  CZ    . TYR B 1 86  ? 76.185 12.502  143.638 1.00 32.40 ? 122 TYR B CZ    1 
ATOM   3223 O  OH    . TYR B 1 86  ? 76.149 12.978  144.935 1.00 32.16 ? 122 TYR B OH    1 
ATOM   3224 N  N     . GLU B 1 87  ? 78.977 9.487   139.907 1.00 35.36 ? 123 GLU B N     1 
ATOM   3225 C  CA    . GLU B 1 87  ? 80.062 8.933   140.721 1.00 36.24 ? 123 GLU B CA    1 
ATOM   3226 C  C     . GLU B 1 87  ? 81.428 9.430   140.263 1.00 37.88 ? 123 GLU B C     1 
ATOM   3227 O  O     . GLU B 1 87  ? 82.264 9.807   141.082 1.00 43.25 ? 123 GLU B O     1 
ATOM   3228 C  CB    . GLU B 1 87  ? 80.022 7.402   140.719 1.00 39.54 ? 123 GLU B CB    1 
ATOM   3229 C  CG    . GLU B 1 87  ? 78.929 6.816   141.602 1.00 38.55 ? 123 GLU B CG    1 
ATOM   3230 C  CD    . GLU B 1 87  ? 78.617 5.366   141.269 1.00 49.36 ? 123 GLU B CD    1 
ATOM   3231 O  OE1   . GLU B 1 87  ? 79.361 4.755   140.466 1.00 48.45 ? 123 GLU B OE1   1 
ATOM   3232 O  OE2   . GLU B 1 87  ? 77.619 4.840   141.808 1.00 51.39 ? 123 GLU B OE2   1 
ATOM   3233 N  N     . GLU B 1 88  ? 81.646 9.446   138.951 1.00 40.60 ? 124 GLU B N     1 
ATOM   3234 C  CA    . GLU B 1 88  ? 82.911 9.911   138.393 1.00 36.64 ? 124 GLU B CA    1 
ATOM   3235 C  C     . GLU B 1 88  ? 83.068 11.410  138.636 1.00 39.71 ? 124 GLU B C     1 
ATOM   3236 O  O     . GLU B 1 88  ? 84.179 11.905  138.853 1.00 44.23 ? 124 GLU B O     1 
ATOM   3237 C  CB    . GLU B 1 88  ? 82.981 9.576   136.897 1.00 38.30 ? 124 GLU B CB    1 
ATOM   3238 C  CG    . GLU B 1 88  ? 84.258 10.003  136.182 1.00 34.89 ? 124 GLU B CG    1 
ATOM   3239 C  CD    . GLU B 1 88  ? 85.449 9.117   136.477 1.00 46.23 ? 124 GLU B CD    1 
ATOM   3240 O  OE1   . GLU B 1 88  ? 85.305 8.156   137.265 1.00 52.13 ? 124 GLU B OE1   1 
ATOM   3241 O  OE2   . GLU B 1 88  ? 86.534 9.384   135.912 1.00 44.83 ? 124 GLU B OE2   1 
ATOM   3242 N  N     . LEU B 1 89  ? 81.942 12.121  138.626 1.00 36.47 ? 125 LEU B N     1 
ATOM   3243 C  CA    . LEU B 1 89  ? 81.920 13.563  138.878 1.00 34.93 ? 125 LEU B CA    1 
ATOM   3244 C  C     . LEU B 1 89  ? 82.431 13.932  140.263 1.00 41.77 ? 125 LEU B C     1 
ATOM   3245 O  O     . LEU B 1 89  ? 83.344 14.746  140.401 1.00 45.76 ? 125 LEU B O     1 
ATOM   3246 C  CB    . LEU B 1 89  ? 80.501 14.106  138.731 1.00 34.52 ? 125 LEU B CB    1 
ATOM   3247 C  CG    . LEU B 1 89  ? 80.097 14.442  137.309 1.00 28.17 ? 125 LEU B CG    1 
ATOM   3248 C  CD1   . LEU B 1 89  ? 78.741 15.132  137.291 1.00 21.76 ? 125 LEU B CD1   1 
ATOM   3249 C  CD2   . LEU B 1 89  ? 81.170 15.332  136.751 1.00 28.58 ? 125 LEU B CD2   1 
ATOM   3250 N  N     . ILE B 1 90  ? 81.813 13.345  141.285 1.00 42.46 ? 126 ILE B N     1 
ATOM   3251 C  CA    . ILE B 1 90  ? 82.181 13.623  142.668 1.00 46.69 ? 126 ILE B CA    1 
ATOM   3252 C  C     . ILE B 1 90  ? 83.612 13.163  142.962 1.00 51.18 ? 126 ILE B C     1 
ATOM   3253 O  O     . ILE B 1 90  ? 84.381 13.868  143.620 1.00 53.46 ? 126 ILE B O     1 
ATOM   3254 C  CB    . ILE B 1 90  ? 81.170 13.008  143.666 1.00 42.68 ? 126 ILE B CB    1 
ATOM   3255 C  CG1   . ILE B 1 90  ? 80.804 11.580  143.271 1.00 43.55 ? 126 ILE B CG1   1 
ATOM   3256 C  CG2   . ILE B 1 90  ? 79.898 13.860  143.742 1.00 39.94 ? 126 ILE B CG2   1 
ATOM   3257 C  CD1   . ILE B 1 90  ? 81.442 10.514  144.142 1.00 53.33 ? 126 ILE B CD1   1 
ATOM   3258 N  N     . ALA B 1 91  ? 83.971 11.993  142.443 1.00 48.59 ? 127 ALA B N     1 
ATOM   3259 C  CA    . ALA B 1 91  ? 85.312 11.443  142.620 1.00 47.56 ? 127 ALA B CA    1 
ATOM   3260 C  C     . ALA B 1 91  ? 86.383 12.258  141.893 1.00 50.76 ? 127 ALA B C     1 
ATOM   3261 O  O     . ALA B 1 91  ? 87.575 11.976  142.023 1.00 56.81 ? 127 ALA B O     1 
ATOM   3262 C  CB    . ALA B 1 91  ? 85.345 10.004  142.166 1.00 46.97 ? 127 ALA B CB    1 
ATOM   3263 N  N     . GLU B 1 92  ? 85.960 13.264  141.130 1.00 51.74 ? 128 GLU B N     1 
ATOM   3264 C  CA    . GLU B 1 92  ? 86.894 14.128  140.417 1.00 49.11 ? 128 GLU B CA    1 
ATOM   3265 C  C     . GLU B 1 92  ? 86.840 15.566  140.953 1.00 54.14 ? 128 GLU B C     1 
ATOM   3266 O  O     . GLU B 1 92  ? 87.365 16.493  140.334 1.00 60.29 ? 128 GLU B O     1 
ATOM   3267 C  CB    . GLU B 1 92  ? 86.622 14.087  138.905 1.00 48.85 ? 128 GLU B CB    1 
ATOM   3268 C  CG    . GLU B 1 92  ? 87.842 14.368  138.026 1.00 49.06 ? 128 GLU B CG    1 
ATOM   3269 C  CD    . GLU B 1 92  ? 87.710 15.645  137.201 1.00 50.91 ? 128 GLU B CD    1 
ATOM   3270 O  OE1   . GLU B 1 92  ? 87.454 15.550  135.984 1.00 44.89 ? 128 GLU B OE1   1 
ATOM   3271 O  OE2   . GLU B 1 92  ? 87.884 16.751  137.754 1.00 54.60 ? 128 GLU B OE2   1 
ATOM   3272 N  N     . GLY B 1 93  ? 86.202 15.756  142.103 1.00 53.78 ? 129 GLY B N     1 
ATOM   3273 C  CA    . GLY B 1 93  ? 86.224 17.055  142.755 1.00 49.64 ? 129 GLY B CA    1 
ATOM   3274 C  C     . GLY B 1 93  ? 84.909 17.812  142.831 1.00 51.74 ? 129 GLY B C     1 
ATOM   3275 O  O     . GLY B 1 93  ? 84.853 18.882  143.444 1.00 51.46 ? 129 GLY B O     1 
ATOM   3276 N  N     . PHE B 1 94  ? 83.855 17.279  142.218 1.00 46.92 ? 130 PHE B N     1 
ATOM   3277 C  CA    . PHE B 1 94  ? 82.570 17.980  142.204 1.00 43.49 ? 130 PHE B CA    1 
ATOM   3278 C  C     . PHE B 1 94  ? 81.689 17.656  143.411 1.00 39.07 ? 130 PHE B C     1 
ATOM   3279 O  O     . PHE B 1 94  ? 81.716 16.544  143.944 1.00 41.12 ? 130 PHE B O     1 
ATOM   3280 C  CB    . PHE B 1 94  ? 81.810 17.726  140.895 1.00 42.51 ? 130 PHE B CB    1 
ATOM   3281 C  CG    . PHE B 1 94  ? 82.425 18.404  139.698 1.00 41.96 ? 130 PHE B CG    1 
ATOM   3282 C  CD1   . PHE B 1 94  ? 82.200 19.752  139.455 1.00 37.73 ? 130 PHE B CD1   1 
ATOM   3283 C  CD2   . PHE B 1 94  ? 83.232 17.693  138.823 1.00 43.33 ? 130 PHE B CD2   1 
ATOM   3284 C  CE1   . PHE B 1 94  ? 82.770 20.379  138.357 1.00 45.57 ? 130 PHE B CE1   1 
ATOM   3285 C  CE2   . PHE B 1 94  ? 83.805 18.312  137.726 1.00 42.31 ? 130 PHE B CE2   1 
ATOM   3286 C  CZ    . PHE B 1 94  ? 83.574 19.658  137.493 1.00 39.97 ? 130 PHE B CZ    1 
ATOM   3287 N  N     . GLU B 1 95  ? 80.910 18.646  143.832 1.00 38.73 ? 131 GLU B N     1 
ATOM   3288 C  CA    . GLU B 1 95  ? 79.976 18.485  144.939 1.00 38.68 ? 131 GLU B CA    1 
ATOM   3289 C  C     . GLU B 1 95  ? 78.538 18.670  144.462 1.00 30.86 ? 131 GLU B C     1 
ATOM   3290 O  O     . GLU B 1 95  ? 78.227 19.622  143.731 1.00 34.34 ? 131 GLU B O     1 
ATOM   3291 C  CB    . GLU B 1 95  ? 80.289 19.494  146.048 1.00 39.92 ? 131 GLU B CB    1 
ATOM   3292 C  CG    . GLU B 1 95  ? 80.994 18.896  147.267 1.00 48.47 ? 131 GLU B CG    1 
ATOM   3293 C  CD    . GLU B 1 95  ? 81.727 19.943  148.097 1.00 54.36 ? 131 GLU B CD    1 
ATOM   3294 O  OE1   . GLU B 1 95  ? 81.722 21.132  147.703 1.00 53.76 ? 131 GLU B OE1   1 
ATOM   3295 O  OE2   . GLU B 1 95  ? 82.318 19.575  149.135 1.00 55.55 ? 131 GLU B OE2   1 
ATOM   3296 N  N     . GLY B 1 96  ? 77.661 17.762  144.875 1.00 27.14 ? 132 GLY B N     1 
ATOM   3297 C  CA    . GLY B 1 96  ? 76.257 17.868  144.524 1.00 23.25 ? 132 GLY B CA    1 
ATOM   3298 C  C     . GLY B 1 96  ? 75.521 16.564  144.730 1.00 26.35 ? 132 GLY B C     1 
ATOM   3299 O  O     . GLY B 1 96  ? 76.047 15.642  145.353 1.00 31.89 ? 132 GLY B O     1 
ATOM   3300 N  N     . LYS B 1 97  ? 74.306 16.477  144.197 1.00 23.95 ? 133 LYS B N     1 
ATOM   3301 C  CA    . LYS B 1 97  ? 73.467 15.305  144.403 1.00 23.89 ? 133 LYS B CA    1 
ATOM   3302 C  C     . LYS B 1 97  ? 72.941 14.739  143.086 1.00 30.79 ? 133 LYS B C     1 
ATOM   3303 O  O     . LYS B 1 97  ? 72.674 15.492  142.147 1.00 25.15 ? 133 LYS B O     1 
ATOM   3304 C  CB    . LYS B 1 97  ? 72.277 15.674  145.289 1.00 29.15 ? 133 LYS B CB    1 
ATOM   3305 C  CG    . LYS B 1 97  ? 72.597 15.836  146.767 1.00 31.94 ? 133 LYS B CG    1 
ATOM   3306 C  CD    . LYS B 1 97  ? 73.065 14.517  147.369 1.00 32.89 ? 133 LYS B CD    1 
ATOM   3307 C  CE    . LYS B 1 97  ? 73.131 14.602  148.888 1.00 39.07 ? 133 LYS B CE    1 
ATOM   3308 N  NZ    . LYS B 1 97  ? 74.175 13.689  149.449 1.00 41.74 ? 133 LYS B NZ    1 
ATOM   3309 N  N     . PHE B 1 98  ? 72.792 13.416  143.018 1.00 27.29 ? 134 PHE B N     1 
ATOM   3310 C  CA    . PHE B 1 98  ? 72.075 12.796  141.908 1.00 28.29 ? 134 PHE B CA    1 
ATOM   3311 C  C     . PHE B 1 98  ? 70.643 12.567  142.361 1.00 34.30 ? 134 PHE B C     1 
ATOM   3312 O  O     . PHE B 1 98  ? 70.338 11.572  143.032 1.00 36.90 ? 134 PHE B O     1 
ATOM   3313 C  CB    . PHE B 1 98  ? 72.718 11.470  141.476 1.00 32.36 ? 134 PHE B CB    1 
ATOM   3314 C  CG    . PHE B 1 98  ? 72.045 10.820  140.284 1.00 35.48 ? 134 PHE B CG    1 
ATOM   3315 C  CD1   . PHE B 1 98  ? 71.224 11.552  139.435 1.00 33.07 ? 134 PHE B CD1   1 
ATOM   3316 C  CD2   . PHE B 1 98  ? 72.231 9.472   140.018 1.00 40.60 ? 134 PHE B CD2   1 
ATOM   3317 C  CE1   . PHE B 1 98  ? 70.600 10.949  138.349 1.00 39.18 ? 134 PHE B CE1   1 
ATOM   3318 C  CE2   . PHE B 1 98  ? 71.612 8.867   138.930 1.00 36.68 ? 134 PHE B CE2   1 
ATOM   3319 C  CZ    . PHE B 1 98  ? 70.797 9.605   138.097 1.00 36.45 ? 134 PHE B CZ    1 
ATOM   3320 N  N     . LEU B 1 99  ? 69.769 13.498  142.000 1.00 32.37 ? 135 LEU B N     1 
ATOM   3321 C  CA    . LEU B 1 99  ? 68.362 13.397  142.353 1.00 38.82 ? 135 LEU B CA    1 
ATOM   3322 C  C     . LEU B 1 99  ? 67.716 12.418  141.380 1.00 40.15 ? 135 LEU B C     1 
ATOM   3323 O  O     . LEU B 1 99  ? 67.429 12.765  140.233 1.00 40.62 ? 135 LEU B O     1 
ATOM   3324 C  CB    . LEU B 1 99  ? 67.703 14.779  142.298 1.00 32.55 ? 135 LEU B CB    1 
ATOM   3325 C  CG    . LEU B 1 99  ? 68.491 15.834  143.091 1.00 34.73 ? 135 LEU B CG    1 
ATOM   3326 C  CD1   . LEU B 1 99  ? 67.852 17.213  143.034 1.00 30.27 ? 135 LEU B CD1   1 
ATOM   3327 C  CD2   . LEU B 1 99  ? 68.666 15.397  144.532 1.00 33.88 ? 135 LEU B CD2   1 
ATOM   3328 N  N     . GLN B 1 100 ? 67.523 11.183  141.837 1.00 47.84 ? 136 GLN B N     1 
ATOM   3329 C  CA    . GLN B 1 100 ? 67.050 10.105  140.969 1.00 50.31 ? 136 GLN B CA    1 
ATOM   3330 C  C     . GLN B 1 100 ? 65.903 9.315   141.593 1.00 52.94 ? 136 GLN B C     1 
ATOM   3331 O  O     . GLN B 1 100 ? 65.005 9.883   142.216 1.00 56.22 ? 136 GLN B O     1 
ATOM   3332 C  CB    . GLN B 1 100 ? 68.200 9.152   140.623 1.00 50.42 ? 136 GLN B CB    1 
ATOM   3333 C  CG    . GLN B 1 100 ? 68.584 8.173   141.738 1.00 46.65 ? 136 GLN B CG    1 
ATOM   3334 C  CD    . GLN B 1 100 ? 69.188 6.886   141.191 1.00 54.53 ? 136 GLN B CD    1 
ATOM   3335 O  OE1   . GLN B 1 100 ? 68.922 6.503   140.048 1.00 58.75 ? 136 GLN B OE1   1 
ATOM   3336 N  NE2   . GLN B 1 100 ? 70.002 6.212   142.004 1.00 48.00 ? 136 GLN B NE2   1 
ATOM   3337 N  N     . ILE B 1 104 ? 61.993 12.207  136.457 1.00 61.04 ? 140 ILE B N     1 
ATOM   3338 C  CA    . ILE B 1 104 ? 63.125 12.313  135.540 1.00 56.19 ? 140 ILE B CA    1 
ATOM   3339 C  C     . ILE B 1 104 ? 64.400 12.785  136.263 1.00 52.53 ? 140 ILE B C     1 
ATOM   3340 O  O     . ILE B 1 104 ? 64.412 13.844  136.900 1.00 54.89 ? 140 ILE B O     1 
ATOM   3341 C  CB    . ILE B 1 104 ? 62.787 13.182  134.275 1.00 60.89 ? 140 ILE B CB    1 
ATOM   3342 C  CG1   . ILE B 1 104 ? 62.638 14.679  134.613 1.00 54.56 ? 140 ILE B CG1   1 
ATOM   3343 C  CG2   . ILE B 1 104 ? 61.542 12.635  133.568 1.00 53.71 ? 140 ILE B CG2   1 
ATOM   3344 C  CD1   . ILE B 1 104 ? 61.342 15.064  135.320 1.00 59.35 ? 140 ILE B CD1   1 
ATOM   3345 N  N     . PRO B 1 105 ? 65.473 11.979  136.182 1.00 50.00 ? 141 PRO B N     1 
ATOM   3346 C  CA    . PRO B 1 105 ? 66.727 12.242  136.908 1.00 48.23 ? 141 PRO B CA    1 
ATOM   3347 C  C     . PRO B 1 105 ? 67.386 13.594  136.584 1.00 45.04 ? 141 PRO B C     1 
ATOM   3348 O  O     . PRO B 1 105 ? 67.276 14.104  135.464 1.00 43.78 ? 141 PRO B O     1 
ATOM   3349 C  CB    . PRO B 1 105 ? 67.637 11.080  136.479 1.00 46.12 ? 141 PRO B CB    1 
ATOM   3350 C  CG    . PRO B 1 105 ? 67.039 10.549  135.212 1.00 42.79 ? 141 PRO B CG    1 
ATOM   3351 C  CD    . PRO B 1 105 ? 65.554 10.757  135.364 1.00 49.90 ? 141 PRO B CD    1 
ATOM   3352 N  N     . ILE B 1 106 ? 68.044 14.173  137.587 1.00 37.72 ? 142 ILE B N     1 
ATOM   3353 C  CA    . ILE B 1 106 ? 68.830 15.390  137.423 1.00 33.98 ? 142 ILE B CA    1 
ATOM   3354 C  C     . ILE B 1 106 ? 70.054 15.294  138.328 1.00 26.91 ? 142 ILE B C     1 
ATOM   3355 O  O     . ILE B 1 106 ? 69.958 14.821  139.463 1.00 28.42 ? 142 ILE B O     1 
ATOM   3356 C  CB    . ILE B 1 106 ? 68.035 16.657  137.819 1.00 32.52 ? 142 ILE B CB    1 
ATOM   3357 C  CG1   . ILE B 1 106 ? 66.807 16.854  136.926 1.00 39.48 ? 142 ILE B CG1   1 
ATOM   3358 C  CG2   . ILE B 1 106 ? 68.926 17.899  137.758 1.00 31.81 ? 142 ILE B CG2   1 
ATOM   3359 C  CD1   . ILE B 1 106 ? 67.117 17.436  135.560 1.00 37.15 ? 142 ILE B CD1   1 
ATOM   3360 N  N     . ILE B 1 107 ? 71.206 15.724  137.828 1.00 21.56 ? 143 ILE B N     1 
ATOM   3361 C  CA    . ILE B 1 107 ? 72.372 15.903  138.677 1.00 20.15 ? 143 ILE B CA    1 
ATOM   3362 C  C     . ILE B 1 107 ? 72.472 17.378  139.003 1.00 25.09 ? 143 ILE B C     1 
ATOM   3363 O  O     . ILE B 1 107 ? 72.542 18.203  138.096 1.00 21.79 ? 143 ILE B O     1 
ATOM   3364 C  CB    . ILE B 1 107 ? 73.667 15.451  137.982 1.00 17.51 ? 143 ILE B CB    1 
ATOM   3365 C  CG1   . ILE B 1 107 ? 73.624 13.949  137.716 1.00 21.14 ? 143 ILE B CG1   1 
ATOM   3366 C  CG2   . ILE B 1 107 ? 74.866 15.773  138.858 1.00 17.83 ? 143 ILE B CG2   1 
ATOM   3367 C  CD1   . ILE B 1 107 ? 74.789 13.441  136.866 1.00 17.47 ? 143 ILE B CD1   1 
ATOM   3368 N  N     . LYS B 1 108 ? 72.446 17.725  140.287 1.00 20.66 ? 144 LYS B N     1 
ATOM   3369 C  CA    . LYS B 1 108 ? 72.568 19.126  140.678 1.00 23.42 ? 144 LYS B CA    1 
ATOM   3370 C  C     . LYS B 1 108 ? 73.926 19.328  141.325 1.00 28.93 ? 144 LYS B C     1 
ATOM   3371 O  O     . LYS B 1 108 ? 74.166 18.820  142.417 1.00 24.02 ? 144 LYS B O     1 
ATOM   3372 C  CB    . LYS B 1 108 ? 71.469 19.503  141.669 1.00 26.59 ? 144 LYS B CB    1 
ATOM   3373 C  CG    . LYS B 1 108 ? 70.670 20.750  141.293 1.00 38.15 ? 144 LYS B CG    1 
ATOM   3374 C  CD    . LYS B 1 108 ? 69.435 20.911  142.195 1.00 43.55 ? 144 LYS B CD    1 
ATOM   3375 C  CE    . LYS B 1 108 ? 69.619 22.016  143.236 1.00 47.84 ? 144 LYS B CE    1 
ATOM   3376 N  NZ    . LYS B 1 108 ? 68.475 22.083  144.198 1.00 49.93 ? 144 LYS B NZ    1 
ATOM   3377 N  N     . LEU B 1 109 ? 74.814 20.055  140.648 1.00 24.38 ? 145 LEU B N     1 
ATOM   3378 C  CA    . LEU B 1 109 ? 76.133 20.375  141.199 1.00 25.71 ? 145 LEU B CA    1 
ATOM   3379 C  C     . LEU B 1 109 ? 76.129 21.802  141.755 1.00 30.52 ? 145 LEU B C     1 
ATOM   3380 O  O     . LEU B 1 109 ? 75.560 22.711  141.145 1.00 32.49 ? 145 LEU B O     1 
ATOM   3381 C  CB    . LEU B 1 109 ? 77.217 20.215  140.130 1.00 26.84 ? 145 LEU B CB    1 
ATOM   3382 C  CG    . LEU B 1 109 ? 77.262 18.891  139.357 1.00 26.61 ? 145 LEU B CG    1 
ATOM   3383 C  CD1   . LEU B 1 109 ? 78.278 18.964  138.216 1.00 27.84 ? 145 LEU B CD1   1 
ATOM   3384 C  CD2   . LEU B 1 109 ? 77.569 17.691  140.250 1.00 25.39 ? 145 LEU B CD2   1 
ATOM   3385 N  N     . THR B 1 110 ? 76.746 22.007  142.917 1.00 35.47 ? 146 THR B N     1 
ATOM   3386 C  CA    . THR B 1 110 ? 76.603 23.284  143.623 1.00 35.59 ? 146 THR B CA    1 
ATOM   3387 C  C     . THR B 1 110 ? 77.931 23.988  143.866 1.00 42.21 ? 146 THR B C     1 
ATOM   3388 O  O     . THR B 1 110 ? 77.963 25.136  144.328 1.00 42.89 ? 146 THR B O     1 
ATOM   3389 C  CB    . THR B 1 110 ? 75.899 23.108  144.971 1.00 38.71 ? 146 THR B CB    1 
ATOM   3390 O  OG1   . THR B 1 110 ? 76.591 22.110  145.727 1.00 31.29 ? 146 THR B OG1   1 
ATOM   3391 C  CG2   . THR B 1 110 ? 74.447 22.687  144.766 1.00 35.39 ? 146 THR B CG2   1 
ATOM   3392 N  N     . SER B 1 111 ? 79.018 23.289  143.562 1.00 42.23 ? 147 SER B N     1 
ATOM   3393 C  CA    . SER B 1 111 ? 80.355 23.869  143.601 1.00 49.93 ? 147 SER B CA    1 
ATOM   3394 C  C     . SER B 1 111 ? 81.313 22.915  142.897 1.00 48.53 ? 147 SER B C     1 
ATOM   3395 O  O     . SER B 1 111 ? 80.984 21.743  142.680 1.00 48.30 ? 147 SER B O     1 
ATOM   3396 C  CB    . SER B 1 111 ? 80.813 24.098  145.043 1.00 46.72 ? 147 SER B CB    1 
ATOM   3397 O  OG    . SER B 1 111 ? 81.476 22.953  145.549 1.00 46.08 ? 147 SER B OG    1 
ATOM   3398 N  N     . SER B 1 120 ? 78.906 30.391  143.644 1.00 52.95 ? 156 SER B N     1 
ATOM   3399 C  CA    . SER B 1 120 ? 78.660 31.092  142.389 1.00 54.03 ? 156 SER B CA    1 
ATOM   3400 C  C     . SER B 1 120 ? 78.469 30.091  141.255 1.00 53.41 ? 156 SER B C     1 
ATOM   3401 O  O     . SER B 1 120 ? 78.426 30.466  140.079 1.00 51.31 ? 156 SER B O     1 
ATOM   3402 C  CB    . SER B 1 120 ? 79.828 32.028  142.064 1.00 51.03 ? 156 SER B CB    1 
ATOM   3403 O  OG    . SER B 1 120 ? 81.062 31.324  142.066 1.00 52.34 ? 156 SER B OG    1 
ATOM   3404 N  N     . PHE B 1 121 ? 78.342 28.819  141.620 1.00 53.11 ? 157 PHE B N     1 
ATOM   3405 C  CA    . PHE B 1 121 ? 78.335 27.739  140.641 1.00 50.81 ? 157 PHE B CA    1 
ATOM   3406 C  C     . PHE B 1 121 ? 77.197 26.751  140.891 1.00 47.26 ? 157 PHE B C     1 
ATOM   3407 O  O     . PHE B 1 121 ? 77.342 25.796  141.649 1.00 46.41 ? 157 PHE B O     1 
ATOM   3408 C  CB    . PHE B 1 121 ? 79.687 27.019  140.667 1.00 51.16 ? 157 PHE B CB    1 
ATOM   3409 C  CG    . PHE B 1 121 ? 79.857 25.992  139.584 1.00 51.42 ? 157 PHE B CG    1 
ATOM   3410 C  CD1   . PHE B 1 121 ? 79.874 26.366  138.248 1.00 49.91 ? 157 PHE B CD1   1 
ATOM   3411 C  CD2   . PHE B 1 121 ? 80.022 24.651  139.905 1.00 50.98 ? 157 PHE B CD2   1 
ATOM   3412 C  CE1   . PHE B 1 121 ? 80.041 25.417  137.249 1.00 47.27 ? 157 PHE B CE1   1 
ATOM   3413 C  CE2   . PHE B 1 121 ? 80.190 23.693  138.914 1.00 50.81 ? 157 PHE B CE2   1 
ATOM   3414 C  CZ    . PHE B 1 121 ? 80.198 24.077  137.583 1.00 48.00 ? 157 PHE B CZ    1 
ATOM   3415 N  N     . GLN B 1 122 ? 76.057 26.993  140.259 1.00 42.21 ? 158 GLN B N     1 
ATOM   3416 C  CA    . GLN B 1 122 ? 74.954 26.050  140.308 1.00 39.21 ? 158 GLN B CA    1 
ATOM   3417 C  C     . GLN B 1 122 ? 74.788 25.466  138.912 1.00 40.67 ? 158 GLN B C     1 
ATOM   3418 O  O     . GLN B 1 122 ? 74.457 26.184  137.957 1.00 33.47 ? 158 GLN B O     1 
ATOM   3419 C  CB    . GLN B 1 122 ? 73.667 26.754  140.738 1.00 45.85 ? 158 GLN B CB    1 
ATOM   3420 C  CG    . GLN B 1 122 ? 73.819 27.654  141.969 1.00 55.98 ? 158 GLN B CG    1 
ATOM   3421 C  CD    . GLN B 1 122 ? 73.618 26.915  143.287 1.00 56.38 ? 158 GLN B CD    1 
ATOM   3422 O  OE1   . GLN B 1 122 ? 74.486 26.935  144.167 1.00 51.75 ? 158 GLN B OE1   1 
ATOM   3423 N  NE2   . GLN B 1 122 ? 72.462 26.274  143.435 1.00 56.84 ? 158 GLN B NE2   1 
ATOM   3424 N  N     . CYS B 1 123 ? 75.030 24.167  138.790 1.00 33.17 ? 159 CYS B N     1 
ATOM   3425 C  CA    . CYS B 1 123 ? 74.922 23.502  137.502 1.00 26.82 ? 159 CYS B CA    1 
ATOM   3426 C  C     . CYS B 1 123 ? 73.923 22.366  137.597 1.00 27.27 ? 159 CYS B C     1 
ATOM   3427 O  O     . CYS B 1 123 ? 74.041 21.500  138.463 1.00 24.99 ? 159 CYS B O     1 
ATOM   3428 C  CB    . CYS B 1 123 ? 76.283 22.969  137.083 1.00 30.11 ? 159 CYS B CB    1 
ATOM   3429 S  SG    . CYS B 1 123 ? 76.264 22.067  135.540 1.00 34.12 ? 159 CYS B SG    1 
ATOM   3430 N  N     . ALA B 1 124 ? 72.923 22.382  136.722 1.00 22.59 ? 160 ALA B N     1 
ATOM   3431 C  CA    . ALA B 1 124 ? 71.927 21.319  136.700 1.00 22.27 ? 160 ALA B CA    1 
ATOM   3432 C  C     . ALA B 1 124 ? 72.106 20.494  135.425 1.00 22.40 ? 160 ALA B C     1 
ATOM   3433 O  O     . ALA B 1 124 ? 72.102 21.043  134.317 1.00 20.67 ? 160 ALA B O     1 
ATOM   3434 C  CB    . ALA B 1 124 ? 70.527 21.906  136.768 1.00 19.35 ? 160 ALA B CB    1 
ATOM   3435 N  N     . ILE B 1 125 ? 72.269 19.183  135.576 1.00 16.02 ? 161 ILE B N     1 
ATOM   3436 C  CA    . ILE B 1 125 ? 72.458 18.319  134.419 1.00 17.08 ? 161 ILE B CA    1 
ATOM   3437 C  C     . ILE B 1 125 ? 71.285 17.356  134.263 1.00 21.59 ? 161 ILE B C     1 
ATOM   3438 O  O     . ILE B 1 125 ? 71.051 16.484  135.117 1.00 20.20 ? 161 ILE B O     1 
ATOM   3439 C  CB    . ILE B 1 125 ? 73.762 17.511  134.515 1.00 16.17 ? 161 ILE B CB    1 
ATOM   3440 C  CG1   . ILE B 1 125 ? 74.963 18.451  134.698 1.00 17.59 ? 161 ILE B CG1   1 
ATOM   3441 C  CG2   . ILE B 1 125 ? 73.939 16.669  133.259 1.00 18.92 ? 161 ILE B CG2   1 
ATOM   3442 C  CD1   . ILE B 1 125 ? 76.249 17.740  135.049 1.00 18.30 ? 161 ILE B CD1   1 
ATOM   3443 N  N     . GLY B 1 126 ? 70.560 17.515  133.162 1.00 19.06 ? 162 GLY B N     1 
ATOM   3444 C  CA    . GLY B 1 126 ? 69.427 16.667  132.858 1.00 21.57 ? 162 GLY B CA    1 
ATOM   3445 C  C     . GLY B 1 126 ? 69.754 15.648  131.781 1.00 23.57 ? 162 GLY B C     1 
ATOM   3446 O  O     . GLY B 1 126 ? 70.870 15.573  131.255 1.00 21.14 ? 162 GLY B O     1 
ATOM   3447 N  N     . PHE B 1 127 ? 68.768 14.841  131.443 1.00 21.47 ? 163 PHE B N     1 
ATOM   3448 C  CA    . PHE B 1 127 ? 69.027 13.752  130.530 1.00 21.21 ? 163 PHE B CA    1 
ATOM   3449 C  C     . PHE B 1 127 ? 68.036 13.778  129.370 1.00 24.88 ? 163 PHE B C     1 
ATOM   3450 O  O     . PHE B 1 127 ? 66.822 13.740  129.579 1.00 26.46 ? 163 PHE B O     1 
ATOM   3451 C  CB    . PHE B 1 127 ? 69.050 12.431  131.312 1.00 23.12 ? 163 PHE B CB    1 
ATOM   3452 C  CG    . PHE B 1 127 ? 70.222 12.331  132.258 1.00 22.42 ? 163 PHE B CG    1 
ATOM   3453 C  CD1   . PHE B 1 127 ? 70.173 12.910  133.520 1.00 29.46 ? 163 PHE B CD1   1 
ATOM   3454 C  CD2   . PHE B 1 127 ? 71.396 11.708  131.855 1.00 27.55 ? 163 PHE B CD2   1 
ATOM   3455 C  CE1   . PHE B 1 127 ? 71.270 12.854  134.372 1.00 27.49 ? 163 PHE B CE1   1 
ATOM   3456 C  CE2   . PHE B 1 127 ? 72.495 11.639  132.697 1.00 25.66 ? 163 PHE B CE2   1 
ATOM   3457 C  CZ    . PHE B 1 127 ? 72.429 12.219  133.960 1.00 26.31 ? 163 PHE B CZ    1 
ATOM   3458 N  N     . ASN B 1 128 ? 68.575 13.915  128.157 1.00 22.92 ? 164 ASN B N     1 
ATOM   3459 C  CA    . ASN B 1 128 ? 67.777 13.923  126.925 1.00 26.85 ? 164 ASN B CA    1 
ATOM   3460 C  C     . ASN B 1 128 ? 66.656 14.982  126.875 1.00 27.57 ? 164 ASN B C     1 
ATOM   3461 O  O     . ASN B 1 128 ? 65.543 14.699  126.425 1.00 33.21 ? 164 ASN B O     1 
ATOM   3462 C  CB    . ASN B 1 128 ? 67.232 12.517  126.627 1.00 30.05 ? 164 ASN B CB    1 
ATOM   3463 C  CG    . ASN B 1 128 ? 68.336 11.518  126.287 1.00 30.27 ? 164 ASN B CG    1 
ATOM   3464 O  OD1   . ASN B 1 128 ? 69.371 11.880  125.719 1.00 30.83 ? 164 ASN B OD1   1 
ATOM   3465 N  ND2   . ASN B 1 128 ? 68.117 10.257  126.629 1.00 32.97 ? 164 ASN B ND2   1 
ATOM   3466 N  N     . ASN B 1 129 ? 66.957 16.196  127.336 1.00 30.93 ? 165 ASN B N     1 
ATOM   3467 C  CA    . ASN B 1 129 ? 66.012 17.316  127.244 1.00 27.75 ? 165 ASN B CA    1 
ATOM   3468 C  C     . ASN B 1 129 ? 66.150 17.997  125.884 1.00 21.53 ? 165 ASN B C     1 
ATOM   3469 O  O     . ASN B 1 129 ? 66.619 19.141  125.784 1.00 18.84 ? 165 ASN B O     1 
ATOM   3470 C  CB    . ASN B 1 129 ? 66.263 18.327  128.371 1.00 27.96 ? 165 ASN B CB    1 
ATOM   3471 C  CG    . ASN B 1 129 ? 65.178 19.396  128.462 1.00 30.91 ? 165 ASN B CG    1 
ATOM   3472 O  OD1   . ASN B 1 129 ? 64.293 19.486  127.606 1.00 27.28 ? 165 ASN B OD1   1 
ATOM   3473 N  ND2   . ASN B 1 129 ? 65.247 20.216  129.507 1.00 29.48 ? 165 ASN B ND2   1 
ATOM   3474 N  N     . ARG B 1 130 ? 65.751 17.298  124.827 1.00 20.21 ? 166 ARG B N     1 
ATOM   3475 C  CA    . ARG B 1 130 ? 65.989 17.805  123.484 1.00 19.08 ? 166 ARG B CA    1 
ATOM   3476 C  C     . ARG B 1 130 ? 65.152 19.030  123.139 1.00 14.85 ? 166 ARG B C     1 
ATOM   3477 O  O     . ARG B 1 130 ? 65.592 19.877  122.358 1.00 18.67 ? 166 ARG B O     1 
ATOM   3478 C  CB    . ARG B 1 130 ? 65.780 16.708  122.444 1.00 20.51 ? 166 ARG B CB    1 
ATOM   3479 C  CG    . ARG B 1 130 ? 66.819 15.602  122.560 1.00 25.50 ? 166 ARG B CG    1 
ATOM   3480 C  CD    . ARG B 1 130 ? 66.778 14.648  121.395 1.00 27.93 ? 166 ARG B CD    1 
ATOM   3481 N  NE    . ARG B 1 130 ? 67.891 13.706  121.499 1.00 47.52 ? 166 ARG B NE    1 
ATOM   3482 C  CZ    . ARG B 1 130 ? 67.918 12.674  122.338 1.00 35.11 ? 166 ARG B CZ    1 
ATOM   3483 N  NH1   . ARG B 1 130 ? 66.884 12.440  123.141 1.00 39.26 ? 166 ARG B NH1   1 
ATOM   3484 N  NH2   . ARG B 1 130 ? 68.976 11.868  122.372 1.00 40.29 ? 166 ARG B NH2   1 
ATOM   3485 N  N     . LEU B 1 131 ? 63.943 19.110  123.685 1.00 18.15 ? 167 LEU B N     1 
ATOM   3486 C  CA    . LEU B 1 131 ? 63.099 20.274  123.404 1.00 18.46 ? 167 LEU B CA    1 
ATOM   3487 C  C     . LEU B 1 131 ? 63.772 21.544  123.915 1.00 17.41 ? 167 LEU B C     1 
ATOM   3488 O  O     . LEU B 1 131 ? 63.748 22.590  123.245 1.00 16.14 ? 167 LEU B O     1 
ATOM   3489 C  CB    . LEU B 1 131 ? 61.696 20.103  124.014 1.00 19.23 ? 167 LEU B CB    1 
ATOM   3490 C  CG    . LEU B 1 131 ? 60.832 19.008  123.386 1.00 21.68 ? 167 LEU B CG    1 
ATOM   3491 C  CD1   . LEU B 1 131 ? 59.536 18.775  124.182 1.00 21.19 ? 167 LEU B CD1   1 
ATOM   3492 C  CD2   . LEU B 1 131 ? 60.506 19.343  121.925 1.00 15.52 ? 167 LEU B CD2   1 
ATOM   3493 N  N     . ALA B 1 132 ? 64.391 21.470  125.094 1.00 16.38 ? 168 ALA B N     1 
ATOM   3494 C  CA    . ALA B 1 132 ? 65.015 22.678  125.639 1.00 18.77 ? 168 ALA B CA    1 
ATOM   3495 C  C     . ALA B 1 132 ? 66.203 23.094  124.789 1.00 16.60 ? 168 ALA B C     1 
ATOM   3496 O  O     . ALA B 1 132 ? 66.460 24.283  124.606 1.00 14.88 ? 168 ALA B O     1 
ATOM   3497 C  CB    . ALA B 1 132 ? 65.412 22.507  127.114 1.00 19.10 ? 168 ALA B CB    1 
ATOM   3498 N  N     . ILE B 1 133 ? 66.925 22.111  124.256 1.00 14.72 ? 169 ILE B N     1 
ATOM   3499 C  CA    . ILE B 1 133 ? 68.025 22.396  123.355 1.00 14.63 ? 169 ILE B CA    1 
ATOM   3500 C  C     . ILE B 1 133 ? 67.507 23.126  122.119 1.00 14.03 ? 169 ILE B C     1 
ATOM   3501 O  O     . ILE B 1 133 ? 68.139 24.039  121.618 1.00 12.76 ? 169 ILE B O     1 
ATOM   3502 C  CB    . ILE B 1 133 ? 68.760 21.086  122.949 1.00 15.13 ? 169 ILE B CB    1 
ATOM   3503 C  CG1   . ILE B 1 133 ? 69.418 20.458  124.187 1.00 14.07 ? 169 ILE B CG1   1 
ATOM   3504 C  CG2   . ILE B 1 133 ? 69.786 21.340  121.840 1.00 16.59 ? 169 ILE B CG2   1 
ATOM   3505 C  CD1   . ILE B 1 133 ? 69.964 19.052  123.937 1.00 23.81 ? 169 ILE B CD1   1 
ATOM   3506 N  N     . HIS B 1 134 ? 66.348 22.719  121.618 1.00 13.48 ? 170 HIS B N     1 
ATOM   3507 C  CA    . HIS B 1 134 ? 65.797 23.372  120.431 1.00 13.31 ? 170 HIS B CA    1 
ATOM   3508 C  C     . HIS B 1 134 ? 65.220 24.773  120.668 1.00 11.76 ? 170 HIS B C     1 
ATOM   3509 O  O     . HIS B 1 134 ? 65.359 25.642  119.813 1.00 14.31 ? 170 HIS B O     1 
ATOM   3510 C  CB    . HIS B 1 134 ? 64.804 22.455  119.707 1.00 14.53 ? 170 HIS B CB    1 
ATOM   3511 C  CG    . HIS B 1 134 ? 65.473 21.339  118.967 1.00 11.05 ? 170 HIS B CG    1 
ATOM   3512 N  ND1   . HIS B 1 134 ? 65.934 21.482  117.673 1.00 14.90 ? 170 HIS B ND1   1 
ATOM   3513 C  CD2   . HIS B 1 134 ? 65.800 20.083  119.347 1.00 17.44 ? 170 HIS B CD2   1 
ATOM   3514 C  CE1   . HIS B 1 134 ? 66.491 20.351  117.282 1.00 16.02 ? 170 HIS B CE1   1 
ATOM   3515 N  NE2   . HIS B 1 134 ? 66.425 19.488  118.281 1.00 14.69 ? 170 HIS B NE2   1 
ATOM   3516 N  N     . ASN B 1 135 ? 64.577 25.013  121.804 1.00 12.90 ? 171 ASN B N     1 
ATOM   3517 C  CA    . ASN B 1 135 ? 64.113 26.379  122.029 1.00 14.92 ? 171 ASN B CA    1 
ATOM   3518 C  C     . ASN B 1 135 ? 65.257 27.335  122.355 1.00 13.11 ? 171 ASN B C     1 
ATOM   3519 O  O     . ASN B 1 135 ? 65.161 28.537  122.119 1.00 15.18 ? 171 ASN B O     1 
ATOM   3520 C  CB    . ASN B 1 135 ? 62.926 26.460  123.003 1.00 17.42 ? 171 ASN B CB    1 
ATOM   3521 C  CG    . ASN B 1 135 ? 63.282 26.072  124.413 1.00 20.14 ? 171 ASN B CG    1 
ATOM   3522 O  OD1   . ASN B 1 135 ? 64.279 26.544  124.964 1.00 22.05 ? 171 ASN B OD1   1 
ATOM   3523 N  ND2   . ASN B 1 135 ? 62.435 25.237  125.033 1.00 20.66 ? 171 ASN B ND2   1 
ATOM   3524 N  N     . THR B 1 136 ? 66.372 26.793  122.836 1.00 12.52 ? 172 THR B N     1 
ATOM   3525 C  CA    . THR B 1 136 ? 67.573 27.601  123.036 1.00 11.55 ? 172 THR B CA    1 
ATOM   3526 C  C     . THR B 1 136 ? 68.204 27.964  121.696 1.00 13.29 ? 172 THR B C     1 
ATOM   3527 O  O     . THR B 1 136 ? 68.768 29.051  121.530 1.00 11.93 ? 172 THR B O     1 
ATOM   3528 C  CB    . THR B 1 136 ? 68.593 26.871  123.941 1.00 14.25 ? 172 THR B CB    1 
ATOM   3529 O  OG1   . THR B 1 136 ? 68.051 26.758  125.262 1.00 16.87 ? 172 THR B OG1   1 
ATOM   3530 C  CG2   . THR B 1 136 ? 69.904 27.643  124.017 1.00 14.63 ? 172 THR B CG2   1 
ATOM   3531 N  N     . LEU B 1 137 ? 68.123 27.051  120.733 1.00 13.43 ? 173 LEU B N     1 
ATOM   3532 C  CA    . LEU B 1 137 ? 68.592 27.347  119.389 1.00 12.88 ? 173 LEU B CA    1 
ATOM   3533 C  C     . LEU B 1 137 ? 67.760 28.467  118.797 1.00 11.76 ? 173 LEU B C     1 
ATOM   3534 O  O     . LEU B 1 137 ? 68.274 29.324  118.075 1.00 9.61  ? 173 LEU B O     1 
ATOM   3535 C  CB    . LEU B 1 137 ? 68.477 26.111  118.493 1.00 14.28 ? 173 LEU B CB    1 
ATOM   3536 C  CG    . LEU B 1 137 ? 69.462 24.963  118.721 1.00 17.19 ? 173 LEU B CG    1 
ATOM   3537 C  CD1   . LEU B 1 137 ? 69.157 23.855  117.727 1.00 17.79 ? 173 LEU B CD1   1 
ATOM   3538 C  CD2   . LEU B 1 137 ? 70.881 25.435  118.522 1.00 25.18 ? 173 LEU B CD2   1 
ATOM   3539 N  N     . LEU B 1 138 ? 66.462 28.447  119.081 1.00 9.50  ? 174 LEU B N     1 
ATOM   3540 C  CA    . LEU B 1 138 ? 65.593 29.501  118.558 1.00 12.16 ? 174 LEU B CA    1 
ATOM   3541 C  C     . LEU B 1 138 ? 65.988 30.841  119.164 1.00 12.17 ? 174 LEU B C     1 
ATOM   3542 O  O     . LEU B 1 138 ? 66.168 31.826  118.451 1.00 10.36 ? 174 LEU B O     1 
ATOM   3543 C  CB    . LEU B 1 138 ? 64.124 29.202  118.872 1.00 11.84 ? 174 LEU B CB    1 
ATOM   3544 C  CG    . LEU B 1 138 ? 63.097 30.260  118.430 1.00 11.21 ? 174 LEU B CG    1 
ATOM   3545 C  CD1   . LEU B 1 138 ? 63.003 30.368  116.897 1.00 10.51 ? 174 LEU B CD1   1 
ATOM   3546 C  CD2   . LEU B 1 138 ? 61.738 29.888  119.001 1.00 11.91 ? 174 LEU B CD2   1 
ATOM   3547 N  N     . LEU B 1 139 ? 66.108 30.881  120.484 1.00 11.00 ? 175 LEU B N     1 
ATOM   3548 C  CA    . LEU B 1 139 ? 66.521 32.114  121.160 1.00 12.54 ? 175 LEU B CA    1 
ATOM   3549 C  C     . LEU B 1 139 ? 67.911 32.569  120.707 1.00 11.98 ? 175 LEU B C     1 
ATOM   3550 O  O     . LEU B 1 139 ? 68.137 33.764  120.503 1.00 10.84 ? 175 LEU B O     1 
ATOM   3551 C  CB    . LEU B 1 139 ? 66.452 31.942  122.686 1.00 12.65 ? 175 LEU B CB    1 
ATOM   3552 C  CG    . LEU B 1 139 ? 65.148 32.300  123.409 1.00 15.85 ? 175 LEU B CG    1 
ATOM   3553 C  CD1   . LEU B 1 139 ? 63.923 31.709  122.756 1.00 15.75 ? 175 LEU B CD1   1 
ATOM   3554 C  CD2   . LEU B 1 139 ? 65.236 31.835  124.874 1.00 18.88 ? 175 LEU B CD2   1 
ATOM   3555 N  N     . SER B 1 140 ? 68.829 31.624  120.497 1.00 11.55 ? 176 SER B N     1 
ATOM   3556 C  CA    . SER B 1 140 ? 70.163 31.971  119.991 1.00 12.11 ? 176 SER B CA    1 
ATOM   3557 C  C     . SER B 1 140 ? 70.118 32.617  118.608 1.00 12.10 ? 176 SER B C     1 
ATOM   3558 O  O     . SER B 1 140 ? 70.866 33.559  118.331 1.00 12.59 ? 176 SER B O     1 
ATOM   3559 C  CB    . SER B 1 140 ? 71.083 30.737  119.936 1.00 13.98 ? 176 SER B CB    1 
ATOM   3560 O  OG    . SER B 1 140 ? 71.189 30.123  121.202 1.00 21.00 ? 176 SER B OG    1 
ATOM   3561 N  N     . SER B 1 141 ? 69.276 32.083  117.724 1.00 12.50 ? 177 SER B N     1 
ATOM   3562 C  CA    . SER B 1 141 ? 69.104 32.666  116.390 1.00 11.40 ? 177 SER B CA    1 
ATOM   3563 C  C     . SER B 1 141 ? 68.608 34.103  116.454 1.00 9.42  ? 177 SER B C     1 
ATOM   3564 O  O     . SER B 1 141 ? 69.088 34.961  115.717 1.00 13.05 ? 177 SER B O     1 
ATOM   3565 C  CB    . SER B 1 141 ? 68.136 31.828  115.552 1.00 14.57 ? 177 SER B CB    1 
ATOM   3566 O  OG    . SER B 1 141 ? 68.743 30.591  115.212 1.00 14.15 ? 177 SER B OG    1 
ATOM   3567 N  N     . TYR B 1 142 ? 67.645 34.367  117.333 1.00 10.77 ? 178 TYR B N     1 
ATOM   3568 C  CA    . TYR B 1 142 ? 67.140 35.726  117.483 1.00 10.63 ? 178 TYR B CA    1 
ATOM   3569 C  C     . TYR B 1 142 ? 68.199 36.688  118.031 1.00 12.43 ? 178 TYR B C     1 
ATOM   3570 O  O     . TYR B 1 142 ? 68.258 37.840  117.604 1.00 12.59 ? 178 TYR B O     1 
ATOM   3571 C  CB    . TYR B 1 142 ? 65.846 35.747  118.316 1.00 10.03 ? 178 TYR B CB    1 
ATOM   3572 C  CG    . TYR B 1 142 ? 64.607 35.451  117.484 1.00 9.76  ? 178 TYR B CG    1 
ATOM   3573 C  CD1   . TYR B 1 142 ? 64.213 36.317  116.467 1.00 13.28 ? 178 TYR B CD1   1 
ATOM   3574 C  CD2   . TYR B 1 142 ? 63.833 34.314  117.711 1.00 10.08 ? 178 TYR B CD2   1 
ATOM   3575 C  CE1   . TYR B 1 142 ? 63.084 36.062  115.698 1.00 10.51 ? 178 TYR B CE1   1 
ATOM   3576 C  CE2   . TYR B 1 142 ? 62.690 34.049  116.938 1.00 12.65 ? 178 TYR B CE2   1 
ATOM   3577 C  CZ    . TYR B 1 142 ? 62.330 34.935  115.937 1.00 10.78 ? 178 TYR B CZ    1 
ATOM   3578 O  OH    . TYR B 1 142 ? 61.206 34.699  115.171 1.00 13.92 ? 178 TYR B OH    1 
ATOM   3579 N  N     . THR B 1 143 ? 69.058 36.241  118.947 1.00 10.84 ? 179 THR B N     1 
ATOM   3580 C  CA    A THR B 1 143 ? 70.073 37.159  119.474 0.63 13.08 ? 179 THR B CA    1 
ATOM   3581 C  CA    B THR B 1 143 ? 70.085 37.130  119.495 0.37 13.05 ? 179 THR B CA    1 
ATOM   3582 C  C     . THR B 1 143 ? 71.084 37.501  118.396 1.00 13.28 ? 179 THR B C     1 
ATOM   3583 O  O     . THR B 1 143 ? 71.660 38.587  118.396 1.00 14.23 ? 179 THR B O     1 
ATOM   3584 C  CB    A THR B 1 143 ? 70.820 36.586  120.691 0.63 13.37 ? 179 THR B CB    1 
ATOM   3585 C  CB    B THR B 1 143 ? 70.803 36.511  120.749 0.37 13.41 ? 179 THR B CB    1 
ATOM   3586 O  OG1   A THR B 1 143 ? 71.725 35.567  120.250 0.63 17.44 ? 179 THR B OG1   1 
ATOM   3587 O  OG1   B THR B 1 143 ? 71.321 37.552  121.581 0.37 11.48 ? 179 THR B OG1   1 
ATOM   3588 C  CG2   A THR B 1 143 ? 69.844 36.016  121.673 0.63 11.18 ? 179 THR B CG2   1 
ATOM   3589 C  CG2   B THR B 1 143 ? 71.948 35.598  120.348 0.37 16.94 ? 179 THR B CG2   1 
ATOM   3590 N  N     . LYS B 1 144 ? 71.276 36.586  117.445 1.00 12.35 ? 180 LYS B N     1 
ATOM   3591 C  CA    . LYS B 1 144 ? 72.198 36.817  116.341 1.00 13.04 ? 180 LYS B CA    1 
ATOM   3592 C  C     . LYS B 1 144 ? 71.619 37.756  115.296 1.00 15.47 ? 180 LYS B C     1 
ATOM   3593 O  O     . LYS B 1 144 ? 72.354 38.431  114.585 1.00 15.29 ? 180 LYS B O     1 
ATOM   3594 C  CB    . LYS B 1 144 ? 72.605 35.493  115.682 1.00 13.85 ? 180 LYS B CB    1 
ATOM   3595 C  CG    . LYS B 1 144 ? 73.556 34.681  116.530 1.00 17.70 ? 180 LYS B CG    1 
ATOM   3596 C  CD    . LYS B 1 144 ? 73.882 33.346  115.854 1.00 25.87 ? 180 LYS B CD    1 
ATOM   3597 C  CE    . LYS B 1 144 ? 75.046 32.665  116.548 1.00 29.33 ? 180 LYS B CE    1 
ATOM   3598 N  NZ    . LYS B 1 144 ? 74.707 31.283  116.971 1.00 32.50 ? 180 LYS B NZ    1 
ATOM   3599 N  N     . LEU B 1 145 ? 70.297 37.817  115.212 1.00 12.10 ? 181 LEU B N     1 
ATOM   3600 C  CA    . LEU B 1 145 ? 69.651 38.621  114.168 1.00 12.88 ? 181 LEU B CA    1 
ATOM   3601 C  C     . LEU B 1 145 ? 69.701 40.117  114.472 1.00 20.15 ? 181 LEU B C     1 
ATOM   3602 O  O     . LEU B 1 145 ? 69.794 40.937  113.564 1.00 16.91 ? 181 LEU B O     1 
ATOM   3603 C  CB    . LEU B 1 145 ? 68.192 38.182  113.965 1.00 10.68 ? 181 LEU B CB    1 
ATOM   3604 C  CG    . LEU B 1 145 ? 67.900 37.012  113.030 1.00 20.39 ? 181 LEU B CG    1 
ATOM   3605 C  CD1   . LEU B 1 145 ? 66.397 36.758  112.977 1.00 14.98 ? 181 LEU B CD1   1 
ATOM   3606 C  CD2   . LEU B 1 145 ? 68.446 37.298  111.623 1.00 19.49 ? 181 LEU B CD2   1 
ATOM   3607 N  N     . ASP B 1 146 ? 69.641 40.483  115.750 1.00 12.40 ? 182 ASP B N     1 
ATOM   3608 C  CA    . ASP B 1 146 ? 69.608 41.909  116.100 1.00 12.11 ? 182 ASP B CA    1 
ATOM   3609 C  C     . ASP B 1 146 ? 70.239 42.123  117.469 1.00 12.99 ? 182 ASP B C     1 
ATOM   3610 O  O     . ASP B 1 146 ? 69.851 41.470  118.444 1.00 11.61 ? 182 ASP B O     1 
ATOM   3611 C  CB    . ASP B 1 146 ? 68.154 42.387  116.104 1.00 12.47 ? 182 ASP B CB    1 
ATOM   3612 C  CG    . ASP B 1 146 ? 68.032 43.900  116.057 1.00 20.01 ? 182 ASP B CG    1 
ATOM   3613 O  OD1   . ASP B 1 146 ? 68.314 44.543  117.087 1.00 16.15 ? 182 ASP B OD1   1 
ATOM   3614 O  OD2   . ASP B 1 146 ? 67.660 44.453  114.991 1.00 20.64 ? 182 ASP B OD2   1 
ATOM   3615 N  N     . ALA B 1 147 ? 71.206 43.035  117.547 1.00 11.78 ? 183 ALA B N     1 
ATOM   3616 C  CA    . ALA B 1 147 ? 71.988 43.218  118.773 1.00 12.72 ? 183 ALA B CA    1 
ATOM   3617 C  C     . ALA B 1 147 ? 71.244 44.008  119.838 1.00 10.15 ? 183 ALA B C     1 
ATOM   3618 O  O     . ALA B 1 147 ? 71.775 44.223  120.926 1.00 10.86 ? 183 ALA B O     1 
ATOM   3619 C  CB    . ALA B 1 147 ? 73.343 43.891  118.468 1.00 13.03 ? 183 ALA B CB    1 
ATOM   3620 N  N     . ARG B 1 148 ? 70.031 44.453  119.532 1.00 10.01 ? 184 ARG B N     1 
ATOM   3621 C  CA    . ARG B 1 148 ? 69.186 45.071  120.559 1.00 11.96 ? 184 ARG B CA    1 
ATOM   3622 C  C     . ARG B 1 148 ? 68.553 44.031  121.470 1.00 14.53 ? 184 ARG B C     1 
ATOM   3623 O  O     . ARG B 1 148 ? 68.157 44.350  122.599 1.00 10.77 ? 184 ARG B O     1 
ATOM   3624 C  CB    . ARG B 1 148 ? 68.092 45.939  119.925 1.00 13.30 ? 184 ARG B CB    1 
ATOM   3625 C  CG    . ARG B 1 148 ? 68.593 47.283  119.394 1.00 11.57 ? 184 ARG B CG    1 
ATOM   3626 C  CD    . ARG B 1 148 ? 67.538 47.971  118.530 1.00 9.37  ? 184 ARG B CD    1 
ATOM   3627 N  NE    . ARG B 1 148 ? 67.183 47.182  117.352 1.00 10.82 ? 184 ARG B NE    1 
ATOM   3628 C  CZ    . ARG B 1 148 ? 66.273 47.549  116.459 1.00 13.80 ? 184 ARG B CZ    1 
ATOM   3629 N  NH1   . ARG B 1 148 ? 65.618 48.696  116.617 1.00 16.91 ? 184 ARG B NH1   1 
ATOM   3630 N  NH2   . ARG B 1 148 ? 66.016 46.766  115.411 1.00 15.94 ? 184 ARG B NH2   1 
ATOM   3631 N  N     . LEU B 1 149 ? 68.453 42.791  120.999 1.00 8.81  ? 185 LEU B N     1 
ATOM   3632 C  CA    . LEU B 1 149 ? 67.736 41.768  121.777 1.00 8.81  ? 185 LEU B CA    1 
ATOM   3633 C  C     . LEU B 1 149 ? 68.423 41.416  123.083 1.00 10.11 ? 185 LEU B C     1 
ATOM   3634 O  O     . LEU B 1 149 ? 67.784 41.390  124.146 1.00 10.47 ? 185 LEU B O     1 
ATOM   3635 C  CB    . LEU B 1 149 ? 67.452 40.496  120.964 1.00 9.12  ? 185 LEU B CB    1 
ATOM   3636 C  CG    . LEU B 1 149 ? 66.721 39.416  121.780 1.00 10.05 ? 185 LEU B CG    1 
ATOM   3637 C  CD1   . LEU B 1 149 ? 65.291 39.840  122.126 1.00 8.69  ? 185 LEU B CD1   1 
ATOM   3638 C  CD2   . LEU B 1 149 ? 66.714 38.052  121.068 1.00 9.49  ? 185 LEU B CD2   1 
ATOM   3639 N  N     . LYS B 1 150 ? 69.727 41.164  123.027 1.00 8.85  ? 186 LYS B N     1 
ATOM   3640 C  CA    . LYS B 1 150 ? 70.441 40.768  124.244 1.00 12.38 ? 186 LYS B CA    1 
ATOM   3641 C  C     . LYS B 1 150 ? 70.308 41.783  125.399 1.00 12.35 ? 186 LYS B C     1 
ATOM   3642 O  O     . LYS B 1 150 ? 69.932 41.405  126.513 1.00 11.17 ? 186 LYS B O     1 
ATOM   3643 C  CB    . LYS B 1 150 ? 71.914 40.454  123.965 1.00 13.04 ? 186 LYS B CB    1 
ATOM   3644 C  CG    . LYS B 1 150 ? 72.724 40.238  125.235 1.00 16.87 ? 186 LYS B CG    1 
ATOM   3645 C  CD    . LYS B 1 150 ? 74.186 39.904  124.923 1.00 21.34 ? 186 LYS B CD    1 
ATOM   3646 C  CE    . LYS B 1 150 ? 75.014 39.794  126.200 1.00 22.50 ? 186 LYS B CE    1 
ATOM   3647 N  NZ    . LYS B 1 150 ? 76.465 39.638  125.891 1.00 28.87 ? 186 LYS B NZ    1 
ATOM   3648 N  N     . PRO B 1 151 ? 70.613 43.071  125.152 1.00 10.08 ? 187 PRO B N     1 
ATOM   3649 C  CA    . PRO B 1 151 ? 70.484 43.954  126.322 1.00 10.24 ? 187 PRO B CA    1 
ATOM   3650 C  C     . PRO B 1 151 ? 69.030 44.126  126.787 1.00 11.32 ? 187 PRO B C     1 
ATOM   3651 O  O     . PRO B 1 151 ? 68.768 44.263  127.987 1.00 10.53 ? 187 PRO B O     1 
ATOM   3652 C  CB    . PRO B 1 151 ? 71.100 45.279  125.836 1.00 9.74  ? 187 PRO B CB    1 
ATOM   3653 C  CG    . PRO B 1 151 ? 71.021 45.215  124.313 1.00 10.28 ? 187 PRO B CG    1 
ATOM   3654 C  CD    . PRO B 1 151 ? 71.248 43.751  124.006 1.00 13.30 ? 187 PRO B CD    1 
ATOM   3655 N  N     . MET B 1 152 ? 68.084 44.098  125.858 1.00 10.01 ? 188 MET B N     1 
ATOM   3656 C  CA    . MET B 1 152 ? 66.681 44.251  126.235 1.00 12.33 ? 188 MET B CA    1 
ATOM   3657 C  C     . MET B 1 152 ? 66.270 43.099  127.140 1.00 13.03 ? 188 MET B C     1 
ATOM   3658 O  O     . MET B 1 152 ? 65.595 43.298  128.151 1.00 9.77  ? 188 MET B O     1 
ATOM   3659 C  CB    . MET B 1 152 ? 65.799 44.291  124.996 1.00 12.12 ? 188 MET B CB    1 
ATOM   3660 C  CG    . MET B 1 152 ? 64.330 44.449  125.319 1.00 12.94 ? 188 MET B CG    1 
ATOM   3661 S  SD    . MET B 1 152 ? 63.359 44.544  123.829 1.00 12.77 ? 188 MET B SD    1 
ATOM   3662 C  CE    . MET B 1 152 ? 61.729 44.920  124.450 1.00 13.37 ? 188 MET B CE    1 
ATOM   3663 N  N     . VAL B 1 153 ? 66.709 41.892  126.784 1.00 10.87 ? 189 VAL B N     1 
ATOM   3664 C  CA    . VAL B 1 153 ? 66.380 40.703  127.573 1.00 9.65  ? 189 VAL B CA    1 
ATOM   3665 C  C     . VAL B 1 153 ? 67.028 40.739  128.960 1.00 10.71 ? 189 VAL B C     1 
ATOM   3666 O  O     . VAL B 1 153 ? 66.386 40.429  129.967 1.00 10.13 ? 189 VAL B O     1 
ATOM   3667 C  CB    . VAL B 1 153 ? 66.786 39.411  126.835 1.00 10.26 ? 189 VAL B CB    1 
ATOM   3668 C  CG1   . VAL B 1 153 ? 66.829 38.240  127.798 1.00 9.78  ? 189 VAL B CG1   1 
ATOM   3669 C  CG2   . VAL B 1 153 ? 65.808 39.114  125.702 1.00 10.92 ? 189 VAL B CG2   1 
ATOM   3670 N  N     . LEU B 1 154 ? 68.290 41.128  129.016 1.00 11.07 ? 190 LEU B N     1 
ATOM   3671 C  CA    . LEU B 1 154 ? 68.989 41.168  130.299 1.00 10.85 ? 190 LEU B CA    1 
ATOM   3672 C  C     . LEU B 1 154 ? 68.325 42.187  131.222 1.00 14.71 ? 190 LEU B C     1 
ATOM   3673 O  O     . LEU B 1 154 ? 68.165 41.946  132.423 1.00 13.41 ? 190 LEU B O     1 
ATOM   3674 C  CB    . LEU B 1 154 ? 70.448 41.553  130.106 1.00 8.85  ? 190 LEU B CB    1 
ATOM   3675 C  CG    . LEU B 1 154 ? 71.361 40.585  129.346 1.00 19.04 ? 190 LEU B CG    1 
ATOM   3676 C  CD1   . LEU B 1 154 ? 72.816 40.864  129.701 1.00 17.47 ? 190 LEU B CD1   1 
ATOM   3677 C  CD2   . LEU B 1 154 ? 71.007 39.157  129.644 1.00 18.68 ? 190 LEU B CD2   1 
ATOM   3678 N  N     . LEU B 1 155 ? 67.932 43.319  130.652 1.00 14.09 ? 191 LEU B N     1 
ATOM   3679 C  CA    . LEU B 1 155 ? 67.301 44.384  131.434 1.00 14.15 ? 191 LEU B CA    1 
ATOM   3680 C  C     . LEU B 1 155 ? 65.926 43.949  131.957 1.00 13.66 ? 191 LEU B C     1 
ATOM   3681 O  O     . LEU B 1 155 ? 65.589 44.206  133.123 1.00 16.56 ? 191 LEU B O     1 
ATOM   3682 C  CB    . LEU B 1 155 ? 67.229 45.670  130.613 1.00 13.43 ? 191 LEU B CB    1 
ATOM   3683 C  CG    . LEU B 1 155 ? 68.608 46.286  130.337 1.00 11.32 ? 191 LEU B CG    1 
ATOM   3684 C  CD1   . LEU B 1 155 ? 68.540 47.383  129.276 1.00 14.47 ? 191 LEU B CD1   1 
ATOM   3685 C  CD2   . LEU B 1 155 ? 69.208 46.834  131.613 1.00 15.38 ? 191 LEU B CD2   1 
ATOM   3686 N  N     . VAL B 1 156 ? 65.151 43.256  131.121 1.00 11.15 ? 192 VAL B N     1 
ATOM   3687 C  CA    . VAL B 1 156 ? 63.860 42.707  131.552 1.00 11.98 ? 192 VAL B CA    1 
ATOM   3688 C  C     . VAL B 1 156 ? 64.027 41.663  132.662 1.00 13.61 ? 192 VAL B C     1 
ATOM   3689 O  O     . VAL B 1 156 ? 63.282 41.663  133.651 1.00 11.26 ? 192 VAL B O     1 
ATOM   3690 C  CB    . VAL B 1 156 ? 63.026 42.172  130.348 1.00 10.55 ? 192 VAL B CB    1 
ATOM   3691 C  CG1   . VAL B 1 156 ? 61.774 41.446  130.819 1.00 12.13 ? 192 VAL B CG1   1 
ATOM   3692 C  CG2   . VAL B 1 156 ? 62.624 43.331  129.433 1.00 10.80 ? 192 VAL B CG2   1 
ATOM   3693 N  N     . LYS B 1 157 ? 65.005 40.775  132.507 1.00 12.43 ? 193 LYS B N     1 
ATOM   3694 C  CA    . LYS B 1 157 ? 65.260 39.750  133.517 1.00 11.05 ? 193 LYS B CA    1 
ATOM   3695 C  C     . LYS B 1 157 ? 65.705 40.393  134.832 1.00 17.10 ? 193 LYS B C     1 
ATOM   3696 O  O     . LYS B 1 157 ? 65.318 39.941  135.909 1.00 15.84 ? 193 LYS B O     1 
ATOM   3697 C  CB    . LYS B 1 157 ? 66.313 38.744  133.007 1.00 12.78 ? 193 LYS B CB    1 
ATOM   3698 C  CG    . LYS B 1 157 ? 65.740 37.751  131.982 1.00 15.34 ? 193 LYS B CG    1 
ATOM   3699 C  CD    . LYS B 1 157 ? 66.815 37.009  131.174 1.00 18.20 ? 193 LYS B CD    1 
ATOM   3700 C  CE    . LYS B 1 157 ? 67.601 36.027  131.972 1.00 23.38 ? 193 LYS B CE    1 
ATOM   3701 N  NZ    . LYS B 1 157 ? 68.228 34.979  131.047 1.00 22.39 ? 193 LYS B NZ    1 
ATOM   3702 N  N     . HIS B 1 158 ? 66.502 41.456  134.733 1.00 15.33 ? 194 HIS B N     1 
ATOM   3703 C  CA    . HIS B 1 158 ? 67.039 42.162  135.902 1.00 14.88 ? 194 HIS B CA    1 
ATOM   3704 C  C     . HIS B 1 158 ? 65.912 42.856  136.658 1.00 17.76 ? 194 HIS B C     1 
ATOM   3705 O  O     . HIS B 1 158 ? 65.845 42.807  137.888 1.00 17.83 ? 194 HIS B O     1 
ATOM   3706 C  CB    . HIS B 1 158 ? 68.090 43.179  135.433 1.00 16.21 ? 194 HIS B CB    1 
ATOM   3707 C  CG    . HIS B 1 158 ? 68.770 43.931  136.538 1.00 19.40 ? 194 HIS B CG    1 
ATOM   3708 N  ND1   . HIS B 1 158 ? 69.352 43.309  137.622 1.00 17.21 ? 194 HIS B ND1   1 
ATOM   3709 C  CD2   . HIS B 1 158 ? 68.992 45.258  136.705 1.00 21.73 ? 194 HIS B CD2   1 
ATOM   3710 C  CE1   . HIS B 1 158 ? 69.895 44.220  138.411 1.00 24.18 ? 194 HIS B CE1   1 
ATOM   3711 N  NE2   . HIS B 1 158 ? 69.687 45.413  137.879 1.00 21.83 ? 194 HIS B NE2   1 
ATOM   3712 N  N     . TRP B 1 159 ? 65.035 43.506  135.898 1.00 13.93 ? 195 TRP B N     1 
ATOM   3713 C  CA    . TRP B 1 159 ? 63.819 44.130  136.399 1.00 17.27 ? 195 TRP B CA    1 
ATOM   3714 C  C     . TRP B 1 159 ? 62.908 43.128  137.106 1.00 22.48 ? 195 TRP B C     1 
ATOM   3715 O  O     . TRP B 1 159 ? 62.415 43.392  138.205 1.00 16.74 ? 195 TRP B O     1 
ATOM   3716 C  CB    . TRP B 1 159 ? 63.078 44.766  135.220 1.00 15.79 ? 195 TRP B CB    1 
ATOM   3717 C  CG    . TRP B 1 159 ? 61.656 45.193  135.484 1.00 16.06 ? 195 TRP B CG    1 
ATOM   3718 C  CD1   . TRP B 1 159 ? 61.245 46.296  136.190 1.00 17.13 ? 195 TRP B CD1   1 
ATOM   3719 C  CD2   . TRP B 1 159 ? 60.467 44.579  134.979 1.00 15.33 ? 195 TRP B CD2   1 
ATOM   3720 N  NE1   . TRP B 1 159 ? 59.878 46.379  136.181 1.00 16.78 ? 195 TRP B NE1   1 
ATOM   3721 C  CE2   . TRP B 1 159 ? 59.373 45.340  135.441 1.00 16.93 ? 195 TRP B CE2   1 
ATOM   3722 C  CE3   . TRP B 1 159 ? 60.217 43.450  134.191 1.00 14.96 ? 195 TRP B CE3   1 
ATOM   3723 C  CZ2   . TRP B 1 159 ? 58.054 45.009  135.143 1.00 18.68 ? 195 TRP B CZ2   1 
ATOM   3724 C  CZ3   . TRP B 1 159 ? 58.908 43.127  133.889 1.00 13.70 ? 195 TRP B CZ3   1 
ATOM   3725 C  CH2   . TRP B 1 159 ? 57.841 43.900  134.368 1.00 14.05 ? 195 TRP B CH2   1 
ATOM   3726 N  N     . ALA B 1 160 ? 62.686 41.978  136.475 1.00 14.83 ? 196 ALA B N     1 
ATOM   3727 C  CA    . ALA B 1 160 ? 61.802 40.972  137.044 1.00 16.61 ? 196 ALA B CA    1 
ATOM   3728 C  C     . ALA B 1 160 ? 62.341 40.397  138.358 1.00 18.22 ? 196 ALA B C     1 
ATOM   3729 O  O     . ALA B 1 160 ? 61.556 40.103  139.272 1.00 18.28 ? 196 ALA B O     1 
ATOM   3730 C  CB    . ALA B 1 160 ? 61.536 39.851  136.033 1.00 14.92 ? 196 ALA B CB    1 
ATOM   3731 N  N     . LYS B 1 161 ? 63.661 40.219  138.460 1.00 16.57 ? 197 LYS B N     1 
ATOM   3732 C  CA    . LYS B 1 161 ? 64.240 39.695  139.703 1.00 17.84 ? 197 LYS B CA    1 
ATOM   3733 C  C     . LYS B 1 161 ? 64.131 40.747  140.796 1.00 21.56 ? 197 LYS B C     1 
ATOM   3734 O  O     . LYS B 1 161 ? 63.775 40.445  141.942 1.00 21.81 ? 197 LYS B O     1 
ATOM   3735 C  CB    . LYS B 1 161 ? 65.714 39.328  139.540 1.00 21.96 ? 197 LYS B CB    1 
ATOM   3736 C  CG    . LYS B 1 161 ? 66.028 38.354  138.422 1.00 29.91 ? 197 LYS B CG    1 
ATOM   3737 C  CD    . LYS B 1 161 ? 67.451 37.820  138.559 1.00 36.18 ? 197 LYS B CD    1 
ATOM   3738 C  CE    . LYS B 1 161 ? 67.463 36.293  138.676 1.00 45.15 ? 197 LYS B CE    1 
ATOM   3739 N  NZ    . LYS B 1 161 ? 67.116 35.610  137.391 1.00 39.08 ? 197 LYS B NZ    1 
ATOM   3740 N  N     . ARG B 1 162 ? 64.449 41.985  140.431 1.00 20.93 ? 198 ARG B N     1 
ATOM   3741 C  CA    . ARG B 1 162 ? 64.421 43.093  141.380 1.00 23.32 ? 198 ARG B CA    1 
ATOM   3742 C  C     . ARG B 1 162 ? 63.026 43.323  141.944 1.00 22.03 ? 198 ARG B C     1 
ATOM   3743 O  O     . ARG B 1 162 ? 62.872 43.619  143.127 1.00 23.85 ? 198 ARG B O     1 
ATOM   3744 C  CB    . ARG B 1 162 ? 64.931 44.368  140.713 1.00 23.44 ? 198 ARG B CB    1 
ATOM   3745 C  CG    . ARG B 1 162 ? 66.437 44.440  140.588 1.00 22.42 ? 198 ARG B CG    1 
ATOM   3746 C  CD    . ARG B 1 162 ? 67.103 44.516  141.952 1.00 27.92 ? 198 ARG B CD    1 
ATOM   3747 N  NE    . ARG B 1 162 ? 68.341 45.285  141.895 1.00 33.19 ? 198 ARG B NE    1 
ATOM   3748 C  CZ    . ARG B 1 162 ? 69.549 44.750  141.769 1.00 31.42 ? 198 ARG B CZ    1 
ATOM   3749 N  NH1   . ARG B 1 162 ? 69.689 43.431  141.698 1.00 42.23 ? 198 ARG B NH1   1 
ATOM   3750 N  NH2   . ARG B 1 162 ? 70.618 45.532  141.718 1.00 33.59 ? 198 ARG B NH2   1 
ATOM   3751 N  N     . LYS B 1 163 ? 62.009 43.178  141.098 1.00 15.42 ? 199 LYS B N     1 
ATOM   3752 C  CA    . LYS B 1 163 ? 60.639 43.443  141.508 1.00 20.06 ? 199 LYS B CA    1 
ATOM   3753 C  C     . LYS B 1 163 ? 59.978 42.203  142.084 1.00 22.91 ? 199 LYS B C     1 
ATOM   3754 O  O     . LYS B 1 163 ? 58.785 42.227  142.395 1.00 22.87 ? 199 LYS B O     1 
ATOM   3755 C  CB    . LYS B 1 163 ? 59.803 43.987  140.342 1.00 19.60 ? 199 LYS B CB    1 
ATOM   3756 C  CG    . LYS B 1 163 ? 60.330 45.289  139.713 1.00 20.14 ? 199 LYS B CG    1 
ATOM   3757 C  CD    . LYS B 1 163 ? 60.685 46.349  140.762 1.00 22.12 ? 199 LYS B CD    1 
ATOM   3758 C  CE    . LYS B 1 163 ? 60.859 47.738  140.114 1.00 23.03 ? 199 LYS B CE    1 
ATOM   3759 N  NZ    . LYS B 1 163 ? 61.231 48.815  141.097 1.00 27.63 ? 199 LYS B NZ    1 
ATOM   3760 N  N     . GLN B 1 164 ? 60.746 41.122  142.209 1.00 20.79 ? 200 GLN B N     1 
ATOM   3761 C  CA    . GLN B 1 164 ? 60.235 39.872  142.788 1.00 21.68 ? 200 GLN B CA    1 
ATOM   3762 C  C     . GLN B 1 164 ? 59.081 39.265  141.995 1.00 23.60 ? 200 GLN B C     1 
ATOM   3763 O  O     . GLN B 1 164 ? 58.123 38.748  142.586 1.00 17.94 ? 200 GLN B O     1 
ATOM   3764 C  CB    . GLN B 1 164 ? 59.794 40.087  144.249 1.00 28.03 ? 200 GLN B CB    1 
ATOM   3765 C  CG    . GLN B 1 164 ? 60.569 39.278  145.271 1.00 41.33 ? 200 GLN B CG    1 
ATOM   3766 C  CD    . GLN B 1 164 ? 61.748 40.035  145.831 1.00 44.82 ? 200 GLN B CD    1 
ATOM   3767 O  OE1   . GLN B 1 164 ? 62.894 39.784  145.457 1.00 43.83 ? 200 GLN B OE1   1 
ATOM   3768 N  NE2   . GLN B 1 164 ? 61.475 40.970  146.739 1.00 50.82 ? 200 GLN B NE2   1 
ATOM   3769 N  N     . ILE B 1 165 ? 59.166 39.313  140.663 1.00 14.91 ? 201 ILE B N     1 
ATOM   3770 C  CA    . ILE B 1 165 ? 58.143 38.692  139.822 1.00 14.93 ? 201 ILE B CA    1 
ATOM   3771 C  C     . ILE B 1 165 ? 58.735 37.612  138.906 1.00 14.04 ? 201 ILE B C     1 
ATOM   3772 O  O     . ILE B 1 165 ? 58.163 37.267  137.871 1.00 16.35 ? 201 ILE B O     1 
ATOM   3773 C  CB    . ILE B 1 165 ? 57.345 39.726  139.003 1.00 15.73 ? 201 ILE B CB    1 
ATOM   3774 C  CG1   . ILE B 1 165 ? 58.280 40.586  138.151 1.00 13.45 ? 201 ILE B CG1   1 
ATOM   3775 C  CG2   . ILE B 1 165 ? 56.480 40.580  139.938 1.00 18.62 ? 201 ILE B CG2   1 
ATOM   3776 C  CD1   . ILE B 1 165 ? 57.548 41.639  137.287 1.00 12.88 ? 201 ILE B CD1   1 
ATOM   3777 N  N     . ASN B 1 166 ? 59.872 37.078  139.336 1.00 14.73 ? 202 ASN B N     1 
ATOM   3778 C  CA    . ASN B 1 166 ? 60.629 36.078  138.602 1.00 17.74 ? 202 ASN B CA    1 
ATOM   3779 C  C     . ASN B 1 166 ? 60.774 34.810  139.455 1.00 17.07 ? 202 ASN B C     1 
ATOM   3780 O  O     . ASN B 1 166 ? 61.808 34.150  139.436 1.00 19.01 ? 202 ASN B O     1 
ATOM   3781 C  CB    . ASN B 1 166 ? 61.994 36.681  138.269 1.00 19.01 ? 202 ASN B CB    1 
ATOM   3782 C  CG    . ASN B 1 166 ? 62.861 35.777  137.421 1.00 19.61 ? 202 ASN B CG    1 
ATOM   3783 O  OD1   . ASN B 1 166 ? 64.085 35.802  137.550 1.00 19.88 ? 202 ASN B OD1   1 
ATOM   3784 N  ND2   . ASN B 1 166 ? 62.240 34.983  136.540 1.00 17.02 ? 202 ASN B ND2   1 
ATOM   3785 N  N     . SER B 1 167 ? 59.731 34.473  140.209 1.00 20.01 ? 203 SER B N     1 
ATOM   3786 C  CA    . SER B 1 167 ? 59.783 33.306  141.093 1.00 22.02 ? 203 SER B CA    1 
ATOM   3787 C  C     . SER B 1 167 ? 58.692 32.300  140.768 1.00 23.53 ? 203 SER B C     1 
ATOM   3788 O  O     . SER B 1 167 ? 57.629 32.317  141.395 1.00 23.78 ? 203 SER B O     1 
ATOM   3789 C  CB    . SER B 1 167 ? 59.649 33.746  142.553 1.00 19.60 ? 203 SER B CB    1 
ATOM   3790 O  OG    . SER B 1 167 ? 60.761 34.512  142.961 1.00 24.92 ? 203 SER B OG    1 
ATOM   3791 N  N     . PRO B 1 168 ? 58.952 31.405  139.796 1.00 18.28 ? 204 PRO B N     1 
ATOM   3792 C  CA    . PRO B 1 168 ? 57.914 30.499  139.297 1.00 19.69 ? 204 PRO B CA    1 
ATOM   3793 C  C     . PRO B 1 168 ? 57.448 29.486  140.330 1.00 30.79 ? 204 PRO B C     1 
ATOM   3794 O  O     . PRO B 1 168 ? 56.409 28.850  140.146 1.00 27.85 ? 204 PRO B O     1 
ATOM   3795 C  CB    . PRO B 1 168 ? 58.601 29.785  138.122 1.00 24.70 ? 204 PRO B CB    1 
ATOM   3796 C  CG    . PRO B 1 168 ? 60.067 29.987  138.345 1.00 25.68 ? 204 PRO B CG    1 
ATOM   3797 C  CD    . PRO B 1 168 ? 60.180 31.326  138.986 1.00 19.40 ? 204 PRO B CD    1 
ATOM   3798 N  N     . TYR B 1 169 ? 58.208 29.336  141.404 1.00 27.39 ? 205 TYR B N     1 
ATOM   3799 C  CA    . TYR B 1 169 ? 57.803 28.454  142.486 1.00 33.78 ? 205 TYR B CA    1 
ATOM   3800 C  C     . TYR B 1 169 ? 56.891 29.193  143.462 1.00 33.20 ? 205 TYR B C     1 
ATOM   3801 O  O     . TYR B 1 169 ? 56.252 28.581  144.313 1.00 31.43 ? 205 TYR B O     1 
ATOM   3802 C  CB    . TYR B 1 169 ? 59.039 27.865  143.178 1.00 33.57 ? 205 TYR B CB    1 
ATOM   3803 C  CG    . TYR B 1 169 ? 59.696 26.768  142.362 1.00 43.33 ? 205 TYR B CG    1 
ATOM   3804 C  CD1   . TYR B 1 169 ? 58.926 25.805  141.718 1.00 48.62 ? 205 TYR B CD1   1 
ATOM   3805 C  CD2   . TYR B 1 169 ? 61.077 26.704  142.219 1.00 43.26 ? 205 TYR B CD2   1 
ATOM   3806 C  CE1   . TYR B 1 169 ? 59.511 24.802  140.962 1.00 48.90 ? 205 TYR B CE1   1 
ATOM   3807 C  CE2   . TYR B 1 169 ? 61.673 25.704  141.464 1.00 48.30 ? 205 TYR B CE2   1 
ATOM   3808 C  CZ    . TYR B 1 169 ? 60.882 24.754  140.839 1.00 51.71 ? 205 TYR B CZ    1 
ATOM   3809 O  OH    . TYR B 1 169 ? 61.459 23.755  140.087 1.00 52.76 ? 205 TYR B OH    1 
ATOM   3810 N  N     . PHE B 1 170 ? 56.809 30.514  143.314 1.00 29.88 ? 206 PHE B N     1 
ATOM   3811 C  CA    . PHE B 1 170 ? 55.982 31.328  144.196 1.00 26.59 ? 206 PHE B CA    1 
ATOM   3812 C  C     . PHE B 1 170 ? 54.932 32.157  143.458 1.00 27.28 ? 206 PHE B C     1 
ATOM   3813 O  O     . PHE B 1 170 ? 54.561 33.245  143.903 1.00 29.43 ? 206 PHE B O     1 
ATOM   3814 C  CB    . PHE B 1 170 ? 56.854 32.208  145.093 1.00 32.06 ? 206 PHE B CB    1 
ATOM   3815 C  CG    . PHE B 1 170 ? 57.669 31.429  146.092 1.00 38.42 ? 206 PHE B CG    1 
ATOM   3816 C  CD1   . PHE B 1 170 ? 58.865 30.827  145.721 1.00 41.27 ? 206 PHE B CD1   1 
ATOM   3817 C  CD2   . PHE B 1 170 ? 57.237 31.300  147.404 1.00 41.20 ? 206 PHE B CD2   1 
ATOM   3818 C  CE1   . PHE B 1 170 ? 59.614 30.108  146.643 1.00 48.92 ? 206 PHE B CE1   1 
ATOM   3819 C  CE2   . PHE B 1 170 ? 57.982 30.588  148.332 1.00 49.59 ? 206 PHE B CE2   1 
ATOM   3820 C  CZ    . PHE B 1 170 ? 59.170 29.990  147.951 1.00 51.87 ? 206 PHE B CZ    1 
ATOM   3821 N  N     . GLY B 1 171 ? 54.447 31.627  142.336 1.00 18.72 ? 207 GLY B N     1 
ATOM   3822 C  CA    . GLY B 1 171 ? 53.265 32.173  141.690 1.00 21.44 ? 207 GLY B CA    1 
ATOM   3823 C  C     . GLY B 1 171 ? 53.532 33.226  140.626 1.00 16.90 ? 207 GLY B C     1 
ATOM   3824 O  O     . GLY B 1 171 ? 52.583 33.755  140.041 1.00 19.76 ? 207 GLY B O     1 
ATOM   3825 N  N     . THR B 1 172 ? 54.805 33.546  140.395 1.00 16.98 ? 208 THR B N     1 
ATOM   3826 C  CA    . THR B 1 172 ? 55.166 34.414  139.265 1.00 17.62 ? 208 THR B CA    1 
ATOM   3827 C  C     . THR B 1 172 ? 55.842 33.611  138.132 1.00 17.27 ? 208 THR B C     1 
ATOM   3828 O  O     . THR B 1 172 ? 55.609 32.410  138.002 1.00 16.39 ? 208 THR B O     1 
ATOM   3829 C  CB    . THR B 1 172 ? 55.936 35.681  139.687 1.00 13.33 ? 208 THR B CB    1 
ATOM   3830 O  OG1   . THR B 1 172 ? 57.041 35.343  140.533 1.00 17.09 ? 208 THR B OG1   1 
ATOM   3831 C  CG2   . THR B 1 172 ? 55.004 36.656  140.439 1.00 16.81 ? 208 THR B CG2   1 
ATOM   3832 N  N     . LEU B 1 173 ? 56.671 34.266  137.325 1.00 13.35 ? 209 LEU B N     1 
ATOM   3833 C  CA    . LEU B 1 173 ? 57.022 33.751  135.995 1.00 13.83 ? 209 LEU B CA    1 
ATOM   3834 C  C     . LEU B 1 173 ? 58.509 33.445  135.814 1.00 12.68 ? 209 LEU B C     1 
ATOM   3835 O  O     . LEU B 1 173 ? 59.381 34.195  136.262 1.00 16.22 ? 209 LEU B O     1 
ATOM   3836 C  CB    . LEU B 1 173 ? 56.571 34.767  134.924 1.00 16.29 ? 209 LEU B CB    1 
ATOM   3837 C  CG    . LEU B 1 173 ? 56.732 34.429  133.439 1.00 13.62 ? 209 LEU B CG    1 
ATOM   3838 C  CD1   . LEU B 1 173 ? 55.790 33.281  133.027 1.00 11.11 ? 209 LEU B CD1   1 
ATOM   3839 C  CD2   . LEU B 1 173 ? 56.492 35.663  132.564 1.00 11.60 ? 209 LEU B CD2   1 
ATOM   3840 N  N     . SER B 1 174 ? 58.801 32.349  135.124 1.00 13.36 ? 210 SER B N     1 
ATOM   3841 C  CA    . SER B 1 174 ? 60.183 31.979  134.823 1.00 16.72 ? 210 SER B CA    1 
ATOM   3842 C  C     . SER B 1 174 ? 60.838 33.015  133.912 1.00 14.02 ? 210 SER B C     1 
ATOM   3843 O  O     . SER B 1 174 ? 60.151 33.731  133.171 1.00 14.58 ? 210 SER B O     1 
ATOM   3844 C  CB    . SER B 1 174 ? 60.209 30.637  134.114 1.00 14.88 ? 210 SER B CB    1 
ATOM   3845 O  OG    . SER B 1 174 ? 59.584 30.744  132.836 1.00 12.50 ? 210 SER B OG    1 
ATOM   3846 N  N     . SER B 1 175 ? 62.165 33.077  133.955 1.00 13.26 ? 211 SER B N     1 
ATOM   3847 C  CA    . SER B 1 175 ? 62.934 33.945  133.062 1.00 13.30 ? 211 SER B CA    1 
ATOM   3848 C  C     . SER B 1 175 ? 62.668 33.640  131.597 1.00 13.98 ? 211 SER B C     1 
ATOM   3849 O  O     . SER B 1 175 ? 62.625 34.553  130.768 1.00 12.68 ? 211 SER B O     1 
ATOM   3850 C  CB    . SER B 1 175 ? 64.426 33.819  133.346 1.00 19.22 ? 211 SER B CB    1 
ATOM   3851 O  OG    . SER B 1 175 ? 64.730 34.280  134.644 1.00 21.22 ? 211 SER B OG    1 
ATOM   3852 N  N     . TYR B 1 176 ? 62.519 32.357  131.279 1.00 12.47 ? 212 TYR B N     1 
ATOM   3853 C  CA    . TYR B 1 176 ? 62.200 31.929  129.917 1.00 14.36 ? 212 TYR B CA    1 
ATOM   3854 C  C     . TYR B 1 176 ? 60.857 32.509  129.517 1.00 15.13 ? 212 TYR B C     1 
ATOM   3855 O  O     . TYR B 1 176 ? 60.690 32.969  128.389 1.00 11.00 ? 212 TYR B O     1 
ATOM   3856 C  CB    . TYR B 1 176 ? 62.187 30.395  129.828 1.00 14.33 ? 212 TYR B CB    1 
ATOM   3857 C  CG    . TYR B 1 176 ? 61.793 29.819  128.473 1.00 15.21 ? 212 TYR B CG    1 
ATOM   3858 C  CD1   . TYR B 1 176 ? 62.546 30.083  127.327 1.00 14.30 ? 212 TYR B CD1   1 
ATOM   3859 C  CD2   . TYR B 1 176 ? 60.691 28.979  128.352 1.00 15.37 ? 212 TYR B CD2   1 
ATOM   3860 C  CE1   . TYR B 1 176 ? 62.187 29.551  126.084 1.00 14.45 ? 212 TYR B CE1   1 
ATOM   3861 C  CE2   . TYR B 1 176 ? 60.335 28.427  127.127 1.00 14.30 ? 212 TYR B CE2   1 
ATOM   3862 C  CZ    . TYR B 1 176 ? 61.084 28.723  125.998 1.00 16.25 ? 212 TYR B CZ    1 
ATOM   3863 O  OH    . TYR B 1 176 ? 60.721 28.183  124.781 1.00 15.26 ? 212 TYR B OH    1 
ATOM   3864 N  N     . GLY B 1 177 ? 59.903 32.497  130.449 1.00 12.34 ? 213 GLY B N     1 
ATOM   3865 C  CA    . GLY B 1 177 ? 58.627 33.163  130.254 1.00 10.94 ? 213 GLY B CA    1 
ATOM   3866 C  C     . GLY B 1 177 ? 58.794 34.629  129.859 1.00 9.31  ? 213 GLY B C     1 
ATOM   3867 O  O     . GLY B 1 177 ? 58.166 35.088  128.905 1.00 9.61  ? 213 GLY B O     1 
ATOM   3868 N  N     . TYR B 1 178 ? 59.631 35.372  130.570 1.00 9.25  ? 214 TYR B N     1 
ATOM   3869 C  CA    . TYR B 1 178 ? 59.852 36.773  130.179 1.00 9.29  ? 214 TYR B CA    1 
ATOM   3870 C  C     . TYR B 1 178 ? 60.525 36.908  128.816 1.00 8.89  ? 214 TYR B C     1 
ATOM   3871 O  O     . TYR B 1 178 ? 60.266 37.873  128.100 1.00 10.71 ? 214 TYR B O     1 
ATOM   3872 C  CB    . TYR B 1 178 ? 60.652 37.526  131.239 1.00 9.81  ? 214 TYR B CB    1 
ATOM   3873 C  CG    . TYR B 1 178 ? 59.802 37.811  132.449 1.00 10.07 ? 214 TYR B CG    1 
ATOM   3874 C  CD1   . TYR B 1 178 ? 58.863 38.835  132.422 1.00 12.01 ? 214 TYR B CD1   1 
ATOM   3875 C  CD2   . TYR B 1 178 ? 59.900 37.042  133.591 1.00 12.83 ? 214 TYR B CD2   1 
ATOM   3876 C  CE1   . TYR B 1 178 ? 58.072 39.102  133.503 1.00 12.52 ? 214 TYR B CE1   1 
ATOM   3877 C  CE2   . TYR B 1 178 ? 59.092 37.299  134.688 1.00 13.08 ? 214 TYR B CE2   1 
ATOM   3878 C  CZ    . TYR B 1 178 ? 58.182 38.331  134.631 1.00 16.46 ? 214 TYR B CZ    1 
ATOM   3879 O  OH    . TYR B 1 178 ? 57.366 38.597  135.706 1.00 14.12 ? 214 TYR B OH    1 
ATOM   3880 N  N     . VAL B 1 179 ? 61.395 35.970  128.452 1.00 11.49 ? 215 VAL B N     1 
ATOM   3881 C  CA    . VAL B 1 179 ? 62.072 36.070  127.145 1.00 8.88  ? 215 VAL B CA    1 
ATOM   3882 C  C     . VAL B 1 179 ? 61.046 35.893  126.035 1.00 10.26 ? 215 VAL B C     1 
ATOM   3883 O  O     . VAL B 1 179 ? 61.080 36.593  125.020 1.00 9.27  ? 215 VAL B O     1 
ATOM   3884 C  CB    . VAL B 1 179 ? 63.209 35.030  127.015 1.00 10.49 ? 215 VAL B CB    1 
ATOM   3885 C  CG1   . VAL B 1 179 ? 63.790 35.030  125.599 1.00 10.83 ? 215 VAL B CG1   1 
ATOM   3886 C  CG2   . VAL B 1 179 ? 64.310 35.354  128.011 1.00 12.36 ? 215 VAL B CG2   1 
ATOM   3887 N  N     . LEU B 1 180 ? 60.115 34.961  126.224 1.00 8.09  ? 216 LEU B N     1 
ATOM   3888 C  CA    . LEU B 1 180 ? 59.060 34.762  125.230 1.00 7.95  ? 216 LEU B CA    1 
ATOM   3889 C  C     . LEU B 1 180 ? 58.152 35.991  125.128 1.00 8.91  ? 216 LEU B C     1 
ATOM   3890 O  O     . LEU B 1 180 ? 57.747 36.379  124.027 1.00 10.31 ? 216 LEU B O     1 
ATOM   3891 C  CB    . LEU B 1 180 ? 58.231 33.519  125.533 1.00 9.89  ? 216 LEU B CB    1 
ATOM   3892 C  CG    . LEU B 1 180 ? 58.991 32.198  125.373 1.00 9.38  ? 216 LEU B CG    1 
ATOM   3893 C  CD1   . LEU B 1 180 ? 58.050 31.023  125.552 1.00 9.60  ? 216 LEU B CD1   1 
ATOM   3894 C  CD2   . LEU B 1 180 ? 59.678 32.128  124.004 1.00 10.35 ? 216 LEU B CD2   1 
ATOM   3895 N  N     . MET B 1 181 ? 57.821 36.599  126.263 1.00 7.51  ? 217 MET B N     1 
ATOM   3896 C  CA    . MET B 1 181 ? 57.056 37.848  126.210 1.00 7.66  ? 217 MET B CA    1 
ATOM   3897 C  C     . MET B 1 181 ? 57.828 38.913  125.437 1.00 9.14  ? 217 MET B C     1 
ATOM   3898 O  O     . MET B 1 181 ? 57.227 39.699  124.691 1.00 10.34 ? 217 MET B O     1 
ATOM   3899 C  CB    . MET B 1 181 ? 56.704 38.347  127.622 1.00 8.17  ? 217 MET B CB    1 
ATOM   3900 C  CG    . MET B 1 181 ? 55.661 37.455  128.328 1.00 9.69  ? 217 MET B CG    1 
ATOM   3901 S  SD    . MET B 1 181 ? 55.445 37.924  130.062 1.00 14.68 ? 217 MET B SD    1 
ATOM   3902 C  CE    . MET B 1 181 ? 54.426 39.385  129.837 1.00 12.99 ? 217 MET B CE    1 
ATOM   3903 N  N     . VAL B 1 182 ? 59.153 38.947  125.603 1.00 7.04  ? 218 VAL B N     1 
ATOM   3904 C  CA    . VAL B 1 182 ? 59.968 39.916  124.856 1.00 9.05  ? 218 VAL B CA    1 
ATOM   3905 C  C     . VAL B 1 182 ? 59.927 39.616  123.358 1.00 11.68 ? 218 VAL B C     1 
ATOM   3906 O  O     . VAL B 1 182 ? 59.675 40.499  122.536 1.00 9.33  ? 218 VAL B O     1 
ATOM   3907 C  CB    . VAL B 1 182 ? 61.436 39.991  125.386 1.00 10.00 ? 218 VAL B CB    1 
ATOM   3908 C  CG1   . VAL B 1 182 ? 62.356 40.699  124.368 1.00 9.01  ? 218 VAL B CG1   1 
ATOM   3909 C  CG2   . VAL B 1 182 ? 61.493 40.710  126.741 1.00 7.13  ? 218 VAL B CG2   1 
ATOM   3910 N  N     . LEU B 1 183 ? 60.151 38.362  122.994 1.00 6.77  ? 219 LEU B N     1 
ATOM   3911 C  CA    . LEU B 1 183 ? 60.127 37.979  121.586 1.00 7.87  ? 219 LEU B CA    1 
ATOM   3912 C  C     . LEU B 1 183 ? 58.772 38.227  120.935 1.00 9.31  ? 219 LEU B C     1 
ATOM   3913 O  O     . LEU B 1 183 ? 58.708 38.734  119.814 1.00 8.12  ? 219 LEU B O     1 
ATOM   3914 C  CB    . LEU B 1 183 ? 60.542 36.512  121.398 1.00 9.71  ? 219 LEU B CB    1 
ATOM   3915 C  CG    . LEU B 1 183 ? 62.017 36.206  121.643 1.00 11.47 ? 219 LEU B CG    1 
ATOM   3916 C  CD1   . LEU B 1 183 ? 62.284 34.695  121.477 1.00 12.26 ? 219 LEU B CD1   1 
ATOM   3917 C  CD2   . LEU B 1 183 ? 62.883 37.010  120.660 1.00 12.01 ? 219 LEU B CD2   1 
ATOM   3918 N  N     . TYR B 1 184 ? 57.691 37.893  121.635 1.00 9.45  ? 220 TYR B N     1 
ATOM   3919 C  CA    . TYR B 1 184 ? 56.353 38.077  121.084 1.00 7.67  ? 220 TYR B CA    1 
ATOM   3920 C  C     . TYR B 1 184 ? 56.110 39.548  120.759 1.00 9.94  ? 220 TYR B C     1 
ATOM   3921 O  O     . TYR B 1 184 ? 55.583 39.883  119.689 1.00 11.72 ? 220 TYR B O     1 
ATOM   3922 C  CB    . TYR B 1 184 ? 55.281 37.578  122.063 1.00 9.53  ? 220 TYR B CB    1 
ATOM   3923 C  CG    . TYR B 1 184 ? 53.863 37.839  121.584 1.00 11.01 ? 220 TYR B CG    1 
ATOM   3924 C  CD1   . TYR B 1 184 ? 53.265 37.015  120.636 1.00 11.64 ? 220 TYR B CD1   1 
ATOM   3925 C  CD2   . TYR B 1 184 ? 53.125 38.908  122.081 1.00 14.57 ? 220 TYR B CD2   1 
ATOM   3926 C  CE1   . TYR B 1 184 ? 51.952 37.255  120.195 1.00 13.07 ? 220 TYR B CE1   1 
ATOM   3927 C  CE2   . TYR B 1 184 ? 51.825 39.162  121.640 1.00 11.41 ? 220 TYR B CE2   1 
ATOM   3928 C  CZ    . TYR B 1 184 ? 51.247 38.335  120.710 1.00 16.55 ? 220 TYR B CZ    1 
ATOM   3929 O  OH    . TYR B 1 184 ? 49.954 38.585  120.300 1.00 16.36 ? 220 TYR B OH    1 
ATOM   3930 N  N     . TYR B 1 185 ? 56.494 40.424  121.684 1.00 8.39  ? 221 TYR B N     1 
ATOM   3931 C  CA    . TYR B 1 185 ? 56.377 41.866  121.448 1.00 10.45 ? 221 TYR B CA    1 
ATOM   3932 C  C     . TYR B 1 185 ? 57.182 42.309  120.209 1.00 12.36 ? 221 TYR B C     1 
ATOM   3933 O  O     . TYR B 1 185 ? 56.669 43.013  119.338 1.00 12.90 ? 221 TYR B O     1 
ATOM   3934 C  CB    . TYR B 1 185 ? 56.795 42.659  122.698 1.00 10.18 ? 221 TYR B CB    1 
ATOM   3935 C  CG    . TYR B 1 185 ? 56.834 44.150  122.449 1.00 10.03 ? 221 TYR B CG    1 
ATOM   3936 C  CD1   . TYR B 1 185 ? 55.651 44.887  122.326 1.00 14.02 ? 221 TYR B CD1   1 
ATOM   3937 C  CD2   . TYR B 1 185 ? 58.042 44.817  122.310 1.00 12.44 ? 221 TYR B CD2   1 
ATOM   3938 C  CE1   . TYR B 1 185 ? 55.679 46.252  122.065 1.00 12.55 ? 221 TYR B CE1   1 
ATOM   3939 C  CE2   . TYR B 1 185 ? 58.076 46.186  122.056 1.00 14.29 ? 221 TYR B CE2   1 
ATOM   3940 C  CZ    . TYR B 1 185 ? 56.895 46.885  121.932 1.00 15.00 ? 221 TYR B CZ    1 
ATOM   3941 O  OH    . TYR B 1 185 ? 56.939 48.233  121.676 1.00 17.85 ? 221 TYR B OH    1 
ATOM   3942 N  N     . LEU B 1 186 ? 58.440 41.895  120.129 1.00 9.34  ? 222 LEU B N     1 
ATOM   3943 C  CA    . LEU B 1 186 ? 59.302 42.296  119.016 1.00 11.71 ? 222 LEU B CA    1 
ATOM   3944 C  C     . LEU B 1 186 ? 58.912 41.734  117.647 1.00 12.69 ? 222 LEU B C     1 
ATOM   3945 O  O     . LEU B 1 186 ? 59.227 42.339  116.611 1.00 12.63 ? 222 LEU B O     1 
ATOM   3946 C  CB    . LEU B 1 186 ? 60.755 41.944  119.334 1.00 10.36 ? 222 LEU B CB    1 
ATOM   3947 C  CG    . LEU B 1 186 ? 61.382 42.647  120.535 1.00 12.22 ? 222 LEU B CG    1 
ATOM   3948 C  CD1   . LEU B 1 186 ? 62.811 42.119  120.736 1.00 11.26 ? 222 LEU B CD1   1 
ATOM   3949 C  CD2   . LEU B 1 186 ? 61.387 44.201  120.372 1.00 12.50 ? 222 LEU B CD2   1 
ATOM   3950 N  N     . ILE B 1 187 ? 58.239 40.585  117.634 1.00 9.25  ? 223 ILE B N     1 
ATOM   3951 C  CA    . ILE B 1 187 ? 57.839 39.945  116.391 1.00 10.08 ? 223 ILE B CA    1 
ATOM   3952 C  C     . ILE B 1 187 ? 56.436 40.367  115.960 1.00 14.98 ? 223 ILE B C     1 
ATOM   3953 O  O     . ILE B 1 187 ? 56.221 40.749  114.798 1.00 14.40 ? 223 ILE B O     1 
ATOM   3954 C  CB    . ILE B 1 187 ? 57.863 38.404  116.529 1.00 7.88  ? 223 ILE B CB    1 
ATOM   3955 C  CG1   . ILE B 1 187 ? 59.288 37.923  116.838 1.00 10.69 ? 223 ILE B CG1   1 
ATOM   3956 C  CG2   . ILE B 1 187 ? 57.343 37.736  115.237 1.00 12.85 ? 223 ILE B CG2   1 
ATOM   3957 C  CD1   . ILE B 1 187 ? 59.334 36.436  117.285 1.00 9.41  ? 223 ILE B CD1   1 
ATOM   3958 N  N     . HIS B 1 188 ? 55.483 40.305  116.892 1.00 11.75 ? 224 HIS B N     1 
ATOM   3959 C  CA    . HIS B 1 188 ? 54.068 40.415  116.526 1.00 12.42 ? 224 HIS B CA    1 
ATOM   3960 C  C     . HIS B 1 188 ? 53.347 41.671  116.990 1.00 16.95 ? 224 HIS B C     1 
ATOM   3961 O  O     . HIS B 1 188 ? 52.201 41.895  116.598 1.00 18.99 ? 224 HIS B O     1 
ATOM   3962 C  CB    . HIS B 1 188 ? 53.284 39.185  117.011 1.00 15.26 ? 224 HIS B CB    1 
ATOM   3963 C  CG    . HIS B 1 188 ? 53.592 37.945  116.235 1.00 14.85 ? 224 HIS B CG    1 
ATOM   3964 N  ND1   . HIS B 1 188 ? 53.316 37.834  114.890 1.00 15.97 ? 224 HIS B ND1   1 
ATOM   3965 C  CD2   . HIS B 1 188 ? 54.167 36.778  116.603 1.00 14.96 ? 224 HIS B CD2   1 
ATOM   3966 C  CE1   . HIS B 1 188 ? 53.697 36.638  114.464 1.00 16.14 ? 224 HIS B CE1   1 
ATOM   3967 N  NE2   . HIS B 1 188 ? 54.221 35.982  115.483 1.00 15.57 ? 224 HIS B NE2   1 
ATOM   3968 N  N     . VAL B 1 189 ? 53.980 42.478  117.828 1.00 13.07 ? 225 VAL B N     1 
ATOM   3969 C  CA    . VAL B 1 189 ? 53.291 43.679  118.317 1.00 16.48 ? 225 VAL B CA    1 
ATOM   3970 C  C     . VAL B 1 189 ? 53.806 44.950  117.665 1.00 20.14 ? 225 VAL B C     1 
ATOM   3971 O  O     . VAL B 1 189 ? 53.049 45.680  117.018 1.00 17.50 ? 225 VAL B O     1 
ATOM   3972 C  CB    . VAL B 1 189 ? 53.370 43.827  119.845 1.00 16.17 ? 225 VAL B CB    1 
ATOM   3973 C  CG1   . VAL B 1 189 ? 52.587 45.073  120.308 1.00 14.72 ? 225 VAL B CG1   1 
ATOM   3974 C  CG2   . VAL B 1 189 ? 52.817 42.600  120.516 1.00 12.30 ? 225 VAL B CG2   1 
ATOM   3975 N  N     . ILE B 1 190 ? 55.101 45.203  117.825 1.00 12.91 ? 226 ILE B N     1 
ATOM   3976 C  CA    . ILE B 1 190 ? 55.667 46.474  117.430 1.00 15.29 ? 226 ILE B CA    1 
ATOM   3977 C  C     . ILE B 1 190 ? 55.640 46.587  115.906 1.00 19.14 ? 226 ILE B C     1 
ATOM   3978 O  O     . ILE B 1 190 ? 55.791 45.592  115.204 1.00 14.82 ? 226 ILE B O     1 
ATOM   3979 C  CB    . ILE B 1 190 ? 57.102 46.659  118.021 1.00 13.68 ? 226 ILE B CB    1 
ATOM   3980 C  CG1   . ILE B 1 190 ? 57.600 48.089  117.818 1.00 15.42 ? 226 ILE B CG1   1 
ATOM   3981 C  CG2   . ILE B 1 190 ? 58.082 45.627  117.437 1.00 14.53 ? 226 ILE B CG2   1 
ATOM   3982 C  CD1   . ILE B 1 190 ? 58.952 48.357  118.453 1.00 13.29 ? 226 ILE B CD1   1 
ATOM   3983 N  N     . LYS B 1 191 ? 55.403 47.796  115.402 1.00 18.10 ? 227 LYS B N     1 
ATOM   3984 C  CA    . LYS B 1 191 ? 55.323 48.022  113.965 1.00 22.18 ? 227 LYS B CA    1 
ATOM   3985 C  C     . LYS B 1 191 ? 56.287 49.146  113.613 1.00 19.52 ? 227 LYS B C     1 
ATOM   3986 O  O     . LYS B 1 191 ? 56.262 50.183  114.252 1.00 21.59 ? 227 LYS B O     1 
ATOM   3987 C  CB    . LYS B 1 191 ? 53.895 48.399  113.552 1.00 23.78 ? 227 LYS B CB    1 
ATOM   3988 C  CG    . LYS B 1 191 ? 52.817 47.387  113.939 1.00 25.63 ? 227 LYS B CG    1 
ATOM   3989 C  CD    . LYS B 1 191 ? 53.045 46.032  113.275 1.00 20.87 ? 227 LYS B CD    1 
ATOM   3990 C  CE    . LYS B 1 191 ? 52.031 45.007  113.775 1.00 29.73 ? 227 LYS B CE    1 
ATOM   3991 N  NZ    . LYS B 1 191 ? 52.291 43.646  113.219 1.00 32.69 ? 227 LYS B NZ    1 
ATOM   3992 N  N     . PRO B 1 192 ? 57.195 48.919  112.649 1.00 19.16 ? 228 PRO B N     1 
ATOM   3993 C  CA    . PRO B 1 192 ? 57.491 47.674  111.936 1.00 21.98 ? 228 PRO B CA    1 
ATOM   3994 C  C     . PRO B 1 192 ? 58.056 46.638  112.906 1.00 17.48 ? 228 PRO B C     1 
ATOM   3995 O  O     . PRO B 1 192 ? 58.548 47.017  113.981 1.00 18.02 ? 228 PRO B O     1 
ATOM   3996 C  CB    . PRO B 1 192 ? 58.591 48.093  110.948 1.00 19.94 ? 228 PRO B CB    1 
ATOM   3997 C  CG    . PRO B 1 192 ? 58.538 49.594  110.906 1.00 23.24 ? 228 PRO B CG    1 
ATOM   3998 C  CD    . PRO B 1 192 ? 58.140 49.986  112.275 1.00 22.46 ? 228 PRO B CD    1 
ATOM   3999 N  N     . PRO B 1 193 ? 57.951 45.351  112.554 1.00 18.07 ? 229 PRO B N     1 
ATOM   4000 C  CA    . PRO B 1 193 ? 58.498 44.320  113.441 1.00 18.49 ? 229 PRO B CA    1 
ATOM   4001 C  C     . PRO B 1 193 ? 60.014 44.487  113.550 1.00 19.37 ? 229 PRO B C     1 
ATOM   4002 O  O     . PRO B 1 193 ? 60.658 44.934  112.601 1.00 15.52 ? 229 PRO B O     1 
ATOM   4003 C  CB    . PRO B 1 193 ? 58.158 43.012  112.713 1.00 18.76 ? 229 PRO B CB    1 
ATOM   4004 C  CG    . PRO B 1 193 ? 56.998 43.363  111.799 1.00 26.13 ? 229 PRO B CG    1 
ATOM   4005 C  CD    . PRO B 1 193 ? 57.241 44.784  111.390 1.00 19.15 ? 229 PRO B CD    1 
ATOM   4006 N  N     . VAL B 1 194 ? 60.581 44.162  114.705 1.00 13.93 ? 230 VAL B N     1 
ATOM   4007 C  CA    . VAL B 1 194 ? 62.027 44.094  114.832 1.00 13.12 ? 230 VAL B CA    1 
ATOM   4008 C  C     . VAL B 1 194 ? 62.545 42.821  114.153 1.00 14.12 ? 230 VAL B C     1 
ATOM   4009 O  O     . VAL B 1 194 ? 63.595 42.827  113.508 1.00 14.43 ? 230 VAL B O     1 
ATOM   4010 C  CB    . VAL B 1 194 ? 62.439 44.148  116.318 1.00 13.08 ? 230 VAL B CB    1 
ATOM   4011 C  CG1   . VAL B 1 194 ? 63.925 43.788  116.500 1.00 16.53 ? 230 VAL B CG1   1 
ATOM   4012 C  CG2   . VAL B 1 194 ? 62.150 45.532  116.879 1.00 12.25 ? 230 VAL B CG2   1 
ATOM   4013 N  N     . PHE B 1 195 ? 61.758 41.755  114.288 1.00 14.22 ? 231 PHE B N     1 
ATOM   4014 C  CA    . PHE B 1 195 ? 62.091 40.390  113.890 1.00 18.88 ? 231 PHE B CA    1 
ATOM   4015 C  C     . PHE B 1 195 ? 60.958 39.807  113.088 1.00 12.31 ? 231 PHE B C     1 
ATOM   4016 O  O     . PHE B 1 195 ? 59.806 40.041  113.439 1.00 16.05 ? 231 PHE B O     1 
ATOM   4017 C  CB    . PHE B 1 195 ? 62.056 39.519  115.152 1.00 16.17 ? 231 PHE B CB    1 
ATOM   4018 C  CG    . PHE B 1 195 ? 63.223 39.663  116.008 1.00 15.58 ? 231 PHE B CG    1 
ATOM   4019 C  CD1   . PHE B 1 195 ? 64.473 39.856  115.450 1.00 12.12 ? 231 PHE B CD1   1 
ATOM   4020 C  CD2   . PHE B 1 195 ? 63.089 39.601  117.384 1.00 11.37 ? 231 PHE B CD2   1 
ATOM   4021 C  CE1   . PHE B 1 195 ? 65.574 39.996  116.250 1.00 16.80 ? 231 PHE B CE1   1 
ATOM   4022 C  CE2   . PHE B 1 195 ? 64.189 39.735  118.187 1.00 11.44 ? 231 PHE B CE2   1 
ATOM   4023 C  CZ    . PHE B 1 195 ? 65.435 39.928  117.617 1.00 11.59 ? 231 PHE B CZ    1 
ATOM   4024 N  N     . PRO B 1 196 ? 61.256 38.968  112.077 1.00 13.84 ? 232 PRO B N     1 
ATOM   4025 C  CA    . PRO B 1 196 ? 60.156 38.144  111.558 1.00 10.57 ? 232 PRO B CA    1 
ATOM   4026 C  C     . PRO B 1 196 ? 59.977 36.904  112.418 1.00 12.61 ? 232 PRO B C     1 
ATOM   4027 O  O     . PRO B 1 196 ? 60.846 36.594  113.247 1.00 12.66 ? 232 PRO B O     1 
ATOM   4028 C  CB    . PRO B 1 196 ? 60.652 37.729  110.168 1.00 18.43 ? 232 PRO B CB    1 
ATOM   4029 C  CG    . PRO B 1 196 ? 62.139 37.694  110.305 1.00 21.66 ? 232 PRO B CG    1 
ATOM   4030 C  CD    . PRO B 1 196 ? 62.483 38.831  111.271 1.00 17.53 ? 232 PRO B CD    1 
ATOM   4031 N  N     . ASN B 1 197 ? 58.873 36.189  112.228 1.00 12.68 ? 233 ASN B N     1 
ATOM   4032 C  CA    . ASN B 1 197 ? 58.661 34.928  112.938 1.00 10.47 ? 233 ASN B CA    1 
ATOM   4033 C  C     . ASN B 1 197 ? 59.329 33.796  112.171 1.00 13.49 ? 233 ASN B C     1 
ATOM   4034 O  O     . ASN B 1 197 ? 58.898 33.447  111.063 1.00 13.76 ? 233 ASN B O     1 
ATOM   4035 C  CB    . ASN B 1 197 ? 57.162 34.676  113.099 1.00 13.76 ? 233 ASN B CB    1 
ATOM   4036 C  CG    . ASN B 1 197 ? 56.857 33.463  113.944 1.00 16.16 ? 233 ASN B CG    1 
ATOM   4037 O  OD1   . ASN B 1 197 ? 57.508 32.422  113.819 1.00 13.40 ? 233 ASN B OD1   1 
ATOM   4038 N  ND2   . ASN B 1 197 ? 55.843 33.581  114.799 1.00 12.75 ? 233 ASN B ND2   1 
ATOM   4039 N  N     . LEU B 1 198 ? 60.390 33.224  112.751 1.00 9.26  ? 234 LEU B N     1 
ATOM   4040 C  CA    . LEU B 1 198 ? 61.187 32.193  112.070 1.00 10.69 ? 234 LEU B CA    1 
ATOM   4041 C  C     . LEU B 1 198 ? 60.456 30.857  111.904 1.00 12.22 ? 234 LEU B C     1 
ATOM   4042 O  O     . LEU B 1 198 ? 60.807 30.052  111.030 1.00 12.85 ? 234 LEU B O     1 
ATOM   4043 C  CB    . LEU B 1 198 ? 62.527 31.987  112.793 1.00 9.51  ? 234 LEU B CB    1 
ATOM   4044 C  CG    . LEU B 1 198 ? 63.406 33.238  112.833 1.00 12.50 ? 234 LEU B CG    1 
ATOM   4045 C  CD1   . LEU B 1 198 ? 64.725 32.973  113.615 1.00 12.83 ? 234 LEU B CD1   1 
ATOM   4046 C  CD2   . LEU B 1 198 ? 63.705 33.721  111.412 1.00 11.36 ? 234 LEU B CD2   1 
ATOM   4047 N  N     . LEU B 1 199 ? 59.448 30.609  112.738 1.00 10.53 ? 235 LEU B N     1 
ATOM   4048 C  CA    . LEU B 1 199 ? 58.634 29.400  112.592 1.00 13.29 ? 235 LEU B CA    1 
ATOM   4049 C  C     . LEU B 1 199 ? 57.726 29.486  111.359 1.00 15.89 ? 235 LEU B C     1 
ATOM   4050 O  O     . LEU B 1 199 ? 57.306 28.455  110.814 1.00 12.99 ? 235 LEU B O     1 
ATOM   4051 C  CB    . LEU B 1 199 ? 57.778 29.138  113.843 1.00 12.39 ? 235 LEU B CB    1 
ATOM   4052 C  CG    . LEU B 1 199 ? 58.412 28.525  115.103 1.00 13.32 ? 235 LEU B CG    1 
ATOM   4053 C  CD1   . LEU B 1 199 ? 59.404 29.507  115.724 1.00 18.21 ? 235 LEU B CD1   1 
ATOM   4054 C  CD2   . LEU B 1 199 ? 57.324 28.164  116.124 1.00 15.00 ? 235 LEU B CD2   1 
ATOM   4055 N  N     . LEU B 1 200 ? 57.431 30.715  110.933 1.00 14.72 ? 236 LEU B N     1 
ATOM   4056 C  CA    . LEU B 1 200 ? 56.477 30.971  109.846 1.00 15.74 ? 236 LEU B CA    1 
ATOM   4057 C  C     . LEU B 1 200 ? 57.162 31.415  108.557 1.00 16.58 ? 236 LEU B C     1 
ATOM   4058 O  O     . LEU B 1 200 ? 56.515 31.921  107.633 1.00 18.19 ? 236 LEU B O     1 
ATOM   4059 C  CB    . LEU B 1 200 ? 55.458 32.038  110.269 1.00 16.27 ? 236 LEU B CB    1 
ATOM   4060 C  CG    . LEU B 1 200 ? 54.653 31.737  111.531 1.00 20.13 ? 236 LEU B CG    1 
ATOM   4061 C  CD1   . LEU B 1 200 ? 53.576 32.797  111.730 1.00 19.75 ? 236 LEU B CD1   1 
ATOM   4062 C  CD2   . LEU B 1 200 ? 54.040 30.366  111.443 1.00 20.37 ? 236 LEU B CD2   1 
ATOM   4063 N  N     . SER B 1 201 ? 58.475 31.246  108.496 1.00 15.20 ? 237 SER B N     1 
ATOM   4064 C  CA    . SER B 1 201 ? 59.210 31.502  107.257 1.00 15.73 ? 237 SER B CA    1 
ATOM   4065 C  C     . SER B 1 201 ? 58.852 30.443  106.213 1.00 15.05 ? 237 SER B C     1 
ATOM   4066 O  O     . SER B 1 201 ? 58.646 29.270  106.547 1.00 16.14 ? 237 SER B O     1 
ATOM   4067 C  CB    . SER B 1 201 ? 60.711 31.464  107.533 1.00 16.21 ? 237 SER B CB    1 
ATOM   4068 O  OG    . SER B 1 201 ? 61.460 31.235  106.346 1.00 20.85 ? 237 SER B OG    1 
ATOM   4069 N  N     . PRO B 1 202 ? 58.777 30.842  104.933 1.00 15.85 ? 238 PRO B N     1 
ATOM   4070 C  CA    . PRO B 1 202 ? 58.508 29.836  103.892 1.00 16.08 ? 238 PRO B CA    1 
ATOM   4071 C  C     . PRO B 1 202 ? 59.641 28.822  103.753 1.00 19.18 ? 238 PRO B C     1 
ATOM   4072 O  O     . PRO B 1 202 ? 59.439 27.777  103.134 1.00 20.08 ? 238 PRO B O     1 
ATOM   4073 C  CB    . PRO B 1 202 ? 58.378 30.681  102.608 1.00 15.00 ? 238 PRO B CB    1 
ATOM   4074 C  CG    . PRO B 1 202 ? 59.105 31.940  102.908 1.00 18.73 ? 238 PRO B CG    1 
ATOM   4075 C  CD    . PRO B 1 202 ? 58.882 32.201  104.378 1.00 16.22 ? 238 PRO B CD    1 
ATOM   4076 N  N     . LEU B 1 203 ? 60.812 29.115  104.319 1.00 13.17 ? 239 LEU B N     1 
ATOM   4077 C  CA    . LEU B 1 203 ? 61.944 28.187  104.242 1.00 18.27 ? 239 LEU B CA    1 
ATOM   4078 C  C     . LEU B 1 203 ? 62.015 27.230  105.443 1.00 21.70 ? 239 LEU B C     1 
ATOM   4079 O  O     . LEU B 1 203 ? 62.865 26.336  105.490 1.00 20.05 ? 239 LEU B O     1 
ATOM   4080 C  CB    . LEU B 1 203 ? 63.257 28.963  104.123 1.00 25.12 ? 239 LEU B CB    1 
ATOM   4081 C  CG    . LEU B 1 203 ? 63.796 29.398  102.754 1.00 31.27 ? 239 LEU B CG    1 
ATOM   4082 C  CD1   . LEU B 1 203 ? 62.740 29.378  101.668 1.00 26.76 ? 239 LEU B CD1   1 
ATOM   4083 C  CD2   . LEU B 1 203 ? 64.437 30.781  102.851 1.00 33.55 ? 239 LEU B CD2   1 
ATOM   4084 N  N     . LYS B 1 204 ? 61.132 27.420  106.417 1.00 16.82 ? 240 LYS B N     1 
ATOM   4085 C  CA    . LYS B 1 204 ? 61.071 26.513  107.569 1.00 19.98 ? 240 LYS B CA    1 
ATOM   4086 C  C     . LYS B 1 204 ? 60.709 25.090  107.132 1.00 20.50 ? 240 LYS B C     1 
ATOM   4087 O  O     . LYS B 1 204 ? 59.805 24.898  106.312 1.00 17.65 ? 240 LYS B O     1 
ATOM   4088 C  CB    . LYS B 1 204 ? 60.053 27.026  108.603 1.00 17.39 ? 240 LYS B CB    1 
ATOM   4089 C  CG    . LYS B 1 204 ? 59.788 26.072  109.786 1.00 15.14 ? 240 LYS B CG    1 
ATOM   4090 C  CD    . LYS B 1 204 ? 58.507 25.250  109.595 1.00 19.97 ? 240 LYS B CD    1 
ATOM   4091 C  CE    . LYS B 1 204 ? 58.250 24.345  110.811 1.00 15.27 ? 240 LYS B CE    1 
ATOM   4092 N  NZ    . LYS B 1 204 ? 57.094 23.399  110.640 1.00 20.14 ? 240 LYS B NZ    1 
ATOM   4093 N  N     . GLN B 1 205 ? 61.415 24.100  107.686 1.00 18.12 ? 241 GLN B N     1 
ATOM   4094 C  CA    . GLN B 1 205 ? 61.149 22.689  107.423 1.00 20.38 ? 241 GLN B CA    1 
ATOM   4095 C  C     . GLN B 1 205 ? 60.668 21.997  108.696 1.00 15.78 ? 241 GLN B C     1 
ATOM   4096 O  O     . GLN B 1 205 ? 61.156 22.303  109.786 1.00 17.20 ? 241 GLN B O     1 
ATOM   4097 C  CB    . GLN B 1 205 ? 62.445 22.008  106.980 1.00 24.27 ? 241 GLN B CB    1 
ATOM   4098 C  CG    . GLN B 1 205 ? 63.215 22.764  105.908 1.00 29.12 ? 241 GLN B CG    1 
ATOM   4099 C  CD    . GLN B 1 205 ? 62.634 22.543  104.532 1.00 36.14 ? 241 GLN B CD    1 
ATOM   4100 O  OE1   . GLN B 1 205 ? 62.565 21.409  104.058 1.00 43.71 ? 241 GLN B OE1   1 
ATOM   4101 N  NE2   . GLN B 1 205 ? 62.205 23.623  103.882 1.00 40.66 ? 241 GLN B NE2   1 
ATOM   4102 N  N     . GLU B 1 206 ? 59.742 21.054  108.559 1.00 19.88 ? 242 GLU B N     1 
ATOM   4103 C  CA    . GLU B 1 206 ? 59.311 20.253  109.699 1.00 19.06 ? 242 GLU B CA    1 
ATOM   4104 C  C     . GLU B 1 206 ? 60.491 19.468  110.271 1.00 18.61 ? 242 GLU B C     1 
ATOM   4105 O  O     . GLU B 1 206 ? 61.293 18.901  109.520 1.00 19.50 ? 242 GLU B O     1 
ATOM   4106 C  CB    . GLU B 1 206 ? 58.203 19.273  109.291 1.00 20.81 ? 242 GLU B CB    1 
ATOM   4107 C  CG    . GLU B 1 206 ? 57.753 18.358  110.427 1.00 23.31 ? 242 GLU B CG    1 
ATOM   4108 C  CD    . GLU B 1 206 ? 56.749 17.304  109.988 1.00 24.70 ? 242 GLU B CD    1 
ATOM   4109 O  OE1   . GLU B 1 206 ? 57.159 16.306  109.362 1.00 28.70 ? 242 GLU B OE1   1 
ATOM   4110 O  OE2   . GLU B 1 206 ? 55.551 17.472  110.279 1.00 26.55 ? 242 GLU B OE2   1 
ATOM   4111 N  N     . LYS B 1 207 ? 60.619 19.450  111.596 1.00 14.87 ? 243 LYS B N     1 
ATOM   4112 C  CA    . LYS B 1 207 ? 61.552 18.534  112.251 1.00 16.79 ? 243 LYS B CA    1 
ATOM   4113 C  C     . LYS B 1 207 ? 60.919 18.072  113.552 1.00 18.84 ? 243 LYS B C     1 
ATOM   4114 O  O     . LYS B 1 207 ? 60.742 18.869  114.472 1.00 12.07 ? 243 LYS B O     1 
ATOM   4115 C  CB    . LYS B 1 207 ? 62.900 19.202  112.535 1.00 18.08 ? 243 LYS B CB    1 
ATOM   4116 C  CG    . LYS B 1 207 ? 63.913 18.277  113.219 1.00 22.02 ? 243 LYS B CG    1 
ATOM   4117 C  CD    . LYS B 1 207 ? 65.120 19.056  113.758 1.00 28.86 ? 243 LYS B CD    1 
ATOM   4118 C  CE    . LYS B 1 207 ? 65.682 20.033  112.726 1.00 30.29 ? 243 LYS B CE    1 
ATOM   4119 N  NZ    . LYS B 1 207 ? 66.875 20.801  113.228 1.00 33.61 ? 243 LYS B NZ    1 
ATOM   4120 N  N     . ILE B 1 208 ? 60.571 16.790  113.626 1.00 12.26 ? 244 ILE B N     1 
ATOM   4121 C  CA    . ILE B 1 208 ? 59.878 16.281  114.813 1.00 14.83 ? 244 ILE B CA    1 
ATOM   4122 C  C     . ILE B 1 208 ? 60.888 15.795  115.851 1.00 16.54 ? 244 ILE B C     1 
ATOM   4123 O  O     . ILE B 1 208 ? 61.736 14.952  115.560 1.00 17.77 ? 244 ILE B O     1 
ATOM   4124 C  CB    . ILE B 1 208 ? 58.917 15.117  114.466 1.00 16.49 ? 244 ILE B CB    1 
ATOM   4125 C  CG1   . ILE B 1 208 ? 57.909 15.545  113.397 1.00 18.70 ? 244 ILE B CG1   1 
ATOM   4126 C  CG2   . ILE B 1 208 ? 58.189 14.629  115.724 1.00 14.66 ? 244 ILE B CG2   1 
ATOM   4127 C  CD1   . ILE B 1 208 ? 57.012 16.672  113.825 1.00 20.63 ? 244 ILE B CD1   1 
ATOM   4128 N  N     . VAL B 1 209 ? 60.795 16.336  117.060 1.00 12.67 ? 245 VAL B N     1 
ATOM   4129 C  CA    . VAL B 1 209 ? 61.641 15.908  118.165 1.00 14.02 ? 245 VAL B CA    1 
ATOM   4130 C  C     . VAL B 1 209 ? 60.732 15.715  119.365 1.00 17.10 ? 245 VAL B C     1 
ATOM   4131 O  O     . VAL B 1 209 ? 59.967 16.618  119.729 1.00 14.28 ? 245 VAL B O     1 
ATOM   4132 C  CB    . VAL B 1 209 ? 62.745 16.947  118.469 1.00 13.06 ? 245 VAL B CB    1 
ATOM   4133 C  CG1   . VAL B 1 209 ? 63.483 16.583  119.755 1.00 20.07 ? 245 VAL B CG1   1 
ATOM   4134 C  CG2   . VAL B 1 209 ? 63.723 17.040  117.315 1.00 14.05 ? 245 VAL B CG2   1 
ATOM   4135 N  N     . ASP B 1 210 ? 60.779 14.521  119.954 1.00 16.27 ? 246 ASP B N     1 
ATOM   4136 C  CA    . ASP B 1 210 ? 59.893 14.165  121.061 1.00 19.46 ? 246 ASP B CA    1 
ATOM   4137 C  C     . ASP B 1 210 ? 58.426 14.476  120.747 1.00 19.75 ? 246 ASP B C     1 
ATOM   4138 O  O     . ASP B 1 210 ? 57.659 14.890  121.624 1.00 22.89 ? 246 ASP B O     1 
ATOM   4139 C  CB    . ASP B 1 210 ? 60.355 14.819  122.375 1.00 20.92 ? 246 ASP B CB    1 
ATOM   4140 C  CG    . ASP B 1 210 ? 61.703 14.285  122.844 1.00 30.06 ? 246 ASP B CG    1 
ATOM   4141 O  OD1   . ASP B 1 210 ? 62.028 13.125  122.518 1.00 35.07 ? 246 ASP B OD1   1 
ATOM   4142 O  OD2   . ASP B 1 210 ? 62.446 15.024  123.522 1.00 33.90 ? 246 ASP B OD2   1 
ATOM   4143 N  N     . GLY B 1 211 ? 58.052 14.285  119.482 1.00 17.30 ? 247 GLY B N     1 
ATOM   4144 C  CA    . GLY B 1 211 ? 56.664 14.412  119.070 1.00 18.47 ? 247 GLY B CA    1 
ATOM   4145 C  C     . GLY B 1 211 ? 56.165 15.826  118.845 1.00 21.16 ? 247 GLY B C     1 
ATOM   4146 O  O     . GLY B 1 211 ? 54.954 16.050  118.722 1.00 19.71 ? 247 GLY B O     1 
ATOM   4147 N  N     . PHE B 1 212 ? 57.083 16.789  118.803 1.00 16.67 ? 248 PHE B N     1 
ATOM   4148 C  CA    . PHE B 1 212 ? 56.715 18.166  118.476 1.00 16.33 ? 248 PHE B CA    1 
ATOM   4149 C  C     . PHE B 1 212 ? 57.550 18.680  117.316 1.00 16.18 ? 248 PHE B C     1 
ATOM   4150 O  O     . PHE B 1 212 ? 58.699 18.267  117.144 1.00 13.43 ? 248 PHE B O     1 
ATOM   4151 C  CB    . PHE B 1 212 ? 56.923 19.072  119.683 1.00 15.24 ? 248 PHE B CB    1 
ATOM   4152 C  CG    . PHE B 1 212 ? 56.014 18.753  120.822 1.00 18.45 ? 248 PHE B CG    1 
ATOM   4153 C  CD1   . PHE B 1 212 ? 54.690 19.169  120.795 1.00 19.23 ? 248 PHE B CD1   1 
ATOM   4154 C  CD2   . PHE B 1 212 ? 56.473 18.033  121.908 1.00 17.07 ? 248 PHE B CD2   1 
ATOM   4155 C  CE1   . PHE B 1 212 ? 53.837 18.861  121.839 1.00 21.06 ? 248 PHE B CE1   1 
ATOM   4156 C  CE2   . PHE B 1 212 ? 55.625 17.725  122.964 1.00 22.61 ? 248 PHE B CE2   1 
ATOM   4157 C  CZ    . PHE B 1 212 ? 54.308 18.143  122.926 1.00 19.81 ? 248 PHE B CZ    1 
ATOM   4158 N  N     . ASP B 1 213 ? 56.977 19.594  116.539 1.00 15.98 ? 249 ASP B N     1 
ATOM   4159 C  CA    . ASP B 1 213 ? 57.703 20.226  115.450 1.00 14.92 ? 249 ASP B CA    1 
ATOM   4160 C  C     . ASP B 1 213 ? 58.576 21.361  116.010 1.00 15.59 ? 249 ASP B C     1 
ATOM   4161 O  O     . ASP B 1 213 ? 58.064 22.399  116.456 1.00 16.19 ? 249 ASP B O     1 
ATOM   4162 C  CB    . ASP B 1 213 ? 56.714 20.737  114.396 1.00 17.06 ? 249 ASP B CB    1 
ATOM   4163 C  CG    . ASP B 1 213 ? 57.399 21.182  113.109 1.00 20.95 ? 249 ASP B CG    1 
ATOM   4164 O  OD1   . ASP B 1 213 ? 58.650 21.291  113.100 1.00 14.89 ? 249 ASP B OD1   1 
ATOM   4165 O  OD2   . ASP B 1 213 ? 56.685 21.442  112.106 1.00 18.24 ? 249 ASP B OD2   1 
ATOM   4166 N  N     . VAL B 1 214 ? 59.892 21.152  116.007 1.00 12.05 ? 250 VAL B N     1 
ATOM   4167 C  CA    . VAL B 1 214 ? 60.838 22.173  116.473 1.00 13.32 ? 250 VAL B CA    1 
ATOM   4168 C  C     . VAL B 1 214 ? 61.502 22.916  115.325 1.00 14.71 ? 250 VAL B C     1 
ATOM   4169 O  O     . VAL B 1 214 ? 62.496 23.639  115.525 1.00 14.62 ? 250 VAL B O     1 
ATOM   4170 C  CB    . VAL B 1 214 ? 61.945 21.570  117.362 1.00 12.91 ? 250 VAL B CB    1 
ATOM   4171 C  CG1   . VAL B 1 214 ? 61.347 20.961  118.604 1.00 12.34 ? 250 VAL B CG1   1 
ATOM   4172 C  CG2   . VAL B 1 214 ? 62.749 20.514  116.580 1.00 16.24 ? 250 VAL B CG2   1 
ATOM   4173 N  N     . GLY B 1 215 ? 60.971 22.752  114.118 1.00 13.71 ? 251 GLY B N     1 
ATOM   4174 C  CA    . GLY B 1 215 ? 61.615 23.344  112.959 1.00 13.79 ? 251 GLY B CA    1 
ATOM   4175 C  C     . GLY B 1 215 ? 61.392 24.846  112.926 1.00 12.80 ? 251 GLY B C     1 
ATOM   4176 O  O     . GLY B 1 215 ? 60.327 25.333  113.331 1.00 13.97 ? 251 GLY B O     1 
ATOM   4177 N  N     . PHE B 1 216 ? 62.413 25.580  112.491 1.00 12.21 ? 252 PHE B N     1 
ATOM   4178 C  CA    . PHE B 1 216 ? 62.288 27.006  112.186 1.00 12.28 ? 252 PHE B CA    1 
ATOM   4179 C  C     . PHE B 1 216 ? 63.381 27.346  111.196 1.00 16.60 ? 252 PHE B C     1 
ATOM   4180 O  O     . PHE B 1 216 ? 64.288 26.540  110.972 1.00 14.94 ? 252 PHE B O     1 
ATOM   4181 C  CB    . PHE B 1 216 ? 62.381 27.887  113.446 1.00 12.82 ? 252 PHE B CB    1 
ATOM   4182 C  CG    . PHE B 1 216 ? 63.723 27.843  114.138 1.00 13.59 ? 252 PHE B CG    1 
ATOM   4183 C  CD1   . PHE B 1 216 ? 64.019 26.833  115.053 1.00 14.75 ? 252 PHE B CD1   1 
ATOM   4184 C  CD2   . PHE B 1 216 ? 64.670 28.832  113.901 1.00 14.40 ? 252 PHE B CD2   1 
ATOM   4185 C  CE1   . PHE B 1 216 ? 65.245 26.804  115.706 1.00 15.73 ? 252 PHE B CE1   1 
ATOM   4186 C  CE2   . PHE B 1 216 ? 65.899 28.812  114.548 1.00 14.92 ? 252 PHE B CE2   1 
ATOM   4187 C  CZ    . PHE B 1 216 ? 66.188 27.792  115.448 1.00 20.38 ? 252 PHE B CZ    1 
ATOM   4188 N  N     . ASP B 1 217 ? 63.280 28.513  110.576 1.00 12.22 ? 253 ASP B N     1 
ATOM   4189 C  CA    . ASP B 1 217 ? 64.285 28.946  109.621 1.00 16.29 ? 253 ASP B CA    1 
ATOM   4190 C  C     . ASP B 1 217 ? 65.517 29.450  110.365 1.00 17.71 ? 253 ASP B C     1 
ATOM   4191 O  O     . ASP B 1 217 ? 65.495 30.546  110.908 1.00 16.53 ? 253 ASP B O     1 
ATOM   4192 C  CB    . ASP B 1 217 ? 63.716 30.081  108.769 1.00 16.18 ? 253 ASP B CB    1 
ATOM   4193 C  CG    . ASP B 1 217 ? 64.668 30.532  107.659 1.00 23.24 ? 253 ASP B CG    1 
ATOM   4194 O  OD1   . ASP B 1 217 ? 65.821 30.044  107.593 1.00 24.03 ? 253 ASP B OD1   1 
ATOM   4195 O  OD2   . ASP B 1 217 ? 64.254 31.395  106.853 1.00 31.07 ? 253 ASP B OD2   1 
ATOM   4196 N  N     . ASP B 1 218 ? 66.595 28.669  110.377 1.00 23.98 ? 254 ASP B N     1 
ATOM   4197 C  CA    . ASP B 1 218 ? 67.806 29.083  111.086 1.00 25.74 ? 254 ASP B CA    1 
ATOM   4198 C  C     . ASP B 1 218 ? 68.939 29.608  110.184 1.00 35.75 ? 254 ASP B C     1 
ATOM   4199 O  O     . ASP B 1 218 ? 70.057 29.834  110.661 1.00 33.00 ? 254 ASP B O     1 
ATOM   4200 C  CB    . ASP B 1 218 ? 68.311 27.961  111.999 1.00 22.68 ? 254 ASP B CB    1 
ATOM   4201 C  CG    . ASP B 1 218 ? 68.762 26.734  111.223 1.00 36.05 ? 254 ASP B CG    1 
ATOM   4202 O  OD1   . ASP B 1 218 ? 68.796 26.786  109.977 1.00 35.07 ? 254 ASP B OD1   1 
ATOM   4203 O  OD2   . ASP B 1 218 ? 69.076 25.707  111.860 1.00 30.67 ? 254 ASP B OD2   1 
ATOM   4204 N  N     . LYS B 1 219 ? 68.650 29.819  108.899 1.00 35.82 ? 255 LYS B N     1 
ATOM   4205 C  CA    . LYS B 1 219 ? 69.644 30.388  107.981 1.00 31.71 ? 255 LYS B CA    1 
ATOM   4206 C  C     . LYS B 1 219 ? 69.539 31.914  107.915 1.00 32.52 ? 255 LYS B C     1 
ATOM   4207 O  O     . LYS B 1 219 ? 68.994 32.485  106.965 1.00 30.12 ? 255 LYS B O     1 
ATOM   4208 C  CB    . LYS B 1 219 ? 69.511 29.775  106.584 1.00 36.42 ? 255 LYS B CB    1 
ATOM   4209 C  CG    . LYS B 1 219 ? 69.628 28.254  106.562 1.00 37.99 ? 255 LYS B CG    1 
ATOM   4210 C  CD    . LYS B 1 219 ? 70.703 27.727  107.513 1.00 42.65 ? 255 LYS B CD    1 
ATOM   4211 C  CE    . LYS B 1 219 ? 70.693 26.207  107.529 1.00 38.83 ? 255 LYS B CE    1 
ATOM   4212 N  NZ    . LYS B 1 219 ? 70.553 25.681  106.147 1.00 40.60 ? 255 LYS B NZ    1 
ATOM   4213 N  N     . LEU B 1 220 ? 70.110 32.568  108.919 1.00 34.14 ? 256 LEU B N     1 
ATOM   4214 C  CA    . LEU B 1 220 ? 69.898 33.989  109.152 1.00 30.87 ? 256 LEU B CA    1 
ATOM   4215 C  C     . LEU B 1 220 ? 70.468 34.930  108.077 1.00 31.19 ? 256 LEU B C     1 
ATOM   4216 O  O     . LEU B 1 220 ? 70.046 36.085  107.964 1.00 27.64 ? 256 LEU B O     1 
ATOM   4217 C  CB    . LEU B 1 220 ? 70.449 34.346  110.533 1.00 30.15 ? 256 LEU B CB    1 
ATOM   4218 C  CG    . LEU B 1 220 ? 69.997 33.380  111.634 1.00 27.85 ? 256 LEU B CG    1 
ATOM   4219 C  CD1   . LEU B 1 220 ? 70.572 33.801  112.982 1.00 29.90 ? 256 LEU B CD1   1 
ATOM   4220 C  CD2   . LEU B 1 220 ? 68.472 33.293  111.699 1.00 23.13 ? 256 LEU B CD2   1 
ATOM   4221 N  N     . GLU B 1 221 ? 71.411 34.437  107.282 1.00 30.92 ? 257 GLU B N     1 
ATOM   4222 C  CA    . GLU B 1 221 ? 72.061 35.260  106.255 1.00 36.50 ? 257 GLU B CA    1 
ATOM   4223 C  C     . GLU B 1 221 ? 71.059 35.782  105.225 1.00 33.76 ? 257 GLU B C     1 
ATOM   4224 O  O     . GLU B 1 221 ? 71.269 36.836  104.611 1.00 37.44 ? 257 GLU B O     1 
ATOM   4225 C  CB    . GLU B 1 221 ? 73.153 34.456  105.533 1.00 46.04 ? 257 GLU B CB    1 
ATOM   4226 C  CG    . GLU B 1 221 ? 74.152 33.746  106.455 1.00 49.30 ? 257 GLU B CG    1 
ATOM   4227 C  CD    . GLU B 1 221 ? 73.653 32.395  106.954 1.00 48.44 ? 257 GLU B CD    1 
ATOM   4228 O  OE1   . GLU B 1 221 ? 72.482 32.049  106.687 1.00 45.95 ? 257 GLU B OE1   1 
ATOM   4229 O  OE2   . GLU B 1 221 ? 74.434 31.674  107.611 1.00 55.71 ? 257 GLU B OE2   1 
ATOM   4230 N  N     . ASP B 1 222 ? 69.972 35.035  105.041 1.00 32.31 ? 258 ASP B N     1 
ATOM   4231 C  CA    . ASP B 1 222 ? 68.962 35.364  104.037 1.00 33.28 ? 258 ASP B CA    1 
ATOM   4232 C  C     . ASP B 1 222 ? 67.725 36.065  104.628 1.00 30.10 ? 258 ASP B C     1 
ATOM   4233 O  O     . ASP B 1 222 ? 66.704 36.230  103.959 1.00 29.56 ? 258 ASP B O     1 
ATOM   4234 C  CB    . ASP B 1 222 ? 68.576 34.097  103.275 1.00 35.54 ? 258 ASP B CB    1 
ATOM   4235 C  CG    . ASP B 1 222 ? 69.788 33.399  102.664 1.00 43.64 ? 258 ASP B CG    1 
ATOM   4236 O  OD1   . ASP B 1 222 ? 70.651 34.100  102.090 1.00 42.46 ? 258 ASP B OD1   1 
ATOM   4237 O  OD2   . ASP B 1 222 ? 69.887 32.156  102.776 1.00 43.67 ? 258 ASP B OD2   1 
ATOM   4238 N  N     . ILE B 1 223 ? 67.831 36.479  105.886 1.00 27.45 ? 259 ILE B N     1 
ATOM   4239 C  CA    . ILE B 1 223 ? 66.776 37.246  106.538 1.00 27.28 ? 259 ILE B CA    1 
ATOM   4240 C  C     . ILE B 1 223 ? 66.991 38.731  106.242 1.00 26.40 ? 259 ILE B C     1 
ATOM   4241 O  O     . ILE B 1 223 ? 68.078 39.255  106.471 1.00 28.04 ? 259 ILE B O     1 
ATOM   4242 C  CB    . ILE B 1 223 ? 66.799 37.039  108.067 1.00 27.70 ? 259 ILE B CB    1 
ATOM   4243 C  CG1   . ILE B 1 223 ? 66.659 35.554  108.421 1.00 25.06 ? 259 ILE B CG1   1 
ATOM   4244 C  CG2   . ILE B 1 223 ? 65.713 37.866  108.734 1.00 27.08 ? 259 ILE B CG2   1 
ATOM   4245 C  CD1   . ILE B 1 223 ? 65.320 34.958  108.072 1.00 25.66 ? 259 ILE B CD1   1 
ATOM   4246 N  N     . PRO B 1 224 ? 65.954 39.422  105.737 1.00 28.08 ? 260 PRO B N     1 
ATOM   4247 C  CA    . PRO B 1 224 ? 66.137 40.835  105.387 1.00 34.70 ? 260 PRO B CA    1 
ATOM   4248 C  C     . PRO B 1 224 ? 66.342 41.678  106.639 1.00 34.39 ? 260 PRO B C     1 
ATOM   4249 O  O     . PRO B 1 224 ? 65.842 41.304  107.704 1.00 33.22 ? 260 PRO B O     1 
ATOM   4250 C  CB    . PRO B 1 224 ? 64.812 41.198  104.705 1.00 33.95 ? 260 PRO B CB    1 
ATOM   4251 C  CG    . PRO B 1 224 ? 63.817 40.261  105.296 1.00 33.59 ? 260 PRO B CG    1 
ATOM   4252 C  CD    . PRO B 1 224 ? 64.571 38.970  105.505 1.00 31.85 ? 260 PRO B CD    1 
ATOM   4253 N  N     . PRO B 1 225 ? 67.071 42.799  106.518 1.00 35.30 ? 261 PRO B N     1 
ATOM   4254 C  CA    . PRO B 1 225 ? 67.388 43.631  107.687 1.00 36.79 ? 261 PRO B CA    1 
ATOM   4255 C  C     . PRO B 1 225 ? 66.116 44.139  108.351 1.00 26.53 ? 261 PRO B C     1 
ATOM   4256 O  O     . PRO B 1 225 ? 65.076 44.209  107.692 1.00 27.94 ? 261 PRO B O     1 
ATOM   4257 C  CB    . PRO B 1 225 ? 68.147 44.819  107.080 1.00 38.05 ? 261 PRO B CB    1 
ATOM   4258 C  CG    . PRO B 1 225 ? 68.600 44.349  105.727 1.00 40.57 ? 261 PRO B CG    1 
ATOM   4259 C  CD    . PRO B 1 225 ? 67.539 43.407  105.261 1.00 38.30 ? 261 PRO B CD    1 
ATOM   4260 N  N     . SER B 1 226 ? 66.182 44.483  109.633 1.00 30.37 ? 262 SER B N     1 
ATOM   4261 C  CA    . SER B 1 226 ? 65.010 45.053  110.289 1.00 25.98 ? 262 SER B CA    1 
ATOM   4262 C  C     . SER B 1 226 ? 64.697 46.435  109.717 1.00 24.62 ? 262 SER B C     1 
ATOM   4263 O  O     . SER B 1 226 ? 65.605 47.198  109.378 1.00 32.02 ? 262 SER B O     1 
ATOM   4264 C  CB    . SER B 1 226 ? 65.219 45.170  111.796 1.00 23.72 ? 262 SER B CB    1 
ATOM   4265 O  OG    . SER B 1 226 ? 64.068 45.725  112.409 1.00 24.05 ? 262 SER B OG    1 
ATOM   4266 N  N     . GLN B 1 227 ? 63.415 46.743  109.599 1.00 23.26 ? 263 GLN B N     1 
ATOM   4267 C  CA    . GLN B 1 227 ? 63.009 48.081  109.210 1.00 29.87 ? 263 GLN B CA    1 
ATOM   4268 C  C     . GLN B 1 227 ? 62.642 48.900  110.437 1.00 25.76 ? 263 GLN B C     1 
ATOM   4269 O  O     . GLN B 1 227 ? 62.249 50.062  110.310 1.00 22.55 ? 263 GLN B O     1 
ATOM   4270 C  CB    . GLN B 1 227 ? 61.825 48.038  108.250 1.00 29.51 ? 263 GLN B CB    1 
ATOM   4271 C  CG    . GLN B 1 227 ? 62.168 47.578  106.846 1.00 37.44 ? 263 GLN B CG    1 
ATOM   4272 C  CD    . GLN B 1 227 ? 60.965 47.634  105.929 1.00 35.69 ? 263 GLN B CD    1 
ATOM   4273 O  OE1   . GLN B 1 227 ? 59.870 47.206  106.300 1.00 36.29 ? 263 GLN B OE1   1 
ATOM   4274 N  NE2   . GLN B 1 227 ? 61.155 48.182  104.733 1.00 32.99 ? 263 GLN B NE2   1 
ATOM   4275 N  N     . ASN B 1 228 ? 62.757 48.294  111.622 1.00 19.35 ? 264 ASN B N     1 
ATOM   4276 C  CA    . ASN B 1 228 ? 62.531 49.037  112.857 1.00 19.95 ? 264 ASN B CA    1 
ATOM   4277 C  C     . ASN B 1 228 ? 63.839 49.605  113.395 1.00 20.67 ? 264 ASN B C     1 
ATOM   4278 O  O     . ASN B 1 228 ? 64.769 48.854  113.702 1.00 18.05 ? 264 ASN B O     1 
ATOM   4279 C  CB    . ASN B 1 228 ? 61.861 48.167  113.927 1.00 18.02 ? 264 ASN B CB    1 
ATOM   4280 C  CG    . ASN B 1 228 ? 61.290 48.988  115.053 1.00 19.82 ? 264 ASN B CG    1 
ATOM   4281 O  OD1   . ASN B 1 228 ? 62.036 49.560  115.851 1.00 22.06 ? 264 ASN B OD1   1 
ATOM   4282 N  ND2   . ASN B 1 228 ? 59.958 49.072  115.120 1.00 19.44 ? 264 ASN B ND2   1 
ATOM   4283 N  N     . TYR B 1 229 ? 63.910 50.934  113.505 1.00 16.21 ? 265 TYR B N     1 
ATOM   4284 C  CA    . TYR B 1 229 ? 65.128 51.607  113.935 1.00 19.13 ? 265 TYR B CA    1 
ATOM   4285 C  C     . TYR B 1 229 ? 65.020 52.190  115.339 1.00 19.93 ? 265 TYR B C     1 
ATOM   4286 O  O     . TYR B 1 229 ? 65.800 53.065  115.709 1.00 19.71 ? 265 TYR B O     1 
ATOM   4287 C  CB    . TYR B 1 229 ? 65.483 52.717  112.937 1.00 23.73 ? 265 TYR B CB    1 
ATOM   4288 C  CG    . TYR B 1 229 ? 65.867 52.172  111.582 1.00 27.29 ? 265 TYR B CG    1 
ATOM   4289 C  CD1   . TYR B 1 229 ? 66.612 51.009  111.473 1.00 30.23 ? 265 TYR B CD1   1 
ATOM   4290 C  CD2   . TYR B 1 229 ? 65.464 52.800  110.414 1.00 40.33 ? 265 TYR B CD2   1 
ATOM   4291 C  CE1   . TYR B 1 229 ? 66.967 50.497  110.241 1.00 34.30 ? 265 TYR B CE1   1 
ATOM   4292 C  CE2   . TYR B 1 229 ? 65.814 52.292  109.173 1.00 41.14 ? 265 TYR B CE2   1 
ATOM   4293 C  CZ    . TYR B 1 229 ? 66.564 51.139  109.095 1.00 38.33 ? 265 TYR B CZ    1 
ATOM   4294 O  OH    . TYR B 1 229 ? 66.921 50.622  107.869 1.00 44.89 ? 265 TYR B OH    1 
ATOM   4295 N  N     . SER B 1 230 ? 64.066 51.696  116.127 1.00 17.71 ? 266 SER B N     1 
ATOM   4296 C  CA    . SER B 1 230 ? 63.878 52.194  117.488 1.00 19.76 ? 266 SER B CA    1 
ATOM   4297 C  C     . SER B 1 230 ? 65.123 51.975  118.332 1.00 21.54 ? 266 SER B C     1 
ATOM   4298 O  O     . SER B 1 230 ? 65.841 50.989  118.154 1.00 16.11 ? 266 SER B O     1 
ATOM   4299 C  CB    . SER B 1 230 ? 62.701 51.492  118.167 1.00 20.72 ? 266 SER B CB    1 
ATOM   4300 O  OG    . SER B 1 230 ? 61.530 51.590  117.394 1.00 22.05 ? 266 SER B OG    1 
ATOM   4301 N  N     . SER B 1 231 ? 65.374 52.895  119.260 1.00 17.56 ? 267 SER B N     1 
ATOM   4302 C  CA    . SER B 1 231 ? 66.437 52.712  120.243 1.00 16.05 ? 267 SER B CA    1 
ATOM   4303 C  C     . SER B 1 231 ? 66.044 51.615  121.235 1.00 11.67 ? 267 SER B C     1 
ATOM   4304 O  O     . SER B 1 231 ? 64.854 51.298  121.381 1.00 13.14 ? 267 SER B O     1 
ATOM   4305 C  CB    . SER B 1 231 ? 66.673 54.012  120.999 1.00 15.61 ? 267 SER B CB    1 
ATOM   4306 O  OG    . SER B 1 231 ? 65.522 54.363  121.742 1.00 16.30 ? 267 SER B OG    1 
ATOM   4307 N  N     . LEU B 1 232 ? 67.044 51.039  121.909 1.00 11.26 ? 268 LEU B N     1 
ATOM   4308 C  CA    . LEU B 1 232 ? 66.809 50.082  122.990 1.00 12.41 ? 268 LEU B CA    1 
ATOM   4309 C  C     . LEU B 1 232 ? 65.809 50.670  123.984 1.00 14.30 ? 268 LEU B C     1 
ATOM   4310 O  O     . LEU B 1 232 ? 64.954 49.963  124.515 1.00 12.86 ? 268 LEU B O     1 
ATOM   4311 C  CB    . LEU B 1 232 ? 68.126 49.768  123.707 1.00 10.34 ? 268 LEU B CB    1 
ATOM   4312 C  CG    . LEU B 1 232 ? 68.030 48.945  124.995 1.00 11.36 ? 268 LEU B CG    1 
ATOM   4313 C  CD1   . LEU B 1 232 ? 67.310 47.625  124.725 1.00 11.93 ? 268 LEU B CD1   1 
ATOM   4314 C  CD2   . LEU B 1 232 ? 69.408 48.692  125.603 1.00 10.72 ? 268 LEU B CD2   1 
ATOM   4315 N  N     . GLY B 1 233 ? 65.915 51.973  124.230 1.00 16.62 ? 269 GLY B N     1 
ATOM   4316 C  CA    . GLY B 1 233 ? 65.021 52.624  125.179 1.00 12.76 ? 269 GLY B CA    1 
ATOM   4317 C  C     . GLY B 1 233 ? 63.575 52.668  124.698 1.00 14.23 ? 269 GLY B C     1 
ATOM   4318 O  O     . GLY B 1 233 ? 62.648 52.431  125.487 1.00 14.13 ? 269 GLY B O     1 
ATOM   4319 N  N     . SER B 1 234 ? 63.369 52.966  123.416 1.00 14.16 ? 270 SER B N     1 
ATOM   4320 C  CA    . SER B 1 234 ? 62.016 52.946  122.849 1.00 14.14 ? 270 SER B CA    1 
ATOM   4321 C  C     . SER B 1 234 ? 61.390 51.551  122.861 1.00 17.64 ? 270 SER B C     1 
ATOM   4322 O  O     . SER B 1 234 ? 60.186 51.400  123.094 1.00 14.06 ? 270 SER B O     1 
ATOM   4323 C  CB    . SER B 1 234 ? 62.000 53.500  121.424 1.00 18.60 ? 270 SER B CB    1 
ATOM   4324 O  OG    . SER B 1 234 ? 62.359 54.870  121.402 1.00 23.80 ? 270 SER B OG    1 
ATOM   4325 N  N     . LEU B 1 235 ? 62.205 50.535  122.586 1.00 13.85 ? 271 LEU B N     1 
ATOM   4326 C  CA    . LEU B 1 235 ? 61.734 49.156  122.613 1.00 14.29 ? 271 LEU B CA    1 
ATOM   4327 C  C     . LEU B 1 235 ? 61.238 48.770  123.994 1.00 10.16 ? 271 LEU B C     1 
ATOM   4328 O  O     . LEU B 1 235 ? 60.152 48.185  124.134 1.00 13.17 ? 271 LEU B O     1 
ATOM   4329 C  CB    . LEU B 1 235 ? 62.858 48.203  122.203 1.00 8.75  ? 271 LEU B CB    1 
ATOM   4330 C  CG    . LEU B 1 235 ? 63.390 48.310  120.780 1.00 14.74 ? 271 LEU B CG    1 
ATOM   4331 C  CD1   . LEU B 1 235 ? 64.346 47.161  120.490 1.00 10.30 ? 271 LEU B CD1   1 
ATOM   4332 C  CD2   . LEU B 1 235 ? 62.246 48.279  119.782 1.00 14.69 ? 271 LEU B CD2   1 
ATOM   4333 N  N     . LEU B 1 236 ? 62.044 49.061  125.014 1.00 11.75 ? 272 LEU B N     1 
ATOM   4334 C  CA    . LEU B 1 236 ? 61.680 48.697  126.380 1.00 11.50 ? 272 LEU B CA    1 
ATOM   4335 C  C     . LEU B 1 236 ? 60.436 49.461  126.842 1.00 17.33 ? 272 LEU B C     1 
ATOM   4336 O  O     . LEU B 1 236 ? 59.554 48.892  127.487 1.00 12.29 ? 272 LEU B O     1 
ATOM   4337 C  CB    . LEU B 1 236 ? 62.838 48.959  127.347 1.00 15.70 ? 272 LEU B CB    1 
ATOM   4338 C  CG    . LEU B 1 236 ? 63.841 47.835  127.586 1.00 18.58 ? 272 LEU B CG    1 
ATOM   4339 C  CD1   . LEU B 1 236 ? 65.015 48.344  128.411 1.00 23.59 ? 272 LEU B CD1   1 
ATOM   4340 C  CD2   . LEU B 1 236 ? 63.145 46.676  128.306 1.00 19.96 ? 272 LEU B CD2   1 
ATOM   4341 N  N     . HIS B 1 237 ? 60.362 50.746  126.510 1.00 14.44 ? 273 HIS B N     1 
ATOM   4342 C  CA    . HIS B 1 237 ? 59.186 51.537  126.886 1.00 17.65 ? 273 HIS B CA    1 
ATOM   4343 C  C     . HIS B 1 237 ? 57.925 50.926  126.299 1.00 15.60 ? 273 HIS B C     1 
ATOM   4344 O  O     . HIS B 1 237 ? 56.934 50.721  127.007 1.00 19.62 ? 273 HIS B O     1 
ATOM   4345 C  CB    . HIS B 1 237 ? 59.321 52.991  126.424 1.00 19.30 ? 273 HIS B CB    1 
ATOM   4346 C  CG    . HIS B 1 237 ? 58.279 53.895  127.003 1.00 24.14 ? 273 HIS B CG    1 
ATOM   4347 N  ND1   . HIS B 1 237 ? 58.240 55.252  126.747 1.00 25.21 ? 273 HIS B ND1   1 
ATOM   4348 C  CD2   . HIS B 1 237 ? 57.239 53.646  127.833 1.00 29.19 ? 273 HIS B CD2   1 
ATOM   4349 C  CE1   . HIS B 1 237 ? 57.223 55.793  127.389 1.00 30.33 ? 273 HIS B CE1   1 
ATOM   4350 N  NE2   . HIS B 1 237 ? 56.596 54.839  128.058 1.00 31.89 ? 273 HIS B NE2   1 
ATOM   4351 N  N     . GLY B 1 238 ? 57.970 50.613  125.010 1.00 15.69 ? 274 GLY B N     1 
ATOM   4352 C  CA    . GLY B 1 238 ? 56.836 50.022  124.333 1.00 10.91 ? 274 GLY B CA    1 
ATOM   4353 C  C     . GLY B 1 238 ? 56.453 48.664  124.893 1.00 13.57 ? 274 GLY B C     1 
ATOM   4354 O  O     . GLY B 1 238 ? 55.261 48.343  124.989 1.00 13.17 ? 274 GLY B O     1 
ATOM   4355 N  N     . PHE B 1 239 ? 57.461 47.865  125.242 1.00 14.21 ? 275 PHE B N     1 
ATOM   4356 C  CA    . PHE B 1 239 ? 57.252 46.550  125.853 1.00 14.10 ? 275 PHE B CA    1 
ATOM   4357 C  C     . PHE B 1 239 ? 56.493 46.690  127.185 1.00 11.70 ? 275 PHE B C     1 
ATOM   4358 O  O     . PHE B 1 239 ? 55.532 45.940  127.453 1.00 12.85 ? 275 PHE B O     1 
ATOM   4359 C  CB    . PHE B 1 239 ? 58.616 45.883  126.068 1.00 12.17 ? 275 PHE B CB    1 
ATOM   4360 C  CG    . PHE B 1 239 ? 58.584 44.656  126.962 1.00 13.99 ? 275 PHE B CG    1 
ATOM   4361 C  CD1   . PHE B 1 239 ? 58.234 43.404  126.457 1.00 12.72 ? 275 PHE B CD1   1 
ATOM   4362 C  CD2   . PHE B 1 239 ? 58.958 44.757  128.298 1.00 14.65 ? 275 PHE B CD2   1 
ATOM   4363 C  CE1   . PHE B 1 239 ? 58.227 42.263  127.295 1.00 9.94  ? 275 PHE B CE1   1 
ATOM   4364 C  CE2   . PHE B 1 239 ? 58.962 43.642  129.124 1.00 12.91 ? 275 PHE B CE2   1 
ATOM   4365 C  CZ    . PHE B 1 239 ? 58.597 42.392  128.619 1.00 11.52 ? 275 PHE B CZ    1 
ATOM   4366 N  N     . PHE B 1 240 ? 56.920 47.634  128.021 1.00 14.35 ? 276 PHE B N     1 
ATOM   4367 C  CA    . PHE B 1 240 ? 56.274 47.818  129.321 1.00 15.34 ? 276 PHE B CA    1 
ATOM   4368 C  C     . PHE B 1 240 ? 54.831 48.279  129.127 1.00 17.76 ? 276 PHE B C     1 
ATOM   4369 O  O     . PHE B 1 240 ? 53.912 47.761  129.779 1.00 15.25 ? 276 PHE B O     1 
ATOM   4370 C  CB    . PHE B 1 240 ? 57.045 48.808  130.207 1.00 13.38 ? 276 PHE B CB    1 
ATOM   4371 C  CG    . PHE B 1 240 ? 58.321 48.253  130.801 1.00 13.95 ? 276 PHE B CG    1 
ATOM   4372 C  CD1   . PHE B 1 240 ? 58.327 47.034  131.465 1.00 15.31 ? 276 PHE B CD1   1 
ATOM   4373 C  CD2   . PHE B 1 240 ? 59.515 48.959  130.695 1.00 11.55 ? 276 PHE B CD2   1 
ATOM   4374 C  CE1   . PHE B 1 240 ? 59.509 46.521  132.016 1.00 14.13 ? 276 PHE B CE1   1 
ATOM   4375 C  CE2   . PHE B 1 240 ? 60.702 48.456  131.244 1.00 15.00 ? 276 PHE B CE2   1 
ATOM   4376 C  CZ    . PHE B 1 240 ? 60.694 47.245  131.909 1.00 14.90 ? 276 PHE B CZ    1 
ATOM   4377 N  N     . ARG B 1 241 ? 54.627 49.244  128.227 1.00 16.22 ? 277 ARG B N     1 
ATOM   4378 C  CA    . ARG B 1 241 ? 53.279 49.763  127.970 1.00 18.33 ? 277 ARG B CA    1 
ATOM   4379 C  C     . ARG B 1 241 ? 52.347 48.692  127.412 1.00 18.34 ? 277 ARG B C     1 
ATOM   4380 O  O     . ARG B 1 241 ? 51.153 48.658  127.732 1.00 13.49 ? 277 ARG B O     1 
ATOM   4381 C  CB    . ARG B 1 241 ? 53.306 50.958  126.993 1.00 19.18 ? 277 ARG B CB    1 
ATOM   4382 C  CG    . ARG B 1 241 ? 53.987 52.215  127.518 1.00 26.03 ? 277 ARG B CG    1 
ATOM   4383 C  CD    . ARG B 1 241 ? 53.686 53.428  126.609 1.00 32.05 ? 277 ARG B CD    1 
ATOM   4384 N  NE    . ARG B 1 241 ? 52.266 53.780  126.642 1.00 34.82 ? 277 ARG B NE    1 
ATOM   4385 C  CZ    . ARG B 1 241 ? 51.387 53.443  125.700 1.00 38.81 ? 277 ARG B CZ    1 
ATOM   4386 N  NH1   . ARG B 1 241 ? 51.778 52.762  124.631 1.00 41.26 ? 277 ARG B NH1   1 
ATOM   4387 N  NH2   . ARG B 1 241 ? 50.115 53.796  125.816 1.00 36.50 ? 277 ARG B NH2   1 
ATOM   4388 N  N     . PHE B 1 242 ? 52.878 47.824  126.558 1.00 12.68 ? 278 PHE B N     1 
ATOM   4389 C  CA    . PHE B 1 242 ? 52.033 46.825  125.937 1.00 12.32 ? 278 PHE B CA    1 
ATOM   4390 C  C     . PHE B 1 242 ? 51.471 45.852  126.961 1.00 13.44 ? 278 PHE B C     1 
ATOM   4391 O  O     . PHE B 1 242 ? 50.268 45.560  126.964 1.00 14.65 ? 278 PHE B O     1 
ATOM   4392 C  CB    . PHE B 1 242 ? 52.779 46.036  124.846 1.00 12.97 ? 278 PHE B CB    1 
ATOM   4393 C  CG    . PHE B 1 242 ? 51.967 44.908  124.280 1.00 12.05 ? 278 PHE B CG    1 
ATOM   4394 C  CD1   . PHE B 1 242 ? 50.896 45.164  123.431 1.00 12.46 ? 278 PHE B CD1   1 
ATOM   4395 C  CD2   . PHE B 1 242 ? 52.253 43.587  124.624 1.00 15.16 ? 278 PHE B CD2   1 
ATOM   4396 C  CE1   . PHE B 1 242 ? 50.131 44.135  122.919 1.00 18.87 ? 278 PHE B CE1   1 
ATOM   4397 C  CE2   . PHE B 1 242 ? 51.491 42.550  124.121 1.00 10.28 ? 278 PHE B CE2   1 
ATOM   4398 C  CZ    . PHE B 1 242 ? 50.431 42.817  123.261 1.00 14.79 ? 278 PHE B CZ    1 
ATOM   4399 N  N     . TYR B 1 243 ? 52.338 45.320  127.812 1.00 12.94 ? 279 TYR B N     1 
ATOM   4400 C  CA    . TYR B 1 243 ? 51.862 44.360  128.808 1.00 14.69 ? 279 TYR B CA    1 
ATOM   4401 C  C     . TYR B 1 243 ? 51.183 45.052  130.007 1.00 15.94 ? 279 TYR B C     1 
ATOM   4402 O  O     . TYR B 1 243 ? 50.438 44.422  130.751 1.00 15.88 ? 279 TYR B O     1 
ATOM   4403 C  CB    . TYR B 1 243 ? 52.997 43.432  129.245 1.00 15.46 ? 279 TYR B CB    1 
ATOM   4404 C  CG    . TYR B 1 243 ? 53.385 42.458  128.150 1.00 12.85 ? 279 TYR B CG    1 
ATOM   4405 C  CD1   . TYR B 1 243 ? 52.508 41.450  127.758 1.00 13.11 ? 279 TYR B CD1   1 
ATOM   4406 C  CD2   . TYR B 1 243 ? 54.597 42.570  127.478 1.00 14.34 ? 279 TYR B CD2   1 
ATOM   4407 C  CE1   . TYR B 1 243 ? 52.837 40.562  126.750 1.00 13.92 ? 279 TYR B CE1   1 
ATOM   4408 C  CE2   . TYR B 1 243 ? 54.935 41.673  126.451 1.00 11.16 ? 279 TYR B CE2   1 
ATOM   4409 C  CZ    . TYR B 1 243 ? 54.047 40.678  126.101 1.00 13.41 ? 279 TYR B CZ    1 
ATOM   4410 O  OH    . TYR B 1 243 ? 54.373 39.784  125.099 1.00 10.66 ? 279 TYR B OH    1 
ATOM   4411 N  N     . ALA B 1 244 ? 51.429 46.347  130.189 1.00 15.36 ? 280 ALA B N     1 
ATOM   4412 C  CA    . ALA B 1 244 ? 50.715 47.099  131.231 1.00 16.99 ? 280 ALA B CA    1 
ATOM   4413 C  C     . ALA B 1 244 ? 49.259 47.337  130.848 1.00 19.73 ? 280 ALA B C     1 
ATOM   4414 O  O     . ALA B 1 244 ? 48.352 47.114  131.652 1.00 22.26 ? 280 ALA B O     1 
ATOM   4415 C  CB    . ALA B 1 244 ? 51.401 48.428  131.525 1.00 12.97 ? 280 ALA B CB    1 
ATOM   4416 N  N     . TYR B 1 245 ? 49.031 47.771  129.612 1.00 18.47 ? 281 TYR B N     1 
ATOM   4417 C  CA    . TYR B 1 245 ? 47.737 48.345  129.246 1.00 21.30 ? 281 TYR B CA    1 
ATOM   4418 C  C     . TYR B 1 245 ? 46.981 47.671  128.099 1.00 24.07 ? 281 TYR B C     1 
ATOM   4419 O  O     . TYR B 1 245 ? 45.752 47.711  128.065 1.00 26.47 ? 281 TYR B O     1 
ATOM   4420 C  CB    . TYR B 1 245 ? 47.923 49.833  128.936 1.00 18.70 ? 281 TYR B CB    1 
ATOM   4421 C  CG    . TYR B 1 245 ? 48.495 50.634  130.093 1.00 19.70 ? 281 TYR B CG    1 
ATOM   4422 C  CD1   . TYR B 1 245 ? 47.949 50.540  131.370 1.00 24.03 ? 281 TYR B CD1   1 
ATOM   4423 C  CD2   . TYR B 1 245 ? 49.579 51.486  129.905 1.00 22.35 ? 281 TYR B CD2   1 
ATOM   4424 C  CE1   . TYR B 1 245 ? 48.469 51.276  132.430 1.00 17.34 ? 281 TYR B CE1   1 
ATOM   4425 C  CE2   . TYR B 1 245 ? 50.102 52.225  130.957 1.00 26.74 ? 281 TYR B CE2   1 
ATOM   4426 C  CZ    . TYR B 1 245 ? 49.533 52.115  132.218 1.00 21.57 ? 281 TYR B CZ    1 
ATOM   4427 O  OH    . TYR B 1 245 ? 50.049 52.839  133.277 1.00 25.32 ? 281 TYR B OH    1 
ATOM   4428 N  N     . LYS B 1 246 ? 47.701 47.050  127.166 1.00 14.78 ? 282 LYS B N     1 
ATOM   4429 C  CA    . LYS B 1 246 ? 47.087 46.582  125.923 1.00 17.02 ? 282 LYS B CA    1 
ATOM   4430 C  C     . LYS B 1 246 ? 46.812 45.079  125.920 1.00 18.48 ? 282 LYS B C     1 
ATOM   4431 O  O     . LYS B 1 246 ? 45.734 44.638  125.532 1.00 16.63 ? 282 LYS B O     1 
ATOM   4432 C  CB    . LYS B 1 246 ? 47.982 46.934  124.728 1.00 18.92 ? 282 LYS B CB    1 
ATOM   4433 C  CG    . LYS B 1 246 ? 47.423 46.505  123.383 1.00 25.89 ? 282 LYS B CG    1 
ATOM   4434 C  CD    . LYS B 1 246 ? 46.270 47.402  122.955 1.00 32.34 ? 282 LYS B CD    1 
ATOM   4435 C  CE    . LYS B 1 246 ? 45.654 46.939  121.641 1.00 38.87 ? 282 LYS B CE    1 
ATOM   4436 N  NZ    . LYS B 1 246 ? 46.673 46.773  120.577 1.00 44.13 ? 282 LYS B NZ    1 
ATOM   4437 N  N     . PHE B 1 247 ? 47.794 44.294  126.346 1.00 14.17 ? 283 PHE B N     1 
ATOM   4438 C  CA    . PHE B 1 247 ? 47.633 42.839  126.358 1.00 17.23 ? 283 PHE B CA    1 
ATOM   4439 C  C     . PHE B 1 247 ? 46.511 42.462  127.323 1.00 20.72 ? 283 PHE B C     1 
ATOM   4440 O  O     . PHE B 1 247 ? 46.424 43.024  128.415 1.00 23.09 ? 283 PHE B O     1 
ATOM   4441 C  CB    . PHE B 1 247 ? 48.924 42.160  126.802 1.00 14.39 ? 283 PHE B CB    1 
ATOM   4442 C  CG    . PHE B 1 247 ? 48.840 40.660  126.783 1.00 16.16 ? 283 PHE B CG    1 
ATOM   4443 C  CD1   . PHE B 1 247 ? 48.816 39.980  125.576 1.00 14.26 ? 283 PHE B CD1   1 
ATOM   4444 C  CD2   . PHE B 1 247 ? 48.761 39.939  127.961 1.00 19.16 ? 283 PHE B CD2   1 
ATOM   4445 C  CE1   . PHE B 1 247 ? 48.725 38.609  125.541 1.00 19.29 ? 283 PHE B CE1   1 
ATOM   4446 C  CE2   . PHE B 1 247 ? 48.670 38.561  127.928 1.00 20.22 ? 283 PHE B CE2   1 
ATOM   4447 C  CZ    . PHE B 1 247 ? 48.653 37.902  126.715 1.00 14.98 ? 283 PHE B CZ    1 
ATOM   4448 N  N     . GLU B 1 248 ? 45.669 41.513  126.917 1.00 18.64 ? 284 GLU B N     1 
ATOM   4449 C  CA    . GLU B 1 248 ? 44.524 41.086  127.719 1.00 22.55 ? 284 GLU B CA    1 
ATOM   4450 C  C     . GLU B 1 248 ? 44.706 39.660  128.204 1.00 17.70 ? 284 GLU B C     1 
ATOM   4451 O  O     . GLU B 1 248 ? 44.279 38.726  127.531 1.00 18.30 ? 284 GLU B O     1 
ATOM   4452 C  CB    . GLU B 1 248 ? 43.244 41.172  126.887 1.00 21.92 ? 284 GLU B CB    1 
ATOM   4453 C  CG    . GLU B 1 248 ? 42.901 42.588  126.441 1.00 25.04 ? 284 GLU B CG    1 
ATOM   4454 C  CD    . GLU B 1 248 ? 41.738 42.631  125.461 1.00 44.02 ? 284 GLU B CD    1 
ATOM   4455 O  OE1   . GLU B 1 248 ? 40.690 43.228  125.795 1.00 48.55 ? 284 GLU B OE1   1 
ATOM   4456 O  OE2   . GLU B 1 248 ? 41.875 42.066  124.354 1.00 45.89 ? 284 GLU B OE2   1 
ATOM   4457 N  N     . PRO B 1 249 ? 45.327 39.493  129.383 1.00 19.51 ? 285 PRO B N     1 
ATOM   4458 C  CA    . PRO B 1 249 ? 45.668 38.176  129.945 1.00 20.12 ? 285 PRO B CA    1 
ATOM   4459 C  C     . PRO B 1 249 ? 44.467 37.271  130.205 1.00 24.62 ? 285 PRO B C     1 
ATOM   4460 O  O     . PRO B 1 249 ? 44.645 36.056  130.249 1.00 21.81 ? 285 PRO B O     1 
ATOM   4461 C  CB    . PRO B 1 249 ? 46.370 38.519  131.272 1.00 24.57 ? 285 PRO B CB    1 
ATOM   4462 C  CG    . PRO B 1 249 ? 45.967 39.926  131.580 1.00 27.16 ? 285 PRO B CG    1 
ATOM   4463 C  CD    . PRO B 1 249 ? 45.775 40.598  130.254 1.00 21.12 ? 285 PRO B CD    1 
ATOM   4464 N  N     . ARG B 1 250 ? 43.273 37.836  130.371 1.00 21.61 ? 286 ARG B N     1 
ATOM   4465 C  CA    . ARG B 1 250 ? 42.083 37.021  130.617 1.00 25.95 ? 286 ARG B CA    1 
ATOM   4466 C  C     . ARG B 1 250 ? 41.573 36.349  129.355 1.00 29.27 ? 286 ARG B C     1 
ATOM   4467 O  O     . ARG B 1 250 ? 40.923 35.302  129.418 1.00 31.70 ? 286 ARG B O     1 
ATOM   4468 C  CB    . ARG B 1 250 ? 40.964 37.870  131.229 1.00 28.65 ? 286 ARG B CB    1 
ATOM   4469 C  CG    . ARG B 1 250 ? 41.266 38.361  132.634 1.00 33.34 ? 286 ARG B CG    1 
ATOM   4470 C  CD    . ARG B 1 250 ? 40.003 38.835  133.354 1.00 40.22 ? 286 ARG B CD    1 
ATOM   4471 N  NE    . ARG B 1 250 ? 40.276 39.218  134.739 1.00 45.91 ? 286 ARG B NE    1 
ATOM   4472 C  CZ    . ARG B 1 250 ? 39.573 40.119  135.423 1.00 52.85 ? 286 ARG B CZ    1 
ATOM   4473 N  NH1   . ARG B 1 250 ? 38.551 40.745  134.853 1.00 50.70 ? 286 ARG B NH1   1 
ATOM   4474 N  NH2   . ARG B 1 250 ? 39.900 40.404  136.677 1.00 46.75 ? 286 ARG B NH2   1 
ATOM   4475 N  N     . GLU B 1 251 ? 41.893 36.940  128.209 1.00 22.85 ? 287 GLU B N     1 
ATOM   4476 C  CA    . GLU B 1 251 ? 41.310 36.523  126.941 1.00 23.15 ? 287 GLU B CA    1 
ATOM   4477 C  C     . GLU B 1 251 ? 42.314 35.935  125.947 1.00 21.91 ? 287 GLU B C     1 
ATOM   4478 O  O     . GLU B 1 251 ? 41.954 35.095  125.118 1.00 26.94 ? 287 GLU B O     1 
ATOM   4479 C  CB    . GLU B 1 251 ? 40.628 37.726  126.276 1.00 28.07 ? 287 GLU B CB    1 
ATOM   4480 C  CG    . GLU B 1 251 ? 39.613 38.444  127.156 1.00 33.72 ? 287 GLU B CG    1 
ATOM   4481 C  CD    . GLU B 1 251 ? 38.391 37.596  127.462 1.00 42.29 ? 287 GLU B CD    1 
ATOM   4482 O  OE1   . GLU B 1 251 ? 38.059 36.706  126.649 1.00 42.15 ? 287 GLU B OE1   1 
ATOM   4483 O  OE2   . GLU B 1 251 ? 37.759 37.827  128.517 1.00 46.27 ? 287 GLU B OE2   1 
ATOM   4484 N  N     . LYS B 1 252 ? 43.561 36.392  126.010 1.00 21.53 ? 288 LYS B N     1 
ATOM   4485 C  CA    . LYS B 1 252 ? 44.504 36.138  124.921 1.00 19.09 ? 288 LYS B CA    1 
ATOM   4486 C  C     . LYS B 1 252 ? 45.708 35.294  125.340 1.00 15.61 ? 288 LYS B C     1 
ATOM   4487 O  O     . LYS B 1 252 ? 46.030 35.185  126.528 1.00 16.06 ? 288 LYS B O     1 
ATOM   4488 C  CB    . LYS B 1 252 ? 44.983 37.462  124.319 1.00 22.02 ? 288 LYS B CB    1 
ATOM   4489 C  CG    . LYS B 1 252 ? 43.851 38.366  123.863 1.00 23.66 ? 288 LYS B CG    1 
ATOM   4490 C  CD    . LYS B 1 252 ? 43.182 37.798  122.617 1.00 25.87 ? 288 LYS B CD    1 
ATOM   4491 C  CE    . LYS B 1 252 ? 41.983 38.646  122.187 1.00 36.70 ? 288 LYS B CE    1 
ATOM   4492 N  NZ    . LYS B 1 252 ? 42.387 39.975  121.639 1.00 43.65 ? 288 LYS B NZ    1 
ATOM   4493 N  N     . VAL B 1 253 ? 46.369 34.708  124.340 1.00 14.14 ? 289 VAL B N     1 
ATOM   4494 C  CA    . VAL B 1 253 ? 47.500 33.816  124.573 1.00 15.73 ? 289 VAL B CA    1 
ATOM   4495 C  C     . VAL B 1 253 ? 48.707 34.376  123.830 1.00 12.42 ? 289 VAL B C     1 
ATOM   4496 O  O     . VAL B 1 253 ? 48.598 34.718  122.652 1.00 16.94 ? 289 VAL B O     1 
ATOM   4497 C  CB    . VAL B 1 253 ? 47.208 32.414  124.003 1.00 16.30 ? 289 VAL B CB    1 
ATOM   4498 C  CG1   . VAL B 1 253 ? 48.400 31.464  124.221 1.00 16.34 ? 289 VAL B CG1   1 
ATOM   4499 C  CG2   . VAL B 1 253 ? 45.932 31.820  124.619 1.00 19.35 ? 289 VAL B CG2   1 
ATOM   4500 N  N     . VAL B 1 254 ? 49.852 34.465  124.499 1.00 11.94 ? 290 VAL B N     1 
ATOM   4501 C  CA    . VAL B 1 254 ? 51.089 34.830  123.801 1.00 11.37 ? 290 VAL B CA    1 
ATOM   4502 C  C     . VAL B 1 254 ? 51.455 33.619  122.935 1.00 15.98 ? 290 VAL B C     1 
ATOM   4503 O  O     . VAL B 1 254 ? 51.545 32.514  123.453 1.00 12.24 ? 290 VAL B O     1 
ATOM   4504 C  CB    . VAL B 1 254 ? 52.215 35.165  124.809 1.00 11.15 ? 290 VAL B CB    1 
ATOM   4505 C  CG1   . VAL B 1 254 ? 53.576 35.220  124.114 1.00 13.38 ? 290 VAL B CG1   1 
ATOM   4506 C  CG2   . VAL B 1 254 ? 51.939 36.519  125.501 1.00 11.52 ? 290 VAL B CG2   1 
ATOM   4507 N  N     . THR B 1 255 ? 51.604 33.804  121.620 1.00 14.48 ? 291 THR B N     1 
ATOM   4508 C  CA    . THR B 1 255 ? 51.796 32.665  120.710 1.00 14.50 ? 291 THR B CA    1 
ATOM   4509 C  C     . THR B 1 255 ? 52.752 32.995  119.564 1.00 14.87 ? 291 THR B C     1 
ATOM   4510 O  O     . THR B 1 255 ? 52.854 34.150  119.134 1.00 11.30 ? 291 THR B O     1 
ATOM   4511 C  CB    . THR B 1 255 ? 50.444 32.162  120.131 1.00 15.51 ? 291 THR B CB    1 
ATOM   4512 O  OG1   . THR B 1 255 ? 50.678 31.075  119.226 1.00 19.89 ? 291 THR B OG1   1 
ATOM   4513 C  CG2   . THR B 1 255 ? 49.726 33.282  119.373 1.00 15.21 ? 291 THR B CG2   1 
ATOM   4514 N  N     . PHE B 1 256 ? 53.445 31.975  119.069 1.00 14.36 ? 292 PHE B N     1 
ATOM   4515 C  CA    . PHE B 1 256 ? 54.349 32.135  117.931 1.00 14.05 ? 292 PHE B CA    1 
ATOM   4516 C  C     . PHE B 1 256 ? 53.851 31.358  116.719 1.00 18.19 ? 292 PHE B C     1 
ATOM   4517 O  O     . PHE B 1 256 ? 54.564 31.218  115.721 1.00 16.23 ? 292 PHE B O     1 
ATOM   4518 C  CB    . PHE B 1 256 ? 55.782 31.722  118.330 1.00 12.48 ? 292 PHE B CB    1 
ATOM   4519 C  CG    . PHE B 1 256 ? 56.312 32.525  119.486 1.00 11.61 ? 292 PHE B CG    1 
ATOM   4520 C  CD1   . PHE B 1 256 ? 56.941 33.745  119.267 1.00 11.58 ? 292 PHE B CD1   1 
ATOM   4521 C  CD2   . PHE B 1 256 ? 56.107 32.104  120.799 1.00 12.64 ? 292 PHE B CD2   1 
ATOM   4522 C  CE1   . PHE B 1 256 ? 57.381 34.519  120.333 1.00 11.93 ? 292 PHE B CE1   1 
ATOM   4523 C  CE2   . PHE B 1 256 ? 56.553 32.873  121.868 1.00 13.34 ? 292 PHE B CE2   1 
ATOM   4524 C  CZ    . PHE B 1 256 ? 57.186 34.081  121.635 1.00 8.20  ? 292 PHE B CZ    1 
ATOM   4525 N  N     . ARG B 1 257 ? 52.608 30.885  116.785 1.00 14.50 ? 293 ARG B N     1 
ATOM   4526 C  CA    . ARG B 1 257 ? 52.059 30.067  115.701 1.00 17.44 ? 293 ARG B CA    1 
ATOM   4527 C  C     . ARG B 1 257 ? 51.009 30.754  114.827 1.00 17.82 ? 293 ARG B C     1 
ATOM   4528 O  O     . ARG B 1 257 ? 50.390 30.106  113.990 1.00 21.47 ? 293 ARG B O     1 
ATOM   4529 C  CB    . ARG B 1 257 ? 51.490 28.756  116.264 1.00 21.56 ? 293 ARG B CB    1 
ATOM   4530 C  CG    . ARG B 1 257 ? 52.557 27.807  116.757 1.00 22.96 ? 293 ARG B CG    1 
ATOM   4531 C  CD    . ARG B 1 257 ? 52.015 26.832  117.793 1.00 26.70 ? 293 ARG B CD    1 
ATOM   4532 N  NE    . ARG B 1 257 ? 50.788 26.165  117.356 1.00 24.98 ? 293 ARG B NE    1 
ATOM   4533 C  CZ    . ARG B 1 257 ? 50.748 25.145  116.502 1.00 33.48 ? 293 ARG B CZ    1 
ATOM   4534 N  NH1   . ARG B 1 257 ? 51.871 24.664  115.972 1.00 28.10 ? 293 ARG B NH1   1 
ATOM   4535 N  NH2   . ARG B 1 257 ? 49.579 24.612  116.168 1.00 33.65 ? 293 ARG B NH2   1 
ATOM   4536 N  N     . ARG B 1 258 ? 50.811 32.056  115.011 1.00 19.73 ? 294 ARG B N     1 
ATOM   4537 C  CA    . ARG B 1 258 ? 49.851 32.801  114.197 1.00 17.45 ? 294 ARG B CA    1 
ATOM   4538 C  C     . ARG B 1 258 ? 50.522 33.945  113.421 1.00 18.12 ? 294 ARG B C     1 
ATOM   4539 O  O     . ARG B 1 258 ? 51.408 34.628  113.953 1.00 16.62 ? 294 ARG B O     1 
ATOM   4540 C  CB    . ARG B 1 258 ? 48.723 33.347  115.076 1.00 21.67 ? 294 ARG B CB    1 
ATOM   4541 C  CG    . ARG B 1 258 ? 47.835 32.261  115.711 1.00 27.05 ? 294 ARG B CG    1 
ATOM   4542 C  CD    . ARG B 1 258 ? 46.828 31.703  114.705 1.00 27.06 ? 294 ARG B CD    1 
ATOM   4543 N  NE    . ARG B 1 258 ? 45.930 30.699  115.280 1.00 43.39 ? 294 ARG B NE    1 
ATOM   4544 C  CZ    . ARG B 1 258 ? 44.734 30.962  115.810 1.00 47.50 ? 294 ARG B CZ    1 
ATOM   4545 N  NH1   . ARG B 1 258 ? 44.270 32.207  115.860 1.00 45.13 ? 294 ARG B NH1   1 
ATOM   4546 N  NH2   . ARG B 1 258 ? 43.993 29.972  116.294 1.00 49.13 ? 294 ARG B NH2   1 
ATOM   4547 N  N     . PRO B 1 259 ? 50.088 34.172  112.168 1.00 22.09 ? 295 PRO B N     1 
ATOM   4548 C  CA    . PRO B 1 259 ? 50.717 35.208  111.335 1.00 19.69 ? 295 PRO B CA    1 
ATOM   4549 C  C     . PRO B 1 259 ? 50.584 36.584  111.963 1.00 20.26 ? 295 PRO B C     1 
ATOM   4550 O  O     . PRO B 1 259 ? 51.494 37.403  111.817 1.00 20.40 ? 295 PRO B O     1 
ATOM   4551 C  CB    . PRO B 1 259 ? 49.910 35.151  110.029 1.00 25.07 ? 295 PRO B CB    1 
ATOM   4552 C  CG    . PRO B 1 259 ? 49.308 33.778  110.012 1.00 28.50 ? 295 PRO B CG    1 
ATOM   4553 C  CD    . PRO B 1 259 ? 49.004 33.475  111.453 1.00 21.05 ? 295 PRO B CD    1 
ATOM   4554 N  N     . ASP B 1 260 ? 49.475 36.821  112.662 1.00 18.13 ? 296 ASP B N     1 
ATOM   4555 C  CA    . ASP B 1 260 ? 49.208 38.123  113.266 1.00 22.25 ? 296 ASP B CA    1 
ATOM   4556 C  C     . ASP B 1 260 ? 49.372 38.094  114.778 1.00 23.27 ? 296 ASP B C     1 
ATOM   4557 O  O     . ASP B 1 260 ? 49.128 39.096  115.452 1.00 19.81 ? 296 ASP B O     1 
ATOM   4558 C  CB    . ASP B 1 260 ? 47.794 38.597  112.918 1.00 29.37 ? 296 ASP B CB    1 
ATOM   4559 C  CG    . ASP B 1 260 ? 46.709 37.633  113.398 1.00 29.64 ? 296 ASP B CG    1 
ATOM   4560 O  OD1   . ASP B 1 260 ? 47.028 36.516  113.871 1.00 26.95 ? 296 ASP B OD1   1 
ATOM   4561 O  OD2   . ASP B 1 260 ? 45.516 37.989  113.280 1.00 33.38 ? 296 ASP B OD2   1 
ATOM   4562 N  N     . GLY B 1 261 ? 49.779 36.943  115.306 1.00 17.90 ? 297 GLY B N     1 
ATOM   4563 C  CA    . GLY B 1 261 ? 49.980 36.783  116.738 1.00 15.30 ? 297 GLY B CA    1 
ATOM   4564 C  C     . GLY B 1 261 ? 48.700 36.781  117.558 1.00 17.29 ? 297 GLY B C     1 
ATOM   4565 O  O     . GLY B 1 261 ? 48.740 36.959  118.781 1.00 16.16 ? 297 GLY B O     1 
ATOM   4566 N  N     . TYR B 1 262 ? 47.567 36.568  116.892 1.00 20.53 ? 298 TYR B N     1 
ATOM   4567 C  CA    . TYR B 1 262 ? 46.267 36.613  117.559 1.00 19.91 ? 298 TYR B CA    1 
ATOM   4568 C  C     . TYR B 1 262 ? 45.786 35.205  117.887 1.00 18.95 ? 298 TYR B C     1 
ATOM   4569 O  O     . TYR B 1 262 ? 45.704 34.345  117.005 1.00 23.32 ? 298 TYR B O     1 
ATOM   4570 C  CB    . TYR B 1 262 ? 45.228 37.329  116.681 1.00 24.78 ? 298 TYR B CB    1 
ATOM   4571 C  CG    . TYR B 1 262 ? 43.847 37.428  117.316 1.00 34.00 ? 298 TYR B CG    1 
ATOM   4572 C  CD1   . TYR B 1 262 ? 42.937 36.374  117.224 1.00 37.66 ? 298 TYR B CD1   1 
ATOM   4573 C  CD2   . TYR B 1 262 ? 43.450 38.575  117.995 1.00 36.72 ? 298 TYR B CD2   1 
ATOM   4574 C  CE1   . TYR B 1 262 ? 41.684 36.457  117.798 1.00 38.61 ? 298 TYR B CE1   1 
ATOM   4575 C  CE2   . TYR B 1 262 ? 42.189 38.665  118.573 1.00 37.50 ? 298 TYR B CE2   1 
ATOM   4576 C  CZ    . TYR B 1 262 ? 41.317 37.601  118.471 1.00 35.43 ? 298 TYR B CZ    1 
ATOM   4577 O  OH    . TYR B 1 262 ? 40.066 37.674  119.039 1.00 44.32 ? 298 TYR B OH    1 
ATOM   4578 N  N     . LEU B 1 263 ? 45.464 34.971  119.155 1.00 20.00 ? 299 LEU B N     1 
ATOM   4579 C  CA    . LEU B 1 263 ? 44.951 33.667  119.581 1.00 20.01 ? 299 LEU B CA    1 
ATOM   4580 C  C     . LEU B 1 263 ? 44.251 33.804  120.920 1.00 22.31 ? 299 LEU B C     1 
ATOM   4581 O  O     . LEU B 1 263 ? 44.821 34.352  121.870 1.00 18.39 ? 299 LEU B O     1 
ATOM   4582 C  CB    . LEU B 1 263 ? 46.097 32.648  119.694 1.00 25.85 ? 299 LEU B CB    1 
ATOM   4583 C  CG    . LEU B 1 263 ? 45.784 31.261  120.279 1.00 26.20 ? 299 LEU B CG    1 
ATOM   4584 C  CD1   . LEU B 1 263 ? 44.761 30.552  119.422 1.00 25.59 ? 299 LEU B CD1   1 
ATOM   4585 C  CD2   . LEU B 1 263 ? 47.041 30.406  120.406 1.00 23.28 ? 299 LEU B CD2   1 
ATOM   4586 N  N     . THR B 1 264 ? 43.020 33.299  121.000 1.00 20.63 ? 300 THR B N     1 
ATOM   4587 C  CA    . THR B 1 264 ? 42.255 33.369  122.242 1.00 23.73 ? 300 THR B CA    1 
ATOM   4588 C  C     . THR B 1 264 ? 42.423 32.112  123.085 1.00 25.03 ? 300 THR B C     1 
ATOM   4589 O  O     . THR B 1 264 ? 42.643 31.020  122.546 1.00 25.31 ? 300 THR B O     1 
ATOM   4590 C  CB    . THR B 1 264 ? 40.753 33.570  121.970 1.00 27.35 ? 300 THR B CB    1 
ATOM   4591 O  OG1   . THR B 1 264 ? 40.254 32.463  121.210 1.00 30.36 ? 300 THR B OG1   1 
ATOM   4592 C  CG2   . THR B 1 264 ? 40.515 34.864  121.200 1.00 26.28 ? 300 THR B CG2   1 
ATOM   4593 N  N     . LYS B 1 265 ? 42.299 32.271  124.403 1.00 23.12 ? 301 LYS B N     1 
ATOM   4594 C  CA    . LYS B 1 265 ? 42.308 31.139  125.319 1.00 26.84 ? 301 LYS B CA    1 
ATOM   4595 C  C     . LYS B 1 265 ? 41.182 30.186  124.977 1.00 30.98 ? 301 LYS B C     1 
ATOM   4596 O  O     . LYS B 1 265 ? 41.311 28.984  125.163 1.00 28.08 ? 301 LYS B O     1 
ATOM   4597 C  CB    . LYS B 1 265 ? 42.119 31.599  126.761 1.00 24.13 ? 301 LYS B CB    1 
ATOM   4598 C  CG    . LYS B 1 265 ? 43.284 32.310  127.401 1.00 24.50 ? 301 LYS B CG    1 
ATOM   4599 C  CD    . LYS B 1 265 ? 42.866 32.747  128.799 1.00 27.38 ? 301 LYS B CD    1 
ATOM   4600 C  CE    . LYS B 1 265 ? 44.045 33.158  129.617 1.00 27.95 ? 301 LYS B CE    1 
ATOM   4601 N  NZ    . LYS B 1 265 ? 43.619 33.748  130.907 1.00 26.80 ? 301 LYS B NZ    1 
ATOM   4602 N  N     . GLN B 1 266 ? 40.070 30.731  124.499 1.00 29.24 ? 302 GLN B N     1 
ATOM   4603 C  CA    . GLN B 1 266 ? 38.932 29.907  124.113 1.00 32.80 ? 302 GLN B CA    1 
ATOM   4604 C  C     . GLN B 1 266 ? 39.294 28.992  122.940 1.00 37.36 ? 302 GLN B C     1 
ATOM   4605 O  O     . GLN B 1 266 ? 39.054 27.781  122.997 1.00 33.83 ? 302 GLN B O     1 
ATOM   4606 C  CB    . GLN B 1 266 ? 37.725 30.781  123.757 1.00 35.73 ? 302 GLN B CB    1 
ATOM   4607 C  CG    . GLN B 1 266 ? 36.407 30.016  123.636 1.00 43.21 ? 302 GLN B CG    1 
ATOM   4608 C  CD    . GLN B 1 266 ? 35.775 29.695  124.991 1.00 50.93 ? 302 GLN B CD    1 
ATOM   4609 O  OE1   . GLN B 1 266 ? 35.809 30.511  125.921 1.00 51.46 ? 302 GLN B OE1   1 
ATOM   4610 N  NE2   . GLN B 1 266 ? 35.193 28.502  125.105 1.00 51.51 ? 302 GLN B NE2   1 
ATOM   4611 N  N     . GLU B 1 267 ? 39.881 29.559  121.884 1.00 27.87 ? 303 GLU B N     1 
ATOM   4612 C  CA    . GLU B 1 267 ? 40.268 28.754  120.722 1.00 31.77 ? 303 GLU B CA    1 
ATOM   4613 C  C     . GLU B 1 267 ? 41.303 27.722  121.115 1.00 35.03 ? 303 GLU B C     1 
ATOM   4614 O  O     . GLU B 1 267 ? 41.354 26.631  120.549 1.00 37.84 ? 303 GLU B O     1 
ATOM   4615 C  CB    . GLU B 1 267 ? 40.832 29.631  119.603 1.00 34.20 ? 303 GLU B CB    1 
ATOM   4616 C  CG    . GLU B 1 267 ? 39.790 30.405  118.817 1.00 44.26 ? 303 GLU B CG    1 
ATOM   4617 C  CD    . GLU B 1 267 ? 40.397 31.201  117.676 1.00 51.55 ? 303 GLU B CD    1 
ATOM   4618 O  OE1   . GLU B 1 267 ? 41.569 30.939  117.323 1.00 51.06 ? 303 GLU B OE1   1 
ATOM   4619 O  OE2   . GLU B 1 267 ? 39.698 32.087  117.137 1.00 55.65 ? 303 GLU B OE2   1 
ATOM   4620 N  N     . LYS B 1 268 ? 42.126 28.081  122.094 1.00 29.61 ? 304 LYS B N     1 
ATOM   4621 C  CA    . LYS B 1 268 ? 43.241 27.248  122.520 1.00 32.01 ? 304 LYS B CA    1 
ATOM   4622 C  C     . LYS B 1 268 ? 42.764 26.129  123.443 1.00 36.35 ? 304 LYS B C     1 
ATOM   4623 O  O     . LYS B 1 268 ? 43.407 25.082  123.558 1.00 36.56 ? 304 LYS B O     1 
ATOM   4624 C  CB    . LYS B 1 268 ? 44.283 28.122  123.226 1.00 28.22 ? 304 LYS B CB    1 
ATOM   4625 C  CG    . LYS B 1 268 ? 45.511 27.396  123.733 1.00 29.59 ? 304 LYS B CG    1 
ATOM   4626 C  CD    . LYS B 1 268 ? 46.299 26.725  122.602 1.00 23.76 ? 304 LYS B CD    1 
ATOM   4627 C  CE    . LYS B 1 268 ? 47.438 25.910  123.210 1.00 21.61 ? 304 LYS B CE    1 
ATOM   4628 N  NZ    . LYS B 1 268 ? 48.191 25.129  122.186 1.00 20.47 ? 304 LYS B NZ    1 
ATOM   4629 N  N     . GLY B 1 269 ? 41.621 26.346  124.086 1.00 35.71 ? 305 GLY B N     1 
ATOM   4630 C  CA    . GLY B 1 269 ? 41.116 25.398  125.061 1.00 34.92 ? 305 GLY B CA    1 
ATOM   4631 C  C     . GLY B 1 269 ? 41.848 25.549  126.376 1.00 35.13 ? 305 GLY B C     1 
ATOM   4632 O  O     . GLY B 1 269 ? 41.939 24.602  127.156 1.00 35.84 ? 305 GLY B O     1 
ATOM   4633 N  N     . TRP B 1 270 ? 42.368 26.750  126.623 1.00 32.24 ? 306 TRP B N     1 
ATOM   4634 C  CA    . TRP B 1 270 ? 43.126 27.029  127.837 1.00 29.00 ? 306 TRP B CA    1 
ATOM   4635 C  C     . TRP B 1 270 ? 42.373 27.953  128.783 1.00 37.88 ? 306 TRP B C     1 
ATOM   4636 O  O     . TRP B 1 270 ? 42.920 28.941  129.282 1.00 35.81 ? 306 TRP B O     1 
ATOM   4637 C  CB    . TRP B 1 270 ? 44.481 27.640  127.481 1.00 30.67 ? 306 TRP B CB    1 
ATOM   4638 C  CG    . TRP B 1 270 ? 45.531 26.637  127.158 1.00 25.92 ? 306 TRP B CG    1 
ATOM   4639 C  CD1   . TRP B 1 270 ? 45.373 25.276  127.054 1.00 28.94 ? 306 TRP B CD1   1 
ATOM   4640 C  CD2   . TRP B 1 270 ? 46.915 26.901  126.902 1.00 21.94 ? 306 TRP B CD2   1 
ATOM   4641 N  NE1   . TRP B 1 270 ? 46.579 24.684  126.745 1.00 25.02 ? 306 TRP B NE1   1 
ATOM   4642 C  CE2   . TRP B 1 270 ? 47.541 25.659  126.654 1.00 23.80 ? 306 TRP B CE2   1 
ATOM   4643 C  CE3   . TRP B 1 270 ? 47.687 28.068  126.862 1.00 23.47 ? 306 TRP B CE3   1 
ATOM   4644 C  CZ2   . TRP B 1 270 ? 48.898 25.554  126.369 1.00 20.97 ? 306 TRP B CZ2   1 
ATOM   4645 C  CZ3   . TRP B 1 270 ? 49.038 27.959  126.582 1.00 16.93 ? 306 TRP B CZ3   1 
ATOM   4646 C  CH2   . TRP B 1 270 ? 49.627 26.712  126.331 1.00 20.43 ? 306 TRP B CH2   1 
ATOM   4647 N  N     . THR B 1 271 ? 41.113 27.623  129.032 1.00 44.63 ? 307 THR B N     1 
ATOM   4648 C  CA    . THR B 1 271 ? 40.311 28.367  129.989 1.00 44.75 ? 307 THR B CA    1 
ATOM   4649 C  C     . THR B 1 271 ? 40.631 27.879  131.395 1.00 49.42 ? 307 THR B C     1 
ATOM   4650 O  O     . THR B 1 271 ? 41.362 28.531  132.143 1.00 48.59 ? 307 THR B O     1 
ATOM   4651 C  CB    . THR B 1 271 ? 38.820 28.178  129.714 1.00 45.81 ? 307 THR B CB    1 
ATOM   4652 O  OG1   . THR B 1 271 ? 38.510 26.778  129.720 1.00 48.15 ? 307 THR B OG1   1 
ATOM   4653 C  CG2   . THR B 1 271 ? 38.466 28.756  128.355 1.00 40.71 ? 307 THR B CG2   1 
ATOM   4654 N  N     . SER B 1 272 ? 40.086 26.717  131.741 1.00 51.39 ? 308 SER B N     1 
ATOM   4655 C  CA    . SER B 1 272 ? 40.317 26.108  133.046 1.00 50.98 ? 308 SER B CA    1 
ATOM   4656 C  C     . SER B 1 272 ? 41.638 25.345  133.098 1.00 46.82 ? 308 SER B C     1 
ATOM   4657 O  O     . SER B 1 272 ? 42.227 25.182  134.169 1.00 43.81 ? 308 SER B O     1 
ATOM   4658 C  CB    . SER B 1 272 ? 39.158 25.177  133.411 1.00 52.36 ? 308 SER B CB    1 
ATOM   4659 O  OG    . SER B 1 272 ? 37.962 25.915  133.608 1.00 59.50 ? 308 SER B OG    1 
ATOM   4660 N  N     . ARG B 1 287 ? 46.956 28.156  136.425 1.00 30.53 ? 323 ARG B N     1 
ATOM   4661 C  CA    . ARG B 1 287 ? 47.291 27.180  135.397 1.00 27.78 ? 323 ARG B CA    1 
ATOM   4662 C  C     . ARG B 1 287 ? 47.339 27.919  134.073 1.00 25.17 ? 323 ARG B C     1 
ATOM   4663 O  O     . ARG B 1 287 ? 48.337 27.848  133.364 1.00 18.73 ? 323 ARG B O     1 
ATOM   4664 C  CB    . ARG B 1 287 ? 46.262 26.048  135.354 1.00 37.19 ? 323 ARG B CB    1 
ATOM   4665 C  CG    . ARG B 1 287 ? 46.831 24.680  134.992 1.00 27.23 ? 323 ARG B CG    1 
ATOM   4666 C  CD    . ARG B 1 287 ? 48.286 24.576  135.413 1.00 35.82 ? 323 ARG B CD    1 
ATOM   4667 N  NE    . ARG B 1 287 ? 48.670 23.233  135.835 1.00 35.25 ? 323 ARG B NE    1 
ATOM   4668 C  CZ    . ARG B 1 287 ? 48.933 22.897  137.095 1.00 43.94 ? 323 ARG B CZ    1 
ATOM   4669 N  NH1   . ARG B 1 287 ? 48.865 23.809  138.053 1.00 44.50 ? 323 ARG B NH1   1 
ATOM   4670 N  NH2   . ARG B 1 287 ? 49.274 21.654  137.403 1.00 52.00 ? 323 ARG B NH2   1 
ATOM   4671 N  N     . TYR B 1 288 ? 46.273 28.655  133.764 1.00 23.28 ? 324 TYR B N     1 
ATOM   4672 C  CA    . TYR B 1 288 ? 46.215 29.442  132.538 1.00 22.75 ? 324 TYR B CA    1 
ATOM   4673 C  C     . TYR B 1 288 ? 45.805 30.888  132.803 1.00 23.02 ? 324 TYR B C     1 
ATOM   4674 O  O     . TYR B 1 288 ? 45.166 31.521  131.970 1.00 25.43 ? 324 TYR B O     1 
ATOM   4675 C  CB    . TYR B 1 288 ? 45.272 28.779  131.536 1.00 23.80 ? 324 TYR B CB    1 
ATOM   4676 C  CG    . TYR B 1 288 ? 45.631 27.337  131.283 1.00 31.00 ? 324 TYR B CG    1 
ATOM   4677 C  CD1   . TYR B 1 288 ? 46.686 27.003  130.445 1.00 25.75 ? 324 TYR B CD1   1 
ATOM   4678 C  CD2   . TYR B 1 288 ? 44.938 26.308  131.908 1.00 30.76 ? 324 TYR B CD2   1 
ATOM   4679 C  CE1   . TYR B 1 288 ? 47.032 25.673  130.219 1.00 25.82 ? 324 TYR B CE1   1 
ATOM   4680 C  CE2   . TYR B 1 288 ? 45.276 24.983  131.688 1.00 29.64 ? 324 TYR B CE2   1 
ATOM   4681 C  CZ    . TYR B 1 288 ? 46.325 24.675  130.845 1.00 30.84 ? 324 TYR B CZ    1 
ATOM   4682 O  OH    . TYR B 1 288 ? 46.661 23.362  130.621 1.00 34.56 ? 324 TYR B OH    1 
ATOM   4683 N  N     . ILE B 1 289 ? 46.193 31.399  133.968 1.00 21.74 ? 325 ILE B N     1 
ATOM   4684 C  CA    . ILE B 1 289 ? 45.917 32.784  134.344 1.00 24.38 ? 325 ILE B CA    1 
ATOM   4685 C  C     . ILE B 1 289 ? 46.694 33.734  133.424 1.00 25.21 ? 325 ILE B C     1 
ATOM   4686 O  O     . ILE B 1 289 ? 46.161 34.742  132.927 1.00 22.92 ? 325 ILE B O     1 
ATOM   4687 C  CB    . ILE B 1 289 ? 46.329 33.050  135.803 1.00 18.93 ? 325 ILE B CB    1 
ATOM   4688 C  CG1   . ILE B 1 289 ? 45.533 32.158  136.765 1.00 27.16 ? 325 ILE B CG1   1 
ATOM   4689 C  CG2   . ILE B 1 289 ? 46.125 34.502  136.157 1.00 24.34 ? 325 ILE B CG2   1 
ATOM   4690 C  CD1   . ILE B 1 289 ? 44.041 32.179  136.510 1.00 24.52 ? 325 ILE B CD1   1 
ATOM   4691 N  N     . LEU B 1 290 ? 47.968 33.416  133.225 1.00 21.47 ? 326 LEU B N     1 
ATOM   4692 C  CA    . LEU B 1 290 ? 48.764 34.050  132.181 1.00 19.95 ? 326 LEU B CA    1 
ATOM   4693 C  C     . LEU B 1 290 ? 49.090 32.933  131.199 1.00 20.44 ? 326 LEU B C     1 
ATOM   4694 O  O     . LEU B 1 290 ? 49.682 31.918  131.581 1.00 18.20 ? 326 LEU B O     1 
ATOM   4695 C  CB    . LEU B 1 290 ? 50.048 34.646  132.765 1.00 14.33 ? 326 LEU B CB    1 
ATOM   4696 C  CG    . LEU B 1 290 ? 50.992 35.352  131.784 1.00 14.40 ? 326 LEU B CG    1 
ATOM   4697 C  CD1   . LEU B 1 290 ? 50.248 36.479  131.031 1.00 15.89 ? 326 LEU B CD1   1 
ATOM   4698 C  CD2   . LEU B 1 290 ? 52.204 35.926  132.515 1.00 18.86 ? 326 LEU B CD2   1 
ATOM   4699 N  N     . ALA B 1 291 ? 48.678 33.095  129.946 1.00 17.17 ? 327 ALA B N     1 
ATOM   4700 C  CA    . ALA B 1 291 ? 48.850 32.036  128.962 1.00 17.08 ? 327 ALA B CA    1 
ATOM   4701 C  C     . ALA B 1 291 ? 49.943 32.398  127.964 1.00 16.51 ? 327 ALA B C     1 
ATOM   4702 O  O     . ALA B 1 291 ? 49.801 33.371  127.217 1.00 15.55 ? 327 ALA B O     1 
ATOM   4703 C  CB    . ALA B 1 291 ? 47.545 31.770  128.233 1.00 16.42 ? 327 ALA B CB    1 
ATOM   4704 N  N     . ILE B 1 292 ? 51.017 31.604  127.949 1.00 13.35 ? 328 ILE B N     1 
ATOM   4705 C  CA    . ILE B 1 292 ? 52.144 31.815  127.036 1.00 14.60 ? 328 ILE B CA    1 
ATOM   4706 C  C     . ILE B 1 292 ? 52.452 30.470  126.393 1.00 15.20 ? 328 ILE B C     1 
ATOM   4707 O  O     . ILE B 1 292 ? 53.022 29.591  127.030 1.00 12.42 ? 328 ILE B O     1 
ATOM   4708 C  CB    . ILE B 1 292 ? 53.413 32.320  127.772 1.00 15.53 ? 328 ILE B CB    1 
ATOM   4709 C  CG1   . ILE B 1 292 ? 53.156 33.663  128.474 1.00 12.55 ? 328 ILE B CG1   1 
ATOM   4710 C  CG2   . ILE B 1 292 ? 54.612 32.455  126.788 1.00 14.74 ? 328 ILE B CG2   1 
ATOM   4711 C  CD1   . ILE B 1 292 ? 54.277 34.092  129.414 1.00 12.35 ? 328 ILE B CD1   1 
ATOM   4712 N  N     . GLU B 1 293 ? 52.063 30.306  125.137 1.00 14.19 ? 329 GLU B N     1 
ATOM   4713 C  CA    . GLU B 1 293 ? 52.239 29.027  124.454 1.00 14.78 ? 329 GLU B CA    1 
ATOM   4714 C  C     . GLU B 1 293 ? 53.707 28.833  124.055 1.00 15.85 ? 329 GLU B C     1 
ATOM   4715 O  O     . GLU B 1 293 ? 54.288 29.687  123.374 1.00 15.38 ? 329 GLU B O     1 
ATOM   4716 C  CB    . GLU B 1 293 ? 51.348 29.011  123.213 1.00 17.93 ? 329 GLU B CB    1 
ATOM   4717 C  CG    . GLU B 1 293 ? 51.380 27.739  122.390 1.00 16.10 ? 329 GLU B CG    1 
ATOM   4718 C  CD    . GLU B 1 293 ? 50.592 27.903  121.118 1.00 19.24 ? 329 GLU B CD    1 
ATOM   4719 O  OE1   . GLU B 1 293 ? 49.546 27.231  120.987 1.00 17.78 ? 329 GLU B OE1   1 
ATOM   4720 O  OE2   . GLU B 1 293 ? 51.000 28.728  120.261 1.00 17.33 ? 329 GLU B OE2   1 
ATOM   4721 N  N     . ASP B 1 294 ? 54.328 27.735  124.492 1.00 12.99 ? 330 ASP B N     1 
ATOM   4722 C  CA    . ASP B 1 294 ? 55.704 27.473  124.074 1.00 11.06 ? 330 ASP B CA    1 
ATOM   4723 C  C     . ASP B 1 294 ? 55.701 27.346  122.563 1.00 12.76 ? 330 ASP B C     1 
ATOM   4724 O  O     . ASP B 1 294 ? 54.778 26.751  121.996 1.00 12.45 ? 330 ASP B O     1 
ATOM   4725 C  CB    . ASP B 1 294 ? 56.254 26.184  124.701 1.00 15.53 ? 330 ASP B CB    1 
ATOM   4726 C  CG    . ASP B 1 294 ? 57.731 26.003  124.436 1.00 17.44 ? 330 ASP B CG    1 
ATOM   4727 O  OD1   . ASP B 1 294 ? 58.539 26.501  125.252 1.00 17.60 ? 330 ASP B OD1   1 
ATOM   4728 O  OD2   . ASP B 1 294 ? 58.097 25.389  123.395 1.00 16.71 ? 330 ASP B OD2   1 
ATOM   4729 N  N     . PRO B 1 295 ? 56.719 27.915  121.896 1.00 12.24 ? 331 PRO B N     1 
ATOM   4730 C  CA    . PRO B 1 295 ? 56.703 27.899  120.431 1.00 13.60 ? 331 PRO B CA    1 
ATOM   4731 C  C     . PRO B 1 295 ? 56.734 26.494  119.844 1.00 16.58 ? 331 PRO B C     1 
ATOM   4732 O  O     . PRO B 1 295 ? 56.202 26.305  118.747 1.00 13.96 ? 331 PRO B O     1 
ATOM   4733 C  CB    . PRO B 1 295 ? 57.982 28.661  120.048 1.00 13.26 ? 331 PRO B CB    1 
ATOM   4734 C  CG    . PRO B 1 295 ? 58.826 28.671  121.289 1.00 16.02 ? 331 PRO B CG    1 
ATOM   4735 C  CD    . PRO B 1 295 ? 57.851 28.703  122.424 1.00 14.58 ? 331 PRO B CD    1 
ATOM   4736 N  N     . PHE B 1 296 ? 57.319 25.534  120.566 1.00 14.95 ? 332 PHE B N     1 
ATOM   4737 C  CA    . PHE B 1 296 ? 57.485 24.178  120.045 1.00 16.40 ? 332 PHE B CA    1 
ATOM   4738 C  C     . PHE B 1 296 ? 56.606 23.165  120.763 1.00 16.75 ? 332 PHE B C     1 
ATOM   4739 O  O     . PHE B 1 296 ? 55.847 22.418  120.132 1.00 13.90 ? 332 PHE B O     1 
ATOM   4740 C  CB    . PHE B 1 296 ? 58.960 23.759  120.139 1.00 14.75 ? 332 PHE B CB    1 
ATOM   4741 C  CG    . PHE B 1 296 ? 59.873 24.592  119.297 1.00 12.45 ? 332 PHE B CG    1 
ATOM   4742 C  CD1   . PHE B 1 296 ? 59.423 25.139  118.103 1.00 13.94 ? 332 PHE B CD1   1 
ATOM   4743 C  CD2   . PHE B 1 296 ? 61.182 24.830  119.687 1.00 12.85 ? 332 PHE B CD2   1 
ATOM   4744 C  CE1   . PHE B 1 296 ? 60.253 25.907  117.315 1.00 11.25 ? 332 PHE B CE1   1 
ATOM   4745 C  CE2   . PHE B 1 296 ? 62.024 25.608  118.898 1.00 12.73 ? 332 PHE B CE2   1 
ATOM   4746 C  CZ    . PHE B 1 296 ? 61.555 26.154  117.721 1.00 11.77 ? 332 PHE B CZ    1 
ATOM   4747 N  N     . GLU B 1 297 ? 56.716 23.129  122.087 1.00 14.85 ? 333 GLU B N     1 
ATOM   4748 C  CA    . GLU B 1 297 ? 55.890 22.220  122.882 1.00 16.46 ? 333 GLU B CA    1 
ATOM   4749 C  C     . GLU B 1 297 ? 54.577 22.922  123.197 1.00 17.10 ? 333 GLU B C     1 
ATOM   4750 O  O     . GLU B 1 297 ? 54.415 23.502  124.271 1.00 16.93 ? 333 GLU B O     1 
ATOM   4751 C  CB    . GLU B 1 297 ? 56.596 21.825  124.179 1.00 16.55 ? 333 GLU B CB    1 
ATOM   4752 C  CG    . GLU B 1 297 ? 55.835 20.749  124.950 1.00 24.14 ? 333 GLU B CG    1 
ATOM   4753 C  CD    . GLU B 1 297 ? 56.476 20.372  126.273 1.00 23.42 ? 333 GLU B CD    1 
ATOM   4754 O  OE1   . GLU B 1 297 ? 57.607 20.823  126.555 1.00 23.82 ? 333 GLU B OE1   1 
ATOM   4755 O  OE2   . GLU B 1 297 ? 55.832 19.619  127.039 1.00 24.29 ? 333 GLU B OE2   1 
ATOM   4756 N  N     . ILE B 1 298 ? 53.644 22.875  122.248 1.00 19.46 ? 334 ILE B N     1 
ATOM   4757 C  CA    . ILE B 1 298 ? 52.518 23.801  122.250 1.00 21.20 ? 334 ILE B CA    1 
ATOM   4758 C  C     . ILE B 1 298 ? 51.452 23.474  123.292 1.00 19.01 ? 334 ILE B C     1 
ATOM   4759 O  O     . ILE B 1 298 ? 50.595 24.297  123.576 1.00 17.30 ? 334 ILE B O     1 
ATOM   4760 C  CB    . ILE B 1 298 ? 51.902 23.918  120.854 1.00 21.47 ? 334 ILE B CB    1 
ATOM   4761 C  CG1   . ILE B 1 298 ? 51.217 22.610  120.457 1.00 25.13 ? 334 ILE B CG1   1 
ATOM   4762 C  CG2   . ILE B 1 298 ? 52.988 24.294  119.851 1.00 22.51 ? 334 ILE B CG2   1 
ATOM   4763 C  CD1   . ILE B 1 298 ? 50.334 22.732  119.230 1.00 31.01 ? 334 ILE B CD1   1 
ATOM   4764 N  N     . SER B 1 299 ? 51.524 22.285  123.881 1.00 17.97 ? 335 SER B N     1 
ATOM   4765 C  CA    . SER B 1 299 ? 50.591 21.900  124.936 1.00 17.39 ? 335 SER B CA    1 
ATOM   4766 C  C     . SER B 1 299 ? 51.077 22.408  126.294 1.00 21.38 ? 335 SER B C     1 
ATOM   4767 O  O     . SER B 1 299 ? 50.418 22.224  127.317 1.00 24.12 ? 335 SER B O     1 
ATOM   4768 C  CB    . SER B 1 299 ? 50.433 20.379  124.969 1.00 19.78 ? 335 SER B CB    1 
ATOM   4769 O  OG    . SER B 1 299 ? 51.701 19.758  125.019 1.00 14.89 ? 335 SER B OG    1 
ATOM   4770 N  N     . HIS B 1 300 ? 52.241 23.051  126.301 1.00 17.91 ? 336 HIS B N     1 
ATOM   4771 C  CA    . HIS B 1 300 ? 52.831 23.530  127.540 1.00 14.91 ? 336 HIS B CA    1 
ATOM   4772 C  C     . HIS B 1 300 ? 52.634 25.032  127.672 1.00 14.31 ? 336 HIS B C     1 
ATOM   4773 O  O     . HIS B 1 300 ? 53.104 25.792  126.826 1.00 14.01 ? 336 HIS B O     1 
ATOM   4774 C  CB    . HIS B 1 300 ? 54.321 23.205  127.571 1.00 16.74 ? 336 HIS B CB    1 
ATOM   4775 C  CG    . HIS B 1 300 ? 55.055 23.832  128.717 1.00 17.69 ? 336 HIS B CG    1 
ATOM   4776 N  ND1   . HIS B 1 300 ? 54.586 23.793  130.011 1.00 22.01 ? 336 HIS B ND1   1 
ATOM   4777 C  CD2   . HIS B 1 300 ? 56.238 24.492  128.762 1.00 17.06 ? 336 HIS B CD2   1 
ATOM   4778 C  CE1   . HIS B 1 300 ? 55.443 24.414  130.807 1.00 18.37 ? 336 HIS B CE1   1 
ATOM   4779 N  NE2   . HIS B 1 300 ? 56.455 24.842  130.075 1.00 23.42 ? 336 HIS B NE2   1 
ATOM   4780 N  N     . ASN B 1 301 ? 51.928 25.452  128.722 1.00 12.09 ? 337 ASN B N     1 
ATOM   4781 C  CA    . ASN B 1 301 ? 51.805 26.875  129.039 1.00 16.05 ? 337 ASN B CA    1 
ATOM   4782 C  C     . ASN B 1 301 ? 53.003 27.280  129.882 1.00 13.89 ? 337 ASN B C     1 
ATOM   4783 O  O     . ASN B 1 301 ? 53.114 26.886  131.042 1.00 16.12 ? 337 ASN B O     1 
ATOM   4784 C  CB    . ASN B 1 301 ? 50.502 27.176  129.800 1.00 15.68 ? 337 ASN B CB    1 
ATOM   4785 C  CG    . ASN B 1 301 ? 50.422 28.628  130.285 1.00 17.84 ? 337 ASN B CG    1 
ATOM   4786 O  OD1   . ASN B 1 301 ? 51.104 29.511  129.758 1.00 16.65 ? 337 ASN B OD1   1 
ATOM   4787 N  ND2   . ASN B 1 301 ? 49.593 28.875  131.307 1.00 15.24 ? 337 ASN B ND2   1 
ATOM   4788 N  N     . VAL B 1 302 ? 53.898 28.078  129.310 1.00 10.66 ? 338 VAL B N     1 
ATOM   4789 C  CA    . VAL B 1 302 ? 55.079 28.518  130.042 1.00 14.05 ? 338 VAL B CA    1 
ATOM   4790 C  C     . VAL B 1 302 ? 54.656 29.327  131.270 1.00 12.85 ? 338 VAL B C     1 
ATOM   4791 O  O     . VAL B 1 302 ? 55.358 29.362  132.281 1.00 13.38 ? 338 VAL B O     1 
ATOM   4792 C  CB    . VAL B 1 302 ? 56.024 29.326  129.117 1.00 14.00 ? 338 VAL B CB    1 
ATOM   4793 C  CG1   . VAL B 1 302 ? 57.255 29.844  129.878 1.00 11.80 ? 338 VAL B CG1   1 
ATOM   4794 C  CG2   . VAL B 1 302 ? 56.465 28.439  127.948 1.00 14.38 ? 338 VAL B CG2   1 
ATOM   4795 N  N     . GLY B 1 303 ? 53.497 29.972  131.182 1.00 14.50 ? 339 GLY B N     1 
ATOM   4796 C  CA    . GLY B 1 303 ? 53.002 30.749  132.309 1.00 15.99 ? 339 GLY B CA    1 
ATOM   4797 C  C     . GLY B 1 303 ? 52.172 29.933  133.284 1.00 17.82 ? 339 GLY B C     1 
ATOM   4798 O  O     . GLY B 1 303 ? 51.443 30.508  134.095 1.00 17.94 ? 339 GLY B O     1 
ATOM   4799 N  N     . ARG B 1 304 ? 52.286 28.603  133.229 1.00 16.19 ? 340 ARG B N     1 
ATOM   4800 C  CA    . ARG B 1 304 ? 51.456 27.727  134.078 1.00 21.04 ? 340 ARG B CA    1 
ATOM   4801 C  C     . ARG B 1 304 ? 51.656 27.949  135.580 1.00 21.60 ? 340 ARG B C     1 
ATOM   4802 O  O     . ARG B 1 304 ? 50.798 27.577  136.393 1.00 20.91 ? 340 ARG B O     1 
ATOM   4803 C  CB    . ARG B 1 304 ? 51.696 26.244  133.746 1.00 20.11 ? 340 ARG B CB    1 
ATOM   4804 C  CG    . ARG B 1 304 ? 53.131 25.776  134.015 1.00 21.40 ? 340 ARG B CG    1 
ATOM   4805 C  CD    . ARG B 1 304 ? 53.226 24.244  134.201 1.00 32.14 ? 340 ARG B CD    1 
ATOM   4806 N  NE    . ARG B 1 304 ? 53.026 23.871  135.605 1.00 37.21 ? 340 ARG B NE    1 
ATOM   4807 C  CZ    . ARG B 1 304 ? 53.974 23.931  136.542 1.00 32.83 ? 340 ARG B CZ    1 
ATOM   4808 N  NH1   . ARG B 1 304 ? 55.204 24.336  136.235 1.00 33.80 ? 340 ARG B NH1   1 
ATOM   4809 N  NH2   . ARG B 1 304 ? 53.696 23.583  137.792 1.00 40.74 ? 340 ARG B NH2   1 
ATOM   4810 N  N     . THR B 1 305 ? 52.788 28.545  135.941 1.00 17.34 ? 341 THR B N     1 
ATOM   4811 C  CA    . THR B 1 305 ? 53.128 28.806  137.339 1.00 20.34 ? 341 THR B CA    1 
ATOM   4812 C  C     . THR B 1 305 ? 52.479 30.070  137.903 1.00 22.29 ? 341 THR B C     1 
ATOM   4813 O  O     . THR B 1 305 ? 52.526 30.312  139.115 1.00 19.97 ? 341 THR B O     1 
ATOM   4814 C  CB    . THR B 1 305 ? 54.649 28.946  137.514 1.00 22.55 ? 341 THR B CB    1 
ATOM   4815 O  OG1   . THR B 1 305 ? 55.127 30.003  136.673 1.00 19.80 ? 341 THR B OG1   1 
ATOM   4816 C  CG2   . THR B 1 305 ? 55.365 27.644  137.134 1.00 23.20 ? 341 THR B CG2   1 
ATOM   4817 N  N     . VAL B 1 306 ? 51.888 30.885  137.034 1.00 19.15 ? 342 VAL B N     1 
ATOM   4818 C  CA    . VAL B 1 306 ? 51.408 32.191  137.469 1.00 15.98 ? 342 VAL B CA    1 
ATOM   4819 C  C     . VAL B 1 306 ? 50.023 32.102  138.126 1.00 17.37 ? 342 VAL B C     1 
ATOM   4820 O  O     . VAL B 1 306 ? 49.058 31.619  137.519 1.00 19.26 ? 342 VAL B O     1 
ATOM   4821 C  CB    . VAL B 1 306 ? 51.376 33.206  136.316 1.00 16.86 ? 342 VAL B CB    1 
ATOM   4822 C  CG1   . VAL B 1 306 ? 50.775 34.517  136.799 1.00 18.24 ? 342 VAL B CG1   1 
ATOM   4823 C  CG2   . VAL B 1 306 ? 52.792 33.433  135.777 1.00 13.67 ? 342 VAL B CG2   1 
ATOM   4824 N  N     . SER B 1 307 ? 49.942 32.568  139.368 1.00 18.48 ? 343 SER B N     1 
ATOM   4825 C  CA    . SER B 1 307 ? 48.686 32.576  140.108 1.00 22.37 ? 343 SER B CA    1 
ATOM   4826 C  C     . SER B 1 307 ? 47.928 33.881  139.867 1.00 22.94 ? 343 SER B C     1 
ATOM   4827 O  O     . SER B 1 307 ? 48.422 34.785  139.186 1.00 16.85 ? 343 SER B O     1 
ATOM   4828 C  CB    . SER B 1 307 ? 48.966 32.420  141.600 1.00 19.68 ? 343 SER B CB    1 
ATOM   4829 O  OG    . SER B 1 307 ? 49.779 33.473  142.063 1.00 21.81 ? 343 SER B OG    1 
ATOM   4830 N  N     . SER B 1 308 ? 46.725 33.987  140.419 1.00 19.90 ? 344 SER B N     1 
ATOM   4831 C  CA    . SER B 1 308 ? 45.988 35.242  140.365 1.00 22.87 ? 344 SER B CA    1 
ATOM   4832 C  C     . SER B 1 308 ? 46.790 36.360  141.015 1.00 22.93 ? 344 SER B C     1 
ATOM   4833 O  O     . SER B 1 308 ? 46.940 37.445  140.442 1.00 24.37 ? 344 SER B O     1 
ATOM   4834 C  CB    . SER B 1 308 ? 44.631 35.103  141.059 1.00 25.88 ? 344 SER B CB    1 
ATOM   4835 O  OG    . SER B 1 308 ? 43.687 34.535  140.178 1.00 36.28 ? 344 SER B OG    1 
ATOM   4836 N  N     . SER B 1 309 ? 47.315 36.099  142.209 1.00 21.83 ? 345 SER B N     1 
ATOM   4837 C  CA    . SER B 1 309 ? 48.072 37.130  142.928 1.00 23.00 ? 345 SER B CA    1 
ATOM   4838 C  C     . SER B 1 309 ? 49.388 37.474  142.241 1.00 22.83 ? 345 SER B C     1 
ATOM   4839 O  O     . SER B 1 309 ? 49.819 38.630  142.250 1.00 20.59 ? 345 SER B O     1 
ATOM   4840 C  CB    . SER B 1 309 ? 48.339 36.697  144.368 1.00 27.12 ? 345 SER B CB    1 
ATOM   4841 O  OG    . SER B 1 309 ? 47.116 36.513  145.051 1.00 33.99 ? 345 SER B OG    1 
ATOM   4842 N  N     . GLY B 1 310 ? 50.033 36.463  141.667 1.00 19.09 ? 346 GLY B N     1 
ATOM   4843 C  CA    . GLY B 1 310 ? 51.249 36.682  140.905 1.00 19.19 ? 346 GLY B CA    1 
ATOM   4844 C  C     . GLY B 1 310 ? 50.995 37.577  139.706 1.00 17.82 ? 346 GLY B C     1 
ATOM   4845 O  O     . GLY B 1 310 ? 51.784 38.495  139.421 1.00 17.91 ? 346 GLY B O     1 
ATOM   4846 N  N     . LEU B 1 311 ? 49.903 37.317  138.992 1.00 14.86 ? 347 LEU B N     1 
ATOM   4847 C  CA    . LEU B 1 311 ? 49.580 38.132  137.824 1.00 16.55 ? 347 LEU B CA    1 
ATOM   4848 C  C     . LEU B 1 311 ? 49.271 39.560  138.243 1.00 20.68 ? 347 LEU B C     1 
ATOM   4849 O  O     . LEU B 1 311 ? 49.633 40.500  137.547 1.00 16.91 ? 347 LEU B O     1 
ATOM   4850 C  CB    . LEU B 1 311 ? 48.419 37.551  137.025 1.00 17.51 ? 347 LEU B CB    1 
ATOM   4851 C  CG    . LEU B 1 311 ? 48.073 38.364  135.772 1.00 24.89 ? 347 LEU B CG    1 
ATOM   4852 C  CD1   . LEU B 1 311 ? 49.263 38.415  134.810 1.00 19.95 ? 347 LEU B CD1   1 
ATOM   4853 C  CD2   . LEU B 1 311 ? 46.846 37.827  135.060 1.00 21.87 ? 347 LEU B CD2   1 
ATOM   4854 N  N     . TYR B 1 312 ? 48.611 39.735  139.385 1.00 17.97 ? 348 TYR B N     1 
ATOM   4855 C  CA    A TYR B 1 312 ? 48.308 41.076  139.873 0.55 19.88 ? 348 TYR B CA    1 
ATOM   4856 C  CA    B TYR B 1 312 ? 48.309 41.077  139.860 0.45 19.88 ? 348 TYR B CA    1 
ATOM   4857 C  C     . TYR B 1 312 ? 49.597 41.838  140.140 1.00 16.36 ? 348 TYR B C     1 
ATOM   4858 O  O     . TYR B 1 312 ? 49.688 43.037  139.891 1.00 18.96 ? 348 TYR B O     1 
ATOM   4859 C  CB    A TYR B 1 312 ? 47.451 41.023  141.146 0.55 20.89 ? 348 TYR B CB    1 
ATOM   4860 C  CB    B TYR B 1 312 ? 47.432 41.041  141.114 0.45 20.91 ? 348 TYR B CB    1 
ATOM   4861 C  CG    A TYR B 1 312 ? 46.094 40.384  140.955 0.55 21.89 ? 348 TYR B CG    1 
ATOM   4862 C  CG    B TYR B 1 312 ? 46.997 42.413  141.573 0.45 22.76 ? 348 TYR B CG    1 
ATOM   4863 C  CD1   A TYR B 1 312 ? 45.518 40.283  139.694 0.55 23.64 ? 348 TYR B CD1   1 
ATOM   4864 C  CD1   B TYR B 1 312 ? 45.779 42.945  141.176 0.45 26.77 ? 348 TYR B CD1   1 
ATOM   4865 C  CD2   A TYR B 1 312 ? 45.388 39.879  142.041 0.55 23.36 ? 348 TYR B CD2   1 
ATOM   4866 C  CD2   B TYR B 1 312 ? 47.805 43.182  142.405 0.45 25.85 ? 348 TYR B CD2   1 
ATOM   4867 C  CE1   A TYR B 1 312 ? 44.282 39.697  139.523 0.55 24.82 ? 348 TYR B CE1   1 
ATOM   4868 C  CE1   B TYR B 1 312 ? 45.381 44.200  141.598 0.45 27.58 ? 348 TYR B CE1   1 
ATOM   4869 C  CE2   A TYR B 1 312 ? 44.146 39.296  141.879 0.55 21.58 ? 348 TYR B CE2   1 
ATOM   4870 C  CE2   B TYR B 1 312 ? 47.408 44.437  142.826 0.45 25.07 ? 348 TYR B CE2   1 
ATOM   4871 C  CZ    A TYR B 1 312 ? 43.600 39.208  140.623 0.55 23.52 ? 348 TYR B CZ    1 
ATOM   4872 C  CZ    B TYR B 1 312 ? 46.198 44.940  142.412 0.45 27.44 ? 348 TYR B CZ    1 
ATOM   4873 O  OH    A TYR B 1 312 ? 42.372 38.623  140.458 0.55 23.99 ? 348 TYR B OH    1 
ATOM   4874 O  OH    B TYR B 1 312 ? 45.787 46.186  142.822 0.45 31.36 ? 348 TYR B OH    1 
ATOM   4875 N  N     . ARG B 1 313 ? 50.595 41.133  140.655 1.00 18.25 ? 349 ARG B N     1 
ATOM   4876 C  CA    . ARG B 1 313 ? 51.887 41.734  140.949 1.00 18.98 ? 349 ARG B CA    1 
ATOM   4877 C  C     . ARG B 1 313 ? 52.631 42.074  139.643 1.00 18.65 ? 349 ARG B C     1 
ATOM   4878 O  O     . ARG B 1 313 ? 53.169 43.179  139.473 1.00 16.66 ? 349 ARG B O     1 
ATOM   4879 C  CB    . ARG B 1 313 ? 52.701 40.743  141.785 1.00 20.45 ? 349 ARG B CB    1 
ATOM   4880 C  CG    . ARG B 1 313 ? 53.986 41.295  142.377 1.00 31.95 ? 349 ARG B CG    1 
ATOM   4881 C  CD    . ARG B 1 313 ? 54.514 40.354  143.452 1.00 36.47 ? 349 ARG B CD    1 
ATOM   4882 N  NE    . ARG B 1 313 ? 53.470 40.061  144.428 1.00 34.92 ? 349 ARG B NE    1 
ATOM   4883 C  CZ    . ARG B 1 313 ? 53.021 38.842  144.711 1.00 42.54 ? 349 ARG B CZ    1 
ATOM   4884 N  NH1   . ARG B 1 313 ? 53.546 37.774  144.116 1.00 42.72 ? 349 ARG B NH1   1 
ATOM   4885 N  NH2   . ARG B 1 313 ? 52.053 38.690  145.611 1.00 44.06 ? 349 ARG B NH2   1 
ATOM   4886 N  N     . ILE B 1 314 ? 52.638 41.119  138.720 1.00 17.40 ? 350 ILE B N     1 
ATOM   4887 C  CA    . ILE B 1 314 ? 53.297 41.295  137.424 1.00 14.98 ? 350 ILE B CA    1 
ATOM   4888 C  C     . ILE B 1 314 ? 52.684 42.484  136.684 1.00 14.71 ? 350 ILE B C     1 
ATOM   4889 O  O     . ILE B 1 314 ? 53.399 43.403  136.258 1.00 18.22 ? 350 ILE B O     1 
ATOM   4890 C  CB    . ILE B 1 314 ? 53.192 40.009  136.591 1.00 16.02 ? 350 ILE B CB    1 
ATOM   4891 C  CG1   . ILE B 1 314 ? 54.075 38.923  137.212 1.00 13.46 ? 350 ILE B CG1   1 
ATOM   4892 C  CG2   . ILE B 1 314 ? 53.605 40.267  135.139 1.00 15.81 ? 350 ILE B CG2   1 
ATOM   4893 C  CD1   . ILE B 1 314 ? 53.707 37.487  136.784 1.00 15.29 ? 350 ILE B CD1   1 
ATOM   4894 N  N     . ARG B 1 315 ? 51.364 42.485  136.546 1.00 15.81 ? 351 ARG B N     1 
ATOM   4895 C  CA    . ARG B 1 315 ? 50.678 43.603  135.894 1.00 20.05 ? 351 ARG B CA    1 
ATOM   4896 C  C     . ARG B 1 315 ? 50.918 44.933  136.608 1.00 20.73 ? 351 ARG B C     1 
ATOM   4897 O  O     . ARG B 1 315 ? 51.066 45.975  135.955 1.00 18.78 ? 351 ARG B O     1 
ATOM   4898 C  CB    . ARG B 1 315 ? 49.179 43.340  135.808 1.00 17.10 ? 351 ARG B CB    1 
ATOM   4899 C  CG    . ARG B 1 315 ? 48.794 42.267  134.823 1.00 24.00 ? 351 ARG B CG    1 
ATOM   4900 C  CD    . ARG B 1 315 ? 48.627 42.827  133.417 1.00 33.56 ? 351 ARG B CD    1 
ATOM   4901 N  NE    . ARG B 1 315 ? 47.318 43.451  133.204 1.00 37.90 ? 351 ARG B NE    1 
ATOM   4902 C  CZ    . ARG B 1 315 ? 46.840 43.785  132.005 1.00 36.92 ? 351 ARG B CZ    1 
ATOM   4903 N  NH1   . ARG B 1 315 ? 45.641 44.347  131.889 1.00 36.01 ? 351 ARG B NH1   1 
ATOM   4904 N  NH2   . ARG B 1 315 ? 47.566 43.554  130.912 1.00 28.61 ? 351 ARG B NH2   1 
ATOM   4905 N  N     . GLY B 1 316 ? 50.953 44.905  137.938 1.00 20.34 ? 352 GLY B N     1 
ATOM   4906 C  CA    . GLY B 1 316 ? 51.227 46.115  138.704 1.00 18.38 ? 352 GLY B CA    1 
ATOM   4907 C  C     . GLY B 1 316 ? 52.608 46.682  138.421 1.00 21.54 ? 352 GLY B C     1 
ATOM   4908 O  O     . GLY B 1 316 ? 52.783 47.905  138.341 1.00 16.26 ? 352 GLY B O     1 
ATOM   4909 N  N     . GLU B 1 317 ? 53.597 45.801  138.265 1.00 15.82 ? 353 GLU B N     1 
ATOM   4910 C  CA    . GLU B 1 317 ? 54.944 46.256  137.940 1.00 17.46 ? 353 GLU B CA    1 
ATOM   4911 C  C     . GLU B 1 317 ? 55.066 46.769  136.511 1.00 14.85 ? 353 GLU B C     1 
ATOM   4912 O  O     . GLU B 1 317 ? 55.818 47.714  136.255 1.00 18.54 ? 353 GLU B O     1 
ATOM   4913 C  CB    . GLU B 1 317 ? 55.983 45.167  138.212 1.00 18.28 ? 353 GLU B CB    1 
ATOM   4914 C  CG    . GLU B 1 317 ? 56.130 44.805  139.689 1.00 20.83 ? 353 GLU B CG    1 
ATOM   4915 C  CD    . GLU B 1 317 ? 56.689 45.931  140.553 1.00 25.17 ? 353 GLU B CD    1 
ATOM   4916 O  OE1   . GLU B 1 317 ? 57.234 46.935  140.027 1.00 24.06 ? 353 GLU B OE1   1 
ATOM   4917 O  OE2   . GLU B 1 317 ? 56.598 45.797  141.791 1.00 26.15 ? 353 GLU B OE2   1 
ATOM   4918 N  N     . PHE B 1 318 ? 54.333 46.163  135.580 1.00 13.59 ? 354 PHE B N     1 
ATOM   4919 C  CA    . PHE B 1 318 ? 54.329 46.677  134.210 1.00 16.31 ? 354 PHE B CA    1 
ATOM   4920 C  C     . PHE B 1 318 ? 53.754 48.089  134.212 1.00 18.32 ? 354 PHE B C     1 
ATOM   4921 O  O     . PHE B 1 318 ? 54.280 48.981  133.552 1.00 13.35 ? 354 PHE B O     1 
ATOM   4922 C  CB    . PHE B 1 318 ? 53.518 45.769  133.265 1.00 14.72 ? 354 PHE B CB    1 
ATOM   4923 C  CG    . PHE B 1 318 ? 54.324 44.636  132.667 1.00 14.55 ? 354 PHE B CG    1 
ATOM   4924 C  CD1   . PHE B 1 318 ? 55.279 44.898  131.690 1.00 15.79 ? 354 PHE B CD1   1 
ATOM   4925 C  CD2   . PHE B 1 318 ? 54.131 43.322  133.085 1.00 13.14 ? 354 PHE B CD2   1 
ATOM   4926 C  CE1   . PHE B 1 318 ? 56.039 43.874  131.133 1.00 13.32 ? 354 PHE B CE1   1 
ATOM   4927 C  CE2   . PHE B 1 318 ? 54.883 42.278  132.531 1.00 13.06 ? 354 PHE B CE2   1 
ATOM   4928 C  CZ    . PHE B 1 318 ? 55.833 42.551  131.553 1.00 10.80 ? 354 PHE B CZ    1 
ATOM   4929 N  N     . MET B 1 319 ? 52.666 48.287  134.952 1.00 16.51 ? 355 MET B N     1 
ATOM   4930 C  CA    . MET B 1 319 ? 52.025 49.605  135.000 1.00 16.92 ? 355 MET B CA    1 
ATOM   4931 C  C     . MET B 1 319 ? 52.919 50.630  135.690 1.00 16.28 ? 355 MET B C     1 
ATOM   4932 O  O     . MET B 1 319 ? 52.996 51.794  135.259 1.00 23.07 ? 355 MET B O     1 
ATOM   4933 C  CB    . MET B 1 319 ? 50.645 49.522  135.678 1.00 17.64 ? 355 MET B CB    1 
ATOM   4934 C  CG    . MET B 1 319 ? 49.591 48.768  134.883 1.00 18.82 ? 355 MET B CG    1 
ATOM   4935 S  SD    . MET B 1 319 ? 48.024 48.655  135.776 1.00 26.10 ? 355 MET B SD    1 
ATOM   4936 C  CE    . MET B 1 319 ? 47.086 47.585  134.675 1.00 27.81 ? 355 MET B CE    1 
ATOM   4937 N  N     . ALA B 1 320 ? 53.607 50.209  136.748 1.00 18.09 ? 356 ALA B N     1 
ATOM   4938 C  CA    . ALA B 1 320 ? 54.517 51.111  137.467 1.00 18.62 ? 356 ALA B CA    1 
ATOM   4939 C  C     . ALA B 1 320 ? 55.651 51.563  136.549 1.00 23.81 ? 356 ALA B C     1 
ATOM   4940 O  O     . ALA B 1 320 ? 56.077 52.730  136.571 1.00 16.78 ? 356 ALA B O     1 
ATOM   4941 C  CB    . ALA B 1 320 ? 55.083 50.429  138.704 1.00 19.05 ? 356 ALA B CB    1 
ATOM   4942 N  N     . ALA B 1 321 ? 56.151 50.625  135.749 1.00 16.53 ? 357 ALA B N     1 
ATOM   4943 C  CA    . ALA B 1 321 ? 57.219 50.920  134.803 1.00 15.75 ? 357 ALA B CA    1 
ATOM   4944 C  C     . ALA B 1 321 ? 56.729 51.898  133.744 1.00 17.43 ? 357 ALA B C     1 
ATOM   4945 O  O     . ALA B 1 321 ? 57.436 52.849  133.391 1.00 20.74 ? 357 ALA B O     1 
ATOM   4946 C  CB    . ALA B 1 321 ? 57.730 49.601  134.149 1.00 14.96 ? 357 ALA B CB    1 
ATOM   4947 N  N     . SER B 1 322 ? 55.519 51.668  133.238 1.00 16.40 ? 358 SER B N     1 
ATOM   4948 C  CA    . SER B 1 322 ? 54.955 52.528  132.208 1.00 20.09 ? 358 SER B CA    1 
ATOM   4949 C  C     . SER B 1 322 ? 54.753 53.949  132.729 1.00 25.16 ? 358 SER B C     1 
ATOM   4950 O  O     . SER B 1 322 ? 55.075 54.924  132.030 1.00 21.45 ? 358 SER B O     1 
ATOM   4951 C  CB    . SER B 1 322 ? 53.646 51.957  131.676 1.00 22.45 ? 358 SER B CB    1 
ATOM   4952 O  OG    . SER B 1 322 ? 53.871 50.701  131.066 1.00 22.92 ? 358 SER B OG    1 
ATOM   4953 N  N     . ARG B 1 323 ? 54.234 54.061  133.952 1.00 22.20 ? 359 ARG B N     1 
ATOM   4954 C  CA    . ARG B 1 323 ? 54.037 55.368  134.588 1.00 23.51 ? 359 ARG B CA    1 
ATOM   4955 C  C     . ARG B 1 323 ? 55.349 56.111  134.685 1.00 22.52 ? 359 ARG B C     1 
ATOM   4956 O  O     . ARG B 1 323 ? 55.410 57.304  134.409 1.00 23.91 ? 359 ARG B O     1 
ATOM   4957 C  CB    . ARG B 1 323 ? 53.471 55.220  136.012 1.00 20.15 ? 359 ARG B CB    1 
ATOM   4958 C  CG    . ARG B 1 323 ? 51.978 54.974  136.121 1.00 23.79 ? 359 ARG B CG    1 
ATOM   4959 C  CD    . ARG B 1 323 ? 51.548 54.887  137.602 1.00 24.82 ? 359 ARG B CD    1 
ATOM   4960 N  NE    . ARG B 1 323 ? 50.739 53.696  137.844 1.00 33.88 ? 359 ARG B NE    1 
ATOM   4961 C  CZ    . ARG B 1 323 ? 51.059 52.697  138.662 1.00 23.81 ? 359 ARG B CZ    1 
ATOM   4962 N  NH1   . ARG B 1 323 ? 52.177 52.715  139.387 1.00 25.49 ? 359 ARG B NH1   1 
ATOM   4963 N  NH2   . ARG B 1 323 ? 50.229 51.674  138.770 1.00 38.81 ? 359 ARG B NH2   1 
ATOM   4964 N  N     . LEU B 1 324 ? 56.393 55.400  135.102 1.00 20.94 ? 360 LEU B N     1 
ATOM   4965 C  CA    . LEU B 1 324 ? 57.704 56.007  135.298 1.00 26.06 ? 360 LEU B CA    1 
ATOM   4966 C  C     . LEU B 1 324 ? 58.233 56.597  133.999 1.00 29.08 ? 360 LEU B C     1 
ATOM   4967 O  O     . LEU B 1 324 ? 58.747 57.712  133.983 1.00 29.97 ? 360 LEU B O     1 
ATOM   4968 C  CB    . LEU B 1 324 ? 58.708 54.983  135.849 1.00 27.30 ? 360 LEU B CB    1 
ATOM   4969 C  CG    . LEU B 1 324 ? 60.178 55.429  135.897 1.00 24.46 ? 360 LEU B CG    1 
ATOM   4970 C  CD1   . LEU B 1 324 ? 60.361 56.617  136.848 1.00 27.27 ? 360 LEU B CD1   1 
ATOM   4971 C  CD2   . LEU B 1 324 ? 61.110 54.290  136.285 1.00 29.88 ? 360 LEU B CD2   1 
ATOM   4972 N  N     . LEU B 1 325 ? 58.090 55.853  132.906 1.00 25.66 ? 361 LEU B N     1 
ATOM   4973 C  CA    . LEU B 1 325 ? 58.636 56.285  131.618 1.00 24.66 ? 361 LEU B CA    1 
ATOM   4974 C  C     . LEU B 1 325 ? 57.790 57.370  130.925 1.00 28.87 ? 361 LEU B C     1 
ATOM   4975 O  O     . LEU B 1 325 ? 58.314 58.145  130.116 1.00 28.22 ? 361 LEU B O     1 
ATOM   4976 C  CB    . LEU B 1 325 ? 58.872 55.070  130.701 1.00 23.12 ? 361 LEU B CB    1 
ATOM   4977 C  CG    . LEU B 1 325 ? 59.840 54.040  131.299 1.00 20.68 ? 361 LEU B CG    1 
ATOM   4978 C  CD1   . LEU B 1 325 ? 59.930 52.725  130.470 1.00 19.64 ? 361 LEU B CD1   1 
ATOM   4979 C  CD2   . LEU B 1 325 ? 61.222 54.651  131.484 1.00 19.39 ? 361 LEU B CD2   1 
ATOM   4980 N  N     . ASN B 1 326 ? 56.494 57.431  131.241 1.00 27.78 ? 362 ASN B N     1 
ATOM   4981 C  CA    . ASN B 1 326 ? 55.621 58.487  130.708 1.00 30.00 ? 362 ASN B CA    1 
ATOM   4982 C  C     . ASN B 1 326 ? 55.532 59.676  131.655 1.00 32.94 ? 362 ASN B C     1 
ATOM   4983 O  O     . ASN B 1 326 ? 54.631 60.515  131.538 1.00 30.81 ? 362 ASN B O     1 
ATOM   4984 C  CB    . ASN B 1 326 ? 54.211 57.963  130.411 1.00 30.73 ? 362 ASN B CB    1 
ATOM   4985 C  CG    . ASN B 1 326 ? 53.930 57.821  128.909 1.00 40.57 ? 362 ASN B CG    1 
ATOM   4986 O  OD1   . ASN B 1 326 ? 54.849 57.657  128.095 1.00 33.65 ? 362 ASN B OD1   1 
ATOM   4987 N  ND2   . ASN B 1 326 ? 52.647 57.884  128.540 1.00 39.66 ? 362 ASN B ND2   1 
ATOM   4988 N  N     . SER B 1 327 ? 56.476 59.745  132.586 1.00 30.23 ? 363 SER B N     1 
ATOM   4989 C  CA    . SER B 1 327 ? 56.494 60.789  133.606 1.00 34.96 ? 363 SER B CA    1 
ATOM   4990 C  C     . SER B 1 327 ? 56.555 62.203  133.016 1.00 32.73 ? 363 SER B C     1 
ATOM   4991 O  O     . SER B 1 327 ? 57.154 62.418  131.962 1.00 31.34 ? 363 SER B O     1 
ATOM   4992 C  CB    . SER B 1 327 ? 57.677 60.563  134.550 1.00 32.25 ? 363 SER B CB    1 
ATOM   4993 O  OG    . SER B 1 327 ? 57.893 61.692  135.375 1.00 42.17 ? 363 SER B OG    1 
ATOM   4994 N  N     . ARG B 1 328 ? 55.912 63.158  133.686 1.00 30.99 ? 364 ARG B N     1 
ATOM   4995 C  CA    . ARG B 1 328 ? 55.999 64.560  133.280 1.00 35.89 ? 364 ARG B CA    1 
ATOM   4996 C  C     . ARG B 1 328 ? 57.221 65.213  133.922 1.00 38.00 ? 364 ARG B C     1 
ATOM   4997 O  O     . ARG B 1 328 ? 57.579 66.345  133.596 1.00 40.63 ? 364 ARG B O     1 
ATOM   4998 C  CB    . ARG B 1 328 ? 54.732 65.324  133.671 1.00 33.25 ? 364 ARG B CB    1 
ATOM   4999 C  CG    . ARG B 1 328 ? 53.445 64.778  133.064 1.00 31.30 ? 364 ARG B CG    1 
ATOM   5000 C  CD    . ARG B 1 328 ? 52.277 65.694  133.405 1.00 32.82 ? 364 ARG B CD    1 
ATOM   5001 N  NE    . ARG B 1 328 ? 52.476 66.306  134.713 1.00 39.38 ? 364 ARG B NE    1 
ATOM   5002 C  CZ    . ARG B 1 328 ? 51.901 65.890  135.836 1.00 44.02 ? 364 ARG B CZ    1 
ATOM   5003 N  NH1   . ARG B 1 328 ? 51.059 64.862  135.816 1.00 46.20 ? 364 ARG B NH1   1 
ATOM   5004 N  NH2   . ARG B 1 328 ? 52.166 66.520  136.977 1.00 38.80 ? 364 ARG B NH2   1 
ATOM   5005 N  N     . SER B 1 329 ? 57.856 64.484  134.837 1.00 40.61 ? 365 SER B N     1 
ATOM   5006 C  CA    . SER B 1 329 ? 59.044 64.971  135.532 1.00 43.83 ? 365 SER B CA    1 
ATOM   5007 C  C     . SER B 1 329 ? 60.227 64.983  134.580 1.00 47.61 ? 365 SER B C     1 
ATOM   5008 O  O     . SER B 1 329 ? 60.237 64.250  133.582 1.00 45.53 ? 365 SER B O     1 
ATOM   5009 C  CB    . SER B 1 329 ? 59.398 64.064  136.715 1.00 42.59 ? 365 SER B CB    1 
ATOM   5010 O  OG    . SER B 1 329 ? 58.268 63.729  137.498 1.00 43.10 ? 365 SER B OG    1 
ATOM   5011 N  N     . TYR B 1 330 ? 61.217 65.816  134.892 1.00 43.67 ? 366 TYR B N     1 
ATOM   5012 C  CA    . TYR B 1 330 ? 62.510 65.780  134.207 1.00 50.18 ? 366 TYR B CA    1 
ATOM   5013 C  C     . TYR B 1 330 ? 63.613 66.406  135.064 1.00 48.67 ? 366 TYR B C     1 
ATOM   5014 O  O     . TYR B 1 330 ? 63.432 67.485  135.631 1.00 50.93 ? 366 TYR B O     1 
ATOM   5015 C  CB    . TYR B 1 330 ? 62.449 66.383  132.786 1.00 53.53 ? 366 TYR B CB    1 
ATOM   5016 C  CG    . TYR B 1 330 ? 62.306 67.889  132.693 1.00 58.43 ? 366 TYR B CG    1 
ATOM   5017 C  CD1   . TYR B 1 330 ? 63.283 68.657  132.067 1.00 61.59 ? 366 TYR B CD1   1 
ATOM   5018 C  CD2   . TYR B 1 330 ? 61.189 68.541  133.207 1.00 56.38 ? 366 TYR B CD2   1 
ATOM   5019 C  CE1   . TYR B 1 330 ? 63.161 70.033  131.969 1.00 62.48 ? 366 TYR B CE1   1 
ATOM   5020 C  CE2   . TYR B 1 330 ? 61.061 69.920  133.117 1.00 58.50 ? 366 TYR B CE2   1 
ATOM   5021 C  CZ    . TYR B 1 330 ? 62.050 70.660  132.491 1.00 63.40 ? 366 TYR B CZ    1 
ATOM   5022 O  OH    . TYR B 1 330 ? 61.936 72.031  132.385 1.00 65.66 ? 366 TYR B OH    1 
ATOM   5023 N  N     . PRO B 1 331 ? 64.758 65.713  135.179 1.00 46.47 ? 367 PRO B N     1 
ATOM   5024 C  CA    . PRO B 1 331 ? 65.044 64.423  134.528 1.00 44.37 ? 367 PRO B CA    1 
ATOM   5025 C  C     . PRO B 1 331 ? 64.312 63.243  135.180 1.00 44.02 ? 367 PRO B C     1 
ATOM   5026 O  O     . PRO B 1 331 ? 64.179 63.206  136.403 1.00 42.66 ? 367 PRO B O     1 
ATOM   5027 C  CB    . PRO B 1 331 ? 66.560 64.260  134.718 1.00 46.82 ? 367 PRO B CB    1 
ATOM   5028 C  CG    . PRO B 1 331 ? 67.064 65.625  135.188 1.00 39.04 ? 367 PRO B CG    1 
ATOM   5029 C  CD    . PRO B 1 331 ? 65.921 66.230  135.920 1.00 42.32 ? 367 PRO B CD    1 
ATOM   5030 N  N     . ILE B 1 332 ? 63.836 62.301  134.365 1.00 40.47 ? 368 ILE B N     1 
ATOM   5031 C  CA    . ILE B 1 332 ? 63.158 61.106  134.870 1.00 37.58 ? 368 ILE B CA    1 
ATOM   5032 C  C     . ILE B 1 332 ? 64.149 60.260  135.677 1.00 34.30 ? 368 ILE B C     1 
ATOM   5033 O  O     . ILE B 1 332 ? 65.291 60.068  135.251 1.00 37.06 ? 368 ILE B O     1 
ATOM   5034 C  CB    . ILE B 1 332 ? 62.557 60.264  133.714 1.00 35.59 ? 368 ILE B CB    1 
ATOM   5035 C  CG1   . ILE B 1 332 ? 61.613 61.111  132.855 1.00 34.96 ? 368 ILE B CG1   1 
ATOM   5036 C  CG2   . ILE B 1 332 ? 61.822 59.031  134.248 1.00 29.84 ? 368 ILE B CG2   1 
ATOM   5037 C  CD1   . ILE B 1 332 ? 60.991 60.351  131.682 1.00 29.70 ? 368 ILE B CD1   1 
ATOM   5038 N  N     . PRO B 1 333 ? 63.727 59.774  136.859 1.00 37.52 ? 369 PRO B N     1 
ATOM   5039 C  CA    . PRO B 1 333 ? 64.586 58.907  137.678 1.00 32.13 ? 369 PRO B CA    1 
ATOM   5040 C  C     . PRO B 1 333 ? 64.501 57.433  137.255 1.00 33.17 ? 369 PRO B C     1 
ATOM   5041 O  O     . PRO B 1 333 ? 63.769 56.635  137.856 1.00 28.21 ? 369 PRO B O     1 
ATOM   5042 C  CB    . PRO B 1 333 ? 64.022 59.096  139.090 1.00 30.94 ? 369 PRO B CB    1 
ATOM   5043 C  CG    . PRO B 1 333 ? 62.573 59.398  138.867 1.00 33.12 ? 369 PRO B CG    1 
ATOM   5044 C  CD    . PRO B 1 333 ? 62.486 60.153  137.564 1.00 37.66 ? 369 PRO B CD    1 
ATOM   5045 N  N     . TYR B 1 334 ? 65.264 57.069  136.231 1.00 30.92 ? 370 TYR B N     1 
ATOM   5046 C  CA    . TYR B 1 334 ? 65.200 55.712  135.696 1.00 28.72 ? 370 TYR B CA    1 
ATOM   5047 C  C     . TYR B 1 334 ? 65.708 54.646  136.677 1.00 28.25 ? 370 TYR B C     1 
ATOM   5048 O  O     . TYR B 1 334 ? 65.320 53.484  136.582 1.00 31.13 ? 370 TYR B O     1 
ATOM   5049 C  CB    . TYR B 1 334 ? 65.976 55.623  134.381 1.00 25.87 ? 370 TYR B CB    1 
ATOM   5050 C  CG    . TYR B 1 334 ? 65.565 56.631  133.336 1.00 22.46 ? 370 TYR B CG    1 
ATOM   5051 C  CD1   . TYR B 1 334 ? 64.320 56.566  132.728 1.00 27.64 ? 370 TYR B CD1   1 
ATOM   5052 C  CD2   . TYR B 1 334 ? 66.441 57.629  132.933 1.00 23.51 ? 370 TYR B CD2   1 
ATOM   5053 C  CE1   . TYR B 1 334 ? 63.950 57.479  131.760 1.00 28.95 ? 370 TYR B CE1   1 
ATOM   5054 C  CE2   . TYR B 1 334 ? 66.082 58.540  131.968 1.00 25.35 ? 370 TYR B CE2   1 
ATOM   5055 C  CZ    . TYR B 1 334 ? 64.840 58.465  131.389 1.00 23.82 ? 370 TYR B CZ    1 
ATOM   5056 O  OH    . TYR B 1 334 ? 64.486 59.375  130.424 1.00 30.67 ? 370 TYR B OH    1 
ATOM   5057 N  N     . ASP B 1 335 ? 66.582 55.048  137.597 1.00 27.57 ? 371 ASP B N     1 
ATOM   5058 C  CA    . ASP B 1 335 ? 67.075 54.188  138.681 1.00 31.29 ? 371 ASP B CA    1 
ATOM   5059 C  C     . ASP B 1 335 ? 65.961 53.402  139.373 1.00 33.53 ? 371 ASP B C     1 
ATOM   5060 O  O     . ASP B 1 335 ? 66.121 52.230  139.733 1.00 29.56 ? 371 ASP B O     1 
ATOM   5061 C  CB    . ASP B 1 335 ? 67.755 55.065  139.732 1.00 42.96 ? 371 ASP B CB    1 
ATOM   5062 C  CG    . ASP B 1 335 ? 69.256 54.916  139.741 1.00 47.66 ? 371 ASP B CG    1 
ATOM   5063 O  OD1   . ASP B 1 335 ? 69.925 55.511  138.868 1.00 46.34 ? 371 ASP B OD1   1 
ATOM   5064 O  OD2   . ASP B 1 335 ? 69.766 54.216  140.640 1.00 51.51 ? 371 ASP B OD2   1 
ATOM   5065 N  N     . SER B 1 336 ? 64.830 54.068  139.563 1.00 28.16 ? 372 SER B N     1 
ATOM   5066 C  CA    . SER B 1 336 ? 63.681 53.481  140.237 1.00 32.07 ? 372 SER B CA    1 
ATOM   5067 C  C     . SER B 1 336 ? 63.178 52.215  139.522 1.00 32.73 ? 372 SER B C     1 
ATOM   5068 O  O     . SER B 1 336 ? 62.544 51.351  140.133 1.00 28.93 ? 372 SER B O     1 
ATOM   5069 C  CB    . SER B 1 336 ? 62.569 54.529  140.345 1.00 30.65 ? 372 SER B CB    1 
ATOM   5070 O  OG    . SER B 1 336 ? 61.289 53.945  140.216 1.00 38.27 ? 372 SER B OG    1 
ATOM   5071 N  N     . LEU B 1 337 ? 63.477 52.096  138.231 1.00 28.82 ? 373 LEU B N     1 
ATOM   5072 C  CA    . LEU B 1 337 ? 62.999 50.954  137.456 1.00 25.95 ? 373 LEU B CA    1 
ATOM   5073 C  C     . LEU B 1 337 ? 63.584 49.638  137.969 1.00 21.16 ? 373 LEU B C     1 
ATOM   5074 O  O     . LEU B 1 337 ? 62.930 48.596  137.922 1.00 23.14 ? 373 LEU B O     1 
ATOM   5075 C  CB    . LEU B 1 337 ? 63.315 51.155  135.966 1.00 26.88 ? 373 LEU B CB    1 
ATOM   5076 C  CG    . LEU B 1 337 ? 62.883 50.057  135.001 1.00 23.79 ? 373 LEU B CG    1 
ATOM   5077 C  CD1   . LEU B 1 337 ? 61.383 49.899  135.038 1.00 21.48 ? 373 LEU B CD1   1 
ATOM   5078 C  CD2   . LEU B 1 337 ? 63.326 50.399  133.594 1.00 22.52 ? 373 LEU B CD2   1 
ATOM   5079 N  N     . PHE B 1 338 ? 64.810 49.691  138.477 1.00 24.07 ? 374 PHE B N     1 
ATOM   5080 C  CA    . PHE B 1 338 ? 65.492 48.484  138.939 1.00 24.85 ? 374 PHE B CA    1 
ATOM   5081 C  C     . PHE B 1 338 ? 65.618 48.431  140.456 1.00 30.76 ? 374 PHE B C     1 
ATOM   5082 O  O     . PHE B 1 338 ? 66.343 47.600  140.996 1.00 28.27 ? 374 PHE B O     1 
ATOM   5083 C  CB    . PHE B 1 338 ? 66.868 48.364  138.272 1.00 24.50 ? 374 PHE B CB    1 
ATOM   5084 C  CG    . PHE B 1 338 ? 66.795 48.300  136.775 1.00 20.41 ? 374 PHE B CG    1 
ATOM   5085 C  CD1   . PHE B 1 338 ? 66.110 47.269  136.155 1.00 23.95 ? 374 PHE B CD1   1 
ATOM   5086 C  CD2   . PHE B 1 338 ? 67.391 49.274  135.989 1.00 23.14 ? 374 PHE B CD2   1 
ATOM   5087 C  CE1   . PHE B 1 338 ? 66.022 47.202  134.775 1.00 22.05 ? 374 PHE B CE1   1 
ATOM   5088 C  CE2   . PHE B 1 338 ? 67.306 49.218  134.606 1.00 26.32 ? 374 PHE B CE2   1 
ATOM   5089 C  CZ    . PHE B 1 338 ? 66.622 48.175  133.997 1.00 24.17 ? 374 PHE B CZ    1 
ATOM   5090 N  N     . GLU B 1 339 ? 64.907 49.323  141.140 1.00 31.57 ? 375 GLU B N     1 
ATOM   5091 C  CA    . GLU B 1 339 ? 64.882 49.312  142.600 1.00 32.55 ? 375 GLU B CA    1 
ATOM   5092 C  C     . GLU B 1 339 ? 64.189 48.065  143.128 1.00 32.60 ? 375 GLU B C     1 
ATOM   5093 O  O     . GLU B 1 339 ? 63.151 47.649  142.602 1.00 34.02 ? 375 GLU B O     1 
ATOM   5094 C  CB    . GLU B 1 339 ? 64.182 50.560  143.139 1.00 35.21 ? 375 GLU B CB    1 
ATOM   5095 C  CG    . GLU B 1 339 ? 65.135 51.584  143.720 1.00 42.25 ? 375 GLU B CG    1 
ATOM   5096 C  CD    . GLU B 1 339 ? 64.474 52.930  143.941 1.00 44.70 ? 375 GLU B CD    1 
ATOM   5097 O  OE1   . GLU B 1 339 ? 63.224 53.002  143.875 1.00 45.59 ? 375 GLU B OE1   1 
ATOM   5098 O  OE2   . GLU B 1 339 ? 65.209 53.915  144.171 1.00 46.16 ? 375 GLU B OE2   1 
ATOM   5099 N  N     . GLU B 1 340 ? 64.781 47.478  144.165 1.00 30.62 ? 376 GLU B N     1 
ATOM   5100 C  CA    . GLU B 1 340 ? 64.234 46.304  144.844 1.00 37.54 ? 376 GLU B CA    1 
ATOM   5101 C  C     . GLU B 1 340 ? 62.753 46.429  145.234 1.00 43.52 ? 376 GLU B C     1 
ATOM   5102 O  O     . GLU B 1 340 ? 62.263 47.526  145.523 1.00 43.27 ? 376 GLU B O     1 
ATOM   5103 C  CB    . GLU B 1 340 ? 65.061 46.012  146.099 1.00 39.98 ? 376 GLU B CB    1 
ATOM   5104 C  CG    . GLU B 1 340 ? 66.327 45.211  145.861 1.00 45.48 ? 376 GLU B CG    1 
ATOM   5105 C  CD    . GLU B 1 340 ? 66.336 43.921  146.665 1.00 59.21 ? 376 GLU B CD    1 
ATOM   5106 O  OE1   . GLU B 1 340 ? 66.872 43.924  147.796 1.00 63.79 ? 376 GLU B OE1   1 
ATOM   5107 O  OE2   . GLU B 1 340 ? 65.788 42.908  146.171 1.00 60.69 ? 376 GLU B OE2   1 
ATOM   5108 N  N     . ALA B 1 341 ? 62.061 45.288  145.241 1.00 42.81 ? 377 ALA B N     1 
ATOM   5109 C  CA    . ALA B 1 341 ? 60.651 45.188  145.630 1.00 44.65 ? 377 ALA B CA    1 
ATOM   5110 C  C     . ALA B 1 341 ? 59.717 45.974  144.717 1.00 47.00 ? 377 ALA B C     1 
ATOM   5111 O  O     . ALA B 1 341 ? 58.740 45.432  144.198 1.00 48.94 ? 377 ALA B O     1 
ATOM   5112 C  CB    . ALA B 1 341 ? 60.455 45.598  147.100 1.00 48.33 ? 377 ALA B CB    1 
HETATM 5113 P  PA    . 2KH C 2 .   ? 63.667 19.290  93.655  1.00 24.30 ? 401 2KH A PA    1 
HETATM 5114 O  O1A   . 2KH C 2 .   ? 65.099 18.844  94.192  1.00 18.30 ? 401 2KH A O1A   1 
HETATM 5115 O  O2A   . 2KH C 2 .   ? 62.844 19.789  94.805  1.00 32.55 ? 401 2KH A O2A   1 
HETATM 5116 N  N3A   . 2KH C 2 .   ? 62.931 18.002  92.908  0.65 27.33 ? 401 2KH A N3A   1 
HETATM 5117 O  "O5'" . 2KH C 2 .   ? 63.907 20.489  92.632  1.00 22.76 ? 401 2KH A "O5'" 1 
HETATM 5118 P  PB    . 2KH C 2 .   ? 61.538 17.475  93.613  0.50 32.54 ? 401 2KH A PB    1 
HETATM 5119 O  O1B   . 2KH C 2 .   ? 60.627 18.688  94.067  0.80 37.68 ? 401 2KH A O1B   1 
HETATM 5120 O  O2B   . 2KH C 2 .   ? 60.836 16.737  92.527  1.00 40.80 ? 401 2KH A O2B   1 
HETATM 5121 O  O3B   . 2KH C 2 .   ? 61.711 16.391  94.796  0.93 37.11 ? 401 2KH A O3B   1 
HETATM 5122 P  PG    . 2KH C 2 .   ? 61.605 16.682  96.340  0.53 37.59 ? 401 2KH A PG    1 
HETATM 5123 O  O1G   . 2KH C 2 .   ? 60.374 16.109  96.802  0.44 38.01 ? 401 2KH A O1G   1 
HETATM 5124 O  O2G   . 2KH C 2 .   ? 61.617 18.141  96.662  0.61 37.31 ? 401 2KH A O2G   1 
HETATM 5125 O  O3G   . 2KH C 2 .   ? 62.743 16.042  97.082  0.43 28.81 ? 401 2KH A O3G   1 
HETATM 5126 C  "C5'" . 2KH C 2 .   ? 62.867 20.949  91.779  1.00 20.73 ? 401 2KH A "C5'" 1 
HETATM 5127 C  "C4'" . 2KH C 2 .   ? 63.262 21.867  90.704  1.00 18.70 ? 401 2KH A "C4'" 1 
HETATM 5128 O  "O4'" . 2KH C 2 .   ? 63.889 23.050  91.224  1.00 18.62 ? 401 2KH A "O4'" 1 
HETATM 5129 C  "C1'" . 2KH C 2 .   ? 64.953 23.387  90.361  1.00 18.16 ? 401 2KH A "C1'" 1 
HETATM 5130 C  "C2'" . 2KH C 2 .   ? 64.873 22.423  89.254  1.00 15.11 ? 401 2KH A "C2'" 1 
HETATM 5131 O  "O2'" . 2KH C 2 .   ? 64.045 22.876  88.214  1.00 16.65 ? 401 2KH A "O2'" 1 
HETATM 5132 C  "C3'" . 2KH C 2 .   ? 64.273 21.257  89.876  1.00 18.21 ? 401 2KH A "C3'" 1 
HETATM 5133 O  "O3'" . 2KH C 2 .   ? 63.710 20.341  88.953  1.00 19.01 ? 401 2KH A "O3'" 1 
HETATM 5134 N  N1    . 2KH C 2 .   ? 66.218 23.313  91.030  1.00 16.54 ? 401 2KH A N1    1 
HETATM 5135 C  C6    . 2KH C 2 .   ? 66.367 22.572  92.172  1.00 18.23 ? 401 2KH A C6    1 
HETATM 5136 C  C2    . 2KH C 2 .   ? 67.299 23.978  90.508  1.00 18.25 ? 401 2KH A C2    1 
HETATM 5137 O  O2    . 2KH C 2 .   ? 67.158 24.673  89.430  1.00 16.92 ? 401 2KH A O2    1 
HETATM 5138 N  N3    . 2KH C 2 .   ? 68.502 23.920  91.102  1.00 18.63 ? 401 2KH A N3    1 
HETATM 5139 C  C4    . 2KH C 2 .   ? 68.698 23.205  92.223  1.00 21.37 ? 401 2KH A C4    1 
HETATM 5140 O  O4    . 2KH C 2 .   ? 69.942 23.139  92.821  1.00 21.83 ? 401 2KH A O4    1 
HETATM 5141 C  C5    . 2KH C 2 .   ? 67.605 22.493  92.807  1.00 19.14 ? 401 2KH A C5    1 
HETATM 5142 BR BR    . BR  D 3 .   ? 82.760 -0.648  88.297  1.00 27.94 ? 402 BR  A BR    1 
HETATM 5143 BR BR    . BR  E 3 .   ? 63.648 16.939  89.854  0.60 20.67 ? 403 BR  A BR    1 
HETATM 5144 MG MG    . MG  F 4 .   ? 65.625 26.672  92.318  1.00 27.55 ? 404 MG  A MG    1 
HETATM 5145 P  PA    . 2KH G 2 .   ? 65.167 29.700  132.724 1.00 31.40 ? 401 2KH B PA    1 
HETATM 5146 O  O1A   . 2KH G 2 .   ? 63.665 30.216  132.927 1.00 20.42 ? 401 2KH B O1A   1 
HETATM 5147 O  O2A   . 2KH G 2 .   ? 65.728 29.228  134.035 1.00 38.35 ? 401 2KH B O2A   1 
HETATM 5148 N  N3A   . 2KH G 2 .   ? 66.048 30.925  132.049 0.73 26.50 ? 401 2KH B N3A   1 
HETATM 5149 O  "O5'" . 2KH G 2 .   ? 65.115 28.450  131.735 1.00 29.21 ? 401 2KH B "O5'" 1 
HETATM 5150 P  PB    . 2KH G 2 .   ? 67.428 31.243  132.868 0.47 39.01 ? 401 2KH B PB    1 
HETATM 5151 O  O1B   . 2KH G 2 .   ? 67.846 30.007  133.766 0.80 42.01 ? 401 2KH B O1B   1 
HETATM 5152 O  O2B   . 2KH G 2 .   ? 68.492 31.477  131.851 1.00 44.47 ? 401 2KH B O2B   1 
HETATM 5153 O  O3B   . 2KH G 2 .   ? 67.315 32.564  133.756 0.92 42.87 ? 401 2KH B O3B   1 
HETATM 5154 P  PG    . 2KH G 2 .   ? 67.328 32.454  135.317 0.45 43.85 ? 401 2KH B PG    1 
HETATM 5155 O  O1G   . 2KH G 2 .   ? 66.740 31.154  135.767 0.73 35.38 ? 401 2KH B O1G   1 
HETATM 5156 O  O2G   . 2KH G 2 .   ? 68.698 32.542  135.751 0.40 44.25 ? 401 2KH B O2G   1 
HETATM 5157 O  O3G   . 2KH G 2 .   ? 66.542 33.585  135.921 0.36 34.57 ? 401 2KH B O3G   1 
HETATM 5158 C  "C5'" . 2KH G 2 .   ? 66.276 27.978  131.058 1.00 26.02 ? 401 2KH B "C5'" 1 
HETATM 5159 C  "C4'" . 2KH G 2 .   ? 66.007 27.092  129.923 1.00 22.37 ? 401 2KH B "C4'" 1 
HETATM 5160 O  "O4'" . 2KH G 2 .   ? 65.151 26.009  130.308 1.00 19.75 ? 401 2KH B "O4'" 1 
HETATM 5161 C  "C1'" . 2KH G 2 .   ? 64.247 25.787  129.237 1.00 22.43 ? 401 2KH B "C1'" 1 
HETATM 5162 C  "C2'" . 2KH G 2 .   ? 64.632 26.734  128.183 1.00 22.28 ? 401 2KH B "C2'" 1 
HETATM 5163 O  "O2'" . 2KH G 2 .   ? 65.571 26.186  127.289 1.00 20.45 ? 401 2KH B "O2'" 1 
HETATM 5164 C  "C3'" . 2KH G 2 .   ? 65.231 27.816  128.941 1.00 20.10 ? 401 2KH B "C3'" 1 
HETATM 5165 O  "O3'" . 2KH G 2 .   ? 66.056 28.650  128.160 1.00 19.43 ? 401 2KH B "O3'" 1 
HETATM 5166 N  N1    . 2KH G 2 .   ? 62.885 25.970  129.631 1.00 19.40 ? 401 2KH B N1    1 
HETATM 5167 C  C6    . 2KH G 2 .   ? 62.569 26.683  130.758 1.00 23.23 ? 401 2KH B C6    1 
HETATM 5168 C  C2    . 2KH G 2 .   ? 61.893 25.418  128.868 1.00 21.34 ? 401 2KH B C2    1 
HETATM 5169 O  O2    . 2KH G 2 .   ? 62.203 24.737  127.801 1.00 23.69 ? 401 2KH B O2    1 
HETATM 5170 N  N3    . 2KH G 2 .   ? 60.602 25.561  129.203 1.00 23.83 ? 401 2KH B N3    1 
HETATM 5171 C  C4    . 2KH G 2 .   ? 60.229 26.261  130.287 1.00 22.69 ? 401 2KH B C4    1 
HETATM 5172 O  O4    . 2KH G 2 .   ? 58.891 26.411  130.612 1.00 20.27 ? 401 2KH B O4    1 
HETATM 5173 C  C5    . 2KH G 2 .   ? 61.235 26.854  131.120 1.00 22.42 ? 401 2KH B C5    1 
HETATM 5174 BR BR    . BR  H 3 .   ? 66.137 32.180  129.312 0.61 18.78 ? 402 BR  B BR    1 
HETATM 5175 MG MG    . MG  I 4 .   ? 53.825 57.534  125.367 1.00 27.37 ? 403 MG  B MG    1 
HETATM 5176 MG MG    . MG  J 4 .   ? 63.222 22.560  130.879 1.00 31.47 ? 404 MG  B MG    1 
HETATM 5177 MG MG    . MG  K 4 .   ? 71.588 54.031  120.914 1.00 14.21 ? 405 MG  B MG    1 
HETATM 5178 O  O     . HOH L 5 .   ? 40.601 17.499  89.266  1.00 34.25 ? 501 HOH A O     1 
HETATM 5179 O  O     . HOH L 5 .   ? 90.390 17.880  91.781  1.00 28.38 ? 502 HOH A O     1 
HETATM 5180 O  O     . HOH L 5 .   ? 44.619 40.470  84.009  1.00 10.23 ? 503 HOH A O     1 
HETATM 5181 O  O     . HOH L 5 .   ? 63.740 -7.622  81.054  1.00 13.19 ? 504 HOH A O     1 
HETATM 5182 O  O     . HOH L 5 .   ? 63.272 -2.158  80.505  1.00 10.35 ? 505 HOH A O     1 
HETATM 5183 O  O     . HOH L 5 .   ? 82.433 15.401  93.653  1.00 14.71 ? 506 HOH A O     1 
HETATM 5184 O  O     . HOH L 5 .   ? 71.467 19.438  96.996  1.00 16.18 ? 507 HOH A O     1 
HETATM 5185 O  O     . HOH L 5 .   ? 61.091 8.371   80.147  1.00 12.10 ? 508 HOH A O     1 
HETATM 5186 O  O     . HOH L 5 .   ? 78.687 0.821   86.279  1.00 12.72 ? 509 HOH A O     1 
HETATM 5187 O  O     . HOH L 5 .   ? 80.280 16.488  80.547  1.00 15.03 ? 510 HOH A O     1 
HETATM 5188 O  O     . HOH L 5 .   ? 67.552 -9.807  87.877  1.00 18.20 ? 511 HOH A O     1 
HETATM 5189 O  O     . HOH L 5 .   ? 70.507 24.845  89.476  1.00 18.54 ? 512 HOH A O     1 
HETATM 5190 O  O     . HOH L 5 .   ? 78.627 7.346   77.644  1.00 16.51 ? 513 HOH A O     1 
HETATM 5191 O  O     . HOH L 5 .   ? 69.641 25.688  85.627  1.00 15.65 ? 514 HOH A O     1 
HETATM 5192 O  O     . HOH L 5 .   ? 69.632 27.090  88.277  1.00 17.88 ? 515 HOH A O     1 
HETATM 5193 O  O     . HOH L 5 .   ? 56.663 -5.506  86.291  1.00 15.26 ? 516 HOH A O     1 
HETATM 5194 O  O     . HOH L 5 .   ? 73.937 25.419  77.104  1.00 18.26 ? 517 HOH A O     1 
HETATM 5195 O  O     . HOH L 5 .   ? 47.752 32.882  80.498  1.00 21.03 ? 518 HOH A O     1 
HETATM 5196 O  O     . HOH L 5 .   ? 41.691 36.867  86.377  1.00 17.37 ? 519 HOH A O     1 
HETATM 5197 O  O     . HOH L 5 .   ? 67.615 -7.555  81.809  1.00 20.26 ? 520 HOH A O     1 
HETATM 5198 O  O     . HOH L 5 .   ? 61.370 -8.091  83.241  1.00 20.24 ? 521 HOH A O     1 
HETATM 5199 O  O     . HOH L 5 .   ? 61.934 33.536  94.124  1.00 18.24 ? 522 HOH A O     1 
HETATM 5200 O  O     . HOH L 5 .   ? 61.441 31.664  80.554  1.00 21.70 ? 523 HOH A O     1 
HETATM 5201 O  O     . HOH L 5 .   ? 71.188 1.362   99.623  1.00 13.84 ? 524 HOH A O     1 
HETATM 5202 O  O     . HOH L 5 .   ? 77.863 0.725   83.761  1.00 18.20 ? 525 HOH A O     1 
HETATM 5203 O  O     . HOH L 5 .   ? 42.532 43.720  89.911  1.00 19.85 ? 526 HOH A O     1 
HETATM 5204 O  O     . HOH L 5 .   ? 49.206 10.095  92.802  1.00 22.77 ? 527 HOH A O     1 
HETATM 5205 O  O     . HOH L 5 .   ? 59.834 35.047  101.156 1.00 20.29 ? 528 HOH A O     1 
HETATM 5206 O  O     . HOH L 5 .   ? 67.485 25.595  72.998  1.00 19.04 ? 529 HOH A O     1 
HETATM 5207 O  O     . HOH L 5 .   ? 84.117 14.361  85.828  1.00 17.58 ? 530 HOH A O     1 
HETATM 5208 O  O     . HOH L 5 .   ? 66.585 25.840  77.295  1.00 17.71 ? 531 HOH A O     1 
HETATM 5209 O  O     . HOH L 5 .   ? 64.791 17.921  96.878  1.00 22.18 ? 532 HOH A O     1 
HETATM 5210 O  O     . HOH L 5 .   ? 67.883 17.518  66.518  1.00 23.68 ? 533 HOH A O     1 
HETATM 5211 O  O     . HOH L 5 .   ? 77.408 20.750  83.747  1.00 11.98 ? 534 HOH A O     1 
HETATM 5212 O  O     . HOH L 5 .   ? 45.207 28.055  83.361  1.00 21.64 ? 535 HOH A O     1 
HETATM 5213 O  O     . HOH L 5 .   ? 39.358 37.186  87.818  1.00 23.86 ? 536 HOH A O     1 
HETATM 5214 O  O     . HOH L 5 .   ? 70.214 21.438  94.725  1.00 22.04 ? 537 HOH A O     1 
HETATM 5215 O  O     . HOH L 5 .   ? 65.626 18.774  103.451 1.00 25.02 ? 538 HOH A O     1 
HETATM 5216 O  O     . HOH L 5 .   ? 76.871 10.394  74.933  1.00 19.41 ? 539 HOH A O     1 
HETATM 5217 O  O     . HOH L 5 .   ? 72.993 -2.247  74.305  1.00 21.92 ? 540 HOH A O     1 
HETATM 5218 O  O     . HOH L 5 .   ? 81.056 1.764   86.707  1.00 20.46 ? 541 HOH A O     1 
HETATM 5219 O  O     . HOH L 5 .   ? 72.310 15.280  69.733  1.00 23.50 ? 542 HOH A O     1 
HETATM 5220 O  O     . HOH L 5 .   ? 43.624 29.518  84.597  1.00 20.43 ? 543 HOH A O     1 
HETATM 5221 O  O     . HOH L 5 .   ? 79.177 19.484  98.850  1.00 20.97 ? 544 HOH A O     1 
HETATM 5222 O  O     . HOH L 5 .   ? 50.299 35.856  80.494  1.00 23.49 ? 545 HOH A O     1 
HETATM 5223 O  O     . HOH L 5 .   ? 59.162 27.408  93.378  1.00 18.94 ? 546 HOH A O     1 
HETATM 5224 O  O     . HOH L 5 .   ? 66.677 32.817  86.429  1.00 24.13 ? 547 HOH A O     1 
HETATM 5225 O  O     . HOH L 5 .   ? 66.026 12.142  102.969 1.00 22.43 ? 548 HOH A O     1 
HETATM 5226 O  O     . HOH L 5 .   ? 67.680 18.816  63.931  1.00 29.80 ? 549 HOH A O     1 
HETATM 5227 O  O     . HOH L 5 .   ? 40.527 23.401  85.907  1.00 25.76 ? 550 HOH A O     1 
HETATM 5228 O  O     . HOH L 5 .   ? 85.143 9.823   88.618  1.00 24.82 ? 551 HOH A O     1 
HETATM 5229 O  O     . HOH L 5 .   ? 66.790 -12.490 86.402  1.00 23.95 ? 552 HOH A O     1 
HETATM 5230 O  O     . HOH L 5 .   ? 55.226 21.764  89.442  1.00 20.80 ? 553 HOH A O     1 
HETATM 5231 O  O     . HOH L 5 .   ? 69.853 8.630   70.549  1.00 24.73 ? 554 HOH A O     1 
HETATM 5232 O  O     . HOH L 5 .   ? 68.987 8.593   73.125  1.00 23.90 ? 555 HOH A O     1 
HETATM 5233 O  O     . HOH L 5 .   ? 78.588 -5.156  94.016  1.00 30.27 ? 556 HOH A O     1 
HETATM 5234 O  O     . HOH L 5 .   ? 59.763 -6.058  82.836  1.00 20.55 ? 557 HOH A O     1 
HETATM 5235 O  O     . HOH L 5 .   ? 60.215 30.994  90.168  1.00 27.92 ? 558 HOH A O     1 
HETATM 5236 O  O     . HOH L 5 .   ? 77.022 12.969  73.756  1.00 21.67 ? 559 HOH A O     1 
HETATM 5237 O  O     . HOH L 5 .   ? 82.089 2.510   84.020  1.00 26.14 ? 560 HOH A O     1 
HETATM 5238 O  O     . HOH L 5 .   ? 42.993 19.386  85.325  1.00 21.44 ? 561 HOH A O     1 
HETATM 5239 O  O     . HOH L 5 .   ? 63.980 20.511  86.393  1.00 21.38 ? 562 HOH A O     1 
HETATM 5240 O  O     . HOH L 5 .   ? 59.848 24.126  81.573  1.00 17.88 ? 563 HOH A O     1 
HETATM 5241 O  O     . HOH L 5 .   ? 80.673 5.175   102.980 1.00 29.61 ? 564 HOH A O     1 
HETATM 5242 O  O     . HOH L 5 .   ? 79.174 0.429   79.964  1.00 26.80 ? 565 HOH A O     1 
HETATM 5243 O  O     . HOH L 5 .   ? 76.208 -3.808  86.022  1.00 31.39 ? 566 HOH A O     1 
HETATM 5244 O  O     . HOH L 5 .   ? 58.555 -9.277  91.381  1.00 31.00 ? 567 HOH A O     1 
HETATM 5245 O  O     . HOH L 5 .   ? 89.810 18.776  84.759  1.00 34.14 ? 568 HOH A O     1 
HETATM 5246 O  O     . HOH L 5 .   ? 53.901 -12.100 89.645  1.00 41.93 ? 569 HOH A O     1 
HETATM 5247 O  O     . HOH L 5 .   ? 39.473 26.069  92.090  1.00 37.58 ? 570 HOH A O     1 
HETATM 5248 O  O     . HOH L 5 .   ? 59.511 -2.236  97.776  1.00 30.72 ? 571 HOH A O     1 
HETATM 5249 O  O     . HOH L 5 .   ? 40.488 24.538  88.668  1.00 24.03 ? 572 HOH A O     1 
HETATM 5250 O  O     . HOH L 5 .   ? 62.567 19.777  73.116  1.00 26.20 ? 573 HOH A O     1 
HETATM 5251 O  O     . HOH L 5 .   ? 76.574 24.829  76.859  1.00 34.83 ? 574 HOH A O     1 
HETATM 5252 O  O     . HOH L 5 .   ? 75.358 29.186  68.918  1.00 29.47 ? 575 HOH A O     1 
HETATM 5253 O  O     . HOH L 5 .   ? 82.027 28.670  88.689  1.00 31.85 ? 576 HOH A O     1 
HETATM 5254 O  O     . HOH L 5 .   ? 57.611 22.691  96.101  1.00 28.24 ? 577 HOH A O     1 
HETATM 5255 O  O     . HOH L 5 .   ? 41.093 31.682  91.386  1.00 28.59 ? 578 HOH A O     1 
HETATM 5256 O  O     . HOH L 5 .   ? 77.771 0.269   102.591 1.00 29.84 ? 579 HOH A O     1 
HETATM 5257 O  O     . HOH L 5 .   ? 66.644 1.239   71.858  1.00 32.58 ? 580 HOH A O     1 
HETATM 5258 O  O     . HOH L 5 .   ? 40.480 20.675  85.634  1.00 28.65 ? 581 HOH A O     1 
HETATM 5259 O  O     . HOH L 5 .   ? 66.318 -12.827 91.964  1.00 33.92 ? 582 HOH A O     1 
HETATM 5260 O  O     . HOH L 5 .   ? 67.404 27.724  89.312  1.00 26.18 ? 583 HOH A O     1 
HETATM 5261 O  O     . HOH L 5 .   ? 68.116 21.215  67.466  1.00 27.40 ? 584 HOH A O     1 
HETATM 5262 O  O     . HOH L 5 .   ? 62.086 22.027  74.299  1.00 26.46 ? 585 HOH A O     1 
HETATM 5263 O  O     . HOH L 5 .   ? 41.616 43.258  92.520  1.00 37.75 ? 586 HOH A O     1 
HETATM 5264 O  O     . HOH L 5 .   ? 77.359 -9.081  96.965  1.00 31.85 ? 587 HOH A O     1 
HETATM 5265 O  O     . HOH L 5 .   ? 79.405 24.430  75.959  1.00 32.56 ? 588 HOH A O     1 
HETATM 5266 O  O     . HOH L 5 .   ? 57.001 10.995  76.449  1.00 35.51 ? 589 HOH A O     1 
HETATM 5267 O  O     . HOH L 5 .   ? 60.558 -2.502  100.140 1.00 25.85 ? 590 HOH A O     1 
HETATM 5268 O  O     . HOH L 5 .   ? 53.212 8.937   86.347  1.00 29.51 ? 591 HOH A O     1 
HETATM 5269 O  O     . HOH L 5 .   ? 83.429 9.825   84.924  1.00 30.46 ? 592 HOH A O     1 
HETATM 5270 O  O     . HOH L 5 .   ? 39.418 22.295  100.580 1.00 37.70 ? 593 HOH A O     1 
HETATM 5271 O  O     . HOH L 5 .   ? 65.649 5.728   73.003  1.00 34.38 ? 594 HOH A O     1 
HETATM 5272 O  O     . HOH L 5 .   ? 82.724 12.073  103.693 1.00 34.95 ? 595 HOH A O     1 
HETATM 5273 O  O     . HOH L 5 .   ? 56.792 16.951  80.211  1.00 31.58 ? 596 HOH A O     1 
HETATM 5274 O  O     . HOH L 5 .   ? 57.976 14.056  93.101  1.00 32.06 ? 597 HOH A O     1 
HETATM 5275 O  O     . HOH L 5 .   ? 37.558 23.491  99.745  1.00 37.28 ? 598 HOH A O     1 
HETATM 5276 O  O     . HOH L 5 .   ? 58.196 10.713  74.024  1.00 33.14 ? 599 HOH A O     1 
HETATM 5277 O  O     . HOH L 5 .   ? 52.393 23.761  82.757  1.00 37.69 ? 600 HOH A O     1 
HETATM 5278 O  O     . HOH L 5 .   ? 81.273 28.853  91.057  1.00 27.65 ? 601 HOH A O     1 
HETATM 5279 O  O     . HOH L 5 .   ? 50.267 18.918  97.840  1.00 36.83 ? 602 HOH A O     1 
HETATM 5280 O  O     . HOH L 5 .   ? 51.792 30.354  81.087  1.00 31.33 ? 603 HOH A O     1 
HETATM 5281 O  O     . HOH L 5 .   ? 75.516 30.600  90.332  1.00 25.65 ? 604 HOH A O     1 
HETATM 5282 O  O     . HOH L 5 .   ? 70.639 0.213   103.208 1.00 28.49 ? 605 HOH A O     1 
HETATM 5283 O  O     . HOH L 5 .   ? 55.702 7.631   96.413  1.00 31.89 ? 606 HOH A O     1 
HETATM 5284 O  O     . HOH L 5 .   ? 77.678 24.299  74.475  1.00 32.13 ? 607 HOH A O     1 
HETATM 5285 O  O     . HOH L 5 .   ? 55.515 37.226  81.983  1.00 34.21 ? 608 HOH A O     1 
HETATM 5286 O  O     . HOH L 5 .   ? 73.636 8.763   71.272  1.00 32.73 ? 609 HOH A O     1 
HETATM 5287 O  O     . HOH L 5 .   ? 59.905 41.251  105.579 1.00 36.98 ? 610 HOH A O     1 
HETATM 5288 O  O     . HOH L 5 .   ? 54.897 -3.841  86.403  1.00 25.74 ? 611 HOH A O     1 
HETATM 5289 O  O     . HOH L 5 .   ? 64.256 -6.941  102.810 1.00 35.59 ? 612 HOH A O     1 
HETATM 5290 O  O     . HOH L 5 .   ? 59.425 14.071  71.044  1.00 36.03 ? 613 HOH A O     1 
HETATM 5291 O  O     . HOH L 5 .   ? 74.110 -3.545  84.935  1.00 30.36 ? 614 HOH A O     1 
HETATM 5292 O  O     . HOH L 5 .   ? 79.336 -7.347  95.777  1.00 34.99 ? 615 HOH A O     1 
HETATM 5293 O  O     . HOH L 5 .   ? 43.388 31.949  103.773 1.00 30.47 ? 616 HOH A O     1 
HETATM 5294 O  O     . HOH L 5 .   ? 70.339 13.487  105.239 1.00 28.38 ? 617 HOH A O     1 
HETATM 5295 O  O     . HOH L 5 .   ? 64.362 38.331  89.972  1.00 39.12 ? 618 HOH A O     1 
HETATM 5296 O  O     . HOH L 5 .   ? 47.910 29.695  80.342  1.00 25.00 ? 619 HOH A O     1 
HETATM 5297 O  O     . HOH L 5 .   ? 60.354 7.434   74.120  1.00 26.19 ? 620 HOH A O     1 
HETATM 5298 O  O     . HOH L 5 .   ? 56.979 12.549  72.966  1.00 40.82 ? 621 HOH A O     1 
HETATM 5299 O  O     . HOH L 5 .   ? 83.511 4.379   83.364  1.00 29.05 ? 622 HOH A O     1 
HETATM 5300 O  O     . HOH L 5 .   ? 64.677 26.682  70.228  1.00 37.67 ? 623 HOH A O     1 
HETATM 5301 O  O     . HOH L 5 .   ? 72.981 5.660   71.924  1.00 27.66 ? 624 HOH A O     1 
HETATM 5302 O  O     . HOH L 5 .   ? 58.897 25.797  79.730  1.00 31.19 ? 625 HOH A O     1 
HETATM 5303 O  O     . HOH L 5 .   ? 70.971 37.594  79.904  1.00 29.95 ? 626 HOH A O     1 
HETATM 5304 O  O     . HOH L 5 .   ? 50.496 40.328  104.303 1.00 38.69 ? 627 HOH A O     1 
HETATM 5305 O  O     . HOH L 5 .   ? 63.589 16.360  99.926  1.00 34.81 ? 628 HOH A O     1 
HETATM 5306 O  O     . HOH L 5 .   ? 46.682 45.149  91.035  1.00 33.15 ? 629 HOH A O     1 
HETATM 5307 O  O     . HOH L 5 .   ? 56.814 20.222  90.362  1.00 25.43 ? 630 HOH A O     1 
HETATM 5308 O  O     . HOH L 5 .   ? 42.671 41.897  94.283  1.00 40.29 ? 631 HOH A O     1 
HETATM 5309 O  O     . HOH L 5 .   ? 82.568 4.769   80.931  1.00 31.84 ? 632 HOH A O     1 
HETATM 5310 O  O     . HOH L 5 .   ? 87.837 5.184   89.682  1.00 31.54 ? 633 HOH A O     1 
HETATM 5311 O  O     . HOH L 5 .   ? 68.809 27.550  71.511  1.00 23.95 ? 634 HOH A O     1 
HETATM 5312 O  O     . HOH L 5 .   ? 62.359 17.830  86.844  1.00 24.07 ? 635 HOH A O     1 
HETATM 5313 O  O     . HOH L 5 .   ? 80.324 16.022  72.122  1.00 34.67 ? 636 HOH A O     1 
HETATM 5314 O  O     . HOH L 5 .   ? 73.471 -4.586  100.452 1.00 30.64 ? 637 HOH A O     1 
HETATM 5315 O  O     . HOH L 5 .   ? 62.823 31.182  93.724  1.00 29.30 ? 638 HOH A O     1 
HETATM 5316 O  O     . HOH L 5 .   ? 49.450 1.931   88.574  1.00 35.54 ? 639 HOH A O     1 
HETATM 5317 O  O     . HOH L 5 .   ? 65.610 37.798  82.097  1.00 40.59 ? 640 HOH A O     1 
HETATM 5318 O  O     . HOH L 5 .   ? 52.063 32.446  107.661 1.00 29.04 ? 641 HOH A O     1 
HETATM 5319 O  O     . HOH L 5 .   ? 91.437 26.316  89.798  1.00 35.16 ? 642 HOH A O     1 
HETATM 5320 O  O     . HOH L 5 .   ? 60.902 18.267  69.506  1.00 34.21 ? 643 HOH A O     1 
HETATM 5321 O  O     . HOH L 5 .   ? 57.005 13.081  79.012  1.00 29.79 ? 644 HOH A O     1 
HETATM 5322 O  O     . HOH L 5 .   ? 75.494 9.576   72.149  1.00 28.38 ? 645 HOH A O     1 
HETATM 5323 O  O     . HOH L 5 .   ? 63.437 32.214  79.296  1.00 25.54 ? 646 HOH A O     1 
HETATM 5324 O  O     . HOH L 5 .   ? 56.058 41.462  82.706  1.00 33.50 ? 647 HOH A O     1 
HETATM 5325 O  O     . HOH L 5 .   ? 48.445 25.557  106.633 1.00 39.60 ? 648 HOH A O     1 
HETATM 5326 O  O     . HOH L 5 .   ? 54.926 -9.259  84.960  1.00 32.20 ? 649 HOH A O     1 
HETATM 5327 O  O     . HOH L 5 .   ? 55.585 10.378  87.481  1.00 24.01 ? 650 HOH A O     1 
HETATM 5328 O  O     . HOH L 5 .   ? 72.089 -9.665  87.521  1.00 34.26 ? 651 HOH A O     1 
HETATM 5329 O  O     . HOH L 5 .   ? 79.263 14.666  74.165  1.00 26.26 ? 652 HOH A O     1 
HETATM 5330 O  O     . HOH L 5 .   ? 47.436 46.074  86.903  1.00 28.65 ? 653 HOH A O     1 
HETATM 5331 O  O     . HOH L 5 .   ? 52.604 -3.398  88.244  1.00 30.93 ? 654 HOH A O     1 
HETATM 5332 O  O     . HOH L 5 .   ? 68.190 10.933  62.770  1.00 37.85 ? 655 HOH A O     1 
HETATM 5333 O  O     . HOH L 5 .   ? 57.068 6.688   100.223 1.00 35.47 ? 656 HOH A O     1 
HETATM 5334 O  O     . HOH L 5 .   ? 83.433 27.139  85.034  1.00 30.72 ? 657 HOH A O     1 
HETATM 5335 O  O     . HOH L 5 .   ? 84.257 22.107  100.309 1.00 21.35 ? 658 HOH A O     1 
HETATM 5336 O  O     . HOH L 5 .   ? 57.649 25.285  82.362  1.00 34.95 ? 659 HOH A O     1 
HETATM 5337 O  O     . HOH L 5 .   ? 66.264 8.687   71.973  1.00 27.56 ? 660 HOH A O     1 
HETATM 5338 O  O     . HOH L 5 .   ? 55.610 9.659   97.217  1.00 32.06 ? 661 HOH A O     1 
HETATM 5339 O  O     . HOH L 5 .   ? 69.075 37.233  77.617  1.00 33.80 ? 662 HOH A O     1 
HETATM 5340 O  O     . HOH L 5 .   ? 79.766 9.683   75.114  1.00 32.31 ? 663 HOH A O     1 
HETATM 5341 O  O     . HOH L 5 .   ? 76.258 -1.651  82.662  1.00 32.74 ? 664 HOH A O     1 
HETATM 5342 O  O     . HOH L 5 .   ? 70.498 13.676  65.946  1.00 25.61 ? 665 HOH A O     1 
HETATM 5343 O  O     . HOH L 5 .   ? 48.043 31.604  106.094 1.00 26.61 ? 666 HOH A O     1 
HETATM 5344 O  O     . HOH L 5 .   ? 81.750 29.244  86.477  1.00 33.31 ? 667 HOH A O     1 
HETATM 5345 O  O     . HOH L 5 .   ? 53.193 25.959  83.228  1.00 22.01 ? 668 HOH A O     1 
HETATM 5346 O  O     . HOH L 5 .   ? 74.450 5.025   104.739 1.00 30.82 ? 669 HOH A O     1 
HETATM 5347 O  O     . HOH L 5 .   ? 53.914 -0.654  83.593  1.00 25.96 ? 670 HOH A O     1 
HETATM 5348 O  O     . HOH L 5 .   ? 78.025 33.175  87.956  1.00 30.46 ? 671 HOH A O     1 
HETATM 5349 O  O     . HOH L 5 .   ? 50.476 46.808  82.362  1.00 38.76 ? 672 HOH A O     1 
HETATM 5350 O  O     . HOH L 5 .   ? 61.071 21.932  95.072  1.00 33.06 ? 673 HOH A O     1 
HETATM 5351 O  O     . HOH L 5 .   ? 44.514 7.933   88.584  1.00 34.59 ? 674 HOH A O     1 
HETATM 5352 O  O     . HOH L 5 .   ? 87.137 27.036  96.000  1.00 43.08 ? 675 HOH A O     1 
HETATM 5353 O  O     . HOH L 5 .   ? 69.284 -9.755  89.765  1.00 27.19 ? 676 HOH A O     1 
HETATM 5354 O  O     . HOH L 5 .   ? 48.940 25.102  82.549  1.00 34.67 ? 677 HOH A O     1 
HETATM 5355 O  O     . HOH L 5 .   ? 52.214 7.443   83.970  1.00 35.58 ? 678 HOH A O     1 
HETATM 5356 O  O     . HOH L 5 .   ? 64.138 18.717  101.412 1.00 32.70 ? 679 HOH A O     1 
HETATM 5357 O  O     . HOH L 5 .   ? 56.246 -5.650  93.974  1.00 39.77 ? 680 HOH A O     1 
HETATM 5358 O  O     . HOH L 5 .   ? 87.376 18.357  97.588  1.00 40.63 ? 681 HOH A O     1 
HETATM 5359 O  O     . HOH L 5 .   ? 80.762 -6.281  97.422  1.00 45.29 ? 682 HOH A O     1 
HETATM 5360 O  O     . HOH L 5 .   ? 43.353 33.612  83.802  1.00 9.65  ? 683 HOH A O     1 
HETATM 5361 O  O     . HOH L 5 .   ? 56.824 0.829   100.085 1.00 39.19 ? 684 HOH A O     1 
HETATM 5362 O  O     . HOH L 5 .   ? 58.070 5.365   108.851 1.00 36.41 ? 685 HOH A O     1 
HETATM 5363 O  O     . HOH L 5 .   ? 68.933 -10.118 75.398  1.00 29.54 ? 686 HOH A O     1 
HETATM 5364 O  O     . HOH L 5 .   ? 54.794 -7.528  87.110  1.00 26.39 ? 687 HOH A O     1 
HETATM 5365 O  O     . HOH L 5 .   ? 59.301 19.827  91.964  1.00 32.68 ? 688 HOH A O     1 
HETATM 5366 O  O     . HOH L 5 .   ? 59.320 40.595  98.053  1.00 26.36 ? 689 HOH A O     1 
HETATM 5367 O  O     . HOH L 5 .   ? 58.133 15.294  79.331  1.00 28.75 ? 690 HOH A O     1 
HETATM 5368 O  O     . HOH L 5 .   ? 59.775 8.508   76.637  1.00 21.14 ? 691 HOH A O     1 
HETATM 5369 O  O     . HOH L 5 .   ? 58.429 7.862   79.634  1.00 22.96 ? 692 HOH A O     1 
HETATM 5370 O  O     . HOH L 5 .   ? 80.927 10.708  76.999  1.00 22.73 ? 693 HOH A O     1 
HETATM 5371 O  O     . HOH L 5 .   ? 72.041 10.391  69.459  1.00 26.39 ? 694 HOH A O     1 
HETATM 5372 O  O     . HOH L 5 .   ? 79.863 3.572   72.643  1.00 33.53 ? 695 HOH A O     1 
HETATM 5373 O  O     . HOH L 5 .   ? 74.244 -1.039  78.914  1.00 28.00 ? 696 HOH A O     1 
HETATM 5374 O  O     . HOH L 5 .   ? 82.292 -10.881 93.765  1.00 31.99 ? 697 HOH A O     1 
HETATM 5375 O  O     . HOH L 5 .   ? 69.649 24.790  70.036  1.00 23.92 ? 698 HOH A O     1 
HETATM 5376 O  O     . HOH L 5 .   ? 65.442 25.903  74.967  1.00 25.21 ? 699 HOH A O     1 
HETATM 5377 O  O     . HOH L 5 .   ? 63.619 24.292  73.934  1.00 28.28 ? 700 HOH A O     1 
HETATM 5378 O  O     . HOH L 5 .   ? 60.896 19.905  95.917  1.00 35.85 ? 701 HOH A O     1 
HETATM 5379 O  O     . HOH L 5 .   ? 63.692 10.843  103.483 1.00 28.19 ? 702 HOH A O     1 
HETATM 5380 O  O     . HOH L 5 .   ? 63.629 35.267  93.192  1.00 27.34 ? 703 HOH A O     1 
HETATM 5381 O  O     . HOH L 5 .   ? 80.105 1.811   82.284  1.00 32.42 ? 704 HOH A O     1 
HETATM 5382 O  O     . HOH L 5 .   ? 69.009 26.978  92.920  1.00 33.39 ? 705 HOH A O     1 
HETATM 5383 O  O     . HOH L 5 .   ? 64.152 28.086  74.928  1.00 36.39 ? 706 HOH A O     1 
HETATM 5384 O  O     . HOH L 5 .   ? 51.077 -0.293  84.035  1.00 30.65 ? 707 HOH A O     1 
HETATM 5385 O  O     . HOH L 5 .   ? 93.177 18.675  87.112  1.00 31.87 ? 708 HOH A O     1 
HETATM 5386 O  O     . HOH L 5 .   ? 60.422 25.916  94.703  1.00 32.34 ? 709 HOH A O     1 
HETATM 5387 O  O     . HOH L 5 .   ? 59.124 -12.779 92.783  1.00 52.10 ? 710 HOH A O     1 
HETATM 5388 O  O     . HOH L 5 .   ? 59.059 21.537  80.291  1.00 28.41 ? 711 HOH A O     1 
HETATM 5389 O  O     . HOH L 5 .   ? 70.628 -1.931  102.511 1.00 33.42 ? 712 HOH A O     1 
HETATM 5390 O  O     . HOH L 5 .   ? 53.419 39.298  104.101 1.00 37.33 ? 713 HOH A O     1 
HETATM 5391 O  O     . HOH L 5 .   ? 56.772 42.011  97.433  1.00 34.29 ? 714 HOH A O     1 
HETATM 5392 O  O     . HOH L 5 .   ? 60.065 -12.467 84.411  1.00 31.05 ? 715 HOH A O     1 
HETATM 5393 O  O     . HOH L 5 .   ? 68.039 -9.462  73.316  1.00 38.31 ? 716 HOH A O     1 
HETATM 5394 O  O     . HOH L 5 .   ? 59.546 7.807   98.470  1.00 28.33 ? 717 HOH A O     1 
HETATM 5395 O  O     . HOH L 5 .   ? 75.557 5.337   70.338  1.00 31.48 ? 718 HOH A O     1 
HETATM 5396 O  O     . HOH L 5 .   ? 85.331 13.064  100.258 1.00 37.40 ? 719 HOH A O     1 
HETATM 5397 O  O     . HOH L 5 .   ? 77.761 -6.324  87.635  1.00 34.31 ? 720 HOH A O     1 
HETATM 5398 O  O     . HOH L 5 .   ? 49.814 18.336  86.962  1.00 28.74 ? 721 HOH A O     1 
HETATM 5399 O  O     . HOH L 5 .   ? 80.060 3.754   104.837 1.00 40.40 ? 722 HOH A O     1 
HETATM 5400 O  O     . HOH L 5 .   ? 86.458 17.045  99.398  1.00 38.79 ? 723 HOH A O     1 
HETATM 5401 O  O     . HOH L 5 .   ? 82.008 23.100  76.826  1.00 32.54 ? 724 HOH A O     1 
HETATM 5402 O  O     . HOH L 5 .   ? 62.547 -15.743 86.135  1.00 39.26 ? 725 HOH A O     1 
HETATM 5403 O  O     . HOH L 5 .   ? 68.484 -5.912  74.605  1.00 32.40 ? 726 HOH A O     1 
HETATM 5404 O  O     . HOH L 5 .   ? 37.550 32.908  92.537  1.00 37.98 ? 727 HOH A O     1 
HETATM 5405 O  O     . HOH L 5 .   ? 60.982 12.448  71.331  1.00 32.22 ? 728 HOH A O     1 
HETATM 5406 O  O     . HOH L 5 .   ? 59.781 18.445  72.681  1.00 36.98 ? 729 HOH A O     1 
HETATM 5407 O  O     . HOH L 5 .   ? 71.942 5.686   105.616 1.00 36.40 ? 730 HOH A O     1 
HETATM 5408 O  O     . HOH L 5 .   ? 78.084 27.839  76.679  1.00 33.95 ? 731 HOH A O     1 
HETATM 5409 O  O     . HOH L 5 .   ? 46.419 21.860  81.564  1.00 41.43 ? 732 HOH A O     1 
HETATM 5410 O  O     . HOH L 5 .   ? 59.155 16.629  71.031  1.00 35.01 ? 733 HOH A O     1 
HETATM 5411 O  O     . HOH L 5 .   ? 75.938 28.493  80.929  1.00 27.03 ? 734 HOH A O     1 
HETATM 5412 O  O     . HOH L 5 .   ? 53.228 34.470  108.551 1.00 29.51 ? 735 HOH A O     1 
HETATM 5413 O  O     . HOH L 5 .   ? 57.283 27.047  80.538  1.00 33.27 ? 736 HOH A O     1 
HETATM 5414 O  O     . HOH L 5 .   ? 53.968 37.493  105.588 1.00 32.10 ? 737 HOH A O     1 
HETATM 5415 O  O     . HOH L 5 .   ? 50.615 5.307   91.156  1.00 26.20 ? 738 HOH A O     1 
HETATM 5416 O  O     . HOH L 5 .   ? 40.629 31.048  94.001  1.00 37.84 ? 739 HOH A O     1 
HETATM 5417 O  O     . HOH L 5 .   ? 46.229 41.713  97.069  1.00 28.06 ? 740 HOH A O     1 
HETATM 5418 O  O     . HOH L 5 .   ? 49.780 2.587   84.100  1.00 37.71 ? 741 HOH A O     1 
HETATM 5419 O  O     . HOH L 5 .   ? 70.912 34.545  73.046  1.00 24.68 ? 742 HOH A O     1 
HETATM 5420 O  O     . HOH L 5 .   ? 63.643 -13.314 92.067  1.00 45.47 ? 743 HOH A O     1 
HETATM 5421 O  O     . HOH L 5 .   ? 81.798 -14.761 95.042  1.00 32.94 ? 744 HOH A O     1 
HETATM 5422 O  O     . HOH L 5 .   ? 63.753 23.354  95.020  1.00 33.86 ? 745 HOH A O     1 
HETATM 5423 O  O     . HOH L 5 .   ? 83.896 11.549  86.401  1.00 31.88 ? 746 HOH A O     1 
HETATM 5424 O  O     . HOH L 5 .   ? 57.617 7.712   97.420  1.00 33.30 ? 747 HOH A O     1 
HETATM 5425 O  O     . HOH L 5 .   ? 76.527 -19.189 91.613  1.00 35.71 ? 748 HOH A O     1 
HETATM 5426 O  O     . HOH L 5 .   ? 70.604 28.350  92.291  1.00 34.59 ? 749 HOH A O     1 
HETATM 5427 O  O     . HOH L 5 .   ? 75.424 17.154  107.971 1.00 36.89 ? 750 HOH A O     1 
HETATM 5428 O  O     . HOH L 5 .   ? 58.243 20.771  77.938  1.00 38.23 ? 751 HOH A O     1 
HETATM 5429 O  O     . HOH L 5 .   ? 63.100 11.420  69.376  1.00 36.00 ? 752 HOH A O     1 
HETATM 5430 O  O     . HOH L 5 .   ? 50.719 20.076  95.585  1.00 34.06 ? 753 HOH A O     1 
HETATM 5431 O  O     . HOH L 5 .   ? 69.534 25.655  95.038  1.00 33.64 ? 754 HOH A O     1 
HETATM 5432 O  O     . HOH L 5 .   ? 79.066 16.545  70.322  1.00 34.22 ? 755 HOH A O     1 
HETATM 5433 O  O     . HOH L 5 .   ? 76.999 28.218  98.399  1.00 41.52 ? 756 HOH A O     1 
HETATM 5434 O  O     . HOH L 5 .   ? 70.907 -8.046  89.760  1.00 27.38 ? 757 HOH A O     1 
HETATM 5435 O  O     . HOH L 5 .   ? 59.809 27.562  77.465  1.00 36.40 ? 758 HOH A O     1 
HETATM 5436 O  O     . HOH L 5 .   ? 38.549 28.682  93.255  1.00 38.76 ? 759 HOH A O     1 
HETATM 5437 O  O     . HOH L 5 .   ? 61.573 29.493  92.025  1.00 26.92 ? 760 HOH A O     1 
HETATM 5438 O  O     . HOH L 5 .   ? 73.794 -5.548  82.727  1.00 33.07 ? 761 HOH A O     1 
HETATM 5439 O  O     . HOH L 5 .   ? 76.035 -1.624  77.730  1.00 34.97 ? 762 HOH A O     1 
HETATM 5440 O  O     . HOH L 5 .   ? 64.561 29.313  95.140  1.00 35.07 ? 763 HOH A O     1 
HETATM 5441 O  O     . HOH L 5 .   ? 59.919 -4.558  101.991 1.00 33.56 ? 764 HOH A O     1 
HETATM 5442 O  O     . HOH L 5 .   ? 80.963 18.945  105.987 1.00 35.65 ? 765 HOH A O     1 
HETATM 5443 O  O     . HOH L 5 .   ? 74.006 28.982  96.555  1.00 43.88 ? 766 HOH A O     1 
HETATM 5444 O  O     . HOH L 5 .   ? 64.887 2.992   74.913  1.00 35.65 ? 767 HOH A O     1 
HETATM 5445 O  O     . HOH L 5 .   ? 69.528 4.461   66.441  1.00 37.68 ? 768 HOH A O     1 
HETATM 5446 O  O     . HOH L 5 .   ? 59.692 18.973  76.305  1.00 34.75 ? 769 HOH A O     1 
HETATM 5447 O  O     . HOH L 5 .   ? 55.061 -2.704  95.223  1.00 50.98 ? 770 HOH A O     1 
HETATM 5448 O  O     . HOH L 5 .   ? 60.998 26.941  97.577  1.00 36.10 ? 771 HOH A O     1 
HETATM 5449 O  O     . HOH L 5 .   ? 57.660 16.730  96.285  1.00 35.48 ? 772 HOH A O     1 
HETATM 5450 O  O     . HOH L 5 .   ? 78.739 26.932  98.822  1.00 43.50 ? 773 HOH A O     1 
HETATM 5451 O  O     . HOH L 5 .   ? 76.093 -6.491  85.849  1.00 35.52 ? 774 HOH A O     1 
HETATM 5452 O  O     . HOH L 5 .   ? 79.064 -1.910  86.459  1.00 28.54 ? 775 HOH A O     1 
HETATM 5453 O  O     . HOH L 5 .   ? 87.365 16.822  79.202  1.00 33.53 ? 776 HOH A O     1 
HETATM 5454 O  O     . HOH L 5 .   ? 87.094 25.140  83.964  1.00 29.67 ? 777 HOH A O     1 
HETATM 5455 O  O     . HOH L 5 .   ? 82.199 23.939  82.483  1.00 32.52 ? 778 HOH A O     1 
HETATM 5456 O  O     . HOH L 5 .   ? 84.975 15.032  98.625  1.00 26.44 ? 779 HOH A O     1 
HETATM 5457 O  O     . HOH L 5 .   ? 79.712 28.091  93.879  1.00 37.65 ? 780 HOH A O     1 
HETATM 5458 O  O     . HOH L 5 .   ? 77.448 26.786  94.532  1.00 23.23 ? 781 HOH A O     1 
HETATM 5459 O  O     . HOH L 5 .   ? 83.542 9.572   101.532 1.00 32.22 ? 782 HOH A O     1 
HETATM 5460 O  O     . HOH L 5 .   ? 73.385 -10.678 90.798  1.00 35.04 ? 783 HOH A O     1 
HETATM 5461 O  O     . HOH L 5 .   ? 85.249 -0.601  89.630  1.00 37.16 ? 784 HOH A O     1 
HETATM 5462 O  O     . HOH L 5 .   ? 66.255 36.080  101.180 1.00 40.12 ? 785 HOH A O     1 
HETATM 5463 O  O     . HOH L 5 .   ? 64.321 32.544  99.983  1.00 33.10 ? 786 HOH A O     1 
HETATM 5464 O  O     . HOH L 5 .   ? 62.113 33.412  101.886 1.00 28.21 ? 787 HOH A O     1 
HETATM 5465 O  O     . HOH L 5 .   ? 57.236 36.114  107.630 1.00 33.76 ? 788 HOH A O     1 
HETATM 5466 O  O     . HOH L 5 .   ? 60.227 41.219  108.788 1.00 32.47 ? 789 HOH A O     1 
HETATM 5467 O  O     . HOH L 5 .   ? 64.749 35.561  85.504  1.00 32.15 ? 790 HOH A O     1 
HETATM 5468 O  O     . HOH L 5 .   ? 67.057 34.702  75.316  1.00 35.07 ? 791 HOH A O     1 
HETATM 5469 O  O     . HOH L 5 .   ? 60.247 14.711  93.491  1.00 40.49 ? 792 HOH A O     1 
HETATM 5470 O  O     . HOH L 5 .   ? 59.023 19.477  96.945  1.00 39.17 ? 793 HOH A O     1 
HETATM 5471 O  O     . HOH L 5 .   ? 52.767 -2.516  90.569  1.00 25.09 ? 794 HOH A O     1 
HETATM 5472 O  O     . HOH L 5 .   ? 61.056 -10.084 90.371  1.00 23.25 ? 795 HOH A O     1 
HETATM 5473 O  O     . HOH L 5 .   ? 58.250 0.640   97.921  1.00 26.62 ? 796 HOH A O     1 
HETATM 5474 O  O     . HOH L 5 .   ? 61.692 7.425   104.510 1.00 31.05 ? 797 HOH A O     1 
HETATM 5475 O  O     . HOH M 5 .   ? 71.170 40.444  120.732 1.00 11.32 ? 501 HOH B O     1 
HETATM 5476 O  O     . HOH M 5 .   ? 55.514 25.291  114.013 1.00 20.58 ? 502 HOH B O     1 
HETATM 5477 O  O     . HOH M 5 .   ? 51.902 34.155  116.479 1.00 16.84 ? 503 HOH B O     1 
HETATM 5478 O  O     . HOH M 5 .   ? 85.249 8.242   125.198 1.00 12.61 ? 504 HOH B O     1 
HETATM 5479 O  O     . HOH M 5 .   ? 53.446 29.620  120.347 1.00 16.91 ? 505 HOH B O     1 
HETATM 5480 O  O     . HOH M 5 .   ? 54.737 43.161  114.506 1.00 16.89 ? 506 HOH B O     1 
HETATM 5481 O  O     . HOH M 5 .   ? 58.742 24.924  127.156 1.00 19.51 ? 507 HOH B O     1 
HETATM 5482 O  O     . HOH M 5 .   ? 61.103 30.354  142.258 1.00 18.29 ? 508 HOH B O     1 
HETATM 5483 O  O     . HOH M 5 .   ? 56.770 30.284  134.585 1.00 17.54 ? 509 HOH B O     1 
HETATM 5484 O  O     . HOH M 5 .   ? 48.843 31.009  134.765 1.00 21.50 ? 510 HOH B O     1 
HETATM 5485 O  O     . HOH M 5 .   ? 53.282 49.534  123.286 1.00 17.51 ? 511 HOH B O     1 
HETATM 5486 O  O     . HOH M 5 .   ? 54.560 25.036  116.568 1.00 23.69 ? 512 HOH B O     1 
HETATM 5487 O  O     . HOH M 5 .   ? 47.123 36.636  121.133 1.00 17.76 ? 513 HOH B O     1 
HETATM 5488 O  O     . HOH M 5 .   ? 65.610 57.340  121.251 1.00 26.48 ? 514 HOH B O     1 
HETATM 5489 O  O     . HOH M 5 .   ? 58.125 48.223  137.697 1.00 20.44 ? 515 HOH B O     1 
HETATM 5490 O  O     . HOH M 5 .   ? 69.809 51.164  120.753 1.00 16.39 ? 516 HOH B O     1 
HETATM 5491 O  O     . HOH M 5 .   ? 56.772 39.803  112.192 1.00 23.66 ? 517 HOH B O     1 
HETATM 5492 O  O     . HOH M 5 .   ? 47.023 35.266  129.201 1.00 17.94 ? 518 HOH B O     1 
HETATM 5493 O  O     . HOH M 5 .   ? 55.341 22.313  117.518 1.00 17.29 ? 519 HOH B O     1 
HETATM 5494 O  O     . HOH M 5 .   ? 87.577 11.917  128.387 1.00 17.14 ? 520 HOH B O     1 
HETATM 5495 O  O     . HOH M 5 .   ? 55.533 26.521  111.502 1.00 26.82 ? 521 HOH B O     1 
HETATM 5496 O  O     . HOH M 5 .   ? 66.435 32.566  105.511 1.00 27.21 ? 522 HOH B O     1 
HETATM 5497 O  O     . HOH M 5 .   ? 50.764 48.935  123.339 1.00 23.79 ? 523 HOH B O     1 
HETATM 5498 O  O     . HOH M 5 .   ? 89.410 12.595  130.315 1.00 21.15 ? 524 HOH B O     1 
HETATM 5499 O  O     . HOH M 5 .   ? 61.480 36.917  141.830 1.00 20.94 ? 525 HOH B O     1 
HETATM 5500 O  O     . HOH M 5 .   ? 55.034 33.886  106.691 1.00 20.20 ? 526 HOH B O     1 
HETATM 5501 O  O     . HOH M 5 .   ? 63.966 24.664  108.930 1.00 20.03 ? 527 HOH B O     1 
HETATM 5502 O  O     . HOH M 5 .   ? 63.416 31.165  136.135 1.00 26.10 ? 528 HOH B O     1 
HETATM 5503 O  O     . HOH M 5 .   ? 54.176 49.809  117.186 1.00 23.74 ? 529 HOH B O     1 
HETATM 5504 O  O     . HOH M 5 .   ? 71.343 57.258  123.943 1.00 21.83 ? 530 HOH B O     1 
HETATM 5505 O  O     . HOH M 5 .   ? 64.648 59.230  127.310 1.00 23.68 ? 531 HOH B O     1 
HETATM 5506 O  O     . HOH M 5 .   ? 73.958 40.619  120.711 1.00 26.18 ? 532 HOH B O     1 
HETATM 5507 O  O     . HOH M 5 .   ? 51.050 49.720  139.280 1.00 27.02 ? 533 HOH B O     1 
HETATM 5508 O  O     . HOH M 5 .   ? 58.199 51.141  116.178 1.00 28.16 ? 534 HOH B O     1 
HETATM 5509 O  O     . HOH M 5 .   ? 59.303 12.137  118.145 1.00 20.37 ? 535 HOH B O     1 
HETATM 5510 O  O     . HOH M 5 .   ? 73.479 40.211  117.433 1.00 25.23 ? 536 HOH B O     1 
HETATM 5511 O  O     . HOH M 5 .   ? 60.888 15.091  111.319 1.00 23.29 ? 537 HOH B O     1 
HETATM 5512 O  O     . HOH M 5 .   ? 61.191 44.953  110.126 1.00 25.43 ? 538 HOH B O     1 
HETATM 5513 O  O     . HOH M 5 .   ? 52.532 40.065  113.321 1.00 27.85 ? 539 HOH B O     1 
HETATM 5514 O  O     . HOH M 5 .   ? 70.851 58.867  130.890 1.00 24.89 ? 540 HOH B O     1 
HETATM 5515 O  O     . HOH M 5 .   ? 59.699 22.583  126.013 1.00 23.67 ? 541 HOH B O     1 
HETATM 5516 O  O     . HOH M 5 .   ? 65.175 61.878  123.792 1.00 33.32 ? 542 HOH B O     1 
HETATM 5517 O  O     . HOH M 5 .   ? 43.371 25.223  136.020 1.00 42.14 ? 543 HOH B O     1 
HETATM 5518 O  O     . HOH M 5 .   ? 77.327 55.810  128.921 1.00 34.01 ? 544 HOH B O     1 
HETATM 5519 O  O     . HOH M 5 .   ? 79.636 42.932  133.662 1.00 29.55 ? 545 HOH B O     1 
HETATM 5520 O  O     . HOH M 5 .   ? 67.193 28.921  135.599 1.00 37.62 ? 546 HOH B O     1 
HETATM 5521 O  O     . HOH M 5 .   ? 66.447 14.865  133.028 1.00 32.32 ? 547 HOH B O     1 
HETATM 5522 O  O     . HOH M 5 .   ? 56.234 35.159  143.255 1.00 28.59 ? 548 HOH B O     1 
HETATM 5523 O  O     . HOH M 5 .   ? 75.265 38.089  128.964 1.00 28.40 ? 549 HOH B O     1 
HETATM 5524 O  O     . HOH M 5 .   ? 51.811 60.680  131.915 1.00 34.60 ? 550 HOH B O     1 
HETATM 5525 O  O     . HOH M 5 .   ? 89.673 17.467  135.990 1.00 48.40 ? 551 HOH B O     1 
HETATM 5526 O  O     . HOH M 5 .   ? 64.623 13.366  123.896 1.00 36.04 ? 552 HOH B O     1 
HETATM 5527 O  O     . HOH M 5 .   ? 70.636 38.145  139.103 1.00 32.21 ? 553 HOH B O     1 
HETATM 5528 O  O     . HOH M 5 .   ? 50.568 45.986  117.273 1.00 31.60 ? 554 HOH B O     1 
HETATM 5529 O  O     . HOH M 5 .   ? 69.054 44.405  112.547 1.00 37.56 ? 555 HOH B O     1 
HETATM 5530 O  O     . HOH M 5 .   ? 63.309 12.783  119.473 1.00 35.38 ? 556 HOH B O     1 
HETATM 5531 O  O     . HOH M 5 .   ? 46.303 51.637  135.969 1.00 32.32 ? 557 HOH B O     1 
HETATM 5532 O  O     . HOH M 5 .   ? 42.252 35.177  138.104 1.00 33.43 ? 558 HOH B O     1 
HETATM 5533 O  O     . HOH M 5 .   ? 77.725 2.686   119.872 1.00 30.18 ? 559 HOH B O     1 
HETATM 5534 O  O     . HOH M 5 .   ? 54.857 68.525  138.201 1.00 37.74 ? 560 HOH B O     1 
HETATM 5535 O  O     . HOH M 5 .   ? 65.963 61.807  126.268 1.00 31.24 ? 561 HOH B O     1 
HETATM 5536 O  O     . HOH M 5 .   ? 78.090 39.460  128.350 1.00 30.98 ? 562 HOH B O     1 
HETATM 5537 O  O     . HOH M 5 .   ? 57.990 53.691  122.368 1.00 36.69 ? 563 HOH B O     1 
HETATM 5538 O  O     . HOH M 5 .   ? 69.891 28.399  132.018 1.00 34.64 ? 564 HOH B O     1 
HETATM 5539 O  O     . HOH M 5 .   ? 49.219 40.052  144.511 1.00 30.40 ? 565 HOH B O     1 
HETATM 5540 O  O     . HOH M 5 .   ? 53.514 68.317  135.244 1.00 33.86 ? 566 HOH B O     1 
HETATM 5541 O  O     . HOH M 5 .   ? 56.593 58.759  124.243 1.00 37.44 ? 567 HOH B O     1 
HETATM 5542 O  O     . HOH M 5 .   ? 81.747 30.813  144.306 1.00 46.25 ? 568 HOH B O     1 
HETATM 5543 O  O     . HOH M 5 .   ? 53.787 52.364  123.221 1.00 31.28 ? 569 HOH B O     1 
HETATM 5544 O  O     . HOH M 5 .   ? 72.888 41.632  114.467 1.00 27.31 ? 570 HOH B O     1 
HETATM 5545 O  O     . HOH M 5 .   ? 57.794 26.679  105.984 1.00 26.88 ? 571 HOH B O     1 
HETATM 5546 O  O     . HOH M 5 .   ? 60.417 23.910  123.691 1.00 25.19 ? 572 HOH B O     1 
HETATM 5547 O  O     . HOH M 5 .   ? 61.749 21.737  127.469 1.00 28.65 ? 573 HOH B O     1 
HETATM 5548 O  O     . HOH M 5 .   ? 62.115 52.817  112.801 1.00 33.36 ? 574 HOH B O     1 
HETATM 5549 O  O     . HOH M 5 .   ? 64.886 23.937  112.298 1.00 26.26 ? 575 HOH B O     1 
HETATM 5550 O  O     . HOH M 5 .   ? 71.112 34.701  133.704 1.00 30.46 ? 576 HOH B O     1 
HETATM 5551 O  O     . HOH M 5 .   ? 68.603 25.260  136.311 1.00 39.78 ? 577 HOH B O     1 
HETATM 5552 O  O     . HOH M 5 .   ? 46.688 33.889  143.972 1.00 25.91 ? 578 HOH B O     1 
HETATM 5553 O  O     . HOH M 5 .   ? 58.351 40.883  109.833 1.00 31.23 ? 579 HOH B O     1 
HETATM 5554 O  O     . HOH M 5 .   ? 67.508 19.325  131.400 1.00 32.51 ? 580 HOH B O     1 
HETATM 5555 O  O     . HOH M 5 .   ? 61.672 42.211  110.079 1.00 24.39 ? 581 HOH B O     1 
HETATM 5556 O  O     . HOH M 5 .   ? 67.660 60.658  134.401 1.00 33.85 ? 582 HOH B O     1 
HETATM 5557 O  O     . HOH M 5 .   ? 44.682 45.041  129.686 1.00 37.87 ? 583 HOH B O     1 
HETATM 5558 O  O     . HOH M 5 .   ? 44.404 40.426  120.705 1.00 42.92 ? 584 HOH B O     1 
HETATM 5559 O  O     . HOH M 5 .   ? 51.256 28.926  143.316 1.00 44.49 ? 585 HOH B O     1 
HETATM 5560 O  O     . HOH M 5 .   ? 80.393 37.922  135.605 1.00 35.64 ? 586 HOH B O     1 
HETATM 5561 O  O     . HOH M 5 .   ? 64.077 22.143  110.451 1.00 30.69 ? 587 HOH B O     1 
HETATM 5562 O  O     . HOH M 5 .   ? 71.818 27.629  121.078 1.00 24.15 ? 588 HOH B O     1 
HETATM 5563 O  O     . HOH M 5 .   ? 47.741 45.291  139.263 1.00 30.86 ? 589 HOH B O     1 
HETATM 5564 O  O     . HOH M 5 .   ? 73.946 47.860  138.310 1.00 41.19 ? 590 HOH B O     1 
HETATM 5565 O  O     . HOH M 5 .   ? 68.460 41.217  142.412 1.00 39.81 ? 591 HOH B O     1 
HETATM 5566 O  O     . HOH M 5 .   ? 63.864 32.259  138.758 1.00 29.20 ? 592 HOH B O     1 
HETATM 5567 O  O     . HOH M 5 .   ? 66.631 28.058  107.276 1.00 40.50 ? 593 HOH B O     1 
HETATM 5568 O  O     . HOH M 5 .   ? 65.341 41.086  111.797 1.00 31.86 ? 594 HOH B O     1 
HETATM 5569 O  O     . HOH M 5 .   ? 48.651 27.136  118.497 1.00 28.26 ? 595 HOH B O     1 
HETATM 5570 O  O     . HOH M 5 .   ? 51.060 32.964  144.474 1.00 34.35 ? 596 HOH B O     1 
HETATM 5571 O  O     . HOH M 5 .   ? 58.412 20.854  105.951 1.00 32.67 ? 597 HOH B O     1 
HETATM 5572 O  O     . HOH M 5 .   ? 59.379 50.546  138.783 1.00 29.53 ? 598 HOH B O     1 
HETATM 5573 O  O     . HOH M 5 .   ? 57.850 60.769  129.913 1.00 32.91 ? 599 HOH B O     1 
HETATM 5574 O  O     . HOH M 5 .   ? 73.318 11.813  145.250 1.00 30.35 ? 600 HOH B O     1 
HETATM 5575 O  O     . HOH M 5 .   ? 56.100 53.610  124.114 1.00 33.95 ? 601 HOH B O     1 
HETATM 5576 O  O     . HOH M 5 .   ? 58.998 44.382  107.599 1.00 42.92 ? 602 HOH B O     1 
HETATM 5577 O  O     . HOH M 5 .   ? 56.476 22.638  107.714 1.00 29.70 ? 603 HOH B O     1 
HETATM 5578 O  O     . HOH M 5 .   ? 60.820 12.159  115.441 1.00 33.37 ? 604 HOH B O     1 
HETATM 5579 O  O     . HOH M 5 .   ? 65.423 27.319  105.679 1.00 38.18 ? 605 HOH B O     1 
HETATM 5580 O  O     . HOH M 5 .   ? 78.648 15.862  146.994 1.00 34.96 ? 606 HOH B O     1 
HETATM 5581 O  O     . HOH M 5 .   ? 76.943 22.648  124.128 1.00 26.43 ? 607 HOH B O     1 
HETATM 5582 O  O     . HOH M 5 .   ? 58.016 49.037  141.506 1.00 30.56 ? 608 HOH B O     1 
HETATM 5583 O  O     . HOH M 5 .   ? 53.812 20.072  116.188 1.00 36.94 ? 609 HOH B O     1 
HETATM 5584 O  O     . HOH M 5 .   ? 45.461 31.521  141.352 1.00 31.44 ? 610 HOH B O     1 
HETATM 5585 O  O     . HOH M 5 .   ? 49.268 21.559  139.748 1.00 42.04 ? 611 HOH B O     1 
HETATM 5586 O  O     . HOH M 5 .   ? 69.129 17.369  120.151 1.00 30.90 ? 612 HOH B O     1 
HETATM 5587 O  O     . HOH M 5 .   ? 52.687 58.666  133.730 1.00 32.32 ? 613 HOH B O     1 
HETATM 5588 O  O     . HOH M 5 .   ? 57.056 24.955  134.438 1.00 34.58 ? 614 HOH B O     1 
HETATM 5589 O  O     . HOH M 5 .   ? 49.277 46.788  119.492 1.00 35.66 ? 615 HOH B O     1 
HETATM 5590 O  O     . HOH M 5 .   ? 68.275 31.011  126.718 1.00 30.84 ? 616 HOH B O     1 
HETATM 5591 O  O     . HOH M 5 .   ? 65.238 23.431  115.669 1.00 26.05 ? 617 HOH B O     1 
HETATM 5592 O  O     . HOH M 5 .   ? 73.768 35.497  111.545 1.00 43.65 ? 618 HOH B O     1 
HETATM 5593 O  O     . HOH M 5 .   ? 69.303 40.220  109.092 1.00 35.12 ? 619 HOH B O     1 
HETATM 5594 O  O     . HOH M 5 .   ? 50.175 41.715  114.123 1.00 41.24 ? 620 HOH B O     1 
HETATM 5595 O  O     . HOH M 5 .   ? 73.348 21.749  120.728 1.00 30.14 ? 621 HOH B O     1 
HETATM 5596 O  O     . HOH M 5 .   ? 75.347 11.884  153.125 1.00 31.36 ? 622 HOH B O     1 
HETATM 5597 O  O     . HOH M 5 .   ? 70.927 25.000  121.733 1.00 25.42 ? 623 HOH B O     1 
HETATM 5598 O  O     . HOH M 5 .   ? 45.932 40.957  123.852 1.00 27.05 ? 624 HOH B O     1 
HETATM 5599 O  O     . HOH M 5 .   ? 50.898 62.341  135.739 1.00 40.07 ? 625 HOH B O     1 
HETATM 5600 O  O     . HOH M 5 .   ? 84.335 20.750  125.289 1.00 30.68 ? 626 HOH B O     1 
HETATM 5601 O  O     . HOH M 5 .   ? 72.897 19.184  120.603 1.00 41.83 ? 627 HOH B O     1 
HETATM 5602 O  O     . HOH M 5 .   ? 59.130 34.530  108.653 1.00 28.17 ? 628 HOH B O     1 
HETATM 5603 O  O     . HOH M 5 .   ? 73.091 23.597  122.697 1.00 29.11 ? 629 HOH B O     1 
HETATM 5604 O  O     . HOH M 5 .   ? 74.338 26.881  130.117 1.00 13.02 ? 630 HOH B O     1 
HETATM 5605 O  O     . HOH M 5 .   ? 84.480 20.628  122.346 1.00 28.75 ? 631 HOH B O     1 
HETATM 5606 O  O     . HOH M 5 .   ? 74.899 37.956  114.509 1.00 32.58 ? 632 HOH B O     1 
HETATM 5607 O  O     . HOH M 5 .   ? 50.466 21.962  134.474 1.00 38.44 ? 633 HOH B O     1 
HETATM 5608 O  O     . HOH M 5 .   ? 53.749 54.748  129.440 1.00 26.91 ? 634 HOH B O     1 
HETATM 5609 O  O     . HOH M 5 .   ? 52.839 21.501  130.820 1.00 37.33 ? 635 HOH B O     1 
HETATM 5610 O  O     . HOH M 5 .   ? 57.451 11.391  121.115 1.00 27.08 ? 636 HOH B O     1 
HETATM 5611 O  O     . HOH M 5 .   ? 71.077 47.995  138.771 1.00 34.14 ? 637 HOH B O     1 
HETATM 5612 O  O     . HOH M 5 .   ? 66.351 42.415  113.251 1.00 29.51 ? 638 HOH B O     1 
HETATM 5613 O  O     . HOH M 5 .   ? 64.368 33.974  104.292 1.00 31.88 ? 639 HOH B O     1 
HETATM 5614 O  O     . HOH M 5 .   ? 75.564 35.390  127.993 1.00 35.14 ? 640 HOH B O     1 
HETATM 5615 O  O     . HOH M 5 .   ? 47.976 44.325  120.058 1.00 46.18 ? 641 HOH B O     1 
HETATM 5616 O  O     . HOH M 5 .   ? 66.934 24.587  111.783 1.00 37.73 ? 642 HOH B O     1 
HETATM 5617 O  O     . HOH M 5 .   ? 54.500 49.337  120.674 1.00 28.40 ? 643 HOH B O     1 
HETATM 5618 O  O     . HOH M 5 .   ? 52.886 69.149  137.266 1.00 36.91 ? 644 HOH B O     1 
HETATM 5619 O  O     . HOH M 5 .   ? 60.581 57.740  128.575 1.00 28.39 ? 645 HOH B O     1 
HETATM 5620 O  O     . HOH M 5 .   ? 70.752 11.859  146.961 1.00 27.65 ? 646 HOH B O     1 
HETATM 5621 O  O     . HOH M 5 .   ? 61.627 18.107  106.939 1.00 34.03 ? 647 HOH B O     1 
HETATM 5622 O  O     . HOH M 5 .   ? 69.131 33.888  133.367 1.00 42.02 ? 648 HOH B O     1 
HETATM 5623 O  O     . HOH M 5 .   ? 54.473 53.511  140.848 1.00 35.16 ? 649 HOH B O     1 
HETATM 5624 O  O     . HOH M 5 .   ? 74.200 54.420  135.258 1.00 34.36 ? 650 HOH B O     1 
HETATM 5625 O  O     . HOH M 5 .   ? 56.682 37.224  110.588 1.00 28.34 ? 651 HOH B O     1 
HETATM 5626 O  O     . HOH M 5 .   ? 81.857 3.095   131.575 1.00 33.84 ? 652 HOH B O     1 
HETATM 5627 O  O     . HOH M 5 .   ? 59.119 15.257  109.377 1.00 34.96 ? 653 HOH B O     1 
HETATM 5628 O  O     . HOH M 5 .   ? 77.198 51.856  127.827 1.00 30.12 ? 654 HOH B O     1 
HETATM 5629 O  O     . HOH M 5 .   ? 56.184 54.159  138.811 1.00 31.60 ? 655 HOH B O     1 
HETATM 5630 O  O     . HOH M 5 .   ? 47.184 23.966  120.404 1.00 35.60 ? 656 HOH B O     1 
HETATM 5631 O  O     . HOH M 5 .   ? 53.505 28.721  141.371 1.00 33.91 ? 657 HOH B O     1 
HETATM 5632 O  O     . HOH M 5 .   ? 58.519 28.147  132.514 1.00 25.59 ? 658 HOH B O     1 
HETATM 5633 O  O     . HOH M 5 .   ? 82.507 24.197  126.056 1.00 37.61 ? 659 HOH B O     1 
HETATM 5634 O  O     . HOH M 5 .   ? 43.440 45.848  125.254 1.00 33.52 ? 660 HOH B O     1 
HETATM 5635 O  O     . HOH M 5 .   ? 57.320 42.459  107.776 1.00 42.49 ? 661 HOH B O     1 
HETATM 5636 O  O     . HOH M 5 .   ? 67.605 28.093  103.617 1.00 30.23 ? 662 HOH B O     1 
HETATM 5637 O  O     . HOH M 5 .   ? 63.110 29.472  140.236 1.00 42.05 ? 663 HOH B O     1 
HETATM 5638 O  O     . HOH M 5 .   ? 67.299 48.341  107.696 1.00 37.25 ? 664 HOH B O     1 
HETATM 5639 O  O     . HOH M 5 .   ? 54.053 49.412  142.775 1.00 39.89 ? 665 HOH B O     1 
HETATM 5640 O  O     . HOH M 5 .   ? 62.711 59.178  129.066 1.00 34.96 ? 666 HOH B O     1 
HETATM 5641 O  O     . HOH M 5 .   ? 53.816 20.482  108.876 1.00 32.37 ? 667 HOH B O     1 
HETATM 5642 O  O     . HOH M 5 .   ? 52.599 66.536  139.709 1.00 30.88 ? 668 HOH B O     1 
HETATM 5643 O  O     . HOH M 5 .   ? 55.707 51.987  120.720 1.00 40.83 ? 669 HOH B O     1 
HETATM 5644 O  O     . HOH M 5 .   ? 51.224 55.393  132.109 1.00 30.65 ? 670 HOH B O     1 
HETATM 5645 O  O     . HOH M 5 .   ? 67.615 22.546  111.431 1.00 37.12 ? 671 HOH B O     1 
HETATM 5646 O  O     . HOH M 5 .   ? 72.815 49.132  140.475 1.00 40.23 ? 672 HOH B O     1 
HETATM 5647 O  O     . HOH M 5 .   ? 51.420 55.014  129.336 1.00 37.85 ? 673 HOH B O     1 
HETATM 5648 O  O     . HOH M 5 .   ? 89.077 8.549   136.085 1.00 37.84 ? 674 HOH B O     1 
HETATM 5649 O  O     . HOH M 5 .   ? 73.664 40.663  137.028 1.00 31.66 ? 675 HOH B O     1 
HETATM 5650 O  O     . HOH M 5 .   ? 49.710 27.596  139.345 1.00 40.06 ? 676 HOH B O     1 
HETATM 5651 O  O     . HOH M 5 .   ? 59.029 52.839  139.268 1.00 39.10 ? 677 HOH B O     1 
HETATM 5652 O  O     . HOH M 5 .   ? 63.763 37.797  142.641 1.00 32.26 ? 678 HOH B O     1 
HETATM 5653 O  O     . HOH M 5 .   ? 53.140 18.962  113.101 1.00 32.32 ? 679 HOH B O     1 
HETATM 5654 O  O     . HOH M 5 .   ? 64.917 35.488  141.022 1.00 36.83 ? 680 HOH B O     1 
HETATM 5655 O  O     . HOH M 5 .   ? 43.200 38.075  135.530 1.00 36.17 ? 681 HOH B O     1 
HETATM 5656 O  O     . HOH M 5 .   ? 57.049 41.909  143.707 1.00 43.28 ? 682 HOH B O     1 
HETATM 5657 O  O     . HOH M 5 .   ? 67.675 30.854  103.177 1.00 33.98 ? 683 HOH B O     1 
HETATM 5658 O  O     . HOH M 5 .   ? 40.438 33.170  131.835 1.00 42.79 ? 684 HOH B O     1 
HETATM 5659 O  O     . HOH M 5 .   ? 58.470 27.334  134.620 1.00 33.84 ? 685 HOH B O     1 
HETATM 5660 O  O     . HOH M 5 .   ? 43.733 40.581  134.277 1.00 41.26 ? 686 HOH B O     1 
HETATM 5661 O  O     . HOH M 5 .   ? 41.730 33.648  133.601 1.00 43.24 ? 687 HOH B O     1 
HETATM 5662 O  O     . HOH M 5 .   ? 48.957 53.141  135.484 1.00 23.07 ? 688 HOH B O     1 
HETATM 5663 O  O     . HOH M 5 .   ? 42.030 22.917  134.998 1.00 45.28 ? 689 HOH B O     1 
HETATM 5664 O  O     . HOH M 5 .   ? 56.612 16.502  126.581 1.00 39.94 ? 690 HOH B O     1 
HETATM 5665 O  O     . HOH M 5 .   ? 75.182 54.316  127.647 1.00 22.87 ? 691 HOH B O     1 
HETATM 5666 O  O     . HOH M 5 .   ? 67.753 26.893  134.951 1.00 35.75 ? 692 HOH B O     1 
HETATM 5667 O  O     . HOH M 5 .   ? 66.320 28.740  125.943 1.00 30.95 ? 693 HOH B O     1 
HETATM 5668 O  O     . HOH M 5 .   ? 69.420 20.643  133.127 1.00 27.29 ? 694 HOH B O     1 
HETATM 5669 O  O     . HOH M 5 .   ? 56.609 20.145  130.175 1.00 40.67 ? 695 HOH B O     1 
HETATM 5670 O  O     . HOH M 5 .   ? 59.016 20.995  129.403 1.00 42.79 ? 696 HOH B O     1 
HETATM 5671 O  O     . HOH M 5 .   ? 49.512 50.477  125.139 1.00 26.37 ? 697 HOH B O     1 
HETATM 5672 O  O     . HOH M 5 .   ? 42.456 40.859  130.270 1.00 20.64 ? 698 HOH B O     1 
HETATM 5673 O  O     . HOH M 5 .   ? 43.764 35.935  133.621 1.00 28.59 ? 699 HOH B O     1 
HETATM 5674 O  O     . HOH M 5 .   ? 47.872 28.162  138.376 1.00 42.10 ? 700 HOH B O     1 
HETATM 5675 O  O     . HOH M 5 .   ? 43.115 28.605  135.014 1.00 31.01 ? 701 HOH B O     1 
HETATM 5676 O  O     . HOH M 5 .   ? 50.576 23.619  130.695 1.00 24.16 ? 702 HOH B O     1 
HETATM 5677 O  O     . HOH M 5 .   ? 53.435 19.538  127.057 1.00 27.03 ? 703 HOH B O     1 
HETATM 5678 O  O     . HOH M 5 .   ? 50.992 28.749  140.952 1.00 38.71 ? 704 HOH B O     1 
HETATM 5679 O  O     . HOH M 5 .   ? 60.972 54.389  117.717 1.00 37.72 ? 705 HOH B O     1 
HETATM 5680 O  O     . HOH M 5 .   ? 59.262 55.805  120.824 1.00 38.47 ? 706 HOH B O     1 
HETATM 5681 O  O     . HOH M 5 .   ? 64.247 41.533  109.903 1.00 27.62 ? 707 HOH B O     1 
HETATM 5682 O  O     . HOH M 5 .   ? 54.761 47.214  109.508 1.00 35.96 ? 708 HOH B O     1 
HETATM 5683 O  O     . HOH M 5 .   ? 74.098 38.174  141.154 1.00 42.41 ? 709 HOH B O     1 
HETATM 5684 O  O     . HOH M 5 .   ? 73.221 38.906  138.547 1.00 33.38 ? 710 HOH B O     1 
HETATM 5685 O  O     . HOH M 5 .   ? 64.448 15.102  129.472 1.00 39.63 ? 711 HOH B O     1 
HETATM 5686 O  O     . HOH M 5 .   ? 70.679 7.423   120.244 1.00 44.54 ? 712 HOH B O     1 
HETATM 5687 O  O     . HOH M 5 .   ? 62.873 16.640  125.108 1.00 29.66 ? 713 HOH B O     1 
HETATM 5688 O  O     . HOH M 5 .   ? 58.021 24.560  114.513 1.00 15.34 ? 714 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   37  ?   ?   ?   A . n 
A 1 2   ASP 2   38  38  ASP ASP A . n 
A 1 3   MET 3   39  39  MET MET A . n 
A 1 4   SER 4   40  40  SER SER A . n 
A 1 5   HIS 5   41  41  HIS HIS A . n 
A 1 6   LYS 6   42  42  LYS LYS A . n 
A 1 7   GLU 7   43  43  GLU GLU A . n 
A 1 8   PHE 8   44  44  PHE PHE A . n 
A 1 9   THR 9   45  45  THR THR A . n 
A 1 10  LYS 10  46  46  LYS LYS A . n 
A 1 11  PHE 11  47  47  PHE PHE A . n 
A 1 12  CYS 12  48  48  CYS CYS A . n 
A 1 13  TYR 13  49  49  TYR TYR A . n 
A 1 14  GLU 14  50  50  GLU GLU A . n 
A 1 15  VAL 15  51  51  VAL VAL A . n 
A 1 16  TYR 16  52  52  TYR TYR A . n 
A 1 17  ASN 17  53  53  ASN ASN A . n 
A 1 18  GLU 18  54  54  GLU GLU A . n 
A 1 19  ILE 19  55  55  ILE ILE A . n 
A 1 20  LYS 20  56  56  LYS LYS A . n 
A 1 21  ILE 21  57  57  ILE ILE A . n 
A 1 22  SER 22  58  58  SER SER A . n 
A 1 23  ASP 23  59  59  ASP ASP A . n 
A 1 24  LYS 24  60  60  LYS LYS A . n 
A 1 25  GLU 25  61  61  GLU GLU A . n 
A 1 26  PHE 26  62  62  PHE PHE A . n 
A 1 27  LYS 27  63  63  LYS LYS A . n 
A 1 28  GLU 28  64  64  GLU GLU A . n 
A 1 29  LYS 29  65  65  LYS LYS A . n 
A 1 30  ARG 30  66  66  ARG ARG A . n 
A 1 31  ALA 31  67  67  ALA ALA A . n 
A 1 32  ALA 32  68  68  ALA ALA A . n 
A 1 33  LEU 33  69  69  LEU LEU A . n 
A 1 34  ASP 34  70  70  ASP ASP A . n 
A 1 35  THR 35  71  71  THR THR A . n 
A 1 36  LEU 36  72  72  LEU LEU A . n 
A 1 37  ARG 37  73  73  ARG ARG A . n 
A 1 38  LEU 38  74  74  LEU LEU A . n 
A 1 39  CYS 39  75  75  CYS CYS A . n 
A 1 40  LEU 40  76  76  LEU LEU A . n 
A 1 41  LYS 41  77  77  LYS LYS A . n 
A 1 42  ARG 42  78  78  ARG ARG A . n 
A 1 43  ILE 43  79  79  ILE ILE A . n 
A 1 44  SER 44  80  80  SER SER A . n 
A 1 45  PRO 45  81  81  PRO PRO A . n 
A 1 46  ASP 46  82  82  ASP ASP A . n 
A 1 47  ALA 47  83  83  ALA ALA A . n 
A 1 48  GLU 48  84  84  GLU GLU A . n 
A 1 49  LEU 49  85  85  LEU LEU A . n 
A 1 50  VAL 50  86  86  VAL VAL A . n 
A 1 51  ALA 51  87  87  ALA ALA A . n 
A 1 52  PHE 52  88  88  PHE PHE A . n 
A 1 53  GLY 53  89  89  GLY GLY A . n 
A 1 54  SER 54  90  90  SER SER A . n 
A 1 55  LEU 55  91  91  LEU LEU A . n 
A 1 56  GLU 56  92  92  GLU GLU A . n 
A 1 57  SER 57  93  93  SER SER A . n 
A 1 58  GLY 58  94  94  GLY GLY A . n 
A 1 59  LEU 59  95  95  LEU LEU A . n 
A 1 60  ALA 60  96  96  ALA ALA A . n 
A 1 61  LEU 61  97  97  LEU LEU A . n 
A 1 62  LYS 62  98  98  LYS LYS A . n 
A 1 63  ASN 63  99  99  ASN ASN A . n 
A 1 64  SER 64  100 100 SER SER A . n 
A 1 65  ASP 65  101 101 ASP ASP A . n 
A 1 66  MET 66  102 102 MET MET A . n 
A 1 67  ASP 67  103 103 ASP ASP A . n 
A 1 68  LEU 68  104 104 LEU LEU A . n 
A 1 69  CYS 69  105 105 CYS CYS A . n 
A 1 70  VAL 70  106 106 VAL VAL A . n 
A 1 71  LEU 71  107 107 LEU LEU A . n 
A 1 72  MET 72  108 108 MET MET A . n 
A 1 73  ASP 73  109 ?   ?   ?   A . n 
A 1 74  SER 74  110 ?   ?   ?   A . n 
A 1 75  ARG 75  111 ?   ?   ?   A . n 
A 1 76  VAL 76  112 ?   ?   ?   A . n 
A 1 77  GLN 77  113 ?   ?   ?   A . n 
A 1 78  SER 78  114 ?   ?   ?   A . n 
A 1 79  ASP 79  115 ?   ?   ?   A . n 
A 1 80  THR 80  116 116 THR THR A . n 
A 1 81  ILE 81  117 117 ILE ILE A . n 
A 1 82  ALA 82  118 118 ALA ALA A . n 
A 1 83  LEU 83  119 119 LEU LEU A . n 
A 1 84  GLN 84  120 120 GLN GLN A . n 
A 1 85  PHE 85  121 121 PHE PHE A . n 
A 1 86  TYR 86  122 122 TYR TYR A . n 
A 1 87  GLU 87  123 123 GLU GLU A . n 
A 1 88  GLU 88  124 124 GLU GLU A . n 
A 1 89  LEU 89  125 125 LEU LEU A . n 
A 1 90  ILE 90  126 126 ILE ILE A . n 
A 1 91  ALA 91  127 127 ALA ALA A . n 
A 1 92  GLU 92  128 128 GLU GLU A . n 
A 1 93  GLY 93  129 129 GLY GLY A . n 
A 1 94  PHE 94  130 130 PHE PHE A . n 
A 1 95  GLU 95  131 131 GLU GLU A . n 
A 1 96  GLY 96  132 132 GLY GLY A . n 
A 1 97  LYS 97  133 133 LYS LYS A . n 
A 1 98  PHE 98  134 134 PHE PHE A . n 
A 1 99  LEU 99  135 135 LEU LEU A . n 
A 1 100 GLN 100 136 136 GLN GLN A . n 
A 1 101 ARG 101 137 137 ARG ARG A . n 
A 1 102 ALA 102 138 138 ALA ALA A . n 
A 1 103 ARG 103 139 139 ARG ARG A . n 
A 1 104 ILE 104 140 140 ILE ILE A . n 
A 1 105 PRO 105 141 141 PRO PRO A . n 
A 1 106 ILE 106 142 142 ILE ILE A . n 
A 1 107 ILE 107 143 143 ILE ILE A . n 
A 1 108 LYS 108 144 144 LYS LYS A . n 
A 1 109 LEU 109 145 145 LEU LEU A . n 
A 1 110 THR 110 146 146 THR THR A . n 
A 1 111 SER 111 147 147 SER SER A . n 
A 1 112 ASP 112 148 148 ASP ASP A . n 
A 1 113 THR 113 149 149 THR THR A . n 
A 1 114 LYS 114 150 150 LYS LYS A . n 
A 1 115 ASN 115 151 151 ASN ASN A . n 
A 1 116 GLY 116 152 152 GLY GLY A . n 
A 1 117 PHE 117 153 153 PHE PHE A . n 
A 1 118 GLY 118 154 154 GLY GLY A . n 
A 1 119 ALA 119 155 155 ALA ALA A . n 
A 1 120 SER 120 156 156 SER SER A . n 
A 1 121 PHE 121 157 157 PHE PHE A . n 
A 1 122 GLN 122 158 158 GLN GLN A . n 
A 1 123 CYS 123 159 159 CYS CYS A . n 
A 1 124 ALA 124 160 160 ALA ALA A . n 
A 1 125 ILE 125 161 161 ILE ILE A . n 
A 1 126 GLY 126 162 162 GLY GLY A . n 
A 1 127 PHE 127 163 163 PHE PHE A . n 
A 1 128 ASN 128 164 164 ASN ASN A . n 
A 1 129 ASN 129 165 165 ASN ASN A . n 
A 1 130 ARG 130 166 166 ARG ARG A . n 
A 1 131 LEU 131 167 167 LEU LEU A . n 
A 1 132 ALA 132 168 168 ALA ALA A . n 
A 1 133 ILE 133 169 169 ILE ILE A . n 
A 1 134 HIS 134 170 170 HIS HIS A . n 
A 1 135 ASN 135 171 171 ASN ASN A . n 
A 1 136 THR 136 172 172 THR THR A . n 
A 1 137 LEU 137 173 173 LEU LEU A . n 
A 1 138 LEU 138 174 174 LEU LEU A . n 
A 1 139 LEU 139 175 175 LEU LEU A . n 
A 1 140 SER 140 176 176 SER SER A . n 
A 1 141 SER 141 177 177 SER SER A . n 
A 1 142 TYR 142 178 178 TYR TYR A . n 
A 1 143 THR 143 179 179 THR THR A . n 
A 1 144 LYS 144 180 180 LYS LYS A . n 
A 1 145 LEU 145 181 181 LEU LEU A . n 
A 1 146 ASP 146 182 182 ASP ASP A . n 
A 1 147 ALA 147 183 183 ALA ALA A . n 
A 1 148 ARG 148 184 184 ARG ARG A . n 
A 1 149 LEU 149 185 185 LEU LEU A . n 
A 1 150 LYS 150 186 186 LYS LYS A . n 
A 1 151 PRO 151 187 187 PRO PRO A . n 
A 1 152 MET 152 188 188 MET MET A . n 
A 1 153 VAL 153 189 189 VAL VAL A . n 
A 1 154 LEU 154 190 190 LEU LEU A . n 
A 1 155 LEU 155 191 191 LEU LEU A . n 
A 1 156 VAL 156 192 192 VAL VAL A . n 
A 1 157 LYS 157 193 193 LYS LYS A . n 
A 1 158 HIS 158 194 194 HIS HIS A . n 
A 1 159 TRP 159 195 195 TRP TRP A . n 
A 1 160 ALA 160 196 196 ALA ALA A . n 
A 1 161 LYS 161 197 197 LYS LYS A . n 
A 1 162 ARG 162 198 198 ARG ARG A . n 
A 1 163 LYS 163 199 199 LYS LYS A . n 
A 1 164 GLN 164 200 200 GLN GLN A . n 
A 1 165 ILE 165 201 201 ILE ILE A . n 
A 1 166 ASN 166 202 202 ASN ASN A . n 
A 1 167 SER 167 203 203 SER SER A . n 
A 1 168 PRO 168 204 204 PRO PRO A . n 
A 1 169 TYR 169 205 205 TYR TYR A . n 
A 1 170 PHE 170 206 206 PHE PHE A . n 
A 1 171 GLY 171 207 207 GLY GLY A . n 
A 1 172 THR 172 208 208 THR THR A . n 
A 1 173 LEU 173 209 209 LEU LEU A . n 
A 1 174 SER 174 210 210 SER SER A . n 
A 1 175 SER 175 211 211 SER SER A . n 
A 1 176 TYR 176 212 212 TYR TYR A . n 
A 1 177 GLY 177 213 213 GLY GLY A . n 
A 1 178 TYR 178 214 214 TYR TYR A . n 
A 1 179 VAL 179 215 215 VAL VAL A . n 
A 1 180 LEU 180 216 216 LEU LEU A . n 
A 1 181 MET 181 217 217 MET MET A . n 
A 1 182 VAL 182 218 218 VAL VAL A . n 
A 1 183 LEU 183 219 219 LEU LEU A . n 
A 1 184 TYR 184 220 220 TYR TYR A . n 
A 1 185 TYR 185 221 221 TYR TYR A . n 
A 1 186 LEU 186 222 222 LEU LEU A . n 
A 1 187 ILE 187 223 223 ILE ILE A . n 
A 1 188 HIS 188 224 224 HIS HIS A . n 
A 1 189 VAL 189 225 225 VAL VAL A . n 
A 1 190 ILE 190 226 226 ILE ILE A . n 
A 1 191 LYS 191 227 227 LYS LYS A . n 
A 1 192 PRO 192 228 228 PRO PRO A . n 
A 1 193 PRO 193 229 229 PRO PRO A . n 
A 1 194 VAL 194 230 230 VAL VAL A . n 
A 1 195 PHE 195 231 231 PHE PHE A . n 
A 1 196 PRO 196 232 232 PRO PRO A . n 
A 1 197 ASN 197 233 233 ASN ASN A . n 
A 1 198 LEU 198 234 234 LEU LEU A . n 
A 1 199 LEU 199 235 235 LEU LEU A . n 
A 1 200 LEU 200 236 236 LEU LEU A . n 
A 1 201 SER 201 237 237 SER SER A . n 
A 1 202 PRO 202 238 238 PRO PRO A . n 
A 1 203 LEU 203 239 239 LEU LEU A . n 
A 1 204 LYS 204 240 240 LYS LYS A . n 
A 1 205 GLN 205 241 241 GLN GLN A . n 
A 1 206 GLU 206 242 242 GLU GLU A . n 
A 1 207 LYS 207 243 243 LYS LYS A . n 
A 1 208 ILE 208 244 244 ILE ILE A . n 
A 1 209 VAL 209 245 245 VAL VAL A . n 
A 1 210 ASP 210 246 246 ASP ASP A . n 
A 1 211 GLY 211 247 247 GLY GLY A . n 
A 1 212 PHE 212 248 248 PHE PHE A . n 
A 1 213 ASP 213 249 249 ASP ASP A . n 
A 1 214 VAL 214 250 250 VAL VAL A . n 
A 1 215 GLY 215 251 251 GLY GLY A . n 
A 1 216 PHE 216 252 252 PHE PHE A . n 
A 1 217 ASP 217 253 253 ASP ASP A . n 
A 1 218 ASP 218 254 254 ASP ASP A . n 
A 1 219 LYS 219 255 255 LYS LYS A . n 
A 1 220 LEU 220 256 256 LEU LEU A . n 
A 1 221 GLU 221 257 257 GLU GLU A . n 
A 1 222 ASP 222 258 258 ASP ASP A . n 
A 1 223 ILE 223 259 259 ILE ILE A . n 
A 1 224 PRO 224 260 260 PRO PRO A . n 
A 1 225 PRO 225 261 261 PRO PRO A . n 
A 1 226 SER 226 262 262 SER SER A . n 
A 1 227 GLN 227 263 263 GLN GLN A . n 
A 1 228 ASN 228 264 264 ASN ASN A . n 
A 1 229 TYR 229 265 265 TYR TYR A . n 
A 1 230 SER 230 266 266 SER SER A . n 
A 1 231 SER 231 267 267 SER SER A . n 
A 1 232 LEU 232 268 268 LEU LEU A . n 
A 1 233 GLY 233 269 269 GLY GLY A . n 
A 1 234 SER 234 270 270 SER SER A . n 
A 1 235 LEU 235 271 271 LEU LEU A . n 
A 1 236 LEU 236 272 272 LEU LEU A . n 
A 1 237 HIS 237 273 273 HIS HIS A . n 
A 1 238 GLY 238 274 274 GLY GLY A . n 
A 1 239 PHE 239 275 275 PHE PHE A . n 
A 1 240 PHE 240 276 276 PHE PHE A . n 
A 1 241 ARG 241 277 277 ARG ARG A . n 
A 1 242 PHE 242 278 278 PHE PHE A . n 
A 1 243 TYR 243 279 279 TYR TYR A . n 
A 1 244 ALA 244 280 280 ALA ALA A . n 
A 1 245 TYR 245 281 281 TYR TYR A . n 
A 1 246 LYS 246 282 282 LYS LYS A . n 
A 1 247 PHE 247 283 283 PHE PHE A . n 
A 1 248 GLU 248 284 284 GLU GLU A . n 
A 1 249 PRO 249 285 285 PRO PRO A . n 
A 1 250 ARG 250 286 286 ARG ARG A . n 
A 1 251 GLU 251 287 287 GLU GLU A . n 
A 1 252 LYS 252 288 288 LYS LYS A . n 
A 1 253 VAL 253 289 289 VAL VAL A . n 
A 1 254 VAL 254 290 290 VAL VAL A . n 
A 1 255 THR 255 291 291 THR THR A . n 
A 1 256 PHE 256 292 292 PHE PHE A . n 
A 1 257 ARG 257 293 293 ARG ARG A . n 
A 1 258 ARG 258 294 294 ARG ARG A . n 
A 1 259 PRO 259 295 295 PRO PRO A . n 
A 1 260 ASP 260 296 296 ASP ASP A . n 
A 1 261 GLY 261 297 297 GLY GLY A . n 
A 1 262 TYR 262 298 298 TYR TYR A . n 
A 1 263 LEU 263 299 299 LEU LEU A . n 
A 1 264 THR 264 300 300 THR THR A . n 
A 1 265 LYS 265 301 301 LYS LYS A . n 
A 1 266 GLN 266 302 302 GLN GLN A . n 
A 1 267 GLU 267 303 303 GLU GLU A . n 
A 1 268 LYS 268 304 304 LYS LYS A . n 
A 1 269 GLY 269 305 305 GLY GLY A . n 
A 1 270 TRP 270 306 306 TRP TRP A . n 
A 1 271 THR 271 307 307 THR THR A . n 
A 1 272 SER 272 308 308 SER SER A . n 
A 1 273 ALA 273 309 ?   ?   ?   A . n 
A 1 274 THR 274 310 ?   ?   ?   A . n 
A 1 275 GLU 275 311 ?   ?   ?   A . n 
A 1 276 HIS 276 312 ?   ?   ?   A . n 
A 1 277 THR 277 313 ?   ?   ?   A . n 
A 1 278 GLY 278 314 ?   ?   ?   A . n 
A 1 279 SER 279 315 ?   ?   ?   A . n 
A 1 280 ALA 280 316 ?   ?   ?   A . n 
A 1 281 ASP 281 317 ?   ?   ?   A . n 
A 1 282 GLN 282 318 ?   ?   ?   A . n 
A 1 283 ILE 283 319 ?   ?   ?   A . n 
A 1 284 ILE 284 320 ?   ?   ?   A . n 
A 1 285 LYS 285 321 ?   ?   ?   A . n 
A 1 286 ASP 286 322 ?   ?   ?   A . n 
A 1 287 ARG 287 323 323 ARG ARG A . n 
A 1 288 TYR 288 324 324 TYR TYR A . n 
A 1 289 ILE 289 325 325 ILE ILE A . n 
A 1 290 LEU 290 326 326 LEU LEU A . n 
A 1 291 ALA 291 327 327 ALA ALA A . n 
A 1 292 ILE 292 328 328 ILE ILE A . n 
A 1 293 GLU 293 329 329 GLU GLU A . n 
A 1 294 ASP 294 330 330 ASP ASP A . n 
A 1 295 PRO 295 331 331 PRO PRO A . n 
A 1 296 PHE 296 332 332 PHE PHE A . n 
A 1 297 GLU 297 333 333 GLU GLU A . n 
A 1 298 ILE 298 334 334 ILE ILE A . n 
A 1 299 SER 299 335 335 SER SER A . n 
A 1 300 HIS 300 336 336 HIS HIS A . n 
A 1 301 ASN 301 337 337 ASN ASN A . n 
A 1 302 VAL 302 338 338 VAL VAL A . n 
A 1 303 GLY 303 339 339 GLY GLY A . n 
A 1 304 ARG 304 340 340 ARG ARG A . n 
A 1 305 THR 305 341 341 THR THR A . n 
A 1 306 VAL 306 342 342 VAL VAL A . n 
A 1 307 SER 307 343 343 SER SER A . n 
A 1 308 SER 308 344 344 SER SER A . n 
A 1 309 SER 309 345 345 SER SER A . n 
A 1 310 GLY 310 346 346 GLY GLY A . n 
A 1 311 LEU 311 347 347 LEU LEU A . n 
A 1 312 TYR 312 348 348 TYR TYR A . n 
A 1 313 ARG 313 349 349 ARG ARG A . n 
A 1 314 ILE 314 350 350 ILE ILE A . n 
A 1 315 ARG 315 351 351 ARG ARG A . n 
A 1 316 GLY 316 352 352 GLY GLY A . n 
A 1 317 GLU 317 353 353 GLU GLU A . n 
A 1 318 PHE 318 354 354 PHE PHE A . n 
A 1 319 MET 319 355 355 MET MET A . n 
A 1 320 ALA 320 356 356 ALA ALA A . n 
A 1 321 ALA 321 357 357 ALA ALA A . n 
A 1 322 SER 322 358 358 SER SER A . n 
A 1 323 ARG 323 359 359 ARG ARG A . n 
A 1 324 LEU 324 360 360 LEU LEU A . n 
A 1 325 LEU 325 361 361 LEU LEU A . n 
A 1 326 ASN 326 362 362 ASN ASN A . n 
A 1 327 SER 327 363 363 SER SER A . n 
A 1 328 ARG 328 364 364 ARG ARG A . n 
A 1 329 SER 329 365 365 SER SER A . n 
A 1 330 TYR 330 366 366 TYR TYR A . n 
A 1 331 PRO 331 367 367 PRO PRO A . n 
A 1 332 ILE 332 368 368 ILE ILE A . n 
A 1 333 PRO 333 369 369 PRO PRO A . n 
A 1 334 TYR 334 370 370 TYR TYR A . n 
A 1 335 ASP 335 371 371 ASP ASP A . n 
A 1 336 SER 336 372 372 SER SER A . n 
A 1 337 LEU 337 373 373 LEU LEU A . n 
A 1 338 PHE 338 374 374 PHE PHE A . n 
A 1 339 GLU 339 375 375 GLU GLU A . n 
A 1 340 GLU 340 376 376 GLU GLU A . n 
A 1 341 ALA 341 377 377 ALA ALA A . n 
B 1 1   GLY 1   37  ?   ?   ?   B . n 
B 1 2   ASP 2   38  38  ASP ASP B . n 
B 1 3   MET 3   39  39  MET MET B . n 
B 1 4   SER 4   40  40  SER SER B . n 
B 1 5   HIS 5   41  41  HIS HIS B . n 
B 1 6   LYS 6   42  42  LYS LYS B . n 
B 1 7   GLU 7   43  43  GLU GLU B . n 
B 1 8   PHE 8   44  44  PHE PHE B . n 
B 1 9   THR 9   45  45  THR THR B . n 
B 1 10  LYS 10  46  46  LYS LYS B . n 
B 1 11  PHE 11  47  47  PHE PHE B . n 
B 1 12  CYS 12  48  48  CYS CYS B . n 
B 1 13  TYR 13  49  49  TYR TYR B . n 
B 1 14  GLU 14  50  50  GLU GLU B . n 
B 1 15  VAL 15  51  51  VAL VAL B . n 
B 1 16  TYR 16  52  52  TYR TYR B . n 
B 1 17  ASN 17  53  53  ASN ASN B . n 
B 1 18  GLU 18  54  54  GLU GLU B . n 
B 1 19  ILE 19  55  55  ILE ILE B . n 
B 1 20  LYS 20  56  56  LYS LYS B . n 
B 1 21  ILE 21  57  57  ILE ILE B . n 
B 1 22  SER 22  58  58  SER SER B . n 
B 1 23  ASP 23  59  59  ASP ASP B . n 
B 1 24  LYS 24  60  60  LYS LYS B . n 
B 1 25  GLU 25  61  61  GLU GLU B . n 
B 1 26  PHE 26  62  62  PHE PHE B . n 
B 1 27  LYS 27  63  63  LYS LYS B . n 
B 1 28  GLU 28  64  64  GLU GLU B . n 
B 1 29  LYS 29  65  65  LYS LYS B . n 
B 1 30  ARG 30  66  66  ARG ARG B . n 
B 1 31  ALA 31  67  67  ALA ALA B . n 
B 1 32  ALA 32  68  68  ALA ALA B . n 
B 1 33  LEU 33  69  69  LEU LEU B . n 
B 1 34  ASP 34  70  70  ASP ASP B . n 
B 1 35  THR 35  71  71  THR THR B . n 
B 1 36  LEU 36  72  72  LEU LEU B . n 
B 1 37  ARG 37  73  73  ARG ARG B . n 
B 1 38  LEU 38  74  74  LEU LEU B . n 
B 1 39  CYS 39  75  75  CYS CYS B . n 
B 1 40  LEU 40  76  76  LEU LEU B . n 
B 1 41  LYS 41  77  77  LYS LYS B . n 
B 1 42  ARG 42  78  78  ARG ARG B . n 
B 1 43  ILE 43  79  79  ILE ILE B . n 
B 1 44  SER 44  80  80  SER SER B . n 
B 1 45  PRO 45  81  81  PRO PRO B . n 
B 1 46  ASP 46  82  82  ASP ASP B . n 
B 1 47  ALA 47  83  83  ALA ALA B . n 
B 1 48  GLU 48  84  84  GLU GLU B . n 
B 1 49  LEU 49  85  85  LEU LEU B . n 
B 1 50  VAL 50  86  86  VAL VAL B . n 
B 1 51  ALA 51  87  87  ALA ALA B . n 
B 1 52  PHE 52  88  88  PHE PHE B . n 
B 1 53  GLY 53  89  89  GLY GLY B . n 
B 1 54  SER 54  90  90  SER SER B . n 
B 1 55  LEU 55  91  91  LEU LEU B . n 
B 1 56  GLU 56  92  92  GLU GLU B . n 
B 1 57  SER 57  93  93  SER SER B . n 
B 1 58  GLY 58  94  94  GLY GLY B . n 
B 1 59  LEU 59  95  95  LEU LEU B . n 
B 1 60  ALA 60  96  96  ALA ALA B . n 
B 1 61  LEU 61  97  97  LEU LEU B . n 
B 1 62  LYS 62  98  98  LYS LYS B . n 
B 1 63  ASN 63  99  99  ASN ASN B . n 
B 1 64  SER 64  100 100 SER SER B . n 
B 1 65  ASP 65  101 101 ASP ASP B . n 
B 1 66  MET 66  102 102 MET MET B . n 
B 1 67  ASP 67  103 103 ASP ASP B . n 
B 1 68  LEU 68  104 104 LEU LEU B . n 
B 1 69  CYS 69  105 105 CYS CYS B . n 
B 1 70  VAL 70  106 106 VAL VAL B . n 
B 1 71  LEU 71  107 107 LEU LEU B . n 
B 1 72  MET 72  108 108 MET MET B . n 
B 1 73  ASP 73  109 ?   ?   ?   B . n 
B 1 74  SER 74  110 ?   ?   ?   B . n 
B 1 75  ARG 75  111 ?   ?   ?   B . n 
B 1 76  VAL 76  112 ?   ?   ?   B . n 
B 1 77  GLN 77  113 ?   ?   ?   B . n 
B 1 78  SER 78  114 ?   ?   ?   B . n 
B 1 79  ASP 79  115 ?   ?   ?   B . n 
B 1 80  THR 80  116 116 THR THR B . n 
B 1 81  ILE 81  117 117 ILE ILE B . n 
B 1 82  ALA 82  118 118 ALA ALA B . n 
B 1 83  LEU 83  119 119 LEU LEU B . n 
B 1 84  GLN 84  120 120 GLN GLN B . n 
B 1 85  PHE 85  121 121 PHE PHE B . n 
B 1 86  TYR 86  122 122 TYR TYR B . n 
B 1 87  GLU 87  123 123 GLU GLU B . n 
B 1 88  GLU 88  124 124 GLU GLU B . n 
B 1 89  LEU 89  125 125 LEU LEU B . n 
B 1 90  ILE 90  126 126 ILE ILE B . n 
B 1 91  ALA 91  127 127 ALA ALA B . n 
B 1 92  GLU 92  128 128 GLU GLU B . n 
B 1 93  GLY 93  129 129 GLY GLY B . n 
B 1 94  PHE 94  130 130 PHE PHE B . n 
B 1 95  GLU 95  131 131 GLU GLU B . n 
B 1 96  GLY 96  132 132 GLY GLY B . n 
B 1 97  LYS 97  133 133 LYS LYS B . n 
B 1 98  PHE 98  134 134 PHE PHE B . n 
B 1 99  LEU 99  135 135 LEU LEU B . n 
B 1 100 GLN 100 136 136 GLN GLN B . n 
B 1 101 ARG 101 137 ?   ?   ?   B . n 
B 1 102 ALA 102 138 ?   ?   ?   B . n 
B 1 103 ARG 103 139 ?   ?   ?   B . n 
B 1 104 ILE 104 140 140 ILE ILE B . n 
B 1 105 PRO 105 141 141 PRO PRO B . n 
B 1 106 ILE 106 142 142 ILE ILE B . n 
B 1 107 ILE 107 143 143 ILE ILE B . n 
B 1 108 LYS 108 144 144 LYS LYS B . n 
B 1 109 LEU 109 145 145 LEU LEU B . n 
B 1 110 THR 110 146 146 THR THR B . n 
B 1 111 SER 111 147 147 SER SER B . n 
B 1 112 ASP 112 148 ?   ?   ?   B . n 
B 1 113 THR 113 149 ?   ?   ?   B . n 
B 1 114 LYS 114 150 ?   ?   ?   B . n 
B 1 115 ASN 115 151 ?   ?   ?   B . n 
B 1 116 GLY 116 152 ?   ?   ?   B . n 
B 1 117 PHE 117 153 ?   ?   ?   B . n 
B 1 118 GLY 118 154 ?   ?   ?   B . n 
B 1 119 ALA 119 155 ?   ?   ?   B . n 
B 1 120 SER 120 156 156 SER SER B . n 
B 1 121 PHE 121 157 157 PHE PHE B . n 
B 1 122 GLN 122 158 158 GLN GLN B . n 
B 1 123 CYS 123 159 159 CYS CYS B . n 
B 1 124 ALA 124 160 160 ALA ALA B . n 
B 1 125 ILE 125 161 161 ILE ILE B . n 
B 1 126 GLY 126 162 162 GLY GLY B . n 
B 1 127 PHE 127 163 163 PHE PHE B . n 
B 1 128 ASN 128 164 164 ASN ASN B . n 
B 1 129 ASN 129 165 165 ASN ASN B . n 
B 1 130 ARG 130 166 166 ARG ARG B . n 
B 1 131 LEU 131 167 167 LEU LEU B . n 
B 1 132 ALA 132 168 168 ALA ALA B . n 
B 1 133 ILE 133 169 169 ILE ILE B . n 
B 1 134 HIS 134 170 170 HIS HIS B . n 
B 1 135 ASN 135 171 171 ASN ASN B . n 
B 1 136 THR 136 172 172 THR THR B . n 
B 1 137 LEU 137 173 173 LEU LEU B . n 
B 1 138 LEU 138 174 174 LEU LEU B . n 
B 1 139 LEU 139 175 175 LEU LEU B . n 
B 1 140 SER 140 176 176 SER SER B . n 
B 1 141 SER 141 177 177 SER SER B . n 
B 1 142 TYR 142 178 178 TYR TYR B . n 
B 1 143 THR 143 179 179 THR THR B . n 
B 1 144 LYS 144 180 180 LYS LYS B . n 
B 1 145 LEU 145 181 181 LEU LEU B . n 
B 1 146 ASP 146 182 182 ASP ASP B . n 
B 1 147 ALA 147 183 183 ALA ALA B . n 
B 1 148 ARG 148 184 184 ARG ARG B . n 
B 1 149 LEU 149 185 185 LEU LEU B . n 
B 1 150 LYS 150 186 186 LYS LYS B . n 
B 1 151 PRO 151 187 187 PRO PRO B . n 
B 1 152 MET 152 188 188 MET MET B . n 
B 1 153 VAL 153 189 189 VAL VAL B . n 
B 1 154 LEU 154 190 190 LEU LEU B . n 
B 1 155 LEU 155 191 191 LEU LEU B . n 
B 1 156 VAL 156 192 192 VAL VAL B . n 
B 1 157 LYS 157 193 193 LYS LYS B . n 
B 1 158 HIS 158 194 194 HIS HIS B . n 
B 1 159 TRP 159 195 195 TRP TRP B . n 
B 1 160 ALA 160 196 196 ALA ALA B . n 
B 1 161 LYS 161 197 197 LYS LYS B . n 
B 1 162 ARG 162 198 198 ARG ARG B . n 
B 1 163 LYS 163 199 199 LYS LYS B . n 
B 1 164 GLN 164 200 200 GLN GLN B . n 
B 1 165 ILE 165 201 201 ILE ILE B . n 
B 1 166 ASN 166 202 202 ASN ASN B . n 
B 1 167 SER 167 203 203 SER SER B . n 
B 1 168 PRO 168 204 204 PRO PRO B . n 
B 1 169 TYR 169 205 205 TYR TYR B . n 
B 1 170 PHE 170 206 206 PHE PHE B . n 
B 1 171 GLY 171 207 207 GLY GLY B . n 
B 1 172 THR 172 208 208 THR THR B . n 
B 1 173 LEU 173 209 209 LEU LEU B . n 
B 1 174 SER 174 210 210 SER SER B . n 
B 1 175 SER 175 211 211 SER SER B . n 
B 1 176 TYR 176 212 212 TYR TYR B . n 
B 1 177 GLY 177 213 213 GLY GLY B . n 
B 1 178 TYR 178 214 214 TYR TYR B . n 
B 1 179 VAL 179 215 215 VAL VAL B . n 
B 1 180 LEU 180 216 216 LEU LEU B . n 
B 1 181 MET 181 217 217 MET MET B . n 
B 1 182 VAL 182 218 218 VAL VAL B . n 
B 1 183 LEU 183 219 219 LEU LEU B . n 
B 1 184 TYR 184 220 220 TYR TYR B . n 
B 1 185 TYR 185 221 221 TYR TYR B . n 
B 1 186 LEU 186 222 222 LEU LEU B . n 
B 1 187 ILE 187 223 223 ILE ILE B . n 
B 1 188 HIS 188 224 224 HIS HIS B . n 
B 1 189 VAL 189 225 225 VAL VAL B . n 
B 1 190 ILE 190 226 226 ILE ILE B . n 
B 1 191 LYS 191 227 227 LYS LYS B . n 
B 1 192 PRO 192 228 228 PRO PRO B . n 
B 1 193 PRO 193 229 229 PRO PRO B . n 
B 1 194 VAL 194 230 230 VAL VAL B . n 
B 1 195 PHE 195 231 231 PHE PHE B . n 
B 1 196 PRO 196 232 232 PRO PRO B . n 
B 1 197 ASN 197 233 233 ASN ASN B . n 
B 1 198 LEU 198 234 234 LEU LEU B . n 
B 1 199 LEU 199 235 235 LEU LEU B . n 
B 1 200 LEU 200 236 236 LEU LEU B . n 
B 1 201 SER 201 237 237 SER SER B . n 
B 1 202 PRO 202 238 238 PRO PRO B . n 
B 1 203 LEU 203 239 239 LEU LEU B . n 
B 1 204 LYS 204 240 240 LYS LYS B . n 
B 1 205 GLN 205 241 241 GLN GLN B . n 
B 1 206 GLU 206 242 242 GLU GLU B . n 
B 1 207 LYS 207 243 243 LYS LYS B . n 
B 1 208 ILE 208 244 244 ILE ILE B . n 
B 1 209 VAL 209 245 245 VAL VAL B . n 
B 1 210 ASP 210 246 246 ASP ASP B . n 
B 1 211 GLY 211 247 247 GLY GLY B . n 
B 1 212 PHE 212 248 248 PHE PHE B . n 
B 1 213 ASP 213 249 249 ASP ASP B . n 
B 1 214 VAL 214 250 250 VAL VAL B . n 
B 1 215 GLY 215 251 251 GLY GLY B . n 
B 1 216 PHE 216 252 252 PHE PHE B . n 
B 1 217 ASP 217 253 253 ASP ASP B . n 
B 1 218 ASP 218 254 254 ASP ASP B . n 
B 1 219 LYS 219 255 255 LYS LYS B . n 
B 1 220 LEU 220 256 256 LEU LEU B . n 
B 1 221 GLU 221 257 257 GLU GLU B . n 
B 1 222 ASP 222 258 258 ASP ASP B . n 
B 1 223 ILE 223 259 259 ILE ILE B . n 
B 1 224 PRO 224 260 260 PRO PRO B . n 
B 1 225 PRO 225 261 261 PRO PRO B . n 
B 1 226 SER 226 262 262 SER SER B . n 
B 1 227 GLN 227 263 263 GLN GLN B . n 
B 1 228 ASN 228 264 264 ASN ASN B . n 
B 1 229 TYR 229 265 265 TYR TYR B . n 
B 1 230 SER 230 266 266 SER SER B . n 
B 1 231 SER 231 267 267 SER SER B . n 
B 1 232 LEU 232 268 268 LEU LEU B . n 
B 1 233 GLY 233 269 269 GLY GLY B . n 
B 1 234 SER 234 270 270 SER SER B . n 
B 1 235 LEU 235 271 271 LEU LEU B . n 
B 1 236 LEU 236 272 272 LEU LEU B . n 
B 1 237 HIS 237 273 273 HIS HIS B . n 
B 1 238 GLY 238 274 274 GLY GLY B . n 
B 1 239 PHE 239 275 275 PHE PHE B . n 
B 1 240 PHE 240 276 276 PHE PHE B . n 
B 1 241 ARG 241 277 277 ARG ARG B . n 
B 1 242 PHE 242 278 278 PHE PHE B . n 
B 1 243 TYR 243 279 279 TYR TYR B . n 
B 1 244 ALA 244 280 280 ALA ALA B . n 
B 1 245 TYR 245 281 281 TYR TYR B . n 
B 1 246 LYS 246 282 282 LYS LYS B . n 
B 1 247 PHE 247 283 283 PHE PHE B . n 
B 1 248 GLU 248 284 284 GLU GLU B . n 
B 1 249 PRO 249 285 285 PRO PRO B . n 
B 1 250 ARG 250 286 286 ARG ARG B . n 
B 1 251 GLU 251 287 287 GLU GLU B . n 
B 1 252 LYS 252 288 288 LYS LYS B . n 
B 1 253 VAL 253 289 289 VAL VAL B . n 
B 1 254 VAL 254 290 290 VAL VAL B . n 
B 1 255 THR 255 291 291 THR THR B . n 
B 1 256 PHE 256 292 292 PHE PHE B . n 
B 1 257 ARG 257 293 293 ARG ARG B . n 
B 1 258 ARG 258 294 294 ARG ARG B . n 
B 1 259 PRO 259 295 295 PRO PRO B . n 
B 1 260 ASP 260 296 296 ASP ASP B . n 
B 1 261 GLY 261 297 297 GLY GLY B . n 
B 1 262 TYR 262 298 298 TYR TYR B . n 
B 1 263 LEU 263 299 299 LEU LEU B . n 
B 1 264 THR 264 300 300 THR THR B . n 
B 1 265 LYS 265 301 301 LYS LYS B . n 
B 1 266 GLN 266 302 302 GLN GLN B . n 
B 1 267 GLU 267 303 303 GLU GLU B . n 
B 1 268 LYS 268 304 304 LYS LYS B . n 
B 1 269 GLY 269 305 305 GLY GLY B . n 
B 1 270 TRP 270 306 306 TRP TRP B . n 
B 1 271 THR 271 307 307 THR THR B . n 
B 1 272 SER 272 308 308 SER SER B . n 
B 1 273 ALA 273 309 ?   ?   ?   B . n 
B 1 274 THR 274 310 ?   ?   ?   B . n 
B 1 275 GLU 275 311 ?   ?   ?   B . n 
B 1 276 HIS 276 312 ?   ?   ?   B . n 
B 1 277 THR 277 313 ?   ?   ?   B . n 
B 1 278 GLY 278 314 ?   ?   ?   B . n 
B 1 279 SER 279 315 ?   ?   ?   B . n 
B 1 280 ALA 280 316 ?   ?   ?   B . n 
B 1 281 ASP 281 317 ?   ?   ?   B . n 
B 1 282 GLN 282 318 ?   ?   ?   B . n 
B 1 283 ILE 283 319 ?   ?   ?   B . n 
B 1 284 ILE 284 320 ?   ?   ?   B . n 
B 1 285 LYS 285 321 ?   ?   ?   B . n 
B 1 286 ASP 286 322 ?   ?   ?   B . n 
B 1 287 ARG 287 323 323 ARG ARG B . n 
B 1 288 TYR 288 324 324 TYR TYR B . n 
B 1 289 ILE 289 325 325 ILE ILE B . n 
B 1 290 LEU 290 326 326 LEU LEU B . n 
B 1 291 ALA 291 327 327 ALA ALA B . n 
B 1 292 ILE 292 328 328 ILE ILE B . n 
B 1 293 GLU 293 329 329 GLU GLU B . n 
B 1 294 ASP 294 330 330 ASP ASP B . n 
B 1 295 PRO 295 331 331 PRO PRO B . n 
B 1 296 PHE 296 332 332 PHE PHE B . n 
B 1 297 GLU 297 333 333 GLU GLU B . n 
B 1 298 ILE 298 334 334 ILE ILE B . n 
B 1 299 SER 299 335 335 SER SER B . n 
B 1 300 HIS 300 336 336 HIS HIS B . n 
B 1 301 ASN 301 337 337 ASN ASN B . n 
B 1 302 VAL 302 338 338 VAL VAL B . n 
B 1 303 GLY 303 339 339 GLY GLY B . n 
B 1 304 ARG 304 340 340 ARG ARG B . n 
B 1 305 THR 305 341 341 THR THR B . n 
B 1 306 VAL 306 342 342 VAL VAL B . n 
B 1 307 SER 307 343 343 SER SER B . n 
B 1 308 SER 308 344 344 SER SER B . n 
B 1 309 SER 309 345 345 SER SER B . n 
B 1 310 GLY 310 346 346 GLY GLY B . n 
B 1 311 LEU 311 347 347 LEU LEU B . n 
B 1 312 TYR 312 348 348 TYR TYR B . n 
B 1 313 ARG 313 349 349 ARG ARG B . n 
B 1 314 ILE 314 350 350 ILE ILE B . n 
B 1 315 ARG 315 351 351 ARG ARG B . n 
B 1 316 GLY 316 352 352 GLY GLY B . n 
B 1 317 GLU 317 353 353 GLU GLU B . n 
B 1 318 PHE 318 354 354 PHE PHE B . n 
B 1 319 MET 319 355 355 MET MET B . n 
B 1 320 ALA 320 356 356 ALA ALA B . n 
B 1 321 ALA 321 357 357 ALA ALA B . n 
B 1 322 SER 322 358 358 SER SER B . n 
B 1 323 ARG 323 359 359 ARG ARG B . n 
B 1 324 LEU 324 360 360 LEU LEU B . n 
B 1 325 LEU 325 361 361 LEU LEU B . n 
B 1 326 ASN 326 362 362 ASN ASN B . n 
B 1 327 SER 327 363 363 SER SER B . n 
B 1 328 ARG 328 364 364 ARG ARG B . n 
B 1 329 SER 329 365 365 SER SER B . n 
B 1 330 TYR 330 366 366 TYR TYR B . n 
B 1 331 PRO 331 367 367 PRO PRO B . n 
B 1 332 ILE 332 368 368 ILE ILE B . n 
B 1 333 PRO 333 369 369 PRO PRO B . n 
B 1 334 TYR 334 370 370 TYR TYR B . n 
B 1 335 ASP 335 371 371 ASP ASP B . n 
B 1 336 SER 336 372 372 SER SER B . n 
B 1 337 LEU 337 373 373 LEU LEU B . n 
B 1 338 PHE 338 374 374 PHE PHE B . n 
B 1 339 GLU 339 375 375 GLU GLU B . n 
B 1 340 GLU 340 376 376 GLU GLU B . n 
B 1 341 ALA 341 377 377 ALA ALA B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,F,L   
2 1 B,G,H,I,J,K,M 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-12-18 
2 'Structure model' 1 1 2014-01-15 
3 'Structure model' 1 2 2014-03-26 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC   'data collection' Quantum                       ? 1 
PHASER phasing           .                             ? 2 
PHENIX refinement        '(phenix.refine: 1.8.1_1168)' ? 3 
XDS    'data reduction'  package                       ? 4 
XDS    'data scaling'    package                       ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 OE1 A GLU 84  ? ? O A HOH 545 ? ? 1.96 
2  1 OE2 A GLU 54  ? ? O A HOH 794 ? ? 2.04 
3  1 O2G A 2KH 401 ? ? O A HOH 701 ? ? 2.05 
4  1 NH2 A ARG 364 ? ? O A HOH 697 ? ? 2.09 
5  1 O   B HOH 593 ? ? O B HOH 605 ? ? 2.13 
6  1 N   A ASP 38  ? ? O A HOH 686 ? ? 2.15 
7  1 O   B HOH 676 ? ? O B HOH 700 ? ? 2.15 
8  1 N   B ARG 323 ? ? O B HOH 700 ? ? 2.16 
9  1 O2A B 2KH 401 ? ? O B HOH 546 ? ? 2.16 
10 1 O   A HOH 606 ? ? O A HOH 747 ? ? 2.17 
11 1 O   B HOH 576 ? ? O B HOH 648 ? ? 2.17 
12 1 OD1 B ASP 253 ? ? O B HOH 593 ? ? 2.17 
13 1 O   A HOH 789 ? ? O B HOH 579 ? ? 2.17 
14 1 O   B SER 308 ? ? O B HOH 543 ? ? 2.18 
15 1 O   A HOH 789 ? ? O B HOH 581 ? ? 2.18 
16 1 O   A HOH 701 ? ? O A HOH 793 ? ? 2.18 
17 1 NH2 B ARG 359 ? ? O B HOH 533 ? ? 2.18 
18 1 O   B HOH 642 ? ? O B HOH 671 ? ? 2.18 
19 1 O   A HOH 606 ? ? O A HOH 661 ? ? 2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 150 ? ? -140.68 -29.29  
2 1 THR A 208 ? ? -114.25 -150.03 
3 1 ASP A 253 ? ? -65.49  97.40   
4 1 TRP A 306 ? ? -108.15 70.21   
5 1 THR A 307 ? ? -107.05 -60.94  
6 1 THR B 208 ? ? -107.03 -154.01 
7 1 THR B 307 ? ? -81.64  -76.93  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 37  ? A GLY 1   
2  1 Y 1 A ASP 109 ? A ASP 73  
3  1 Y 1 A SER 110 ? A SER 74  
4  1 Y 1 A ARG 111 ? A ARG 75  
5  1 Y 1 A VAL 112 ? A VAL 76  
6  1 Y 1 A GLN 113 ? A GLN 77  
7  1 Y 1 A SER 114 ? A SER 78  
8  1 Y 1 A ASP 115 ? A ASP 79  
9  1 Y 1 A ALA 309 ? A ALA 273 
10 1 Y 1 A THR 310 ? A THR 274 
11 1 Y 1 A GLU 311 ? A GLU 275 
12 1 Y 1 A HIS 312 ? A HIS 276 
13 1 Y 1 A THR 313 ? A THR 277 
14 1 Y 1 A GLY 314 ? A GLY 278 
15 1 Y 1 A SER 315 ? A SER 279 
16 1 Y 1 A ALA 316 ? A ALA 280 
17 1 Y 1 A ASP 317 ? A ASP 281 
18 1 Y 1 A GLN 318 ? A GLN 282 
19 1 Y 1 A ILE 319 ? A ILE 283 
20 1 Y 1 A ILE 320 ? A ILE 284 
21 1 Y 1 A LYS 321 ? A LYS 285 
22 1 Y 1 A ASP 322 ? A ASP 286 
23 1 Y 1 B GLY 37  ? B GLY 1   
24 1 Y 1 B ASP 109 ? B ASP 73  
25 1 Y 1 B SER 110 ? B SER 74  
26 1 Y 1 B ARG 111 ? B ARG 75  
27 1 Y 1 B VAL 112 ? B VAL 76  
28 1 Y 1 B GLN 113 ? B GLN 77  
29 1 Y 1 B SER 114 ? B SER 78  
30 1 Y 1 B ASP 115 ? B ASP 79  
31 1 Y 1 B ARG 137 ? B ARG 101 
32 1 Y 1 B ALA 138 ? B ALA 102 
33 1 Y 1 B ARG 139 ? B ARG 103 
34 1 Y 1 B ASP 148 ? B ASP 112 
35 1 Y 1 B THR 149 ? B THR 113 
36 1 Y 1 B LYS 150 ? B LYS 114 
37 1 Y 1 B ASN 151 ? B ASN 115 
38 1 Y 1 B GLY 152 ? B GLY 116 
39 1 Y 1 B PHE 153 ? B PHE 117 
40 1 Y 1 B GLY 154 ? B GLY 118 
41 1 Y 1 B ALA 155 ? B ALA 119 
42 1 Y 1 B ALA 309 ? B ALA 273 
43 1 Y 1 B THR 310 ? B THR 274 
44 1 Y 1 B GLU 311 ? B GLU 275 
45 1 Y 1 B HIS 312 ? B HIS 276 
46 1 Y 1 B THR 313 ? B THR 277 
47 1 Y 1 B GLY 314 ? B GLY 278 
48 1 Y 1 B SER 315 ? B SER 279 
49 1 Y 1 B ALA 316 ? B ALA 280 
50 1 Y 1 B ASP 317 ? B ASP 281 
51 1 Y 1 B GLN 318 ? B GLN 282 
52 1 Y 1 B ILE 319 ? B ILE 283 
53 1 Y 1 B ILE 320 ? B ILE 284 
54 1 Y 1 B LYS 321 ? B LYS 285 
55 1 Y 1 B ASP 322 ? B ASP 286 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]uridine" 2KH 
3 'BROMIDE ION'                                                                     BR  
4 'MAGNESIUM ION'                                                                   MG  
5 water                                                                             HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 2KH 1   401 1   2KH UNP A . 
D 3 BR  1   402 1   BR  BR  A . 
E 3 BR  1   403 1   BR  BR  A . 
F 4 MG  1   404 1   MG  MG  A . 
G 2 2KH 1   401 1   2KH UNP B . 
H 3 BR  1   402 1   BR  BR  B . 
I 4 MG  1   403 1   MG  MG  B . 
J 4 MG  1   404 1   MG  MG  B . 
K 4 MG  1   405 1   MG  MG  B . 
L 5 HOH 1   501 1   HOH HOH A . 
L 5 HOH 2   502 2   HOH HOH A . 
L 5 HOH 3   503 3   HOH HOH A . 
L 5 HOH 4   504 4   HOH HOH A . 
L 5 HOH 5   505 5   HOH HOH A . 
L 5 HOH 6   506 6   HOH HOH A . 
L 5 HOH 7   507 8   HOH HOH A . 
L 5 HOH 8   508 13  HOH HOH A . 
L 5 HOH 9   509 14  HOH HOH A . 
L 5 HOH 10  510 15  HOH HOH A . 
L 5 HOH 11  511 16  HOH HOH A . 
L 5 HOH 12  512 17  HOH HOH A . 
L 5 HOH 13  513 19  HOH HOH A . 
L 5 HOH 14  514 20  HOH HOH A . 
L 5 HOH 15  515 21  HOH HOH A . 
L 5 HOH 16  516 22  HOH HOH A . 
L 5 HOH 17  517 23  HOH HOH A . 
L 5 HOH 18  518 24  HOH HOH A . 
L 5 HOH 19  519 25  HOH HOH A . 
L 5 HOH 20  520 26  HOH HOH A . 
L 5 HOH 21  521 28  HOH HOH A . 
L 5 HOH 22  522 31  HOH HOH A . 
L 5 HOH 23  523 32  HOH HOH A . 
L 5 HOH 24  524 34  HOH HOH A . 
L 5 HOH 25  525 36  HOH HOH A . 
L 5 HOH 26  526 37  HOH HOH A . 
L 5 HOH 27  527 39  HOH HOH A . 
L 5 HOH 28  528 41  HOH HOH A . 
L 5 HOH 29  529 43  HOH HOH A . 
L 5 HOH 30  530 44  HOH HOH A . 
L 5 HOH 31  531 46  HOH HOH A . 
L 5 HOH 32  532 47  HOH HOH A . 
L 5 HOH 33  533 49  HOH HOH A . 
L 5 HOH 34  534 50  HOH HOH A . 
L 5 HOH 35  535 53  HOH HOH A . 
L 5 HOH 36  536 57  HOH HOH A . 
L 5 HOH 37  537 58  HOH HOH A . 
L 5 HOH 38  538 59  HOH HOH A . 
L 5 HOH 39  539 60  HOH HOH A . 
L 5 HOH 40  540 61  HOH HOH A . 
L 5 HOH 41  541 65  HOH HOH A . 
L 5 HOH 42  542 67  HOH HOH A . 
L 5 HOH 43  543 69  HOH HOH A . 
L 5 HOH 44  544 70  HOH HOH A . 
L 5 HOH 45  545 71  HOH HOH A . 
L 5 HOH 46  546 73  HOH HOH A . 
L 5 HOH 47  547 79  HOH HOH A . 
L 5 HOH 48  548 81  HOH HOH A . 
L 5 HOH 49  549 82  HOH HOH A . 
L 5 HOH 50  550 83  HOH HOH A . 
L 5 HOH 51  551 85  HOH HOH A . 
L 5 HOH 52  552 87  HOH HOH A . 
L 5 HOH 53  553 88  HOH HOH A . 
L 5 HOH 54  554 89  HOH HOH A . 
L 5 HOH 55  555 90  HOH HOH A . 
L 5 HOH 56  556 97  HOH HOH A . 
L 5 HOH 57  557 98  HOH HOH A . 
L 5 HOH 58  558 100 HOH HOH A . 
L 5 HOH 59  559 101 HOH HOH A . 
L 5 HOH 60  560 102 HOH HOH A . 
L 5 HOH 61  561 103 HOH HOH A . 
L 5 HOH 62  562 104 HOH HOH A . 
L 5 HOH 63  563 105 HOH HOH A . 
L 5 HOH 64  564 106 HOH HOH A . 
L 5 HOH 65  565 107 HOH HOH A . 
L 5 HOH 66  566 109 HOH HOH A . 
L 5 HOH 67  567 110 HOH HOH A . 
L 5 HOH 68  568 111 HOH HOH A . 
L 5 HOH 69  569 114 HOH HOH A . 
L 5 HOH 70  570 118 HOH HOH A . 
L 5 HOH 71  571 119 HOH HOH A . 
L 5 HOH 72  572 121 HOH HOH A . 
L 5 HOH 73  573 123 HOH HOH A . 
L 5 HOH 74  574 124 HOH HOH A . 
L 5 HOH 75  575 125 HOH HOH A . 
L 5 HOH 76  576 126 HOH HOH A . 
L 5 HOH 77  577 127 HOH HOH A . 
L 5 HOH 78  578 128 HOH HOH A . 
L 5 HOH 79  579 129 HOH HOH A . 
L 5 HOH 80  580 131 HOH HOH A . 
L 5 HOH 81  581 132 HOH HOH A . 
L 5 HOH 82  582 135 HOH HOH A . 
L 5 HOH 83  583 137 HOH HOH A . 
L 5 HOH 84  584 140 HOH HOH A . 
L 5 HOH 85  585 141 HOH HOH A . 
L 5 HOH 86  586 142 HOH HOH A . 
L 5 HOH 87  587 143 HOH HOH A . 
L 5 HOH 88  588 144 HOH HOH A . 
L 5 HOH 89  589 145 HOH HOH A . 
L 5 HOH 90  590 146 HOH HOH A . 
L 5 HOH 91  591 147 HOH HOH A . 
L 5 HOH 92  592 148 HOH HOH A . 
L 5 HOH 93  593 149 HOH HOH A . 
L 5 HOH 94  594 150 HOH HOH A . 
L 5 HOH 95  595 151 HOH HOH A . 
L 5 HOH 96  596 152 HOH HOH A . 
L 5 HOH 97  597 154 HOH HOH A . 
L 5 HOH 98  598 155 HOH HOH A . 
L 5 HOH 99  599 157 HOH HOH A . 
L 5 HOH 100 600 158 HOH HOH A . 
L 5 HOH 101 601 159 HOH HOH A . 
L 5 HOH 102 602 160 HOH HOH A . 
L 5 HOH 103 603 165 HOH HOH A . 
L 5 HOH 104 604 167 HOH HOH A . 
L 5 HOH 105 605 169 HOH HOH A . 
L 5 HOH 106 606 170 HOH HOH A . 
L 5 HOH 107 607 171 HOH HOH A . 
L 5 HOH 108 608 175 HOH HOH A . 
L 5 HOH 109 609 176 HOH HOH A . 
L 5 HOH 110 610 178 HOH HOH A . 
L 5 HOH 111 611 181 HOH HOH A . 
L 5 HOH 112 612 182 HOH HOH A . 
L 5 HOH 113 613 183 HOH HOH A . 
L 5 HOH 114 614 184 HOH HOH A . 
L 5 HOH 115 615 185 HOH HOH A . 
L 5 HOH 116 616 186 HOH HOH A . 
L 5 HOH 117 617 187 HOH HOH A . 
L 5 HOH 118 618 188 HOH HOH A . 
L 5 HOH 119 619 190 HOH HOH A . 
L 5 HOH 120 620 191 HOH HOH A . 
L 5 HOH 121 621 192 HOH HOH A . 
L 5 HOH 122 622 193 HOH HOH A . 
L 5 HOH 123 623 194 HOH HOH A . 
L 5 HOH 124 624 195 HOH HOH A . 
L 5 HOH 125 625 196 HOH HOH A . 
L 5 HOH 126 626 197 HOH HOH A . 
L 5 HOH 127 627 198 HOH HOH A . 
L 5 HOH 128 628 199 HOH HOH A . 
L 5 HOH 129 629 200 HOH HOH A . 
L 5 HOH 130 630 201 HOH HOH A . 
L 5 HOH 131 631 202 HOH HOH A . 
L 5 HOH 132 632 204 HOH HOH A . 
L 5 HOH 133 633 206 HOH HOH A . 
L 5 HOH 134 634 207 HOH HOH A . 
L 5 HOH 135 635 208 HOH HOH A . 
L 5 HOH 136 636 210 HOH HOH A . 
L 5 HOH 137 637 211 HOH HOH A . 
L 5 HOH 138 638 212 HOH HOH A . 
L 5 HOH 139 639 213 HOH HOH A . 
L 5 HOH 140 640 215 HOH HOH A . 
L 5 HOH 141 641 219 HOH HOH A . 
L 5 HOH 142 642 222 HOH HOH A . 
L 5 HOH 143 643 228 HOH HOH A . 
L 5 HOH 144 644 233 HOH HOH A . 
L 5 HOH 145 645 235 HOH HOH A . 
L 5 HOH 146 646 236 HOH HOH A . 
L 5 HOH 147 647 238 HOH HOH A . 
L 5 HOH 148 648 239 HOH HOH A . 
L 5 HOH 149 649 241 HOH HOH A . 
L 5 HOH 150 650 246 HOH HOH A . 
L 5 HOH 151 651 247 HOH HOH A . 
L 5 HOH 152 652 248 HOH HOH A . 
L 5 HOH 153 653 251 HOH HOH A . 
L 5 HOH 154 654 253 HOH HOH A . 
L 5 HOH 155 655 254 HOH HOH A . 
L 5 HOH 156 656 258 HOH HOH A . 
L 5 HOH 157 657 259 HOH HOH A . 
L 5 HOH 158 658 262 HOH HOH A . 
L 5 HOH 159 659 263 HOH HOH A . 
L 5 HOH 160 660 265 HOH HOH A . 
L 5 HOH 161 661 271 HOH HOH A . 
L 5 HOH 162 662 273 HOH HOH A . 
L 5 HOH 163 663 274 HOH HOH A . 
L 5 HOH 164 664 275 HOH HOH A . 
L 5 HOH 165 665 276 HOH HOH A . 
L 5 HOH 166 666 277 HOH HOH A . 
L 5 HOH 167 667 279 HOH HOH A . 
L 5 HOH 168 668 282 HOH HOH A . 
L 5 HOH 169 669 284 HOH HOH A . 
L 5 HOH 170 670 285 HOH HOH A . 
L 5 HOH 171 671 286 HOH HOH A . 
L 5 HOH 172 672 287 HOH HOH A . 
L 5 HOH 173 673 290 HOH HOH A . 
L 5 HOH 174 674 291 HOH HOH A . 
L 5 HOH 175 675 292 HOH HOH A . 
L 5 HOH 176 676 298 HOH HOH A . 
L 5 HOH 177 677 299 HOH HOH A . 
L 5 HOH 178 678 301 HOH HOH A . 
L 5 HOH 179 679 302 HOH HOH A . 
L 5 HOH 180 680 303 HOH HOH A . 
L 5 HOH 181 681 306 HOH HOH A . 
L 5 HOH 182 682 310 HOH HOH A . 
L 5 HOH 183 683 312 HOH HOH A . 
L 5 HOH 184 684 313 HOH HOH A . 
L 5 HOH 185 685 316 HOH HOH A . 
L 5 HOH 186 686 318 HOH HOH A . 
L 5 HOH 187 687 321 HOH HOH A . 
L 5 HOH 188 688 322 HOH HOH A . 
L 5 HOH 189 689 323 HOH HOH A . 
L 5 HOH 190 690 324 HOH HOH A . 
L 5 HOH 191 691 325 HOH HOH A . 
L 5 HOH 192 692 326 HOH HOH A . 
L 5 HOH 193 693 327 HOH HOH A . 
L 5 HOH 194 694 328 HOH HOH A . 
L 5 HOH 195 695 329 HOH HOH A . 
L 5 HOH 196 696 330 HOH HOH A . 
L 5 HOH 197 697 331 HOH HOH A . 
L 5 HOH 198 698 332 HOH HOH A . 
L 5 HOH 199 699 333 HOH HOH A . 
L 5 HOH 200 700 334 HOH HOH A . 
L 5 HOH 201 701 336 HOH HOH A . 
L 5 HOH 202 702 341 HOH HOH A . 
L 5 HOH 203 703 343 HOH HOH A . 
L 5 HOH 204 704 345 HOH HOH A . 
L 5 HOH 205 705 349 HOH HOH A . 
L 5 HOH 206 706 350 HOH HOH A . 
L 5 HOH 207 707 351 HOH HOH A . 
L 5 HOH 208 708 352 HOH HOH A . 
L 5 HOH 209 709 353 HOH HOH A . 
L 5 HOH 210 710 354 HOH HOH A . 
L 5 HOH 211 711 356 HOH HOH A . 
L 5 HOH 212 712 358 HOH HOH A . 
L 5 HOH 213 713 359 HOH HOH A . 
L 5 HOH 214 714 362 HOH HOH A . 
L 5 HOH 215 715 364 HOH HOH A . 
L 5 HOH 216 716 365 HOH HOH A . 
L 5 HOH 217 717 366 HOH HOH A . 
L 5 HOH 218 718 367 HOH HOH A . 
L 5 HOH 219 719 368 HOH HOH A . 
L 5 HOH 220 720 369 HOH HOH A . 
L 5 HOH 221 721 370 HOH HOH A . 
L 5 HOH 222 722 371 HOH HOH A . 
L 5 HOH 223 723 372 HOH HOH A . 
L 5 HOH 224 724 373 HOH HOH A . 
L 5 HOH 225 725 374 HOH HOH A . 
L 5 HOH 226 726 376 HOH HOH A . 
L 5 HOH 227 727 378 HOH HOH A . 
L 5 HOH 228 728 379 HOH HOH A . 
L 5 HOH 229 729 380 HOH HOH A . 
L 5 HOH 230 730 382 HOH HOH A . 
L 5 HOH 231 731 384 HOH HOH A . 
L 5 HOH 232 732 385 HOH HOH A . 
L 5 HOH 233 733 387 HOH HOH A . 
L 5 HOH 234 734 390 HOH HOH A . 
L 5 HOH 235 735 395 HOH HOH A . 
L 5 HOH 236 736 400 HOH HOH A . 
L 5 HOH 237 737 401 HOH HOH A . 
L 5 HOH 238 738 406 HOH HOH A . 
L 5 HOH 239 739 409 HOH HOH A . 
L 5 HOH 240 740 411 HOH HOH A . 
L 5 HOH 241 741 414 HOH HOH A . 
L 5 HOH 242 742 417 HOH HOH A . 
L 5 HOH 243 743 419 HOH HOH A . 
L 5 HOH 244 744 421 HOH HOH A . 
L 5 HOH 245 745 423 HOH HOH A . 
L 5 HOH 246 746 424 HOH HOH A . 
L 5 HOH 247 747 425 HOH HOH A . 
L 5 HOH 248 748 427 HOH HOH A . 
L 5 HOH 249 749 428 HOH HOH A . 
L 5 HOH 250 750 429 HOH HOH A . 
L 5 HOH 251 751 430 HOH HOH A . 
L 5 HOH 252 752 431 HOH HOH A . 
L 5 HOH 253 753 432 HOH HOH A . 
L 5 HOH 254 754 433 HOH HOH A . 
L 5 HOH 255 755 434 HOH HOH A . 
L 5 HOH 256 756 436 HOH HOH A . 
L 5 HOH 257 757 437 HOH HOH A . 
L 5 HOH 258 758 438 HOH HOH A . 
L 5 HOH 259 759 439 HOH HOH A . 
L 5 HOH 260 760 440 HOH HOH A . 
L 5 HOH 261 761 442 HOH HOH A . 
L 5 HOH 262 762 443 HOH HOH A . 
L 5 HOH 263 763 446 HOH HOH A . 
L 5 HOH 264 764 447 HOH HOH A . 
L 5 HOH 265 765 448 HOH HOH A . 
L 5 HOH 266 766 451 HOH HOH A . 
L 5 HOH 267 767 452 HOH HOH A . 
L 5 HOH 268 768 454 HOH HOH A . 
L 5 HOH 269 769 455 HOH HOH A . 
L 5 HOH 270 770 456 HOH HOH A . 
L 5 HOH 271 771 457 HOH HOH A . 
L 5 HOH 272 772 459 HOH HOH A . 
L 5 HOH 273 773 461 HOH HOH A . 
L 5 HOH 274 774 462 HOH HOH A . 
L 5 HOH 275 775 465 HOH HOH A . 
L 5 HOH 276 776 466 HOH HOH A . 
L 5 HOH 277 777 467 HOH HOH A . 
L 5 HOH 278 778 468 HOH HOH A . 
L 5 HOH 279 779 469 HOH HOH A . 
L 5 HOH 280 780 470 HOH HOH A . 
L 5 HOH 281 781 471 HOH HOH A . 
L 5 HOH 282 782 472 HOH HOH A . 
L 5 HOH 283 783 473 HOH HOH A . 
L 5 HOH 284 784 490 HOH HOH A . 
L 5 HOH 285 785 491 HOH HOH A . 
L 5 HOH 286 786 492 HOH HOH A . 
L 5 HOH 287 787 493 HOH HOH A . 
L 5 HOH 288 788 494 HOH HOH A . 
L 5 HOH 289 789 495 HOH HOH A . 
L 5 HOH 290 790 498 HOH HOH A . 
L 5 HOH 291 791 499 HOH HOH A . 
L 5 HOH 292 792 500 HOH HOH A . 
L 5 HOH 293 793 501 HOH HOH A . 
L 5 HOH 294 794 502 HOH HOH A . 
L 5 HOH 295 795 503 HOH HOH A . 
L 5 HOH 296 796 504 HOH HOH A . 
L 5 HOH 297 797 511 HOH HOH A . 
M 5 HOH 1   501 7   HOH HOH B . 
M 5 HOH 2   502 9   HOH HOH B . 
M 5 HOH 3   503 10  HOH HOH B . 
M 5 HOH 4   504 11  HOH HOH B . 
M 5 HOH 5   505 12  HOH HOH B . 
M 5 HOH 6   506 18  HOH HOH B . 
M 5 HOH 7   507 27  HOH HOH B . 
M 5 HOH 8   508 29  HOH HOH B . 
M 5 HOH 9   509 30  HOH HOH B . 
M 5 HOH 10  510 33  HOH HOH B . 
M 5 HOH 11  511 35  HOH HOH B . 
M 5 HOH 12  512 38  HOH HOH B . 
M 5 HOH 13  513 40  HOH HOH B . 
M 5 HOH 14  514 42  HOH HOH B . 
M 5 HOH 15  515 45  HOH HOH B . 
M 5 HOH 16  516 48  HOH HOH B . 
M 5 HOH 17  517 51  HOH HOH B . 
M 5 HOH 18  518 52  HOH HOH B . 
M 5 HOH 19  519 54  HOH HOH B . 
M 5 HOH 20  520 55  HOH HOH B . 
M 5 HOH 21  521 56  HOH HOH B . 
M 5 HOH 22  522 62  HOH HOH B . 
M 5 HOH 23  523 63  HOH HOH B . 
M 5 HOH 24  524 64  HOH HOH B . 
M 5 HOH 25  525 66  HOH HOH B . 
M 5 HOH 26  526 68  HOH HOH B . 
M 5 HOH 27  527 72  HOH HOH B . 
M 5 HOH 28  528 74  HOH HOH B . 
M 5 HOH 29  529 75  HOH HOH B . 
M 5 HOH 30  530 76  HOH HOH B . 
M 5 HOH 31  531 77  HOH HOH B . 
M 5 HOH 32  532 78  HOH HOH B . 
M 5 HOH 33  533 80  HOH HOH B . 
M 5 HOH 34  534 84  HOH HOH B . 
M 5 HOH 35  535 86  HOH HOH B . 
M 5 HOH 36  536 91  HOH HOH B . 
M 5 HOH 37  537 92  HOH HOH B . 
M 5 HOH 38  538 93  HOH HOH B . 
M 5 HOH 39  539 94  HOH HOH B . 
M 5 HOH 40  540 95  HOH HOH B . 
M 5 HOH 41  541 96  HOH HOH B . 
M 5 HOH 42  542 99  HOH HOH B . 
M 5 HOH 43  543 108 HOH HOH B . 
M 5 HOH 44  544 112 HOH HOH B . 
M 5 HOH 45  545 113 HOH HOH B . 
M 5 HOH 46  546 115 HOH HOH B . 
M 5 HOH 47  547 116 HOH HOH B . 
M 5 HOH 48  548 117 HOH HOH B . 
M 5 HOH 49  549 120 HOH HOH B . 
M 5 HOH 50  550 122 HOH HOH B . 
M 5 HOH 51  551 130 HOH HOH B . 
M 5 HOH 52  552 133 HOH HOH B . 
M 5 HOH 53  553 134 HOH HOH B . 
M 5 HOH 54  554 136 HOH HOH B . 
M 5 HOH 55  555 138 HOH HOH B . 
M 5 HOH 56  556 139 HOH HOH B . 
M 5 HOH 57  557 153 HOH HOH B . 
M 5 HOH 58  558 156 HOH HOH B . 
M 5 HOH 59  559 161 HOH HOH B . 
M 5 HOH 60  560 162 HOH HOH B . 
M 5 HOH 61  561 163 HOH HOH B . 
M 5 HOH 62  562 164 HOH HOH B . 
M 5 HOH 63  563 166 HOH HOH B . 
M 5 HOH 64  564 168 HOH HOH B . 
M 5 HOH 65  565 172 HOH HOH B . 
M 5 HOH 66  566 173 HOH HOH B . 
M 5 HOH 67  567 174 HOH HOH B . 
M 5 HOH 68  568 177 HOH HOH B . 
M 5 HOH 69  569 179 HOH HOH B . 
M 5 HOH 70  570 180 HOH HOH B . 
M 5 HOH 71  571 189 HOH HOH B . 
M 5 HOH 72  572 203 HOH HOH B . 
M 5 HOH 73  573 205 HOH HOH B . 
M 5 HOH 74  574 209 HOH HOH B . 
M 5 HOH 75  575 214 HOH HOH B . 
M 5 HOH 76  576 216 HOH HOH B . 
M 5 HOH 77  577 217 HOH HOH B . 
M 5 HOH 78  578 218 HOH HOH B . 
M 5 HOH 79  579 220 HOH HOH B . 
M 5 HOH 80  580 221 HOH HOH B . 
M 5 HOH 81  581 223 HOH HOH B . 
M 5 HOH 82  582 224 HOH HOH B . 
M 5 HOH 83  583 225 HOH HOH B . 
M 5 HOH 84  584 226 HOH HOH B . 
M 5 HOH 85  585 227 HOH HOH B . 
M 5 HOH 86  586 229 HOH HOH B . 
M 5 HOH 87  587 230 HOH HOH B . 
M 5 HOH 88  588 231 HOH HOH B . 
M 5 HOH 89  589 232 HOH HOH B . 
M 5 HOH 90  590 234 HOH HOH B . 
M 5 HOH 91  591 237 HOH HOH B . 
M 5 HOH 92  592 240 HOH HOH B . 
M 5 HOH 93  593 242 HOH HOH B . 
M 5 HOH 94  594 243 HOH HOH B . 
M 5 HOH 95  595 244 HOH HOH B . 
M 5 HOH 96  596 245 HOH HOH B . 
M 5 HOH 97  597 249 HOH HOH B . 
M 5 HOH 98  598 250 HOH HOH B . 
M 5 HOH 99  599 252 HOH HOH B . 
M 5 HOH 100 600 255 HOH HOH B . 
M 5 HOH 101 601 256 HOH HOH B . 
M 5 HOH 102 602 257 HOH HOH B . 
M 5 HOH 103 603 260 HOH HOH B . 
M 5 HOH 104 604 261 HOH HOH B . 
M 5 HOH 105 605 264 HOH HOH B . 
M 5 HOH 106 606 266 HOH HOH B . 
M 5 HOH 107 607 267 HOH HOH B . 
M 5 HOH 108 608 268 HOH HOH B . 
M 5 HOH 109 609 269 HOH HOH B . 
M 5 HOH 110 610 270 HOH HOH B . 
M 5 HOH 111 611 272 HOH HOH B . 
M 5 HOH 112 612 278 HOH HOH B . 
M 5 HOH 113 613 280 HOH HOH B . 
M 5 HOH 114 614 281 HOH HOH B . 
M 5 HOH 115 615 283 HOH HOH B . 
M 5 HOH 116 616 288 HOH HOH B . 
M 5 HOH 117 617 289 HOH HOH B . 
M 5 HOH 118 618 293 HOH HOH B . 
M 5 HOH 119 619 294 HOH HOH B . 
M 5 HOH 120 620 295 HOH HOH B . 
M 5 HOH 121 621 296 HOH HOH B . 
M 5 HOH 122 622 297 HOH HOH B . 
M 5 HOH 123 623 300 HOH HOH B . 
M 5 HOH 124 624 304 HOH HOH B . 
M 5 HOH 125 625 305 HOH HOH B . 
M 5 HOH 126 626 307 HOH HOH B . 
M 5 HOH 127 627 308 HOH HOH B . 
M 5 HOH 128 628 309 HOH HOH B . 
M 5 HOH 129 629 311 HOH HOH B . 
M 5 HOH 130 630 314 HOH HOH B . 
M 5 HOH 131 631 315 HOH HOH B . 
M 5 HOH 132 632 317 HOH HOH B . 
M 5 HOH 133 633 319 HOH HOH B . 
M 5 HOH 134 634 320 HOH HOH B . 
M 5 HOH 135 635 335 HOH HOH B . 
M 5 HOH 136 636 337 HOH HOH B . 
M 5 HOH 137 637 338 HOH HOH B . 
M 5 HOH 138 638 339 HOH HOH B . 
M 5 HOH 139 639 340 HOH HOH B . 
M 5 HOH 140 640 342 HOH HOH B . 
M 5 HOH 141 641 344 HOH HOH B . 
M 5 HOH 142 642 346 HOH HOH B . 
M 5 HOH 143 643 347 HOH HOH B . 
M 5 HOH 144 644 348 HOH HOH B . 
M 5 HOH 145 645 355 HOH HOH B . 
M 5 HOH 146 646 357 HOH HOH B . 
M 5 HOH 147 647 360 HOH HOH B . 
M 5 HOH 148 648 361 HOH HOH B . 
M 5 HOH 149 649 363 HOH HOH B . 
M 5 HOH 150 650 375 HOH HOH B . 
M 5 HOH 151 651 377 HOH HOH B . 
M 5 HOH 152 652 381 HOH HOH B . 
M 5 HOH 153 653 383 HOH HOH B . 
M 5 HOH 154 654 386 HOH HOH B . 
M 5 HOH 155 655 388 HOH HOH B . 
M 5 HOH 156 656 389 HOH HOH B . 
M 5 HOH 157 657 391 HOH HOH B . 
M 5 HOH 158 658 392 HOH HOH B . 
M 5 HOH 159 659 393 HOH HOH B . 
M 5 HOH 160 660 394 HOH HOH B . 
M 5 HOH 161 661 396 HOH HOH B . 
M 5 HOH 162 662 397 HOH HOH B . 
M 5 HOH 163 663 398 HOH HOH B . 
M 5 HOH 164 664 399 HOH HOH B . 
M 5 HOH 165 665 402 HOH HOH B . 
M 5 HOH 166 666 403 HOH HOH B . 
M 5 HOH 167 667 404 HOH HOH B . 
M 5 HOH 168 668 405 HOH HOH B . 
M 5 HOH 169 669 407 HOH HOH B . 
M 5 HOH 170 670 408 HOH HOH B . 
M 5 HOH 171 671 410 HOH HOH B . 
M 5 HOH 172 672 412 HOH HOH B . 
M 5 HOH 173 673 413 HOH HOH B . 
M 5 HOH 174 674 415 HOH HOH B . 
M 5 HOH 175 675 416 HOH HOH B . 
M 5 HOH 176 676 418 HOH HOH B . 
M 5 HOH 177 677 420 HOH HOH B . 
M 5 HOH 178 678 422 HOH HOH B . 
M 5 HOH 179 679 426 HOH HOH B . 
M 5 HOH 180 680 435 HOH HOH B . 
M 5 HOH 181 681 441 HOH HOH B . 
M 5 HOH 182 682 444 HOH HOH B . 
M 5 HOH 183 683 445 HOH HOH B . 
M 5 HOH 184 684 449 HOH HOH B . 
M 5 HOH 185 685 450 HOH HOH B . 
M 5 HOH 186 686 453 HOH HOH B . 
M 5 HOH 187 687 458 HOH HOH B . 
M 5 HOH 188 688 460 HOH HOH B . 
M 5 HOH 189 689 463 HOH HOH B . 
M 5 HOH 190 690 464 HOH HOH B . 
M 5 HOH 191 691 474 HOH HOH B . 
M 5 HOH 192 692 475 HOH HOH B . 
M 5 HOH 193 693 476 HOH HOH B . 
M 5 HOH 194 694 477 HOH HOH B . 
M 5 HOH 195 695 478 HOH HOH B . 
M 5 HOH 196 696 479 HOH HOH B . 
M 5 HOH 197 697 480 HOH HOH B . 
M 5 HOH 198 698 481 HOH HOH B . 
M 5 HOH 199 699 482 HOH HOH B . 
M 5 HOH 200 700 483 HOH HOH B . 
M 5 HOH 201 701 484 HOH HOH B . 
M 5 HOH 202 702 485 HOH HOH B . 
M 5 HOH 203 703 486 HOH HOH B . 
M 5 HOH 204 704 487 HOH HOH B . 
M 5 HOH 205 705 488 HOH HOH B . 
M 5 HOH 206 706 489 HOH HOH B . 
M 5 HOH 207 707 496 HOH HOH B . 
M 5 HOH 208 708 497 HOH HOH B . 
M 5 HOH 209 709 505 HOH HOH B . 
M 5 HOH 210 710 506 HOH HOH B . 
M 5 HOH 211 711 507 HOH HOH B . 
M 5 HOH 212 712 508 HOH HOH B . 
M 5 HOH 213 713 509 HOH HOH B . 
M 5 HOH 214 714 510 HOH HOH B . 
#