data_4NKU
# 
_entry.id   4NKU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4NKU         
NDB   NA2777       
RCSB  RCSB083329   
WWPDB D_1000083329 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4NKT 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4NKU 
_pdbx_database_status.recvd_initial_deposition_date   2013-11-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Munoz-Tello, P.' 1 
'Gabus, C.'       2 
'Thore, S.'       3 
# 
_citation.id                        primary 
_citation.title                     
'A critical switch in the enzymatic properties of the Cid1 protein deciphered from its product-bound crystal structure.' 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_volume            42 
_citation.page_first                3372 
_citation.page_last                 3380 
_citation.year                      2014 
_citation.journal_id_ASTM           NARHAD 
_citation.country                   UK 
_citation.journal_id_ISSN           0305-1048 
_citation.journal_id_CSD            0389 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24322298 
_citation.pdbx_database_id_DOI      10.1093/nar/gkt1278 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Munoz-Tello, P.' 1 
primary 'Gabus, C.'       2 
primary 'Thore, S.'       3 
# 
_cell.entry_id           4NKU 
_cell.length_a           54.020 
_cell.length_b           77.090 
_cell.length_c           81.830 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.71 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4NKU 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Poly(A) RNA polymerase protein cid1' 38984.703 2   2.7.7.- D160A 'UNP residues 40-377' ? 
2 polymer     syn "5'-R(*AP*U)-3'"                      590.414   2   ?       ?     ?                     ? 
3 non-polymer syn 'MAGNESIUM ION'                       24.305    3   ?       ?     ?                     ? 
4 non-polymer syn 'BROMIDE ION'                         79.904    3   ?       ?     ?                     ? 
5 water       nat water                                 18.015    356 ?       ?     ?                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Caffeine-induced death protein 1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no 
;GDMSHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDT
IALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCAIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWA
KRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFF
RFYAYKFEPREKVVTFRRPDGYLTKQEKGWTSATEHTGSADQIIKDRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMA
ASRLLNSRSYPIPYDSLFEEA
;
;GDMSHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDT
IALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCAIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWA
KRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFF
RFYAYKFEPREKVVTFRRPDGYLTKQEKGWTSATEHTGSADQIIKDRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMA
ASRLLNSRSYPIPYDSLFEEA
;
A,B ? 
2 polyribonucleotide no no AU AU D,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ASP n 
1 3   MET n 
1 4   SER n 
1 5   HIS n 
1 6   LYS n 
1 7   GLU n 
1 8   PHE n 
1 9   THR n 
1 10  LYS n 
1 11  PHE n 
1 12  CYS n 
1 13  TYR n 
1 14  GLU n 
1 15  VAL n 
1 16  TYR n 
1 17  ASN n 
1 18  GLU n 
1 19  ILE n 
1 20  LYS n 
1 21  ILE n 
1 22  SER n 
1 23  ASP n 
1 24  LYS n 
1 25  GLU n 
1 26  PHE n 
1 27  LYS n 
1 28  GLU n 
1 29  LYS n 
1 30  ARG n 
1 31  ALA n 
1 32  ALA n 
1 33  LEU n 
1 34  ASP n 
1 35  THR n 
1 36  LEU n 
1 37  ARG n 
1 38  LEU n 
1 39  CYS n 
1 40  LEU n 
1 41  LYS n 
1 42  ARG n 
1 43  ILE n 
1 44  SER n 
1 45  PRO n 
1 46  ASP n 
1 47  ALA n 
1 48  GLU n 
1 49  LEU n 
1 50  VAL n 
1 51  ALA n 
1 52  PHE n 
1 53  GLY n 
1 54  SER n 
1 55  LEU n 
1 56  GLU n 
1 57  SER n 
1 58  GLY n 
1 59  LEU n 
1 60  ALA n 
1 61  LEU n 
1 62  LYS n 
1 63  ASN n 
1 64  SER n 
1 65  ASP n 
1 66  MET n 
1 67  ASP n 
1 68  LEU n 
1 69  CYS n 
1 70  VAL n 
1 71  LEU n 
1 72  MET n 
1 73  ASP n 
1 74  SER n 
1 75  ARG n 
1 76  VAL n 
1 77  GLN n 
1 78  SER n 
1 79  ASP n 
1 80  THR n 
1 81  ILE n 
1 82  ALA n 
1 83  LEU n 
1 84  GLN n 
1 85  PHE n 
1 86  TYR n 
1 87  GLU n 
1 88  GLU n 
1 89  LEU n 
1 90  ILE n 
1 91  ALA n 
1 92  GLU n 
1 93  GLY n 
1 94  PHE n 
1 95  GLU n 
1 96  GLY n 
1 97  LYS n 
1 98  PHE n 
1 99  LEU n 
1 100 GLN n 
1 101 ARG n 
1 102 ALA n 
1 103 ARG n 
1 104 ILE n 
1 105 PRO n 
1 106 ILE n 
1 107 ILE n 
1 108 LYS n 
1 109 LEU n 
1 110 THR n 
1 111 SER n 
1 112 ASP n 
1 113 THR n 
1 114 LYS n 
1 115 ASN n 
1 116 GLY n 
1 117 PHE n 
1 118 GLY n 
1 119 ALA n 
1 120 SER n 
1 121 PHE n 
1 122 GLN n 
1 123 CYS n 
1 124 ALA n 
1 125 ILE n 
1 126 GLY n 
1 127 PHE n 
1 128 ASN n 
1 129 ASN n 
1 130 ARG n 
1 131 LEU n 
1 132 ALA n 
1 133 ILE n 
1 134 HIS n 
1 135 ASN n 
1 136 THR n 
1 137 LEU n 
1 138 LEU n 
1 139 LEU n 
1 140 SER n 
1 141 SER n 
1 142 TYR n 
1 143 THR n 
1 144 LYS n 
1 145 LEU n 
1 146 ASP n 
1 147 ALA n 
1 148 ARG n 
1 149 LEU n 
1 150 LYS n 
1 151 PRO n 
1 152 MET n 
1 153 VAL n 
1 154 LEU n 
1 155 LEU n 
1 156 VAL n 
1 157 LYS n 
1 158 HIS n 
1 159 TRP n 
1 160 ALA n 
1 161 LYS n 
1 162 ARG n 
1 163 LYS n 
1 164 GLN n 
1 165 ILE n 
1 166 ASN n 
1 167 SER n 
1 168 PRO n 
1 169 TYR n 
1 170 PHE n 
1 171 GLY n 
1 172 THR n 
1 173 LEU n 
1 174 SER n 
1 175 SER n 
1 176 TYR n 
1 177 GLY n 
1 178 TYR n 
1 179 VAL n 
1 180 LEU n 
1 181 MET n 
1 182 VAL n 
1 183 LEU n 
1 184 TYR n 
1 185 TYR n 
1 186 LEU n 
1 187 ILE n 
1 188 HIS n 
1 189 VAL n 
1 190 ILE n 
1 191 LYS n 
1 192 PRO n 
1 193 PRO n 
1 194 VAL n 
1 195 PHE n 
1 196 PRO n 
1 197 ASN n 
1 198 LEU n 
1 199 LEU n 
1 200 LEU n 
1 201 SER n 
1 202 PRO n 
1 203 LEU n 
1 204 LYS n 
1 205 GLN n 
1 206 GLU n 
1 207 LYS n 
1 208 ILE n 
1 209 VAL n 
1 210 ASP n 
1 211 GLY n 
1 212 PHE n 
1 213 ASP n 
1 214 VAL n 
1 215 GLY n 
1 216 PHE n 
1 217 ASP n 
1 218 ASP n 
1 219 LYS n 
1 220 LEU n 
1 221 GLU n 
1 222 ASP n 
1 223 ILE n 
1 224 PRO n 
1 225 PRO n 
1 226 SER n 
1 227 GLN n 
1 228 ASN n 
1 229 TYR n 
1 230 SER n 
1 231 SER n 
1 232 LEU n 
1 233 GLY n 
1 234 SER n 
1 235 LEU n 
1 236 LEU n 
1 237 HIS n 
1 238 GLY n 
1 239 PHE n 
1 240 PHE n 
1 241 ARG n 
1 242 PHE n 
1 243 TYR n 
1 244 ALA n 
1 245 TYR n 
1 246 LYS n 
1 247 PHE n 
1 248 GLU n 
1 249 PRO n 
1 250 ARG n 
1 251 GLU n 
1 252 LYS n 
1 253 VAL n 
1 254 VAL n 
1 255 THR n 
1 256 PHE n 
1 257 ARG n 
1 258 ARG n 
1 259 PRO n 
1 260 ASP n 
1 261 GLY n 
1 262 TYR n 
1 263 LEU n 
1 264 THR n 
1 265 LYS n 
1 266 GLN n 
1 267 GLU n 
1 268 LYS n 
1 269 GLY n 
1 270 TRP n 
1 271 THR n 
1 272 SER n 
1 273 ALA n 
1 274 THR n 
1 275 GLU n 
1 276 HIS n 
1 277 THR n 
1 278 GLY n 
1 279 SER n 
1 280 ALA n 
1 281 ASP n 
1 282 GLN n 
1 283 ILE n 
1 284 ILE n 
1 285 LYS n 
1 286 ASP n 
1 287 ARG n 
1 288 TYR n 
1 289 ILE n 
1 290 LEU n 
1 291 ALA n 
1 292 ILE n 
1 293 GLU n 
1 294 ASP n 
1 295 PRO n 
1 296 PHE n 
1 297 GLU n 
1 298 ILE n 
1 299 SER n 
1 300 HIS n 
1 301 ASN n 
1 302 VAL n 
1 303 GLY n 
1 304 ARG n 
1 305 THR n 
1 306 VAL n 
1 307 SER n 
1 308 SER n 
1 309 SER n 
1 310 GLY n 
1 311 LEU n 
1 312 TYR n 
1 313 ARG n 
1 314 ILE n 
1 315 ARG n 
1 316 GLY n 
1 317 GLU n 
1 318 PHE n 
1 319 MET n 
1 320 ALA n 
1 321 ALA n 
1 322 SER n 
1 323 ARG n 
1 324 LEU n 
1 325 LEU n 
1 326 ASN n 
1 327 SER n 
1 328 ARG n 
1 329 SER n 
1 330 TYR n 
1 331 PRO n 
1 332 ILE n 
1 333 PRO n 
1 334 TYR n 
1 335 ASP n 
1 336 SER n 
1 337 LEU n 
1 338 PHE n 
1 339 GLU n 
1 340 GLU n 
1 341 ALA n 
2 1   A   n 
2 2   U   n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Fission yeast' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'cid1, SPAC19D5.03' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Schizosaccharomyces pombe' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     4896 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 Star' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET42-based 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP CID1_SCHPO O13833 1 
;SHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIAL
QFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRK
QINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFY
AYKFEPREKVVTFRRPDGYLTKQEKGWTSATEHTGSADQIIKDRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASR
LLNSRSYPIPYDSLFEEA
;
40 ? 
2 PDB 4NKU       4NKU   2 AU 1  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4NKU A 4 ? 341 ? O13833 40 ? 377 ? 40 377 
2 1 4NKU B 4 ? 341 ? O13833 40 ? 377 ? 40 377 
3 2 4NKU D 1 ? 2   ? 4NKU   58 ? 59  ? 58 59  
4 2 4NKU H 1 ? 2   ? 4NKU   58 ? 59  ? 58 59  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4NKU GLY A 1   ? UNP O13833 ?   ?   'EXPRESSION TAG'      37  1 
1 4NKU ASP A 2   ? UNP O13833 ?   ?   'EXPRESSION TAG'      38  2 
1 4NKU MET A 3   ? UNP O13833 ?   ?   'EXPRESSION TAG'      39  3 
1 4NKU ALA A 124 ? UNP O13833 ASP 160 'ENGINEERED MUTATION' 160 4 
2 4NKU GLY B 1   ? UNP O13833 ?   ?   'EXPRESSION TAG'      37  5 
2 4NKU ASP B 2   ? UNP O13833 ?   ?   'EXPRESSION TAG'      38  6 
2 4NKU MET B 3   ? UNP O13833 ?   ?   'EXPRESSION TAG'      39  7 
2 4NKU ALA B 124 ? UNP O13833 ASP 160 'ENGINEERED MUTATION' 160 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
BR  non-polymer         . 'BROMIDE ION'                ? 'Br -1'           79.904  
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'              ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4NKU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.15 
_exptl_crystal.density_percent_sol   42.86 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.1 
_exptl_crystal_grow.pdbx_details    
;0.1 M imidazole/MES, pH 6.1, 20% glycerol, 10% PEG4000, 126 mM halogens (sodium iodide, sodium bromide, sodium fluoride), 10 mM TCEP, VAPOR DIFFUSION, SITTING DROP, temperature 291K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2012-06-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'channel cut Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9394 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9394 
# 
_reflns.entry_id                     4NKU 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             45.337 
_reflns.d_resolution_high            1.94 
_reflns.number_obs                   49569 
_reflns.number_all                   49786 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            0.093 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.14 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.94 
_reflns_shell.d_res_low              ? 
_reflns_shell.percent_possible_all   99.2 
_reflns_shell.Rmerge_I_obs           0.086 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.28 
_reflns_shell.pdbx_redundancy        5.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4NKU 
_refine.ls_number_reflns_obs                     49569 
_refine.ls_number_reflns_all                     49786 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45.337 
_refine.ls_d_res_high                            1.940 
_refine.ls_percent_reflns_obs                    99.54 
_refine.ls_R_factor_obs                          0.1810 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1792 
_refine.ls_R_factor_R_free                       0.2257 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.04 
_refine.ls_number_reflns_R_free                  2001 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 4EP7' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.18 
_refine.pdbx_overall_phase_error                 22.77 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5111 
_refine_hist.pdbx_number_atoms_nucleic_acid   78 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             356 
_refine_hist.number_atoms_total               5551 
_refine_hist.d_res_high                       1.940 
_refine_hist.d_res_low                        45.337 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.007  ? ? 5339 ? 'X-RAY DIFFRACTION' 
f_angle_d          1.077  ? ? 7220 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 15.364 ? ? 2013 ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.078  ? ? 794  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.006  ? ? 899  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 1.940  1.9884  3359 0.2175 99.0  0.2720 . . 134 . . . . 'X-RAY DIFFRACTION' 
. 1.9884 2.0422  3396 0.2079 99.0  0.2323 . . 142 . . . . 'X-RAY DIFFRACTION' 
. 2.0422 2.1023  3348 0.1985 99.0  0.2799 . . 148 . . . . 'X-RAY DIFFRACTION' 
. 2.1023 2.1701  3359 0.1963 100.0 0.2709 . . 147 . . . . 'X-RAY DIFFRACTION' 
. 2.1701 2.2477  3422 0.1972 99.0  0.2723 . . 133 . . . . 'X-RAY DIFFRACTION' 
. 2.2477 2.3377  3392 0.1881 100.0 0.2605 . . 150 . . . . 'X-RAY DIFFRACTION' 
. 2.3377 2.4441  3371 0.1854 100.0 0.2603 . . 148 . . . . 'X-RAY DIFFRACTION' 
. 2.4441 2.5729  3424 0.1847 100.0 0.2512 . . 131 . . . . 'X-RAY DIFFRACTION' 
. 2.5729 2.7341  3376 0.1947 100.0 0.2747 . . 146 . . . . 'X-RAY DIFFRACTION' 
. 2.7341 2.9452  3395 0.1899 100.0 0.2290 . . 156 . . . . 'X-RAY DIFFRACTION' 
. 2.9452 3.2415  3418 0.1839 100.0 0.2227 . . 141 . . . . 'X-RAY DIFFRACTION' 
. 3.2415 3.7103  3414 0.1619 100.0 0.2040 . . 145 . . . . 'X-RAY DIFFRACTION' 
. 3.7103 4.6739  3439 0.1494 100.0 0.1689 . . 140 . . . . 'X-RAY DIFFRACTION' 
. 4.6739 45.3497 3455 0.1816 98.0  0.2185 . . 140 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4NKU 
_struct.title                     'Structure of Cid1 in complex with its short product ApU' 
_struct.pdbx_descriptor           'Poly(A) RNA polymerase protein cid1 (E.C.2.7.7.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4NKU 
_struct_keywords.pdbx_keywords   TRANSFERASE/RNA 
_struct_keywords.text            
'poly(U) polymerase, nucleotidyl tranfer domain, PAP-associated domain, UTP binding, TRANSFERASE-RNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
K N N 5 ? 
L N N 5 ? 
M N N 5 ? 
N N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  HIS A 5   ? LYS A 20  ? HIS A 41  LYS A 56  1 ? 16 
HELX_P HELX_P2  2  SER A 22  ? ARG A 42  ? SER A 58  ARG A 78  1 ? 21 
HELX_P HELX_P3  3  GLY A 53  ? GLY A 58  ? GLY A 89  GLY A 94  1 ? 6  
HELX_P HELX_P4  4  ILE A 81  ? GLU A 92  ? ILE A 117 GLU A 128 1 ? 12 
HELX_P HELX_P5  5  ASN A 129 ? ASP A 146 ? ASN A 165 ASP A 182 1 ? 18 
HELX_P HELX_P6  6  ARG A 148 ? LYS A 163 ? ARG A 184 LYS A 199 1 ? 16 
HELX_P HELX_P7  7  SER A 167 ? GLY A 171 ? SER A 203 GLY A 207 5 ? 5  
HELX_P HELX_P8  8  SER A 174 ? VAL A 189 ? SER A 210 VAL A 225 1 ? 16 
HELX_P HELX_P9  9  LYS A 219 ? ILE A 223 ? LYS A 255 ILE A 259 5 ? 5  
HELX_P HELX_P10 10 SER A 231 ? LYS A 246 ? SER A 267 LYS A 282 1 ? 16 
HELX_P HELX_P11 11 THR A 264 ? GLY A 269 ? THR A 300 GLY A 305 1 ? 6  
HELX_P HELX_P12 12 SER A 307 ? SER A 327 ? SER A 343 SER A 363 1 ? 21 
HELX_P HELX_P13 13 PRO A 333 ? GLU A 339 ? PRO A 369 GLU A 375 5 ? 7  
HELX_P HELX_P14 14 HIS B 5   ? LYS B 20  ? HIS B 41  LYS B 56  1 ? 16 
HELX_P HELX_P15 15 SER B 22  ? ARG B 42  ? SER B 58  ARG B 78  1 ? 21 
HELX_P HELX_P16 16 GLY B 53  ? GLY B 58  ? GLY B 89  GLY B 94  1 ? 6  
HELX_P HELX_P17 17 ILE B 81  ? GLU B 92  ? ILE B 117 GLU B 128 1 ? 12 
HELX_P HELX_P18 18 ASN B 129 ? ASP B 146 ? ASN B 165 ASP B 182 1 ? 18 
HELX_P HELX_P19 19 ARG B 148 ? LYS B 163 ? ARG B 184 LYS B 199 1 ? 16 
HELX_P HELX_P20 20 SER B 167 ? GLY B 171 ? SER B 203 GLY B 207 5 ? 5  
HELX_P HELX_P21 21 SER B 174 ? VAL B 189 ? SER B 210 VAL B 225 1 ? 16 
HELX_P HELX_P22 22 ASN B 197 ? SER B 201 ? ASN B 233 SER B 237 5 ? 5  
HELX_P HELX_P23 23 LYS B 219 ? ILE B 223 ? LYS B 255 ILE B 259 5 ? 5  
HELX_P HELX_P24 24 SER B 231 ? LYS B 246 ? SER B 267 LYS B 282 1 ? 16 
HELX_P HELX_P25 25 THR B 264 ? GLY B 269 ? THR B 300 GLY B 305 1 ? 6  
HELX_P HELX_P26 26 ASN B 301 ? VAL B 306 ? ASN B 337 VAL B 342 5 ? 6  
HELX_P HELX_P27 27 SER B 307 ? ASN B 326 ? SER B 343 ASN B 362 1 ? 20 
HELX_P HELX_P28 28 PRO B 333 ? GLU B 339 ? PRO B 369 GLU B 375 5 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? E MG . MG ? ? ? 1_555 K HOH . O ? ? A MG 401 A HOH 680 1_555 ? ? ? ? ? ? ? 2.068 ? 
metalc2 metalc ? ? H MG . MG ? ? ? 1_555 L HOH . O ? ? B MG 401 B HOH 644 1_555 ? ? ? ? ? ? ? 2.732 ? 
metalc3 metalc ? ? E MG . MG ? ? ? 1_555 K HOH . O ? ? A MG 401 A HOH 619 1_555 ? ? ? ? ? ? ? 2.839 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 191 A . ? LYS 227 A PRO 192 A ? PRO 228 A 1 -4.50 
2 LYS 191 B . ? LYS 227 B PRO 192 B ? PRO 228 B 1 -6.20 
3 TYR 330 B . ? TYR 366 B PRO 331 B ? PRO 367 B 1 0.53  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 5 ? 
D ? 2 ? 
E ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 48  ? PHE A 52  ? GLU A 84  PHE A 88  
A 2 MET A 66  ? LEU A 71  ? MET A 102 LEU A 107 
A 3 CYS A 123 ? PHE A 127 ? CYS A 159 PHE A 163 
A 4 ILE A 107 ? ASP A 112 ? ILE A 143 ASP A 148 
A 5 PHE A 94  ? PHE A 98  ? PHE A 130 PHE A 134 
B 1 ILE A 208 ? VAL A 209 ? ILE A 244 VAL A 245 
B 2 PHE A 212 ? ASP A 213 ? PHE A 248 ASP A 249 
C 1 GLU B 48  ? PHE B 52  ? GLU B 84  PHE B 88  
C 2 MET B 66  ? LEU B 71  ? MET B 102 LEU B 107 
C 3 CYS B 123 ? PHE B 127 ? CYS B 159 PHE B 163 
C 4 ILE B 106 ? SER B 111 ? ILE B 142 SER B 147 
C 5 GLU B 95  ? LEU B 99  ? GLU B 131 LEU B 135 
D 1 ILE B 208 ? VAL B 209 ? ILE B 244 VAL B 245 
D 2 PHE B 212 ? ASP B 213 ? PHE B 248 ASP B 249 
E 1 VAL B 253 ? VAL B 254 ? VAL B 289 VAL B 290 
E 2 ALA B 291 ? ILE B 292 ? ALA B 327 ILE B 328 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 50  ? N VAL A 86  O CYS A 69  ? O CYS A 105 
A 2 3 N LEU A 68  ? N LEU A 104 O GLY A 126 ? O GLY A 162 
A 3 4 O CYS A 123 ? O CYS A 159 N LEU A 109 ? N LEU A 145 
A 4 5 O LYS A 108 ? O LYS A 144 N LYS A 97  ? N LYS A 133 
B 1 2 N VAL A 209 ? N VAL A 245 O PHE A 212 ? O PHE A 248 
C 1 2 N GLU B 48  ? N GLU B 84  O LEU B 71  ? O LEU B 107 
C 2 3 N LEU B 68  ? N LEU B 104 O ALA B 124 ? O ALA B 160 
C 3 4 O CYS B 123 ? O CYS B 159 N LEU B 109 ? N LEU B 145 
C 4 5 O ILE B 106 ? O ILE B 142 N LEU B 99  ? N LEU B 135 
D 1 2 N VAL B 209 ? N VAL B 245 O PHE B 212 ? O PHE B 248 
E 1 2 N VAL B 254 ? N VAL B 290 O ALA B 291 ? O ALA B 327 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG A 401' 
AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MG A 402' 
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MG B 401' 
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE BR B 402' 
AC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE BR D 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 HOH K .   ? HOH A 517 . ? 1_555 ? 
2  AC1 3 HOH K .   ? HOH A 619 . ? 1_555 ? 
3  AC1 3 HOH K .   ? HOH A 680 . ? 1_555 ? 
4  AC2 2 THR A 9   ? THR A 45  . ? 1_555 ? 
5  AC2 2 HOH K .   ? HOH A 573 . ? 1_555 ? 
6  AC3 2 LEU B 38  ? LEU B 74  . ? 1_555 ? 
7  AC3 2 HOH L .   ? HOH B 644 . ? 1_555 ? 
8  AC4 3 LYS B 157 ? LYS B 193 . ? 1_555 ? 
9  AC4 3 HOH L .   ? HOH B 593 . ? 1_555 ? 
10 AC4 3 U   D 2   ? U   H 59  . ? 1_555 ? 
11 AC5 3 LYS A 157 ? LYS A 193 . ? 1_555 ? 
12 AC5 3 HOH K .   ? HOH A 609 . ? 1_555 ? 
13 AC5 3 U   C 2   ? U   D 59  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4NKU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4NKU 
_atom_sites.fract_transf_matrix[1][1]   0.018512 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000229 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012972 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012221 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ASP A 1 2   ? 16.172  -7.931  -5.841  1.00 44.93 ? 38  ASP A N     1 
ATOM   2    C  CA    . ASP A 1 2   ? 16.782  -7.990  -4.516  1.00 43.61 ? 38  ASP A CA    1 
ATOM   3    C  C     . ASP A 1 2   ? 15.893  -8.759  -3.541  1.00 42.61 ? 38  ASP A C     1 
ATOM   4    O  O     . ASP A 1 2   ? 14.903  -8.220  -3.026  1.00 45.02 ? 38  ASP A O     1 
ATOM   5    C  CB    . ASP A 1 2   ? 17.070  -6.577  -3.997  1.00 37.93 ? 38  ASP A CB    1 
ATOM   6    C  CG    . ASP A 1 2   ? 17.549  -6.563  -2.551  1.00 37.24 ? 38  ASP A CG    1 
ATOM   7    O  OD1   . ASP A 1 2   ? 18.105  -7.577  -2.071  1.00 39.74 ? 38  ASP A OD1   1 
ATOM   8    O  OD2   . ASP A 1 2   ? 17.376  -5.518  -1.894  1.00 32.43 ? 38  ASP A OD2   1 
ATOM   9    N  N     . MET A 1 3   ? 16.250  -10.016 -3.283  1.00 42.06 ? 39  MET A N     1 
ATOM   10   C  CA    . MET A 1 3   ? 15.507  -10.839 -2.331  1.00 38.03 ? 39  MET A CA    1 
ATOM   11   C  C     . MET A 1 3   ? 16.243  -11.043 -1.001  1.00 37.51 ? 39  MET A C     1 
ATOM   12   O  O     . MET A 1 3   ? 15.830  -11.856 -0.171  1.00 39.34 ? 39  MET A O     1 
ATOM   13   C  CB    . MET A 1 3   ? 15.142  -12.200 -2.947  1.00 39.44 ? 39  MET A CB    1 
ATOM   14   C  CG    . MET A 1 3   ? 14.549  -12.168 -4.359  1.00 41.54 ? 39  MET A CG    1 
ATOM   15   S  SD    . MET A 1 3   ? 12.945  -11.326 -4.547  1.00 63.16 ? 39  MET A SD    1 
ATOM   16   C  CE    . MET A 1 3   ? 12.233  -11.524 -2.915  1.00 37.78 ? 39  MET A CE    1 
ATOM   17   N  N     . SER A 1 4   ? 17.316  -10.283 -0.798  1.00 37.89 ? 40  SER A N     1 
ATOM   18   C  CA    . SER A 1 4   ? 18.203  -10.430 0.363   1.00 39.14 ? 40  SER A CA    1 
ATOM   19   C  C     . SER A 1 4   ? 17.572  -10.086 1.732   1.00 42.26 ? 40  SER A C     1 
ATOM   20   O  O     . SER A 1 4   ? 17.979  -10.625 2.776   1.00 40.65 ? 40  SER A O     1 
ATOM   21   C  CB    . SER A 1 4   ? 19.448  -9.563  0.147   1.00 40.88 ? 40  SER A CB    1 
ATOM   22   O  OG    . SER A 1 4   ? 19.084  -8.189  0.041   1.00 41.30 ? 40  SER A OG    1 
ATOM   23   N  N     . HIS A 1 5   ? 16.588  -9.191  1.732   1.00 33.11 ? 41  HIS A N     1 
ATOM   24   C  CA    . HIS A 1 5   ? 16.003  -8.709  2.981   1.00 29.62 ? 41  HIS A CA    1 
ATOM   25   C  C     . HIS A 1 5   ? 14.479  -8.828  2.949   1.00 32.83 ? 41  HIS A C     1 
ATOM   26   O  O     . HIS A 1 5   ? 13.762  -7.953  3.454   1.00 26.39 ? 41  HIS A O     1 
ATOM   27   C  CB    . HIS A 1 5   ? 16.393  -7.245  3.222   1.00 31.20 ? 41  HIS A CB    1 
ATOM   28   C  CG    . HIS A 1 5   ? 17.840  -7.040  3.555   1.00 33.54 ? 41  HIS A CG    1 
ATOM   29   N  ND1   . HIS A 1 5   ? 18.838  -7.060  2.602   1.00 31.62 ? 41  HIS A ND1   1 
ATOM   30   C  CD2   . HIS A 1 5   ? 18.455  -6.791  4.740   1.00 33.06 ? 41  HIS A CD2   1 
ATOM   31   C  CE1   . HIS A 1 5   ? 20.006  -6.840  3.185   1.00 35.46 ? 41  HIS A CE1   1 
ATOM   32   N  NE2   . HIS A 1 5   ? 19.801  -6.675  4.482   1.00 35.75 ? 41  HIS A NE2   1 
ATOM   33   N  N     . LYS A 1 6   ? 13.986  -9.911  2.356   1.00 32.77 ? 42  LYS A N     1 
ATOM   34   C  CA    . LYS A 1 6   ? 12.554  -10.067 2.123   1.00 32.67 ? 42  LYS A CA    1 
ATOM   35   C  C     . LYS A 1 6   ? 11.729  -9.954  3.398   1.00 28.53 ? 42  LYS A C     1 
ATOM   36   O  O     . LYS A 1 6   ? 10.737  -9.228  3.431   1.00 25.37 ? 42  LYS A O     1 
ATOM   37   C  CB    . LYS A 1 6   ? 12.256  -11.396 1.419   1.00 35.30 ? 42  LYS A CB    1 
ATOM   38   C  CG    . LYS A 1 6   ? 10.817  -11.494 0.935   1.00 41.09 ? 42  LYS A CG    1 
ATOM   39   C  CD    . LYS A 1 6   ? 10.607  -12.720 0.061   1.00 45.92 ? 42  LYS A CD    1 
ATOM   40   C  CE    . LYS A 1 6   ? 10.598  -13.999 0.881   1.00 43.54 ? 42  LYS A CE    1 
ATOM   41   N  NZ    . LYS A 1 6   ? 9.258   -14.207 1.497   1.00 51.34 ? 42  LYS A NZ    1 
ATOM   42   N  N     . GLU A 1 7   ? 12.147  -10.654 4.450   1.00 26.98 ? 43  GLU A N     1 
ATOM   43   C  CA    . GLU A 1 7   ? 11.416  -10.647 5.722   1.00 28.08 ? 43  GLU A CA    1 
ATOM   44   C  C     . GLU A 1 7   ? 11.397  -9.270  6.397   1.00 29.33 ? 43  GLU A C     1 
ATOM   45   O  O     . GLU A 1 7   ? 10.352  -8.792  6.866   1.00 24.05 ? 43  GLU A O     1 
ATOM   46   C  CB    . GLU A 1 7   ? 12.046  -11.647 6.696   1.00 34.22 ? 43  GLU A CB    1 
ATOM   47   C  CG    . GLU A 1 7   ? 11.200  -12.860 6.955   1.00 43.65 ? 43  GLU A CG    1 
ATOM   48   C  CD    . GLU A 1 7   ? 10.849  -13.577 5.677   1.00 54.77 ? 43  GLU A CD    1 
ATOM   49   O  OE1   . GLU A 1 7   ? 9.696   -13.416 5.204   1.00 52.45 ? 43  GLU A OE1   1 
ATOM   50   O  OE2   . GLU A 1 7   ? 11.732  -14.288 5.137   1.00 63.00 ? 43  GLU A OE2   1 
ATOM   51   N  N     . PHE A 1 8   ? 12.573  -8.657  6.478   1.00 24.07 ? 44  PHE A N     1 
ATOM   52   C  CA    . PHE A 1 8   ? 12.690  -7.339  7.079   1.00 26.50 ? 44  PHE A CA    1 
ATOM   53   C  C     . PHE A 1 8   ? 11.866  -6.335  6.269   1.00 25.38 ? 44  PHE A C     1 
ATOM   54   O  O     . PHE A 1 8   ? 11.167  -5.488  6.838   1.00 22.65 ? 44  PHE A O     1 
ATOM   55   C  CB    . PHE A 1 8   ? 14.163  -6.934  7.154   1.00 24.54 ? 44  PHE A CB    1 
ATOM   56   C  CG    . PHE A 1 8   ? 14.389  -5.563  7.722   1.00 23.91 ? 44  PHE A CG    1 
ATOM   57   C  CD1   . PHE A 1 8   ? 13.709  -5.144  8.857   1.00 24.99 ? 44  PHE A CD1   1 
ATOM   58   C  CD2   . PHE A 1 8   ? 15.311  -4.701  7.132   1.00 25.27 ? 44  PHE A CD2   1 
ATOM   59   C  CE1   . PHE A 1 8   ? 13.923  -3.881  9.380   1.00 24.55 ? 44  PHE A CE1   1 
ATOM   60   C  CE2   . PHE A 1 8   ? 15.536  -3.439  7.650   1.00 26.68 ? 44  PHE A CE2   1 
ATOM   61   C  CZ    . PHE A 1 8   ? 14.837  -3.030  8.782   1.00 25.09 ? 44  PHE A CZ    1 
ATOM   62   N  N     . THR A 1 9   ? 11.939  -6.440  4.941   1.00 24.20 ? 45  THR A N     1 
ATOM   63   C  CA    . THR A 1 9   ? 11.153  -5.566  4.073   1.00 21.01 ? 45  THR A CA    1 
ATOM   64   C  C     . THR A 1 9   ? 9.656   -5.709  4.327   1.00 26.84 ? 45  THR A C     1 
ATOM   65   O  O     . THR A 1 9   ? 8.962   -4.711  4.503   1.00 20.33 ? 45  THR A O     1 
ATOM   66   C  CB    . THR A 1 9   ? 11.485  -5.780  2.577   1.00 24.09 ? 45  THR A CB    1 
ATOM   67   O  OG1   . THR A 1 9   ? 12.870  -5.484  2.353   1.00 23.56 ? 45  THR A OG1   1 
ATOM   68   C  CG2   . THR A 1 9   ? 10.654  -4.843  1.698   1.00 20.75 ? 45  THR A CG2   1 
ATOM   69   N  N     . LYS A 1 10  ? 9.149   -6.941  4.359   1.00 23.71 ? 46  LYS A N     1 
ATOM   70   C  CA    . LYS A 1 10  ? 7.743   -7.149  4.681   1.00 23.89 ? 46  LYS A CA    1 
ATOM   71   C  C     . LYS A 1 10  ? 7.371   -6.471  6.005   1.00 23.35 ? 46  LYS A C     1 
ATOM   72   O  O     . LYS A 1 10  ? 6.346   -5.793  6.105   1.00 23.78 ? 46  LYS A O     1 
ATOM   73   C  CB    . LYS A 1 10  ? 7.432   -8.658  4.743   1.00 25.90 ? 46  LYS A CB    1 
ATOM   74   C  CG    . LYS A 1 10  ? 6.041   -8.996  5.273   1.00 33.12 ? 46  LYS A CG    1 
ATOM   75   C  CD    . LYS A 1 10  ? 5.714   -10.472 5.039   1.00 33.63 ? 46  LYS A CD    1 
ATOM   76   C  CE    . LYS A 1 10  ? 4.247   -10.792 5.364   1.00 38.45 ? 46  LYS A CE    1 
ATOM   77   N  NZ    . LYS A 1 10  ? 3.896   -10.550 6.795   1.00 38.71 ? 46  LYS A NZ    1 
ATOM   78   N  N     . PHE A 1 11  ? 8.223   -6.628  7.013   1.00 22.66 ? 47  PHE A N     1 
ATOM   79   C  CA    . PHE A 1 11  ? 8.011   -5.988  8.309   1.00 24.24 ? 47  PHE A CA    1 
ATOM   80   C  C     . PHE A 1 11  ? 8.045   -4.453  8.212   1.00 24.16 ? 47  PHE A C     1 
ATOM   81   O  O     . PHE A 1 11  ? 7.239   -3.761  8.853   1.00 22.91 ? 47  PHE A O     1 
ATOM   82   C  CB    . PHE A 1 11  ? 9.058   -6.490  9.310   1.00 23.44 ? 47  PHE A CB    1 
ATOM   83   C  CG    . PHE A 1 11  ? 9.171   -5.656  10.548  1.00 27.30 ? 47  PHE A CG    1 
ATOM   84   C  CD1   . PHE A 1 11  ? 8.336   -5.884  11.634  1.00 30.09 ? 47  PHE A CD1   1 
ATOM   85   C  CD2   . PHE A 1 11  ? 10.138  -4.658  10.638  1.00 27.00 ? 47  PHE A CD2   1 
ATOM   86   C  CE1   . PHE A 1 11  ? 8.449   -5.118  12.787  1.00 33.30 ? 47  PHE A CE1   1 
ATOM   87   C  CE2   . PHE A 1 11  ? 10.248  -3.883  11.784  1.00 32.83 ? 47  PHE A CE2   1 
ATOM   88   C  CZ    . PHE A 1 11  ? 9.406   -4.118  12.857  1.00 31.57 ? 47  PHE A CZ    1 
ATOM   89   N  N     . CYS A 1 12  ? 8.970   -3.921  7.419   1.00 22.38 ? 48  CYS A N     1 
ATOM   90   C  CA    . CYS A 1 12  ? 9.051   -2.477  7.226   1.00 21.98 ? 48  CYS A CA    1 
ATOM   91   C  C     . CYS A 1 12  ? 7.742   -1.900  6.669   1.00 22.91 ? 48  CYS A C     1 
ATOM   92   O  O     . CYS A 1 12  ? 7.247   -0.868  7.146   1.00 22.77 ? 48  CYS A O     1 
ATOM   93   C  CB    . CYS A 1 12  ? 10.219  -2.126  6.300   1.00 22.16 ? 48  CYS A CB    1 
ATOM   94   S  SG    . CYS A 1 12  ? 11.869  -2.245  7.064   1.00 25.10 ? 48  CYS A SG    1 
ATOM   95   N  N     . TYR A 1 13  ? 7.174   -2.561  5.661   1.00 20.43 ? 49  TYR A N     1 
ATOM   96   C  CA    . TYR A 1 13  ? 5.951   -2.055  5.049   1.00 24.64 ? 49  TYR A CA    1 
ATOM   97   C  C     . TYR A 1 13  ? 4.744   -2.173  5.982   1.00 27.59 ? 49  TYR A C     1 
ATOM   98   O  O     . TYR A 1 13  ? 3.843   -1.326  5.940   1.00 24.43 ? 49  TYR A O     1 
ATOM   99   C  CB    . TYR A 1 13  ? 5.709   -2.691  3.665   1.00 24.96 ? 49  TYR A CB    1 
ATOM   100  C  CG    . TYR A 1 13  ? 6.541   -2.062  2.566   1.00 24.54 ? 49  TYR A CG    1 
ATOM   101  C  CD1   . TYR A 1 13  ? 6.295   -0.753  2.141   1.00 21.85 ? 49  TYR A CD1   1 
ATOM   102  C  CD2   . TYR A 1 13  ? 7.567   -2.771  1.949   1.00 19.97 ? 49  TYR A CD2   1 
ATOM   103  C  CE1   . TYR A 1 13  ? 7.041   -0.170  1.133   1.00 21.13 ? 49  TYR A CE1   1 
ATOM   104  C  CE2   . TYR A 1 13  ? 8.322   -2.195  0.939   1.00 23.92 ? 49  TYR A CE2   1 
ATOM   105  C  CZ    . TYR A 1 13  ? 8.054   -0.902  0.540   1.00 21.55 ? 49  TYR A CZ    1 
ATOM   106  O  OH    . TYR A 1 13  ? 8.813   -0.350  -0.455  1.00 25.45 ? 49  TYR A OH    1 
ATOM   107  N  N     . GLU A 1 14  ? 4.747   -3.186  6.848   1.00 23.79 ? 50  GLU A N     1 
ATOM   108  C  CA    . GLU A 1 14  ? 3.690   -3.323  7.867   1.00 27.57 ? 50  GLU A CA    1 
ATOM   109  C  C     . GLU A 1 14  ? 3.720   -2.175  8.878   1.00 30.35 ? 50  GLU A C     1 
ATOM   110  O  O     . GLU A 1 14  ? 2.668   -1.622  9.249   1.00 27.82 ? 50  GLU A O     1 
ATOM   111  C  CB    . GLU A 1 14  ? 3.778   -4.683  8.592   1.00 28.12 ? 50  GLU A CB    1 
ATOM   112  C  CG    . GLU A 1 14  ? 3.506   -5.889  7.684   1.00 35.24 ? 50  GLU A CG    1 
ATOM   113  C  CD    . GLU A 1 14  ? 3.646   -7.239  8.393   1.00 42.33 ? 50  GLU A CD    1 
ATOM   114  O  OE1   . GLU A 1 14  ? 4.044   -7.262  9.581   1.00 46.01 ? 50  GLU A OE1   1 
ATOM   115  O  OE2   . GLU A 1 14  ? 3.355   -8.278  7.752   1.00 40.28 ? 50  GLU A OE2   1 
ATOM   116  N  N     . VAL A 1 15  ? 4.920   -1.815  9.327   1.00 25.70 ? 51  VAL A N     1 
ATOM   117  C  CA    . VAL A 1 15  ? 5.062   -0.710  10.276  1.00 25.50 ? 51  VAL A CA    1 
ATOM   118  C  C     . VAL A 1 15  ? 4.737   0.627   9.608   1.00 26.34 ? 51  VAL A C     1 
ATOM   119  O  O     . VAL A 1 15  ? 4.044   1.479   10.184  1.00 22.00 ? 51  VAL A O     1 
ATOM   120  C  CB    . VAL A 1 15  ? 6.479   -0.654  10.893  1.00 26.97 ? 51  VAL A CB    1 
ATOM   121  C  CG1   . VAL A 1 15  ? 6.613   0.579   11.804  1.00 25.55 ? 51  VAL A CG1   1 
ATOM   122  C  CG2   . VAL A 1 15  ? 6.772   -1.925  11.666  1.00 23.58 ? 51  VAL A CG2   1 
ATOM   123  N  N     . TYR A 1 16  ? 5.253   0.813   8.394   1.00 23.96 ? 52  TYR A N     1 
ATOM   124  C  CA    . TYR A 1 16  ? 4.956   2.001   7.605   1.00 19.05 ? 52  TYR A CA    1 
ATOM   125  C  C     . TYR A 1 16  ? 3.458   2.262   7.501   1.00 25.87 ? 52  TYR A C     1 
ATOM   126  O  O     . TYR A 1 16  ? 3.001   3.387   7.692   1.00 22.12 ? 52  TYR A O     1 
ATOM   127  C  CB    . TYR A 1 16  ? 5.557   1.859   6.205   1.00 20.12 ? 52  TYR A CB    1 
ATOM   128  C  CG    . TYR A 1 16  ? 5.010   2.835   5.200   1.00 20.15 ? 52  TYR A CG    1 
ATOM   129  C  CD1   . TYR A 1 16  ? 5.362   4.178   5.246   1.00 20.82 ? 52  TYR A CD1   1 
ATOM   130  C  CD2   . TYR A 1 16  ? 4.153   2.417   4.190   1.00 21.23 ? 52  TYR A CD2   1 
ATOM   131  C  CE1   . TYR A 1 16  ? 4.878   5.080   4.304   1.00 22.48 ? 52  TYR A CE1   1 
ATOM   132  C  CE2   . TYR A 1 16  ? 3.662   3.314   3.243   1.00 21.80 ? 52  TYR A CE2   1 
ATOM   133  C  CZ    . TYR A 1 16  ? 4.027   4.644   3.315   1.00 25.77 ? 52  TYR A CZ    1 
ATOM   134  O  OH    . TYR A 1 16  ? 3.545   5.550   2.388   1.00 26.97 ? 52  TYR A OH    1 
ATOM   135  N  N     . ASN A 1 17  ? 2.689   1.224   7.199   1.00 23.63 ? 53  ASN A N     1 
ATOM   136  C  CA    . ASN A 1 17  ? 1.255   1.410   7.056   1.00 25.89 ? 53  ASN A CA    1 
ATOM   137  C  C     . ASN A 1 17  ? 0.578   1.781   8.378   1.00 28.80 ? 53  ASN A C     1 
ATOM   138  O  O     . ASN A 1 17  ? -0.467  2.416   8.376   1.00 29.39 ? 53  ASN A O     1 
ATOM   139  C  CB    . ASN A 1 17  ? 0.593   0.186   6.396   1.00 27.27 ? 53  ASN A CB    1 
ATOM   140  C  CG    . ASN A 1 17  ? 0.870   0.111   4.894   1.00 31.40 ? 53  ASN A CG    1 
ATOM   141  O  OD1   . ASN A 1 17  ? 0.823   1.122   4.182   1.00 33.72 ? 53  ASN A OD1   1 
ATOM   142  N  ND2   . ASN A 1 17  ? 1.168   -1.082  4.411   1.00 35.55 ? 53  ASN A ND2   1 
ATOM   143  N  N     . GLU A 1 18  ? 1.201   1.417   9.497   1.00 25.96 ? 54  GLU A N     1 
ATOM   144  C  CA    . GLU A 1 18  ? 0.691   1.756   10.827  1.00 31.94 ? 54  GLU A CA    1 
ATOM   145  C  C     . GLU A 1 18  ? 1.055   3.175   11.279  1.00 31.16 ? 54  GLU A C     1 
ATOM   146  O  O     . GLU A 1 18  ? 0.346   3.765   12.088  1.00 26.49 ? 54  GLU A O     1 
ATOM   147  C  CB    . GLU A 1 18  ? 1.179   0.726   11.870  1.00 31.15 ? 54  GLU A CB    1 
ATOM   148  C  CG    . GLU A 1 18  ? 0.599   -0.683  11.662  1.00 38.99 ? 54  GLU A CG    1 
ATOM   149  C  CD    . GLU A 1 18  ? 1.470   -1.802  12.239  1.00 50.52 ? 54  GLU A CD    1 
ATOM   150  O  OE1   . GLU A 1 18  ? 2.497   -1.500  12.892  1.00 51.47 ? 54  GLU A OE1   1 
ATOM   151  O  OE2   . GLU A 1 18  ? 1.117   -2.991  12.037  1.00 51.16 ? 54  GLU A OE2   1 
ATOM   152  N  N     . ILE A 1 19  ? 2.155   3.726   10.765  1.00 23.83 ? 55  ILE A N     1 
ATOM   153  C  CA    . ILE A 1 19  ? 2.652   5.013   11.275  1.00 26.10 ? 55  ILE A CA    1 
ATOM   154  C  C     . ILE A 1 19  ? 2.407   6.204   10.349  1.00 24.32 ? 55  ILE A C     1 
ATOM   155  O  O     . ILE A 1 19  ? 2.485   7.356   10.781  1.00 24.74 ? 55  ILE A O     1 
ATOM   156  C  CB    . ILE A 1 19  ? 4.159   4.956   11.612  1.00 23.26 ? 55  ILE A CB    1 
ATOM   157  C  CG1   . ILE A 1 19  ? 4.970   4.686   10.340  1.00 22.38 ? 55  ILE A CG1   1 
ATOM   158  C  CG2   . ILE A 1 19  ? 4.444   3.915   12.704  1.00 27.92 ? 55  ILE A CG2   1 
ATOM   159  C  CD1   . ILE A 1 19  ? 6.487   4.726   10.548  1.00 21.75 ? 55  ILE A CD1   1 
ATOM   160  N  N     . LYS A 1 20  ? 2.121   5.937   9.078   1.00 24.53 ? 56  LYS A N     1 
ATOM   161  C  CA    . LYS A 1 20  ? 1.923   7.022   8.103   1.00 23.80 ? 56  LYS A CA    1 
ATOM   162  C  C     . LYS A 1 20  ? 0.635   7.784   8.410   1.00 29.07 ? 56  LYS A C     1 
ATOM   163  O  O     . LYS A 1 20  ? -0.314  7.226   8.960   1.00 25.74 ? 56  LYS A O     1 
ATOM   164  C  CB    . LYS A 1 20  ? 1.850   6.471   6.683   1.00 24.56 ? 56  LYS A CB    1 
ATOM   165  C  CG    . LYS A 1 20  ? 0.668   5.533   6.438   1.00 25.78 ? 56  LYS A CG    1 
ATOM   166  C  CD    . LYS A 1 20  ? 0.751   4.937   5.049   1.00 26.44 ? 56  LYS A CD    1 
ATOM   167  C  CE    . LYS A 1 20  ? -0.460  4.051   4.735   1.00 31.23 ? 56  LYS A CE    1 
ATOM   168  N  NZ    . LYS A 1 20  ? -0.310  3.415   3.386   1.00 32.28 ? 56  LYS A NZ    1 
ATOM   169  N  N     . ILE A 1 21  ? 0.589   9.061   8.071   1.00 25.65 ? 57  ILE A N     1 
ATOM   170  C  CA    . ILE A 1 21  ? -0.626  9.831   8.336   1.00 31.63 ? 57  ILE A CA    1 
ATOM   171  C  C     . ILE A 1 21  ? -1.771  9.305   7.466   1.00 31.98 ? 57  ILE A C     1 
ATOM   172  O  O     . ILE A 1 21  ? -1.567  8.955   6.301   1.00 31.17 ? 57  ILE A O     1 
ATOM   173  C  CB    . ILE A 1 21  ? -0.395  11.344  8.118   1.00 29.56 ? 57  ILE A CB    1 
ATOM   174  C  CG1   . ILE A 1 21  ? -1.629  12.149  8.535   1.00 31.31 ? 57  ILE A CG1   1 
ATOM   175  C  CG2   . ILE A 1 21  ? -0.030  11.638  6.689   1.00 30.68 ? 57  ILE A CG2   1 
ATOM   176  C  CD1   . ILE A 1 21  ? -1.429  13.659  8.422   1.00 33.66 ? 57  ILE A CD1   1 
ATOM   177  N  N     . SER A 1 22  ? -2.966  9.215   8.045   1.00 33.35 ? 58  SER A N     1 
ATOM   178  C  CA    . SER A 1 22  ? -4.140  8.747   7.308   1.00 38.17 ? 58  SER A CA    1 
ATOM   179  C  C     . SER A 1 22  ? -4.625  9.815   6.332   1.00 37.97 ? 58  SER A C     1 
ATOM   180  O  O     . SER A 1 22  ? -4.293  10.995  6.481   1.00 32.72 ? 58  SER A O     1 
ATOM   181  C  CB    . SER A 1 22  ? -5.261  8.374   8.274   1.00 35.72 ? 58  SER A CB    1 
ATOM   182  O  OG    . SER A 1 22  ? -5.659  9.492   9.046   1.00 33.64 ? 58  SER A OG    1 
ATOM   183  N  N     . ASP A 1 23  ? -5.393  9.402   5.325   1.00 39.43 ? 59  ASP A N     1 
ATOM   184  C  CA    . ASP A 1 23  ? -5.964  10.348  4.369   1.00 39.25 ? 59  ASP A CA    1 
ATOM   185  C  C     . ASP A 1 23  ? -6.982  11.238  5.063   1.00 42.81 ? 59  ASP A C     1 
ATOM   186  O  O     . ASP A 1 23  ? -7.167  12.398  4.694   1.00 41.64 ? 59  ASP A O     1 
ATOM   187  C  CB    . ASP A 1 23  ? -6.608  9.629   3.180   1.00 44.81 ? 59  ASP A CB    1 
ATOM   188  C  CG    . ASP A 1 23  ? -5.628  9.397   2.032   1.00 61.12 ? 59  ASP A CG    1 
ATOM   189  O  OD1   . ASP A 1 23  ? -5.340  10.361  1.281   1.00 62.68 ? 59  ASP A OD1   1 
ATOM   190  O  OD2   . ASP A 1 23  ? -5.146  8.249   1.878   1.00 60.33 ? 59  ASP A OD2   1 
ATOM   191  N  N     . LYS A 1 24  ? -7.637  10.695  6.079   1.00 36.47 ? 60  LYS A N     1 
ATOM   192  C  CA    . LYS A 1 24  ? -8.567  11.473  6.881   1.00 35.77 ? 60  LYS A CA    1 
ATOM   193  C  C     . LYS A 1 24  ? -7.870  12.603  7.655   1.00 38.36 ? 60  LYS A C     1 
ATOM   194  O  O     . LYS A 1 24  ? -8.327  13.759  7.645   1.00 30.90 ? 60  LYS A O     1 
ATOM   195  C  CB    . LYS A 1 24  ? -9.320  10.540  7.836   1.00 40.95 ? 60  LYS A CB    1 
ATOM   196  C  CG    . LYS A 1 24  ? -10.138 11.251  8.901   1.00 41.00 ? 60  LYS A CG    1 
ATOM   197  C  CD    . LYS A 1 24  ? -10.202 10.407  10.170  1.00 49.24 ? 60  LYS A CD    1 
ATOM   198  C  CE    . LYS A 1 24  ? -10.999 11.092  11.272  1.00 58.85 ? 60  LYS A CE    1 
ATOM   199  N  NZ    . LYS A 1 24  ? -12.465 11.025  11.014  1.00 59.67 ? 60  LYS A NZ    1 
ATOM   200  N  N     . GLU A 1 25  ? -6.767  12.279  8.328   1.00 34.11 ? 61  GLU A N     1 
ATOM   201  C  CA    . GLU A 1 25  ? -6.050  13.292  9.097   1.00 35.14 ? 61  GLU A CA    1 
ATOM   202  C  C     . GLU A 1 25  ? -5.439  14.318  8.138   1.00 31.32 ? 61  GLU A C     1 
ATOM   203  O  O     . GLU A 1 25  ? -5.337  15.509  8.450   1.00 29.14 ? 61  GLU A O     1 
ATOM   204  C  CB    . GLU A 1 25  ? -4.966  12.662  9.984   1.00 37.31 ? 61  GLU A CB    1 
ATOM   205  C  CG    . GLU A 1 25  ? -4.319  13.664  10.946  1.00 38.06 ? 61  GLU A CG    1 
ATOM   206  C  CD    . GLU A 1 25  ? -3.035  13.156  11.604  1.00 46.46 ? 61  GLU A CD    1 
ATOM   207  O  OE1   . GLU A 1 25  ? -2.181  14.008  11.929  1.00 46.18 ? 61  GLU A OE1   1 
ATOM   208  O  OE2   . GLU A 1 25  ? -2.875  11.927  11.807  1.00 42.76 ? 61  GLU A OE2   1 
ATOM   209  N  N     . PHE A 1 26  ? -5.048  13.847  6.964   1.00 32.32 ? 62  PHE A N     1 
ATOM   210  C  CA    . PHE A 1 26  ? -4.459  14.714  5.962   1.00 34.27 ? 62  PHE A CA    1 
ATOM   211  C  C     . PHE A 1 26  ? -5.498  15.732  5.491   1.00 32.82 ? 62  PHE A C     1 
ATOM   212  O  O     . PHE A 1 26  ? -5.205  16.925  5.391   1.00 28.91 ? 62  PHE A O     1 
ATOM   213  C  CB    . PHE A 1 26  ? -3.924  13.889  4.793   1.00 34.68 ? 62  PHE A CB    1 
ATOM   214  C  CG    . PHE A 1 26  ? -3.155  14.690  3.787   1.00 39.30 ? 62  PHE A CG    1 
ATOM   215  C  CD1   . PHE A 1 26  ? -1.829  15.039  4.024   1.00 40.29 ? 62  PHE A CD1   1 
ATOM   216  C  CD2   . PHE A 1 26  ? -3.752  15.089  2.597   1.00 40.80 ? 62  PHE A CD2   1 
ATOM   217  C  CE1   . PHE A 1 26  ? -1.114  15.783  3.093   1.00 48.95 ? 62  PHE A CE1   1 
ATOM   218  C  CE2   . PHE A 1 26  ? -3.045  15.833  1.660   1.00 45.23 ? 62  PHE A CE2   1 
ATOM   219  C  CZ    . PHE A 1 26  ? -1.727  16.182  1.909   1.00 45.39 ? 62  PHE A CZ    1 
ATOM   220  N  N     . LYS A 1 27  ? -6.716  15.260  5.225   1.00 31.42 ? 63  LYS A N     1 
ATOM   221  C  CA    . LYS A 1 27  ? -7.810  16.133  4.789   1.00 34.85 ? 63  LYS A CA    1 
ATOM   222  C  C     . LYS A 1 27  ? -8.178  17.156  5.852   1.00 29.43 ? 63  LYS A C     1 
ATOM   223  O  O     . LYS A 1 27  ? -8.537  18.295  5.538   1.00 28.49 ? 63  LYS A O     1 
ATOM   224  C  CB    . LYS A 1 27  ? -9.048  15.308  4.419   1.00 36.79 ? 63  LYS A CB    1 
ATOM   225  C  CG    . LYS A 1 27  ? -8.866  14.438  3.182   1.00 44.95 ? 63  LYS A CG    1 
ATOM   226  C  CD    . LYS A 1 27  ? -8.922  15.244  1.893   1.00 45.20 ? 63  LYS A CD    1 
ATOM   227  C  CE    . LYS A 1 27  ? -10.352 15.349  1.383   1.00 54.58 ? 63  LYS A CE    1 
ATOM   228  N  NZ    . LYS A 1 27  ? -10.699 16.727  0.917   1.00 59.35 ? 63  LYS A NZ    1 
ATOM   229  N  N     . GLU A 1 28  ? -8.090  16.751  7.111   1.00 31.36 ? 64  GLU A N     1 
ATOM   230  C  CA    . GLU A 1 28  ? -8.387  17.639  8.233   1.00 30.31 ? 64  GLU A CA    1 
ATOM   231  C  C     . GLU A 1 28  ? -7.380  18.775  8.319   1.00 31.86 ? 64  GLU A C     1 
ATOM   232  O  O     . GLU A 1 28  ? -7.740  19.937  8.552   1.00 28.00 ? 64  GLU A O     1 
ATOM   233  C  CB    . GLU A 1 28  ? -8.372  16.858  9.546   1.00 33.09 ? 64  GLU A CB    1 
ATOM   234  C  CG    . GLU A 1 28  ? -9.750  16.519  10.092  1.00 44.21 ? 64  GLU A CG    1 
ATOM   235  C  CD    . GLU A 1 28  ? -9.755  15.257  10.935  1.00 50.70 ? 64  GLU A CD    1 
ATOM   236  O  OE1   . GLU A 1 28  ? -10.790 14.550  10.940  1.00 56.87 ? 64  GLU A OE1   1 
ATOM   237  O  OE2   . GLU A 1 28  ? -8.726  14.966  11.590  1.00 52.12 ? 64  GLU A OE2   1 
ATOM   238  N  N     . LYS A 1 29  ? -6.104  18.450  8.159   1.00 28.68 ? 65  LYS A N     1 
ATOM   239  C  CA    . LYS A 1 29  ? -5.096  19.494  8.248   1.00 27.07 ? 65  LYS A CA    1 
ATOM   240  C  C     . LYS A 1 29  ? -5.169  20.416  7.044   1.00 26.07 ? 65  LYS A C     1 
ATOM   241  O  O     . LYS A 1 29  ? -4.871  21.606  7.147   1.00 28.19 ? 65  LYS A O     1 
ATOM   242  C  CB    . LYS A 1 29  ? -3.708  18.883  8.459   1.00 29.05 ? 65  LYS A CB    1 
ATOM   243  C  CG    . LYS A 1 29  ? -3.617  18.274  9.846   1.00 34.63 ? 65  LYS A CG    1 
ATOM   244  C  CD    . LYS A 1 29  ? -2.307  17.585  10.142  1.00 39.66 ? 65  LYS A CD    1 
ATOM   245  C  CE    . LYS A 1 29  ? -2.359  17.021  11.552  1.00 43.15 ? 65  LYS A CE    1 
ATOM   246  N  NZ    . LYS A 1 29  ? -3.043  17.960  12.491  1.00 50.30 ? 65  LYS A NZ    1 
ATOM   247  N  N     . ARG A 1 30  ? -5.573  19.868  5.905   1.00 27.13 ? 66  ARG A N     1 
ATOM   248  C  CA    . ARG A 1 30  ? -5.877  20.687  4.733   1.00 29.25 ? 66  ARG A CA    1 
ATOM   249  C  C     . ARG A 1 30  ? -6.972  21.715  5.028   1.00 29.21 ? 66  ARG A C     1 
ATOM   250  O  O     . ARG A 1 30  ? -6.874  22.873  4.614   1.00 25.97 ? 66  ARG A O     1 
ATOM   251  C  CB    . ARG A 1 30  ? -6.350  19.797  3.584   1.00 32.92 ? 66  ARG A CB    1 
ATOM   252  C  CG    . ARG A 1 30  ? -5.662  20.082  2.281   1.00 45.50 ? 66  ARG A CG    1 
ATOM   253  C  CD    . ARG A 1 30  ? -4.218  19.665  2.387   1.00 49.38 ? 66  ARG A CD    1 
ATOM   254  N  NE    . ARG A 1 30  ? -3.347  20.390  1.467   1.00 56.48 ? 66  ARG A NE    1 
ATOM   255  C  CZ    . ARG A 1 30  ? -2.021  20.304  1.492   1.00 60.49 ? 66  ARG A CZ    1 
ATOM   256  N  NH1   . ARG A 1 30  ? -1.432  19.528  2.394   1.00 58.11 ? 66  ARG A NH1   1 
ATOM   257  N  NH2   . ARG A 1 30  ? -1.286  20.994  0.627   1.00 63.43 ? 66  ARG A NH2   1 
ATOM   258  N  N     . ALA A 1 31  ? -8.031  21.284  5.713   1.00 28.50 ? 67  ALA A N     1 
ATOM   259  C  CA    . ALA A 1 31  ? -9.133  22.192  6.029   1.00 30.27 ? 67  ALA A CA    1 
ATOM   260  C  C     . ALA A 1 31  ? -8.696  23.237  7.050   1.00 29.65 ? 67  ALA A C     1 
ATOM   261  O  O     . ALA A 1 31  ? -9.127  24.393  6.997   1.00 25.20 ? 67  ALA A O     1 
ATOM   262  C  CB    . ALA A 1 31  ? -10.346 21.418  6.523   1.00 33.96 ? 67  ALA A CB    1 
ATOM   263  N  N     . ALA A 1 32  ? -7.853  22.831  7.995   1.00 24.24 ? 68  ALA A N     1 
ATOM   264  C  CA    . ALA A 1 32  ? -7.303  23.783  8.961   1.00 27.19 ? 68  ALA A CA    1 
ATOM   265  C  C     . ALA A 1 32  ? -6.510  24.875  8.251   1.00 27.53 ? 68  ALA A C     1 
ATOM   266  O  O     . ALA A 1 32  ? -6.618  26.060  8.581   1.00 25.23 ? 68  ALA A O     1 
ATOM   267  C  CB    . ALA A 1 32  ? -6.437  23.075  9.980   1.00 31.50 ? 68  ALA A CB    1 
ATOM   268  N  N     . LEU A 1 33  ? -5.705  24.470  7.280   1.00 24.93 ? 69  LEU A N     1 
ATOM   269  C  CA    . LEU A 1 33  ? -4.918  25.422  6.503   1.00 22.92 ? 69  LEU A CA    1 
ATOM   270  C  C     . LEU A 1 33  ? -5.850  26.394  5.764   1.00 21.98 ? 69  LEU A C     1 
ATOM   271  O  O     . LEU A 1 33  ? -5.607  27.607  5.752   1.00 23.85 ? 69  LEU A O     1 
ATOM   272  C  CB    . LEU A 1 33  ? -4.025  24.666  5.520   1.00 25.02 ? 69  LEU A CB    1 
ATOM   273  C  CG    . LEU A 1 33  ? -3.303  25.521  4.486   1.00 26.82 ? 69  LEU A CG    1 
ATOM   274  C  CD1   . LEU A 1 33  ? -2.499  26.588  5.178   1.00 26.02 ? 69  LEU A CD1   1 
ATOM   275  C  CD2   . LEU A 1 33  ? -2.410  24.662  3.602   1.00 32.41 ? 69  LEU A CD2   1 
ATOM   276  N  N     . ASP A 1 34  ? -6.924  25.865  5.175   1.00 26.66 ? 70  ASP A N     1 
ATOM   277  C  CA    . ASP A 1 34  ? -7.924  26.704  4.499   1.00 28.07 ? 70  ASP A CA    1 
ATOM   278  C  C     . ASP A 1 34  ? -8.524  27.742  5.442   1.00 27.31 ? 70  ASP A C     1 
ATOM   279  O  O     . ASP A 1 34  ? -8.700  28.905  5.071   1.00 24.79 ? 70  ASP A O     1 
ATOM   280  C  CB    . ASP A 1 34  ? -9.061  25.855  3.916   1.00 30.32 ? 70  ASP A CB    1 
ATOM   281  C  CG    . ASP A 1 34  ? -8.601  24.903  2.844   1.00 35.99 ? 70  ASP A CG    1 
ATOM   282  O  OD1   . ASP A 1 34  ? -9.183  23.791  2.756   1.00 34.94 ? 70  ASP A OD1   1 
ATOM   283  O  OD2   . ASP A 1 34  ? -7.675  25.257  2.082   1.00 35.91 ? 70  ASP A OD2   1 
ATOM   284  N  N     . THR A 1 35  ? -8.833  27.314  6.662   1.00 24.09 ? 71  THR A N     1 
ATOM   285  C  CA    . THR A 1 35  ? -9.448  28.193  7.652   1.00 26.29 ? 71  THR A CA    1 
ATOM   286  C  C     . THR A 1 35  ? -8.479  29.279  8.081   1.00 27.16 ? 71  THR A C     1 
ATOM   287  O  O     . THR A 1 35  ? -8.854  30.451  8.212   1.00 22.96 ? 71  THR A O     1 
ATOM   288  C  CB    . THR A 1 35  ? -9.915  27.394  8.895   1.00 27.67 ? 71  THR A CB    1 
ATOM   289  O  OG1   . THR A 1 35  ? -10.905 26.441  8.498   1.00 32.70 ? 71  THR A OG1   1 
ATOM   290  C  CG2   . THR A 1 35  ? -10.513 28.310  9.936   1.00 28.35 ? 71  THR A CG2   1 
ATOM   291  N  N     . LEU A 1 36  ? -7.225  28.893  8.296   1.00 21.37 ? 72  LEU A N     1 
ATOM   292  C  CA    . LEU A 1 36  ? -6.220  29.859  8.735   1.00 23.15 ? 72  LEU A CA    1 
ATOM   293  C  C     . LEU A 1 36  ? -5.881  30.876  7.642   1.00 23.17 ? 72  LEU A C     1 
ATOM   294  O  O     . LEU A 1 36  ? -5.583  32.036  7.926   1.00 22.36 ? 72  LEU A O     1 
ATOM   295  C  CB    . LEU A 1 36  ? -4.968  29.140  9.242   1.00 26.36 ? 72  LEU A CB    1 
ATOM   296  C  CG    . LEU A 1 36  ? -5.185  28.354  10.541  1.00 25.82 ? 72  LEU A CG    1 
ATOM   297  C  CD1   . LEU A 1 36  ? -4.031  27.413  10.816  1.00 24.12 ? 72  LEU A CD1   1 
ATOM   298  C  CD2   . LEU A 1 36  ? -5.364  29.294  11.710  1.00 27.32 ? 72  LEU A CD2   1 
ATOM   299  N  N     . ARG A 1 37  ? -5.932  30.438  6.392   1.00 24.57 ? 73  ARG A N     1 
ATOM   300  C  CA    . ARG A 1 37  ? -5.633  31.305  5.264   1.00 24.21 ? 73  ARG A CA    1 
ATOM   301  C  C     . ARG A 1 37  ? -6.696  32.389  5.181   1.00 26.74 ? 73  ARG A C     1 
ATOM   302  O  O     . ARG A 1 37  ? -6.391  33.572  4.990   1.00 24.69 ? 73  ARG A O     1 
ATOM   303  C  CB    . ARG A 1 37  ? -5.585  30.466  3.986   1.00 24.48 ? 73  ARG A CB    1 
ATOM   304  C  CG    . ARG A 1 37  ? -5.229  31.229  2.722   1.00 34.10 ? 73  ARG A CG    1 
ATOM   305  C  CD    . ARG A 1 37  ? -4.946  30.256  1.577   1.00 33.98 ? 73  ARG A CD    1 
ATOM   306  N  NE    . ARG A 1 37  ? -3.631  29.639  1.708   1.00 32.96 ? 73  ARG A NE    1 
ATOM   307  C  CZ    . ARG A 1 37  ? -3.382  28.355  1.486   1.00 37.18 ? 73  ARG A CZ    1 
ATOM   308  N  NH1   . ARG A 1 37  ? -2.148  27.879  1.618   1.00 35.91 ? 73  ARG A NH1   1 
ATOM   309  N  NH2   . ARG A 1 37  ? -4.364  27.548  1.122   1.00 35.91 ? 73  ARG A NH2   1 
ATOM   310  N  N     . LEU A 1 38  ? -7.949  31.983  5.356   1.00 25.21 ? 74  LEU A N     1 
ATOM   311  C  CA    . LEU A 1 38  ? -9.053  32.936  5.325   1.00 30.25 ? 74  LEU A CA    1 
ATOM   312  C  C     . LEU A 1 38  ? -8.934  33.947  6.459   1.00 28.65 ? 74  LEU A C     1 
ATOM   313  O  O     . LEU A 1 38  ? -9.209  35.140  6.282   1.00 27.47 ? 74  LEU A O     1 
ATOM   314  C  CB    . LEU A 1 38  ? -10.383 32.193  5.397   1.00 30.49 ? 74  LEU A CB    1 
ATOM   315  C  CG    . LEU A 1 38  ? -10.924 31.722  4.057   1.00 37.41 ? 74  LEU A CG    1 
ATOM   316  C  CD1   . LEU A 1 38  ? -11.754 30.463  4.253   1.00 40.49 ? 74  LEU A CD1   1 
ATOM   317  C  CD2   . LEU A 1 38  ? -11.774 32.840  3.454   1.00 39.38 ? 74  LEU A CD2   1 
ATOM   318  N  N     . CYS A 1 39  ? -8.513  33.480  7.629   1.00 25.33 ? 75  CYS A N     1 
ATOM   319  C  CA    A CYS A 1 39  ? -8.291  34.383  8.741   0.45 25.93 ? 75  CYS A CA    1 
ATOM   320  C  CA    B CYS A 1 39  ? -8.290  34.382  8.753   0.55 25.93 ? 75  CYS A CA    1 
ATOM   321  C  C     . CYS A 1 39  ? -7.193  35.398  8.426   1.00 26.25 ? 75  CYS A C     1 
ATOM   322  O  O     . CYS A 1 39  ? -7.317  36.565  8.743   1.00 25.73 ? 75  CYS A O     1 
ATOM   323  C  CB    A CYS A 1 39  ? -7.923  33.598  9.990   0.45 27.56 ? 75  CYS A CB    1 
ATOM   324  C  CB    B CYS A 1 39  ? -7.940  33.606  10.030  0.55 27.55 ? 75  CYS A CB    1 
ATOM   325  S  SG    A CYS A 1 39  ? -7.839  34.622  11.437  0.45 35.85 ? 75  CYS A SG    1 
ATOM   326  S  SG    B CYS A 1 39  ? -9.342  32.740  10.816  0.55 34.29 ? 75  CYS A SG    1 
ATOM   327  N  N     . LEU A 1 40  ? -6.112  34.953  7.791   1.00 21.40 ? 76  LEU A N     1 
ATOM   328  C  CA    . LEU A 1 40  ? -5.029  35.877  7.454   1.00 21.10 ? 76  LEU A CA    1 
ATOM   329  C  C     . LEU A 1 40  ? -5.469  36.932  6.444   1.00 20.54 ? 76  LEU A C     1 
ATOM   330  O  O     . LEU A 1 40  ? -5.058  38.093  6.533   1.00 24.52 ? 76  LEU A O     1 
ATOM   331  C  CB    . LEU A 1 40  ? -3.804  35.123  6.917   1.00 20.40 ? 76  LEU A CB    1 
ATOM   332  C  CG    . LEU A 1 40  ? -2.640  36.002  6.437   1.00 21.73 ? 76  LEU A CG    1 
ATOM   333  C  CD1   . LEU A 1 40  ? -2.040  36.722  7.600   1.00 26.16 ? 76  LEU A CD1   1 
ATOM   334  C  CD2   . LEU A 1 40  ? -1.568  35.172  5.727   1.00 22.86 ? 76  LEU A CD2   1 
ATOM   335  N  N     . LYS A 1 41  ? -6.295  36.534  5.479   1.00 21.47 ? 77  LYS A N     1 
ATOM   336  C  CA    . LYS A 1 41  ? -6.794  37.483  4.467   1.00 22.32 ? 77  LYS A CA    1 
ATOM   337  C  C     . LYS A 1 41  ? -7.710  38.566  5.043   1.00 25.49 ? 77  LYS A C     1 
ATOM   338  O  O     . LYS A 1 41  ? -7.923  39.601  4.401   1.00 27.96 ? 77  LYS A O     1 
ATOM   339  C  CB    . LYS A 1 41  ? -7.505  36.745  3.326   1.00 22.67 ? 77  LYS A CB    1 
ATOM   340  C  CG    . LYS A 1 41  ? -6.599  35.859  2.489   1.00 21.11 ? 77  LYS A CG    1 
ATOM   341  C  CD    . LYS A 1 41  ? -5.499  36.672  1.792   1.00 24.12 ? 77  LYS A CD    1 
ATOM   342  C  CE    . LYS A 1 41  ? -4.737  35.792  0.799   1.00 28.16 ? 77  LYS A CE    1 
ATOM   343  N  NZ    . LYS A 1 41  ? -3.600  36.552  0.202   1.00 28.38 ? 77  LYS A NZ    1 
ATOM   344  N  N     . ARG A 1 42  ? -8.252  38.334  6.241   1.00 23.28 ? 78  ARG A N     1 
ATOM   345  C  CA    . ARG A 1 42  ? -8.981  39.388  6.964   1.00 27.40 ? 78  ARG A CA    1 
ATOM   346  C  C     . ARG A 1 42  ? -8.055  40.448  7.527   1.00 31.13 ? 78  ARG A C     1 
ATOM   347  O  O     . ARG A 1 42  ? -8.493  41.545  7.884   1.00 32.52 ? 78  ARG A O     1 
ATOM   348  C  CB    . ARG A 1 42  ? -9.787  38.805  8.119   1.00 32.70 ? 78  ARG A CB    1 
ATOM   349  C  CG    . ARG A 1 42  ? -11.059 38.138  7.704   1.00 35.57 ? 78  ARG A CG    1 
ATOM   350  C  CD    . ARG A 1 42  ? -11.743 37.490  8.907   1.00 41.22 ? 78  ARG A CD    1 
ATOM   351  N  NE    . ARG A 1 42  ? -12.423 38.450  9.772   1.00 47.52 ? 78  ARG A NE    1 
ATOM   352  C  CZ    . ARG A 1 42  ? -13.544 39.086  9.435   1.00 46.12 ? 78  ARG A CZ    1 
ATOM   353  N  NH1   . ARG A 1 42  ? -14.094 38.879  8.240   1.00 41.03 ? 78  ARG A NH1   1 
ATOM   354  N  NH2   . ARG A 1 42  ? -14.107 39.936  10.284  1.00 41.86 ? 78  ARG A NH2   1 
ATOM   355  N  N     . ILE A 1 43  ? -6.772  40.118  7.622   1.00 29.56 ? 79  ILE A N     1 
ATOM   356  C  CA    . ILE A 1 43  ? -5.797  41.043  8.180   1.00 29.90 ? 79  ILE A CA    1 
ATOM   357  C  C     . ILE A 1 43  ? -5.149  41.841  7.069   1.00 27.98 ? 79  ILE A C     1 
ATOM   358  O  O     . ILE A 1 43  ? -4.908  43.035  7.205   1.00 25.73 ? 79  ILE A O     1 
ATOM   359  C  CB    . ILE A 1 43  ? -4.679  40.298  8.933   1.00 31.34 ? 79  ILE A CB    1 
ATOM   360  C  CG1   . ILE A 1 43  ? -5.265  39.496  10.078  1.00 32.82 ? 79  ILE A CG1   1 
ATOM   361  C  CG2   . ILE A 1 43  ? -3.657  41.281  9.469   1.00 34.23 ? 79  ILE A CG2   1 
ATOM   362  C  CD1   . ILE A 1 43  ? -6.186  40.314  10.918  1.00 40.74 ? 79  ILE A CD1   1 
ATOM   363  N  N     . SER A 1 44  ? -4.836  41.163  5.972   1.00 25.28 ? 80  SER A N     1 
ATOM   364  C  CA    . SER A 1 44  ? -4.143  41.807  4.868   1.00 27.13 ? 80  SER A CA    1 
ATOM   365  C  C     . SER A 1 44  ? -4.327  41.028  3.593   1.00 25.33 ? 80  SER A C     1 
ATOM   366  O  O     . SER A 1 44  ? -4.210  39.801  3.589   1.00 28.49 ? 80  SER A O     1 
ATOM   367  C  CB    . SER A 1 44  ? -2.646  41.926  5.161   1.00 29.56 ? 80  SER A CB    1 
ATOM   368  O  OG    . SER A 1 44  ? -1.929  42.277  3.981   1.00 31.34 ? 80  SER A OG    1 
ATOM   369  N  N     . PRO A 1 45  ? -4.564  41.737  2.484   1.00 25.22 ? 81  PRO A N     1 
ATOM   370  C  CA    . PRO A 1 45  ? -4.684  41.007  1.220   1.00 24.91 ? 81  PRO A CA    1 
ATOM   371  C  C     . PRO A 1 45  ? -3.312  40.658  0.666   1.00 24.74 ? 81  PRO A C     1 
ATOM   372  O  O     . PRO A 1 45  ? -3.217  39.907  -0.295  1.00 24.95 ? 81  PRO A O     1 
ATOM   373  C  CB    . PRO A 1 45  ? -5.378  42.028  0.307   1.00 25.13 ? 81  PRO A CB    1 
ATOM   374  C  CG    . PRO A 1 45  ? -4.842  43.369  0.797   1.00 24.87 ? 81  PRO A CG    1 
ATOM   375  C  CD    . PRO A 1 45  ? -4.712  43.199  2.312   1.00 25.93 ? 81  PRO A CD    1 
ATOM   376  N  N     . ASP A 1 46  ? -2.263  41.214  1.268   1.00 25.69 ? 82  ASP A N     1 
ATOM   377  C  CA    . ASP A 1 46  ? -0.915  41.136  0.711   1.00 27.31 ? 82  ASP A CA    1 
ATOM   378  C  C     . ASP A 1 46  ? -0.030  40.109  1.432   1.00 32.05 ? 82  ASP A C     1 
ATOM   379  O  O     . ASP A 1 46  ? 1.177   40.051  1.233   1.00 38.44 ? 82  ASP A O     1 
ATOM   380  C  CB    . ASP A 1 46  ? -0.280  42.530  0.730   1.00 28.85 ? 82  ASP A CB    1 
ATOM   381  C  CG    . ASP A 1 46  ? -0.997  43.494  -0.197  1.00 30.05 ? 82  ASP A CG    1 
ATOM   382  O  OD1   . ASP A 1 46  ? -1.217  43.120  -1.368  1.00 29.55 ? 82  ASP A OD1   1 
ATOM   383  O  OD2   . ASP A 1 46  ? -1.366  44.601  0.244   1.00 35.02 ? 82  ASP A OD2   1 
ATOM   384  N  N     . ALA A 1 47  ? -0.648  39.287  2.263   1.00 20.02 ? 83  ALA A N     1 
ATOM   385  C  CA    . ALA A 1 47  ? 0.086   38.249  2.973   1.00 27.29 ? 83  ALA A CA    1 
ATOM   386  C  C     . ALA A 1 47  ? -0.452  36.904  2.515   1.00 26.23 ? 83  ALA A C     1 
ATOM   387  O  O     . ALA A 1 47  ? -1.657  36.767  2.303   1.00 29.39 ? 83  ALA A O     1 
ATOM   388  C  CB    . ALA A 1 47  ? -0.120  38.409  4.467   1.00 31.13 ? 83  ALA A CB    1 
ATOM   389  N  N     . GLU A 1 48  ? 0.408   35.901  2.372   1.00 25.27 ? 84  GLU A N     1 
ATOM   390  C  CA    . GLU A 1 48  ? -0.103  34.579  2.027   1.00 29.04 ? 84  GLU A CA    1 
ATOM   391  C  C     . GLU A 1 48  ? 0.351   33.564  3.071   1.00 24.87 ? 84  GLU A C     1 
ATOM   392  O  O     . GLU A 1 48  ? 1.394   33.725  3.707   1.00 25.35 ? 84  GLU A O     1 
ATOM   393  C  CB    . GLU A 1 48  ? 0.334   34.168  0.621   1.00 36.93 ? 84  GLU A CB    1 
ATOM   394  C  CG    . GLU A 1 48  ? 1.821   33.940  0.476   1.00 34.49 ? 84  GLU A CG    1 
ATOM   395  C  CD    . GLU A 1 48  ? 2.286   33.945  -0.979  1.00 55.26 ? 84  GLU A CD    1 
ATOM   396  O  OE1   . GLU A 1 48  ? 3.001   34.903  -1.368  1.00 54.70 ? 84  GLU A OE1   1 
ATOM   397  O  OE2   . GLU A 1 48  ? 1.950   32.988  -1.721  1.00 58.06 ? 84  GLU A OE2   1 
ATOM   398  N  N     . LEU A 1 49  ? -0.447  32.533  3.267   1.00 25.85 ? 85  LEU A N     1 
ATOM   399  C  CA    . LEU A 1 49  ? -0.098  31.511  4.240   1.00 27.85 ? 85  LEU A CA    1 
ATOM   400  C  C     . LEU A 1 49  ? 0.345   30.269  3.486   1.00 28.74 ? 85  LEU A C     1 
ATOM   401  O  O     . LEU A 1 49  ? -0.407  29.730  2.673   1.00 28.78 ? 85  LEU A O     1 
ATOM   402  C  CB    . LEU A 1 49  ? -1.299  31.211  5.122   1.00 24.45 ? 85  LEU A CB    1 
ATOM   403  C  CG    . LEU A 1 49  ? -1.070  30.260  6.291   1.00 24.86 ? 85  LEU A CG    1 
ATOM   404  C  CD1   . LEU A 1 49  ? -0.004  30.824  7.210   1.00 24.07 ? 85  LEU A CD1   1 
ATOM   405  C  CD2   . LEU A 1 49  ? -2.373  30.075  7.048   1.00 22.78 ? 85  LEU A CD2   1 
ATOM   406  N  N     . VAL A 1 50  ? 1.575   29.826  3.736   1.00 24.99 ? 86  VAL A N     1 
ATOM   407  C  CA    . VAL A 1 50  ? 2.160   28.719  2.985   1.00 25.33 ? 86  VAL A CA    1 
ATOM   408  C  C     . VAL A 1 50  ? 2.542   27.584  3.932   1.00 27.97 ? 86  VAL A C     1 
ATOM   409  O  O     . VAL A 1 50  ? 3.148   27.819  4.974   1.00 27.38 ? 86  VAL A O     1 
ATOM   410  C  CB    . VAL A 1 50  ? 3.409   29.187  2.204   1.00 29.43 ? 86  VAL A CB    1 
ATOM   411  C  CG1   . VAL A 1 50  ? 4.022   28.040  1.399   1.00 28.98 ? 86  VAL A CG1   1 
ATOM   412  C  CG2   . VAL A 1 50  ? 3.058   30.348  1.282   1.00 33.73 ? 86  VAL A CG2   1 
ATOM   413  N  N     . ALA A 1 51  ? 2.154   26.359  3.589   1.00 26.45 ? 87  ALA A N     1 
ATOM   414  C  CA    . ALA A 1 51  ? 2.532   25.184  4.371   1.00 22.33 ? 87  ALA A CA    1 
ATOM   415  C  C     . ALA A 1 51  ? 3.925   24.730  3.946   1.00 25.12 ? 87  ALA A C     1 
ATOM   416  O  O     . ALA A 1 51  ? 4.287   24.841  2.765   1.00 22.66 ? 87  ALA A O     1 
ATOM   417  C  CB    . ALA A 1 51  ? 1.526   24.059  4.164   1.00 24.21 ? 87  ALA A CB    1 
ATOM   418  N  N     . PHE A 1 52  ? 4.720   24.246  4.896   1.00 23.99 ? 88  PHE A N     1 
ATOM   419  C  CA    . PHE A 1 52  ? 6.010   23.650  4.549   1.00 22.36 ? 88  PHE A CA    1 
ATOM   420  C  C     . PHE A 1 52  ? 6.232   22.441  5.440   1.00 23.92 ? 88  PHE A C     1 
ATOM   421  O  O     . PHE A 1 52  ? 5.339   22.057  6.192   1.00 23.54 ? 88  PHE A O     1 
ATOM   422  C  CB    . PHE A 1 52  ? 7.172   24.672  4.594   1.00 21.91 ? 88  PHE A CB    1 
ATOM   423  C  CG    . PHE A 1 52  ? 7.513   25.185  5.975   1.00 24.34 ? 88  PHE A CG    1 
ATOM   424  C  CD1   . PHE A 1 52  ? 8.503   24.574  6.732   1.00 27.99 ? 88  PHE A CD1   1 
ATOM   425  C  CD2   . PHE A 1 52  ? 6.872   26.299  6.498   1.00 25.80 ? 88  PHE A CD2   1 
ATOM   426  C  CE1   . PHE A 1 52  ? 8.821   25.035  8.010   1.00 25.45 ? 88  PHE A CE1   1 
ATOM   427  C  CE2   . PHE A 1 52  ? 7.188   26.778  7.767   1.00 27.36 ? 88  PHE A CE2   1 
ATOM   428  C  CZ    . PHE A 1 52  ? 8.158   26.144  8.530   1.00 27.03 ? 88  PHE A CZ    1 
ATOM   429  N  N     . GLY A 1 53  ? 7.392   21.803  5.337   1.00 21.58 ? 89  GLY A N     1 
ATOM   430  C  CA    . GLY A 1 53  ? 7.670   20.692  6.228   1.00 26.29 ? 89  GLY A CA    1 
ATOM   431  C  C     . GLY A 1 53  ? 6.943   19.430  5.811   1.00 27.50 ? 89  GLY A C     1 
ATOM   432  O  O     . GLY A 1 53  ? 6.441   19.327  4.689   1.00 25.39 ? 89  GLY A O     1 
ATOM   433  N  N     . SER A 1 54  ? 6.859   18.476  6.727   1.00 29.54 ? 90  SER A N     1 
ATOM   434  C  CA    . SER A 1 54  ? 6.568   17.084  6.354   1.00 30.46 ? 90  SER A CA    1 
ATOM   435  C  C     . SER A 1 54  ? 5.185   16.851  5.759   1.00 29.89 ? 90  SER A C     1 
ATOM   436  O  O     . SER A 1 54  ? 5.015   15.966  4.917   1.00 30.07 ? 90  SER A O     1 
ATOM   437  C  CB    . SER A 1 54  ? 6.786   16.165  7.547   1.00 32.79 ? 90  SER A CB    1 
ATOM   438  O  OG    . SER A 1 54  ? 5.938   16.546  8.606   1.00 37.33 ? 90  SER A OG    1 
ATOM   439  N  N     . LEU A 1 55  ? 4.196   17.626  6.198   1.00 27.22 ? 91  LEU A N     1 
ATOM   440  C  CA    . LEU A 1 55  ? 2.856   17.507  5.630   1.00 30.78 ? 91  LEU A CA    1 
ATOM   441  C  C     . LEU A 1 55  ? 2.825   17.905  4.163   1.00 35.40 ? 91  LEU A C     1 
ATOM   442  O  O     . LEU A 1 55  ? 2.059   17.352  3.375   1.00 36.02 ? 91  LEU A O     1 
ATOM   443  C  CB    . LEU A 1 55  ? 1.863   18.353  6.419   1.00 30.52 ? 91  LEU A CB    1 
ATOM   444  C  CG    . LEU A 1 55  ? 1.352   17.611  7.654   1.00 37.02 ? 91  LEU A CG    1 
ATOM   445  C  CD1   . LEU A 1 55  ? 0.673   18.549  8.625   1.00 36.96 ? 91  LEU A CD1   1 
ATOM   446  C  CD2   . LEU A 1 55  ? 0.404   16.509  7.229   1.00 37.38 ? 91  LEU A CD2   1 
ATOM   447  N  N     . GLU A 1 56  ? 3.670   18.864  3.801   1.00 26.71 ? 92  GLU A N     1 
ATOM   448  C  CA    . GLU A 1 56  ? 3.711   19.370  2.435   1.00 27.47 ? 92  GLU A CA    1 
ATOM   449  C  C     . GLU A 1 56  ? 4.546   18.449  1.548   1.00 30.57 ? 92  GLU A C     1 
ATOM   450  O  O     . GLU A 1 56  ? 4.253   18.266  0.364   1.00 32.87 ? 92  GLU A O     1 
ATOM   451  C  CB    . GLU A 1 56  ? 4.281   20.796  2.440   1.00 31.21 ? 92  GLU A CB    1 
ATOM   452  C  CG    . GLU A 1 56  ? 4.191   21.517  1.107   1.00 33.33 ? 92  GLU A CG    1 
ATOM   453  C  CD    . GLU A 1 56  ? 2.751   21.747  0.671   1.00 44.30 ? 92  GLU A CD    1 
ATOM   454  O  OE1   . GLU A 1 56  ? 1.841   21.712  1.535   1.00 40.91 ? 92  GLU A OE1   1 
ATOM   455  O  OE2   . GLU A 1 56  ? 2.536   21.958  -0.545  1.00 53.20 ? 92  GLU A OE2   1 
ATOM   456  N  N     . SER A 1 57  ? 5.585   17.852  2.125   1.00 27.88 ? 93  SER A N     1 
ATOM   457  C  CA    . SER A 1 57  ? 6.461   16.969  1.365   1.00 28.86 ? 93  SER A CA    1 
ATOM   458  C  C     . SER A 1 57  ? 5.898   15.552  1.283   1.00 31.68 ? 93  SER A C     1 
ATOM   459  O  O     . SER A 1 57  ? 6.329   14.754  0.449   1.00 35.06 ? 93  SER A O     1 
ATOM   460  C  CB    . SER A 1 57  ? 7.844   16.917  2.007   1.00 28.73 ? 93  SER A CB    1 
ATOM   461  O  OG    . SER A 1 57  ? 7.764   16.335  3.297   1.00 30.47 ? 93  SER A OG    1 
ATOM   462  N  N     . GLY A 1 58  ? 4.949   15.236  2.159   1.00 29.73 ? 94  GLY A N     1 
ATOM   463  C  CA    . GLY A 1 58  ? 4.412   13.884  2.239   1.00 30.80 ? 94  GLY A CA    1 
ATOM   464  C  C     . GLY A 1 58  ? 5.184   12.968  3.179   1.00 31.54 ? 94  GLY A C     1 
ATOM   465  O  O     . GLY A 1 58  ? 4.996   11.748  3.175   1.00 33.94 ? 94  GLY A O     1 
ATOM   466  N  N     . LEU A 1 59  ? 6.046   13.550  4.007   1.00 26.71 ? 95  LEU A N     1 
ATOM   467  C  CA    . LEU A 1 59  ? 6.886   12.755  4.902   1.00 24.84 ? 95  LEU A CA    1 
ATOM   468  C  C     . LEU A 1 59  ? 6.399   12.800  6.357   1.00 27.71 ? 95  LEU A C     1 
ATOM   469  O  O     . LEU A 1 59  ? 7.202   12.745  7.284   1.00 25.47 ? 95  LEU A O     1 
ATOM   470  C  CB    . LEU A 1 59  ? 8.345   13.218  4.794   1.00 21.16 ? 95  LEU A CB    1 
ATOM   471  C  CG    . LEU A 1 59  ? 8.970   13.110  3.398   1.00 23.60 ? 95  LEU A CG    1 
ATOM   472  C  CD1   . LEU A 1 59  ? 10.337  13.787  3.339   1.00 20.77 ? 95  LEU A CD1   1 
ATOM   473  C  CD2   . LEU A 1 59  ? 9.101   11.647  2.977   1.00 21.13 ? 95  LEU A CD2   1 
ATOM   474  N  N     . ALA A 1 60  ? 5.082   12.864  6.548   1.00 26.73 ? 96  ALA A N     1 
ATOM   475  C  CA    . ALA A 1 60  ? 4.495   13.059  7.880   1.00 28.21 ? 96  ALA A CA    1 
ATOM   476  C  C     . ALA A 1 60  ? 4.072   11.753  8.559   1.00 25.06 ? 96  ALA A C     1 
ATOM   477  O  O     . ALA A 1 60  ? 3.467   10.878  7.929   1.00 25.97 ? 96  ALA A O     1 
ATOM   478  C  CB    . ALA A 1 60  ? 3.299   14.001  7.787   1.00 33.04 ? 96  ALA A CB    1 
ATOM   479  N  N     . LEU A 1 61  ? 4.388   11.633  9.843   1.00 27.50 ? 97  LEU A N     1 
ATOM   480  C  CA    . LEU A 1 61  ? 3.845   10.549  10.668  1.00 29.01 ? 97  LEU A CA    1 
ATOM   481  C  C     . LEU A 1 61  ? 2.439   10.914  11.157  1.00 34.00 ? 97  LEU A C     1 
ATOM   482  O  O     . LEU A 1 61  ? 2.043   12.083  11.099  1.00 30.11 ? 97  LEU A O     1 
ATOM   483  C  CB    . LEU A 1 61  ? 4.763   10.304  11.865  1.00 30.92 ? 97  LEU A CB    1 
ATOM   484  C  CG    . LEU A 1 61  ? 6.167   9.809   11.514  1.00 30.43 ? 97  LEU A CG    1 
ATOM   485  C  CD1   . LEU A 1 61  ? 7.050   9.771   12.738  1.00 34.25 ? 97  LEU A CD1   1 
ATOM   486  C  CD2   . LEU A 1 61  ? 6.071   8.422   10.932  1.00 26.50 ? 97  LEU A CD2   1 
ATOM   487  N  N     . LYS A 1 62  ? 1.683   9.922   11.637  1.00 29.78 ? 98  LYS A N     1 
ATOM   488  C  CA    . LYS A 1 62  ? 0.404   10.192  12.308  1.00 30.54 ? 98  LYS A CA    1 
ATOM   489  C  C     . LYS A 1 62  ? 0.576   11.235  13.393  1.00 31.28 ? 98  LYS A C     1 
ATOM   490  O  O     . LYS A 1 62  ? 1.603   11.251  14.067  1.00 30.53 ? 98  LYS A O     1 
ATOM   491  C  CB    . LYS A 1 62  ? -0.152  8.924   12.958  1.00 36.57 ? 98  LYS A CB    1 
ATOM   492  C  CG    . LYS A 1 62  ? -0.785  7.956   11.998  1.00 38.16 ? 98  LYS A CG    1 
ATOM   493  C  CD    . LYS A 1 62  ? -1.474  6.831   12.758  1.00 36.75 ? 98  LYS A CD    1 
ATOM   494  C  CE    . LYS A 1 62  ? -2.103  5.839   11.785  1.00 42.31 ? 98  LYS A CE    1 
ATOM   495  N  NZ    . LYS A 1 62  ? -2.436  4.539   12.448  1.00 45.47 ? 98  LYS A NZ    1 
ATOM   496  N  N     . ASN A 1 63  ? -0.435  12.096  13.549  1.00 34.70 ? 99  ASN A N     1 
ATOM   497  C  CA    . ASN A 1 63  ? -0.490  13.090  14.625  1.00 37.81 ? 99  ASN A CA    1 
ATOM   498  C  C     . ASN A 1 63  ? 0.605   14.147  14.555  1.00 39.55 ? 99  ASN A C     1 
ATOM   499  O  O     . ASN A 1 63  ? 1.045   14.656  15.582  1.00 40.89 ? 99  ASN A O     1 
ATOM   500  C  CB    . ASN A 1 63  ? -0.448  12.403  15.990  1.00 37.21 ? 99  ASN A CB    1 
ATOM   501  C  CG    . ASN A 1 63  ? -1.495  11.315  16.122  1.00 43.74 ? 99  ASN A CG    1 
ATOM   502  O  OD1   . ASN A 1 63  ? -2.638  11.489  15.701  1.00 51.20 ? 99  ASN A OD1   1 
ATOM   503  N  ND2   . ASN A 1 63  ? -1.104  10.177  16.693  1.00 47.56 ? 99  ASN A ND2   1 
ATOM   504  N  N     . SER A 1 64  ? 1.054   14.472  13.351  1.00 36.64 ? 100 SER A N     1 
ATOM   505  C  CA    . SER A 1 64  ? 2.121   15.456  13.213  1.00 45.31 ? 100 SER A CA    1 
ATOM   506  C  C     . SER A 1 64  ? 1.585   16.882  13.319  1.00 35.95 ? 100 SER A C     1 
ATOM   507  O  O     . SER A 1 64  ? 0.398   17.128  13.098  1.00 39.55 ? 100 SER A O     1 
ATOM   508  C  CB    . SER A 1 64  ? 2.895   15.255  11.905  1.00 42.57 ? 100 SER A CB    1 
ATOM   509  O  OG    . SER A 1 64  ? 2.032   15.230  10.784  1.00 43.18 ? 100 SER A OG    1 
ATOM   510  N  N     . ASP A 1 65  ? 2.460   17.816  13.673  1.00 38.09 ? 101 ASP A N     1 
ATOM   511  C  CA    . ASP A 1 65  ? 2.070   19.218  13.740  1.00 43.61 ? 101 ASP A CA    1 
ATOM   512  C  C     . ASP A 1 65  ? 2.184   19.838  12.357  1.00 36.76 ? 101 ASP A C     1 
ATOM   513  O  O     . ASP A 1 65  ? 2.905   19.323  11.497  1.00 36.71 ? 101 ASP A O     1 
ATOM   514  C  CB    . ASP A 1 65  ? 2.960   19.978  14.724  1.00 43.04 ? 101 ASP A CB    1 
ATOM   515  C  CG    . ASP A 1 65  ? 3.302   19.159  15.948  1.00 52.86 ? 101 ASP A CG    1 
ATOM   516  O  OD1   . ASP A 1 65  ? 4.431   18.615  16.003  1.00 59.73 ? 101 ASP A OD1   1 
ATOM   517  O  OD2   . ASP A 1 65  ? 2.439   19.049  16.850  1.00 59.34 ? 101 ASP A OD2   1 
ATOM   518  N  N     . MET A 1 66  ? 1.459   20.928  12.134  1.00 28.35 ? 102 MET A N     1 
ATOM   519  C  CA    . MET A 1 66  ? 1.547   21.643  10.871  1.00 28.15 ? 102 MET A CA    1 
ATOM   520  C  C     . MET A 1 66  ? 2.634   22.698  10.999  1.00 27.19 ? 102 MET A C     1 
ATOM   521  O  O     . MET A 1 66  ? 2.838   23.258  12.080  1.00 27.97 ? 102 MET A O     1 
ATOM   522  C  CB    . MET A 1 66  ? 0.225   22.329  10.560  1.00 30.36 ? 102 MET A CB    1 
ATOM   523  C  CG    . MET A 1 66  ? -0.979  21.447  10.773  1.00 42.70 ? 102 MET A CG    1 
ATOM   524  S  SD    . MET A 1 66  ? -2.479  22.263  10.210  1.00 47.94 ? 102 MET A SD    1 
ATOM   525  C  CE    . MET A 1 66  ? -2.016  22.623  8.507   1.00 34.46 ? 102 MET A CE    1 
ATOM   526  N  N     . ASP A 1 67  ? 3.335   22.964  9.907   1.00 28.78 ? 103 ASP A N     1 
ATOM   527  C  CA    . ASP A 1 67  ? 4.310   24.048  9.876   1.00 26.70 ? 103 ASP A CA    1 
ATOM   528  C  C     . ASP A 1 67  ? 3.908   25.000  8.769   1.00 23.79 ? 103 ASP A C     1 
ATOM   529  O  O     . ASP A 1 67  ? 3.792   24.607  7.598   1.00 24.65 ? 103 ASP A O     1 
ATOM   530  C  CB    . ASP A 1 67  ? 5.717   23.513  9.611   1.00 34.30 ? 103 ASP A CB    1 
ATOM   531  C  CG    . ASP A 1 67  ? 6.312   22.812  10.815  1.00 40.94 ? 103 ASP A CG    1 
ATOM   532  O  OD1   . ASP A 1 67  ? 6.664   23.515  11.798  1.00 43.99 ? 103 ASP A OD1   1 
ATOM   533  O  OD2   . ASP A 1 67  ? 6.434   21.566  10.768  1.00 48.67 ? 103 ASP A OD2   1 
ATOM   534  N  N     . LEU A 1 68  ? 3.683   26.252  9.146   1.00 23.54 ? 104 LEU A N     1 
ATOM   535  C  CA    . LEU A 1 68  ? 3.158   27.246  8.229   1.00 20.62 ? 104 LEU A CA    1 
ATOM   536  C  C     . LEU A 1 68  ? 4.011   28.488  8.310   1.00 23.46 ? 104 LEU A C     1 
ATOM   537  O  O     . LEU A 1 68  ? 4.636   28.776  9.341   1.00 20.34 ? 104 LEU A O     1 
ATOM   538  C  CB    . LEU A 1 68  ? 1.717   27.618  8.602   1.00 21.66 ? 104 LEU A CB    1 
ATOM   539  C  CG    . LEU A 1 68  ? 0.654   26.522  8.707   1.00 28.56 ? 104 LEU A CG    1 
ATOM   540  C  CD1   . LEU A 1 68  ? -0.700  27.166  9.056   1.00 27.54 ? 104 LEU A CD1   1 
ATOM   541  C  CD2   . LEU A 1 68  ? 0.560   25.713  7.405   1.00 24.38 ? 104 LEU A CD2   1 
ATOM   542  N  N     . CYS A 1 69  ? 4.008   29.247  7.224   1.00 18.54 ? 105 CYS A N     1 
ATOM   543  C  CA    . CYS A 1 69  ? 4.799   30.452  7.150   1.00 20.86 ? 105 CYS A CA    1 
ATOM   544  C  C     . CYS A 1 69  ? 3.943   31.535  6.514   1.00 21.37 ? 105 CYS A C     1 
ATOM   545  O  O     . CYS A 1 69  ? 3.318   31.296  5.482   1.00 25.60 ? 105 CYS A O     1 
ATOM   546  C  CB    . CYS A 1 69  ? 6.002   30.186  6.251   1.00 26.90 ? 105 CYS A CB    1 
ATOM   547  S  SG    . CYS A 1 69  ? 7.117   31.551  6.232   1.00 44.94 ? 105 CYS A SG    1 
ATOM   548  N  N     . VAL A 1 70  ? 3.913   32.715  7.121   1.00 26.39 ? 106 VAL A N     1 
ATOM   549  C  CA    . VAL A 1 70  ? 3.285   33.885  6.497   1.00 23.98 ? 106 VAL A CA    1 
ATOM   550  C  C     . VAL A 1 70  ? 4.313   34.642  5.665   1.00 24.38 ? 106 VAL A C     1 
ATOM   551  O  O     . VAL A 1 70  ? 5.356   35.055  6.192   1.00 25.96 ? 106 VAL A O     1 
ATOM   552  C  CB    . VAL A 1 70  ? 2.710   34.845  7.547   1.00 19.89 ? 106 VAL A CB    1 
ATOM   553  C  CG1   . VAL A 1 70  ? 2.226   36.132  6.886   1.00 22.24 ? 106 VAL A CG1   1 
ATOM   554  C  CG2   . VAL A 1 70  ? 1.553   34.189  8.313   1.00 21.64 ? 106 VAL A CG2   1 
ATOM   555  N  N     . LEU A 1 71  ? 4.035   34.814  4.370   1.00 22.56 ? 107 LEU A N     1 
ATOM   556  C  CA    . LEU A 1 71  ? 4.925   35.577  3.485   1.00 26.65 ? 107 LEU A CA    1 
ATOM   557  C  C     . LEU A 1 71  ? 4.319   36.932  3.156   1.00 31.52 ? 107 LEU A C     1 
ATOM   558  O  O     . LEU A 1 71  ? 3.116   37.019  2.911   1.00 28.07 ? 107 LEU A O     1 
ATOM   559  C  CB    . LEU A 1 71  ? 5.182   34.820  2.180   1.00 28.52 ? 107 LEU A CB    1 
ATOM   560  C  CG    . LEU A 1 71  ? 5.745   33.410  2.337   1.00 37.07 ? 107 LEU A CG    1 
ATOM   561  C  CD1   . LEU A 1 71  ? 6.004   32.767  0.986   1.00 37.13 ? 107 LEU A CD1   1 
ATOM   562  C  CD2   . LEU A 1 71  ? 7.022   33.474  3.147   1.00 34.68 ? 107 LEU A CD2   1 
ATOM   563  N  N     . MET A 1 72  ? 5.150   37.977  3.150   1.00 32.86 ? 108 MET A N     1 
ATOM   564  C  CA    . MET A 1 72  ? 4.727   39.332  2.774   1.00 45.15 ? 108 MET A CA    1 
ATOM   565  C  C     . MET A 1 72  ? 5.734   40.021  1.848   1.00 50.16 ? 108 MET A C     1 
ATOM   566  O  O     . MET A 1 72  ? 6.729   39.417  1.430   1.00 53.14 ? 108 MET A O     1 
ATOM   567  C  CB    . MET A 1 72  ? 4.616   40.229  3.998   1.00 43.32 ? 108 MET A CB    1 
ATOM   568  C  CG    . MET A 1 72  ? 4.054   39.622  5.241   1.00 47.65 ? 108 MET A CG    1 
ATOM   569  S  SD    . MET A 1 72  ? 4.208   40.869  6.535   1.00 73.61 ? 108 MET A SD    1 
ATOM   570  C  CE    . MET A 1 72  ? 5.989   41.084  6.669   1.00 51.74 ? 108 MET A CE    1 
ATOM   571  N  N     . ASP A 1 73  ? 5.465   41.300  1.570   1.00 55.79 ? 109 ASP A N     1 
ATOM   572  C  CA    . ASP A 1 73  ? 6.379   42.210  0.861   1.00 58.42 ? 109 ASP A CA    1 
ATOM   573  C  C     . ASP A 1 73  ? 6.890   41.681  -0.478  1.00 63.74 ? 109 ASP A C     1 
ATOM   574  O  O     . ASP A 1 73  ? 6.244   41.863  -1.512  1.00 67.51 ? 109 ASP A O     1 
ATOM   575  C  CB    . ASP A 1 73  ? 7.546   42.646  1.765   1.00 58.57 ? 109 ASP A CB    1 
ATOM   576  C  CG    . ASP A 1 73  ? 7.146   43.739  2.755   1.00 67.56 ? 109 ASP A CG    1 
ATOM   577  O  OD1   . ASP A 1 73  ? 5.935   43.873  3.035   1.00 60.25 ? 109 ASP A OD1   1 
ATOM   578  O  OD2   . ASP A 1 73  ? 8.041   44.464  3.250   1.00 70.32 ? 109 ASP A OD2   1 
ATOM   579  N  N     . THR A 1 80  ? 4.987   42.770  12.240  1.00 54.72 ? 116 THR A N     1 
ATOM   580  C  CA    . THR A 1 80  ? 3.893   43.559  12.815  1.00 49.09 ? 116 THR A CA    1 
ATOM   581  C  C     . THR A 1 80  ? 2.519   42.988  12.460  1.00 51.90 ? 116 THR A C     1 
ATOM   582  O  O     . THR A 1 80  ? 1.544   43.140  13.212  1.00 49.12 ? 116 THR A O     1 
ATOM   583  C  CB    . THR A 1 80  ? 3.946   45.012  12.362  1.00 57.29 ? 116 THR A CB    1 
ATOM   584  O  OG1   . THR A 1 80  ? 2.679   45.635  12.620  1.00 60.52 ? 116 THR A OG1   1 
ATOM   585  C  CG2   . THR A 1 80  ? 4.247   45.090  10.874  1.00 53.87 ? 116 THR A CG2   1 
ATOM   586  N  N     . ILE A 1 81  ? 2.438   42.344  11.300  1.00 44.99 ? 117 ILE A N     1 
ATOM   587  C  CA    . ILE A 1 81  ? 1.227   41.633  10.923  1.00 39.01 ? 117 ILE A CA    1 
ATOM   588  C  C     . ILE A 1 81  ? 1.055   40.448  11.873  1.00 32.09 ? 117 ILE A C     1 
ATOM   589  O  O     . ILE A 1 81  ? -0.059  39.960  12.097  1.00 34.02 ? 117 ILE A O     1 
ATOM   590  C  CB    . ILE A 1 81  ? 1.324   41.137  9.471   1.00 42.47 ? 117 ILE A CB    1 
ATOM   591  C  CG1   . ILE A 1 81  ? 0.029   40.444  9.044   1.00 43.14 ? 117 ILE A CG1   1 
ATOM   592  C  CG2   . ILE A 1 81  ? 2.512   40.202  9.304   1.00 46.62 ? 117 ILE A CG2   1 
ATOM   593  C  CD1   . ILE A 1 81  ? 0.085   39.874  7.655   1.00 42.09 ? 117 ILE A CD1   1 
ATOM   594  N  N     . ALA A 1 82  ? 2.177   39.995  12.428  1.00 33.38 ? 118 ALA A N     1 
ATOM   595  C  CA    . ALA A 1 82  ? 2.192   38.842  13.316  1.00 34.04 ? 118 ALA A CA    1 
ATOM   596  C  C     . ALA A 1 82  ? 1.269   39.061  14.503  1.00 29.83 ? 118 ALA A C     1 
ATOM   597  O  O     . ALA A 1 82  ? 0.477   38.192  14.843  1.00 29.53 ? 118 ALA A O     1 
ATOM   598  C  CB    . ALA A 1 82  ? 3.609   38.554  13.780  1.00 32.50 ? 118 ALA A CB    1 
ATOM   599  N  N     . LEU A 1 83  ? 1.373   40.222  15.138  1.00 30.53 ? 119 LEU A N     1 
ATOM   600  C  CA    . LEU A 1 83  ? 0.542   40.496  16.306  1.00 35.26 ? 119 LEU A CA    1 
ATOM   601  C  C     . LEU A 1 83  ? -0.943  40.587  15.932  1.00 31.58 ? 119 LEU A C     1 
ATOM   602  O  O     . LEU A 1 83  ? -1.808  40.038  16.625  1.00 31.02 ? 119 LEU A O     1 
ATOM   603  C  CB    . LEU A 1 83  ? 1.022   41.763  17.018  1.00 34.33 ? 119 LEU A CB    1 
ATOM   604  C  CG    . LEU A 1 83  ? 0.460   42.066  18.410  1.00 39.36 ? 119 LEU A CG    1 
ATOM   605  C  CD1   . LEU A 1 83  ? -0.804  42.873  18.309  1.00 47.54 ? 119 LEU A CD1   1 
ATOM   606  C  CD2   . LEU A 1 83  ? 0.194   40.798  19.215  1.00 39.00 ? 119 LEU A CD2   1 
ATOM   607  N  N     . GLN A 1 84  ? -1.233  41.255  14.821  1.00 31.42 ? 120 GLN A N     1 
ATOM   608  C  CA    . GLN A 1 84  ? -2.613  41.386  14.365  1.00 33.04 ? 120 GLN A CA    1 
ATOM   609  C  C     . GLN A 1 84  ? -3.212  40.020  14.039  1.00 30.95 ? 120 GLN A C     1 
ATOM   610  O  O     . GLN A 1 84  ? -4.370  39.740  14.359  1.00 29.67 ? 120 GLN A O     1 
ATOM   611  C  CB    . GLN A 1 84  ? -2.692  42.308  13.140  1.00 35.38 ? 120 GLN A CB    1 
ATOM   612  C  CG    . GLN A 1 84  ? -3.305  43.676  13.430  1.00 45.31 ? 120 GLN A CG    1 
ATOM   613  C  CD    . GLN A 1 84  ? -4.201  44.167  12.300  1.00 52.73 ? 120 GLN A CD    1 
ATOM   614  O  OE1   . GLN A 1 84  ? -5.432  44.065  12.373  1.00 55.39 ? 120 GLN A OE1   1 
ATOM   615  N  NE2   . GLN A 1 84  ? -3.588  44.704  11.251  1.00 52.97 ? 120 GLN A NE2   1 
ATOM   616  N  N     . PHE A 1 85  ? -2.414  39.172  13.401  1.00 28.48 ? 121 PHE A N     1 
ATOM   617  C  CA    . PHE A 1 85  ? -2.842  37.823  13.065  1.00 27.81 ? 121 PHE A CA    1 
ATOM   618  C  C     . PHE A 1 85  ? -3.071  37.039  14.357  1.00 28.57 ? 121 PHE A C     1 
ATOM   619  O  O     . PHE A 1 85  ? -4.090  36.360  14.519  1.00 24.90 ? 121 PHE A O     1 
ATOM   620  C  CB    . PHE A 1 85  ? -1.765  37.146  12.206  1.00 25.88 ? 121 PHE A CB    1 
ATOM   621  C  CG    . PHE A 1 85  ? -2.205  35.860  11.565  1.00 24.98 ? 121 PHE A CG    1 
ATOM   622  C  CD1   . PHE A 1 85  ? -3.538  35.635  11.246  1.00 24.71 ? 121 PHE A CD1   1 
ATOM   623  C  CD2   . PHE A 1 85  ? -1.267  34.880  11.262  1.00 27.55 ? 121 PHE A CD2   1 
ATOM   624  C  CE1   . PHE A 1 85  ? -3.931  34.448  10.637  1.00 23.73 ? 121 PHE A CE1   1 
ATOM   625  C  CE2   . PHE A 1 85  ? -1.644  33.695  10.659  1.00 23.61 ? 121 PHE A CE2   1 
ATOM   626  C  CZ    . PHE A 1 85  ? -2.975  33.472  10.349  1.00 22.63 ? 121 PHE A CZ    1 
ATOM   627  N  N     . TYR A 1 86  ? -2.131  37.147  15.288  1.00 27.15 ? 122 TYR A N     1 
ATOM   628  C  CA    . TYR A 1 86  ? -2.270  36.441  16.560  1.00 27.85 ? 122 TYR A CA    1 
ATOM   629  C  C     . TYR A 1 86  ? -3.551  36.835  17.294  1.00 28.27 ? 122 TYR A C     1 
ATOM   630  O  O     . TYR A 1 86  ? -4.275  35.971  17.814  1.00 27.39 ? 122 TYR A O     1 
ATOM   631  C  CB    . TYR A 1 86  ? -1.066  36.705  17.456  1.00 26.17 ? 122 TYR A CB    1 
ATOM   632  C  CG    . TYR A 1 86  ? -1.201  36.068  18.821  1.00 28.79 ? 122 TYR A CG    1 
ATOM   633  C  CD1   . TYR A 1 86  ? -1.166  34.689  18.965  1.00 29.14 ? 122 TYR A CD1   1 
ATOM   634  C  CD2   . TYR A 1 86  ? -1.358  36.845  19.964  1.00 36.06 ? 122 TYR A CD2   1 
ATOM   635  C  CE1   . TYR A 1 86  ? -1.277  34.094  20.205  1.00 31.80 ? 122 TYR A CE1   1 
ATOM   636  C  CE2   . TYR A 1 86  ? -1.473  36.260  21.212  1.00 33.11 ? 122 TYR A CE2   1 
ATOM   637  C  CZ    . TYR A 1 86  ? -1.427  34.887  21.323  1.00 34.04 ? 122 TYR A CZ    1 
ATOM   638  O  OH    . TYR A 1 86  ? -1.543  34.290  22.553  1.00 44.50 ? 122 TYR A OH    1 
ATOM   639  N  N     . GLU A 1 87  ? -3.835  38.134  17.328  1.00 32.61 ? 123 GLU A N     1 
ATOM   640  C  CA    . GLU A 1 87  ? -5.026  38.624  18.026  1.00 34.67 ? 123 GLU A CA    1 
ATOM   641  C  C     . GLU A 1 87  ? -6.305  38.097  17.382  1.00 35.82 ? 123 GLU A C     1 
ATOM   642  O  O     . GLU A 1 87  ? -7.227  37.684  18.082  1.00 34.20 ? 123 GLU A O     1 
ATOM   643  C  CB    . GLU A 1 87  ? -5.045  40.158  18.110  1.00 39.79 ? 123 GLU A CB    1 
ATOM   644  C  CG    . GLU A 1 87  ? -3.960  40.741  19.025  1.00 45.53 ? 123 GLU A CG    1 
ATOM   645  C  CD    . GLU A 1 87  ? -4.016  42.255  19.146  1.00 52.95 ? 123 GLU A CD    1 
ATOM   646  O  OE1   . GLU A 1 87  ? -4.513  42.927  18.210  1.00 56.20 ? 123 GLU A OE1   1 
ATOM   647  O  OE2   . GLU A 1 87  ? -3.540  42.779  20.179  1.00 61.34 ? 123 GLU A OE2   1 
ATOM   648  N  N     . GLU A 1 88  ? -6.354  38.087  16.051  1.00 34.74 ? 124 GLU A N     1 
ATOM   649  C  CA    . GLU A 1 88  ? -7.527  37.548  15.353  1.00 36.80 ? 124 GLU A CA    1 
ATOM   650  C  C     . GLU A 1 88  ? -7.727  36.053  15.564  1.00 39.05 ? 124 GLU A C     1 
ATOM   651  O  O     . GLU A 1 88  ? -8.861  35.598  15.722  1.00 36.52 ? 124 GLU A O     1 
ATOM   652  C  CB    . GLU A 1 88  ? -7.462  37.853  13.857  1.00 36.31 ? 124 GLU A CB    1 
ATOM   653  C  CG    . GLU A 1 88  ? -8.054  39.205  13.495  1.00 53.05 ? 124 GLU A CG    1 
ATOM   654  C  CD    . GLU A 1 88  ? -9.539  39.143  13.215  1.00 58.27 ? 124 GLU A CD    1 
ATOM   655  O  OE1   . GLU A 1 88  ? -10.144 40.219  12.987  1.00 64.06 ? 124 GLU A OE1   1 
ATOM   656  O  OE2   . GLU A 1 88  ? -10.094 38.019  13.218  1.00 56.31 ? 124 GLU A OE2   1 
ATOM   657  N  N     . LEU A 1 89  ? -6.633  35.288  15.538  1.00 34.11 ? 125 LEU A N     1 
ATOM   658  C  CA    . LEU A 1 89  ? -6.701  33.842  15.766  1.00 34.03 ? 125 LEU A CA    1 
ATOM   659  C  C     . LEU A 1 89  ? -7.305  33.506  17.126  1.00 34.22 ? 125 LEU A C     1 
ATOM   660  O  O     . LEU A 1 89  ? -8.130  32.601  17.236  1.00 35.74 ? 125 LEU A O     1 
ATOM   661  C  CB    . LEU A 1 89  ? -5.318  33.197  15.631  1.00 24.59 ? 125 LEU A CB    1 
ATOM   662  C  CG    . LEU A 1 89  ? -4.756  33.271  14.214  1.00 28.50 ? 125 LEU A CG    1 
ATOM   663  C  CD1   . LEU A 1 89  ? -3.365  32.681  14.128  1.00 30.64 ? 125 LEU A CD1   1 
ATOM   664  C  CD2   . LEU A 1 89  ? -5.681  32.543  13.271  1.00 31.39 ? 125 LEU A CD2   1 
ATOM   665  N  N     . ILE A 1 90  ? -6.907  34.233  18.166  1.00 34.34 ? 126 ILE A N     1 
ATOM   666  C  CA    . ILE A 1 90  ? -7.468  33.941  19.482  1.00 39.58 ? 126 ILE A CA    1 
ATOM   667  C  C     . ILE A 1 90  ? -8.915  34.439  19.586  1.00 44.66 ? 126 ILE A C     1 
ATOM   668  O  O     . ILE A 1 90  ? -9.752  33.783  20.198  1.00 45.37 ? 126 ILE A O     1 
ATOM   669  C  CB    . ILE A 1 90  ? -6.581  34.429  20.664  1.00 44.95 ? 126 ILE A CB    1 
ATOM   670  C  CG1   . ILE A 1 90  ? -6.487  35.948  20.709  1.00 46.12 ? 126 ILE A CG1   1 
ATOM   671  C  CG2   . ILE A 1 90  ? -5.186  33.804  20.590  1.00 39.69 ? 126 ILE A CG2   1 
ATOM   672  C  CD1   . ILE A 1 90  ? -6.305  36.495  22.123  1.00 50.86 ? 126 ILE A CD1   1 
ATOM   673  N  N     . ALA A 1 91  ? -9.214  35.580  18.967  1.00 41.83 ? 127 ALA A N     1 
ATOM   674  C  CA    . ALA A 1 91  ? -10.601 36.026  18.851  1.00 38.79 ? 127 ALA A CA    1 
ATOM   675  C  C     . ALA A 1 91  ? -11.433 34.982  18.104  1.00 46.55 ? 127 ALA A C     1 
ATOM   676  O  O     . ALA A 1 91  ? -12.629 34.833  18.360  1.00 49.70 ? 127 ALA A O     1 
ATOM   677  C  CB    . ALA A 1 91  ? -10.676 37.366  18.144  1.00 40.79 ? 127 ALA A CB    1 
ATOM   678  N  N     . GLU A 1 92  ? -10.788 34.259  17.186  1.00 42.78 ? 128 GLU A N     1 
ATOM   679  C  CA    . GLU A 1 92  ? -11.449 33.214  16.402  1.00 44.89 ? 128 GLU A CA    1 
ATOM   680  C  C     . GLU A 1 92  ? -11.643 31.910  17.168  1.00 46.19 ? 128 GLU A C     1 
ATOM   681  O  O     . GLU A 1 92  ? -12.224 30.954  16.640  1.00 47.30 ? 128 GLU A O     1 
ATOM   682  C  CB    . GLU A 1 92  ? -10.654 32.926  15.121  1.00 47.49 ? 128 GLU A CB    1 
ATOM   683  C  CG    . GLU A 1 92  ? -11.176 33.637  13.883  1.00 49.77 ? 128 GLU A CG    1 
ATOM   684  C  CD    . GLU A 1 92  ? -12.071 34.803  14.228  1.00 54.91 ? 128 GLU A CD    1 
ATOM   685  O  OE1   . GLU A 1 92  ? -11.536 35.903  14.496  1.00 56.91 ? 128 GLU A OE1   1 
ATOM   686  O  OE2   . GLU A 1 92  ? -13.311 34.616  14.242  1.00 57.55 ? 128 GLU A OE2   1 
ATOM   687  N  N     . GLY A 1 93  ? -11.135 31.852  18.396  1.00 44.83 ? 129 GLY A N     1 
ATOM   688  C  CA    . GLY A 1 93  ? -11.302 30.665  19.220  1.00 41.39 ? 129 GLY A CA    1 
ATOM   689  C  C     . GLY A 1 93  ? -10.147 29.677  19.205  1.00 47.35 ? 129 GLY A C     1 
ATOM   690  O  O     . GLY A 1 93  ? -10.238 28.609  19.819  1.00 38.43 ? 129 GLY A O     1 
ATOM   691  N  N     . PHE A 1 94  ? -9.068  30.001  18.495  1.00 40.46 ? 130 PHE A N     1 
ATOM   692  C  CA    . PHE A 1 94  ? -7.865  29.191  18.623  1.00 40.62 ? 130 PHE A CA    1 
ATOM   693  C  C     . PHE A 1 94  ? -7.178  29.611  19.916  1.00 39.51 ? 130 PHE A C     1 
ATOM   694  O  O     . PHE A 1 94  ? -7.353  30.736  20.384  1.00 39.92 ? 130 PHE A O     1 
ATOM   695  C  CB    . PHE A 1 94  ? -6.906  29.391  17.441  1.00 36.38 ? 130 PHE A CB    1 
ATOM   696  C  CG    . PHE A 1 94  ? -7.417  28.857  16.134  1.00 35.93 ? 130 PHE A CG    1 
ATOM   697  C  CD1   . PHE A 1 94  ? -7.206  27.531  15.776  1.00 39.04 ? 130 PHE A CD1   1 
ATOM   698  C  CD2   . PHE A 1 94  ? -8.073  29.696  15.243  1.00 38.32 ? 130 PHE A CD2   1 
ATOM   699  C  CE1   . PHE A 1 94  ? -7.668  27.040  14.550  1.00 41.07 ? 130 PHE A CE1   1 
ATOM   700  C  CE2   . PHE A 1 94  ? -8.541  29.219  14.026  1.00 34.06 ? 130 PHE A CE2   1 
ATOM   701  C  CZ    . PHE A 1 94  ? -8.339  27.890  13.676  1.00 36.80 ? 130 PHE A CZ    1 
ATOM   702  N  N     . GLU A 1 95  ? -6.411  28.706  20.507  1.00 34.87 ? 131 GLU A N     1 
ATOM   703  C  CA    . GLU A 1 95  ? -5.603  29.085  21.651  1.00 37.58 ? 131 GLU A CA    1 
ATOM   704  C  C     . GLU A 1 95  ? -4.143  28.903  21.260  1.00 33.58 ? 131 GLU A C     1 
ATOM   705  O  O     . GLU A 1 95  ? -3.796  28.003  20.488  1.00 32.50 ? 131 GLU A O     1 
ATOM   706  C  CB    . GLU A 1 95  ? -5.964  28.253  22.886  1.00 42.55 ? 131 GLU A CB    1 
ATOM   707  C  CG    . GLU A 1 95  ? -4.912  27.239  23.267  1.00 44.88 ? 131 GLU A CG    1 
ATOM   708  C  CD    . GLU A 1 95  ? -5.379  26.269  24.329  1.00 54.13 ? 131 GLU A CD    1 
ATOM   709  O  OE1   . GLU A 1 95  ? -4.571  25.396  24.729  1.00 53.49 ? 131 GLU A OE1   1 
ATOM   710  O  OE2   . GLU A 1 95  ? -6.555  26.375  24.753  1.00 60.03 ? 131 GLU A OE2   1 
ATOM   711  N  N     . GLY A 1 96  ? -3.280  29.768  21.760  1.00 29.86 ? 132 GLY A N     1 
ATOM   712  C  CA    . GLY A 1 96  ? -1.886  29.626  21.410  1.00 32.36 ? 132 GLY A CA    1 
ATOM   713  C  C     . GLY A 1 96  ? -0.987  30.648  22.051  1.00 33.84 ? 132 GLY A C     1 
ATOM   714  O  O     . GLY A 1 96  ? -1.404  31.385  22.939  1.00 37.05 ? 132 GLY A O     1 
ATOM   715  N  N     . LYS A 1 97  ? 0.259   30.698  21.590  1.00 28.02 ? 133 LYS A N     1 
ATOM   716  C  CA    . LYS A 1 97  ? 1.266   31.498  22.258  1.00 26.01 ? 133 LYS A CA    1 
ATOM   717  C  C     . LYS A 1 97  ? 2.026   32.306  21.242  1.00 31.74 ? 133 LYS A C     1 
ATOM   718  O  O     . LYS A 1 97  ? 2.154   31.899  20.081  1.00 25.96 ? 133 LYS A O     1 
ATOM   719  C  CB    . LYS A 1 97  ? 2.247   30.585  22.993  1.00 30.25 ? 133 LYS A CB    1 
ATOM   720  C  CG    . LYS A 1 97  ? 1.588   29.496  23.830  1.00 33.00 ? 133 LYS A CG    1 
ATOM   721  C  CD    . LYS A 1 97  ? 2.626   28.748  24.644  1.00 33.05 ? 133 LYS A CD    1 
ATOM   722  C  CE    . LYS A 1 97  ? 2.165   27.342  24.956  1.00 45.88 ? 133 LYS A CE    1 
ATOM   723  N  NZ    . LYS A 1 97  ? 2.422   26.459  23.773  1.00 50.34 ? 133 LYS A NZ    1 
ATOM   724  N  N     . PHE A 1 98  ? 2.577   33.428  21.687  1.00 28.45 ? 134 PHE A N     1 
ATOM   725  C  CA    . PHE A 1 98  ? 3.278   34.322  20.781  1.00 28.06 ? 134 PHE A CA    1 
ATOM   726  C  C     . PHE A 1 98  ? 4.147   35.251  21.590  1.00 29.61 ? 134 PHE A C     1 
ATOM   727  O  O     . PHE A 1 98  ? 3.707   35.777  22.612  1.00 30.16 ? 134 PHE A O     1 
ATOM   728  C  CB    . PHE A 1 98  ? 2.255   35.140  19.993  1.00 27.21 ? 134 PHE A CB    1 
ATOM   729  C  CG    . PHE A 1 98  ? 2.864   36.182  19.104  1.00 28.81 ? 134 PHE A CG    1 
ATOM   730  C  CD1   . PHE A 1 98  ? 3.765   35.820  18.105  1.00 30.34 ? 134 PHE A CD1   1 
ATOM   731  C  CD2   . PHE A 1 98  ? 2.526   37.523  19.258  1.00 33.69 ? 134 PHE A CD2   1 
ATOM   732  C  CE1   . PHE A 1 98  ? 4.335   36.791  17.278  1.00 31.52 ? 134 PHE A CE1   1 
ATOM   733  C  CE2   . PHE A 1 98  ? 3.082   38.496  18.443  1.00 31.60 ? 134 PHE A CE2   1 
ATOM   734  C  CZ    . PHE A 1 98  ? 3.986   38.133  17.449  1.00 32.10 ? 134 PHE A CZ    1 
ATOM   735  N  N     . LEU A 1 99  ? 5.376   35.468  21.142  1.00 31.32 ? 135 LEU A N     1 
ATOM   736  C  CA    . LEU A 1 99  ? 6.225   36.442  21.814  1.00 35.02 ? 135 LEU A CA    1 
ATOM   737  C  C     . LEU A 1 99  ? 6.524   37.608  20.871  1.00 34.96 ? 135 LEU A C     1 
ATOM   738  O  O     . LEU A 1 99  ? 7.304   37.465  19.932  1.00 37.03 ? 135 LEU A O     1 
ATOM   739  C  CB    . LEU A 1 99  ? 7.514   35.775  22.307  1.00 33.92 ? 135 LEU A CB    1 
ATOM   740  C  CG    . LEU A 1 99  ? 8.447   36.603  23.192  1.00 38.88 ? 135 LEU A CG    1 
ATOM   741  C  CD1   . LEU A 1 99  ? 7.669   37.339  24.265  1.00 40.09 ? 135 LEU A CD1   1 
ATOM   742  C  CD2   . LEU A 1 99  ? 9.493   35.705  23.843  1.00 41.55 ? 135 LEU A CD2   1 
ATOM   743  N  N     . GLN A 1 100 ? 5.901   38.762  21.108  1.00 35.12 ? 136 GLN A N     1 
ATOM   744  C  CA    . GLN A 1 100 ? 6.115   39.906  20.219  1.00 40.57 ? 136 GLN A CA    1 
ATOM   745  C  C     . GLN A 1 100 ? 7.559   40.403  20.302  1.00 39.88 ? 136 GLN A C     1 
ATOM   746  O  O     . GLN A 1 100 ? 8.197   40.301  21.354  1.00 37.59 ? 136 GLN A O     1 
ATOM   747  C  CB    . GLN A 1 100 ? 5.167   41.061  20.544  1.00 42.62 ? 136 GLN A CB    1 
ATOM   748  C  CG    . GLN A 1 100 ? 4.004   40.736  21.469  1.00 42.03 ? 136 GLN A CG    1 
ATOM   749  C  CD    . GLN A 1 100 ? 3.218   41.991  21.834  1.00 52.80 ? 136 GLN A CD    1 
ATOM   750  O  OE1   . GLN A 1 100 ? 3.531   43.087  21.361  1.00 51.06 ? 136 GLN A OE1   1 
ATOM   751  N  NE2   . GLN A 1 100 ? 2.199   41.837  22.678  1.00 49.20 ? 136 GLN A NE2   1 
ATOM   752  N  N     . ARG A 1 101 ? 8.058   40.940  19.189  1.00 41.68 ? 137 ARG A N     1 
ATOM   753  C  CA    . ARG A 1 101 ? 9.440   41.441  19.086  1.00 44.68 ? 137 ARG A CA    1 
ATOM   754  C  C     . ARG A 1 101 ? 10.521  40.359  19.228  1.00 47.10 ? 137 ARG A C     1 
ATOM   755  O  O     . ARG A 1 101 ? 11.713  40.677  19.235  1.00 49.46 ? 137 ARG A O     1 
ATOM   756  C  CB    . ARG A 1 101 ? 9.710   42.580  20.088  1.00 40.51 ? 137 ARG A CB    1 
ATOM   757  C  CG    . ARG A 1 101 ? 8.706   43.728  20.053  1.00 44.32 ? 137 ARG A CG    1 
ATOM   758  C  CD    . ARG A 1 101 ? 9.083   44.840  21.037  1.00 39.59 ? 137 ARG A CD    1 
ATOM   759  N  NE    . ARG A 1 101 ? 9.115   44.353  22.414  1.00 47.93 ? 137 ARG A NE    1 
ATOM   760  C  CZ    . ARG A 1 101 ? 10.220  44.237  23.145  1.00 43.19 ? 137 ARG A CZ    1 
ATOM   761  N  NH1   . ARG A 1 101 ? 11.392  44.591  22.643  1.00 41.49 ? 137 ARG A NH1   1 
ATOM   762  N  NH2   . ARG A 1 101 ? 10.151  43.771  24.387  1.00 48.67 ? 137 ARG A NH2   1 
ATOM   763  N  N     . ALA A 1 102 ? 10.111  39.096  19.342  1.00 43.85 ? 138 ALA A N     1 
ATOM   764  C  CA    . ALA A 1 102 ? 11.054  37.983  19.509  1.00 46.52 ? 138 ALA A CA    1 
ATOM   765  C  C     . ALA A 1 102 ? 12.029  37.942  18.351  1.00 49.60 ? 138 ALA A C     1 
ATOM   766  O  O     . ALA A 1 102 ? 11.692  38.367  17.243  1.00 48.23 ? 138 ALA A O     1 
ATOM   767  C  CB    . ALA A 1 102 ? 10.309  36.649  19.597  1.00 42.54 ? 138 ALA A CB    1 
ATOM   768  N  N     . ARG A 1 103 ? 13.239  37.446  18.595  1.00 52.97 ? 139 ARG A N     1 
ATOM   769  C  CA    . ARG A 1 103 ? 14.129  37.156  17.482  1.00 55.05 ? 139 ARG A CA    1 
ATOM   770  C  C     . ARG A 1 103 ? 13.470  35.966  16.805  1.00 54.89 ? 139 ARG A C     1 
ATOM   771  O  O     . ARG A 1 103 ? 13.365  34.896  17.413  1.00 49.16 ? 139 ARG A O     1 
ATOM   772  C  CB    . ARG A 1 103 ? 15.543  36.806  17.959  1.00 53.75 ? 139 ARG A CB    1 
ATOM   773  C  CG    . ARG A 1 103 ? 16.582  36.866  16.841  1.00 58.94 ? 139 ARG A CG    1 
ATOM   774  C  CD    . ARG A 1 103 ? 17.932  36.310  17.274  1.00 58.02 ? 139 ARG A CD    1 
ATOM   775  N  NE    . ARG A 1 103 ? 17.857  34.892  17.629  1.00 61.48 ? 139 ARG A NE    1 
ATOM   776  C  CZ    . ARG A 1 103 ? 17.946  33.887  16.759  1.00 64.40 ? 139 ARG A CZ    1 
ATOM   777  N  NH1   . ARG A 1 103 ? 18.102  34.136  15.462  1.00 61.87 ? 139 ARG A NH1   1 
ATOM   778  N  NH2   . ARG A 1 103 ? 17.873  32.628  17.186  1.00 58.88 ? 139 ARG A NH2   1 
ATOM   779  N  N     . ILE A 1 104 ? 12.995  36.174  15.574  1.00 47.98 ? 140 ILE A N     1 
ATOM   780  C  CA    . ILE A 1 104 ? 12.174  35.190  14.854  1.00 47.14 ? 140 ILE A CA    1 
ATOM   781  C  C     . ILE A 1 104 ? 10.800  34.979  15.510  1.00 39.66 ? 140 ILE A C     1 
ATOM   782  O  O     . ILE A 1 104 ? 10.630  34.086  16.338  1.00 35.99 ? 140 ILE A O     1 
ATOM   783  C  CB    . ILE A 1 104 ? 12.881  33.820  14.700  1.00 48.28 ? 140 ILE A CB    1 
ATOM   784  C  CG1   . ILE A 1 104 ? 14.334  34.000  14.238  1.00 50.24 ? 140 ILE A CG1   1 
ATOM   785  C  CG2   . ILE A 1 104 ? 12.100  32.918  13.753  1.00 43.54 ? 140 ILE A CG2   1 
ATOM   786  C  CD1   . ILE A 1 104 ? 15.208  32.773  14.480  1.00 46.60 ? 140 ILE A CD1   1 
ATOM   787  N  N     . PRO A 1 105 ? 9.811   35.804  15.130  1.00 40.36 ? 141 PRO A N     1 
ATOM   788  C  CA    . PRO A 1 105 ? 8.465   35.688  15.706  1.00 36.59 ? 141 PRO A CA    1 
ATOM   789  C  C     . PRO A 1 105 ? 7.801   34.363  15.319  1.00 34.01 ? 141 PRO A C     1 
ATOM   790  O  O     . PRO A 1 105 ? 7.932   33.902  14.187  1.00 31.40 ? 141 PRO A O     1 
ATOM   791  C  CB    . PRO A 1 105 ? 7.710   36.868  15.082  1.00 36.15 ? 141 PRO A CB    1 
ATOM   792  C  CG    . PRO A 1 105 ? 8.472   37.200  13.836  1.00 36.50 ? 141 PRO A CG    1 
ATOM   793  C  CD    . PRO A 1 105 ? 9.905   36.889  14.136  1.00 38.38 ? 141 PRO A CD    1 
ATOM   794  N  N     . ILE A 1 106 ? 7.110   33.753  16.270  1.00 28.51 ? 142 ILE A N     1 
ATOM   795  C  CA    . ILE A 1 106 ? 6.480   32.470  16.053  1.00 29.27 ? 142 ILE A CA    1 
ATOM   796  C  C     . ILE A 1 106 ? 5.125   32.500  16.736  1.00 29.86 ? 142 ILE A C     1 
ATOM   797  O  O     . ILE A 1 106 ? 5.032   32.885  17.906  1.00 29.38 ? 142 ILE A O     1 
ATOM   798  C  CB    . ILE A 1 106 ? 7.305   31.322  16.694  1.00 25.03 ? 142 ILE A CB    1 
ATOM   799  C  CG1   . ILE A 1 106 ? 8.664   31.167  16.013  1.00 34.20 ? 142 ILE A CG1   1 
ATOM   800  C  CG2   . ILE A 1 106 ? 6.519   30.010  16.641  1.00 29.18 ? 142 ILE A CG2   1 
ATOM   801  C  CD1   . ILE A 1 106 ? 8.569   30.764  14.563  1.00 33.05 ? 142 ILE A CD1   1 
ATOM   802  N  N     . ILE A 1 107 ? 4.071   32.122  16.016  1.00 25.98 ? 143 ILE A N     1 
ATOM   803  C  CA    . ILE A 1 107 ? 2.785   31.856  16.658  1.00 21.95 ? 143 ILE A CA    1 
ATOM   804  C  C     . ILE A 1 107 ? 2.621   30.358  16.791  1.00 26.27 ? 143 ILE A C     1 
ATOM   805  O  O     . ILE A 1 107 ? 2.685   29.631  15.798  1.00 28.18 ? 143 ILE A O     1 
ATOM   806  C  CB    . ILE A 1 107 ? 1.590   32.419  15.853  1.00 26.54 ? 143 ILE A CB    1 
ATOM   807  C  CG1   . ILE A 1 107 ? 1.627   33.951  15.832  1.00 24.02 ? 143 ILE A CG1   1 
ATOM   808  C  CG2   . ILE A 1 107 ? 0.261   31.920  16.442  1.00 25.69 ? 143 ILE A CG2   1 
ATOM   809  C  CD1   . ILE A 1 107 ? 0.759   34.554  14.746  1.00 25.58 ? 143 ILE A CD1   1 
ATOM   810  N  N     . LYS A 1 108 ? 2.440   29.881  18.018  1.00 23.34 ? 144 LYS A N     1 
ATOM   811  C  CA    . LYS A 1 108 ? 2.230   28.455  18.241  1.00 24.43 ? 144 LYS A CA    1 
ATOM   812  C  C     . LYS A 1 108 ? 0.773   28.271  18.623  1.00 29.84 ? 144 LYS A C     1 
ATOM   813  O  O     . LYS A 1 108 ? 0.343   28.778  19.648  1.00 27.34 ? 144 LYS A O     1 
ATOM   814  C  CB    . LYS A 1 108 ? 3.138   27.963  19.376  1.00 27.30 ? 144 LYS A CB    1 
ATOM   815  C  CG    . LYS A 1 108 ? 3.003   26.482  19.718  1.00 33.41 ? 144 LYS A CG    1 
ATOM   816  C  CD    . LYS A 1 108 ? 4.163   25.684  19.154  1.00 39.25 ? 144 LYS A CD    1 
ATOM   817  C  CE    . LYS A 1 108 ? 3.919   24.183  19.262  1.00 42.73 ? 144 LYS A CE    1 
ATOM   818  N  NZ    . LYS A 1 108 ? 2.766   23.777  18.394  1.00 39.67 ? 144 LYS A NZ    1 
ATOM   819  N  N     . LEU A 1 109 ? 0.001   27.570  17.800  1.00 24.34 ? 145 LEU A N     1 
ATOM   820  C  CA    . LEU A 1 109 ? -1.382  27.283  18.161  1.00 29.80 ? 145 LEU A CA    1 
ATOM   821  C  C     . LEU A 1 109 ? -1.392  25.926  18.842  1.00 32.44 ? 145 LEU A C     1 
ATOM   822  O  O     . LEU A 1 109 ? -0.769  24.976  18.362  1.00 32.56 ? 145 LEU A O     1 
ATOM   823  C  CB    . LEU A 1 109 ? -2.289  27.284  16.930  1.00 27.15 ? 145 LEU A CB    1 
ATOM   824  C  CG    . LEU A 1 109 ? -2.324  28.608  16.156  1.00 28.88 ? 145 LEU A CG    1 
ATOM   825  C  CD1   . LEU A 1 109 ? -3.208  28.497  14.908  1.00 29.40 ? 145 LEU A CD1   1 
ATOM   826  C  CD2   . LEU A 1 109 ? -2.782  29.765  17.033  1.00 26.48 ? 145 LEU A CD2   1 
ATOM   827  N  N     . THR A 1 110 ? -2.081  25.834  19.969  1.00 31.66 ? 146 THR A N     1 
ATOM   828  C  CA    . THR A 1 110 ? -2.033  24.616  20.773  1.00 35.36 ? 146 THR A CA    1 
ATOM   829  C  C     . THR A 1 110 ? -3.393  23.951  20.907  1.00 43.16 ? 146 THR A C     1 
ATOM   830  O  O     . THR A 1 110 ? -3.489  22.810  21.370  1.00 43.13 ? 146 THR A O     1 
ATOM   831  C  CB    . THR A 1 110 ? -1.471  24.891  22.175  1.00 36.50 ? 146 THR A CB    1 
ATOM   832  O  OG1   . THR A 1 110 ? -2.290  25.852  22.844  1.00 38.53 ? 146 THR A OG1   1 
ATOM   833  C  CG2   . THR A 1 110 ? -0.062  25.444  22.072  1.00 37.04 ? 146 THR A CG2   1 
ATOM   834  N  N     . SER A 1 111 ? -4.440  24.664  20.498  1.00 40.89 ? 147 SER A N     1 
ATOM   835  C  CA    . SER A 1 111 ? -5.792  24.123  20.561  1.00 44.59 ? 147 SER A CA    1 
ATOM   836  C  C     . SER A 1 111 ? -6.784  24.916  19.723  1.00 42.96 ? 147 SER A C     1 
ATOM   837  O  O     . SER A 1 111 ? -6.553  26.080  19.392  1.00 39.69 ? 147 SER A O     1 
ATOM   838  C  CB    . SER A 1 111 ? -6.283  24.079  22.009  1.00 45.98 ? 147 SER A CB    1 
ATOM   839  O  OG    . SER A 1 111 ? -7.525  23.406  22.098  1.00 53.57 ? 147 SER A OG    1 
ATOM   840  N  N     . ASP A 1 112 ? -7.895  24.267  19.388  1.00 45.76 ? 148 ASP A N     1 
ATOM   841  C  CA    . ASP A 1 112 ? -8.994  24.928  18.701  1.00 47.04 ? 148 ASP A CA    1 
ATOM   842  C  C     . ASP A 1 112 ? -10.282 24.665  19.468  1.00 47.18 ? 148 ASP A C     1 
ATOM   843  O  O     . ASP A 1 112 ? -10.599 23.510  19.773  1.00 42.78 ? 148 ASP A O     1 
ATOM   844  C  CB    . ASP A 1 112 ? -9.128  24.399  17.274  1.00 43.51 ? 148 ASP A CB    1 
ATOM   845  C  CG    . ASP A 1 112 ? -10.432 24.815  16.624  1.00 46.30 ? 148 ASP A CG    1 
ATOM   846  O  OD1   . ASP A 1 112 ? -10.831 25.994  16.783  1.00 46.61 ? 148 ASP A OD1   1 
ATOM   847  O  OD2   . ASP A 1 112 ? -11.061 23.954  15.973  1.00 49.67 ? 148 ASP A OD2   1 
ATOM   848  N  N     . THR A 1 113 ? -11.024 25.729  19.768  1.00 47.40 ? 149 THR A N     1 
ATOM   849  C  CA    . THR A 1 113 ? -12.242 25.599  20.569  1.00 51.24 ? 149 THR A CA    1 
ATOM   850  C  C     . THR A 1 113 ? -13.537 25.762  19.759  1.00 51.47 ? 149 THR A C     1 
ATOM   851  O  O     . THR A 1 113 ? -14.588 25.281  20.178  1.00 55.12 ? 149 THR A O     1 
ATOM   852  C  CB    . THR A 1 113 ? -12.244 26.557  21.800  1.00 49.77 ? 149 THR A CB    1 
ATOM   853  O  OG1   . THR A 1 113 ? -12.389 27.917  21.375  1.00 49.02 ? 149 THR A OG1   1 
ATOM   854  C  CG2   . THR A 1 113 ? -10.959 26.415  22.599  1.00 50.70 ? 149 THR A CG2   1 
ATOM   855  N  N     . LYS A 1 114 ? -13.459 26.424  18.604  1.00 45.15 ? 150 LYS A N     1 
ATOM   856  C  CA    . LYS A 1 114 ? -14.655 26.724  17.801  1.00 48.17 ? 150 LYS A CA    1 
ATOM   857  C  C     . LYS A 1 114 ? -14.678 26.122  16.387  1.00 47.96 ? 150 LYS A C     1 
ATOM   858  O  O     . LYS A 1 114 ? -15.747 25.988  15.791  1.00 45.12 ? 150 LYS A O     1 
ATOM   859  C  CB    . LYS A 1 114 ? -14.854 28.243  17.669  1.00 52.42 ? 150 LYS A CB    1 
ATOM   860  C  CG    . LYS A 1 114 ? -14.995 29.020  18.973  1.00 51.69 ? 150 LYS A CG    1 
ATOM   861  C  CD    . LYS A 1 114 ? -15.603 30.403  18.712  1.00 56.75 ? 150 LYS A CD    1 
ATOM   862  C  CE    . LYS A 1 114 ? -15.215 31.420  19.785  1.00 56.96 ? 150 LYS A CE    1 
ATOM   863  N  NZ    . LYS A 1 114 ? -15.582 30.970  21.158  1.00 55.18 ? 150 LYS A NZ    1 
ATOM   864  N  N     . ASN A 1 115 ? -13.508 25.784  15.846  1.00 45.84 ? 151 ASN A N     1 
ATOM   865  C  CA    . ASN A 1 115 ? -13.380 25.442  14.429  1.00 46.88 ? 151 ASN A CA    1 
ATOM   866  C  C     . ASN A 1 115 ? -13.366 23.944  14.129  1.00 42.67 ? 151 ASN A C     1 
ATOM   867  O  O     . ASN A 1 115 ? -13.199 23.546  12.979  1.00 45.19 ? 151 ASN A O     1 
ATOM   868  C  CB    . ASN A 1 115 ? -12.117 26.089  13.835  1.00 42.52 ? 151 ASN A CB    1 
ATOM   869  C  CG    . ASN A 1 115 ? -12.070 27.593  14.050  1.00 51.21 ? 151 ASN A CG    1 
ATOM   870  O  OD1   . ASN A 1 115 ? -12.494 28.370  13.189  1.00 52.34 ? 151 ASN A OD1   1 
ATOM   871  N  ND2   . ASN A 1 115 ? -11.554 28.013  15.206  1.00 49.39 ? 151 ASN A ND2   1 
ATOM   872  N  N     . GLY A 1 116 ? -13.511 23.118  15.161  1.00 41.09 ? 152 GLY A N     1 
ATOM   873  C  CA    . GLY A 1 116 ? -13.602 21.679  14.981  1.00 39.86 ? 152 GLY A CA    1 
ATOM   874  C  C     . GLY A 1 116 ? -12.335 20.946  14.565  1.00 42.94 ? 152 GLY A C     1 
ATOM   875  O  O     . GLY A 1 116 ? -12.414 19.893  13.929  1.00 41.92 ? 152 GLY A O     1 
ATOM   876  N  N     . PHE A 1 117 ? -11.165 21.482  14.918  1.00 44.41 ? 153 PHE A N     1 
ATOM   877  C  CA    . PHE A 1 117 ? -9.901  20.834  14.546  1.00 42.11 ? 153 PHE A CA    1 
ATOM   878  C  C     . PHE A 1 117 ? -9.287  20.084  15.717  1.00 43.08 ? 153 PHE A C     1 
ATOM   879  O  O     . PHE A 1 117 ? -8.213  19.486  15.597  1.00 45.60 ? 153 PHE A O     1 
ATOM   880  C  CB    . PHE A 1 117 ? -8.906  21.839  13.948  1.00 38.94 ? 153 PHE A CB    1 
ATOM   881  C  CG    . PHE A 1 117 ? -9.389  22.467  12.678  1.00 38.00 ? 153 PHE A CG    1 
ATOM   882  C  CD1   . PHE A 1 117 ? -9.647  21.680  11.558  1.00 41.43 ? 153 PHE A CD1   1 
ATOM   883  C  CD2   . PHE A 1 117 ? -9.601  23.835  12.601  1.00 41.88 ? 153 PHE A CD2   1 
ATOM   884  C  CE1   . PHE A 1 117 ? -10.110 22.248  10.382  1.00 40.16 ? 153 PHE A CE1   1 
ATOM   885  C  CE2   . PHE A 1 117 ? -10.059 24.414  11.427  1.00 39.78 ? 153 PHE A CE2   1 
ATOM   886  C  CZ    . PHE A 1 117 ? -10.318 23.621  10.321  1.00 38.72 ? 153 PHE A CZ    1 
ATOM   887  N  N     . GLY A 1 118 ? -9.976  20.122  16.851  1.00 42.06 ? 154 GLY A N     1 
ATOM   888  C  CA    . GLY A 1 118 ? -9.595  19.301  17.985  1.00 49.82 ? 154 GLY A CA    1 
ATOM   889  C  C     . GLY A 1 118 ? -8.912  20.027  19.128  1.00 47.96 ? 154 GLY A C     1 
ATOM   890  O  O     . GLY A 1 118 ? -8.269  21.065  18.944  1.00 43.45 ? 154 GLY A O     1 
ATOM   891  N  N     . ALA A 1 119 ? -9.046  19.466  20.325  1.00 50.58 ? 155 ALA A N     1 
ATOM   892  C  CA    . ALA A 1 119 ? -8.367  20.004  21.498  1.00 51.56 ? 155 ALA A CA    1 
ATOM   893  C  C     . ALA A 1 119 ? -6.851  19.819  21.402  1.00 45.56 ? 155 ALA A C     1 
ATOM   894  O  O     . ALA A 1 119 ? -6.092  20.505  22.087  1.00 51.26 ? 155 ALA A O     1 
ATOM   895  C  CB    . ALA A 1 119 ? -8.900  19.345  22.755  1.00 55.23 ? 155 ALA A CB    1 
ATOM   896  N  N     . SER A 1 120 ? -6.421  18.881  20.562  1.00 49.84 ? 156 SER A N     1 
ATOM   897  C  CA    . SER A 1 120 ? -4.999  18.607  20.373  1.00 52.91 ? 156 SER A CA    1 
ATOM   898  C  C     . SER A 1 120 ? -4.498  19.123  19.018  1.00 47.76 ? 156 SER A C     1 
ATOM   899  O  O     . SER A 1 120 ? -3.628  18.515  18.390  1.00 49.02 ? 156 SER A O     1 
ATOM   900  C  CB    . SER A 1 120 ? -4.736  17.105  20.484  1.00 52.62 ? 156 SER A CB    1 
ATOM   901  O  OG    . SER A 1 120 ? -5.334  16.410  19.401  1.00 58.44 ? 156 SER A OG    1 
ATOM   902  N  N     . PHE A 1 121 ? -5.054  20.242  18.568  1.00 45.73 ? 157 PHE A N     1 
ATOM   903  C  CA    . PHE A 1 121 ? -4.622  20.854  17.317  1.00 42.58 ? 157 PHE A CA    1 
ATOM   904  C  C     . PHE A 1 121 ? -3.332  21.625  17.541  1.00 39.62 ? 157 PHE A C     1 
ATOM   905  O  O     . PHE A 1 121 ? -3.307  22.579  18.317  1.00 47.77 ? 157 PHE A O     1 
ATOM   906  C  CB    . PHE A 1 121 ? -5.702  21.794  16.793  1.00 42.35 ? 157 PHE A CB    1 
ATOM   907  C  CG    . PHE A 1 121 ? -5.290  22.577  15.576  1.00 38.46 ? 157 PHE A CG    1 
ATOM   908  C  CD1   . PHE A 1 121 ? -5.203  21.961  14.338  1.00 36.22 ? 157 PHE A CD1   1 
ATOM   909  C  CD2   . PHE A 1 121 ? -5.021  23.935  15.672  1.00 38.21 ? 157 PHE A CD2   1 
ATOM   910  C  CE1   . PHE A 1 121 ? -4.833  22.680  13.213  1.00 34.76 ? 157 PHE A CE1   1 
ATOM   911  C  CE2   . PHE A 1 121 ? -4.656  24.672  14.551  1.00 36.06 ? 157 PHE A CE2   1 
ATOM   912  C  CZ    . PHE A 1 121 ? -4.563  24.043  13.320  1.00 34.92 ? 157 PHE A CZ    1 
ATOM   913  N  N     . GLN A 1 122 ? -2.264  21.223  16.860  1.00 37.54 ? 158 GLN A N     1 
ATOM   914  C  CA    . GLN A 1 122 ? -0.972  21.886  17.028  1.00 34.65 ? 158 GLN A CA    1 
ATOM   915  C  C     . GLN A 1 122 ? -0.442  22.423  15.705  1.00 36.99 ? 158 GLN A C     1 
ATOM   916  O  O     . GLN A 1 122 ? -0.334  21.691  14.701  1.00 34.70 ? 158 GLN A O     1 
ATOM   917  C  CB    . GLN A 1 122 ? 0.057   20.938  17.662  1.00 41.34 ? 158 GLN A CB    1 
ATOM   918  C  CG    . GLN A 1 122 ? -0.323  20.394  19.050  1.00 46.36 ? 158 GLN A CG    1 
ATOM   919  C  CD    . GLN A 1 122 ? -0.032  21.365  20.190  1.00 47.72 ? 158 GLN A CD    1 
ATOM   920  O  OE1   . GLN A 1 122 ? 0.895   22.182  20.114  1.00 51.83 ? 158 GLN A OE1   1 
ATOM   921  N  NE2   . GLN A 1 122 ? -0.823  21.275  21.258  1.00 50.79 ? 158 GLN A NE2   1 
ATOM   922  N  N     . CYS A 1 123 ? -0.082  23.702  15.714  1.00 30.02 ? 159 CYS A N     1 
ATOM   923  C  CA    . CYS A 1 123 ? 0.373   24.361  14.506  1.00 25.43 ? 159 CYS A CA    1 
ATOM   924  C  C     . CYS A 1 123 ? 1.363   25.479  14.845  1.00 30.48 ? 159 CYS A C     1 
ATOM   925  O  O     . CYS A 1 123 ? 1.098   26.295  15.732  1.00 31.75 ? 159 CYS A O     1 
ATOM   926  C  CB    . CYS A 1 123 ? -0.849  24.945  13.792  1.00 30.98 ? 159 CYS A CB    1 
ATOM   927  S  SG    . CYS A 1 123 ? -0.495  25.803  12.271  1.00 39.05 ? 159 CYS A SG    1 
ATOM   928  N  N     . ALA A 1 124 ? 2.499   25.525  14.146  1.00 22.95 ? 160 ALA A N     1 
ATOM   929  C  CA    . ALA A 1 124 ? 3.475   26.609  14.338  1.00 21.18 ? 160 ALA A CA    1 
ATOM   930  C  C     . ALA A 1 124 ? 3.497   27.491  13.102  1.00 25.23 ? 160 ALA A C     1 
ATOM   931  O  O     . ALA A 1 124 ? 3.661   26.997  11.985  1.00 24.84 ? 160 ALA A O     1 
ATOM   932  C  CB    . ALA A 1 124 ? 4.879   26.046  14.608  1.00 27.51 ? 160 ALA A CB    1 
ATOM   933  N  N     . ILE A 1 125 ? 3.356   28.795  13.304  1.00 23.43 ? 161 ILE A N     1 
ATOM   934  C  CA    . ILE A 1 125 ? 3.325   29.745  12.200  1.00 20.92 ? 161 ILE A CA    1 
ATOM   935  C  C     . ILE A 1 125 ? 4.503   30.704  12.324  1.00 22.21 ? 161 ILE A C     1 
ATOM   936  O  O     . ILE A 1 125 ? 4.589   31.461  13.296  1.00 24.18 ? 161 ILE A O     1 
ATOM   937  C  CB    . ILE A 1 125 ? 2.033   30.575  12.249  1.00 20.40 ? 161 ILE A CB    1 
ATOM   938  C  CG1   . ILE A 1 125 ? 0.804   29.654  12.254  1.00 25.76 ? 161 ILE A CG1   1 
ATOM   939  C  CG2   . ILE A 1 125 ? 1.979   31.556  11.087  1.00 22.53 ? 161 ILE A CG2   1 
ATOM   940  C  CD1   . ILE A 1 125 ? -0.520  30.394  12.524  1.00 26.17 ? 161 ILE A CD1   1 
ATOM   941  N  N     . GLY A 1 126 ? 5.396   30.673  11.336  1.00 21.04 ? 162 GLY A N     1 
ATOM   942  C  CA    . GLY A 1 126 ? 6.539   31.557  11.300  1.00 21.51 ? 162 GLY A CA    1 
ATOM   943  C  C     . GLY A 1 126 ? 6.295   32.647  10.283  1.00 25.31 ? 162 GLY A C     1 
ATOM   944  O  O     . GLY A 1 126 ? 5.224   32.718  9.662   1.00 21.01 ? 162 GLY A O     1 
ATOM   945  N  N     . PHE A 1 127 ? 7.285   33.511  10.106  1.00 22.69 ? 163 PHE A N     1 
ATOM   946  C  CA    . PHE A 1 127 ? 7.103   34.661  9.245   1.00 21.79 ? 163 PHE A CA    1 
ATOM   947  C  C     . PHE A 1 127 ? 8.267   34.834  8.295   1.00 27.04 ? 163 PHE A C     1 
ATOM   948  O  O     . PHE A 1 127 ? 9.417   34.815  8.721   1.00 29.07 ? 163 PHE A O     1 
ATOM   949  C  CB    . PHE A 1 127 ? 6.864   35.899  10.113  1.00 25.39 ? 163 PHE A CB    1 
ATOM   950  C  CG    . PHE A 1 127 ? 5.574   35.827  10.856  1.00 25.90 ? 163 PHE A CG    1 
ATOM   951  C  CD1   . PHE A 1 127 ? 4.419   36.358  10.301  1.00 25.43 ? 163 PHE A CD1   1 
ATOM   952  C  CD2   . PHE A 1 127 ? 5.491   35.148  12.071  1.00 25.34 ? 163 PHE A CD2   1 
ATOM   953  C  CE1   . PHE A 1 127 ? 3.203   36.246  10.959  1.00 24.20 ? 163 PHE A CE1   1 
ATOM   954  C  CE2   . PHE A 1 127 ? 4.271   35.027  12.732  1.00 27.78 ? 163 PHE A CE2   1 
ATOM   955  C  CZ    . PHE A 1 127 ? 3.129   35.578  12.168  1.00 27.98 ? 163 PHE A CZ    1 
ATOM   956  N  N     . ASN A 1 128 ? 7.948   34.962  7.006   1.00 23.11 ? 164 ASN A N     1 
ATOM   957  C  CA    . ASN A 1 128 ? 8.932   35.178  5.944   1.00 26.11 ? 164 ASN A CA    1 
ATOM   958  C  C     . ASN A 1 128 ? 10.095  34.185  5.943   1.00 30.44 ? 164 ASN A C     1 
ATOM   959  O  O     . ASN A 1 128 ? 11.228  34.550  5.668   1.00 32.23 ? 164 ASN A O     1 
ATOM   960  C  CB    . ASN A 1 128 ? 9.429   36.631  5.957   1.00 34.55 ? 164 ASN A CB    1 
ATOM   961  C  CG    . ASN A 1 128 ? 8.357   37.619  5.488   1.00 38.51 ? 164 ASN A CG    1 
ATOM   962  O  OD1   . ASN A 1 128 ? 7.727   37.421  4.443   1.00 34.89 ? 164 ASN A OD1   1 
ATOM   963  N  ND2   . ASN A 1 128 ? 8.134   38.674  6.272   1.00 44.25 ? 164 ASN A ND2   1 
ATOM   964  N  N     . ASN A 1 129 ? 9.795   32.923  6.232   1.00 27.55 ? 165 ASN A N     1 
ATOM   965  C  CA    . ASN A 1 129 ? 10.806  31.865  6.217   1.00 28.15 ? 165 ASN A CA    1 
ATOM   966  C  C     . ASN A 1 129 ? 10.844  31.181  4.838   1.00 28.91 ? 165 ASN A C     1 
ATOM   967  O  O     . ASN A 1 129 ? 10.443  30.016  4.688   1.00 24.68 ? 165 ASN A O     1 
ATOM   968  C  CB    . ASN A 1 129 ? 10.472  30.857  7.322   1.00 33.52 ? 165 ASN A CB    1 
ATOM   969  C  CG    . ASN A 1 129 ? 11.581  29.850  7.573   1.00 35.98 ? 165 ASN A CG    1 
ATOM   970  O  OD1   . ASN A 1 129 ? 11.455  29.002  8.461   1.00 41.46 ? 165 ASN A OD1   1 
ATOM   971  N  ND2   . ASN A 1 129 ? 12.666  29.931  6.803   1.00 28.10 ? 165 ASN A ND2   1 
ATOM   972  N  N     . ARG A 1 130 ? 11.329  31.906  3.831   1.00 21.56 ? 166 ARG A N     1 
ATOM   973  C  CA    . ARG A 1 130 ? 11.317  31.408  2.462   1.00 24.83 ? 166 ARG A CA    1 
ATOM   974  C  C     . ARG A 1 130 ? 12.250  30.232  2.269   1.00 23.23 ? 166 ARG A C     1 
ATOM   975  O  O     . ARG A 1 130 ? 11.979  29.366  1.444   1.00 25.31 ? 166 ARG A O     1 
ATOM   976  C  CB    . ARG A 1 130 ? 11.665  32.528  1.478   1.00 30.12 ? 166 ARG A CB    1 
ATOM   977  C  CG    . ARG A 1 130 ? 10.522  33.511  1.287   1.00 29.81 ? 166 ARG A CG    1 
ATOM   978  C  CD    . ARG A 1 130 ? 10.840  34.594  0.275   1.00 37.46 ? 166 ARG A CD    1 
ATOM   979  N  NE    . ARG A 1 130 ? 9.621   35.335  -0.043  1.00 44.99 ? 166 ARG A NE    1 
ATOM   980  C  CZ    . ARG A 1 130 ? 9.146   36.334  0.694   1.00 43.69 ? 166 ARG A CZ    1 
ATOM   981  N  NH1   . ARG A 1 130 ? 9.803   36.733  1.779   1.00 41.65 ? 166 ARG A NH1   1 
ATOM   982  N  NH2   . ARG A 1 130 ? 8.019   36.942  0.343   1.00 44.96 ? 166 ARG A NH2   1 
ATOM   983  N  N     . LEU A 1 131 ? 13.328  30.192  3.044   1.00 19.43 ? 167 LEU A N     1 
ATOM   984  C  CA    . LEU A 1 131 ? 14.298  29.095  2.956   1.00 27.22 ? 167 LEU A CA    1 
ATOM   985  C  C     . LEU A 1 131 ? 13.679  27.753  3.336   1.00 26.68 ? 167 LEU A C     1 
ATOM   986  O  O     . LEU A 1 131 ? 13.964  26.733  2.705   1.00 20.94 ? 167 LEU A O     1 
ATOM   987  C  CB    . LEU A 1 131 ? 15.511  29.368  3.843   1.00 29.48 ? 167 LEU A CB    1 
ATOM   988  C  CG    . LEU A 1 131 ? 16.791  29.981  3.252   1.00 34.82 ? 167 LEU A CG    1 
ATOM   989  C  CD1   . LEU A 1 131 ? 16.656  30.436  1.805   1.00 31.90 ? 167 LEU A CD1   1 
ATOM   990  C  CD2   . LEU A 1 131 ? 17.290  31.131  4.112   1.00 35.29 ? 167 LEU A CD2   1 
ATOM   991  N  N     . ALA A 1 132 ? 12.842  27.751  4.375   1.00 20.47 ? 168 ALA A N     1 
ATOM   992  C  CA    . ALA A 1 132 ? 12.196  26.511  4.808   1.00 24.49 ? 168 ALA A CA    1 
ATOM   993  C  C     . ALA A 1 132 ? 11.259  26.042  3.710   1.00 21.65 ? 168 ALA A C     1 
ATOM   994  O  O     . ALA A 1 132 ? 11.104  24.847  3.475   1.00 22.33 ? 168 ALA A O     1 
ATOM   995  C  CB    . ALA A 1 132 ? 11.430  26.716  6.137   1.00 26.10 ? 168 ALA A CB    1 
ATOM   996  N  N     . ILE A 1 133 ? 10.613  26.990  3.044   1.00 18.65 ? 169 ILE A N     1 
ATOM   997  C  CA    . ILE A 1 133 ? 9.748   26.653  1.919   1.00 23.64 ? 169 ILE A CA    1 
ATOM   998  C  C     . ILE A 1 133 ? 10.521  25.973  0.795   1.00 23.08 ? 169 ILE A C     1 
ATOM   999  O  O     . ILE A 1 133 ? 10.064  24.968  0.240   1.00 20.80 ? 169 ILE A O     1 
ATOM   1000 C  CB    . ILE A 1 133 ? 8.966   27.895  1.421   1.00 26.49 ? 169 ILE A CB    1 
ATOM   1001 C  CG1   . ILE A 1 133 ? 7.898   28.268  2.449   1.00 24.24 ? 169 ILE A CG1   1 
ATOM   1002 C  CG2   . ILE A 1 133 ? 8.308   27.640  0.068   1.00 29.20 ? 169 ILE A CG2   1 
ATOM   1003 C  CD1   . ILE A 1 133 ? 7.356   29.691  2.262   1.00 29.00 ? 169 ILE A CD1   1 
ATOM   1004 N  N     . HIS A 1 134 ? 11.698  26.501  0.456   1.00 19.90 ? 170 HIS A N     1 
ATOM   1005 C  CA    . HIS A 1 134 ? 12.517  25.873  -0.578  1.00 21.09 ? 170 HIS A CA    1 
ATOM   1006 C  C     . HIS A 1 134 ? 13.108  24.516  -0.196  1.00 20.59 ? 170 HIS A C     1 
ATOM   1007 O  O     . HIS A 1 134 ? 13.195  23.631  -1.049  1.00 23.80 ? 170 HIS A O     1 
ATOM   1008 C  CB    . HIS A 1 134 ? 13.582  26.844  -1.098  1.00 24.58 ? 170 HIS A CB    1 
ATOM   1009 C  CG    . HIS A 1 134 ? 12.998  27.968  -1.893  1.00 23.52 ? 170 HIS A CG    1 
ATOM   1010 N  ND1   . HIS A 1 134 ? 12.765  27.872  -3.246  1.00 28.83 ? 170 HIS A ND1   1 
ATOM   1011 C  CD2   . HIS A 1 134 ? 12.538  29.187  -1.515  1.00 30.67 ? 170 HIS A CD2   1 
ATOM   1012 C  CE1   . HIS A 1 134 ? 12.217  28.996  -3.678  1.00 31.60 ? 170 HIS A CE1   1 
ATOM   1013 N  NE2   . HIS A 1 134 ? 12.066  29.810  -2.646  1.00 30.71 ? 170 HIS A NE2   1 
ATOM   1014 N  N     . ASN A 1 135 ? 13.538  24.319  1.047   1.00 21.41 ? 171 ASN A N     1 
ATOM   1015 C  CA    A ASN A 1 135 ? 14.006  22.978  1.350   0.57 22.40 ? 171 ASN A CA    1 
ATOM   1016 C  CA    B ASN A 1 135 ? 13.954  22.999  1.541   0.43 22.43 ? 171 ASN A CA    1 
ATOM   1017 C  C     . ASN A 1 135 ? 12.846  21.970  1.349   1.00 21.70 ? 171 ASN A C     1 
ATOM   1018 O  O     . ASN A 1 135 ? 13.062  20.803  1.055   1.00 18.94 ? 171 ASN A O     1 
ATOM   1019 C  CB    A ASN A 1 135 ? 14.920  22.906  2.591   0.57 23.34 ? 171 ASN A CB    1 
ATOM   1020 C  CB    B ASN A 1 135 ? 14.231  23.053  3.049   0.43 24.76 ? 171 ASN A CB    1 
ATOM   1021 C  CG    A ASN A 1 135 ? 14.205  23.245  3.884   0.57 24.85 ? 171 ASN A CG    1 
ATOM   1022 C  CG    B ASN A 1 135 ? 15.406  23.929  3.411   0.43 25.44 ? 171 ASN A CG    1 
ATOM   1023 O  OD1   A ASN A 1 135 ? 13.109  22.753  4.150   0.57 26.63 ? 171 ASN A OD1   1 
ATOM   1024 O  OD1   B ASN A 1 135 ? 16.335  24.104  2.627   0.43 24.83 ? 171 ASN A OD1   1 
ATOM   1025 N  ND2   A ASN A 1 135 ? 14.829  24.088  4.699   0.57 25.87 ? 171 ASN A ND2   1 
ATOM   1026 N  ND2   B ASN A 1 135 ? 15.380  24.470  4.627   0.43 27.13 ? 171 ASN A ND2   1 
ATOM   1027 N  N     . THR A 1 136 ? 11.627  22.422  1.614   1.00 21.08 ? 172 THR A N     1 
ATOM   1028 C  CA    . THR A 1 136 ? 10.460  21.548  1.490   1.00 21.25 ? 172 THR A CA    1 
ATOM   1029 C  C     . THR A 1 136 ? 10.224  21.194  0.016   1.00 19.81 ? 172 THR A C     1 
ATOM   1030 O  O     . THR A 1 136 ? 9.911   20.054  -0.309  1.00 22.45 ? 172 THR A O     1 
ATOM   1031 C  CB    . THR A 1 136 ? 9.207   22.202  2.136   1.00 20.18 ? 172 THR A CB    1 
ATOM   1032 O  OG1   . THR A 1 136 ? 9.458   22.377  3.543   1.00 25.22 ? 172 THR A OG1   1 
ATOM   1033 C  CG2   . THR A 1 136 ? 7.974   21.320  1.962   1.00 20.52 ? 172 THR A CG2   1 
ATOM   1034 N  N     . LEU A 1 137 ? 10.411  22.167  -0.873  1.00 21.37 ? 173 LEU A N     1 
ATOM   1035 C  CA    . LEU A 1 137 ? 10.302  21.924  -2.310  1.00 21.24 ? 173 LEU A CA    1 
ATOM   1036 C  C     . LEU A 1 137 ? 11.283  20.861  -2.760  1.00 20.31 ? 173 LEU A C     1 
ATOM   1037 O  O     . LEU A 1 137 ? 10.939  19.988  -3.550  1.00 19.25 ? 173 LEU A O     1 
ATOM   1038 C  CB    . LEU A 1 137 ? 10.572  23.203  -3.100  1.00 22.45 ? 173 LEU A CB    1 
ATOM   1039 C  CG    . LEU A 1 137 ? 9.409   24.172  -3.319  1.00 32.39 ? 173 LEU A CG    1 
ATOM   1040 C  CD1   . LEU A 1 137 ? 9.906   25.410  -4.103  1.00 33.70 ? 173 LEU A CD1   1 
ATOM   1041 C  CD2   . LEU A 1 137 ? 8.255   23.476  -4.056  1.00 31.77 ? 173 LEU A CD2   1 
ATOM   1042 N  N     . LEU A 1 138 ? 12.519  20.960  -2.282  1.00 20.06 ? 174 LEU A N     1 
ATOM   1043 C  CA    . LEU A 1 138 ? 13.539  19.971  -2.605  1.00 18.84 ? 174 LEU A CA    1 
ATOM   1044 C  C     . LEU A 1 138 ? 13.161  18.594  -2.068  1.00 20.50 ? 174 LEU A C     1 
ATOM   1045 O  O     . LEU A 1 138 ? 13.250  17.604  -2.792  1.00 18.13 ? 174 LEU A O     1 
ATOM   1046 C  CB    . LEU A 1 138 ? 14.887  20.395  -2.029  1.00 22.67 ? 174 LEU A CB    1 
ATOM   1047 C  CG    . LEU A 1 138 ? 16.042  19.412  -2.240  1.00 23.96 ? 174 LEU A CG    1 
ATOM   1048 C  CD1   . LEU A 1 138 ? 16.447  19.378  -3.726  1.00 24.68 ? 174 LEU A CD1   1 
ATOM   1049 C  CD2   . LEU A 1 138 ? 17.228  19.858  -1.390  1.00 23.75 ? 174 LEU A CD2   1 
ATOM   1050 N  N     . LEU A 1 139 ? 12.754  18.523  -0.802  1.00 19.38 ? 175 LEU A N     1 
ATOM   1051 C  CA    . LEU A 1 139 ? 12.361  17.235  -0.222  1.00 19.76 ? 175 LEU A CA    1 
ATOM   1052 C  C     . LEU A 1 139 ? 11.151  16.637  -0.947  1.00 19.75 ? 175 LEU A C     1 
ATOM   1053 O  O     . LEU A 1 139 ? 11.093  15.431  -1.180  1.00 18.94 ? 175 LEU A O     1 
ATOM   1054 C  CB    . LEU A 1 139 ? 12.096  17.378  1.283   1.00 21.25 ? 175 LEU A CB    1 
ATOM   1055 C  CG    . LEU A 1 139 ? 13.278  17.039  2.200   1.00 21.77 ? 175 LEU A CG    1 
ATOM   1056 C  CD1   . LEU A 1 139 ? 14.572  17.725  1.757   1.00 23.74 ? 175 LEU A CD1   1 
ATOM   1057 C  CD2   . LEU A 1 139 ? 12.944  17.382  3.666   1.00 26.22 ? 175 LEU A CD2   1 
ATOM   1058 N  N     . SER A 1 140 ? 10.199  17.493  -1.315  1.00 18.65 ? 176 SER A N     1 
ATOM   1059 C  CA    A SER A 1 140 ? 9.025   17.078  -2.080  0.47 20.29 ? 176 SER A CA    1 
ATOM   1060 C  CA    B SER A 1 140 ? 9.029   17.069  -2.071  0.53 20.41 ? 176 SER A CA    1 
ATOM   1061 C  C     . SER A 1 140 ? 9.407   16.416  -3.399  1.00 21.74 ? 176 SER A C     1 
ATOM   1062 O  O     . SER A 1 140 ? 8.807   15.427  -3.799  1.00 20.31 ? 176 SER A O     1 
ATOM   1063 C  CB    A SER A 1 140 ? 8.125   18.293  -2.366  0.47 22.36 ? 176 SER A CB    1 
ATOM   1064 C  CB    B SER A 1 140 ? 8.091   18.264  -2.323  0.53 22.29 ? 176 SER A CB    1 
ATOM   1065 O  OG    A SER A 1 140 ? 6.919   17.891  -2.985  0.47 25.16 ? 176 SER A OG    1 
ATOM   1066 O  OG    B SER A 1 140 ? 7.455   18.653  -1.126  0.53 24.30 ? 176 SER A OG    1 
ATOM   1067 N  N     . SER A 1 141 ? 10.405  16.977  -4.075  1.00 19.35 ? 177 SER A N     1 
ATOM   1068 C  CA    . SER A 1 141 ? 10.822  16.456  -5.370  1.00 20.97 ? 177 SER A CA    1 
ATOM   1069 C  C     . SER A 1 141 ? 11.434  15.081  -5.236  1.00 21.49 ? 177 SER A C     1 
ATOM   1070 O  O     . SER A 1 141 ? 11.145  14.188  -6.024  1.00 19.37 ? 177 SER A O     1 
ATOM   1071 C  CB    . SER A 1 141 ? 11.842  17.385  -6.018  1.00 21.02 ? 177 SER A CB    1 
ATOM   1072 O  OG    . SER A 1 141 ? 11.227  18.597  -6.382  1.00 22.54 ? 177 SER A OG    1 
ATOM   1073 N  N     . TYR A 1 142 ? 12.300  14.915  -4.244  1.00 17.90 ? 178 TYR A N     1 
ATOM   1074 C  CA    . TYR A 1 142 ? 12.861  13.597  -3.988  1.00 18.71 ? 178 TYR A CA    1 
ATOM   1075 C  C     . TYR A 1 142 ? 11.791  12.542  -3.665  1.00 19.67 ? 178 TYR A C     1 
ATOM   1076 O  O     . TYR A 1 142 ? 11.897  11.376  -4.084  1.00 21.29 ? 178 TYR A O     1 
ATOM   1077 C  CB    . TYR A 1 142 ? 13.930  13.689  -2.885  1.00 18.75 ? 178 TYR A CB    1 
ATOM   1078 C  CG    . TYR A 1 142 ? 15.271  14.128  -3.425  1.00 19.69 ? 178 TYR A CG    1 
ATOM   1079 C  CD1   . TYR A 1 142 ? 15.962  13.336  -4.337  1.00 19.18 ? 178 TYR A CD1   1 
ATOM   1080 C  CD2   . TYR A 1 142 ? 15.830  15.344  -3.047  1.00 21.26 ? 178 TYR A CD2   1 
ATOM   1081 C  CE1   . TYR A 1 142 ? 17.186  13.738  -4.844  1.00 19.13 ? 178 TYR A CE1   1 
ATOM   1082 C  CE2   . TYR A 1 142 ? 17.048  15.758  -3.543  1.00 22.02 ? 178 TYR A CE2   1 
ATOM   1083 C  CZ    . TYR A 1 142 ? 17.722  14.953  -4.438  1.00 23.28 ? 178 TYR A CZ    1 
ATOM   1084 O  OH    . TYR A 1 142 ? 18.940  15.381  -4.919  1.00 24.02 ? 178 TYR A OH    1 
ATOM   1085 N  N     . THR A 1 143 ? 10.746  12.931  -2.951  1.00 19.06 ? 179 THR A N     1 
ATOM   1086 C  CA    . THR A 1 143 ? 9.724   11.936  -2.591  1.00 18.87 ? 179 THR A CA    1 
ATOM   1087 C  C     . THR A 1 143 ? 8.930   11.520  -3.817  1.00 21.29 ? 179 THR A C     1 
ATOM   1088 O  O     . THR A 1 143 ? 8.444   10.389  -3.899  1.00 25.56 ? 179 THR A O     1 
ATOM   1089 C  CB    . THR A 1 143 ? 8.782   12.445  -1.499  1.00 25.66 ? 179 THR A CB    1 
ATOM   1090 O  OG1   . THR A 1 143 ? 7.987   13.518  -2.018  1.00 34.17 ? 179 THR A OG1   1 
ATOM   1091 C  CG2   . THR A 1 143 ? 9.579   12.966  -0.326  1.00 21.20 ? 179 THR A CG2   1 
ATOM   1092 N  N     . LYS A 1 144 ? 8.807   12.441  -4.772  1.00 23.52 ? 180 LYS A N     1 
ATOM   1093 C  CA    . LYS A 1 144 ? 8.160   12.150  -6.055  1.00 22.00 ? 180 LYS A CA    1 
ATOM   1094 C  C     . LYS A 1 144 ? 9.061   11.358  -6.991  1.00 26.98 ? 180 LYS A C     1 
ATOM   1095 O  O     . LYS A 1 144 ? 8.576   10.661  -7.877  1.00 30.17 ? 180 LYS A O     1 
ATOM   1096 C  CB    . LYS A 1 144 ? 7.710   13.451  -6.743  1.00 23.20 ? 180 LYS A CB    1 
ATOM   1097 C  CG    . LYS A 1 144 ? 6.552   14.135  -6.026  1.00 28.39 ? 180 LYS A CG    1 
ATOM   1098 C  CD    . LYS A 1 144 ? 6.108   15.383  -6.780  1.00 35.40 ? 180 LYS A CD    1 
ATOM   1099 C  CE    . LYS A 1 144 ? 5.201   16.246  -5.915  1.00 39.71 ? 180 LYS A CE    1 
ATOM   1100 N  NZ    . LYS A 1 144 ? 4.866   17.536  -6.590  1.00 44.76 ? 180 LYS A NZ    1 
ATOM   1101 N  N     . LEU A 1 145 ? 10.372  11.458  -6.785  1.00 22.94 ? 181 LEU A N     1 
ATOM   1102 C  CA    . LEU A 1 145 ? 11.346  10.736  -7.601  1.00 22.13 ? 181 LEU A CA    1 
ATOM   1103 C  C     . LEU A 1 145 ? 11.403  9.242   -7.342  1.00 29.36 ? 181 LEU A C     1 
ATOM   1104 O  O     . LEU A 1 145 ? 11.617  8.465   -8.270  1.00 30.11 ? 181 LEU A O     1 
ATOM   1105 C  CB    . LEU A 1 145 ? 12.752  11.292  -7.398  1.00 25.80 ? 181 LEU A CB    1 
ATOM   1106 C  CG    . LEU A 1 145 ? 13.226  12.290  -8.438  1.00 33.79 ? 181 LEU A CG    1 
ATOM   1107 C  CD1   . LEU A 1 145 ? 14.677  12.660  -8.168  1.00 32.02 ? 181 LEU A CD1   1 
ATOM   1108 C  CD2   . LEU A 1 145 ? 13.048  11.685  -9.829  1.00 36.51 ? 181 LEU A CD2   1 
ATOM   1109 N  N     . ASP A 1 146 ? 11.252  8.822   -6.090  1.00 21.92 ? 182 ASP A N     1 
ATOM   1110 C  CA    . ASP A 1 146 ? 11.396  7.396   -5.810  1.00 24.87 ? 182 ASP A CA    1 
ATOM   1111 C  C     . ASP A 1 146 ? 10.461  6.969   -4.711  1.00 21.66 ? 182 ASP A C     1 
ATOM   1112 O  O     . ASP A 1 146 ? 10.421  7.563   -3.625  1.00 21.88 ? 182 ASP A O     1 
ATOM   1113 C  CB    . ASP A 1 146 ? 12.847  7.022   -5.474  1.00 26.04 ? 182 ASP A CB    1 
ATOM   1114 C  CG    . ASP A 1 146 ? 13.111  5.519   -5.575  1.00 31.02 ? 182 ASP A CG    1 
ATOM   1115 O  OD1   . ASP A 1 146 ? 12.649  4.747   -4.691  1.00 27.40 ? 182 ASP A OD1   1 
ATOM   1116 O  OD2   . ASP A 1 146 ? 13.795  5.103   -6.544  1.00 32.24 ? 182 ASP A OD2   1 
ATOM   1117 N  N     . ALA A 1 147 ? 9.686   5.941   -5.022  1.00 20.41 ? 183 ALA A N     1 
ATOM   1118 C  CA    . ALA A 1 147 ? 8.629   5.448   -4.155  1.00 23.78 ? 183 ALA A CA    1 
ATOM   1119 C  C     . ALA A 1 147 ? 9.146   4.874   -2.841  1.00 23.84 ? 183 ALA A C     1 
ATOM   1120 O  O     . ALA A 1 147 ? 8.380   4.722   -1.879  1.00 22.22 ? 183 ALA A O     1 
ATOM   1121 C  CB    . ALA A 1 147 ? 7.802   4.398   -4.903  1.00 24.14 ? 183 ALA A CB    1 
ATOM   1122 N  N     . ARG A 1 148 ? 10.428  4.522   -2.798  1.00 17.94 ? 184 ARG A N     1 
ATOM   1123 C  CA    . ARG A 1 148 ? 10.997  3.927   -1.585  1.00 19.92 ? 184 ARG A CA    1 
ATOM   1124 C  C     . ARG A 1 148 ? 11.368  4.975   -0.545  1.00 19.39 ? 184 ARG A C     1 
ATOM   1125 O  O     . ARG A 1 148 ? 11.580  4.645   0.620   1.00 18.38 ? 184 ARG A O     1 
ATOM   1126 C  CB    . ARG A 1 148 ? 12.234  3.093   -1.938  1.00 21.25 ? 184 ARG A CB    1 
ATOM   1127 C  CG    . ARG A 1 148 ? 11.893  1.832   -2.747  1.00 22.31 ? 184 ARG A CG    1 
ATOM   1128 C  CD    . ARG A 1 148 ? 13.132  1.177   -3.337  1.00 20.79 ? 184 ARG A CD    1 
ATOM   1129 N  NE    . ARG A 1 148 ? 13.761  2.035   -4.333  1.00 22.76 ? 184 ARG A NE    1 
ATOM   1130 C  CZ    . ARG A 1 148 ? 14.924  1.762   -4.918  1.00 26.07 ? 184 ARG A CZ    1 
ATOM   1131 N  NH1   . ARG A 1 148 ? 15.570  0.648   -4.602  1.00 24.16 ? 184 ARG A NH1   1 
ATOM   1132 N  NH2   . ARG A 1 148 ? 15.440  2.603   -5.812  1.00 24.53 ? 184 ARG A NH2   1 
ATOM   1133 N  N     . LEU A 1 149 ? 11.455  6.232   -0.956  1.00 18.47 ? 185 LEU A N     1 
ATOM   1134 C  CA    . LEU A 1 149 ? 11.929  7.290   -0.040  1.00 18.81 ? 185 LEU A CA    1 
ATOM   1135 C  C     . LEU A 1 149 ? 10.965  7.551   1.108   1.00 18.81 ? 185 LEU A C     1 
ATOM   1136 O  O     . LEU A 1 149 ? 11.367  7.622   2.278   1.00 17.71 ? 185 LEU A O     1 
ATOM   1137 C  CB    . LEU A 1 149 ? 12.229  8.603   -0.777  1.00 18.15 ? 185 LEU A CB    1 
ATOM   1138 C  CG    . LEU A 1 149 ? 12.687  9.753   0.149   1.00 19.99 ? 185 LEU A CG    1 
ATOM   1139 C  CD1   . LEU A 1 149 ? 13.970  9.366   0.876   1.00 19.01 ? 185 LEU A CD1   1 
ATOM   1140 C  CD2   . LEU A 1 149 ? 12.896  11.031  -0.619  1.00 17.56 ? 185 LEU A CD2   1 
ATOM   1141 N  N     . LYS A 1 150 ? 9.686   7.696   0.787   1.00 20.39 ? 186 LYS A N     1 
ATOM   1142 C  CA    . LYS A 1 150 ? 8.700   7.988   1.822   1.00 20.36 ? 186 LYS A CA    1 
ATOM   1143 C  C     . LYS A 1 150 ? 8.681   6.971   2.970   1.00 18.02 ? 186 LYS A C     1 
ATOM   1144 O  O     . LYS A 1 150 ? 8.819   7.367   4.134   1.00 16.85 ? 186 LYS A O     1 
ATOM   1145 C  CB    . LYS A 1 150 ? 7.305   8.191   1.217   1.00 22.86 ? 186 LYS A CB    1 
ATOM   1146 C  CG    . LYS A 1 150 ? 6.200   8.434   2.244   1.00 24.56 ? 186 LYS A CG    1 
ATOM   1147 C  CD    . LYS A 1 150 ? 4.850   8.571   1.525   1.00 32.42 ? 186 LYS A CD    1 
ATOM   1148 C  CE    . LYS A 1 150 ? 3.702   8.795   2.497   1.00 38.43 ? 186 LYS A CE    1 
ATOM   1149 N  NZ    . LYS A 1 150 ? 2.376   8.569   1.826   1.00 41.49 ? 186 LYS A NZ    1 
ATOM   1150 N  N     . PRO A 1 151 ? 8.517   5.659   2.666   1.00 17.20 ? 187 PRO A N     1 
ATOM   1151 C  CA    . PRO A 1 151 ? 8.534   4.741   3.806   1.00 22.13 ? 187 PRO A CA    1 
ATOM   1152 C  C     . PRO A 1 151 ? 9.876   4.725   4.531   1.00 21.37 ? 187 PRO A C     1 
ATOM   1153 O  O     . PRO A 1 151 ? 9.891   4.584   5.757   1.00 18.48 ? 187 PRO A O     1 
ATOM   1154 C  CB    . PRO A 1 151 ? 8.233   3.365   3.181   1.00 17.80 ? 187 PRO A CB    1 
ATOM   1155 C  CG    . PRO A 1 151 ? 8.562   3.512   1.710   1.00 19.40 ? 187 PRO A CG    1 
ATOM   1156 C  CD    . PRO A 1 151 ? 8.217   4.962   1.402   1.00 18.96 ? 187 PRO A CD    1 
ATOM   1157 N  N     . MET A 1 152 ? 10.980  4.879   3.811   1.00 17.71 ? 188 MET A N     1 
ATOM   1158 C  CA    . MET A 1 152 ? 12.274  4.861   4.487   1.00 18.12 ? 188 MET A CA    1 
ATOM   1159 C  C     . MET A 1 152 ? 12.390  6.008   5.489   1.00 19.06 ? 188 MET A C     1 
ATOM   1160 O  O     . MET A 1 152 ? 12.867  5.820   6.625   1.00 14.84 ? 188 MET A O     1 
ATOM   1161 C  CB    . MET A 1 152 ? 13.410  4.934   3.472   1.00 18.84 ? 188 MET A CB    1 
ATOM   1162 C  CG    . MET A 1 152 ? 14.781  4.786   4.112   1.00 22.41 ? 188 MET A CG    1 
ATOM   1163 S  SD    . MET A 1 152 ? 16.025  4.824   2.822   1.00 23.83 ? 188 MET A SD    1 
ATOM   1164 C  CE    . MET A 1 152 ? 17.473  4.558   3.848   1.00 19.45 ? 188 MET A CE    1 
ATOM   1165 N  N     . VAL A 1 153 ? 11.934  7.190   5.081   1.00 16.41 ? 189 VAL A N     1 
ATOM   1166 C  CA    . VAL A 1 153 ? 11.967  8.359   5.956   1.00 16.81 ? 189 VAL A CA    1 
ATOM   1167 C  C     . VAL A 1 153 ? 11.079  8.211   7.187   1.00 18.25 ? 189 VAL A C     1 
ATOM   1168 O  O     . VAL A 1 153 ? 11.494  8.558   8.299   1.00 16.98 ? 189 VAL A O     1 
ATOM   1169 C  CB    . VAL A 1 153 ? 11.617  9.638   5.185   1.00 18.58 ? 189 VAL A CB    1 
ATOM   1170 C  CG1   . VAL A 1 153 ? 11.350  10.818  6.140   1.00 19.16 ? 189 VAL A CG1   1 
ATOM   1171 C  CG2   . VAL A 1 153 ? 12.760  9.970   4.219   1.00 19.52 ? 189 VAL A CG2   1 
ATOM   1172 N  N     . LEU A 1 154 ? 9.850   7.730   6.993   1.00 14.57 ? 190 LEU A N     1 
ATOM   1173 C  CA    . LEU A 1 154 ? 8.938   7.548   8.114   1.00 16.96 ? 190 LEU A CA    1 
ATOM   1174 C  C     . LEU A 1 154 ? 9.493   6.534   9.108   1.00 17.97 ? 190 LEU A C     1 
ATOM   1175 O  O     . LEU A 1 154 ? 9.358   6.712   10.321  1.00 17.80 ? 190 LEU A O     1 
ATOM   1176 C  CB    . LEU A 1 154 ? 7.554   7.077   7.639   1.00 19.21 ? 190 LEU A CB    1 
ATOM   1177 C  CG    . LEU A 1 154 ? 6.757   8.019   6.741   1.00 20.92 ? 190 LEU A CG    1 
ATOM   1178 C  CD1   . LEU A 1 154 ? 5.283   7.681   6.888   1.00 24.79 ? 190 LEU A CD1   1 
ATOM   1179 C  CD2   . LEU A 1 154 ? 7.001   9.453   7.105   1.00 24.64 ? 190 LEU A CD2   1 
ATOM   1180 N  N     . LEU A 1 155 ? 10.103  5.466   8.607   1.00 16.60 ? 191 LEU A N     1 
ATOM   1181 C  CA    . LEU A 1 155 ? 10.607  4.426   9.502   1.00 16.56 ? 191 LEU A CA    1 
ATOM   1182 C  C     . LEU A 1 155 ? 11.792  4.941   10.297  1.00 16.46 ? 191 LEU A C     1 
ATOM   1183 O  O     . LEU A 1 155 ? 11.925  4.652   11.480  1.00 17.28 ? 191 LEU A O     1 
ATOM   1184 C  CB    . LEU A 1 155 ? 10.972  3.143   8.733   1.00 14.91 ? 191 LEU A CB    1 
ATOM   1185 C  CG    . LEU A 1 155 ? 9.755   2.448   8.120   1.00 20.25 ? 191 LEU A CG    1 
ATOM   1186 C  CD1   . LEU A 1 155 ? 10.152  1.382   7.112   1.00 24.28 ? 191 LEU A CD1   1 
ATOM   1187 C  CD2   . LEU A 1 155 ? 8.879   1.824   9.206   1.00 21.74 ? 191 LEU A CD2   1 
ATOM   1188 N  N     . VAL A 1 156 ? 12.647  5.733   9.656   1.00 17.76 ? 192 VAL A N     1 
ATOM   1189 C  CA    . VAL A 1 156 ? 13.788  6.317   10.359  1.00 15.35 ? 192 VAL A CA    1 
ATOM   1190 C  C     . VAL A 1 156 ? 13.305  7.333   11.399  1.00 15.43 ? 192 VAL A C     1 
ATOM   1191 O  O     . VAL A 1 156 ? 13.813  7.378   12.522  1.00 16.28 ? 192 VAL A O     1 
ATOM   1192 C  CB    . VAL A 1 156 ? 14.771  6.966   9.364   1.00 14.65 ? 192 VAL A CB    1 
ATOM   1193 C  CG1   . VAL A 1 156 ? 15.815  7.834   10.110  1.00 17.49 ? 192 VAL A CG1   1 
ATOM   1194 C  CG2   . VAL A 1 156 ? 15.462  5.895   8.560   1.00 15.44 ? 192 VAL A CG2   1 
ATOM   1195 N  N     . LYS A 1 157 ? 12.317  8.144   11.032  1.00 16.59 ? 193 LYS A N     1 
ATOM   1196 C  CA    . LYS A 1 157 ? 11.750  9.094   11.988  1.00 18.17 ? 193 LYS A CA    1 
ATOM   1197 C  C     . LYS A 1 157 ? 11.135  8.389   13.193  1.00 18.32 ? 193 LYS A C     1 
ATOM   1198 O  O     . LYS A 1 157 ? 11.282  8.830   14.338  1.00 21.38 ? 193 LYS A O     1 
ATOM   1199 C  CB    . LYS A 1 157 ? 10.686  9.959   11.325  1.00 13.71 ? 193 LYS A CB    1 
ATOM   1200 C  CG    . LYS A 1 157 ? 11.233  11.081  10.446  1.00 19.96 ? 193 LYS A CG    1 
ATOM   1201 C  CD    . LYS A 1 157 ? 10.061  11.858  9.882   1.00 22.19 ? 193 LYS A CD    1 
ATOM   1202 C  CE    . LYS A 1 157 ? 10.478  13.047  9.026   1.00 27.17 ? 193 LYS A CE    1 
ATOM   1203 N  NZ    . LYS A 1 157 ? 9.259   13.887  8.739   1.00 30.45 ? 193 LYS A NZ    1 
ATOM   1204 N  N     . HIS A 1 158 ? 10.419  7.309   12.919  1.00 17.42 ? 194 HIS A N     1 
ATOM   1205 C  CA    . HIS A 1 158 ? 9.745   6.516   13.959  1.00 19.15 ? 194 HIS A CA    1 
ATOM   1206 C  C     . HIS A 1 158 ? 10.787  5.889   14.901  1.00 20.10 ? 194 HIS A C     1 
ATOM   1207 O  O     . HIS A 1 158 ? 10.668  5.944   16.132  1.00 21.75 ? 194 HIS A O     1 
ATOM   1208 C  CB    . HIS A 1 158 ? 8.894   5.444   13.260  1.00 20.29 ? 194 HIS A CB    1 
ATOM   1209 C  CG    . HIS A 1 158 ? 8.067   4.603   14.182  1.00 25.52 ? 194 HIS A CG    1 
ATOM   1210 N  ND1   . HIS A 1 158 ? 7.151   5.134   15.068  1.00 29.48 ? 194 HIS A ND1   1 
ATOM   1211 C  CD2   . HIS A 1 158 ? 7.985   3.258   14.316  1.00 25.84 ? 194 HIS A CD2   1 
ATOM   1212 C  CE1   . HIS A 1 158 ? 6.553   4.151   15.721  1.00 30.20 ? 194 HIS A CE1   1 
ATOM   1213 N  NE2   . HIS A 1 158 ? 7.043   3.003   15.285  1.00 28.24 ? 194 HIS A NE2   1 
ATOM   1214 N  N     . TRP A 1 159 ? 11.815  5.297   14.316  1.00 16.04 ? 195 TRP A N     1 
ATOM   1215 C  CA    . TRP A 1 159 ? 12.954  4.772   15.063  1.00 18.44 ? 195 TRP A CA    1 
ATOM   1216 C  C     . TRP A 1 159 ? 13.622  5.847   15.923  1.00 21.69 ? 195 TRP A C     1 
ATOM   1217 O  O     . TRP A 1 159 ? 13.877  5.624   17.102  1.00 24.53 ? 195 TRP A O     1 
ATOM   1218 C  CB    . TRP A 1 159 ? 13.956  4.174   14.073  1.00 19.96 ? 195 TRP A CB    1 
ATOM   1219 C  CG    . TRP A 1 159 ? 15.329  3.851   14.598  1.00 19.94 ? 195 TRP A CG    1 
ATOM   1220 C  CD1   . TRP A 1 159 ? 15.698  2.746   15.315  1.00 20.11 ? 195 TRP A CD1   1 
ATOM   1221 C  CD2   . TRP A 1 159 ? 16.531  4.601   14.372  1.00 18.64 ? 195 TRP A CD2   1 
ATOM   1222 N  NE1   . TRP A 1 159 ? 17.049  2.777   15.568  1.00 23.83 ? 195 TRP A NE1   1 
ATOM   1223 C  CE2   . TRP A 1 159 ? 17.585  3.902   14.998  1.00 22.30 ? 195 TRP A CE2   1 
ATOM   1224 C  CE3   . TRP A 1 159 ? 16.818  5.792   13.693  1.00 20.57 ? 195 TRP A CE3   1 
ATOM   1225 C  CZ2   . TRP A 1 159 ? 18.909  4.366   14.982  1.00 22.87 ? 195 TRP A CZ2   1 
ATOM   1226 C  CZ3   . TRP A 1 159 ? 18.133  6.257   13.678  1.00 22.08 ? 195 TRP A CZ3   1 
ATOM   1227 C  CH2   . TRP A 1 159 ? 19.163  5.533   14.315  1.00 19.81 ? 195 TRP A CH2   1 
ATOM   1228 N  N     . ALA A 1 160 ? 13.922  7.005   15.350  1.00 20.98 ? 196 ALA A N     1 
ATOM   1229 C  CA    . ALA A 1 160 ? 14.610  8.031   16.130  1.00 20.90 ? 196 ALA A CA    1 
ATOM   1230 C  C     . ALA A 1 160 ? 13.747  8.465   17.323  1.00 21.58 ? 196 ALA A C     1 
ATOM   1231 O  O     . ALA A 1 160 ? 14.258  8.691   18.423  1.00 25.35 ? 196 ALA A O     1 
ATOM   1232 C  CB    . ALA A 1 160 ? 14.986  9.231   15.262  1.00 19.70 ? 196 ALA A CB    1 
ATOM   1233 N  N     . LYS A 1 161 ? 12.447  8.586   17.092  1.00 19.64 ? 197 LYS A N     1 
ATOM   1234 C  CA    . LYS A 1 161 ? 11.518  8.978   18.152  1.00 25.64 ? 197 LYS A CA    1 
ATOM   1235 C  C     . LYS A 1 161 ? 11.496  7.911   19.251  1.00 26.44 ? 197 LYS A C     1 
ATOM   1236 O  O     . LYS A 1 161 ? 11.598  8.226   20.439  1.00 24.42 ? 197 LYS A O     1 
ATOM   1237 C  CB    . LYS A 1 161 ? 10.117  9.200   17.575  1.00 26.69 ? 197 LYS A CB    1 
ATOM   1238 C  CG    . LYS A 1 161 ? 9.091   9.751   18.573  1.00 37.67 ? 197 LYS A CG    1 
ATOM   1239 C  CD    . LYS A 1 161 ? 7.646   9.604   18.058  1.00 44.04 ? 197 LYS A CD    1 
ATOM   1240 C  CE    . LYS A 1 161 ? 7.457   10.233  16.674  1.00 48.80 ? 197 LYS A CE    1 
ATOM   1241 N  NZ    . LYS A 1 161 ? 6.028   10.175  16.215  1.00 50.06 ? 197 LYS A NZ    1 
ATOM   1242 N  N     . ARG A 1 162 ? 11.391  6.645   18.857  1.00 23.44 ? 198 ARG A N     1 
ATOM   1243 C  CA    . ARG A 1 162 ? 11.284  5.572   19.836  1.00 27.18 ? 198 ARG A CA    1 
ATOM   1244 C  C     . ARG A 1 162 ? 12.573  5.429   20.638  1.00 28.70 ? 198 ARG A C     1 
ATOM   1245 O  O     . ARG A 1 162 ? 12.540  5.138   21.840  1.00 30.93 ? 198 ARG A O     1 
ATOM   1246 C  CB    . ARG A 1 162 ? 10.897  4.246   19.150  1.00 25.10 ? 198 ARG A CB    1 
ATOM   1247 C  CG    . ARG A 1 162 ? 9.448   4.218   18.655  1.00 24.92 ? 198 ARG A CG    1 
ATOM   1248 C  CD    . ARG A 1 162 ? 8.475   4.008   19.833  1.00 31.09 ? 198 ARG A CD    1 
ATOM   1249 N  NE    . ARG A 1 162 ? 7.065   4.059   19.445  1.00 32.88 ? 198 ARG A NE    1 
ATOM   1250 C  CZ    . ARG A 1 162 ? 6.366   3.008   19.025  1.00 34.34 ? 198 ARG A CZ    1 
ATOM   1251 N  NH1   . ARG A 1 162 ? 6.948   1.819   18.929  1.00 33.43 ? 198 ARG A NH1   1 
ATOM   1252 N  NH2   . ARG A 1 162 ? 5.086   3.145   18.698  1.00 33.79 ? 198 ARG A NH2   1 
ATOM   1253 N  N     . LYS A 1 163 ? 13.711  5.663   19.989  1.00 22.77 ? 199 LYS A N     1 
ATOM   1254 C  CA    . LYS A 1 163 ? 14.995  5.553   20.679  1.00 27.03 ? 199 LYS A CA    1 
ATOM   1255 C  C     . LYS A 1 163 ? 15.412  6.830   21.419  1.00 23.79 ? 199 LYS A C     1 
ATOM   1256 O  O     . LYS A 1 163 ? 16.524  6.906   21.950  1.00 27.60 ? 199 LYS A O     1 
ATOM   1257 C  CB    . LYS A 1 163 ? 16.103  5.127   19.704  1.00 26.56 ? 199 LYS A CB    1 
ATOM   1258 C  CG    . LYS A 1 163 ? 15.838  3.814   18.979  1.00 25.75 ? 199 LYS A CG    1 
ATOM   1259 C  CD    . LYS A 1 163 ? 15.472  2.696   19.932  1.00 28.10 ? 199 LYS A CD    1 
ATOM   1260 C  CE    . LYS A 1 163 ? 15.434  1.361   19.188  1.00 25.87 ? 199 LYS A CE    1 
ATOM   1261 N  NZ    . LYS A 1 163 ? 15.058  0.238   20.104  1.00 31.93 ? 199 LYS A NZ    1 
ATOM   1262 N  N     . GLN A 1 164 ? 14.535  7.826   21.444  1.00 24.61 ? 200 GLN A N     1 
ATOM   1263 C  CA    . GLN A 1 164 ? 14.819  9.093   22.126  1.00 27.94 ? 200 GLN A CA    1 
ATOM   1264 C  C     . GLN A 1 164 ? 16.043  9.818   21.596  1.00 31.40 ? 200 GLN A C     1 
ATOM   1265 O  O     . GLN A 1 164 ? 16.785  10.426  22.374  1.00 31.24 ? 200 GLN A O     1 
ATOM   1266 C  CB    . GLN A 1 164 ? 15.017  8.892   23.633  1.00 37.19 ? 200 GLN A CB    1 
ATOM   1267 C  CG    . GLN A 1 164 ? 13.899  9.422   24.487  1.00 43.77 ? 200 GLN A CG    1 
ATOM   1268 C  CD    . GLN A 1 164 ? 12.877  8.366   24.765  1.00 49.65 ? 200 GLN A CD    1 
ATOM   1269 O  OE1   . GLN A 1 164 ? 12.674  7.460   23.949  1.00 48.88 ? 200 GLN A OE1   1 
ATOM   1270 N  NE2   . GLN A 1 164 ? 12.232  8.452   25.928  1.00 47.52 ? 200 GLN A NE2   1 
ATOM   1271 N  N     . ILE A 1 165 ? 16.260  9.779   20.284  1.00 27.84 ? 201 ILE A N     1 
ATOM   1272 C  CA    . ILE A 1 165 ? 17.376  10.532  19.705  1.00 22.28 ? 201 ILE A CA    1 
ATOM   1273 C  C     . ILE A 1 165 ? 16.864  11.582  18.715  1.00 22.08 ? 201 ILE A C     1 
ATOM   1274 O  O     . ILE A 1 165 ? 17.600  12.046  17.838  1.00 23.43 ? 201 ILE A O     1 
ATOM   1275 C  CB    . ILE A 1 165 ? 18.389  9.593   19.030  1.00 25.16 ? 201 ILE A CB    1 
ATOM   1276 C  CG1   . ILE A 1 165 ? 17.680  8.679   18.031  1.00 24.41 ? 201 ILE A CG1   1 
ATOM   1277 C  CG2   . ILE A 1 165 ? 19.148  8.757   20.095  1.00 26.24 ? 201 ILE A CG2   1 
ATOM   1278 C  CD1   . ILE A 1 165 ? 18.622  7.667   17.356  1.00 23.65 ? 201 ILE A CD1   1 
ATOM   1279 N  N     . ASN A 1 166 ? 15.596  11.944  18.880  1.00 24.16 ? 202 ASN A N     1 
ATOM   1280 C  CA    . ASN A 1 166 ? 14.913  12.910  18.023  1.00 26.83 ? 202 ASN A CA    1 
ATOM   1281 C  C     . ASN A 1 166 ? 14.496  14.157  18.818  1.00 25.63 ? 202 ASN A C     1 
ATOM   1282 O  O     . ASN A 1 166 ? 13.411  14.707  18.613  1.00 29.60 ? 202 ASN A O     1 
ATOM   1283 C  CB    . ASN A 1 166 ? 13.700  12.223  17.385  1.00 24.59 ? 202 ASN A CB    1 
ATOM   1284 C  CG    . ASN A 1 166 ? 12.963  13.096  16.385  1.00 28.20 ? 202 ASN A CG    1 
ATOM   1285 O  OD1   . ASN A 1 166 ? 11.744  12.974  16.230  1.00 30.11 ? 202 ASN A OD1   1 
ATOM   1286 N  ND2   . ASN A 1 166 ? 13.685  13.989  15.715  1.00 27.00 ? 202 ASN A ND2   1 
ATOM   1287 N  N     . SER A 1 167 ? 15.372  14.610  19.715  1.00 25.10 ? 203 SER A N     1 
ATOM   1288 C  CA    . SER A 1 167 ? 15.056  15.727  20.613  1.00 31.63 ? 203 SER A CA    1 
ATOM   1289 C  C     . SER A 1 167 ? 16.096  16.852  20.563  1.00 30.73 ? 203 SER A C     1 
ATOM   1290 O  O     . SER A 1 167 ? 17.019  16.889  21.386  1.00 29.21 ? 203 SER A O     1 
ATOM   1291 C  CB    . SER A 1 167 ? 14.906  15.238  22.054  1.00 29.61 ? 203 SER A CB    1 
ATOM   1292 O  OG    . SER A 1 167 ? 13.708  14.504  22.226  1.00 39.49 ? 203 SER A OG    1 
ATOM   1293 N  N     . PRO A 1 168 ? 15.929  17.782  19.604  1.00 27.93 ? 204 PRO A N     1 
ATOM   1294 C  CA    . PRO A 1 168 ? 16.908  18.851  19.365  1.00 31.90 ? 204 PRO A CA    1 
ATOM   1295 C  C     . PRO A 1 168 ? 17.070  19.717  20.611  1.00 36.02 ? 204 PRO A C     1 
ATOM   1296 O  O     . PRO A 1 168 ? 18.180  20.170  20.903  1.00 38.01 ? 204 PRO A O     1 
ATOM   1297 C  CB    . PRO A 1 168 ? 16.289  19.670  18.214  1.00 26.51 ? 204 PRO A CB    1 
ATOM   1298 C  CG    . PRO A 1 168 ? 15.179  18.826  17.661  1.00 35.92 ? 204 PRO A CG    1 
ATOM   1299 C  CD    . PRO A 1 168 ? 14.716  17.931  18.778  1.00 24.92 ? 204 PRO A CD    1 
ATOM   1300 N  N     . TYR A 1 169 ? 15.984  19.900  21.359  1.00 33.54 ? 205 TYR A N     1 
ATOM   1301 C  CA    . TYR A 1 169 ? 16.035  20.689  22.587  1.00 38.04 ? 205 TYR A CA    1 
ATOM   1302 C  C     . TYR A 1 169 ? 16.784  19.976  23.708  1.00 42.03 ? 205 TYR A C     1 
ATOM   1303 O  O     . TYR A 1 169 ? 17.199  20.614  24.677  1.00 46.79 ? 205 TYR A O     1 
ATOM   1304 C  CB    . TYR A 1 169 ? 14.623  21.086  23.029  1.00 44.35 ? 205 TYR A CB    1 
ATOM   1305 C  CG    . TYR A 1 169 ? 13.982  22.090  22.101  1.00 49.05 ? 205 TYR A CG    1 
ATOM   1306 C  CD1   . TYR A 1 169 ? 13.258  21.677  20.982  1.00 45.55 ? 205 TYR A CD1   1 
ATOM   1307 C  CD2   . TYR A 1 169 ? 14.115  23.452  22.331  1.00 48.67 ? 205 TYR A CD2   1 
ATOM   1308 C  CE1   . TYR A 1 169 ? 12.682  22.595  20.125  1.00 49.56 ? 205 TYR A CE1   1 
ATOM   1309 C  CE2   . TYR A 1 169 ? 13.544  24.376  21.485  1.00 51.01 ? 205 TYR A CE2   1 
ATOM   1310 C  CZ    . TYR A 1 169 ? 12.827  23.945  20.384  1.00 55.99 ? 205 TYR A CZ    1 
ATOM   1311 O  OH    . TYR A 1 169 ? 12.259  24.873  19.541  1.00 59.61 ? 205 TYR A OH    1 
ATOM   1312 N  N     . PHE A 1 170 ? 16.976  18.664  23.560  1.00 37.11 ? 206 PHE A N     1 
ATOM   1313 C  CA    . PHE A 1 170 ? 17.646  17.846  24.577  1.00 39.39 ? 206 PHE A CA    1 
ATOM   1314 C  C     . PHE A 1 170 ? 18.945  17.202  24.095  1.00 39.30 ? 206 PHE A C     1 
ATOM   1315 O  O     . PHE A 1 170 ? 19.346  16.146  24.595  1.00 38.63 ? 206 PHE A O     1 
ATOM   1316 C  CB    . PHE A 1 170 ? 16.715  16.741  25.096  1.00 43.82 ? 206 PHE A CB    1 
ATOM   1317 C  CG    . PHE A 1 170 ? 15.569  17.240  25.929  1.00 49.48 ? 206 PHE A CG    1 
ATOM   1318 C  CD1   . PHE A 1 170 ? 15.500  18.567  26.338  1.00 49.50 ? 206 PHE A CD1   1 
ATOM   1319 C  CD2   . PHE A 1 170 ? 14.563  16.367  26.319  1.00 52.04 ? 206 PHE A CD2   1 
ATOM   1320 C  CE1   . PHE A 1 170 ? 14.442  19.015  27.112  1.00 51.96 ? 206 PHE A CE1   1 
ATOM   1321 C  CE2   . PHE A 1 170 ? 13.500  16.802  27.093  1.00 51.78 ? 206 PHE A CE2   1 
ATOM   1322 C  CZ    . PHE A 1 170 ? 13.437  18.128  27.488  1.00 58.78 ? 206 PHE A CZ    1 
ATOM   1323 N  N     . GLY A 1 171 ? 19.602  17.823  23.122  1.00 30.98 ? 207 GLY A N     1 
ATOM   1324 C  CA    . GLY A 1 171 ? 20.917  17.373  22.710  1.00 31.03 ? 207 GLY A CA    1 
ATOM   1325 C  C     . GLY A 1 171 ? 20.984  16.345  21.592  1.00 27.60 ? 207 GLY A C     1 
ATOM   1326 O  O     . GLY A 1 171 ? 22.074  15.878  21.260  1.00 29.79 ? 207 GLY A O     1 
ATOM   1327 N  N     . THR A 1 172 ? 19.844  15.965  21.020  1.00 27.89 ? 208 THR A N     1 
ATOM   1328 C  CA    . THR A 1 172 ? 19.909  15.111  19.831  1.00 29.99 ? 208 THR A CA    1 
ATOM   1329 C  C     . THR A 1 172 ? 19.428  15.847  18.569  1.00 26.08 ? 208 THR A C     1 
ATOM   1330 O  O     . THR A 1 172 ? 19.571  17.069  18.477  1.00 24.51 ? 208 THR A O     1 
ATOM   1331 C  CB    . THR A 1 172 ? 19.296  13.671  20.034  1.00 24.74 ? 208 THR A CB    1 
ATOM   1332 O  OG1   . THR A 1 172 ? 17.957  13.754  20.544  1.00 26.65 ? 208 THR A OG1   1 
ATOM   1333 C  CG2   . THR A 1 172 ? 20.155  12.852  20.986  1.00 26.68 ? 208 THR A CG2   1 
ATOM   1334 N  N     . LEU A 1 173 ? 18.874  15.120  17.602  1.00 26.10 ? 209 LEU A N     1 
ATOM   1335 C  CA    . LEU A 1 173 ? 18.759  15.652  16.231  1.00 21.49 ? 209 LEU A CA    1 
ATOM   1336 C  C     . LEU A 1 173 ? 17.308  15.868  15.803  1.00 22.82 ? 209 LEU A C     1 
ATOM   1337 O  O     . LEU A 1 173 ? 16.427  15.065  16.126  1.00 23.82 ? 209 LEU A O     1 
ATOM   1338 C  CB    . LEU A 1 173 ? 19.475  14.709  15.258  1.00 22.56 ? 209 LEU A CB    1 
ATOM   1339 C  CG    . LEU A 1 173 ? 19.658  15.123  13.797  1.00 19.80 ? 209 LEU A CG    1 
ATOM   1340 C  CD1   . LEU A 1 173 ? 20.489  16.413  13.695  1.00 20.61 ? 209 LEU A CD1   1 
ATOM   1341 C  CD2   . LEU A 1 173 ? 20.339  13.988  13.040  1.00 21.69 ? 209 LEU A CD2   1 
ATOM   1342 N  N     . SER A 1 174 ? 17.046  16.970  15.104  1.00 19.80 ? 210 SER A N     1 
ATOM   1343 C  CA    . SER A 1 174 ? 15.711  17.220  14.585  1.00 24.22 ? 210 SER A CA    1 
ATOM   1344 C  C     . SER A 1 174 ? 15.358  16.187  13.528  1.00 19.95 ? 210 SER A C     1 
ATOM   1345 O  O     . SER A 1 174 ? 16.243  15.534  12.950  1.00 18.13 ? 210 SER A O     1 
ATOM   1346 C  CB    . SER A 1 174 ? 15.620  18.613  13.972  1.00 24.83 ? 210 SER A CB    1 
ATOM   1347 O  OG    . SER A 1 174 ? 16.401  18.698  12.790  1.00 21.24 ? 210 SER A OG    1 
ATOM   1348 N  N     . SER A 1 175 ? 14.066  16.053  13.267  1.00 21.37 ? 211 SER A N     1 
ATOM   1349 C  CA    . SER A 1 175 ? 13.580  15.113  12.258  1.00 22.91 ? 211 SER A CA    1 
ATOM   1350 C  C     . SER A 1 175 ? 14.136  15.478  10.895  1.00 20.39 ? 211 SER A C     1 
ATOM   1351 O  O     . SER A 1 175 ? 14.510  14.604  10.122  1.00 16.59 ? 211 SER A O     1 
ATOM   1352 C  CB    . SER A 1 175 ? 12.049  15.108  12.232  1.00 26.60 ? 211 SER A CB    1 
ATOM   1353 O  OG    . SER A 1 175 ? 11.554  14.561  13.432  1.00 31.44 ? 211 SER A OG    1 
ATOM   1354 N  N     . TYR A 1 176 ? 14.209  16.772  10.607  1.00 19.65 ? 212 TYR A N     1 
ATOM   1355 C  CA    . TYR A 1 176 ? 14.772  17.249  9.337   1.00 20.41 ? 212 TYR A CA    1 
ATOM   1356 C  C     . TYR A 1 176 ? 16.222  16.780  9.182   1.00 19.25 ? 212 TYR A C     1 
ATOM   1357 O  O     . TYR A 1 176 ? 16.676  16.406  8.086   1.00 18.38 ? 212 TYR A O     1 
ATOM   1358 C  CB    . TYR A 1 176 ? 14.689  18.775  9.295   1.00 22.27 ? 212 TYR A CB    1 
ATOM   1359 C  CG    . TYR A 1 176 ? 15.265  19.420  8.050   1.00 22.21 ? 212 TYR A CG    1 
ATOM   1360 C  CD1   . TYR A 1 176 ? 14.799  19.085  6.777   1.00 22.43 ? 212 TYR A CD1   1 
ATOM   1361 C  CD2   . TYR A 1 176 ? 16.255  20.391  8.152   1.00 24.40 ? 212 TYR A CD2   1 
ATOM   1362 C  CE1   . TYR A 1 176 ? 15.327  19.703  5.631   1.00 23.44 ? 212 TYR A CE1   1 
ATOM   1363 C  CE2   . TYR A 1 176 ? 16.773  21.011  7.038   1.00 21.08 ? 212 TYR A CE2   1 
ATOM   1364 C  CZ    . TYR A 1 176 ? 16.313  20.665  5.781   1.00 24.01 ? 212 TYR A CZ    1 
ATOM   1365 O  OH    . TYR A 1 176 ? 16.851  21.287  4.675   1.00 21.66 ? 212 TYR A OH    1 
ATOM   1366 N  N     . GLY A 1 177 ? 16.952  16.800  10.292  1.00 19.08 ? 213 GLY A N     1 
ATOM   1367 C  CA    . GLY A 1 177 ? 18.311  16.298  10.313  1.00 18.87 ? 213 GLY A CA    1 
ATOM   1368 C  C     . GLY A 1 177 ? 18.383  14.850  9.874   1.00 17.36 ? 213 GLY A C     1 
ATOM   1369 O  O     . GLY A 1 177 ? 19.259  14.480  9.096   1.00 17.40 ? 213 GLY A O     1 
ATOM   1370 N  N     . TYR A 1 178 ? 17.467  14.018  10.357  1.00 17.51 ? 214 TYR A N     1 
ATOM   1371 C  CA    . TYR A 1 178 ? 17.481  12.617  9.945   1.00 19.84 ? 214 TYR A CA    1 
ATOM   1372 C  C     . TYR A 1 178 ? 17.127  12.459  8.472   1.00 17.05 ? 214 TYR A C     1 
ATOM   1373 O  O     . TYR A 1 178 ? 17.697  11.613  7.794   1.00 15.08 ? 214 TYR A O     1 
ATOM   1374 C  CB    . TYR A 1 178 ? 16.556  11.764  10.822  1.00 18.54 ? 214 TYR A CB    1 
ATOM   1375 C  CG    . TYR A 1 178 ? 17.157  11.487  12.180  1.00 19.94 ? 214 TYR A CG    1 
ATOM   1376 C  CD1   . TYR A 1 178 ? 16.727  12.171  13.302  1.00 18.62 ? 214 TYR A CD1   1 
ATOM   1377 C  CD2   . TYR A 1 178 ? 18.176  10.553  12.326  1.00 16.68 ? 214 TYR A CD2   1 
ATOM   1378 C  CE1   . TYR A 1 178 ? 17.300  11.928  14.553  1.00 19.46 ? 214 TYR A CE1   1 
ATOM   1379 C  CE2   . TYR A 1 178 ? 18.748  10.299  13.560  1.00 20.33 ? 214 TYR A CE2   1 
ATOM   1380 C  CZ    . TYR A 1 178 ? 18.305  10.997  14.668  1.00 22.22 ? 214 TYR A CZ    1 
ATOM   1381 O  OH    . TYR A 1 178 ? 18.881  10.755  15.895  1.00 22.82 ? 214 TYR A OH    1 
ATOM   1382 N  N     . VAL A 1 179 ? 16.188  13.259  7.982   1.00 15.00 ? 215 VAL A N     1 
ATOM   1383 C  CA    . VAL A 1 179 ? 15.827  13.218  6.563   1.00 17.49 ? 215 VAL A CA    1 
ATOM   1384 C  C     . VAL A 1 179 ? 17.034  13.527  5.690   1.00 15.96 ? 215 VAL A C     1 
ATOM   1385 O  O     . VAL A 1 179 ? 17.286  12.849  4.700   1.00 16.20 ? 215 VAL A O     1 
ATOM   1386 C  CB    . VAL A 1 179 ? 14.678  14.218  6.251   1.00 14.74 ? 215 VAL A CB    1 
ATOM   1387 C  CG1   . VAL A 1 179 ? 14.414  14.275  4.753   1.00 20.37 ? 215 VAL A CG1   1 
ATOM   1388 C  CG2   . VAL A 1 179 ? 13.432  13.787  6.964   1.00 18.21 ? 215 VAL A CG2   1 
ATOM   1389 N  N     . LEU A 1 180 ? 17.787  14.555  6.059   1.00 14.46 ? 216 LEU A N     1 
ATOM   1390 C  CA    . LEU A 1 180 ? 19.020  14.863  5.350   1.00 14.72 ? 216 LEU A CA    1 
ATOM   1391 C  C     . LEU A 1 180 ? 20.042  13.708  5.430   1.00 17.39 ? 216 LEU A C     1 
ATOM   1392 O  O     . LEU A 1 180 ? 20.735  13.424  4.461   1.00 16.82 ? 216 LEU A O     1 
ATOM   1393 C  CB    . LEU A 1 180 ? 19.615  16.176  5.864   1.00 14.54 ? 216 LEU A CB    1 
ATOM   1394 C  CG    . LEU A 1 180 ? 18.800  17.455  5.612   1.00 14.05 ? 216 LEU A CG    1 
ATOM   1395 C  CD1   . LEU A 1 180 ? 19.609  18.704  6.010   1.00 16.44 ? 216 LEU A CD1   1 
ATOM   1396 C  CD2   . LEU A 1 180 ? 18.405  17.550  4.132   1.00 18.56 ? 216 LEU A CD2   1 
ATOM   1397 N  N     . MET A 1 181 ? 20.131  13.026  6.569   1.00 14.45 ? 217 MET A N     1 
ATOM   1398 C  CA    . MET A 1 181 ? 21.070  11.899  6.663   1.00 15.42 ? 217 MET A CA    1 
ATOM   1399 C  C     . MET A 1 181 ? 20.639  10.773  5.727   1.00 16.20 ? 217 MET A C     1 
ATOM   1400 O  O     . MET A 1 181 ? 21.470  10.096  5.103   1.00 15.96 ? 217 MET A O     1 
ATOM   1401 C  CB    . MET A 1 181 ? 21.162  11.394  8.108   1.00 17.88 ? 217 MET A CB    1 
ATOM   1402 C  CG    . MET A 1 181 ? 21.951  12.355  9.005   1.00 21.24 ? 217 MET A CG    1 
ATOM   1403 S  SD    . MET A 1 181 ? 21.867  11.891  10.731  1.00 25.03 ? 217 MET A SD    1 
ATOM   1404 C  CE    . MET A 1 181 ? 22.947  10.466  10.697  1.00 19.74 ? 217 MET A CE    1 
ATOM   1405 N  N     . VAL A 1 182 ? 19.331  10.581  5.617   1.00 15.41 ? 218 VAL A N     1 
ATOM   1406 C  CA    . VAL A 1 182 ? 18.797  9.609   4.664   1.00 15.17 ? 218 VAL A CA    1 
ATOM   1407 C  C     . VAL A 1 182 ? 19.093  9.985   3.211   1.00 16.94 ? 218 VAL A C     1 
ATOM   1408 O  O     . VAL A 1 182 ? 19.606  9.166   2.446   1.00 16.57 ? 218 VAL A O     1 
ATOM   1409 C  CB    . VAL A 1 182 ? 17.276  9.401   4.847   1.00 14.78 ? 218 VAL A CB    1 
ATOM   1410 C  CG1   . VAL A 1 182 ? 16.752  8.537   3.713   1.00 17.29 ? 218 VAL A CG1   1 
ATOM   1411 C  CG2   . VAL A 1 182 ? 17.004  8.707   6.185   1.00 17.10 ? 218 VAL A CG2   1 
ATOM   1412 N  N     . LEU A 1 183 ? 18.767  11.208  2.820   1.00 16.16 ? 219 LEU A N     1 
ATOM   1413 C  CA    . LEU A 1 183 ? 19.067  11.626  1.452   1.00 17.81 ? 219 LEU A CA    1 
ATOM   1414 C  C     . LEU A 1 183 ? 20.557  11.556  1.141   1.00 19.67 ? 219 LEU A C     1 
ATOM   1415 O  O     . LEU A 1 183 ? 20.945  11.154  0.046   1.00 17.97 ? 219 LEU A O     1 
ATOM   1416 C  CB    . LEU A 1 183 ? 18.573  13.038  1.169   1.00 16.52 ? 219 LEU A CB    1 
ATOM   1417 C  CG    . LEU A 1 183 ? 17.066  13.249  1.068   1.00 24.19 ? 219 LEU A CG    1 
ATOM   1418 C  CD1   . LEU A 1 183 ? 16.760  14.755  1.025   1.00 26.47 ? 219 LEU A CD1   1 
ATOM   1419 C  CD2   . LEU A 1 183 ? 16.530  12.530  -0.188  1.00 20.11 ? 219 LEU A CD2   1 
ATOM   1420 N  N     . TYR A 1 184 ? 21.401  11.946  2.090   1.00 18.46 ? 220 TYR A N     1 
ATOM   1421 C  CA    . TYR A 1 184 ? 22.833  11.899  1.822   1.00 17.28 ? 220 TYR A CA    1 
ATOM   1422 C  C     . TYR A 1 184 ? 23.264  10.476  1.493   1.00 18.79 ? 220 TYR A C     1 
ATOM   1423 O  O     . TYR A 1 184 ? 23.997  10.243  0.521   1.00 16.93 ? 220 TYR A O     1 
ATOM   1424 C  CB    . TYR A 1 184 ? 23.621  12.434  3.012   1.00 16.40 ? 220 TYR A CB    1 
ATOM   1425 C  CG    . TYR A 1 184 ? 25.105  12.322  2.825   1.00 19.69 ? 220 TYR A CG    1 
ATOM   1426 C  CD1   . TYR A 1 184 ? 25.798  13.249  2.041   1.00 19.08 ? 220 TYR A CD1   1 
ATOM   1427 C  CD2   . TYR A 1 184 ? 25.822  11.289  3.420   1.00 19.73 ? 220 TYR A CD2   1 
ATOM   1428 C  CE1   . TYR A 1 184 ? 27.178  13.146  1.858   1.00 22.34 ? 220 TYR A CE1   1 
ATOM   1429 C  CE2   . TYR A 1 184 ? 27.205  11.173  3.239   1.00 21.52 ? 220 TYR A CE2   1 
ATOM   1430 C  CZ    . TYR A 1 184 ? 27.871  12.111  2.464   1.00 25.95 ? 220 TYR A CZ    1 
ATOM   1431 O  OH    . TYR A 1 184 ? 29.240  12.011  2.282   1.00 24.85 ? 220 TYR A OH    1 
ATOM   1432 N  N     . TYR A 1 185 ? 22.805  9.522   2.297   1.00 17.00 ? 221 TYR A N     1 
ATOM   1433 C  CA    . TYR A 1 185 ? 23.111  8.119   2.058   1.00 15.78 ? 221 TYR A CA    1 
ATOM   1434 C  C     . TYR A 1 185 ? 22.616  7.663   0.688   1.00 19.71 ? 221 TYR A C     1 
ATOM   1435 O  O     . TYR A 1 185 ? 23.339  6.969   -0.048  1.00 18.76 ? 221 TYR A O     1 
ATOM   1436 C  CB    . TYR A 1 185 ? 22.526  7.239   3.173   1.00 19.38 ? 221 TYR A CB    1 
ATOM   1437 C  CG    . TYR A 1 185 ? 22.624  5.767   2.870   1.00 20.49 ? 221 TYR A CG    1 
ATOM   1438 C  CD1   . TYR A 1 185 ? 23.833  5.086   3.014   1.00 23.34 ? 221 TYR A CD1   1 
ATOM   1439 C  CD2   . TYR A 1 185 ? 21.527  5.062   2.418   1.00 22.34 ? 221 TYR A CD2   1 
ATOM   1440 C  CE1   . TYR A 1 185 ? 23.929  3.730   2.719   1.00 22.36 ? 221 TYR A CE1   1 
ATOM   1441 C  CE2   . TYR A 1 185 ? 21.615  3.712   2.122   1.00 20.33 ? 221 TYR A CE2   1 
ATOM   1442 C  CZ    . TYR A 1 185 ? 22.818  3.060   2.275   1.00 21.02 ? 221 TYR A CZ    1 
ATOM   1443 O  OH    . TYR A 1 185 ? 22.913  1.723   1.966   1.00 26.40 ? 221 TYR A OH    1 
ATOM   1444 N  N     . LEU A 1 186 ? 21.385  8.039   0.339   1.00 17.15 ? 222 LEU A N     1 
ATOM   1445 C  CA    . LEU A 1 186 ? 20.792  7.546   -0.911  1.00 18.16 ? 222 LEU A CA    1 
ATOM   1446 C  C     . LEU A 1 186 ? 21.407  8.185   -2.156  1.00 21.39 ? 222 LEU A C     1 
ATOM   1447 O  O     . LEU A 1 186 ? 21.383  7.599   -3.251  1.00 21.25 ? 222 LEU A O     1 
ATOM   1448 C  CB    . LEU A 1 186 ? 19.281  7.774   -0.901  1.00 16.88 ? 222 LEU A CB    1 
ATOM   1449 C  CG    . LEU A 1 186 ? 18.550  6.960   0.161   1.00 21.10 ? 222 LEU A CG    1 
ATOM   1450 C  CD1   . LEU A 1 186 ? 17.097  7.451   0.301   1.00 18.24 ? 222 LEU A CD1   1 
ATOM   1451 C  CD2   . LEU A 1 186 ? 18.597  5.466   -0.163  1.00 19.50 ? 222 LEU A CD2   1 
ATOM   1452 N  N     . ILE A 1 187 ? 21.952  9.384   -1.985  1.00 19.26 ? 223 ILE A N     1 
ATOM   1453 C  CA    . ILE A 1 187 ? 22.595  10.107  -3.089  1.00 20.10 ? 223 ILE A CA    1 
ATOM   1454 C  C     . ILE A 1 187 ? 24.089  9.809   -3.231  1.00 23.96 ? 223 ILE A C     1 
ATOM   1455 O  O     . ILE A 1 187 ? 24.574  9.517   -4.328  1.00 22.69 ? 223 ILE A O     1 
ATOM   1456 C  CB    . ILE A 1 187 ? 22.424  11.622  -2.908  1.00 19.05 ? 223 ILE A CB    1 
ATOM   1457 C  CG1   . ILE A 1 187 ? 20.943  12.001  -3.017  1.00 17.17 ? 223 ILE A CG1   1 
ATOM   1458 C  CG2   . ILE A 1 187 ? 23.221  12.385  -3.959  1.00 25.79 ? 223 ILE A CG2   1 
ATOM   1459 C  CD1   . ILE A 1 187 ? 20.639  13.422  -2.526  1.00 19.01 ? 223 ILE A CD1   1 
ATOM   1460 N  N     . HIS A 1 188 ? 24.823  9.883   -2.124  1.00 20.35 ? 224 HIS A N     1 
ATOM   1461 C  CA    . HIS A 1 188 ? 26.280  9.911   -2.200  1.00 23.40 ? 224 HIS A CA    1 
ATOM   1462 C  C     . HIS A 1 188 ? 26.982  8.679   -1.650  1.00 25.30 ? 224 HIS A C     1 
ATOM   1463 O  O     . HIS A 1 188 ? 28.179  8.526   -1.846  1.00 31.00 ? 224 HIS A O     1 
ATOM   1464 C  CB    . HIS A 1 188 ? 26.820  11.162  -1.498  1.00 23.30 ? 224 HIS A CB    1 
ATOM   1465 C  CG    . HIS A 1 188 ? 26.571  12.421  -2.260  1.00 23.37 ? 224 HIS A CG    1 
ATOM   1466 N  ND1   . HIS A 1 188 ? 27.143  12.662  -3.492  1.00 24.82 ? 224 HIS A ND1   1 
ATOM   1467 C  CD2   . HIS A 1 188 ? 25.800  13.497  -1.985  1.00 22.57 ? 224 HIS A CD2   1 
ATOM   1468 C  CE1   . HIS A 1 188 ? 26.731  13.833  -3.942  1.00 28.61 ? 224 HIS A CE1   1 
ATOM   1469 N  NE2   . HIS A 1 188 ? 25.916  14.361  -3.046  1.00 27.28 ? 224 HIS A NE2   1 
ATOM   1470 N  N     . VAL A 1 189 ? 26.257  7.804   -0.964  1.00 22.95 ? 225 VAL A N     1 
ATOM   1471 C  CA    . VAL A 1 189 ? 26.889  6.612   -0.384  1.00 22.97 ? 225 VAL A CA    1 
ATOM   1472 C  C     . VAL A 1 189 ? 26.552  5.331   -1.127  1.00 26.52 ? 225 VAL A C     1 
ATOM   1473 O  O     . VAL A 1 189 ? 27.432  4.649   -1.647  1.00 26.79 ? 225 VAL A O     1 
ATOM   1474 C  CB    . VAL A 1 189 ? 26.502  6.425   1.090   1.00 22.24 ? 225 VAL A CB    1 
ATOM   1475 C  CG1   . VAL A 1 189 ? 27.153  5.177   1.653   1.00 22.65 ? 225 VAL A CG1   1 
ATOM   1476 C  CG2   . VAL A 1 189 ? 26.901  7.650   1.899   1.00 24.39 ? 225 VAL A CG2   1 
ATOM   1477 N  N     . ILE A 1 190 ? 25.273  4.992   -1.171  1.00 21.62 ? 226 ILE A N     1 
ATOM   1478 C  CA    . ILE A 1 190 ? 24.863  3.731   -1.769  1.00 25.01 ? 226 ILE A CA    1 
ATOM   1479 C  C     . ILE A 1 190 ? 25.186  3.686   -3.267  1.00 22.65 ? 226 ILE A C     1 
ATOM   1480 O  O     . ILE A 1 190 ? 25.079  4.700   -3.969  1.00 27.94 ? 226 ILE A O     1 
ATOM   1481 C  CB    . ILE A 1 190 ? 23.372  3.452   -1.527  1.00 23.89 ? 226 ILE A CB    1 
ATOM   1482 C  CG1   . ILE A 1 190 ? 23.065  1.997   -1.849  1.00 26.44 ? 226 ILE A CG1   1 
ATOM   1483 C  CG2   . ILE A 1 190 ? 22.488  4.408   -2.354  1.00 21.38 ? 226 ILE A CG2   1 
ATOM   1484 C  CD1   . ILE A 1 190 ? 21.649  1.603   -1.512  1.00 28.97 ? 226 ILE A CD1   1 
ATOM   1485 N  N     . LYS A 1 191 ? 25.627  2.518   -3.737  1.00 27.77 ? 227 LYS A N     1 
ATOM   1486 C  CA    . LYS A 1 191 ? 25.984  2.324   -5.143  1.00 30.02 ? 227 LYS A CA    1 
ATOM   1487 C  C     . LYS A 1 191 ? 25.229  1.128   -5.690  1.00 29.85 ? 227 LYS A C     1 
ATOM   1488 O  O     . LYS A 1 191 ? 25.257  0.063   -5.082  1.00 29.46 ? 227 LYS A O     1 
ATOM   1489 C  CB    . LYS A 1 191 ? 27.495  2.077   -5.307  1.00 34.45 ? 227 LYS A CB    1 
ATOM   1490 C  CG    . LYS A 1 191 ? 28.377  3.155   -4.726  1.00 32.30 ? 227 LYS A CG    1 
ATOM   1491 C  CD    . LYS A 1 191 ? 28.189  4.490   -5.444  1.00 35.07 ? 227 LYS A CD    1 
ATOM   1492 C  CE    . LYS A 1 191 ? 29.034  5.570   -4.794  1.00 35.34 ? 227 LYS A CE    1 
ATOM   1493 N  NZ    . LYS A 1 191 ? 28.757  6.917   -5.381  1.00 37.76 ? 227 LYS A NZ    1 
ATOM   1494 N  N     . PRO A 1 192 ? 24.537  1.294   -6.833  1.00 28.50 ? 228 PRO A N     1 
ATOM   1495 C  CA    . PRO A 1 192 ? 24.325  2.521   -7.611  1.00 30.60 ? 228 PRO A CA    1 
ATOM   1496 C  C     . PRO A 1 192 ? 23.479  3.493   -6.792  1.00 27.56 ? 228 PRO A C     1 
ATOM   1497 O  O     . PRO A 1 192 ? 22.751  3.028   -5.910  1.00 24.38 ? 228 PRO A O     1 
ATOM   1498 C  CB    . PRO A 1 192 ? 23.506  2.037   -8.812  1.00 32.59 ? 228 PRO A CB    1 
ATOM   1499 C  CG    . PRO A 1 192 ? 23.724  0.577   -8.876  1.00 37.61 ? 228 PRO A CG    1 
ATOM   1500 C  CD    . PRO A 1 192 ? 23.860  0.143   -7.445  1.00 35.95 ? 228 PRO A CD    1 
ATOM   1501 N  N     . PRO A 1 193 ? 23.600  4.803   -7.053  1.00 28.12 ? 229 PRO A N     1 
ATOM   1502 C  CA    . PRO A 1 193 ? 22.854  5.796   -6.273  1.00 24.53 ? 229 PRO A CA    1 
ATOM   1503 C  C     . PRO A 1 193 ? 21.363  5.577   -6.446  1.00 29.28 ? 229 PRO A C     1 
ATOM   1504 O  O     . PRO A 1 193 ? 20.943  5.126   -7.522  1.00 23.59 ? 229 PRO A O     1 
ATOM   1505 C  CB    . PRO A 1 193 ? 23.268  7.120   -6.919  1.00 28.25 ? 229 PRO A CB    1 
ATOM   1506 C  CG    . PRO A 1 193 ? 24.640  6.831   -7.515  1.00 31.70 ? 229 PRO A CG    1 
ATOM   1507 C  CD    . PRO A 1 193 ? 24.489  5.436   -8.047  1.00 31.40 ? 229 PRO A CD    1 
ATOM   1508 N  N     . VAL A 1 194 ? 20.569  5.854   -5.412  1.00 23.87 ? 230 VAL A N     1 
ATOM   1509 C  CA    . VAL A 1 194 ? 19.128  5.774   -5.575  1.00 21.13 ? 230 VAL A CA    1 
ATOM   1510 C  C     . VAL A 1 194 ? 18.644  7.019   -6.305  1.00 24.22 ? 230 VAL A C     1 
ATOM   1511 O  O     . VAL A 1 194 ? 17.733  6.945   -7.129  1.00 22.90 ? 230 VAL A O     1 
ATOM   1512 C  CB    . VAL A 1 194 ? 18.397  5.573   -4.224  1.00 20.92 ? 230 VAL A CB    1 
ATOM   1513 C  CG1   . VAL A 1 194 ? 16.885  5.859   -4.360  1.00 20.63 ? 230 VAL A CG1   1 
ATOM   1514 C  CG2   . VAL A 1 194 ? 18.625  4.138   -3.718  1.00 23.88 ? 230 VAL A CG2   1 
ATOM   1515 N  N     . PHE A 1 195 ? 19.296  8.147   -6.017  1.00 23.71 ? 231 PHE A N     1 
ATOM   1516 C  CA    . PHE A 1 195 ? 18.926  9.462   -6.531  1.00 25.89 ? 231 PHE A CA    1 
ATOM   1517 C  C     . PHE A 1 195 ? 20.140  10.154  -7.096  1.00 25.20 ? 231 PHE A C     1 
ATOM   1518 O  O     . PHE A 1 195 ? 21.237  9.973   -6.574  1.00 26.41 ? 231 PHE A O     1 
ATOM   1519 C  CB    . PHE A 1 195 ? 18.531  10.377  -5.373  1.00 27.77 ? 231 PHE A CB    1 
ATOM   1520 C  CG    . PHE A 1 195 ? 17.237  10.056  -4.744  1.00 22.17 ? 231 PHE A CG    1 
ATOM   1521 C  CD1   . PHE A 1 195 ? 16.109  9.848   -5.516  1.00 24.08 ? 231 PHE A CD1   1 
ATOM   1522 C  CD2   . PHE A 1 195 ? 17.128  10.032  -3.355  1.00 23.62 ? 231 PHE A CD2   1 
ATOM   1523 C  CE1   . PHE A 1 195 ? 14.892  9.577   -4.922  1.00 26.42 ? 231 PHE A CE1   1 
ATOM   1524 C  CE2   . PHE A 1 195 ? 15.912  9.744   -2.741  1.00 19.74 ? 231 PHE A CE2   1 
ATOM   1525 C  CZ    . PHE A 1 195 ? 14.789  9.517   -3.529  1.00 20.33 ? 231 PHE A CZ    1 
ATOM   1526 N  N     . PRO A 1 196 ? 19.945  11.010  -8.113  1.00 24.14 ? 232 PRO A N     1 
ATOM   1527 C  CA    . PRO A 1 196 ? 20.990  11.980  -8.461  1.00 24.73 ? 232 PRO A CA    1 
ATOM   1528 C  C     . PRO A 1 196 ? 20.958  13.114  -7.441  1.00 22.91 ? 232 PRO A C     1 
ATOM   1529 O  O     . PRO A 1 196 ? 19.953  13.266  -6.734  1.00 21.36 ? 232 PRO A O     1 
ATOM   1530 C  CB    . PRO A 1 196 ? 20.532  12.512  -9.824  1.00 29.21 ? 232 PRO A CB    1 
ATOM   1531 C  CG    . PRO A 1 196 ? 19.031  12.395  -9.781  1.00 30.29 ? 232 PRO A CG    1 
ATOM   1532 C  CD    . PRO A 1 196 ? 18.758  11.131  -8.981  1.00 28.85 ? 232 PRO A CD    1 
ATOM   1533 N  N     . ASN A 1 197 ? 22.031  13.893  -7.360  1.00 21.11 ? 233 ASN A N     1 
ATOM   1534 C  CA    . ASN A 1 197 ? 22.009  15.140  -6.597  1.00 22.54 ? 233 ASN A CA    1 
ATOM   1535 C  C     . ASN A 1 197 ? 21.398  16.247  -7.462  1.00 24.93 ? 233 ASN A C     1 
ATOM   1536 O  O     . ASN A 1 197 ? 21.995  16.662  -8.458  1.00 24.70 ? 233 ASN A O     1 
ATOM   1537 C  CB    . ASN A 1 197 ? 23.435  15.515  -6.191  1.00 26.86 ? 233 ASN A CB    1 
ATOM   1538 C  CG    . ASN A 1 197 ? 23.488  16.667  -5.219  1.00 25.12 ? 233 ASN A CG    1 
ATOM   1539 O  OD1   . ASN A 1 197 ? 22.815  17.690  -5.401  1.00 26.10 ? 233 ASN A OD1   1 
ATOM   1540 N  ND2   . ASN A 1 197 ? 24.313  16.524  -4.184  1.00 25.18 ? 233 ASN A ND2   1 
ATOM   1541 N  N     . LEU A 1 198 ? 20.224  16.741  -7.077  1.00 19.83 ? 234 LEU A N     1 
ATOM   1542 C  CA    . LEU A 1 198 ? 19.495  17.708  -7.910  1.00 23.34 ? 234 LEU A CA    1 
ATOM   1543 C  C     . LEU A 1 198 ? 20.118  19.103  -7.900  1.00 22.41 ? 234 LEU A C     1 
ATOM   1544 O  O     . LEU A 1 198 ? 19.916  19.892  -8.832  1.00 26.18 ? 234 LEU A O     1 
ATOM   1545 C  CB    . LEU A 1 198 ? 18.021  17.778  -7.499  1.00 23.28 ? 234 LEU A CB    1 
ATOM   1546 C  CG    . LEU A 1 198 ? 17.195  16.499  -7.682  1.00 28.84 ? 234 LEU A CG    1 
ATOM   1547 C  CD1   . LEU A 1 198 ? 15.739  16.698  -7.276  1.00 25.20 ? 234 LEU A CD1   1 
ATOM   1548 C  CD2   . LEU A 1 198 ? 17.243  16.032  -9.126  1.00 25.74 ? 234 LEU A CD2   1 
ATOM   1549 N  N     . LEU A 1 199 ? 20.871  19.410  -6.850  1.00 18.31 ? 235 LEU A N     1 
ATOM   1550 C  CA    . LEU A 1 199 ? 21.550  20.702  -6.738  1.00 22.09 ? 235 LEU A CA    1 
ATOM   1551 C  C     . LEU A 1 199 ? 22.749  20.763  -7.674  1.00 23.92 ? 235 LEU A C     1 
ATOM   1552 O  O     . LEU A 1 199 ? 23.113  21.836  -8.157  1.00 26.03 ? 235 LEU A O     1 
ATOM   1553 C  CB    . LEU A 1 199 ? 22.034  20.953  -5.304  1.00 23.23 ? 235 LEU A CB    1 
ATOM   1554 C  CG    . LEU A 1 199 ? 21.031  21.331  -4.211  1.00 26.87 ? 235 LEU A CG    1 
ATOM   1555 C  CD1   . LEU A 1 199 ? 20.112  20.179  -3.916  1.00 31.27 ? 235 LEU A CD1   1 
ATOM   1556 C  CD2   . LEU A 1 199 ? 21.739  21.757  -2.938  1.00 31.72 ? 235 LEU A CD2   1 
ATOM   1557 N  N     . LEU A 1 200 ? 23.373  19.614  -7.909  1.00 23.36 ? 236 LEU A N     1 
ATOM   1558 C  CA    . LEU A 1 200 ? 24.631  19.565  -8.673  1.00 23.72 ? 236 LEU A CA    1 
ATOM   1559 C  C     . LEU A 1 200 ? 24.427  19.189  -10.136 1.00 31.88 ? 236 LEU A C     1 
ATOM   1560 O  O     . LEU A 1 200 ? 25.385  19.138  -10.917 1.00 32.58 ? 236 LEU A O     1 
ATOM   1561 C  CB    . LEU A 1 200 ? 25.647  18.621  -8.020  1.00 24.21 ? 236 LEU A CB    1 
ATOM   1562 C  CG    . LEU A 1 200 ? 25.972  18.947  -6.557  1.00 27.68 ? 236 LEU A CG    1 
ATOM   1563 C  CD1   . LEU A 1 200 ? 27.026  18.021  -5.981  1.00 26.24 ? 236 LEU A CD1   1 
ATOM   1564 C  CD2   . LEU A 1 200 ? 26.417  20.384  -6.414  1.00 27.38 ? 236 LEU A CD2   1 
ATOM   1565 N  N     . SER A 1 201 ? 23.177  18.945  -10.510 1.00 25.10 ? 237 SER A N     1 
ATOM   1566 C  CA    . SER A 1 201 ? 22.834  18.697  -11.904 1.00 33.56 ? 237 SER A CA    1 
ATOM   1567 C  C     . SER A 1 201 ? 23.373  19.766  -12.847 1.00 32.47 ? 237 SER A C     1 
ATOM   1568 O  O     . SER A 1 201 ? 23.339  20.966  -12.545 1.00 30.82 ? 237 SER A O     1 
ATOM   1569 C  CB    . SER A 1 201 ? 21.323  18.623  -12.073 1.00 34.24 ? 237 SER A CB    1 
ATOM   1570 O  OG    . SER A 1 201 ? 20.991  18.411  -13.435 1.00 36.96 ? 237 SER A OG    1 
ATOM   1571 N  N     . PRO A 1 202 ? 23.855  19.338  -14.018 1.00 33.57 ? 238 PRO A N     1 
ATOM   1572 C  CA    . PRO A 1 202 ? 24.311  20.342  -14.983 1.00 38.15 ? 238 PRO A CA    1 
ATOM   1573 C  C     . PRO A 1 202 ? 23.151  21.188  -15.513 1.00 36.97 ? 238 PRO A C     1 
ATOM   1574 O  O     . PRO A 1 202 ? 23.392  22.215  -16.132 1.00 37.17 ? 238 PRO A O     1 
ATOM   1575 C  CB    . PRO A 1 202 ? 24.927  19.497  -16.109 1.00 36.92 ? 238 PRO A CB    1 
ATOM   1576 C  CG    . PRO A 1 202 ? 24.269  18.162  -15.997 1.00 37.82 ? 238 PRO A CG    1 
ATOM   1577 C  CD    . PRO A 1 202 ? 24.006  17.960  -14.519 1.00 37.79 ? 238 PRO A CD    1 
ATOM   1578 N  N     . LEU A 1 203 ? 21.916  20.757  -15.268 1.00 34.34 ? 239 LEU A N     1 
ATOM   1579 C  CA    . LEU A 1 203 ? 20.736  21.507  -15.699 1.00 36.26 ? 239 LEU A CA    1 
ATOM   1580 C  C     . LEU A 1 203 ? 20.228  22.474  -14.635 1.00 35.87 ? 239 LEU A C     1 
ATOM   1581 O  O     . LEU A 1 203 ? 19.327  23.275  -14.894 1.00 36.75 ? 239 LEU A O     1 
ATOM   1582 C  CB    . LEU A 1 203 ? 19.604  20.552  -16.083 1.00 35.66 ? 239 LEU A CB    1 
ATOM   1583 C  CG    . LEU A 1 203 ? 19.418  20.240  -17.570 1.00 46.96 ? 239 LEU A CG    1 
ATOM   1584 C  CD1   . LEU A 1 203 ? 20.761  20.022  -18.258 1.00 42.02 ? 239 LEU A CD1   1 
ATOM   1585 C  CD2   . LEU A 1 203 ? 18.522  19.024  -17.748 1.00 47.08 ? 239 LEU A CD2   1 
ATOM   1586 N  N     . LYS A 1 204 ? 20.789  22.388  -13.432 1.00 32.72 ? 240 LYS A N     1 
ATOM   1587 C  CA    . LYS A 1 204 ? 20.382  23.285  -12.352 1.00 30.46 ? 240 LYS A CA    1 
ATOM   1588 C  C     . LYS A 1 204 ? 20.723  24.720  -12.708 1.00 33.25 ? 240 LYS A C     1 
ATOM   1589 O  O     . LYS A 1 204 ? 21.820  25.008  -13.212 1.00 30.16 ? 240 LYS A O     1 
ATOM   1590 C  CB    . LYS A 1 204 ? 21.059  22.894  -11.028 1.00 30.55 ? 240 LYS A CB    1 
ATOM   1591 C  CG    . LYS A 1 204 ? 20.920  23.945  -9.918  1.00 27.64 ? 240 LYS A CG    1 
ATOM   1592 C  CD    . LYS A 1 204 ? 22.216  24.748  -9.749  1.00 29.77 ? 240 LYS A CD    1 
ATOM   1593 C  CE    . LYS A 1 204 ? 22.015  25.929  -8.811  1.00 30.83 ? 240 LYS A CE    1 
ATOM   1594 N  NZ    . LYS A 1 204 ? 23.308  26.563  -8.402  1.00 33.06 ? 240 LYS A NZ    1 
ATOM   1595 N  N     . GLN A 1 205 ? 19.780  25.618  -12.454 1.00 30.90 ? 241 GLN A N     1 
ATOM   1596 C  CA    . GLN A 1 205 ? 20.036  27.042  -12.595 1.00 36.42 ? 241 GLN A CA    1 
ATOM   1597 C  C     . GLN A 1 205 ? 19.995  27.760  -11.256 1.00 33.94 ? 241 GLN A C     1 
ATOM   1598 O  O     . GLN A 1 205 ? 19.173  27.459  -10.390 1.00 29.64 ? 241 GLN A O     1 
ATOM   1599 C  CB    . GLN A 1 205 ? 19.053  27.679  -13.580 1.00 37.28 ? 241 GLN A CB    1 
ATOM   1600 C  CG    . GLN A 1 205 ? 19.388  27.365  -15.039 1.00 43.16 ? 241 GLN A CG    1 
ATOM   1601 C  CD    . GLN A 1 205 ? 18.411  27.992  -16.019 1.00 53.22 ? 241 GLN A CD    1 
ATOM   1602 O  OE1   . GLN A 1 205 ? 17.417  28.600  -15.620 1.00 58.92 ? 241 GLN A OE1   1 
ATOM   1603 N  NE2   . GLN A 1 205 ? 18.693  27.848  -17.310 1.00 61.73 ? 241 GLN A NE2   1 
ATOM   1604 N  N     . GLU A 1 206 ? 20.893  28.721  -11.097 1.00 31.85 ? 242 GLU A N     1 
ATOM   1605 C  CA    . GLU A 1 206 ? 20.978  29.479  -9.862  1.00 34.00 ? 242 GLU A CA    1 
ATOM   1606 C  C     . GLU A 1 206 ? 19.707  30.291  -9.638  1.00 33.19 ? 242 GLU A C     1 
ATOM   1607 O  O     . GLU A 1 206 ? 19.134  30.852  -10.576 1.00 32.73 ? 242 GLU A O     1 
ATOM   1608 C  CB    . GLU A 1 206 ? 22.204  30.384  -9.907  1.00 36.89 ? 242 GLU A CB    1 
ATOM   1609 C  CG    . GLU A 1 206 ? 22.308  31.383  -8.782  1.00 40.19 ? 242 GLU A CG    1 
ATOM   1610 C  CD    . GLU A 1 206 ? 23.485  32.312  -8.984  1.00 43.25 ? 242 GLU A CD    1 
ATOM   1611 O  OE1   . GLU A 1 206 ? 23.268  33.545  -9.070  1.00 42.93 ? 242 GLU A OE1   1 
ATOM   1612 O  OE2   . GLU A 1 206 ? 24.625  31.798  -9.062  1.00 43.80 ? 242 GLU A OE2   1 
ATOM   1613 N  N     . LYS A 1 207 ? 19.245  30.309  -8.394  1.00 33.48 ? 243 LYS A N     1 
ATOM   1614 C  CA    . LYS A 1 207 ? 18.122  31.145  -7.998  1.00 31.63 ? 243 LYS A CA    1 
ATOM   1615 C  C     . LYS A 1 207 ? 18.398  31.633  -6.590  1.00 30.30 ? 243 LYS A C     1 
ATOM   1616 O  O     . LYS A 1 207 ? 18.431  30.839  -5.643  1.00 26.46 ? 243 LYS A O     1 
ATOM   1617 C  CB    . LYS A 1 207 ? 16.800  30.373  -8.031  1.00 28.58 ? 243 LYS A CB    1 
ATOM   1618 C  CG    . LYS A 1 207 ? 15.627  31.228  -7.536  1.00 35.89 ? 243 LYS A CG    1 
ATOM   1619 C  CD    . LYS A 1 207 ? 14.382  30.411  -7.306  1.00 41.23 ? 243 LYS A CD    1 
ATOM   1620 C  CE    . LYS A 1 207 ? 14.031  29.567  -8.517  1.00 45.98 ? 243 LYS A CE    1 
ATOM   1621 N  NZ    . LYS A 1 207 ? 12.798  28.756  -8.266  1.00 55.60 ? 243 LYS A NZ    1 
ATOM   1622 N  N     . ILE A 1 208 ? 18.602  32.938  -6.446  1.00 26.84 ? 244 ILE A N     1 
ATOM   1623 C  CA    . ILE A 1 208 ? 19.006  33.492  -5.165  1.00 24.56 ? 244 ILE A CA    1 
ATOM   1624 C  C     . ILE A 1 208 ? 17.819  33.977  -4.337  1.00 32.93 ? 244 ILE A C     1 
ATOM   1625 O  O     . ILE A 1 208 ? 17.090  34.882  -4.748  1.00 26.43 ? 244 ILE A O     1 
ATOM   1626 C  CB    . ILE A 1 208 ? 19.987  34.668  -5.354  1.00 29.74 ? 244 ILE A CB    1 
ATOM   1627 C  CG1   . ILE A 1 208 ? 21.169  34.232  -6.223  1.00 31.26 ? 244 ILE A CG1   1 
ATOM   1628 C  CG2   . ILE A 1 208 ? 20.476  35.165  -4.006  1.00 27.46 ? 244 ILE A CG2   1 
ATOM   1629 C  CD1   . ILE A 1 208 ? 22.018  33.145  -5.579  1.00 31.25 ? 244 ILE A CD1   1 
ATOM   1630 N  N     . VAL A 1 209 ? 17.641  33.384  -3.162  1.00 29.29 ? 245 VAL A N     1 
ATOM   1631 C  CA    . VAL A 1 209 ? 16.580  33.784  -2.244  1.00 29.25 ? 245 VAL A CA    1 
ATOM   1632 C  C     . VAL A 1 209 ? 17.198  34.015  -0.869  1.00 30.39 ? 245 VAL A C     1 
ATOM   1633 O  O     . VAL A 1 209 ? 17.955  33.166  -0.391  1.00 29.03 ? 245 VAL A O     1 
ATOM   1634 C  CB    . VAL A 1 209 ? 15.486  32.687  -2.143  1.00 31.43 ? 245 VAL A CB    1 
ATOM   1635 C  CG1   . VAL A 1 209 ? 14.560  32.962  -0.974  1.00 34.92 ? 245 VAL A CG1   1 
ATOM   1636 C  CG2   . VAL A 1 209 ? 14.688  32.603  -3.438  1.00 29.48 ? 245 VAL A CG2   1 
ATOM   1637 N  N     . ASP A 1 210 ? 16.907  35.157  -0.240  1.00 32.16 ? 246 ASP A N     1 
ATOM   1638 C  CA    . ASP A 1 210 ? 17.430  35.420  1.107   1.00 39.18 ? 246 ASP A CA    1 
ATOM   1639 C  C     . ASP A 1 210 ? 18.961  35.362  1.151   1.00 35.19 ? 246 ASP A C     1 
ATOM   1640 O  O     . ASP A 1 210 ? 19.538  35.043  2.188   1.00 38.86 ? 246 ASP A O     1 
ATOM   1641 C  CB    . ASP A 1 210 ? 16.899  34.359  2.095   1.00 40.17 ? 246 ASP A CB    1 
ATOM   1642 C  CG    . ASP A 1 210 ? 15.813  34.873  3.005   1.00 49.82 ? 246 ASP A CG    1 
ATOM   1643 O  OD1   . ASP A 1 210 ? 14.628  34.846  2.601   1.00 45.58 ? 246 ASP A OD1   1 
ATOM   1644 O  OD2   . ASP A 1 210 ? 16.143  35.260  4.149   1.00 61.59 ? 246 ASP A OD2   1 
ATOM   1645 N  N     . GLY A 1 211 ? 19.625  35.628  0.034   1.00 32.57 ? 247 GLY A N     1 
ATOM   1646 C  CA    . GLY A 1 211 ? 21.076  35.551  0.008   1.00 31.56 ? 247 GLY A CA    1 
ATOM   1647 C  C     . GLY A 1 211 ? 21.662  34.162  -0.215  1.00 34.63 ? 247 GLY A C     1 
ATOM   1648 O  O     . GLY A 1 211 ? 22.889  33.999  -0.225  1.00 36.77 ? 247 GLY A O     1 
ATOM   1649 N  N     . PHE A 1 212 ? 20.809  33.151  -0.390  1.00 28.79 ? 248 PHE A N     1 
ATOM   1650 C  CA    . PHE A 1 212 ? 21.300  31.811  -0.697  1.00 28.88 ? 248 PHE A CA    1 
ATOM   1651 C  C     . PHE A 1 212 ? 20.758  31.282  -2.024  1.00 26.84 ? 248 PHE A C     1 
ATOM   1652 O  O     . PHE A 1 212 ? 19.674  31.664  -2.472  1.00 27.29 ? 248 PHE A O     1 
ATOM   1653 C  CB    . PHE A 1 212 ? 20.933  30.823  0.412   1.00 29.27 ? 248 PHE A CB    1 
ATOM   1654 C  CG    . PHE A 1 212 ? 21.454  31.198  1.769   1.00 30.93 ? 248 PHE A CG    1 
ATOM   1655 C  CD1   . PHE A 1 212 ? 22.730  30.808  2.171   1.00 33.10 ? 248 PHE A CD1   1 
ATOM   1656 C  CD2   . PHE A 1 212 ? 20.655  31.904  2.661   1.00 34.50 ? 248 PHE A CD2   1 
ATOM   1657 C  CE1   . PHE A 1 212 ? 23.210  31.136  3.438   1.00 32.11 ? 248 PHE A CE1   1 
ATOM   1658 C  CE2   . PHE A 1 212 ? 21.121  32.237  3.929   1.00 32.39 ? 248 PHE A CE2   1 
ATOM   1659 C  CZ    . PHE A 1 212 ? 22.403  31.853  4.317   1.00 29.49 ? 248 PHE A CZ    1 
ATOM   1660 N  N     . ASP A 1 213 ? 21.516  30.380  -2.631  1.00 23.23 ? 249 ASP A N     1 
ATOM   1661 C  CA    . ASP A 1 213 ? 21.111  29.735  -3.878  1.00 29.08 ? 249 ASP A CA    1 
ATOM   1662 C  C     . ASP A 1 213 ? 20.207  28.539  -3.577  1.00 27.82 ? 249 ASP A C     1 
ATOM   1663 O  O     . ASP A 1 213 ? 20.654  27.536  -3.019  1.00 23.39 ? 249 ASP A O     1 
ATOM   1664 C  CB    . ASP A 1 213 ? 22.349  29.288  -4.652  1.00 30.87 ? 249 ASP A CB    1 
ATOM   1665 C  CG    . ASP A 1 213 ? 22.018  28.720  -6.025  1.00 35.08 ? 249 ASP A CG    1 
ATOM   1666 O  OD1   . ASP A 1 213 ? 20.839  28.775  -6.450  1.00 29.07 ? 249 ASP A OD1   1 
ATOM   1667 O  OD2   . ASP A 1 213 ? 22.958  28.228  -6.686  1.00 37.44 ? 249 ASP A OD2   1 
ATOM   1668 N  N     . VAL A 1 214 ? 18.937  28.656  -3.950  1.00 21.77 ? 250 VAL A N     1 
ATOM   1669 C  CA    . VAL A 1 214 ? 17.976  27.592  -3.708  1.00 26.27 ? 250 VAL A CA    1 
ATOM   1670 C  C     . VAL A 1 214 ? 17.615  26.887  -5.008  1.00 26.25 ? 250 VAL A C     1 
ATOM   1671 O  O     . VAL A 1 214 ? 16.613  26.189  -5.084  1.00 24.57 ? 250 VAL A O     1 
ATOM   1672 C  CB    . VAL A 1 214 ? 16.697  28.140  -3.034  1.00 26.51 ? 250 VAL A CB    1 
ATOM   1673 C  CG1   . VAL A 1 214 ? 17.040  28.805  -1.701  1.00 23.35 ? 250 VAL A CG1   1 
ATOM   1674 C  CG2   . VAL A 1 214 ? 16.014  29.147  -3.945  1.00 26.62 ? 250 VAL A CG2   1 
ATOM   1675 N  N     . GLY A 1 215 ? 18.434  27.068  -6.037  1.00 24.79 ? 251 GLY A N     1 
ATOM   1676 C  CA    . GLY A 1 215 ? 18.156  26.449  -7.318  1.00 20.87 ? 251 GLY A CA    1 
ATOM   1677 C  C     . GLY A 1 215 ? 18.457  24.968  -7.316  1.00 24.41 ? 251 GLY A C     1 
ATOM   1678 O  O     . GLY A 1 215 ? 19.402  24.514  -6.669  1.00 23.96 ? 251 GLY A O     1 
ATOM   1679 N  N     . PHE A 1 216 ? 17.639  24.205  -8.029  1.00 19.72 ? 252 PHE A N     1 
ATOM   1680 C  CA    . PHE A 1 216 ? 17.936  22.796  -8.254  1.00 25.49 ? 252 PHE A CA    1 
ATOM   1681 C  C     . PHE A 1 216 ? 17.212  22.337  -9.501  1.00 25.94 ? 252 PHE A C     1 
ATOM   1682 O  O     . PHE A 1 216 ? 16.306  23.019  -9.987  1.00 28.54 ? 252 PHE A O     1 
ATOM   1683 C  CB    . PHE A 1 216 ? 17.588  21.928  -7.024  1.00 20.62 ? 252 PHE A CB    1 
ATOM   1684 C  CG    . PHE A 1 216 ? 16.102  21.787  -6.741  1.00 23.12 ? 252 PHE A CG    1 
ATOM   1685 C  CD1   . PHE A 1 216 ? 15.390  20.702  -7.243  1.00 25.04 ? 252 PHE A CD1   1 
ATOM   1686 C  CD2   . PHE A 1 216 ? 15.439  22.701  -5.932  1.00 25.99 ? 252 PHE A CD2   1 
ATOM   1687 C  CE1   . PHE A 1 216 ? 14.038  20.539  -6.980  1.00 25.05 ? 252 PHE A CE1   1 
ATOM   1688 C  CE2   . PHE A 1 216 ? 14.076  22.551  -5.654  1.00 26.75 ? 252 PHE A CE2   1 
ATOM   1689 C  CZ    . PHE A 1 216 ? 13.374  21.466  -6.177  1.00 24.83 ? 252 PHE A CZ    1 
ATOM   1690 N  N     . ASP A 1 217 ? 17.634  21.192  -10.021 1.00 26.58 ? 253 ASP A N     1 
ATOM   1691 C  CA    . ASP A 1 217 ? 17.030  20.594  -11.201 1.00 32.98 ? 253 ASP A CA    1 
ATOM   1692 C  C     . ASP A 1 217 ? 15.662  20.023  -10.820 1.00 29.98 ? 253 ASP A C     1 
ATOM   1693 O  O     . ASP A 1 217 ? 15.587  18.955  -10.220 1.00 29.78 ? 253 ASP A O     1 
ATOM   1694 C  CB    . ASP A 1 217 ? 17.961  19.494  -11.734 1.00 31.47 ? 253 ASP A CB    1 
ATOM   1695 C  CG    . ASP A 1 217 ? 17.451  18.854  -13.010 1.00 41.19 ? 253 ASP A CG    1 
ATOM   1696 O  OD1   . ASP A 1 217 ? 16.608  19.479  -13.697 1.00 37.94 ? 253 ASP A OD1   1 
ATOM   1697 O  OD2   . ASP A 1 217 ? 17.901  17.725  -13.320 1.00 45.96 ? 253 ASP A OD2   1 
ATOM   1698 N  N     . ASP A 1 218 ? 14.587  20.741  -11.146 1.00 33.05 ? 254 ASP A N     1 
ATOM   1699 C  CA    . ASP A 1 218 ? 13.252  20.383  -10.650 1.00 34.86 ? 254 ASP A CA    1 
ATOM   1700 C  C     . ASP A 1 218 ? 12.328  19.758  -11.697 1.00 41.32 ? 254 ASP A C     1 
ATOM   1701 O  O     . ASP A 1 218 ? 11.165  19.442  -11.400 1.00 34.37 ? 254 ASP A O     1 
ATOM   1702 C  CB    . ASP A 1 218 ? 12.567  21.602  -10.019 1.00 37.99 ? 254 ASP A CB    1 
ATOM   1703 C  CG    . ASP A 1 218 ? 12.322  22.720  -11.020 1.00 44.47 ? 254 ASP A CG    1 
ATOM   1704 O  OD1   . ASP A 1 218 ? 12.808  22.619  -12.166 1.00 42.89 ? 254 ASP A OD1   1 
ATOM   1705 O  OD2   . ASP A 1 218 ? 11.655  23.712  -10.650 1.00 45.83 ? 254 ASP A OD2   1 
ATOM   1706 N  N     . LYS A 1 219 ? 12.833  19.587  -12.918 1.00 35.98 ? 255 LYS A N     1 
ATOM   1707 C  CA    . LYS A 1 219 ? 12.045  18.958  -13.975 1.00 40.08 ? 255 LYS A CA    1 
ATOM   1708 C  C     . LYS A 1 219 ? 12.108  17.442  -13.837 1.00 39.51 ? 255 LYS A C     1 
ATOM   1709 O  O     . LYS A 1 219 ? 12.925  16.775  -14.483 1.00 37.14 ? 255 LYS A O     1 
ATOM   1710 C  CB    . LYS A 1 219 ? 12.535  19.404  -15.357 1.00 44.56 ? 255 LYS A CB    1 
ATOM   1711 C  CG    . LYS A 1 219 ? 12.375  20.898  -15.616 1.00 45.56 ? 255 LYS A CG    1 
ATOM   1712 C  CD    . LYS A 1 219 ? 11.006  21.399  -15.160 1.00 53.45 ? 255 LYS A CD    1 
ATOM   1713 C  CE    . LYS A 1 219 ? 10.660  22.757  -15.778 1.00 59.51 ? 255 LYS A CE    1 
ATOM   1714 N  NZ    . LYS A 1 219 ? 10.308  22.635  -17.225 1.00 62.20 ? 255 LYS A NZ    1 
ATOM   1715 N  N     . LEU A 1 220 ? 11.228  16.900  -13.003 1.00 38.27 ? 256 LEU A N     1 
ATOM   1716 C  CA    . LEU A 1 220 ? 11.346  15.514  -12.564 1.00 37.46 ? 256 LEU A CA    1 
ATOM   1717 C  C     . LEU A 1 220 ? 11.095  14.481  -13.674 1.00 39.43 ? 256 LEU A C     1 
ATOM   1718 O  O     . LEU A 1 220 ? 11.633  13.372  -13.633 1.00 41.28 ? 256 LEU A O     1 
ATOM   1719 C  CB    . LEU A 1 220 ? 10.432  15.276  -11.355 1.00 40.70 ? 256 LEU A CB    1 
ATOM   1720 C  CG    . LEU A 1 220 ? 10.608  16.347  -10.273 1.00 38.29 ? 256 LEU A CG    1 
ATOM   1721 C  CD1   . LEU A 1 220 ? 9.717   16.114  -9.049  1.00 34.95 ? 256 LEU A CD1   1 
ATOM   1722 C  CD2   . LEU A 1 220 ? 12.068  16.432  -9.864  1.00 36.91 ? 256 LEU A CD2   1 
ATOM   1723 N  N     . GLU A 1 221 ? 10.289  14.851  -14.665 1.00 41.15 ? 257 GLU A N     1 
ATOM   1724 C  CA    . GLU A 1 221 ? 9.942   13.941  -15.762 1.00 43.61 ? 257 GLU A CA    1 
ATOM   1725 C  C     . GLU A 1 221 ? 11.152  13.637  -16.647 1.00 42.85 ? 257 GLU A C     1 
ATOM   1726 O  O     . GLU A 1 221 ? 11.185  12.634  -17.357 1.00 42.45 ? 257 GLU A O     1 
ATOM   1727 C  CB    . GLU A 1 221 ? 8.817   14.540  -16.611 1.00 47.79 ? 257 GLU A CB    1 
ATOM   1728 C  CG    . GLU A 1 221 ? 9.290   15.648  -17.543 1.00 51.25 ? 257 GLU A CG    1 
ATOM   1729 C  CD    . GLU A 1 221 ? 8.285   16.773  -17.682 1.00 60.35 ? 257 GLU A CD    1 
ATOM   1730 O  OE1   . GLU A 1 221 ? 7.313   16.612  -18.453 1.00 66.38 ? 257 GLU A OE1   1 
ATOM   1731 O  OE2   . GLU A 1 221 ? 8.474   17.819  -17.018 1.00 64.88 ? 257 GLU A OE2   1 
ATOM   1732 N  N     . ASP A 1 222 ? 12.153  14.509  -16.600 1.00 41.78 ? 258 ASP A N     1 
ATOM   1733 C  CA    . ASP A 1 222 ? 13.377  14.294  -17.364 1.00 40.92 ? 258 ASP A CA    1 
ATOM   1734 C  C     . ASP A 1 222 ? 14.399  13.420  -16.614 1.00 43.69 ? 258 ASP A C     1 
ATOM   1735 O  O     . ASP A 1 222 ? 15.417  13.015  -17.175 1.00 44.11 ? 258 ASP A O     1 
ATOM   1736 C  CB    . ASP A 1 222 ? 13.990  15.641  -17.767 1.00 41.21 ? 258 ASP A CB    1 
ATOM   1737 C  CG    . ASP A 1 222 ? 13.151  16.377  -18.809 1.00 46.42 ? 258 ASP A CG    1 
ATOM   1738 O  OD1   . ASP A 1 222 ? 13.177  17.625  -18.823 1.00 46.39 ? 258 ASP A OD1   1 
ATOM   1739 O  OD2   . ASP A 1 222 ? 12.464  15.708  -19.613 1.00 46.81 ? 258 ASP A OD2   1 
ATOM   1740 N  N     . ILE A 1 223 ? 14.123  13.131  -15.347 1.00 38.01 ? 259 ILE A N     1 
ATOM   1741 C  CA    . ILE A 1 223 ? 15.002  12.279  -14.553 1.00 40.18 ? 259 ILE A CA    1 
ATOM   1742 C  C     . ILE A 1 223 ? 14.662  10.819  -14.815 1.00 42.13 ? 259 ILE A C     1 
ATOM   1743 O  O     . ILE A 1 223 ? 13.522  10.396  -14.610 1.00 41.21 ? 259 ILE A O     1 
ATOM   1744 C  CB    . ILE A 1 223 ? 14.842  12.547  -13.041 1.00 42.02 ? 259 ILE A CB    1 
ATOM   1745 C  CG1   . ILE A 1 223 ? 14.859  14.049  -12.747 1.00 41.67 ? 259 ILE A CG1   1 
ATOM   1746 C  CG2   . ILE A 1 223 ? 15.922  11.818  -12.253 1.00 39.55 ? 259 ILE A CG2   1 
ATOM   1747 C  CD1   . ILE A 1 223 ? 16.210  14.574  -12.296 1.00 45.67 ? 259 ILE A CD1   1 
ATOM   1748 N  N     . PRO A 1 224 ? 15.652  10.032  -15.259 1.00 42.04 ? 260 PRO A N     1 
ATOM   1749 C  CA    . PRO A 1 224 ? 15.389  8.608   -15.508 1.00 46.69 ? 260 PRO A CA    1 
ATOM   1750 C  C     . PRO A 1 224 ? 15.192  7.846   -14.199 1.00 47.87 ? 260 PRO A C     1 
ATOM   1751 O  O     . PRO A 1 224 ? 15.713  8.283   -13.169 1.00 45.50 ? 260 PRO A O     1 
ATOM   1752 C  CB    . PRO A 1 224 ? 16.665  8.138   -16.210 1.00 43.87 ? 260 PRO A CB    1 
ATOM   1753 C  CG    . PRO A 1 224 ? 17.735  9.063   -15.696 1.00 45.74 ? 260 PRO A CG    1 
ATOM   1754 C  CD    . PRO A 1 224 ? 17.067  10.394  -15.466 1.00 42.46 ? 260 PRO A CD    1 
ATOM   1755 N  N     . PRO A 1 225 ? 14.436  6.732   -14.234 1.00 48.27 ? 261 PRO A N     1 
ATOM   1756 C  CA    . PRO A 1 225 ? 14.241  5.887   -13.049 1.00 48.77 ? 261 PRO A CA    1 
ATOM   1757 C  C     . PRO A 1 225 ? 15.577  5.473   -12.437 1.00 40.70 ? 261 PRO A C     1 
ATOM   1758 O  O     . PRO A 1 225 ? 16.580  5.395   -13.141 1.00 39.61 ? 261 PRO A O     1 
ATOM   1759 C  CB    . PRO A 1 225 ? 13.525  4.652   -13.611 1.00 48.56 ? 261 PRO A CB    1 
ATOM   1760 C  CG    . PRO A 1 225 ? 12.814  5.156   -14.825 1.00 52.78 ? 261 PRO A CG    1 
ATOM   1761 C  CD    . PRO A 1 225 ? 13.710  6.215   -15.410 1.00 48.38 ? 261 PRO A CD    1 
ATOM   1762 N  N     . SER A 1 226 ? 15.585  5.224   -11.134 1.00 35.95 ? 262 SER A N     1 
ATOM   1763 C  CA    . SER A 1 226 ? 16.798  4.821   -10.439 1.00 36.09 ? 262 SER A CA    1 
ATOM   1764 C  C     . SER A 1 226 ? 17.380  3.529   -11.019 1.00 35.13 ? 262 SER A C     1 
ATOM   1765 O  O     . SER A 1 226 ? 16.640  2.603   -11.380 1.00 35.57 ? 262 SER A O     1 
ATOM   1766 C  CB    . SER A 1 226 ? 16.491  4.605   -8.954  1.00 32.98 ? 262 SER A CB    1 
ATOM   1767 O  OG    . SER A 1 226 ? 17.662  4.251   -8.244  1.00 31.00 ? 262 SER A OG    1 
ATOM   1768 N  N     . GLN A 1 227 ? 18.703  3.462   -11.078 1.00 30.12 ? 263 GLN A N     1 
ATOM   1769 C  CA    . GLN A 1 227 ? 19.389  2.219   -11.417 1.00 34.94 ? 263 GLN A CA    1 
ATOM   1770 C  C     . GLN A 1 227 ? 19.644  1.340   -10.193 1.00 35.20 ? 263 GLN A C     1 
ATOM   1771 O  O     . GLN A 1 227 ? 20.255  0.271   -10.296 1.00 28.80 ? 263 GLN A O     1 
ATOM   1772 C  CB    . GLN A 1 227 ? 20.702  2.510   -12.151 1.00 43.67 ? 263 GLN A CB    1 
ATOM   1773 C  CG    . GLN A 1 227 ? 20.514  2.783   -13.638 1.00 49.05 ? 263 GLN A CG    1 
ATOM   1774 C  CD    . GLN A 1 227 ? 19.831  1.625   -14.354 1.00 56.03 ? 263 GLN A CD    1 
ATOM   1775 O  OE1   . GLN A 1 227 ? 18.658  1.715   -14.725 1.00 56.07 ? 263 GLN A OE1   1 
ATOM   1776 N  NE2   . GLN A 1 227 ? 20.564  0.528   -14.545 1.00 54.41 ? 263 GLN A NE2   1 
ATOM   1777 N  N     . ASN A 1 228 ? 19.178  1.788   -9.030  1.00 29.60 ? 264 ASN A N     1 
ATOM   1778 C  CA    . ASN A 1 228 ? 19.263  0.968   -7.827  1.00 27.91 ? 264 ASN A CA    1 
ATOM   1779 C  C     . ASN A 1 228 ? 17.974  0.181   -7.624  1.00 27.59 ? 264 ASN A C     1 
ATOM   1780 O  O     . ASN A 1 228 ? 16.893  0.774   -7.485  1.00 28.11 ? 264 ASN A O     1 
ATOM   1781 C  CB    . ASN A 1 228 ? 19.533  1.847   -6.591  1.00 26.28 ? 264 ASN A CB    1 
ATOM   1782 C  CG    . ASN A 1 228 ? 19.793  1.022   -5.343  1.00 28.56 ? 264 ASN A CG    1 
ATOM   1783 O  OD1   . ASN A 1 228 ? 18.905  0.326   -4.855  1.00 26.52 ? 264 ASN A OD1   1 
ATOM   1784 N  ND2   . ASN A 1 228 ? 21.016  1.092   -4.824  1.00 29.19 ? 264 ASN A ND2   1 
ATOM   1785 N  N     . TYR A 1 229 ? 18.080  -1.141  -7.567  1.00 25.34 ? 265 TYR A N     1 
ATOM   1786 C  CA    . TYR A 1 229 ? 16.892  -1.981  -7.421  1.00 29.92 ? 265 TYR A CA    1 
ATOM   1787 C  C     . TYR A 1 229 ? 16.766  -2.617  -6.039  1.00 25.94 ? 265 TYR A C     1 
ATOM   1788 O  O     . TYR A 1 229 ? 16.072  -3.609  -5.872  1.00 29.71 ? 265 TYR A O     1 
ATOM   1789 C  CB    . TYR A 1 229 ? 16.844  -3.038  -8.537  1.00 38.17 ? 265 TYR A CB    1 
ATOM   1790 C  CG    . TYR A 1 229 ? 16.827  -2.421  -9.918  1.00 36.38 ? 265 TYR A CG    1 
ATOM   1791 C  CD1   . TYR A 1 229 ? 15.626  -2.149  -10.566 1.00 42.61 ? 265 TYR A CD1   1 
ATOM   1792 C  CD2   . TYR A 1 229 ? 18.013  -2.091  -10.564 1.00 37.89 ? 265 TYR A CD2   1 
ATOM   1793 C  CE1   . TYR A 1 229 ? 15.611  -1.572  -11.833 1.00 44.99 ? 265 TYR A CE1   1 
ATOM   1794 C  CE2   . TYR A 1 229 ? 18.009  -1.521  -11.823 1.00 43.72 ? 265 TYR A CE2   1 
ATOM   1795 C  CZ    . TYR A 1 229 ? 16.809  -1.262  -12.451 1.00 46.76 ? 265 TYR A CZ    1 
ATOM   1796 O  OH    . TYR A 1 229 ? 16.819  -0.692  -13.705 1.00 54.55 ? 265 TYR A OH    1 
ATOM   1797 N  N     . SER A 1 230 ? 17.416  -2.021  -5.040  1.00 26.16 ? 266 SER A N     1 
ATOM   1798 C  CA    . SER A 1 230 ? 17.387  -2.575  -3.679  1.00 27.56 ? 266 SER A CA    1 
ATOM   1799 C  C     . SER A 1 230 ? 15.987  -2.505  -3.077  1.00 27.66 ? 266 SER A C     1 
ATOM   1800 O  O     . SER A 1 230 ? 15.228  -1.574  -3.363  1.00 23.25 ? 266 SER A O     1 
ATOM   1801 C  CB    . SER A 1 230 ? 18.368  -1.829  -2.764  1.00 29.76 ? 266 SER A CB    1 
ATOM   1802 O  OG    . SER A 1 230 ? 19.675  -1.815  -3.312  1.00 37.50 ? 266 SER A OG    1 
ATOM   1803 N  N     . SER A 1 231 ? 15.642  -3.482  -2.243  1.00 23.76 ? 267 SER A N     1 
ATOM   1804 C  CA    . SER A 1 231 ? 14.380  -3.427  -1.518  1.00 24.82 ? 267 SER A CA    1 
ATOM   1805 C  C     . SER A 1 231 ? 14.475  -2.371  -0.419  1.00 21.88 ? 267 SER A C     1 
ATOM   1806 O  O     . SER A 1 231 ? 15.578  -1.937  -0.060  1.00 18.52 ? 267 SER A O     1 
ATOM   1807 C  CB    . SER A 1 231 ? 14.088  -4.779  -0.883  1.00 27.11 ? 267 SER A CB    1 
ATOM   1808 O  OG    . SER A 1 231 ? 15.109  -5.091  0.045   1.00 24.06 ? 267 SER A OG    1 
ATOM   1809 N  N     . LEU A 1 232 ? 13.329  -1.968  0.125   1.00 22.48 ? 268 LEU A N     1 
ATOM   1810 C  CA    . LEU A 1 232 ? 13.301  -1.004  1.231   1.00 21.10 ? 268 LEU A CA    1 
ATOM   1811 C  C     . LEU A 1 232 ? 14.140  -1.498  2.399   1.00 22.95 ? 268 LEU A C     1 
ATOM   1812 O  O     . LEU A 1 232 ? 14.900  -0.732  3.001   1.00 19.89 ? 268 LEU A O     1 
ATOM   1813 C  CB    . LEU A 1 232 ? 11.856  -0.769  1.699   1.00 17.69 ? 268 LEU A CB    1 
ATOM   1814 C  CG    . LEU A 1 232 ? 11.683  0.100   2.943   1.00 21.96 ? 268 LEU A CG    1 
ATOM   1815 C  CD1   . LEU A 1 232 ? 12.255  1.467   2.698   1.00 21.12 ? 268 LEU A CD1   1 
ATOM   1816 C  CD2   . LEU A 1 232 ? 10.226  0.215   3.316   1.00 23.08 ? 268 LEU A CD2   1 
ATOM   1817 N  N     . GLY A 1 233 ? 13.980  -2.778  2.724   1.00 21.67 ? 269 GLY A N     1 
ATOM   1818 C  CA    . GLY A 1 233 ? 14.752  -3.412  3.782   1.00 23.37 ? 269 GLY A CA    1 
ATOM   1819 C  C     . GLY A 1 233 ? 16.248  -3.315  3.569   1.00 20.24 ? 269 GLY A C     1 
ATOM   1820 O  O     . GLY A 1 233 ? 16.980  -2.987  4.515   1.00 20.35 ? 269 GLY A O     1 
ATOM   1821 N  N     . SER A 1 234 ? 16.715  -3.611  2.355   1.00 19.11 ? 270 SER A N     1 
ATOM   1822 C  CA    . SER A 1 234 ? 18.138  -3.495  2.060   1.00 20.88 ? 270 SER A CA    1 
ATOM   1823 C  C     . SER A 1 234 ? 18.624  -2.050  2.206   1.00 22.21 ? 270 SER A C     1 
ATOM   1824 O  O     . SER A 1 234 ? 19.716  -1.820  2.731   1.00 18.66 ? 270 SER A O     1 
ATOM   1825 C  CB    . SER A 1 234 ? 18.474  -4.028  0.663   1.00 24.04 ? 270 SER A CB    1 
ATOM   1826 O  OG    . SER A 1 234 ? 18.183  -5.409  0.571   1.00 28.65 ? 270 SER A OG    1 
ATOM   1827 N  N     . LEU A 1 235 ? 17.821  -1.084  1.749   1.00 20.63 ? 271 LEU A N     1 
ATOM   1828 C  CA    . LEU A 1 235 ? 18.199  0.327   1.869   1.00 20.52 ? 271 LEU A CA    1 
ATOM   1829 C  C     . LEU A 1 235 ? 18.368  0.703   3.339   1.00 18.76 ? 271 LEU A C     1 
ATOM   1830 O  O     . LEU A 1 235 ? 19.323  1.395   3.698   1.00 17.23 ? 271 LEU A O     1 
ATOM   1831 C  CB    . LEU A 1 235 ? 17.157  1.258   1.227   1.00 21.72 ? 271 LEU A CB    1 
ATOM   1832 C  CG    . LEU A 1 235 ? 16.932  1.161   -0.284  1.00 25.15 ? 271 LEU A CG    1 
ATOM   1833 C  CD1   . LEU A 1 235 ? 15.965  2.229   -0.783  1.00 25.13 ? 271 LEU A CD1   1 
ATOM   1834 C  CD2   . LEU A 1 235 ? 18.228  1.251   -1.033  1.00 21.57 ? 271 LEU A CD2   1 
ATOM   1835 N  N     . LEU A 1 236 ? 17.438  0.269   4.190   1.00 18.63 ? 272 LEU A N     1 
ATOM   1836 C  CA    . LEU A 1 236 ? 17.498  0.660   5.597   1.00 18.23 ? 272 LEU A CA    1 
ATOM   1837 C  C     . LEU A 1 236 ? 18.684  0.041   6.316   1.00 20.38 ? 272 LEU A C     1 
ATOM   1838 O  O     . LEU A 1 236 ? 19.326  0.705   7.136   1.00 20.82 ? 272 LEU A O     1 
ATOM   1839 C  CB    . LEU A 1 236 ? 16.199  0.307   6.342   1.00 21.46 ? 272 LEU A CB    1 
ATOM   1840 C  CG    . LEU A 1 236 ? 15.126  1.364   6.187   1.00 25.45 ? 272 LEU A CG    1 
ATOM   1841 C  CD1   . LEU A 1 236 ? 13.798  0.781   6.610   1.00 26.59 ? 272 LEU A CD1   1 
ATOM   1842 C  CD2   . LEU A 1 236 ? 15.479  2.595   7.041   1.00 23.77 ? 272 LEU A CD2   1 
ATOM   1843 N  N     . HIS A 1 237 ? 18.958  -1.229  6.019   1.00 18.96 ? 273 HIS A N     1 
ATOM   1844 C  CA    . HIS A 1 237 ? 20.085  -1.931  6.627   1.00 21.93 ? 273 HIS A CA    1 
ATOM   1845 C  C     . HIS A 1 237 ? 21.371  -1.197  6.268   1.00 20.37 ? 273 HIS A C     1 
ATOM   1846 O  O     . HIS A 1 237 ? 22.205  -0.915  7.135   1.00 21.98 ? 273 HIS A O     1 
ATOM   1847 C  CB    . HIS A 1 237 ? 20.139  -3.388  6.160   1.00 20.67 ? 273 HIS A CB    1 
ATOM   1848 C  CG    . HIS A 1 237 ? 21.117  -4.232  6.929   1.00 27.46 ? 273 HIS A CG    1 
ATOM   1849 N  ND1   . HIS A 1 237 ? 21.390  -5.546  6.592   1.00 31.79 ? 273 HIS A ND1   1 
ATOM   1850 C  CD2   . HIS A 1 237 ? 21.873  -3.961  8.017   1.00 28.14 ? 273 HIS A CD2   1 
ATOM   1851 C  CE1   . HIS A 1 237 ? 22.284  -6.036  7.430   1.00 29.73 ? 273 HIS A CE1   1 
ATOM   1852 N  NE2   . HIS A 1 237 ? 22.594  -5.100  8.310   1.00 30.76 ? 273 HIS A NE2   1 
ATOM   1853 N  N     . GLY A 1 238 ? 21.511  -0.861  4.988   1.00 21.97 ? 274 GLY A N     1 
ATOM   1854 C  CA    . GLY A 1 238 ? 22.649  -0.095  4.517   1.00 20.75 ? 274 GLY A CA    1 
ATOM   1855 C  C     . GLY A 1 238 ? 22.807  1.261   5.185   1.00 20.91 ? 274 GLY A C     1 
ATOM   1856 O  O     . GLY A 1 238 ? 23.923  1.665   5.518   1.00 19.23 ? 274 GLY A O     1 
ATOM   1857 N  N     . PHE A 1 239 ? 21.693  1.976   5.349   1.00 17.32 ? 275 PHE A N     1 
ATOM   1858 C  CA    . PHE A 1 239 ? 21.688  3.271   5.979   1.00 19.62 ? 275 PHE A CA    1 
ATOM   1859 C  C     . PHE A 1 239 ? 22.169  3.128   7.423   1.00 18.24 ? 275 PHE A C     1 
ATOM   1860 O  O     . PHE A 1 239 ? 23.016  3.895   7.883   1.00 18.14 ? 275 PHE A O     1 
ATOM   1861 C  CB    . PHE A 1 239 ? 20.268  3.860   5.895   1.00 16.10 ? 275 PHE A CB    1 
ATOM   1862 C  CG    . PHE A 1 239 ? 20.016  4.989   6.828   1.00 17.86 ? 275 PHE A CG    1 
ATOM   1863 C  CD1   . PHE A 1 239 ? 20.419  6.288   6.512   1.00 16.46 ? 275 PHE A CD1   1 
ATOM   1864 C  CD2   . PHE A 1 239 ? 19.339  4.770   8.012   1.00 18.50 ? 275 PHE A CD2   1 
ATOM   1865 C  CE1   . PHE A 1 239 ? 20.158  7.329   7.393   1.00 14.11 ? 275 PHE A CE1   1 
ATOM   1866 C  CE2   . PHE A 1 239 ? 19.099  5.799   8.892   1.00 17.90 ? 275 PHE A CE2   1 
ATOM   1867 C  CZ    . PHE A 1 239 ? 19.497  7.076   8.583   1.00 16.00 ? 275 PHE A CZ    1 
ATOM   1868 N  N     . PHE A 1 240 ? 21.632  2.156   8.143   1.00 17.62 ? 276 PHE A N     1 
ATOM   1869 C  CA    . PHE A 1 240 ? 22.054  1.995   9.526   1.00 21.21 ? 276 PHE A CA    1 
ATOM   1870 C  C     . PHE A 1 240 ? 23.547  1.689   9.621   1.00 18.53 ? 276 PHE A C     1 
ATOM   1871 O  O     . PHE A 1 240 ? 24.242  2.245   10.478  1.00 17.85 ? 276 PHE A O     1 
ATOM   1872 C  CB    . PHE A 1 240 ? 21.228  0.912   10.229  1.00 17.95 ? 276 PHE A CB    1 
ATOM   1873 C  CG    . PHE A 1 240 ? 19.847  1.367   10.610  1.00 18.44 ? 276 PHE A CG    1 
ATOM   1874 C  CD1   . PHE A 1 240 ? 18.730  0.633   10.224  1.00 22.24 ? 276 PHE A CD1   1 
ATOM   1875 C  CD2   . PHE A 1 240 ? 19.671  2.534   11.342  1.00 19.27 ? 276 PHE A CD2   1 
ATOM   1876 C  CE1   . PHE A 1 240 ? 17.439  1.056   10.578  1.00 24.68 ? 276 PHE A CE1   1 
ATOM   1877 C  CE2   . PHE A 1 240 ? 18.405  2.966   11.700  1.00 22.55 ? 276 PHE A CE2   1 
ATOM   1878 C  CZ    . PHE A 1 240 ? 17.280  2.221   11.320  1.00 20.88 ? 276 PHE A CZ    1 
ATOM   1879 N  N     . ARG A 1 241 ? 24.034  0.817   8.741   1.00 18.56 ? 277 ARG A N     1 
ATOM   1880 C  CA    . ARG A 1 241 ? 25.443  0.425   8.777   1.00 23.16 ? 277 ARG A CA    1 
ATOM   1881 C  C     . ARG A 1 241 ? 26.384  1.574   8.436   1.00 21.88 ? 277 ARG A C     1 
ATOM   1882 O  O     . ARG A 1 241 ? 27.478  1.662   8.982   1.00 22.28 ? 277 ARG A O     1 
ATOM   1883 C  CB    . ARG A 1 241 ? 25.707  -0.760  7.851   1.00 22.35 ? 277 ARG A CB    1 
ATOM   1884 C  CG    . ARG A 1 241 ? 25.111  -2.090  8.315   1.00 26.18 ? 277 ARG A CG    1 
ATOM   1885 C  CD    . ARG A 1 241 ? 25.360  -3.156  7.266   1.00 27.17 ? 277 ARG A CD    1 
ATOM   1886 N  NE    . ARG A 1 241 ? 26.785  -3.248  6.948   1.00 31.08 ? 277 ARG A NE    1 
ATOM   1887 C  CZ    . ARG A 1 241 ? 27.645  -4.036  7.594   1.00 36.28 ? 277 ARG A CZ    1 
ATOM   1888 N  NH1   . ARG A 1 241 ? 27.227  -4.820  8.583   1.00 31.95 ? 277 ARG A NH1   1 
ATOM   1889 N  NH2   . ARG A 1 241 ? 28.924  -4.051  7.243   1.00 37.26 ? 277 ARG A NH2   1 
ATOM   1890 N  N     . PHE A 1 242 ? 25.966  2.459   7.535   1.00 20.83 ? 278 PHE A N     1 
ATOM   1891 C  CA    . PHE A 1 242 ? 26.828  3.572   7.144   1.00 22.50 ? 278 PHE A CA    1 
ATOM   1892 C  C     . PHE A 1 242 ? 27.110  4.500   8.312   1.00 23.68 ? 278 PHE A C     1 
ATOM   1893 O  O     . PHE A 1 242 ? 28.262  4.900   8.561   1.00 21.33 ? 278 PHE A O     1 
ATOM   1894 C  CB    . PHE A 1 242 ? 26.233  4.385   5.993   1.00 17.68 ? 278 PHE A CB    1 
ATOM   1895 C  CG    . PHE A 1 242 ? 27.066  5.565   5.631   1.00 19.98 ? 278 PHE A CG    1 
ATOM   1896 C  CD1   . PHE A 1 242 ? 28.279  5.390   4.984   1.00 23.02 ? 278 PHE A CD1   1 
ATOM   1897 C  CD2   . PHE A 1 242 ? 26.663  6.846   5.977   1.00 21.54 ? 278 PHE A CD2   1 
ATOM   1898 C  CE1   . PHE A 1 242 ? 29.074  6.477   4.660   1.00 26.65 ? 278 PHE A CE1   1 
ATOM   1899 C  CE2   . PHE A 1 242 ? 27.455  7.954   5.661   1.00 21.28 ? 278 PHE A CE2   1 
ATOM   1900 C  CZ    . PHE A 1 242 ? 28.662  7.765   5.008   1.00 18.71 ? 278 PHE A CZ    1 
ATOM   1901 N  N     . TYR A 1 243 ? 26.056  4.858   9.033   1.00 19.71 ? 279 TYR A N     1 
ATOM   1902 C  CA    . TYR A 1 243 ? 26.218  5.778   10.133  1.00 19.05 ? 279 TYR A CA    1 
ATOM   1903 C  C     . TYR A 1 243 ? 26.704  5.087   11.413  1.00 23.21 ? 279 TYR A C     1 
ATOM   1904 O  O     . TYR A 1 243 ? 27.211  5.746   12.306  1.00 25.33 ? 279 TYR A O     1 
ATOM   1905 C  CB    . TYR A 1 243 ? 24.924  6.572   10.366  1.00 18.45 ? 279 TYR A CB    1 
ATOM   1906 C  CG    . TYR A 1 243 ? 24.654  7.565   9.250   1.00 17.73 ? 279 TYR A CG    1 
ATOM   1907 C  CD1   . TYR A 1 243 ? 23.601  7.389   8.364   1.00 19.44 ? 279 TYR A CD1   1 
ATOM   1908 C  CD2   . TYR A 1 243 ? 25.479  8.655   9.071   1.00 19.12 ? 279 TYR A CD2   1 
ATOM   1909 C  CE1   . TYR A 1 243 ? 23.366  8.300   7.330   1.00 17.64 ? 279 TYR A CE1   1 
ATOM   1910 C  CE2   . TYR A 1 243 ? 25.258  9.574   8.044   1.00 19.27 ? 279 TYR A CE2   1 
ATOM   1911 C  CZ    . TYR A 1 243 ? 24.205  9.389   7.182   1.00 21.12 ? 279 TYR A CZ    1 
ATOM   1912 O  OH    . TYR A 1 243 ? 23.992  10.313  6.175   1.00 20.34 ? 279 TYR A OH    1 
ATOM   1913 N  N     . ALA A 1 244 ? 26.531  3.774   11.504  1.00 21.76 ? 280 ALA A N     1 
ATOM   1914 C  CA    . ALA A 1 244 ? 27.105  3.025   12.628  1.00 28.47 ? 280 ALA A CA    1 
ATOM   1915 C  C     . ALA A 1 244 ? 28.626  2.908   12.496  1.00 25.12 ? 280 ALA A C     1 
ATOM   1916 O  O     . ALA A 1 244 ? 29.357  3.112   13.460  1.00 28.88 ? 280 ALA A O     1 
ATOM   1917 C  CB    . ALA A 1 244 ? 26.476  1.630   12.750  1.00 24.29 ? 280 ALA A CB    1 
ATOM   1918 N  N     . TYR A 1 245 ? 29.100  2.581   11.299  1.00 24.16 ? 281 TYR A N     1 
ATOM   1919 C  CA    . TYR A 1 245 ? 30.480  2.108   11.149  1.00 28.14 ? 281 TYR A CA    1 
ATOM   1920 C  C     . TYR A 1 245 ? 31.396  2.932   10.240  1.00 31.37 ? 281 TYR A C     1 
ATOM   1921 O  O     . TYR A 1 245 ? 32.605  2.981   10.459  1.00 32.09 ? 281 TYR A O     1 
ATOM   1922 C  CB    . TYR A 1 245 ? 30.464  0.667   10.633  1.00 25.46 ? 281 TYR A CB    1 
ATOM   1923 C  CG    . TYR A 1 245 ? 29.630  -0.290  11.454  1.00 27.00 ? 281 TYR A CG    1 
ATOM   1924 C  CD1   . TYR A 1 245 ? 28.830  -1.244  10.831  1.00 35.17 ? 281 TYR A CD1   1 
ATOM   1925 C  CD2   . TYR A 1 245 ? 29.663  -0.262  12.842  1.00 28.80 ? 281 TYR A CD2   1 
ATOM   1926 C  CE1   . TYR A 1 245 ? 28.069  -2.136  11.573  1.00 35.03 ? 281 TYR A CE1   1 
ATOM   1927 C  CE2   . TYR A 1 245 ? 28.908  -1.149  13.596  1.00 32.82 ? 281 TYR A CE2   1 
ATOM   1928 C  CZ    . TYR A 1 245 ? 28.114  -2.080  12.954  1.00 36.11 ? 281 TYR A CZ    1 
ATOM   1929 O  OH    . TYR A 1 245 ? 27.358  -2.958  13.700  1.00 42.75 ? 281 TYR A OH    1 
ATOM   1930 N  N     . LYS A 1 246 ? 30.832  3.553   9.210   1.00 25.86 ? 282 LYS A N     1 
ATOM   1931 C  CA    . LYS A 1 246 ? 31.639  4.137   8.138   1.00 26.33 ? 282 LYS A CA    1 
ATOM   1932 C  C     . LYS A 1 246 ? 31.779  5.652   8.222   1.00 31.70 ? 282 LYS A C     1 
ATOM   1933 O  O     . LYS A 1 246 ? 32.866  6.213   8.031   1.00 29.97 ? 282 LYS A O     1 
ATOM   1934 C  CB    . LYS A 1 246 ? 31.027  3.790   6.781   1.00 28.80 ? 282 LYS A CB    1 
ATOM   1935 C  CG    . LYS A 1 246 ? 31.986  3.163   5.788   1.00 38.82 ? 282 LYS A CG    1 
ATOM   1936 C  CD    . LYS A 1 246 ? 33.238  3.983   5.609   1.00 43.22 ? 282 LYS A CD    1 
ATOM   1937 C  CE    . LYS A 1 246 ? 33.650  4.002   4.139   1.00 46.44 ? 282 LYS A CE    1 
ATOM   1938 N  NZ    . LYS A 1 246 ? 33.596  2.642   3.530   1.00 50.94 ? 282 LYS A NZ    1 
ATOM   1939 N  N     . PHE A 1 247 ? 30.664  6.329   8.452   1.00 28.93 ? 283 PHE A N     1 
ATOM   1940 C  CA    . PHE A 1 247 ? 30.697  7.781   8.544   1.00 27.19 ? 283 PHE A CA    1 
ATOM   1941 C  C     . PHE A 1 247 ? 31.559  8.207   9.732   1.00 28.71 ? 283 PHE A C     1 
ATOM   1942 O  O     . PHE A 1 247 ? 31.494  7.597   10.793  1.00 29.26 ? 283 PHE A O     1 
ATOM   1943 C  CB    . PHE A 1 247 ? 29.284  8.333   8.698   1.00 25.12 ? 283 PHE A CB    1 
ATOM   1944 C  CG    . PHE A 1 247 ? 29.229  9.824   8.795   1.00 22.75 ? 283 PHE A CG    1 
ATOM   1945 C  CD1   . PHE A 1 247 ? 29.493  10.606  7.683   1.00 28.20 ? 283 PHE A CD1   1 
ATOM   1946 C  CD2   . PHE A 1 247 ? 28.907  10.442  9.989   1.00 26.58 ? 283 PHE A CD2   1 
ATOM   1947 C  CE1   . PHE A 1 247 ? 29.445  11.991  7.761   1.00 28.12 ? 283 PHE A CE1   1 
ATOM   1948 C  CE2   . PHE A 1 247 ? 28.845  11.825  10.077  1.00 29.24 ? 283 PHE A CE2   1 
ATOM   1949 C  CZ    . PHE A 1 247 ? 29.125  12.602  8.957   1.00 27.47 ? 283 PHE A CZ    1 
ATOM   1950 N  N     . GLU A 1 248 ? 32.371  9.244   9.553   1.00 29.14 ? 284 GLU A N     1 
ATOM   1951 C  CA    . GLU A 1 248 ? 33.243  9.707   10.633  1.00 30.66 ? 284 GLU A CA    1 
ATOM   1952 C  C     . GLU A 1 248 ? 32.852  11.101  11.074  1.00 27.71 ? 284 GLU A C     1 
ATOM   1953 O  O     . GLU A 1 248 ? 33.346  12.085  10.524  1.00 33.02 ? 284 GLU A O     1 
ATOM   1954 C  CB    . GLU A 1 248 ? 34.703  9.693   10.172  1.00 38.44 ? 284 GLU A CB    1 
ATOM   1955 C  CG    . GLU A 1 248 ? 35.156  8.339   9.648   1.00 38.43 ? 284 GLU A CG    1 
ATOM   1956 C  CD    . GLU A 1 248 ? 36.187  8.434   8.533   1.00 50.91 ? 284 GLU A CD    1 
ATOM   1957 O  OE1   . GLU A 1 248 ? 35.895  9.061   7.484   1.00 55.93 ? 284 GLU A OE1   1 
ATOM   1958 O  OE2   . GLU A 1 248 ? 37.291  7.874   8.707   1.00 60.30 ? 284 GLU A OE2   1 
ATOM   1959 N  N     . PRO A 1 249 ? 31.974  11.195  12.085  1.00 27.11 ? 285 PRO A N     1 
ATOM   1960 C  CA    . PRO A 1 249 ? 31.378  12.489  12.419  1.00 29.70 ? 285 PRO A CA    1 
ATOM   1961 C  C     . PRO A 1 249 ? 32.357  13.447  13.068  1.00 34.02 ? 285 PRO A C     1 
ATOM   1962 O  O     . PRO A 1 249 ? 32.067  14.627  13.117  1.00 29.85 ? 285 PRO A O     1 
ATOM   1963 C  CB    . PRO A 1 249 ? 30.256  12.128  13.407  1.00 31.28 ? 285 PRO A CB    1 
ATOM   1964 C  CG    . PRO A 1 249 ? 30.613  10.776  13.942  1.00 33.90 ? 285 PRO A CG    1 
ATOM   1965 C  CD    . PRO A 1 249 ? 31.416  10.087  12.884  1.00 29.01 ? 285 PRO A CD    1 
ATOM   1966 N  N     . ARG A 1 250 ? 33.487  12.951  13.561  1.00 37.31 ? 286 ARG A N     1 
ATOM   1967 C  CA    . ARG A 1 250 ? 34.485  13.834  14.162  1.00 38.41 ? 286 ARG A CA    1 
ATOM   1968 C  C     . ARG A 1 250 ? 35.172  14.665  13.083  1.00 37.75 ? 286 ARG A C     1 
ATOM   1969 O  O     . ARG A 1 250 ? 35.587  15.798  13.326  1.00 40.40 ? 286 ARG A O     1 
ATOM   1970 C  CB    . ARG A 1 250 ? 35.509  13.009  14.954  1.00 43.71 ? 286 ARG A CB    1 
ATOM   1971 C  CG    . ARG A 1 250 ? 34.878  12.152  16.059  1.00 45.33 ? 286 ARG A CG    1 
ATOM   1972 C  CD    . ARG A 1 250 ? 35.747  10.946  16.434  1.00 58.36 ? 286 ARG A CD    1 
ATOM   1973 N  NE    . ARG A 1 250 ? 36.994  11.321  17.103  1.00 66.23 ? 286 ARG A NE    1 
ATOM   1974 C  CZ    . ARG A 1 250 ? 37.500  10.687  18.161  1.00 61.82 ? 286 ARG A CZ    1 
ATOM   1975 N  NH1   . ARG A 1 250 ? 36.869  9.645   18.687  1.00 61.42 ? 286 ARG A NH1   1 
ATOM   1976 N  NH2   . ARG A 1 250 ? 38.639  11.099  18.698  1.00 57.09 ? 286 ARG A NH2   1 
ATOM   1977 N  N     . GLU A 1 251 ? 35.263  14.105  11.881  1.00 29.97 ? 287 GLU A N     1 
ATOM   1978 C  CA    . GLU A 1 251 ? 36.008  14.725  10.791  1.00 38.28 ? 287 GLU A CA    1 
ATOM   1979 C  C     . GLU A 1 251 ? 35.148  15.228  9.621   1.00 36.44 ? 287 GLU A C     1 
ATOM   1980 O  O     . GLU A 1 251 ? 35.540  16.161  8.922   1.00 32.58 ? 287 GLU A O     1 
ATOM   1981 C  CB    . GLU A 1 251 ? 37.033  13.718  10.248  1.00 42.94 ? 287 GLU A CB    1 
ATOM   1982 C  CG    . GLU A 1 251 ? 37.987  14.275  9.195   1.00 51.84 ? 287 GLU A CG    1 
ATOM   1983 C  CD    . GLU A 1 251 ? 38.915  13.211  8.620   1.00 58.44 ? 287 GLU A CD    1 
ATOM   1984 O  OE1   . GLU A 1 251 ? 39.166  12.196  9.312   1.00 63.19 ? 287 GLU A OE1   1 
ATOM   1985 O  OE2   . GLU A 1 251 ? 39.386  13.393  7.473   1.00 56.22 ? 287 GLU A OE2   1 
ATOM   1986 N  N     . LYS A 1 252 ? 33.995  14.601  9.387   1.00 29.53 ? 288 LYS A N     1 
ATOM   1987 C  CA    . LYS A 1 252 ? 33.280  14.813  8.122   1.00 29.07 ? 288 LYS A CA    1 
ATOM   1988 C  C     . LYS A 1 252 ? 31.963  15.578  8.267   1.00 25.25 ? 288 LYS A C     1 
ATOM   1989 O  O     . LYS A 1 252 ? 31.381  15.650  9.351   1.00 26.04 ? 288 LYS A O     1 
ATOM   1990 C  CB    . LYS A 1 252 ? 33.043  13.476  7.400   1.00 28.68 ? 288 LYS A CB    1 
ATOM   1991 C  CG    . LYS A 1 252 ? 34.320  12.714  7.067   1.00 33.77 ? 288 LYS A CG    1 
ATOM   1992 C  CD    . LYS A 1 252 ? 35.129  13.485  6.039   1.00 39.51 ? 288 LYS A CD    1 
ATOM   1993 C  CE    . LYS A 1 252 ? 36.557  12.977  5.947   1.00 45.36 ? 288 LYS A CE    1 
ATOM   1994 N  NZ    . LYS A 1 252 ? 36.615  11.608  5.370   1.00 50.51 ? 288 LYS A NZ    1 
ATOM   1995 N  N     . VAL A 1 253 ? 31.514  16.149  7.151   1.00 28.71 ? 289 VAL A N     1 
ATOM   1996 C  CA    . VAL A 1 253 ? 30.264  16.889  7.091   1.00 24.17 ? 289 VAL A CA    1 
ATOM   1997 C  C     . VAL A 1 253 ? 29.326  16.192  6.107   1.00 21.03 ? 289 VAL A C     1 
ATOM   1998 O  O     . VAL A 1 253 ? 29.712  15.880  4.978   1.00 20.31 ? 289 VAL A O     1 
ATOM   1999 C  CB    . VAL A 1 253 ? 30.476  18.332  6.589   1.00 25.63 ? 289 VAL A CB    1 
ATOM   2000 C  CG1   . VAL A 1 253 ? 29.159  19.093  6.624   1.00 23.36 ? 289 VAL A CG1   1 
ATOM   2001 C  CG2   . VAL A 1 253 ? 31.540  19.067  7.430   1.00 24.55 ? 289 VAL A CG2   1 
ATOM   2002 N  N     . VAL A 1 254 ? 28.094  15.940  6.539   1.00 24.11 ? 290 VAL A N     1 
ATOM   2003 C  CA    . VAL A 1 254 ? 27.055  15.518  5.610   1.00 22.97 ? 290 VAL A CA    1 
ATOM   2004 C  C     . VAL A 1 254 ? 26.758  16.725  4.726   1.00 21.23 ? 290 VAL A C     1 
ATOM   2005 O  O     . VAL A 1 254 ? 26.379  17.780  5.226   1.00 23.97 ? 290 VAL A O     1 
ATOM   2006 C  CB    . VAL A 1 254 ? 25.793  15.087  6.348   1.00 19.55 ? 290 VAL A CB    1 
ATOM   2007 C  CG1   . VAL A 1 254 ? 24.655  14.909  5.375   1.00 22.35 ? 290 VAL A CG1   1 
ATOM   2008 C  CG2   . VAL A 1 254 ? 26.037  13.773  7.121   1.00 22.66 ? 290 VAL A CG2   1 
ATOM   2009 N  N     . THR A 1 255 ? 26.947  16.574  3.420   1.00 21.37 ? 291 THR A N     1 
ATOM   2010 C  CA    . THR A 1 255 ? 26.813  17.695  2.509   1.00 23.01 ? 291 THR A CA    1 
ATOM   2011 C  C     . THR A 1 255 ? 26.136  17.296  1.213   1.00 22.39 ? 291 THR A C     1 
ATOM   2012 O  O     . THR A 1 255 ? 26.224  16.148  0.775   1.00 21.05 ? 291 THR A O     1 
ATOM   2013 C  CB    . THR A 1 255 ? 28.203  18.336  2.194   1.00 28.81 ? 291 THR A CB    1 
ATOM   2014 O  OG1   . THR A 1 255 ? 28.044  19.421  1.271   1.00 26.99 ? 291 THR A OG1   1 
ATOM   2015 C  CG2   . THR A 1 255 ? 29.137  17.299  1.593   1.00 25.51 ? 291 THR A CG2   1 
ATOM   2016 N  N     . PHE A 1 256 ? 25.449  18.260  0.609   1.00 19.80 ? 292 PHE A N     1 
ATOM   2017 C  CA    . PHE A 1 256 ? 24.853  18.090  -0.714  1.00 21.16 ? 292 PHE A CA    1 
ATOM   2018 C  C     . PHE A 1 256 ? 25.542  18.974  -1.759  1.00 24.66 ? 292 PHE A C     1 
ATOM   2019 O  O     . PHE A 1 256 ? 25.055  19.129  -2.881  1.00 26.62 ? 292 PHE A O     1 
ATOM   2020 C  CB    . PHE A 1 256 ? 23.354  18.393  -0.623  1.00 20.00 ? 292 PHE A CB    1 
ATOM   2021 C  CG    . PHE A 1 256 ? 22.668  17.551  0.415   1.00 22.31 ? 292 PHE A CG    1 
ATOM   2022 C  CD1   . PHE A 1 256 ? 22.298  16.249  0.118   1.00 23.34 ? 292 PHE A CD1   1 
ATOM   2023 C  CD2   . PHE A 1 256 ? 22.494  18.019  1.709   1.00 20.31 ? 292 PHE A CD2   1 
ATOM   2024 C  CE1   . PHE A 1 256 ? 21.712  15.429  1.091   1.00 20.14 ? 292 PHE A CE1   1 
ATOM   2025 C  CE2   . PHE A 1 256 ? 21.909  17.202  2.688   1.00 20.11 ? 292 PHE A CE2   1 
ATOM   2026 C  CZ    . PHE A 1 256 ? 21.519  15.917  2.373   1.00 18.62 ? 292 PHE A CZ    1 
ATOM   2027 N  N     . ARG A 1 257 ? 26.687  19.538  -1.390  1.00 21.93 ? 293 ARG A N     1 
ATOM   2028 C  CA    . ARG A 1 257 ? 27.360  20.497  -2.272  1.00 23.41 ? 293 ARG A CA    1 
ATOM   2029 C  C     . ARG A 1 257 ? 28.663  19.986  -2.896  1.00 27.79 ? 293 ARG A C     1 
ATOM   2030 O  O     . ARG A 1 257 ? 29.422  20.766  -3.482  1.00 29.64 ? 293 ARG A O     1 
ATOM   2031 C  CB    . ARG A 1 257 ? 27.626  21.806  -1.525  1.00 27.35 ? 293 ARG A CB    1 
ATOM   2032 C  CG    . ARG A 1 257 ? 26.871  22.984  -2.096  1.00 41.53 ? 293 ARG A CG    1 
ATOM   2033 C  CD    . ARG A 1 257 ? 25.565  23.145  -1.387  1.00 34.61 ? 293 ARG A CD    1 
ATOM   2034 N  NE    . ARG A 1 257 ? 24.453  23.464  -2.274  1.00 35.22 ? 293 ARG A NE    1 
ATOM   2035 C  CZ    . ARG A 1 257 ? 23.923  24.672  -2.417  1.00 40.81 ? 293 ARG A CZ    1 
ATOM   2036 N  NH1   . ARG A 1 257 ? 24.416  25.704  -1.748  1.00 43.81 ? 293 ARG A NH1   1 
ATOM   2037 N  NH2   . ARG A 1 257 ? 22.897  24.851  -3.241  1.00 46.22 ? 293 ARG A NH2   1 
ATOM   2038 N  N     . ARG A 1 258 ? 28.924  18.691  -2.776  1.00 25.22 ? 294 ARG A N     1 
ATOM   2039 C  CA    . ARG A 1 258 ? 30.126  18.098  -3.367  1.00 26.28 ? 294 ARG A CA    1 
ATOM   2040 C  C     . ARG A 1 258 ? 29.769  16.900  -4.227  1.00 28.17 ? 294 ARG A C     1 
ATOM   2041 O  O     . ARG A 1 258 ? 29.005  16.034  -3.805  1.00 28.01 ? 294 ARG A O     1 
ATOM   2042 C  CB    . ARG A 1 258 ? 31.114  17.674  -2.280  1.00 25.05 ? 294 ARG A CB    1 
ATOM   2043 C  CG    . ARG A 1 258 ? 31.639  18.826  -1.437  1.00 30.10 ? 294 ARG A CG    1 
ATOM   2044 C  CD    . ARG A 1 258 ? 32.648  19.633  -2.230  1.00 36.60 ? 294 ARG A CD    1 
ATOM   2045 N  NE    . ARG A 1 258 ? 32.825  20.981  -1.694  1.00 45.82 ? 294 ARG A NE    1 
ATOM   2046 C  CZ    . ARG A 1 258 ? 33.929  21.409  -1.090  1.00 52.53 ? 294 ARG A CZ    1 
ATOM   2047 N  NH1   . ARG A 1 258 ? 34.970  20.593  -0.941  1.00 52.36 ? 294 ARG A NH1   1 
ATOM   2048 N  NH2   . ARG A 1 258 ? 33.993  22.659  -0.643  1.00 54.91 ? 294 ARG A NH2   1 
ATOM   2049 N  N     . PRO A 1 259 ? 30.351  16.833  -5.436  1.00 33.66 ? 295 PRO A N     1 
ATOM   2050 C  CA    . PRO A 1 259 ? 30.051  15.779  -6.416  1.00 29.55 ? 295 PRO A CA    1 
ATOM   2051 C  C     . PRO A 1 259 ? 30.237  14.371  -5.855  1.00 31.52 ? 295 PRO A C     1 
ATOM   2052 O  O     . PRO A 1 259 ? 29.468  13.468  -6.205  1.00 34.95 ? 295 PRO A O     1 
ATOM   2053 C  CB    . PRO A 1 259 ? 31.058  16.055  -7.537  1.00 31.72 ? 295 PRO A CB    1 
ATOM   2054 C  CG    . PRO A 1 259 ? 31.344  17.521  -7.430  1.00 36.56 ? 295 PRO A CG    1 
ATOM   2055 C  CD    . PRO A 1 259 ? 31.318  17.820  -5.957  1.00 34.09 ? 295 PRO A CD    1 
ATOM   2056 N  N     . ASP A 1 260 ? 31.220  14.198  -4.971  1.00 30.51 ? 296 ASP A N     1 
ATOM   2057 C  CA    . ASP A 1 260 ? 31.491  12.897  -4.359  1.00 39.07 ? 296 ASP A CA    1 
ATOM   2058 C  C     . ASP A 1 260 ? 31.050  12.827  -2.895  1.00 35.59 ? 296 ASP A C     1 
ATOM   2059 O  O     . ASP A 1 260 ? 31.346  11.850  -2.191  1.00 32.15 ? 296 ASP A O     1 
ATOM   2060 C  CB    . ASP A 1 260 ? 32.984  12.592  -4.440  1.00 36.56 ? 296 ASP A CB    1 
ATOM   2061 C  CG    . ASP A 1 260 ? 33.827  13.594  -3.672  1.00 40.27 ? 296 ASP A CG    1 
ATOM   2062 O  OD1   . ASP A 1 260 ? 33.306  14.658  -3.252  1.00 36.05 ? 296 ASP A OD1   1 
ATOM   2063 O  OD2   . ASP A 1 260 ? 35.034  13.318  -3.500  1.00 47.93 ? 296 ASP A OD2   1 
ATOM   2064 N  N     . GLY A 1 261 ? 30.378  13.880  -2.439  1.00 31.15 ? 297 GLY A N     1 
ATOM   2065 C  CA    . GLY A 1 261 ? 29.846  13.944  -1.089  1.00 29.04 ? 297 GLY A CA    1 
ATOM   2066 C  C     . GLY A 1 261 ? 30.898  14.064  -0.005  1.00 30.34 ? 297 GLY A C     1 
ATOM   2067 O  O     . GLY A 1 261 ? 30.596  13.822  1.159   1.00 27.78 ? 297 GLY A O     1 
ATOM   2068 N  N     . TYR A 1 262 ? 32.126  14.438  -0.379  1.00 30.55 ? 298 TYR A N     1 
ATOM   2069 C  CA    . TYR A 1 262 ? 33.244  14.512  0.575   1.00 28.65 ? 298 TYR A CA    1 
ATOM   2070 C  C     . TYR A 1 262 ? 33.519  15.949  1.035   1.00 31.86 ? 298 TYR A C     1 
ATOM   2071 O  O     . TYR A 1 262 ? 33.810  16.821  0.214   1.00 34.26 ? 298 TYR A O     1 
ATOM   2072 C  CB    . TYR A 1 262 ? 34.513  13.902  -0.054  1.00 36.08 ? 298 TYR A CB    1 
ATOM   2073 C  CG    . TYR A 1 262 ? 35.742  13.909  0.840   1.00 41.68 ? 298 TYR A CG    1 
ATOM   2074 C  CD1   . TYR A 1 262 ? 36.079  12.791  1.599   1.00 42.22 ? 298 TYR A CD1   1 
ATOM   2075 C  CD2   . TYR A 1 262 ? 36.573  15.028  0.913   1.00 38.30 ? 298 TYR A CD2   1 
ATOM   2076 C  CE1   . TYR A 1 262 ? 37.203  12.790  2.417   1.00 45.28 ? 298 TYR A CE1   1 
ATOM   2077 C  CE2   . TYR A 1 262 ? 37.696  15.040  1.731   1.00 40.29 ? 298 TYR A CE2   1 
ATOM   2078 C  CZ    . TYR A 1 262 ? 38.005  13.917  2.480   1.00 51.15 ? 298 TYR A CZ    1 
ATOM   2079 O  OH    . TYR A 1 262 ? 39.123  13.924  3.291   1.00 58.97 ? 298 TYR A OH    1 
ATOM   2080 N  N     . LEU A 1 263 ? 33.450  16.193  2.344   1.00 29.07 ? 299 LEU A N     1 
ATOM   2081 C  CA    . LEU A 1 263 ? 33.669  17.537  2.886   1.00 29.91 ? 299 LEU A CA    1 
ATOM   2082 C  C     . LEU A 1 263 ? 34.137  17.423  4.326   1.00 32.78 ? 299 LEU A C     1 
ATOM   2083 O  O     . LEU A 1 263 ? 33.446  16.821  5.147   1.00 29.41 ? 299 LEU A O     1 
ATOM   2084 C  CB    . LEU A 1 263 ? 32.357  18.330  2.871   1.00 26.46 ? 299 LEU A CB    1 
ATOM   2085 C  CG    . LEU A 1 263 ? 32.290  19.829  2.586   1.00 39.52 ? 299 LEU A CG    1 
ATOM   2086 C  CD1   . LEU A 1 263 ? 31.197  20.513  3.433   1.00 30.71 ? 299 LEU A CD1   1 
ATOM   2087 C  CD2   . LEU A 1 263 ? 33.640  20.518  2.749   1.00 41.87 ? 299 LEU A CD2   1 
ATOM   2088 N  N     . THR A 1 264 ? 35.294  18.005  4.649   1.00 31.59 ? 300 THR A N     1 
ATOM   2089 C  CA    . THR A 1 264 ? 35.813  17.947  6.024   1.00 31.42 ? 300 THR A CA    1 
ATOM   2090 C  C     . THR A 1 264 ? 35.288  19.105  6.854   1.00 27.25 ? 300 THR A C     1 
ATOM   2091 O  O     . THR A 1 264 ? 34.957  20.163  6.313   1.00 35.39 ? 300 THR A O     1 
ATOM   2092 C  CB    . THR A 1 264 ? 37.359  17.971  6.080   1.00 34.44 ? 300 THR A CB    1 
ATOM   2093 O  OG1   . THR A 1 264 ? 37.836  19.190  5.490   1.00 32.38 ? 300 THR A OG1   1 
ATOM   2094 C  CG2   . THR A 1 264 ? 37.954  16.761  5.360   1.00 35.72 ? 300 THR A CG2   1 
ATOM   2095 N  N     . LYS A 1 265 ? 35.213  18.921  8.168   1.00 25.01 ? 301 LYS A N     1 
ATOM   2096 C  CA    . LYS A 1 265 ? 34.841  20.032  9.042   1.00 33.14 ? 301 LYS A CA    1 
ATOM   2097 C  C     . LYS A 1 265 ? 35.878  21.149  8.927   1.00 35.82 ? 301 LYS A C     1 
ATOM   2098 O  O     . LYS A 1 265 ? 35.575  22.339  9.078   1.00 32.19 ? 301 LYS A O     1 
ATOM   2099 C  CB    . LYS A 1 265 ? 34.758  19.563  10.490  1.00 33.12 ? 301 LYS A CB    1 
ATOM   2100 C  CG    . LYS A 1 265 ? 33.539  18.725  10.833  1.00 31.54 ? 301 LYS A CG    1 
ATOM   2101 C  CD    . LYS A 1 265 ? 33.586  18.367  12.310  1.00 37.10 ? 301 LYS A CD    1 
ATOM   2102 C  CE    . LYS A 1 265 ? 32.402  17.554  12.708  1.00 31.64 ? 301 LYS A CE    1 
ATOM   2103 N  NZ    . LYS A 1 265 ? 32.447  17.181  14.157  1.00 30.52 ? 301 LYS A NZ    1 
ATOM   2104 N  N     . GLN A 1 266 ? 37.111  20.745  8.655   1.00 38.43 ? 302 GLN A N     1 
ATOM   2105 C  CA    . GLN A 1 266 ? 38.225  21.680  8.517   1.00 41.93 ? 302 GLN A CA    1 
ATOM   2106 C  C     . GLN A 1 266 ? 38.009  22.659  7.363   1.00 39.70 ? 302 GLN A C     1 
ATOM   2107 O  O     . GLN A 1 266 ? 38.117  23.881  7.519   1.00 44.49 ? 302 GLN A O     1 
ATOM   2108 C  CB    . GLN A 1 266 ? 39.515  20.891  8.287   1.00 41.89 ? 302 GLN A CB    1 
ATOM   2109 C  CG    . GLN A 1 266 ? 40.663  21.378  9.119   1.00 50.12 ? 302 GLN A CG    1 
ATOM   2110 C  CD    . GLN A 1 266 ? 40.684  22.887  9.206   1.00 48.51 ? 302 GLN A CD    1 
ATOM   2111 O  OE1   . GLN A 1 266 ? 40.358  23.464  10.245  1.00 52.49 ? 302 GLN A OE1   1 
ATOM   2112 N  NE2   . GLN A 1 266 ? 41.055  23.540  8.105   1.00 51.02 ? 302 GLN A NE2   1 
ATOM   2113 N  N     . GLU A 1 267 ? 37.704  22.099  6.200   1.00 38.10 ? 303 GLU A N     1 
ATOM   2114 C  CA    . GLU A 1 267 ? 37.519  22.859  4.974   1.00 39.69 ? 303 GLU A CA    1 
ATOM   2115 C  C     . GLU A 1 267 ? 36.311  23.787  5.093   1.00 42.94 ? 303 GLU A C     1 
ATOM   2116 O  O     . GLU A 1 267 ? 36.320  24.926  4.623   1.00 39.74 ? 303 GLU A O     1 
ATOM   2117 C  CB    . GLU A 1 267 ? 37.322  21.874  3.816   1.00 38.82 ? 303 GLU A CB    1 
ATOM   2118 C  CG    . GLU A 1 267 ? 37.612  22.443  2.444   1.00 50.88 ? 303 GLU A CG    1 
ATOM   2119 C  CD    . GLU A 1 267 ? 36.694  21.878  1.378   1.00 57.11 ? 303 GLU A CD    1 
ATOM   2120 O  OE1   . GLU A 1 267 ? 35.939  22.676  0.780   1.00 61.10 ? 303 GLU A OE1   1 
ATOM   2121 O  OE2   . GLU A 1 267 ? 36.725  20.647  1.141   1.00 57.02 ? 303 GLU A OE2   1 
ATOM   2122 N  N     . LYS A 1 268 ? 35.277  23.279  5.749   1.00 38.88 ? 304 LYS A N     1 
ATOM   2123 C  CA    . LYS A 1 268 ? 34.034  23.998  5.948   1.00 36.02 ? 304 LYS A CA    1 
ATOM   2124 C  C     . LYS A 1 268 ? 34.201  25.094  7.006   1.00 39.14 ? 304 LYS A C     1 
ATOM   2125 O  O     . LYS A 1 268 ? 33.387  26.016  7.104   1.00 40.73 ? 304 LYS A O     1 
ATOM   2126 C  CB    . LYS A 1 268 ? 32.962  22.980  6.369   1.00 34.45 ? 304 LYS A CB    1 
ATOM   2127 C  CG    . LYS A 1 268 ? 31.561  23.531  6.522   1.00 37.16 ? 304 LYS A CG    1 
ATOM   2128 C  CD    . LYS A 1 268 ? 30.962  24.028  5.201   1.00 35.13 ? 304 LYS A CD    1 
ATOM   2129 C  CE    . LYS A 1 268 ? 29.765  24.928  5.497   1.00 32.74 ? 304 LYS A CE    1 
ATOM   2130 N  NZ    . LYS A 1 268 ? 29.024  25.302  4.276   1.00 27.24 ? 304 LYS A NZ    1 
ATOM   2131 N  N     . GLY A 1 269 ? 35.271  25.005  7.790   1.00 36.87 ? 305 GLY A N     1 
ATOM   2132 C  CA    . GLY A 1 269 ? 35.480  25.943  8.878   1.00 37.99 ? 305 GLY A CA    1 
ATOM   2133 C  C     . GLY A 1 269 ? 34.547  25.684  10.046  1.00 41.29 ? 305 GLY A C     1 
ATOM   2134 O  O     . GLY A 1 269 ? 34.252  26.589  10.828  1.00 38.32 ? 305 GLY A O     1 
ATOM   2135 N  N     . TRP A 1 270 ? 34.078  24.443  10.159  1.00 38.07 ? 306 TRP A N     1 
ATOM   2136 C  CA    . TRP A 1 270 ? 33.184  24.032  11.238  1.00 40.10 ? 306 TRP A CA    1 
ATOM   2137 C  C     . TRP A 1 270 ? 33.912  23.191  12.290  1.00 40.94 ? 306 TRP A C     1 
ATOM   2138 O  O     . TRP A 1 270 ? 33.603  22.015  12.470  1.00 37.26 ? 306 TRP A O     1 
ATOM   2139 C  CB    . TRP A 1 270 ? 32.008  23.235  10.657  1.00 36.68 ? 306 TRP A CB    1 
ATOM   2140 C  CG    . TRP A 1 270 ? 30.930  24.118  10.100  1.00 36.81 ? 306 TRP A CG    1 
ATOM   2141 C  CD1   . TRP A 1 270 ? 30.939  25.483  10.048  1.00 32.56 ? 306 TRP A CD1   1 
ATOM   2142 C  CD2   . TRP A 1 270 ? 29.687  23.701  9.518   1.00 30.90 ? 306 TRP A CD2   1 
ATOM   2143 N  NE1   . TRP A 1 270 ? 29.776  25.944  9.479   1.00 34.80 ? 306 TRP A NE1   1 
ATOM   2144 C  CE2   . TRP A 1 270 ? 28.991  24.869  9.140   1.00 34.39 ? 306 TRP A CE2   1 
ATOM   2145 C  CE3   . TRP A 1 270 ? 29.092  22.450  9.284   1.00 30.20 ? 306 TRP A CE3   1 
ATOM   2146 C  CZ2   . TRP A 1 270 ? 27.725  24.828  8.535   1.00 30.53 ? 306 TRP A CZ2   1 
ATOM   2147 C  CZ3   . TRP A 1 270 ? 27.835  22.411  8.677   1.00 24.85 ? 306 TRP A CZ3   1 
ATOM   2148 C  CH2   . TRP A 1 270 ? 27.170  23.591  8.311   1.00 26.97 ? 306 TRP A CH2   1 
ATOM   2149 N  N     . THR A 1 271 ? 34.852  23.807  13.004  1.00 44.98 ? 307 THR A N     1 
ATOM   2150 C  CA    . THR A 1 271 ? 35.799  23.061  13.840  1.00 46.38 ? 307 THR A CA    1 
ATOM   2151 C  C     . THR A 1 271 ? 35.696  23.288  15.355  1.00 49.25 ? 307 THR A C     1 
ATOM   2152 O  O     . THR A 1 271 ? 35.970  22.376  16.142  1.00 56.78 ? 307 THR A O     1 
ATOM   2153 C  CB    . THR A 1 271 ? 37.249  23.280  13.354  1.00 49.26 ? 307 THR A CB    1 
ATOM   2154 O  OG1   . THR A 1 271 ? 37.465  24.675  13.088  1.00 44.57 ? 307 THR A OG1   1 
ATOM   2155 C  CG2   . THR A 1 271 ? 37.480  22.503  12.074  1.00 45.62 ? 307 THR A CG2   1 
ATOM   2156 N  N     . SER A 1 272 ? 35.300  24.485  15.773  1.00 46.49 ? 308 SER A N     1 
ATOM   2157 C  CA    . SER A 1 272 ? 35.037  24.719  17.195  1.00 54.36 ? 308 SER A CA    1 
ATOM   2158 C  C     . SER A 1 272 ? 33.567  24.476  17.559  1.00 50.60 ? 308 SER A C     1 
ATOM   2159 O  O     . SER A 1 272 ? 32.846  25.395  17.964  1.00 54.00 ? 308 SER A O     1 
ATOM   2160 C  CB    . SER A 1 272 ? 35.480  26.124  17.619  1.00 54.99 ? 308 SER A CB    1 
ATOM   2161 O  OG    . SER A 1 272 ? 35.582  26.991  16.503  1.00 60.43 ? 308 SER A OG    1 
ATOM   2162 N  N     . ARG A 1 287 ? 27.694  24.988  17.265  1.00 39.74 ? 323 ARG A N     1 
ATOM   2163 C  CA    . ARG A 1 287 ? 28.129  23.644  17.661  1.00 40.29 ? 323 ARG A CA    1 
ATOM   2164 C  C     . ARG A 1 287 ? 28.267  22.679  16.476  1.00 37.27 ? 323 ARG A C     1 
ATOM   2165 O  O     . ARG A 1 287 ? 27.370  22.580  15.644  1.00 32.70 ? 323 ARG A O     1 
ATOM   2166 C  CB    . ARG A 1 287 ? 27.174  23.063  18.695  1.00 44.52 ? 323 ARG A CB    1 
ATOM   2167 C  CG    . ARG A 1 287 ? 27.708  21.804  19.341  1.00 40.24 ? 323 ARG A CG    1 
ATOM   2168 C  CD    . ARG A 1 287 ? 27.273  21.744  20.786  1.00 49.27 ? 323 ARG A CD    1 
ATOM   2169 N  NE    . ARG A 1 287 ? 25.822  21.628  20.912  1.00 51.40 ? 323 ARG A NE    1 
ATOM   2170 C  CZ    . ARG A 1 287 ? 25.197  21.324  22.043  1.00 50.15 ? 323 ARG A CZ    1 
ATOM   2171 N  NH1   . ARG A 1 287 ? 25.902  21.099  23.143  1.00 50.96 ? 323 ARG A NH1   1 
ATOM   2172 N  NH2   . ARG A 1 287 ? 23.871  21.232  22.072  1.00 45.06 ? 323 ARG A NH2   1 
ATOM   2173 N  N     . TYR A 1 288 ? 29.389  21.964  16.412  1.00 32.07 ? 324 TYR A N     1 
ATOM   2174 C  CA    . TYR A 1 288 ? 29.696  21.162  15.241  1.00 32.22 ? 324 TYR A CA    1 
ATOM   2175 C  C     . TYR A 1 288 ? 30.106  19.734  15.567  1.00 32.32 ? 324 TYR A C     1 
ATOM   2176 O  O     . TYR A 1 288 ? 30.861  19.122  14.824  1.00 32.23 ? 324 TYR A O     1 
ATOM   2177 C  CB    . TYR A 1 288 ? 30.775  21.854  14.410  1.00 33.39 ? 324 TYR A CB    1 
ATOM   2178 C  CG    . TYR A 1 288 ? 30.403  23.267  14.049  1.00 38.07 ? 324 TYR A CG    1 
ATOM   2179 C  CD1   . TYR A 1 288 ? 29.416  23.520  13.102  1.00 35.34 ? 324 TYR A CD1   1 
ATOM   2180 C  CD2   . TYR A 1 288 ? 31.021  24.351  14.664  1.00 38.31 ? 324 TYR A CD2   1 
ATOM   2181 C  CE1   . TYR A 1 288 ? 29.058  24.814  12.774  1.00 33.56 ? 324 TYR A CE1   1 
ATOM   2182 C  CE2   . TYR A 1 288 ? 30.671  25.645  14.342  1.00 41.93 ? 324 TYR A CE2   1 
ATOM   2183 C  CZ    . TYR A 1 288 ? 29.689  25.869  13.396  1.00 37.99 ? 324 TYR A CZ    1 
ATOM   2184 O  OH    . TYR A 1 288 ? 29.332  27.152  13.064  1.00 39.16 ? 324 TYR A OH    1 
ATOM   2185 N  N     . ILE A 1 289 ? 29.597  19.205  16.673  1.00 31.59 ? 325 ILE A N     1 
ATOM   2186 C  CA    . ILE A 1 289 ? 29.850  17.816  17.050  1.00 29.29 ? 325 ILE A CA    1 
ATOM   2187 C  C     . ILE A 1 289 ? 29.310  16.850  15.976  1.00 29.17 ? 325 ILE A C     1 
ATOM   2188 O  O     . ILE A 1 289 ? 30.013  15.928  15.539  1.00 26.60 ? 325 ILE A O     1 
ATOM   2189 C  CB    . ILE A 1 289 ? 29.266  17.525  18.442  1.00 33.07 ? 325 ILE A CB    1 
ATOM   2190 C  CG1   . ILE A 1 289 ? 30.094  18.250  19.515  1.00 37.40 ? 325 ILE A CG1   1 
ATOM   2191 C  CG2   . ILE A 1 289 ? 29.237  16.040  18.726  1.00 33.12 ? 325 ILE A CG2   1 
ATOM   2192 C  CD1   . ILE A 1 289 ? 29.340  18.509  20.804  1.00 37.77 ? 325 ILE A CD1   1 
ATOM   2193 N  N     . LEU A 1 290 ? 28.070  17.072  15.543  1.00 26.55 ? 326 LEU A N     1 
ATOM   2194 C  CA    . LEU A 1 290 ? 27.569  16.432  14.319  1.00 27.83 ? 326 LEU A CA    1 
ATOM   2195 C  C     . LEU A 1 290 ? 27.326  17.526  13.287  1.00 23.67 ? 326 LEU A C     1 
ATOM   2196 O  O     . LEU A 1 290 ? 26.607  18.489  13.562  1.00 27.08 ? 326 LEU A O     1 
ATOM   2197 C  CB    . LEU A 1 290 ? 26.272  15.660  14.579  1.00 25.14 ? 326 LEU A CB    1 
ATOM   2198 C  CG    . LEU A 1 290 ? 25.675  14.875  13.398  1.00 21.95 ? 326 LEU A CG    1 
ATOM   2199 C  CD1   . LEU A 1 290 ? 26.674  13.836  12.897  1.00 24.59 ? 326 LEU A CD1   1 
ATOM   2200 C  CD2   . LEU A 1 290 ? 24.355  14.207  13.760  1.00 23.72 ? 326 LEU A CD2   1 
ATOM   2201 N  N     . ALA A 1 291 ? 27.944  17.382  12.119  1.00 24.01 ? 327 ALA A N     1 
ATOM   2202 C  CA    . ALA A 1 291 ? 27.902  18.419  11.086  1.00 24.10 ? 327 ALA A CA    1 
ATOM   2203 C  C     . ALA A 1 291 ? 27.060  17.972  9.900   1.00 20.25 ? 327 ALA A C     1 
ATOM   2204 O  O     . ALA A 1 291 ? 27.425  17.045  9.179   1.00 22.18 ? 327 ALA A O     1 
ATOM   2205 C  CB    . ALA A 1 291 ? 29.313  18.777  10.627  1.00 23.80 ? 327 ALA A CB    1 
ATOM   2206 N  N     . ILE A 1 292 ? 25.935  18.652  9.709   1.00 20.58 ? 328 ILE A N     1 
ATOM   2207 C  CA    . ILE A 1 292 ? 25.063  18.406  8.570   1.00 21.59 ? 328 ILE A CA    1 
ATOM   2208 C  C     . ILE A 1 292 ? 24.746  19.753  7.939   1.00 22.56 ? 328 ILE A C     1 
ATOM   2209 O  O     . ILE A 1 292 ? 24.021  20.572  8.518   1.00 22.69 ? 328 ILE A O     1 
ATOM   2210 C  CB    . ILE A 1 292 ? 23.737  17.733  9.014   1.00 21.82 ? 328 ILE A CB    1 
ATOM   2211 C  CG1   . ILE A 1 292 ? 24.000  16.371  9.676   1.00 21.61 ? 328 ILE A CG1   1 
ATOM   2212 C  CG2   . ILE A 1 292 ? 22.824  17.539  7.811   1.00 23.65 ? 328 ILE A CG2   1 
ATOM   2213 C  CD1   . ILE A 1 292 ? 22.859  15.884  10.622  1.00 21.25 ? 328 ILE A CD1   1 
ATOM   2214 N  N     . GLU A 1 293 ? 25.311  19.991  6.762   1.00 21.52 ? 329 GLU A N     1 
ATOM   2215 C  CA    . GLU A 1 293 ? 25.195  21.289  6.094   1.00 26.73 ? 329 GLU A CA    1 
ATOM   2216 C  C     . GLU A 1 293 ? 23.834  21.380  5.399   1.00 22.62 ? 329 GLU A C     1 
ATOM   2217 O  O     . GLU A 1 293 ? 23.532  20.540  4.544   1.00 24.56 ? 329 GLU A O     1 
ATOM   2218 C  CB    . GLU A 1 293 ? 26.337  21.412  5.073   1.00 24.68 ? 329 GLU A CB    1 
ATOM   2219 C  CG    . GLU A 1 293 ? 26.368  22.698  4.230   1.00 30.22 ? 329 GLU A CG    1 
ATOM   2220 C  CD    . GLU A 1 293 ? 27.402  22.632  3.107   1.00 30.65 ? 329 GLU A CD    1 
ATOM   2221 O  OE1   . GLU A 1 293 ? 28.328  23.480  3.097   1.00 34.07 ? 329 GLU A OE1   1 
ATOM   2222 O  OE2   . GLU A 1 293 ? 27.297  21.735  2.231   1.00 34.56 ? 329 GLU A OE2   1 
ATOM   2223 N  N     . ASP A 1 294 ? 22.999  22.359  5.755   1.00 21.33 ? 330 ASP A N     1 
ATOM   2224 C  CA    . ASP A 1 294 ? 21.706  22.499  5.072   1.00 22.06 ? 330 ASP A CA    1 
ATOM   2225 C  C     . ASP A 1 294 ? 21.970  22.687  3.593   1.00 23.41 ? 330 ASP A C     1 
ATOM   2226 O  O     . ASP A 1 294 ? 22.922  23.367  3.231   1.00 25.49 ? 330 ASP A O     1 
ATOM   2227 C  CB    . ASP A 1 294 ? 20.918  23.700  5.574   1.00 29.36 ? 330 ASP A CB    1 
ATOM   2228 C  CG    . ASP A 1 294 ? 19.542  23.826  4.889   1.00 33.12 ? 330 ASP A CG    1 
ATOM   2229 O  OD1   . ASP A 1 294 ? 18.574  23.253  5.436   1.00 30.32 ? 330 ASP A OD1   1 
ATOM   2230 O  OD2   . ASP A 1 294 ? 19.431  24.481  3.806   1.00 28.30 ? 330 ASP A OD2   1 
ATOM   2231 N  N     . PRO A 1 295 ? 21.155  22.060  2.731   1.00 23.66 ? 331 PRO A N     1 
ATOM   2232 C  CA    . PRO A 1 295 ? 21.522  22.083  1.308   1.00 26.37 ? 331 PRO A CA    1 
ATOM   2233 C  C     . PRO A 1 295 ? 21.415  23.464  0.689   1.00 24.00 ? 331 PRO A C     1 
ATOM   2234 O  O     . PRO A 1 295 ? 22.115  23.702  -0.285  1.00 25.48 ? 331 PRO A O     1 
ATOM   2235 C  CB    . PRO A 1 295 ? 20.507  21.138  0.648   1.00 23.11 ? 331 PRO A CB    1 
ATOM   2236 C  CG    . PRO A 1 295 ? 19.416  20.919  1.691   1.00 25.93 ? 331 PRO A CG    1 
ATOM   2237 C  CD    . PRO A 1 295 ? 20.076  21.096  3.024   1.00 23.56 ? 331 PRO A CD    1 
ATOM   2238 N  N     . PHE A 1 296 ? 20.574  24.342  1.234   1.00 22.05 ? 332 PHE A N     1 
ATOM   2239 C  CA    . PHE A 1 296 ? 20.453  25.705  0.702   1.00 25.71 ? 332 PHE A CA    1 
ATOM   2240 C  C     . PHE A 1 296 ? 21.126  26.744  1.600   1.00 27.10 ? 332 PHE A C     1 
ATOM   2241 O  O     . PHE A 1 296 ? 21.978  27.503  1.140   1.00 25.37 ? 332 PHE A O     1 
ATOM   2242 C  CB    . PHE A 1 296 ? 18.982  26.052  0.452   1.00 22.61 ? 332 PHE A CB    1 
ATOM   2243 C  CG    . PHE A 1 296 ? 18.339  25.195  -0.608  1.00 25.60 ? 332 PHE A CG    1 
ATOM   2244 C  CD1   . PHE A 1 296 ? 19.053  24.824  -1.746  1.00 25.28 ? 332 PHE A CD1   1 
ATOM   2245 C  CD2   . PHE A 1 296 ? 17.036  24.733  -0.456  1.00 23.45 ? 332 PHE A CD2   1 
ATOM   2246 C  CE1   . PHE A 1 296 ? 18.471  24.033  -2.733  1.00 22.97 ? 332 PHE A CE1   1 
ATOM   2247 C  CE2   . PHE A 1 296 ? 16.448  23.935  -1.431  1.00 26.72 ? 332 PHE A CE2   1 
ATOM   2248 C  CZ    . PHE A 1 296 ? 17.169  23.584  -2.578  1.00 23.91 ? 332 PHE A CZ    1 
ATOM   2249 N  N     . GLU A 1 297 ? 20.758  26.758  2.883   1.00 24.74 ? 333 GLU A N     1 
ATOM   2250 C  CA    . GLU A 1 297 ? 21.386  27.661  3.855   1.00 26.61 ? 333 GLU A CA    1 
ATOM   2251 C  C     . GLU A 1 297 ? 22.686  27.021  4.347   1.00 26.79 ? 333 GLU A C     1 
ATOM   2252 O  O     . GLU A 1 297 ? 22.735  26.464  5.445   1.00 24.10 ? 333 GLU A O     1 
ATOM   2253 C  CB    . GLU A 1 297 ? 20.438  27.925  5.036   1.00 29.93 ? 333 GLU A CB    1 
ATOM   2254 C  CG    . GLU A 1 297 ? 20.832  29.120  5.920   1.00 32.45 ? 333 GLU A CG    1 
ATOM   2255 C  CD    . GLU A 1 297 ? 19.936  29.268  7.150   1.00 40.28 ? 333 GLU A CD    1 
ATOM   2256 O  OE1   . GLU A 1 297 ? 20.351  29.964  8.103   1.00 40.35 ? 333 GLU A OE1   1 
ATOM   2257 O  OE2   . GLU A 1 297 ? 18.821  28.686  7.169   1.00 39.07 ? 333 GLU A OE2   1 
ATOM   2258 N  N     . ILE A 1 298 ? 23.735  27.098  3.526   1.00 25.30 ? 334 ILE A N     1 
ATOM   2259 C  CA    . ILE A 1 298 ? 24.966  26.338  3.767   1.00 24.25 ? 334 ILE A CA    1 
ATOM   2260 C  C     . ILE A 1 298 ? 25.746  26.772  5.015   1.00 26.86 ? 334 ILE A C     1 
ATOM   2261 O  O     . ILE A 1 298 ? 26.663  26.083  5.459   1.00 26.84 ? 334 ILE A O     1 
ATOM   2262 C  CB    . ILE A 1 298 ? 25.892  26.366  2.546   1.00 29.18 ? 334 ILE A CB    1 
ATOM   2263 C  CG1   . ILE A 1 298 ? 26.288  27.801  2.210   1.00 31.03 ? 334 ILE A CG1   1 
ATOM   2264 C  CG2   . ILE A 1 298 ? 25.214  25.691  1.349   1.00 32.30 ? 334 ILE A CG2   1 
ATOM   2265 C  CD1   . ILE A 1 298 ? 27.310  27.900  1.095   1.00 36.56 ? 334 ILE A CD1   1 
ATOM   2266 N  N     . SER A 1 299 ? 25.385  27.911  5.587   1.00 26.78 ? 335 SER A N     1 
ATOM   2267 C  CA    . SER A 1 299 ? 26.050  28.356  6.804   1.00 27.21 ? 335 SER A CA    1 
ATOM   2268 C  C     . SER A 1 299 ? 25.360  27.784  8.044   1.00 33.93 ? 335 SER A C     1 
ATOM   2269 O  O     . SER A 1 299 ? 25.795  28.017  9.178   1.00 29.39 ? 335 SER A O     1 
ATOM   2270 C  CB    . SER A 1 299 ? 26.068  29.880  6.864   1.00 31.51 ? 335 SER A CB    1 
ATOM   2271 O  OG    . SER A 1 299 ? 24.753  30.390  6.783   1.00 32.90 ? 335 SER A OG    1 
ATOM   2272 N  N     . HIS A 1 300 ? 24.279  27.036  7.830   1.00 27.45 ? 336 HIS A N     1 
ATOM   2273 C  CA    . HIS A 1 300 ? 23.515  26.484  8.939   1.00 27.90 ? 336 HIS A CA    1 
ATOM   2274 C  C     . HIS A 1 300 ? 23.859  25.004  9.136   1.00 25.63 ? 336 HIS A C     1 
ATOM   2275 O  O     . HIS A 1 300 ? 23.743  24.194  8.215   1.00 23.30 ? 336 HIS A O     1 
ATOM   2276 C  CB    . HIS A 1 300 ? 22.012  26.674  8.700   1.00 27.05 ? 336 HIS A CB    1 
ATOM   2277 C  CG    . HIS A 1 300 ? 21.145  25.979  9.701   1.00 31.61 ? 336 HIS A CG    1 
ATOM   2278 N  ND1   . HIS A 1 300 ? 21.295  26.144  11.062  1.00 36.18 ? 336 HIS A ND1   1 
ATOM   2279 C  CD2   . HIS A 1 300 ? 20.118  25.109  9.541   1.00 30.75 ? 336 HIS A CD2   1 
ATOM   2280 C  CE1   . HIS A 1 300 ? 20.402  25.406  11.697  1.00 32.75 ? 336 HIS A CE1   1 
ATOM   2281 N  NE2   . HIS A 1 300 ? 19.668  24.775  10.796  1.00 34.63 ? 336 HIS A NE2   1 
ATOM   2282 N  N     . ASN A 1 301 ? 24.301  24.649  10.336  1.00 24.21 ? 337 ASN A N     1 
ATOM   2283 C  CA    . ASN A 1 301 ? 24.514  23.247  10.653  1.00 21.40 ? 337 ASN A CA    1 
ATOM   2284 C  C     . ASN A 1 301 ? 23.224  22.698  11.233  1.00 24.36 ? 337 ASN A C     1 
ATOM   2285 O  O     . ASN A 1 301 ? 22.832  23.068  12.324  1.00 20.52 ? 337 ASN A O     1 
ATOM   2286 C  CB    . ASN A 1 301 ? 25.654  23.088  11.659  1.00 24.57 ? 337 ASN A CB    1 
ATOM   2287 C  CG    . ASN A 1 301 ? 25.831  21.660  12.112  1.00 25.81 ? 337 ASN A CG    1 
ATOM   2288 O  OD1   . ASN A 1 301 ? 25.450  20.726  11.404  1.00 28.09 ? 337 ASN A OD1   1 
ATOM   2289 N  ND2   . ASN A 1 301 ? 26.416  21.472  13.305  1.00 28.42 ? 337 ASN A ND2   1 
ATOM   2290 N  N     . VAL A 1 302 ? 22.560  21.811  10.506  1.00 24.07 ? 338 VAL A N     1 
ATOM   2291 C  CA    . VAL A 1 302 ? 21.302  21.241  10.979  1.00 23.16 ? 338 VAL A CA    1 
ATOM   2292 C  C     . VAL A 1 302 ? 21.555  20.418  12.246  1.00 24.30 ? 338 VAL A C     1 
ATOM   2293 O  O     . VAL A 1 302 ? 20.676  20.274  13.095  1.00 25.53 ? 338 VAL A O     1 
ATOM   2294 C  CB    . VAL A 1 302 ? 20.614  20.399  9.870   1.00 24.15 ? 338 VAL A CB    1 
ATOM   2295 C  CG1   . VAL A 1 302 ? 19.246  19.898  10.333  1.00 23.67 ? 338 VAL A CG1   1 
ATOM   2296 C  CG2   . VAL A 1 302 ? 20.448  21.232  8.607   1.00 25.18 ? 338 VAL A CG2   1 
ATOM   2297 N  N     . GLY A 1 303 ? 22.773  19.903  12.394  1.00 20.49 ? 339 GLY A N     1 
ATOM   2298 C  CA    . GLY A 1 303 ? 23.098  19.149  13.590  1.00 20.79 ? 339 GLY A CA    1 
ATOM   2299 C  C     . GLY A 1 303 ? 23.677  19.939  14.757  1.00 25.51 ? 339 GLY A C     1 
ATOM   2300 O  O     . GLY A 1 303 ? 24.280  19.348  15.659  1.00 27.69 ? 339 GLY A O     1 
ATOM   2301 N  N     . ARG A 1 304 ? 23.496  21.253  14.792  1.00 25.75 ? 340 ARG A N     1 
ATOM   2302 C  CA    . ARG A 1 304 ? 24.119  21.998  15.904  1.00 31.18 ? 340 ARG A CA    1 
ATOM   2303 C  C     . ARG A 1 304 ? 23.450  21.859  17.267  1.00 31.64 ? 340 ARG A C     1 
ATOM   2304 O  O     . ARG A 1 304 ? 23.972  22.346  18.264  1.00 33.77 ? 340 ARG A O     1 
ATOM   2305 C  CB    . ARG A 1 304 ? 24.411  23.469  15.591  1.00 31.85 ? 340 ARG A CB    1 
ATOM   2306 C  CG    . ARG A 1 304 ? 23.376  24.239  14.839  1.00 37.26 ? 340 ARG A CG    1 
ATOM   2307 C  CD    . ARG A 1 304 ? 22.073  24.460  15.545  1.00 34.76 ? 340 ARG A CD    1 
ATOM   2308 N  NE    . ARG A 1 304 ? 21.464  25.678  15.014  1.00 40.42 ? 340 ARG A NE    1 
ATOM   2309 C  CZ    . ARG A 1 304 ? 21.211  26.760  15.737  1.00 49.18 ? 340 ARG A CZ    1 
ATOM   2310 N  NH1   . ARG A 1 304 ? 21.503  26.760  17.031  1.00 54.52 ? 340 ARG A NH1   1 
ATOM   2311 N  NH2   . ARG A 1 304 ? 20.658  27.834  15.172  1.00 57.26 ? 340 ARG A NH2   1 
ATOM   2312 N  N     . THR A 1 305 ? 22.309  21.185  17.304  1.00 29.63 ? 341 THR A N     1 
ATOM   2313 C  CA    . THR A 1 305 ? 21.630  20.889  18.561  1.00 30.96 ? 341 THR A CA    1 
ATOM   2314 C  C     . THR A 1 305 ? 22.247  19.656  19.219  1.00 33.59 ? 341 THR A C     1 
ATOM   2315 O  O     . THR A 1 305 ? 22.000  19.384  20.386  1.00 33.65 ? 341 THR A O     1 
ATOM   2316 C  CB    . THR A 1 305 ? 20.144  20.623  18.340  1.00 27.05 ? 341 THR A CB    1 
ATOM   2317 O  OG1   . THR A 1 305 ? 19.992  19.558  17.385  1.00 30.29 ? 341 THR A OG1   1 
ATOM   2318 C  CG2   . THR A 1 305 ? 19.454  21.866  17.809  1.00 32.45 ? 341 THR A CG2   1 
ATOM   2319 N  N     . VAL A 1 306 ? 23.058  18.914  18.467  1.00 28.83 ? 342 VAL A N     1 
ATOM   2320 C  CA    . VAL A 1 306 ? 23.585  17.640  18.954  1.00 29.80 ? 342 VAL A CA    1 
ATOM   2321 C  C     . VAL A 1 306 ? 24.762  17.837  19.917  1.00 33.71 ? 342 VAL A C     1 
ATOM   2322 O  O     . VAL A 1 306 ? 25.773  18.422  19.546  1.00 32.72 ? 342 VAL A O     1 
ATOM   2323 C  CB    . VAL A 1 306 ? 24.032  16.749  17.787  1.00 28.21 ? 342 VAL A CB    1 
ATOM   2324 C  CG1   . VAL A 1 306 ? 24.628  15.437  18.306  1.00 22.67 ? 342 VAL A CG1   1 
ATOM   2325 C  CG2   . VAL A 1 306 ? 22.854  16.485  16.851  1.00 22.51 ? 342 VAL A CG2   1 
ATOM   2326 N  N     . SER A 1 307 ? 24.620  17.340  21.146  1.00 34.05 ? 343 SER A N     1 
ATOM   2327 C  CA    . SER A 1 307 ? 25.694  17.404  22.146  1.00 35.65 ? 343 SER A CA    1 
ATOM   2328 C  C     . SER A 1 307 ? 26.611  16.180  22.069  1.00 38.40 ? 343 SER A C     1 
ATOM   2329 O  O     . SER A 1 307 ? 26.280  15.185  21.408  1.00 32.35 ? 343 SER A O     1 
ATOM   2330 C  CB    . SER A 1 307 ? 25.091  17.505  23.547  1.00 35.22 ? 343 SER A CB    1 
ATOM   2331 O  OG    . SER A 1 307 ? 24.302  16.365  23.843  1.00 34.94 ? 343 SER A OG    1 
ATOM   2332 N  N     . SER A 1 308 ? 27.759  16.244  22.747  1.00 35.05 ? 344 SER A N     1 
ATOM   2333 C  CA    . SER A 1 308 ? 28.697  15.115  22.765  1.00 36.92 ? 344 SER A CA    1 
ATOM   2334 C  C     . SER A 1 308 ? 28.024  13.838  23.291  1.00 36.43 ? 344 SER A C     1 
ATOM   2335 O  O     . SER A 1 308 ? 28.261  12.735  22.781  1.00 35.64 ? 344 SER A O     1 
ATOM   2336 C  CB    . SER A 1 308 ? 29.930  15.451  23.609  1.00 38.11 ? 344 SER A CB    1 
ATOM   2337 O  OG    . SER A 1 308 ? 30.827  14.353  23.643  1.00 47.06 ? 344 SER A OG    1 
ATOM   2338 N  N     . SER A 1 309 ? 27.176  13.993  24.301  1.00 34.72 ? 345 SER A N     1 
ATOM   2339 C  CA    . SER A 1 309 ? 26.484  12.843  24.876  1.00 36.39 ? 345 SER A CA    1 
ATOM   2340 C  C     . SER A 1 309 ? 25.378  12.384  23.926  1.00 36.69 ? 345 SER A C     1 
ATOM   2341 O  O     . SER A 1 309 ? 25.130  11.179  23.773  1.00 33.34 ? 345 SER A O     1 
ATOM   2342 C  CB    . SER A 1 309 ? 25.897  13.190  26.239  1.00 40.62 ? 345 SER A CB    1 
ATOM   2343 O  OG    . SER A 1 309 ? 24.852  14.135  26.114  1.00 40.89 ? 345 SER A OG    1 
ATOM   2344 N  N     . GLY A 1 310 ? 24.725  13.359  23.293  1.00 36.86 ? 346 GLY A N     1 
ATOM   2345 C  CA    . GLY A 1 310 ? 23.709  13.105  22.286  1.00 31.07 ? 346 GLY A CA    1 
ATOM   2346 C  C     . GLY A 1 310 ? 24.256  12.317  21.110  1.00 28.46 ? 346 GLY A C     1 
ATOM   2347 O  O     . GLY A 1 310 ? 23.588  11.401  20.618  1.00 30.41 ? 346 GLY A O     1 
ATOM   2348 N  N     . LEU A 1 311 ? 25.464  12.654  20.659  1.00 26.44 ? 347 LEU A N     1 
ATOM   2349 C  CA    . LEU A 1 311 ? 26.053  11.956  19.510  1.00 31.32 ? 347 LEU A CA    1 
ATOM   2350 C  C     . LEU A 1 311 ? 26.427  10.534  19.903  1.00 34.77 ? 347 LEU A C     1 
ATOM   2351 O  O     . LEU A 1 311 ? 26.332  9.599   19.101  1.00 28.52 ? 347 LEU A O     1 
ATOM   2352 C  CB    . LEU A 1 311 ? 27.282  12.691  18.964  1.00 30.45 ? 347 LEU A CB    1 
ATOM   2353 C  CG    . LEU A 1 311 ? 28.099  11.922  17.914  1.00 31.54 ? 347 LEU A CG    1 
ATOM   2354 C  CD1   . LEU A 1 311 ? 27.263  11.586  16.677  1.00 28.08 ? 347 LEU A CD1   1 
ATOM   2355 C  CD2   . LEU A 1 311 ? 29.380  12.655  17.504  1.00 33.23 ? 347 LEU A CD2   1 
ATOM   2356 N  N     . TYR A 1 312 ? 26.858  10.370  21.150  1.00 35.48 ? 348 TYR A N     1 
ATOM   2357 C  CA    . TYR A 1 312 ? 27.233  9.048   21.633  1.00 34.09 ? 348 TYR A CA    1 
ATOM   2358 C  C     . TYR A 1 312 ? 26.005  8.133   21.652  1.00 29.40 ? 348 TYR A C     1 
ATOM   2359 O  O     . TYR A 1 312 ? 26.090  6.959   21.289  1.00 30.85 ? 348 TYR A O     1 
ATOM   2360 C  CB    . TYR A 1 312 ? 27.891  9.145   23.019  1.00 39.79 ? 348 TYR A CB    1 
ATOM   2361 C  CG    . TYR A 1 312 ? 28.507  7.845   23.501  1.00 40.91 ? 348 TYR A CG    1 
ATOM   2362 C  CD1   . TYR A 1 312 ? 29.821  7.517   23.191  1.00 43.87 ? 348 TYR A CD1   1 
ATOM   2363 C  CD2   . TYR A 1 312 ? 27.769  6.946   24.261  1.00 41.73 ? 348 TYR A CD2   1 
ATOM   2364 C  CE1   . TYR A 1 312 ? 30.385  6.325   23.630  1.00 45.86 ? 348 TYR A CE1   1 
ATOM   2365 C  CE2   . TYR A 1 312 ? 28.324  5.757   24.706  1.00 43.14 ? 348 TYR A CE2   1 
ATOM   2366 C  CZ    . TYR A 1 312 ? 29.628  5.453   24.389  1.00 47.12 ? 348 TYR A CZ    1 
ATOM   2367 O  OH    . TYR A 1 312 ? 30.171  4.263   24.830  1.00 50.92 ? 348 TYR A OH    1 
ATOM   2368 N  N     . ARG A 1 313 ? 24.858  8.685   22.047  1.00 30.17 ? 349 ARG A N     1 
ATOM   2369 C  CA    . ARG A 1 313 ? 23.624  7.908   22.080  1.00 33.20 ? 349 ARG A CA    1 
ATOM   2370 C  C     . ARG A 1 313 ? 23.120  7.596   20.669  1.00 29.69 ? 349 ARG A C     1 
ATOM   2371 O  O     . ARG A 1 313 ? 22.682  6.479   20.404  1.00 26.59 ? 349 ARG A O     1 
ATOM   2372 C  CB    . ARG A 1 313 ? 22.540  8.634   22.880  1.00 33.94 ? 349 ARG A CB    1 
ATOM   2373 C  CG    . ARG A 1 313 ? 22.895  8.890   24.333  1.00 36.63 ? 349 ARG A CG    1 
ATOM   2374 C  CD    . ARG A 1 313 ? 21.712  9.489   25.067  1.00 45.32 ? 349 ARG A CD    1 
ATOM   2375 N  NE    . ARG A 1 313 ? 20.488  8.774   24.726  1.00 50.16 ? 349 ARG A NE    1 
ATOM   2376 C  CZ    . ARG A 1 313 ? 19.432  9.333   24.146  1.00 45.30 ? 349 ARG A CZ    1 
ATOM   2377 N  NH1   . ARG A 1 313 ? 19.437  10.628  23.872  1.00 43.06 ? 349 ARG A NH1   1 
ATOM   2378 N  NH2   . ARG A 1 313 ? 18.363  8.596   23.856  1.00 41.76 ? 349 ARG A NH2   1 
ATOM   2379 N  N     . ILE A 1 314 ? 23.184  8.586   19.776  1.00 25.76 ? 350 ILE A N     1 
ATOM   2380 C  CA    . ILE A 1 314 ? 22.794  8.396   18.371  1.00 22.35 ? 350 ILE A CA    1 
ATOM   2381 C  C     . ILE A 1 314 ? 23.648  7.308   17.733  1.00 23.86 ? 350 ILE A C     1 
ATOM   2382 O  O     . ILE A 1 314 ? 23.124  6.344   17.149  1.00 23.52 ? 350 ILE A O     1 
ATOM   2383 C  CB    . ILE A 1 314 ? 22.905  9.739   17.576  1.00 25.05 ? 350 ILE A CB    1 
ATOM   2384 C  CG1   . ILE A 1 314 ? 21.790  10.694  18.012  1.00 22.56 ? 350 ILE A CG1   1 
ATOM   2385 C  CG2   . ILE A 1 314 ? 22.865  9.500   16.061  1.00 23.87 ? 350 ILE A CG2   1 
ATOM   2386 C  CD1   . ILE A 1 314 ? 22.061  12.164  17.659  1.00 25.27 ? 350 ILE A CD1   1 
ATOM   2387 N  N     . ARG A 1 315 ? 24.964  7.440   17.838  1.00 23.40 ? 351 ARG A N     1 
ATOM   2388 C  CA    . ARG A 1 315 ? 25.851  6.404   17.326  1.00 26.69 ? 351 ARG A CA    1 
ATOM   2389 C  C     . ARG A 1 315 ? 25.565  5.027   17.946  1.00 26.93 ? 351 ARG A C     1 
ATOM   2390 O  O     . ARG A 1 315 ? 25.597  4.011   17.247  1.00 26.72 ? 351 ARG A O     1 
ATOM   2391 C  CB    . ARG A 1 315 ? 27.318  6.782   17.532  1.00 30.54 ? 351 ARG A CB    1 
ATOM   2392 C  CG    . ARG A 1 315 ? 27.809  7.890   16.616  1.00 40.90 ? 351 ARG A CG    1 
ATOM   2393 C  CD    . ARG A 1 315 ? 29.275  7.688   16.222  1.00 40.70 ? 351 ARG A CD    1 
ATOM   2394 N  NE    . ARG A 1 315 ? 29.437  6.833   15.041  1.00 46.89 ? 351 ARG A NE    1 
ATOM   2395 C  CZ    . ARG A 1 315 ? 30.605  6.588   14.451  1.00 43.37 ? 351 ARG A CZ    1 
ATOM   2396 N  NH1   . ARG A 1 315 ? 30.661  5.816   13.374  1.00 42.45 ? 351 ARG A NH1   1 
ATOM   2397 N  NH2   . ARG A 1 315 ? 31.717  7.119   14.935  1.00 43.40 ? 351 ARG A NH2   1 
ATOM   2398 N  N     . GLY A 1 316 ? 25.284  4.996   19.249  1.00 29.39 ? 352 GLY A N     1 
ATOM   2399 C  CA    . GLY A 1 316 ? 24.989  3.741   19.925  1.00 26.13 ? 352 GLY A CA    1 
ATOM   2400 C  C     . GLY A 1 316 ? 23.770  3.072   19.320  1.00 27.94 ? 352 GLY A C     1 
ATOM   2401 O  O     . GLY A 1 316 ? 23.725  1.843   19.170  1.00 27.06 ? 352 GLY A O     1 
ATOM   2402 N  N     . GLU A 1 317 ? 22.782  3.886   18.959  1.00 25.46 ? 353 GLU A N     1 
ATOM   2403 C  CA    . GLU A 1 317 ? 21.538  3.369   18.403  1.00 27.34 ? 353 GLU A CA    1 
ATOM   2404 C  C     . GLU A 1 317 ? 21.710  2.871   16.979  1.00 24.97 ? 353 GLU A C     1 
ATOM   2405 O  O     . GLU A 1 317 ? 21.094  1.872   16.588  1.00 22.40 ? 353 GLU A O     1 
ATOM   2406 C  CB    . GLU A 1 317 ? 20.423  4.419   18.482  1.00 22.27 ? 353 GLU A CB    1 
ATOM   2407 C  CG    . GLU A 1 317 ? 19.874  4.637   19.886  1.00 27.61 ? 353 GLU A CG    1 
ATOM   2408 C  CD    . GLU A 1 317 ? 19.222  3.383   20.479  1.00 33.07 ? 353 GLU A CD    1 
ATOM   2409 O  OE1   . GLU A 1 317 ? 18.983  3.365   21.705  1.00 42.71 ? 353 GLU A OE1   1 
ATOM   2410 O  OE2   . GLU A 1 317 ? 18.930  2.424   19.732  1.00 37.39 ? 353 GLU A OE2   1 
ATOM   2411 N  N     . PHE A 1 318 ? 22.543  3.558   16.207  1.00 21.19 ? 354 PHE A N     1 
ATOM   2412 C  CA    . PHE A 1 318 ? 22.864  3.092   14.860  1.00 22.10 ? 354 PHE A CA    1 
ATOM   2413 C  C     . PHE A 1 318 ? 23.571  1.735   14.925  1.00 25.03 ? 354 PHE A C     1 
ATOM   2414 O  O     . PHE A 1 318 ? 23.290  0.839   14.128  1.00 23.29 ? 354 PHE A O     1 
ATOM   2415 C  CB    . PHE A 1 318 ? 23.755  4.095   14.130  1.00 21.20 ? 354 PHE A CB    1 
ATOM   2416 C  CG    . PHE A 1 318 ? 22.991  5.160   13.364  1.00 20.31 ? 354 PHE A CG    1 
ATOM   2417 C  CD1   . PHE A 1 318 ? 22.971  6.478   13.805  1.00 21.11 ? 354 PHE A CD1   1 
ATOM   2418 C  CD2   . PHE A 1 318 ? 22.309  4.834   12.193  1.00 17.81 ? 354 PHE A CD2   1 
ATOM   2419 C  CE1   . PHE A 1 318 ? 22.276  7.469   13.098  1.00 22.20 ? 354 PHE A CE1   1 
ATOM   2420 C  CE2   . PHE A 1 318 ? 21.606  5.819   11.474  1.00 18.32 ? 354 PHE A CE2   1 
ATOM   2421 C  CZ    . PHE A 1 318 ? 21.590  7.136   11.938  1.00 18.63 ? 354 PHE A CZ    1 
ATOM   2422 N  N     . MET A 1 319 ? 24.497  1.585   15.872  1.00 24.86 ? 355 MET A N     1 
ATOM   2423 C  CA    . MET A 1 319 ? 25.192  0.290   16.041  1.00 28.92 ? 355 MET A CA    1 
ATOM   2424 C  C     . MET A 1 319 ? 24.230  -0.832  16.455  1.00 26.36 ? 355 MET A C     1 
ATOM   2425 O  O     . MET A 1 319 ? 24.323  -1.961  15.956  1.00 26.64 ? 355 MET A O     1 
ATOM   2426 C  CB    . MET A 1 319 ? 26.358  0.412   17.045  1.00 28.33 ? 355 MET A CB    1 
ATOM   2427 C  CG    . MET A 1 319 ? 27.612  1.119   16.495  1.00 38.64 ? 355 MET A CG    1 
ATOM   2428 S  SD    . MET A 1 319 ? 28.640  1.856   17.808  1.00 53.83 ? 355 MET A SD    1 
ATOM   2429 C  CE    . MET A 1 319 ? 30.066  2.433   16.883  1.00 47.33 ? 355 MET A CE    1 
ATOM   2430 N  N     . ALA A 1 320 ? 23.307  -0.526  17.361  1.00 23.05 ? 356 ALA A N     1 
ATOM   2431 C  CA    . ALA A 1 320 ? 22.348  -1.534  17.819  1.00 29.84 ? 356 ALA A CA    1 
ATOM   2432 C  C     . ALA A 1 320 ? 21.424  -1.954  16.684  1.00 28.77 ? 356 ALA A C     1 
ATOM   2433 O  O     . ALA A 1 320 ? 21.091  -3.122  16.552  1.00 25.59 ? 356 ALA A O     1 
ATOM   2434 C  CB    . ALA A 1 320 ? 21.529  -1.017  19.004  1.00 26.62 ? 356 ALA A CB    1 
ATOM   2435 N  N     . ALA A 1 321 ? 20.998  -0.990  15.870  1.00 24.86 ? 357 ALA A N     1 
ATOM   2436 C  CA    . ALA A 1 321 ? 20.118  -1.291  14.744  1.00 25.06 ? 357 ALA A CA    1 
ATOM   2437 C  C     . ALA A 1 321 ? 20.872  -2.176  13.765  1.00 24.80 ? 357 ALA A C     1 
ATOM   2438 O  O     . ALA A 1 321 ? 20.338  -3.173  13.251  1.00 21.52 ? 357 ALA A O     1 
ATOM   2439 C  CB    . ALA A 1 321 ? 19.665  -0.008  14.060  1.00 24.91 ? 357 ALA A CB    1 
ATOM   2440 N  N     . SER A 1 322 ? 22.119  -1.808  13.504  1.00 21.24 ? 358 SER A N     1 
ATOM   2441 C  CA    . SER A 1 322 ? 22.958  -2.592  12.604  1.00 26.42 ? 358 SER A CA    1 
ATOM   2442 C  C     . SER A 1 322 ? 23.164  -4.001  13.134  1.00 28.57 ? 358 SER A C     1 
ATOM   2443 O  O     . SER A 1 322 ? 23.037  -4.969  12.387  1.00 24.48 ? 358 SER A O     1 
ATOM   2444 C  CB    . SER A 1 322 ? 24.304  -1.908  12.396  1.00 27.69 ? 358 SER A CB    1 
ATOM   2445 O  OG    . SER A 1 322 ? 24.124  -0.653  11.770  1.00 28.74 ? 358 SER A OG    1 
ATOM   2446 N  N     . ARG A 1 323 ? 23.466  -4.111  14.426  1.00 28.09 ? 359 ARG A N     1 
ATOM   2447 C  CA    . ARG A 1 323 ? 23.733  -5.415  15.040  1.00 30.16 ? 359 ARG A CA    1 
ATOM   2448 C  C     . ARG A 1 323 ? 22.518  -6.321  14.891  1.00 29.99 ? 359 ARG A C     1 
ATOM   2449 O  O     . ARG A 1 323 ? 22.643  -7.484  14.513  1.00 30.84 ? 359 ARG A O     1 
ATOM   2450 C  CB    . ARG A 1 323 ? 24.091  -5.257  16.528  1.00 33.65 ? 359 ARG A CB    1 
ATOM   2451 C  CG    . ARG A 1 323 ? 25.563  -5.527  16.853  1.00 48.11 ? 359 ARG A CG    1 
ATOM   2452 C  CD    . ARG A 1 323 ? 25.860  -5.496  18.368  1.00 47.06 ? 359 ARG A CD    1 
ATOM   2453 N  NE    . ARG A 1 323 ? 24.833  -6.149  19.184  1.00 53.53 ? 359 ARG A NE    1 
ATOM   2454 C  CZ    . ARG A 1 323 ? 24.582  -7.459  19.196  1.00 54.77 ? 359 ARG A CZ    1 
ATOM   2455 N  NH1   . ARG A 1 323 ? 25.270  -8.287  18.415  1.00 59.93 ? 359 ARG A NH1   1 
ATOM   2456 N  NH2   . ARG A 1 323 ? 23.629  -7.945  19.985  1.00 53.38 ? 359 ARG A NH2   1 
ATOM   2457 N  N     . LEU A 1 324 ? 21.340  -5.770  15.174  1.00 24.55 ? 360 LEU A N     1 
ATOM   2458 C  CA    . LEU A 1 324 ? 20.083  -6.505  15.028  1.00 28.41 ? 360 LEU A CA    1 
ATOM   2459 C  C     . LEU A 1 324 ? 19.935  -7.069  13.621  1.00 31.73 ? 360 LEU A C     1 
ATOM   2460 O  O     . LEU A 1 324 ? 19.627  -8.246  13.437  1.00 29.41 ? 360 LEU A O     1 
ATOM   2461 C  CB    . LEU A 1 324 ? 18.898  -5.586  15.350  1.00 28.69 ? 360 LEU A CB    1 
ATOM   2462 C  CG    . LEU A 1 324 ? 17.479  -6.131  15.148  1.00 33.08 ? 360 LEU A CG    1 
ATOM   2463 C  CD1   . LEU A 1 324 ? 17.144  -7.220  16.166  1.00 31.02 ? 360 LEU A CD1   1 
ATOM   2464 C  CD2   . LEU A 1 324 ? 16.453  -5.016  15.232  1.00 35.26 ? 360 LEU A CD2   1 
ATOM   2465 N  N     . LEU A 1 325 ? 20.170  -6.230  12.620  1.00 25.56 ? 361 LEU A N     1 
ATOM   2466 C  CA    . LEU A 1 325 ? 19.935  -6.635  11.239  1.00 27.04 ? 361 LEU A CA    1 
ATOM   2467 C  C     . LEU A 1 325 ? 21.074  -7.494  10.669  1.00 28.82 ? 361 LEU A C     1 
ATOM   2468 O  O     . LEU A 1 325 ? 20.876  -8.210  9.696   1.00 31.85 ? 361 LEU A O     1 
ATOM   2469 C  CB    . LEU A 1 325 ? 19.708  -5.406  10.354  1.00 21.75 ? 361 LEU A CB    1 
ATOM   2470 C  CG    . LEU A 1 325 ? 18.538  -4.516  10.757  1.00 27.02 ? 361 LEU A CG    1 
ATOM   2471 C  CD1   . LEU A 1 325 ? 18.452  -3.295  9.849   1.00 27.48 ? 361 LEU A CD1   1 
ATOM   2472 C  CD2   . LEU A 1 325 ? 17.242  -5.300  10.728  1.00 25.29 ? 361 LEU A CD2   1 
ATOM   2473 N  N     . ASN A 1 326 ? 22.258  -7.400  11.268  1.00 32.58 ? 362 ASN A N     1 
ATOM   2474 C  CA    . ASN A 1 326 ? 23.419  -8.148  10.795  1.00 33.75 ? 362 ASN A CA    1 
ATOM   2475 C  C     . ASN A 1 326 ? 23.305  -9.614  11.209  1.00 43.22 ? 362 ASN A C     1 
ATOM   2476 O  O     . ASN A 1 326 ? 24.064  -10.470 10.742  1.00 43.23 ? 362 ASN A O     1 
ATOM   2477 C  CB    . ASN A 1 326 ? 24.724  -7.575  11.374  1.00 36.69 ? 362 ASN A CB    1 
ATOM   2478 C  CG    . ASN A 1 326 ? 25.124  -6.215  10.782  1.00 39.50 ? 362 ASN A CG    1 
ATOM   2479 O  OD1   . ASN A 1 326 ? 24.621  -5.775  9.742   1.00 34.13 ? 362 ASN A OD1   1 
ATOM   2480 N  ND2   . ASN A 1 326 ? 26.056  -5.546  11.462  1.00 38.07 ? 362 ASN A ND2   1 
ATOM   2481 N  N     . SER A 1 327 ? 22.351  -9.892  12.095  1.00 34.68 ? 363 SER A N     1 
ATOM   2482 C  CA    . SER A 1 327 ? 22.227  -11.204 12.731  1.00 46.65 ? 363 SER A CA    1 
ATOM   2483 C  C     . SER A 1 327 ? 21.995  -12.342 11.740  1.00 49.66 ? 363 SER A C     1 
ATOM   2484 O  O     . SER A 1 327 ? 21.060  -12.307 10.942  1.00 49.55 ? 363 SER A O     1 
ATOM   2485 C  CB    . SER A 1 327 ? 21.101  -11.182 13.769  1.00 47.30 ? 363 SER A CB    1 
ATOM   2486 O  OG    . SER A 1 327 ? 20.943  -12.448 14.384  1.00 54.37 ? 363 SER A OG    1 
ATOM   2487 N  N     . ARG A 1 328 ? 22.851  -13.355 11.802  1.00 53.58 ? 364 ARG A N     1 
ATOM   2488 C  CA    . ARG A 1 328 ? 22.699  -14.534 10.953  1.00 55.99 ? 364 ARG A CA    1 
ATOM   2489 C  C     . ARG A 1 328 ? 21.806  -15.586 11.602  1.00 59.85 ? 364 ARG A C     1 
ATOM   2490 O  O     . ARG A 1 328 ? 21.382  -16.542 10.950  1.00 61.64 ? 364 ARG A O     1 
ATOM   2491 C  CB    . ARG A 1 328 ? 24.063  -15.136 10.621  1.00 58.69 ? 364 ARG A CB    1 
ATOM   2492 C  CG    . ARG A 1 328 ? 24.784  -14.456 9.473   1.00 56.10 ? 364 ARG A CG    1 
ATOM   2493 C  CD    . ARG A 1 328 ? 26.038  -15.231 9.087   1.00 51.64 ? 364 ARG A CD    1 
ATOM   2494 N  NE    . ARG A 1 328 ? 27.202  -14.829 9.875   1.00 52.36 ? 364 ARG A NE    1 
ATOM   2495 C  CZ    . ARG A 1 328 ? 27.574  -15.402 11.016  1.00 47.93 ? 364 ARG A CZ    1 
ATOM   2496 N  NH1   . ARG A 1 328 ? 26.871  -16.407 11.516  1.00 51.45 ? 364 ARG A NH1   1 
ATOM   2497 N  NH2   . ARG A 1 328 ? 28.653  -14.967 11.660  1.00 50.74 ? 364 ARG A NH2   1 
ATOM   2498 N  N     . SER A 1 329 ? 21.522  -15.398 12.889  1.00 63.31 ? 365 SER A N     1 
ATOM   2499 C  CA    . SER A 1 329 ? 20.579  -16.244 13.616  1.00 63.92 ? 365 SER A CA    1 
ATOM   2500 C  C     . SER A 1 329 ? 19.205  -16.234 12.942  1.00 66.79 ? 365 SER A C     1 
ATOM   2501 O  O     . SER A 1 329 ? 18.991  -15.525 11.957  1.00 71.24 ? 365 SER A O     1 
ATOM   2502 C  CB    . SER A 1 329 ? 20.453  -15.760 15.061  1.00 64.02 ? 365 SER A CB    1 
ATOM   2503 O  OG    . SER A 1 329 ? 19.173  -16.063 15.592  1.00 68.39 ? 365 SER A OG    1 
ATOM   2504 N  N     . TYR A 1 330 ? 18.263  -17.010 13.462  1.00 68.41 ? 366 TYR A N     1 
ATOM   2505 C  CA    . TYR A 1 330 ? 16.962  -17.065 12.803  1.00 69.74 ? 366 TYR A CA    1 
ATOM   2506 C  C     . TYR A 1 330 ? 15.748  -16.673 13.671  1.00 73.73 ? 366 TYR A C     1 
ATOM   2507 O  O     . TYR A 1 330 ? 15.877  -16.557 14.892  1.00 75.39 ? 366 TYR A O     1 
ATOM   2508 C  CB    . TYR A 1 330 ? 16.802  -18.352 11.990  1.00 74.15 ? 366 TYR A CB    1 
ATOM   2509 C  CG    . TYR A 1 330 ? 16.807  -18.042 10.514  1.00 76.60 ? 366 TYR A CG    1 
ATOM   2510 C  CD1   . TYR A 1 330 ? 17.985  -17.683 9.865   1.00 77.17 ? 366 TYR A CD1   1 
ATOM   2511 C  CD2   . TYR A 1 330 ? 15.628  -18.060 9.778   1.00 77.11 ? 366 TYR A CD2   1 
ATOM   2512 C  CE1   . TYR A 1 330 ? 17.992  -17.374 8.511   1.00 82.55 ? 366 TYR A CE1   1 
ATOM   2513 C  CE2   . TYR A 1 330 ? 15.623  -17.757 8.425   1.00 80.74 ? 366 TYR A CE2   1 
ATOM   2514 C  CZ    . TYR A 1 330 ? 16.805  -17.412 7.796   1.00 82.16 ? 366 TYR A CZ    1 
ATOM   2515 O  OH    . TYR A 1 330 ? 16.793  -17.109 6.451   1.00 78.49 ? 366 TYR A OH    1 
ATOM   2516 N  N     . PRO A 1 331 ? 14.558  -16.552 13.048  1.00 71.53 ? 367 PRO A N     1 
ATOM   2517 C  CA    . PRO A 1 331 ? 13.697  -15.382 13.255  1.00 65.85 ? 367 PRO A CA    1 
ATOM   2518 C  C     . PRO A 1 331 ? 14.379  -14.176 13.918  1.00 57.79 ? 367 PRO A C     1 
ATOM   2519 O  O     . PRO A 1 331 ? 14.669  -14.208 15.112  1.00 61.92 ? 367 PRO A O     1 
ATOM   2520 C  CB    . PRO A 1 331 ? 12.564  -15.936 14.132  1.00 64.40 ? 367 PRO A CB    1 
ATOM   2521 C  CG    . PRO A 1 331 ? 12.654  -17.473 13.994  1.00 66.00 ? 367 PRO A CG    1 
ATOM   2522 C  CD    . PRO A 1 331 ? 13.707  -17.749 12.943  1.00 70.27 ? 367 PRO A CD    1 
ATOM   2523 N  N     . ILE A 1 332 ? 14.623  -13.116 13.153  1.00 54.17 ? 368 ILE A N     1 
ATOM   2524 C  CA    . ILE A 1 332 ? 15.135  -11.885 13.749  1.00 47.72 ? 368 ILE A CA    1 
ATOM   2525 C  C     . ILE A 1 332 ? 13.974  -11.081 14.352  1.00 45.55 ? 368 ILE A C     1 
ATOM   2526 O  O     . ILE A 1 332 ? 12.946  -10.880 13.705  1.00 47.30 ? 368 ILE A O     1 
ATOM   2527 C  CB    . ILE A 1 332 ? 15.954  -11.026 12.745  1.00 43.52 ? 368 ILE A CB    1 
ATOM   2528 C  CG1   . ILE A 1 332 ? 17.086  -11.849 12.117  1.00 43.94 ? 368 ILE A CG1   1 
ATOM   2529 C  CG2   . ILE A 1 332 ? 16.520  -9.785  13.434  1.00 41.10 ? 368 ILE A CG2   1 
ATOM   2530 C  CD1   . ILE A 1 332 ? 18.019  -11.055 11.175  1.00 44.53 ? 368 ILE A CD1   1 
ATOM   2531 N  N     . PRO A 1 333 ? 14.125  -10.649 15.613  1.00 46.61 ? 369 PRO A N     1 
ATOM   2532 C  CA    . PRO A 1 333 ? 13.104  -9.862  16.315  1.00 45.10 ? 369 PRO A CA    1 
ATOM   2533 C  C     . PRO A 1 333 ? 13.095  -8.418  15.837  1.00 40.67 ? 369 PRO A C     1 
ATOM   2534 O  O     . PRO A 1 333 ? 13.591  -7.527  16.547  1.00 39.51 ? 369 PRO A O     1 
ATOM   2535 C  CB    . PRO A 1 333 ? 13.577  -9.907  17.773  1.00 49.97 ? 369 PRO A CB    1 
ATOM   2536 C  CG    . PRO A 1 333 ? 15.074  -10.070 17.666  1.00 45.39 ? 369 PRO A CG    1 
ATOM   2537 C  CD    . PRO A 1 333 ? 15.268  -10.979 16.489  1.00 43.70 ? 369 PRO A CD    1 
ATOM   2538 N  N     . TYR A 1 334 ? 12.524  -8.181  14.661  1.00 37.11 ? 370 TYR A N     1 
ATOM   2539 C  CA    . TYR A 1 334 ? 12.570  -6.847  14.069  1.00 32.76 ? 370 TYR A CA    1 
ATOM   2540 C  C     . TYR A 1 334 ? 11.860  -5.800  14.932  1.00 33.25 ? 370 TYR A C     1 
ATOM   2541 O  O     . TYR A 1 334 ? 12.198  -4.617  14.874  1.00 31.88 ? 370 TYR A O     1 
ATOM   2542 C  CB    . TYR A 1 334 ? 12.007  -6.880  12.649  1.00 30.39 ? 370 TYR A CB    1 
ATOM   2543 C  CG    . TYR A 1 334 ? 12.799  -7.750  11.704  1.00 32.10 ? 370 TYR A CG    1 
ATOM   2544 C  CD1   . TYR A 1 334 ? 14.172  -7.587  11.566  1.00 32.89 ? 370 TYR A CD1   1 
ATOM   2545 C  CD2   . TYR A 1 334 ? 12.177  -8.741  10.952  1.00 34.02 ? 370 TYR A CD2   1 
ATOM   2546 C  CE1   . TYR A 1 334 ? 14.911  -8.390  10.692  1.00 36.05 ? 370 TYR A CE1   1 
ATOM   2547 C  CE2   . TYR A 1 334 ? 12.905  -9.545  10.080  1.00 35.53 ? 370 TYR A CE2   1 
ATOM   2548 C  CZ    . TYR A 1 334 ? 14.270  -9.364  9.959   1.00 35.41 ? 370 TYR A CZ    1 
ATOM   2549 O  OH    . TYR A 1 334 ? 14.989  -10.158 9.095   1.00 40.60 ? 370 TYR A OH    1 
ATOM   2550 N  N     . ASP A 1 335 ? 10.898  -6.250  15.738  1.00 35.25 ? 371 ASP A N     1 
ATOM   2551 C  CA    . ASP A 1 335 ? 10.139  -5.384  16.644  1.00 35.71 ? 371 ASP A CA    1 
ATOM   2552 C  C     . ASP A 1 335 ? 11.037  -4.517  17.514  1.00 34.67 ? 371 ASP A C     1 
ATOM   2553 O  O     . ASP A 1 335 ? 10.709  -3.366  17.805  1.00 32.60 ? 371 ASP A O     1 
ATOM   2554 C  CB    . ASP A 1 335 ? 9.259   -6.225  17.577  1.00 45.11 ? 371 ASP A CB    1 
ATOM   2555 C  CG    . ASP A 1 335 ? 8.011   -6.747  16.903  1.00 53.40 ? 371 ASP A CG    1 
ATOM   2556 O  OD1   . ASP A 1 335 ? 7.654   -6.234  15.817  1.00 51.43 ? 371 ASP A OD1   1 
ATOM   2557 O  OD2   . ASP A 1 335 ? 7.378   -7.664  17.477  1.00 59.53 ? 371 ASP A OD2   1 
ATOM   2558 N  N     . SER A 1 336 ? 12.169  -5.074  17.938  1.00 30.55 ? 372 SER A N     1 
ATOM   2559 C  CA    . SER A 1 336 ? 13.056  -4.377  18.860  1.00 33.06 ? 372 SER A CA    1 
ATOM   2560 C  C     . SER A 1 336 ? 13.598  -3.079  18.245  1.00 31.13 ? 372 SER A C     1 
ATOM   2561 O  O     . SER A 1 336 ? 13.978  -2.149  18.955  1.00 26.57 ? 372 SER A O     1 
ATOM   2562 C  CB    . SER A 1 336 ? 14.190  -5.302  19.319  1.00 37.79 ? 372 SER A CB    1 
ATOM   2563 O  OG    . SER A 1 336 ? 15.057  -5.640  18.252  1.00 42.22 ? 372 SER A OG    1 
ATOM   2564 N  N     . LEU A 1 337 ? 13.606  -3.017  16.918  1.00 32.56 ? 373 LEU A N     1 
ATOM   2565 C  CA    . LEU A 1 337 ? 14.035  -1.816  16.206  1.00 31.34 ? 373 LEU A CA    1 
ATOM   2566 C  C     . LEU A 1 337 ? 13.197  -0.607  16.613  1.00 28.19 ? 373 LEU A C     1 
ATOM   2567 O  O     . LEU A 1 337 ? 13.693  0.508   16.653  1.00 30.72 ? 373 LEU A O     1 
ATOM   2568 C  CB    . LEU A 1 337 ? 13.943  -2.047  14.693  1.00 33.04 ? 373 LEU A CB    1 
ATOM   2569 C  CG    . LEU A 1 337 ? 14.654  -1.112  13.727  1.00 32.39 ? 373 LEU A CG    1 
ATOM   2570 C  CD1   . LEU A 1 337 ? 16.119  -1.049  14.065  1.00 29.64 ? 373 LEU A CD1   1 
ATOM   2571 C  CD2   . LEU A 1 337 ? 14.468  -1.630  12.304  1.00 28.67 ? 373 LEU A CD2   1 
ATOM   2572 N  N     . PHE A 1 338 ? 11.925  -0.828  16.930  1.00 24.12 ? 374 PHE A N     1 
ATOM   2573 C  CA    . PHE A 1 338 ? 11.039  0.270   17.320  1.00 27.61 ? 374 PHE A CA    1 
ATOM   2574 C  C     . PHE A 1 338 ? 10.559  0.224   18.769  1.00 34.21 ? 374 PHE A C     1 
ATOM   2575 O  O     . PHE A 1 338 ? 9.649   0.958   19.150  1.00 32.79 ? 374 PHE A O     1 
ATOM   2576 C  CB    . PHE A 1 338 ? 9.844   0.350   16.370  1.00 31.42 ? 374 PHE A CB    1 
ATOM   2577 C  CG    . PHE A 1 338 ? 10.243  0.476   14.935  1.00 29.50 ? 374 PHE A CG    1 
ATOM   2578 C  CD1   . PHE A 1 338 ? 10.852  1.642   14.470  1.00 25.94 ? 374 PHE A CD1   1 
ATOM   2579 C  CD2   . PHE A 1 338 ? 10.030  -0.570  14.051  1.00 27.33 ? 374 PHE A CD2   1 
ATOM   2580 C  CE1   . PHE A 1 338 ? 11.240  1.755   13.136  1.00 26.95 ? 374 PHE A CE1   1 
ATOM   2581 C  CE2   . PHE A 1 338 ? 10.411  -0.474  12.722  1.00 26.42 ? 374 PHE A CE2   1 
ATOM   2582 C  CZ    . PHE A 1 338 ? 11.021  0.704   12.260  1.00 27.67 ? 374 PHE A CZ    1 
ATOM   2583 N  N     . GLU A 1 339 ? 11.161  -0.639  19.578  1.00 33.47 ? 375 GLU A N     1 
ATOM   2584 C  CA    . GLU A 1 339 ? 10.830  -0.654  20.998  1.00 37.26 ? 375 GLU A CA    1 
ATOM   2585 C  C     . GLU A 1 339 ? 11.495  0.532   21.659  1.00 36.14 ? 375 GLU A C     1 
ATOM   2586 O  O     . GLU A 1 339 ? 12.610  0.911   21.299  1.00 33.27 ? 375 GLU A O     1 
ATOM   2587 C  CB    . GLU A 1 339 ? 11.278  -1.950  21.669  1.00 41.49 ? 375 GLU A CB    1 
ATOM   2588 C  CG    . GLU A 1 339 ? 10.511  -3.182  21.217  1.00 42.85 ? 375 GLU A CG    1 
ATOM   2589 C  CD    . GLU A 1 339 ? 10.976  -4.432  21.937  1.00 47.01 ? 375 GLU A CD    1 
ATOM   2590 O  OE1   . GLU A 1 339 ? 11.891  -4.313  22.785  1.00 46.47 ? 375 GLU A OE1   1 
ATOM   2591 O  OE2   . GLU A 1 339 ? 10.428  -5.523  21.654  1.00 50.85 ? 375 GLU A OE2   1 
ATOM   2592 N  N     . GLU A 1 340 ? 10.798  1.118   22.627  1.00 39.13 ? 376 GLU A N     1 
ATOM   2593 C  CA    . GLU A 1 340 ? 11.228  2.358   23.269  1.00 40.50 ? 376 GLU A CA    1 
ATOM   2594 C  C     . GLU A 1 340 ? 12.593  2.234   23.944  1.00 41.84 ? 376 GLU A C     1 
ATOM   2595 O  O     . GLU A 1 340 ? 13.011  1.139   24.319  1.00 46.76 ? 376 GLU A O     1 
ATOM   2596 C  CB    . GLU A 1 340 ? 10.181  2.798   24.299  1.00 44.68 ? 376 GLU A CB    1 
ATOM   2597 C  CG    . GLU A 1 340 ? 9.231   3.899   23.832  1.00 48.77 ? 376 GLU A CG    1 
ATOM   2598 C  CD    . GLU A 1 340 ? 9.031   4.967   24.905  1.00 59.96 ? 376 GLU A CD    1 
ATOM   2599 O  OE1   . GLU A 1 340 ? 9.152   4.624   26.105  1.00 58.15 ? 376 GLU A OE1   1 
ATOM   2600 O  OE2   . GLU A 1 340 ? 8.775   6.145   24.553  1.00 60.92 ? 376 GLU A OE2   1 
ATOM   2601 N  N     . ALA A 1 341 ? 13.282  3.368   24.071  1.00 45.12 ? 377 ALA A N     1 
ATOM   2602 C  CA    . ALA A 1 341 ? 14.530  3.476   24.828  1.00 48.41 ? 377 ALA A CA    1 
ATOM   2603 C  C     . ALA A 1 341 ? 15.634  2.567   24.307  1.00 47.14 ? 377 ALA A C     1 
ATOM   2604 O  O     . ALA A 1 341 ? 16.611  3.039   23.724  1.00 51.70 ? 377 ALA A O     1 
ATOM   2605 C  CB    . ALA A 1 341 ? 14.280  3.222   26.320  1.00 52.76 ? 377 ALA A CB    1 
ATOM   2606 N  N     . MET B 1 3   ? 38.689  20.708  44.594  1.00 60.27 ? 39  MET B N     1 
ATOM   2607 C  CA    . MET B 1 3   ? 39.687  21.765  44.746  1.00 52.58 ? 39  MET B CA    1 
ATOM   2608 C  C     . MET B 1 3   ? 40.758  21.774  43.632  1.00 49.83 ? 39  MET B C     1 
ATOM   2609 O  O     . MET B 1 3   ? 40.639  22.529  42.662  1.00 52.36 ? 39  MET B O     1 
ATOM   2610 C  CB    . MET B 1 3   ? 40.292  21.769  46.170  1.00 55.71 ? 39  MET B CB    1 
ATOM   2611 C  CG    . MET B 1 3   ? 41.055  20.506  46.622  1.00 57.54 ? 39  MET B CG    1 
ATOM   2612 S  SD    . MET B 1 3   ? 40.108  19.213  47.453  1.00 75.21 ? 39  MET B SD    1 
ATOM   2613 C  CE    . MET B 1 3   ? 39.663  18.196  46.051  1.00 50.99 ? 39  MET B CE    1 
ATOM   2614 N  N     . SER B 1 4   ? 41.779  20.926  43.745  1.00 48.28 ? 40  SER B N     1 
ATOM   2615 C  CA    . SER B 1 4   ? 42.924  20.969  42.830  1.00 49.54 ? 40  SER B CA    1 
ATOM   2616 C  C     . SER B 1 4   ? 42.556  20.700  41.361  1.00 47.66 ? 40  SER B C     1 
ATOM   2617 O  O     . SER B 1 4   ? 43.163  21.270  40.440  1.00 51.94 ? 40  SER B O     1 
ATOM   2618 C  CB    . SER B 1 4   ? 44.014  19.988  43.292  1.00 45.29 ? 40  SER B CB    1 
ATOM   2619 O  OG    . SER B 1 4   ? 43.500  18.674  43.378  1.00 42.37 ? 40  SER B OG    1 
ATOM   2620 N  N     . HIS B 1 5   ? 41.548  19.854  41.154  1.00 39.76 ? 41  HIS B N     1 
ATOM   2621 C  CA    . HIS B 1 5   ? 41.200  19.355  39.824  1.00 37.06 ? 41  HIS B CA    1 
ATOM   2622 C  C     . HIS B 1 5   ? 39.683  19.333  39.605  1.00 37.86 ? 41  HIS B C     1 
ATOM   2623 O  O     . HIS B 1 5   ? 39.142  18.323  39.128  1.00 33.62 ? 41  HIS B O     1 
ATOM   2624 C  CB    . HIS B 1 5   ? 41.734  17.922  39.657  1.00 32.74 ? 41  HIS B CB    1 
ATOM   2625 C  CG    . HIS B 1 5   ? 43.223  17.832  39.493  1.00 38.22 ? 41  HIS B CG    1 
ATOM   2626 N  ND1   . HIS B 1 5   ? 44.095  17.861  40.562  1.00 37.34 ? 41  HIS B ND1   1 
ATOM   2627 C  CD2   . HIS B 1 5   ? 43.989  17.696  38.385  1.00 38.06 ? 41  HIS B CD2   1 
ATOM   2628 C  CE1   . HIS B 1 5   ? 45.334  17.748  40.118  1.00 39.42 ? 41  HIS B CE1   1 
ATOM   2629 N  NE2   . HIS B 1 5   ? 45.298  17.653  38.801  1.00 36.72 ? 41  HIS B NE2   1 
ATOM   2630 N  N     . LYS B 1 6   ? 38.998  20.427  39.949  1.00 30.06 ? 42  LYS B N     1 
ATOM   2631 C  CA    . LYS B 1 6   ? 37.532  20.467  39.892  1.00 33.44 ? 42  LYS B CA    1 
ATOM   2632 C  C     . LYS B 1 6   ? 36.960  20.235  38.494  1.00 32.17 ? 42  LYS B C     1 
ATOM   2633 O  O     . LYS B 1 6   ? 36.031  19.455  38.316  1.00 30.46 ? 42  LYS B O     1 
ATOM   2634 C  CB    . LYS B 1 6   ? 36.988  21.782  40.476  1.00 35.02 ? 42  LYS B CB    1 
ATOM   2635 C  CG    . LYS B 1 6   ? 35.518  21.710  40.888  1.00 44.80 ? 42  LYS B CG    1 
ATOM   2636 C  CD    . LYS B 1 6   ? 35.034  23.000  41.563  1.00 48.53 ? 42  LYS B CD    1 
ATOM   2637 C  CE    . LYS B 1 6   ? 35.132  24.195  40.619  1.00 54.87 ? 42  LYS B CE    1 
ATOM   2638 N  NZ    . LYS B 1 6   ? 34.341  25.369  41.106  1.00 57.51 ? 42  LYS B NZ    1 
ATOM   2639 N  N     . GLU B 1 7   ? 37.505  20.917  37.498  1.00 31.00 ? 43  GLU B N     1 
ATOM   2640 C  CA    . GLU B 1 7   ? 36.979  20.788  36.141  1.00 31.36 ? 43  GLU B CA    1 
ATOM   2641 C  C     . GLU B 1 7   ? 37.288  19.433  35.515  1.00 29.54 ? 43  GLU B C     1 
ATOM   2642 O  O     . GLU B 1 7   ? 36.463  18.882  34.784  1.00 27.38 ? 43  GLU B O     1 
ATOM   2643 C  CB    . GLU B 1 7   ? 37.524  21.897  35.237  1.00 39.40 ? 43  GLU B CB    1 
ATOM   2644 C  CG    . GLU B 1 7   ? 36.451  22.541  34.385  1.00 45.69 ? 43  GLU B CG    1 
ATOM   2645 C  CD    . GLU B 1 7   ? 35.382  23.193  35.238  1.00 53.81 ? 43  GLU B CD    1 
ATOM   2646 O  OE1   . GLU B 1 7   ? 35.763  23.860  36.227  1.00 55.60 ? 43  GLU B OE1   1 
ATOM   2647 O  OE2   . GLU B 1 7   ? 34.172  23.019  34.937  1.00 52.52 ? 43  GLU B OE2   1 
ATOM   2648 N  N     . PHE B 1 8   ? 38.481  18.912  35.773  1.00 28.04 ? 44  PHE B N     1 
ATOM   2649 C  CA    . PHE B 1 8   ? 38.830  17.613  35.218  1.00 30.72 ? 44  PHE B CA    1 
ATOM   2650 C  C     . PHE B 1 8   ? 37.938  16.552  35.875  1.00 24.11 ? 44  PHE B C     1 
ATOM   2651 O  O     . PHE B 1 8   ? 37.459  15.645  35.208  1.00 24.53 ? 44  PHE B O     1 
ATOM   2652 C  CB    . PHE B 1 8   ? 40.322  17.313  35.395  1.00 28.97 ? 44  PHE B CB    1 
ATOM   2653 C  CG    . PHE B 1 8   ? 40.740  15.962  34.862  1.00 25.49 ? 44  PHE B CG    1 
ATOM   2654 C  CD1   . PHE B 1 8   ? 40.272  15.504  33.634  1.00 30.29 ? 44  PHE B CD1   1 
ATOM   2655 C  CD2   . PHE B 1 8   ? 41.595  15.152  35.591  1.00 29.08 ? 44  PHE B CD2   1 
ATOM   2656 C  CE1   . PHE B 1 8   ? 40.648  14.246  33.144  1.00 28.14 ? 44  PHE B CE1   1 
ATOM   2657 C  CE2   . PHE B 1 8   ? 41.980  13.895  35.109  1.00 24.97 ? 44  PHE B CE2   1 
ATOM   2658 C  CZ    . PHE B 1 8   ? 41.510  13.447  33.885  1.00 21.34 ? 44  PHE B CZ    1 
ATOM   2659 N  N     . THR B 1 9   ? 37.681  16.698  37.168  1.00 26.19 ? 45  THR B N     1 
ATOM   2660 C  CA    . THR B 1 9   ? 36.816  15.729  37.861  1.00 26.14 ? 45  THR B CA    1 
ATOM   2661 C  C     . THR B 1 9   ? 35.410  15.713  37.274  1.00 27.64 ? 45  THR B C     1 
ATOM   2662 O  O     . THR B 1 9   ? 34.806  14.653  37.043  1.00 24.11 ? 45  THR B O     1 
ATOM   2663 C  CB    . THR B 1 9   ? 36.793  15.973  39.371  1.00 22.86 ? 45  THR B CB    1 
ATOM   2664 O  OG1   . THR B 1 9   ? 38.114  15.766  39.894  1.00 26.26 ? 45  THR B OG1   1 
ATOM   2665 C  CG2   . THR B 1 9   ? 35.841  15.005  40.060  1.00 26.60 ? 45  THR B CG2   1 
ATOM   2666 N  N     . LYS B 1 10  ? 34.892  16.897  36.996  1.00 26.99 ? 46  LYS B N     1 
ATOM   2667 C  CA    . LYS B 1 10  ? 33.552  17.009  36.459  1.00 28.45 ? 46  LYS B CA    1 
ATOM   2668 C  C     . LYS B 1 10  ? 33.470  16.317  35.104  1.00 26.28 ? 46  LYS B C     1 
ATOM   2669 O  O     . LYS B 1 10  ? 32.517  15.597  34.819  1.00 30.54 ? 46  LYS B O     1 
ATOM   2670 C  CB    . LYS B 1 10  ? 33.174  18.486  36.343  1.00 31.76 ? 46  LYS B CB    1 
ATOM   2671 C  CG    . LYS B 1 10  ? 31.864  18.745  35.633  1.00 37.23 ? 46  LYS B CG    1 
ATOM   2672 C  CD    . LYS B 1 10  ? 31.575  20.253  35.571  1.00 36.12 ? 46  LYS B CD    1 
ATOM   2673 C  CE    . LYS B 1 10  ? 30.158  20.522  35.086  1.00 49.88 ? 46  LYS B CE    1 
ATOM   2674 N  NZ    . LYS B 1 10  ? 29.873  19.809  33.803  1.00 54.42 ? 46  LYS B NZ    1 
ATOM   2675 N  N     . PHE B 1 11  ? 34.488  16.522  34.282  1.00 25.31 ? 47  PHE B N     1 
ATOM   2676 C  CA    . PHE B 1 11  ? 34.592  15.848  32.998  1.00 26.98 ? 47  PHE B CA    1 
ATOM   2677 C  C     . PHE B 1 11  ? 34.658  14.323  33.177  1.00 26.72 ? 47  PHE B C     1 
ATOM   2678 O  O     . PHE B 1 11  ? 33.974  13.590  32.469  1.00 24.04 ? 47  PHE B O     1 
ATOM   2679 C  CB    . PHE B 1 11  ? 35.831  16.349  32.245  1.00 27.60 ? 47  PHE B CB    1 
ATOM   2680 C  CG    . PHE B 1 11  ? 36.180  15.533  31.026  1.00 30.73 ? 47  PHE B CG    1 
ATOM   2681 C  CD1   . PHE B 1 11  ? 35.507  15.721  29.827  1.00 35.05 ? 47  PHE B CD1   1 
ATOM   2682 C  CD2   . PHE B 1 11  ? 37.189  14.583  31.083  1.00 32.47 ? 47  PHE B CD2   1 
ATOM   2683 C  CE1   . PHE B 1 11  ? 35.827  14.972  28.702  1.00 34.83 ? 47  PHE B CE1   1 
ATOM   2684 C  CE2   . PHE B 1 11  ? 37.519  13.830  29.967  1.00 33.36 ? 47  PHE B CE2   1 
ATOM   2685 C  CZ    . PHE B 1 11  ? 36.833  14.022  28.774  1.00 32.85 ? 47  PHE B CZ    1 
ATOM   2686 N  N     . CYS B 1 12  ? 35.470  13.860  34.122  1.00 23.83 ? 48  CYS B N     1 
ATOM   2687 C  CA    . CYS B 1 12  ? 35.592  12.418  34.369  1.00 24.50 ? 48  CYS B CA    1 
ATOM   2688 C  C     . CYS B 1 12  ? 34.250  11.780  34.695  1.00 23.00 ? 48  CYS B C     1 
ATOM   2689 O  O     . CYS B 1 12  ? 33.931  10.710  34.178  1.00 20.98 ? 48  CYS B O     1 
ATOM   2690 C  CB    . CYS B 1 12  ? 36.596  12.137  35.483  1.00 20.83 ? 48  CYS B CB    1 
ATOM   2691 S  SG    . CYS B 1 12  ? 38.315  12.443  35.000  1.00 30.06 ? 48  CYS B SG    1 
ATOM   2692 N  N     . TYR B 1 13  ? 33.443  12.422  35.535  1.00 25.39 ? 49  TYR B N     1 
ATOM   2693 C  CA    . TYR B 1 13  ? 32.166  11.797  35.873  1.00 26.14 ? 49  TYR B CA    1 
ATOM   2694 C  C     . TYR B 1 13  ? 31.171  11.808  34.712  1.00 31.37 ? 49  TYR B C     1 
ATOM   2695 O  O     . TYR B 1 13  ? 30.338  10.909  34.607  1.00 23.86 ? 49  TYR B O     1 
ATOM   2696 C  CB    . TYR B 1 13  ? 31.554  12.369  37.161  1.00 25.32 ? 49  TYR B CB    1 
ATOM   2697 C  CG    . TYR B 1 13  ? 32.241  11.844  38.401  1.00 24.10 ? 49  TYR B CG    1 
ATOM   2698 C  CD1   . TYR B 1 13  ? 32.022  10.530  38.841  1.00 25.50 ? 49  TYR B CD1   1 
ATOM   2699 C  CD2   . TYR B 1 13  ? 33.118  12.640  39.118  1.00 20.79 ? 49  TYR B CD2   1 
ATOM   2700 C  CE1   . TYR B 1 13  ? 32.650  10.039  39.966  1.00 21.31 ? 49  TYR B CE1   1 
ATOM   2701 C  CE2   . TYR B 1 13  ? 33.754  12.158  40.245  1.00 22.72 ? 49  TYR B CE2   1 
ATOM   2702 C  CZ    . TYR B 1 13  ? 33.512  10.864  40.660  1.00 18.34 ? 49  TYR B CZ    1 
ATOM   2703 O  OH    . TYR B 1 13  ? 34.153  10.408  41.779  1.00 23.47 ? 49  TYR B OH    1 
ATOM   2704 N  N     . GLU B 1 14  ? 31.250  12.823  33.851  1.00 28.47 ? 50  GLU B N     1 
ATOM   2705 C  CA    . GLU B 1 14  ? 30.432  12.861  32.637  1.00 31.25 ? 50  GLU B CA    1 
ATOM   2706 C  C     . GLU B 1 14  ? 30.767  11.685  31.720  1.00 26.13 ? 50  GLU B C     1 
ATOM   2707 O  O     . GLU B 1 14  ? 29.871  11.012  31.189  1.00 31.02 ? 50  GLU B O     1 
ATOM   2708 C  CB    . GLU B 1 14  ? 30.665  14.173  31.862  1.00 34.04 ? 50  GLU B CB    1 
ATOM   2709 C  CG    . GLU B 1 14  ? 30.265  15.445  32.611  1.00 38.03 ? 50  GLU B CG    1 
ATOM   2710 C  CD    . GLU B 1 14  ? 30.833  16.715  31.962  1.00 47.75 ? 50  GLU B CD    1 
ATOM   2711 O  OE1   . GLU B 1 14  ? 30.670  17.811  32.550  1.00 48.84 ? 50  GLU B OE1   1 
ATOM   2712 O  OE2   . GLU B 1 14  ? 31.449  16.615  30.870  1.00 50.69 ? 50  GLU B OE2   1 
ATOM   2713 N  N     . VAL B 1 15  ? 32.058  11.455  31.507  1.00 25.80 ? 51  VAL B N     1 
ATOM   2714 C  CA    . VAL B 1 15  ? 32.489  10.373  30.631  1.00 24.97 ? 51  VAL B CA    1 
ATOM   2715 C  C     . VAL B 1 15  ? 32.116  9.044   31.274  1.00 25.88 ? 51  VAL B C     1 
ATOM   2716 O  O     . VAL B 1 15  ? 31.639  8.135   30.595  1.00 26.34 ? 51  VAL B O     1 
ATOM   2717 C  CB    . VAL B 1 15  ? 33.998  10.434  30.340  1.00 25.29 ? 51  VAL B CB    1 
ATOM   2718 C  CG1   . VAL B 1 15  ? 34.466  9.192   29.570  1.00 21.91 ? 51  VAL B CG1   1 
ATOM   2719 C  CG2   . VAL B 1 15  ? 34.324  11.698  29.543  1.00 30.24 ? 51  VAL B CG2   1 
ATOM   2720 N  N     . TYR B 1 16  ? 32.324  8.949   32.588  1.00 27.41 ? 52  TYR B N     1 
ATOM   2721 C  CA    . TYR B 1 16  ? 31.983  7.733   33.330  1.00 25.90 ? 52  TYR B CA    1 
ATOM   2722 C  C     . TYR B 1 16  ? 30.527  7.355   33.074  1.00 25.03 ? 52  TYR B C     1 
ATOM   2723 O  O     . TYR B 1 16  ? 30.225  6.210   32.726  1.00 27.35 ? 52  TYR B O     1 
ATOM   2724 C  CB    . TYR B 1 16  ? 32.250  7.911   34.840  1.00 24.67 ? 52  TYR B CB    1 
ATOM   2725 C  CG    . TYR B 1 16  ? 31.526  6.888   35.705  1.00 23.19 ? 52  TYR B CG    1 
ATOM   2726 C  CD1   . TYR B 1 16  ? 31.911  5.560   35.701  1.00 25.35 ? 52  TYR B CD1   1 
ATOM   2727 C  CD2   . TYR B 1 16  ? 30.458  7.258   36.513  1.00 26.05 ? 52  TYR B CD2   1 
ATOM   2728 C  CE1   . TYR B 1 16  ? 31.250  4.618   36.476  1.00 27.39 ? 52  TYR B CE1   1 
ATOM   2729 C  CE2   . TYR B 1 16  ? 29.793  6.334   37.292  1.00 27.98 ? 52  TYR B CE2   1 
ATOM   2730 C  CZ    . TYR B 1 16  ? 30.197  5.014   37.269  1.00 29.10 ? 52  TYR B CZ    1 
ATOM   2731 O  OH    . TYR B 1 16  ? 29.544  4.070   38.026  1.00 29.53 ? 52  TYR B OH    1 
ATOM   2732 N  N     . ASN B 1 17  ? 29.619  8.317   33.222  1.00 30.56 ? 53  ASN B N     1 
ATOM   2733 C  CA    . ASN B 1 17  ? 28.196  8.017   33.030  1.00 30.23 ? 53  ASN B CA    1 
ATOM   2734 C  C     . ASN B 1 17  ? 27.882  7.503   31.625  1.00 35.01 ? 53  ASN B C     1 
ATOM   2735 O  O     . ASN B 1 17  ? 26.983  6.678   31.432  1.00 36.23 ? 53  ASN B O     1 
ATOM   2736 C  CB    . ASN B 1 17  ? 27.333  9.234   33.374  1.00 28.03 ? 53  ASN B CB    1 
ATOM   2737 C  CG    . ASN B 1 17  ? 27.327  9.530   34.852  1.00 37.31 ? 53  ASN B CG    1 
ATOM   2738 O  OD1   . ASN B 1 17  ? 27.339  8.617   35.679  1.00 36.59 ? 53  ASN B OD1   1 
ATOM   2739 N  ND2   . ASN B 1 17  ? 27.312  10.812  35.200  1.00 42.87 ? 53  ASN B ND2   1 
ATOM   2740 N  N     . GLU B 1 18  ? 28.664  7.969   30.657  1.00 31.98 ? 54  GLU B N     1 
ATOM   2741 C  CA    . GLU B 1 18  ? 28.512  7.598   29.255  1.00 32.19 ? 54  GLU B CA    1 
ATOM   2742 C  C     . GLU B 1 18  ? 28.965  6.162   28.969  1.00 31.56 ? 54  GLU B C     1 
ATOM   2743 O  O     . GLU B 1 18  ? 28.340  5.448   28.190  1.00 32.94 ? 54  GLU B O     1 
ATOM   2744 C  CB    . GLU B 1 18  ? 29.318  8.598   28.400  1.00 36.52 ? 54  GLU B CB    1 
ATOM   2745 C  CG    . GLU B 1 18  ? 29.328  8.387   26.892  1.00 41.91 ? 54  GLU B CG    1 
ATOM   2746 C  CD    . GLU B 1 18  ? 30.197  9.433   26.163  1.00 49.10 ? 54  GLU B CD    1 
ATOM   2747 O  OE1   . GLU B 1 18  ? 31.357  9.115   25.802  1.00 54.79 ? 54  GLU B OE1   1 
ATOM   2748 O  OE2   . GLU B 1 18  ? 29.721  10.576  25.958  1.00 48.56 ? 54  GLU B OE2   1 
ATOM   2749 N  N     . ILE B 1 19  ? 30.064  5.738   29.586  1.00 29.25 ? 55  ILE B N     1 
ATOM   2750 C  CA    . ILE B 1 19  ? 30.700  4.483   29.189  1.00 26.32 ? 55  ILE B CA    1 
ATOM   2751 C  C     . ILE B 1 19  ? 30.388  3.299   30.110  1.00 29.85 ? 55  ILE B C     1 
ATOM   2752 O  O     . ILE B 1 19  ? 30.739  2.158   29.795  1.00 27.49 ? 55  ILE B O     1 
ATOM   2753 C  CB    . ILE B 1 19  ? 32.221  4.635   29.102  1.00 26.12 ? 55  ILE B CB    1 
ATOM   2754 C  CG1   . ILE B 1 19  ? 32.772  5.114   30.449  1.00 23.87 ? 55  ILE B CG1   1 
ATOM   2755 C  CG2   . ILE B 1 19  ? 32.603  5.611   27.958  1.00 29.93 ? 55  ILE B CG2   1 
ATOM   2756 C  CD1   . ILE B 1 19  ? 34.282  5.110   30.535  1.00 23.50 ? 55  ILE B CD1   1 
ATOM   2757 N  N     . LYS B 1 20  ? 29.763  3.574   31.252  1.00 26.31 ? 56  LYS B N     1 
ATOM   2758 C  CA    . LYS B 1 20  ? 29.476  2.516   32.223  1.00 29.61 ? 56  LYS B CA    1 
ATOM   2759 C  C     . LYS B 1 20  ? 28.344  1.648   31.713  1.00 33.57 ? 56  LYS B C     1 
ATOM   2760 O  O     . LYS B 1 20  ? 27.521  2.089   30.909  1.00 31.14 ? 56  LYS B O     1 
ATOM   2761 C  CB    . LYS B 1 20  ? 29.106  3.100   33.586  1.00 27.75 ? 56  LYS B CB    1 
ATOM   2762 C  CG    . LYS B 1 20  ? 27.762  3.854   33.629  1.00 28.21 ? 56  LYS B CG    1 
ATOM   2763 C  CD    . LYS B 1 20  ? 27.617  4.589   34.948  1.00 31.44 ? 56  LYS B CD    1 
ATOM   2764 C  CE    . LYS B 1 20  ? 26.158  4.970   35.215  1.00 37.29 ? 56  LYS B CE    1 
ATOM   2765 N  NZ    . LYS B 1 20  ? 26.061  5.974   36.308  1.00 42.56 ? 56  LYS B NZ    1 
ATOM   2766 N  N     . ILE B 1 21  ? 28.301  0.401   32.168  1.00 37.43 ? 57  ILE B N     1 
ATOM   2767 C  CA    . ILE B 1 21  ? 27.224  -0.491  31.760  1.00 34.77 ? 57  ILE B CA    1 
ATOM   2768 C  C     . ILE B 1 21  ? 25.893  0.055   32.274  1.00 33.77 ? 57  ILE B C     1 
ATOM   2769 O  O     . ILE B 1 21  ? 25.787  0.475   33.425  1.00 37.66 ? 57  ILE B O     1 
ATOM   2770 C  CB    . ILE B 1 21  ? 27.485  -1.963  32.203  1.00 36.14 ? 57  ILE B CB    1 
ATOM   2771 C  CG1   . ILE B 1 21  ? 26.575  -2.929  31.443  1.00 43.92 ? 57  ILE B CG1   1 
ATOM   2772 C  CG2   . ILE B 1 21  ? 27.358  -2.140  33.713  1.00 35.13 ? 57  ILE B CG2   1 
ATOM   2773 C  CD1   . ILE B 1 21  ? 26.897  -4.393  31.701  1.00 42.76 ? 57  ILE B CD1   1 
ATOM   2774 N  N     . SER B 1 22  ? 24.885  0.093   31.409  1.00 32.79 ? 58  SER B N     1 
ATOM   2775 C  CA    . SER B 1 22  ? 23.560  0.520   31.843  1.00 39.45 ? 58  SER B CA    1 
ATOM   2776 C  C     . SER B 1 22  ? 22.953  -0.590  32.691  1.00 43.17 ? 58  SER B C     1 
ATOM   2777 O  O     . SER B 1 22  ? 23.287  -1.760  32.506  1.00 37.80 ? 58  SER B O     1 
ATOM   2778 C  CB    . SER B 1 22  ? 22.656  0.795   30.646  1.00 39.13 ? 58  SER B CB    1 
ATOM   2779 O  OG    . SER B 1 22  ? 22.241  -0.417  30.049  1.00 41.61 ? 58  SER B OG    1 
ATOM   2780 N  N     . ASP B 1 23  ? 22.062  -0.248  33.615  1.00 42.98 ? 59  ASP B N     1 
ATOM   2781 C  CA    . ASP B 1 23  ? 21.414  -1.310  34.393  1.00 49.64 ? 59  ASP B CA    1 
ATOM   2782 C  C     . ASP B 1 23  ? 20.490  -2.166  33.511  1.00 44.88 ? 59  ASP B C     1 
ATOM   2783 O  O     . ASP B 1 23  ? 20.187  -3.306  33.854  1.00 45.99 ? 59  ASP B O     1 
ATOM   2784 C  CB    . ASP B 1 23  ? 20.702  -0.770  35.636  1.00 50.88 ? 59  ASP B CB    1 
ATOM   2785 C  CG    . ASP B 1 23  ? 19.423  -0.053  35.306  1.00 58.34 ? 59  ASP B CG    1 
ATOM   2786 O  OD1   . ASP B 1 23  ? 19.504  1.112   34.864  1.00 62.23 ? 59  ASP B OD1   1 
ATOM   2787 O  OD2   . ASP B 1 23  ? 18.337  -0.649  35.498  1.00 65.55 ? 59  ASP B OD2   1 
ATOM   2788 N  N     . LYS B 1 24  ? 20.078  -1.633  32.364  1.00 39.51 ? 60  LYS B N     1 
ATOM   2789 C  CA    . LYS B 1 24  ? 19.374  -2.445  31.374  1.00 44.01 ? 60  LYS B CA    1 
ATOM   2790 C  C     . LYS B 1 24  ? 20.256  -3.590  30.867  1.00 44.69 ? 60  LYS B C     1 
ATOM   2791 O  O     . LYS B 1 24  ? 19.873  -4.768  30.924  1.00 37.40 ? 60  LYS B O     1 
ATOM   2792 C  CB    . LYS B 1 24  ? 18.924  -1.604  30.181  1.00 46.04 ? 60  LYS B CB    1 
ATOM   2793 C  CG    . LYS B 1 24  ? 18.114  -2.415  29.184  1.00 50.56 ? 60  LYS B CG    1 
ATOM   2794 C  CD    . LYS B 1 24  ? 18.190  -1.876  27.764  1.00 56.54 ? 60  LYS B CD    1 
ATOM   2795 C  CE    . LYS B 1 24  ? 17.406  -2.785  26.821  1.00 55.61 ? 60  LYS B CE    1 
ATOM   2796 N  NZ    . LYS B 1 24  ? 16.140  -3.243  27.461  1.00 55.25 ? 60  LYS B NZ    1 
ATOM   2797 N  N     . GLU B 1 25  ? 21.429  -3.236  30.350  1.00 41.36 ? 61  GLU B N     1 
ATOM   2798 C  CA    . GLU B 1 25  ? 22.379  -4.229  29.862  1.00 40.64 ? 61  GLU B CA    1 
ATOM   2799 C  C     . GLU B 1 25  ? 22.825  -5.114  31.020  1.00 37.72 ? 61  GLU B C     1 
ATOM   2800 O  O     . GLU B 1 25  ? 23.026  -6.318  30.860  1.00 34.02 ? 61  GLU B O     1 
ATOM   2801 C  CB    . GLU B 1 25  ? 23.598  -3.554  29.213  1.00 43.33 ? 61  GLU B CB    1 
ATOM   2802 C  CG    . GLU B 1 25  ? 24.562  -4.540  28.543  1.00 47.19 ? 61  GLU B CG    1 
ATOM   2803 C  CD    . GLU B 1 25  ? 25.851  -3.890  28.045  1.00 46.82 ? 61  GLU B CD    1 
ATOM   2804 O  OE1   . GLU B 1 25  ? 26.925  -4.507  28.230  1.00 49.63 ? 61  GLU B OE1   1 
ATOM   2805 O  OE2   . GLU B 1 25  ? 25.793  -2.782  27.464  1.00 47.69 ? 61  GLU B OE2   1 
ATOM   2806 N  N     . PHE B 1 26  ? 22.978  -4.516  32.193  1.00 33.45 ? 62  PHE B N     1 
ATOM   2807 C  CA    . PHE B 1 26  ? 23.375  -5.290  33.351  1.00 37.95 ? 62  PHE B CA    1 
ATOM   2808 C  C     . PHE B 1 26  ? 22.332  -6.360  33.635  1.00 37.41 ? 62  PHE B C     1 
ATOM   2809 O  O     . PHE B 1 26  ? 22.671  -7.534  33.826  1.00 37.76 ? 62  PHE B O     1 
ATOM   2810 C  CB    . PHE B 1 26  ? 23.558  -4.398  34.572  1.00 43.02 ? 62  PHE B CB    1 
ATOM   2811 C  CG    . PHE B 1 26  ? 24.088  -5.131  35.760  1.00 45.08 ? 62  PHE B CG    1 
ATOM   2812 C  CD1   . PHE B 1 26  ? 25.436  -5.460  35.838  1.00 42.79 ? 62  PHE B CD1   1 
ATOM   2813 C  CD2   . PHE B 1 26  ? 23.240  -5.519  36.786  1.00 47.22 ? 62  PHE B CD2   1 
ATOM   2814 C  CE1   . PHE B 1 26  ? 25.930  -6.147  36.928  1.00 46.48 ? 62  PHE B CE1   1 
ATOM   2815 C  CE2   . PHE B 1 26  ? 23.724  -6.209  37.879  1.00 50.22 ? 62  PHE B CE2   1 
ATOM   2816 C  CZ    . PHE B 1 26  ? 25.072  -6.524  37.950  1.00 50.03 ? 62  PHE B CZ    1 
ATOM   2817 N  N     . LYS B 1 27  ? 21.064  -5.950  33.630  1.00 35.24 ? 63  LYS B N     1 
ATOM   2818 C  CA    . LYS B 1 27  ? 19.944  -6.855  33.887  1.00 42.39 ? 63  LYS B CA    1 
ATOM   2819 C  C     . LYS B 1 27  ? 19.892  -7.990  32.878  1.00 36.39 ? 63  LYS B C     1 
ATOM   2820 O  O     . LYS B 1 27  ? 19.611  -9.140  33.228  1.00 36.39 ? 63  LYS B O     1 
ATOM   2821 C  CB    . LYS B 1 27  ? 18.610  -6.096  33.866  1.00 43.33 ? 63  LYS B CB    1 
ATOM   2822 C  CG    . LYS B 1 27  ? 17.943  -5.947  35.235  1.00 50.80 ? 63  LYS B CG    1 
ATOM   2823 C  CD    . LYS B 1 27  ? 18.118  -4.536  35.794  1.00 55.40 ? 63  LYS B CD    1 
ATOM   2824 C  CE    . LYS B 1 27  ? 18.213  -4.520  37.321  1.00 59.33 ? 63  LYS B CE    1 
ATOM   2825 N  NZ    . LYS B 1 27  ? 18.550  -3.152  37.824  1.00 61.16 ? 63  LYS B NZ    1 
ATOM   2826 N  N     . GLU B 1 28  ? 20.155  -7.668  31.619  1.00 36.14 ? 64  GLU B N     1 
ATOM   2827 C  CA    . GLU B 1 28  ? 20.127  -8.678  30.570  1.00 38.52 ? 64  GLU B CA    1 
ATOM   2828 C  C     . GLU B 1 28  ? 21.248  -9.701  30.719  1.00 36.06 ? 64  GLU B C     1 
ATOM   2829 O  O     . GLU B 1 28  ? 21.038  -10.897 30.499  1.00 34.58 ? 64  GLU B O     1 
ATOM   2830 C  CB    . GLU B 1 28  ? 20.190  -8.020  29.195  1.00 42.09 ? 64  GLU B CB    1 
ATOM   2831 C  CG    . GLU B 1 28  ? 18.870  -7.396  28.765  1.00 48.83 ? 64  GLU B CG    1 
ATOM   2832 C  CD    . GLU B 1 28  ? 19.051  -6.372  27.661  1.00 54.85 ? 64  GLU B CD    1 
ATOM   2833 O  OE1   . GLU B 1 28  ? 18.026  -5.897  27.122  1.00 60.35 ? 64  GLU B OE1   1 
ATOM   2834 O  OE2   . GLU B 1 28  ? 20.220  -6.039  27.341  1.00 53.00 ? 64  GLU B OE2   1 
ATOM   2835 N  N     . LYS B 1 29  ? 22.439  -9.246  31.090  1.00 29.67 ? 65  LYS B N     1 
ATOM   2836 C  CA    . LYS B 1 29  ? 23.544  -10.190 31.238  1.00 31.09 ? 65  LYS B CA    1 
ATOM   2837 C  C     . LYS B 1 29  ? 23.337  -11.086 32.462  1.00 33.84 ? 65  LYS B C     1 
ATOM   2838 O  O     . LYS B 1 29  ? 23.694  -12.265 32.445  1.00 30.86 ? 65  LYS B O     1 
ATOM   2839 C  CB    . LYS B 1 29  ? 24.906  -9.475  31.198  1.00 34.64 ? 65  LYS B CB    1 
ATOM   2840 C  CG    . LYS B 1 29  ? 25.261  -9.062  29.767  1.00 38.54 ? 65  LYS B CG    1 
ATOM   2841 C  CD    . LYS B 1 29  ? 26.546  -8.260  29.645  1.00 49.09 ? 65  LYS B CD    1 
ATOM   2842 C  CE    . LYS B 1 29  ? 26.692  -7.694  28.228  1.00 50.23 ? 65  LYS B CE    1 
ATOM   2843 N  NZ    . LYS B 1 29  ? 26.525  -8.739  27.171  1.00 57.37 ? 65  LYS B NZ    1 
ATOM   2844 N  N     . ARG B 1 30  ? 22.705  -10.542 33.495  1.00 30.78 ? 66  ARG B N     1 
ATOM   2845 C  CA    . ARG B 1 30  ? 22.353  -11.328 34.676  1.00 40.66 ? 66  ARG B CA    1 
ATOM   2846 C  C     . ARG B 1 30  ? 21.266  -12.357 34.371  1.00 34.50 ? 66  ARG B C     1 
ATOM   2847 O  O     . ARG B 1 30  ? 21.251  -13.442 34.955  1.00 36.73 ? 66  ARG B O     1 
ATOM   2848 C  CB    . ARG B 1 30  ? 21.912  -10.418 35.824  1.00 42.46 ? 66  ARG B CB    1 
ATOM   2849 C  CG    . ARG B 1 30  ? 22.776  -10.548 37.081  1.00 55.24 ? 66  ARG B CG    1 
ATOM   2850 C  CD    . ARG B 1 30  ? 24.270  -10.656 36.744  1.00 54.07 ? 66  ARG B CD    1 
ATOM   2851 N  NE    . ARG B 1 30  ? 25.133  -10.476 37.916  1.00 58.27 ? 66  ARG B NE    1 
ATOM   2852 C  CZ    . ARG B 1 30  ? 26.458  -10.611 37.907  1.00 53.41 ? 66  ARG B CZ    1 
ATOM   2853 N  NH1   . ARG B 1 30  ? 27.093  -10.942 36.791  1.00 54.12 ? 66  ARG B NH1   1 
ATOM   2854 N  NH2   . ARG B 1 30  ? 27.154  -10.422 39.020  1.00 55.99 ? 66  ARG B NH2   1 
ATOM   2855 N  N     . ALA B 1 31  ? 20.351  -12.015 33.467  1.00 32.34 ? 67  ALA B N     1 
ATOM   2856 C  CA    . ALA B 1 31  ? 19.334  -12.971 33.030  1.00 34.70 ? 67  ALA B CA    1 
ATOM   2857 C  C     . ALA B 1 31  ? 19.958  -14.100 32.211  1.00 30.41 ? 67  ALA B C     1 
ATOM   2858 O  O     . ALA B 1 31  ? 19.523  -15.253 32.284  1.00 32.39 ? 67  ALA B O     1 
ATOM   2859 C  CB    . ALA B 1 31  ? 18.260  -12.275 32.231  1.00 33.62 ? 67  ALA B CB    1 
ATOM   2860 N  N     . ALA B 1 32  ? 20.970  -13.766 31.416  1.00 29.11 ? 68  ALA B N     1 
ATOM   2861 C  CA    . ALA B 1 32  ? 21.643  -14.767 30.591  1.00 31.61 ? 68  ALA B CA    1 
ATOM   2862 C  C     . ALA B 1 32  ? 22.392  -15.755 31.482  1.00 30.15 ? 68  ALA B C     1 
ATOM   2863 O  O     . ALA B 1 32  ? 22.384  -16.967 31.235  1.00 28.51 ? 68  ALA B O     1 
ATOM   2864 C  CB    . ALA B 1 32  ? 22.596  -14.096 29.616  1.00 35.52 ? 68  ALA B CB    1 
ATOM   2865 N  N     . LEU B 1 33  ? 23.056  -15.224 32.507  1.00 24.10 ? 69  LEU B N     1 
ATOM   2866 C  CA    . LEU B 1 33  ? 23.718  -16.051 33.513  1.00 30.23 ? 69  LEU B CA    1 
ATOM   2867 C  C     . LEU B 1 33  ? 22.720  -16.993 34.208  1.00 28.78 ? 69  LEU B C     1 
ATOM   2868 O  O     . LEU B 1 33  ? 22.971  -18.196 34.333  1.00 28.94 ? 69  LEU B O     1 
ATOM   2869 C  CB    . LEU B 1 33  ? 24.418  -15.165 34.554  1.00 26.89 ? 69  LEU B CB    1 
ATOM   2870 C  CG    . LEU B 1 33  ? 25.123  -15.901 35.699  1.00 36.42 ? 69  LEU B CG    1 
ATOM   2871 C  CD1   . LEU B 1 33  ? 26.038  -16.974 35.125  1.00 34.39 ? 69  LEU B CD1   1 
ATOM   2872 C  CD2   . LEU B 1 33  ? 25.922  -14.948 36.583  1.00 40.28 ? 69  LEU B CD2   1 
ATOM   2873 N  N     . ASP B 1 34  ? 21.591  -16.452 34.655  1.00 28.68 ? 70  ASP B N     1 
ATOM   2874 C  CA    . ASP B 1 34  ? 20.570  -17.285 35.292  1.00 27.32 ? 70  ASP B CA    1 
ATOM   2875 C  C     . ASP B 1 34  ? 20.048  -18.378 34.346  1.00 28.37 ? 70  ASP B C     1 
ATOM   2876 O  O     . ASP B 1 34  ? 19.769  -19.506 34.760  1.00 27.12 ? 70  ASP B O     1 
ATOM   2877 C  CB    . ASP B 1 34  ? 19.417  -16.418 35.799  1.00 33.98 ? 70  ASP B CB    1 
ATOM   2878 C  CG    . ASP B 1 34  ? 19.852  -15.428 36.874  1.00 40.27 ? 70  ASP B CG    1 
ATOM   2879 O  OD1   . ASP B 1 34  ? 19.167  -14.393 37.039  1.00 45.77 ? 70  ASP B OD1   1 
ATOM   2880 O  OD2   . ASP B 1 34  ? 20.876  -15.672 37.546  1.00 41.33 ? 70  ASP B OD2   1 
ATOM   2881 N  N     . THR B 1 35  ? 19.925  -18.044 33.069  1.00 28.23 ? 71  THR B N     1 
ATOM   2882 C  CA    . THR B 1 35  ? 19.451  -19.017 32.085  1.00 27.70 ? 71  THR B CA    1 
ATOM   2883 C  C     . THR B 1 35  ? 20.473  -20.133 31.887  1.00 29.20 ? 71  THR B C     1 
ATOM   2884 O  O     . THR B 1 35  ? 20.122  -21.328 31.865  1.00 25.82 ? 71  THR B O     1 
ATOM   2885 C  CB    . THR B 1 35  ? 19.139  -18.330 30.750  1.00 31.03 ? 71  THR B CB    1 
ATOM   2886 O  OG1   . THR B 1 35  ? 18.148  -17.313 30.964  1.00 33.10 ? 71  THR B OG1   1 
ATOM   2887 C  CG2   . THR B 1 35  ? 18.613  -19.330 29.760  1.00 37.45 ? 71  THR B CG2   1 
ATOM   2888 N  N     . LEU B 1 36  ? 21.741  -19.748 31.756  1.00 24.49 ? 72  LEU B N     1 
ATOM   2889 C  CA    . LEU B 1 36  ? 22.816  -20.718 31.577  1.00 25.43 ? 72  LEU B CA    1 
ATOM   2890 C  C     . LEU B 1 36  ? 22.972  -21.646 32.790  1.00 26.30 ? 72  LEU B C     1 
ATOM   2891 O  O     . LEU B 1 36  ? 23.302  -22.834 32.656  1.00 23.09 ? 72  LEU B O     1 
ATOM   2892 C  CB    . LEU B 1 36  ? 24.130  -19.991 31.264  1.00 27.37 ? 72  LEU B CB    1 
ATOM   2893 C  CG    . LEU B 1 36  ? 24.243  -19.273 29.916  1.00 29.28 ? 72  LEU B CG    1 
ATOM   2894 C  CD1   . LEU B 1 36  ? 25.430  -18.306 29.902  1.00 30.50 ? 72  LEU B CD1   1 
ATOM   2895 C  CD2   . LEU B 1 36  ? 24.391  -20.279 28.789  1.00 29.48 ? 72  LEU B CD2   1 
ATOM   2896 N  N     . ARG B 1 37  ? 22.723  -21.104 33.975  1.00 24.16 ? 73  ARG B N     1 
ATOM   2897 C  CA    . ARG B 1 37  ? 22.852  -21.866 35.201  1.00 23.67 ? 73  ARG B CA    1 
ATOM   2898 C  C     . ARG B 1 37  ? 21.792  -22.962 35.254  1.00 26.52 ? 73  ARG B C     1 
ATOM   2899 O  O     . ARG B 1 37  ? 22.076  -24.096 35.649  1.00 26.65 ? 73  ARG B O     1 
ATOM   2900 C  CB    . ARG B 1 37  ? 22.761  -20.917 36.411  1.00 28.57 ? 73  ARG B CB    1 
ATOM   2901 C  CG    . ARG B 1 37  ? 22.836  -21.602 37.766  1.00 34.09 ? 73  ARG B CG    1 
ATOM   2902 C  CD    . ARG B 1 37  ? 22.945  -20.586 38.911  1.00 38.64 ? 73  ARG B CD    1 
ATOM   2903 N  NE    . ARG B 1 37  ? 24.245  -19.908 38.937  1.00 43.67 ? 73  ARG B NE    1 
ATOM   2904 C  CZ    . ARG B 1 37  ? 24.386  -18.588 39.017  1.00 46.34 ? 73  ARG B CZ    1 
ATOM   2905 N  NH1   . ARG B 1 37  ? 23.305  -17.823 39.085  1.00 48.68 ? 73  ARG B NH1   1 
ATOM   2906 N  NH2   . ARG B 1 37  ? 25.593  -18.030 39.036  1.00 41.72 ? 73  ARG B NH2   1 
ATOM   2907 N  N     . LEU B 1 38  ? 20.577  -22.624 34.842  1.00 24.74 ? 74  LEU B N     1 
ATOM   2908 C  CA    . LEU B 1 38  ? 19.492  -23.604 34.746  1.00 30.11 ? 74  LEU B CA    1 
ATOM   2909 C  C     . LEU B 1 38  ? 19.816  -24.705 33.753  1.00 29.86 ? 74  LEU B C     1 
ATOM   2910 O  O     . LEU B 1 38  ? 19.475  -25.864 33.971  1.00 26.91 ? 74  LEU B O     1 
ATOM   2911 C  CB    . LEU B 1 38  ? 18.205  -22.916 34.314  1.00 28.90 ? 74  LEU B CB    1 
ATOM   2912 C  CG    . LEU B 1 38  ? 17.555  -22.030 35.359  1.00 35.37 ? 74  LEU B CG    1 
ATOM   2913 C  CD1   . LEU B 1 38  ? 16.526  -21.155 34.683  1.00 40.11 ? 74  LEU B CD1   1 
ATOM   2914 C  CD2   . LEU B 1 38  ? 16.898  -22.903 36.412  1.00 34.53 ? 74  LEU B CD2   1 
ATOM   2915 N  N     . CYS B 1 39  ? 20.474  -24.339 32.657  1.00 27.66 ? 75  CYS B N     1 
ATOM   2916 C  CA    A CYS B 1 39  ? 20.850  -25.306 31.642  0.41 29.50 ? 75  CYS B CA    1 
ATOM   2917 C  CA    B CYS B 1 39  ? 20.848  -25.314 31.636  0.59 29.48 ? 75  CYS B CA    1 
ATOM   2918 C  C     . CYS B 1 39  ? 21.888  -26.280 32.177  1.00 27.80 ? 75  CYS B C     1 
ATOM   2919 O  O     . CYS B 1 39  ? 21.850  -27.464 31.878  1.00 29.24 ? 75  CYS B O     1 
ATOM   2920 C  CB    A CYS B 1 39  ? 21.405  -24.590 30.417  0.41 32.17 ? 75  CYS B CB    1 
ATOM   2921 C  CB    B CYS B 1 39  ? 21.376  -24.624 30.370  0.59 32.18 ? 75  CYS B CB    1 
ATOM   2922 S  SG    A CYS B 1 39  ? 21.730  -25.699 29.065  0.41 37.15 ? 75  CYS B SG    1 
ATOM   2923 S  SG    B CYS B 1 39  ? 20.088  -24.038 29.229  0.59 41.82 ? 75  CYS B SG    1 
ATOM   2924 N  N     . LEU B 1 40  ? 22.819  -25.762 32.972  1.00 24.91 ? 76  LEU B N     1 
ATOM   2925 C  CA    . LEU B 1 40  ? 23.834  -26.592 33.598  1.00 21.80 ? 76  LEU B CA    1 
ATOM   2926 C  C     . LEU B 1 40  ? 23.177  -27.557 34.571  1.00 21.15 ? 76  LEU B C     1 
ATOM   2927 O  O     . LEU B 1 40  ? 23.567  -28.717 34.659  1.00 23.23 ? 76  LEU B O     1 
ATOM   2928 C  CB    . LEU B 1 40  ? 24.856  -25.725 34.343  1.00 21.91 ? 76  LEU B CB    1 
ATOM   2929 C  CG    . LEU B 1 40  ? 26.011  -26.477 35.009  1.00 22.55 ? 76  LEU B CG    1 
ATOM   2930 C  CD1   . LEU B 1 40  ? 26.882  -27.149 33.962  1.00 26.50 ? 76  LEU B CD1   1 
ATOM   2931 C  CD2   . LEU B 1 40  ? 26.847  -25.528 35.871  1.00 25.42 ? 76  LEU B CD2   1 
ATOM   2932 N  N     . LYS B 1 41  ? 22.179  -27.073 35.303  1.00 21.07 ? 77  LYS B N     1 
ATOM   2933 C  CA    . LYS B 1 41  ? 21.499  -27.910 36.293  1.00 22.79 ? 77  LYS B CA    1 
ATOM   2934 C  C     . LYS B 1 41  ? 20.671  -29.057 35.688  1.00 25.99 ? 77  LYS B C     1 
ATOM   2935 O  O     . LYS B 1 41  ? 20.368  -30.036 36.378  1.00 27.28 ? 77  LYS B O     1 
ATOM   2936 C  CB    . LYS B 1 41  ? 20.649  -27.054 37.236  1.00 20.50 ? 77  LYS B CB    1 
ATOM   2937 C  CG    . LYS B 1 41  ? 21.477  -26.209 38.218  1.00 23.77 ? 77  LYS B CG    1 
ATOM   2938 C  CD    . LYS B 1 41  ? 22.436  -27.059 39.070  1.00 24.07 ? 77  LYS B CD    1 
ATOM   2939 C  CE    . LYS B 1 41  ? 22.947  -26.246 40.288  1.00 26.79 ? 77  LYS B CE    1 
ATOM   2940 N  NZ    . LYS B 1 41  ? 24.002  -26.974 41.050  1.00 28.21 ? 77  LYS B NZ    1 
ATOM   2941 N  N     . ARG B 1 42  ? 20.298  -28.949 34.416  1.00 22.85 ? 78  ARG B N     1 
ATOM   2942 C  CA    . ARG B 1 42  ? 19.640  -30.092 33.760  1.00 31.46 ? 78  ARG B CA    1 
ATOM   2943 C  C     . ARG B 1 42  ? 20.662  -31.156 33.345  1.00 27.42 ? 78  ARG B C     1 
ATOM   2944 O  O     . ARG B 1 42  ? 20.306  -32.292 33.038  1.00 34.18 ? 78  ARG B O     1 
ATOM   2945 C  CB    . ARG B 1 42  ? 18.792  -29.644 32.558  1.00 32.28 ? 78  ARG B CB    1 
ATOM   2946 C  CG    . ARG B 1 42  ? 17.676  -28.658 32.925  1.00 35.57 ? 78  ARG B CG    1 
ATOM   2947 C  CD    . ARG B 1 42  ? 16.581  -28.576 31.850  1.00 35.13 ? 78  ARG B CD    1 
ATOM   2948 N  NE    . ARG B 1 42  ? 17.075  -28.037 30.588  1.00 40.76 ? 78  ARG B NE    1 
ATOM   2949 C  CZ    . ARG B 1 42  ? 17.150  -26.735 30.306  1.00 46.95 ? 78  ARG B CZ    1 
ATOM   2950 N  NH1   . ARG B 1 42  ? 16.763  -25.827 31.203  1.00 42.59 ? 78  ARG B NH1   1 
ATOM   2951 N  NH2   . ARG B 1 42  ? 17.612  -26.336 29.124  1.00 49.28 ? 78  ARG B NH2   1 
ATOM   2952 N  N     . ILE B 1 43  ? 21.933  -30.772 33.349  1.00 27.77 ? 79  ILE B N     1 
ATOM   2953 C  CA    . ILE B 1 43  ? 23.040  -31.668 33.017  1.00 30.99 ? 79  ILE B CA    1 
ATOM   2954 C  C     . ILE B 1 43  ? 23.587  -32.353 34.276  1.00 31.31 ? 79  ILE B C     1 
ATOM   2955 O  O     . ILE B 1 43  ? 23.863  -33.556 34.295  1.00 27.53 ? 79  ILE B O     1 
ATOM   2956 C  CB    . ILE B 1 43  ? 24.210  -30.873 32.372  1.00 35.06 ? 79  ILE B CB    1 
ATOM   2957 C  CG1   . ILE B 1 43  ? 23.777  -30.215 31.062  1.00 37.35 ? 79  ILE B CG1   1 
ATOM   2958 C  CG2   . ILE B 1 43  ? 25.420  -31.767 32.157  1.00 37.81 ? 79  ILE B CG2   1 
ATOM   2959 C  CD1   . ILE B 1 43  ? 23.110  -31.185 30.112  1.00 42.58 ? 79  ILE B CD1   1 
ATOM   2960 N  N     . SER B 1 44  ? 23.791  -31.565 35.321  1.00 26.43 ? 80  SER B N     1 
ATOM   2961 C  CA    . SER B 1 44  ? 24.334  -32.090 36.562  1.00 25.65 ? 80  SER B CA    1 
ATOM   2962 C  C     . SER B 1 44  ? 23.819  -31.274 37.731  1.00 25.06 ? 80  SER B C     1 
ATOM   2963 O  O     . SER B 1 44  ? 23.860  -30.047 37.696  1.00 25.50 ? 80  SER B O     1 
ATOM   2964 C  CB    . SER B 1 44  ? 25.860  -32.023 36.552  1.00 34.56 ? 80  SER B CB    1 
ATOM   2965 O  OG    . SER B 1 44  ? 26.387  -32.508 37.780  1.00 37.06 ? 80  SER B OG    1 
ATOM   2966 N  N     . PRO B 1 45  ? 23.355  -31.955 38.784  1.00 26.27 ? 81  PRO B N     1 
ATOM   2967 C  CA    . PRO B 1 45  ? 22.881  -31.229 39.962  1.00 27.55 ? 81  PRO B CA    1 
ATOM   2968 C  C     . PRO B 1 45  ? 24.071  -30.747 40.773  1.00 29.40 ? 81  PRO B C     1 
ATOM   2969 O  O     . PRO B 1 45  ? 23.909  -29.872 41.615  1.00 27.82 ? 81  PRO B O     1 
ATOM   2970 C  CB    . PRO B 1 45  ? 22.118  -32.304 40.749  1.00 26.77 ? 81  PRO B CB    1 
ATOM   2971 C  CG    . PRO B 1 45  ? 22.798  -33.601 40.353  1.00 31.59 ? 81  PRO B CG    1 
ATOM   2972 C  CD    . PRO B 1 45  ? 23.252  -33.422 38.936  1.00 25.93 ? 81  PRO B CD    1 
ATOM   2973 N  N     . ASP B 1 46  ? 25.248  -31.315 40.518  1.00 23.89 ? 82  ASP B N     1 
ATOM   2974 C  CA    . ASP B 1 46  ? 26.420  -31.022 41.337  1.00 30.99 ? 82  ASP B CA    1 
ATOM   2975 C  C     . ASP B 1 46  ? 27.256  -29.850 40.824  1.00 35.92 ? 82  ASP B C     1 
ATOM   2976 O  O     . ASP B 1 46  ? 27.999  -29.229 41.582  1.00 37.26 ? 82  ASP B O     1 
ATOM   2977 C  CB    . ASP B 1 46  ? 27.297  -32.264 41.460  1.00 32.08 ? 82  ASP B CB    1 
ATOM   2978 C  CG    . ASP B 1 46  ? 26.565  -33.429 42.092  1.00 36.39 ? 82  ASP B CG    1 
ATOM   2979 O  OD1   . ASP B 1 46  ? 25.846  -33.217 43.097  1.00 31.81 ? 82  ASP B OD1   1 
ATOM   2980 O  OD2   . ASP B 1 46  ? 26.707  -34.552 41.575  1.00 39.02 ? 82  ASP B OD2   1 
ATOM   2981 N  N     . ALA B 1 47  ? 27.122  -29.539 39.544  1.00 29.85 ? 83  ALA B N     1 
ATOM   2982 C  CA    . ALA B 1 47  ? 27.954  -28.513 38.925  1.00 29.96 ? 83  ALA B CA    1 
ATOM   2983 C  C     . ALA B 1 47  ? 27.420  -27.118 39.206  1.00 30.22 ? 83  ALA B C     1 
ATOM   2984 O  O     . ALA B 1 47  ? 26.207  -26.900 39.195  1.00 26.66 ? 83  ALA B O     1 
ATOM   2985 C  CB    . ALA B 1 47  ? 28.014  -28.738 37.438  1.00 27.08 ? 83  ALA B CB    1 
ATOM   2986 N  N     . GLU B 1 48  ? 28.314  -26.156 39.428  1.00 26.90 ? 84  GLU B N     1 
ATOM   2987 C  CA    . GLU B 1 48  ? 27.860  -24.772 39.587  1.00 27.95 ? 84  GLU B CA    1 
ATOM   2988 C  C     . GLU B 1 48  ? 28.481  -23.836 38.545  1.00 27.09 ? 84  GLU B C     1 
ATOM   2989 O  O     . GLU B 1 48  ? 29.563  -24.084 38.027  1.00 26.83 ? 84  GLU B O     1 
ATOM   2990 C  CB    . GLU B 1 48  ? 28.078  -24.258 41.013  1.00 31.61 ? 84  GLU B CB    1 
ATOM   2991 C  CG    . GLU B 1 48  ? 29.510  -24.252 41.491  1.00 38.00 ? 84  GLU B CG    1 
ATOM   2992 C  CD    . GLU B 1 48  ? 29.680  -23.548 42.845  1.00 52.15 ? 84  GLU B CD    1 
ATOM   2993 O  OE1   . GLU B 1 48  ? 29.142  -22.425 43.017  1.00 52.15 ? 84  GLU B OE1   1 
ATOM   2994 O  OE2   . GLU B 1 48  ? 30.358  -24.116 43.733  1.00 50.38 ? 84  GLU B OE2   1 
ATOM   2995 N  N     . LEU B 1 49  ? 27.762  -22.780 38.213  1.00 24.98 ? 85  LEU B N     1 
ATOM   2996 C  CA    . LEU B 1 49  ? 28.229  -21.852 37.196  1.00 26.81 ? 85  LEU B CA    1 
ATOM   2997 C  C     . LEU B 1 49  ? 28.485  -20.530 37.909  1.00 28.19 ? 85  LEU B C     1 
ATOM   2998 O  O     . LEU B 1 49  ? 27.576  -19.946 38.513  1.00 31.57 ? 85  LEU B O     1 
ATOM   2999 C  CB    . LEU B 1 49  ? 27.179  -21.698 36.098  1.00 27.53 ? 85  LEU B CB    1 
ATOM   3000 C  CG    . LEU B 1 49  ? 27.512  -20.809 34.899  1.00 30.67 ? 85  LEU B CG    1 
ATOM   3001 C  CD1   . LEU B 1 49  ? 28.628  -21.419 34.087  1.00 28.72 ? 85  LEU B CD1   1 
ATOM   3002 C  CD2   . LEU B 1 49  ? 26.280  -20.605 34.040  1.00 30.35 ? 85  LEU B CD2   1 
ATOM   3003 N  N     . VAL B 1 50  ? 29.734  -20.081 37.845  1.00 28.50 ? 86  VAL B N     1 
ATOM   3004 C  CA    . VAL B 1 50  ? 30.210  -18.939 38.621  1.00 34.12 ? 86  VAL B CA    1 
ATOM   3005 C  C     . VAL B 1 50  ? 30.629  -17.842 37.655  1.00 29.86 ? 86  VAL B C     1 
ATOM   3006 O  O     . VAL B 1 50  ? 31.378  -18.112 36.728  1.00 25.25 ? 86  VAL B O     1 
ATOM   3007 C  CB    . VAL B 1 50  ? 31.457  -19.364 39.447  1.00 30.84 ? 86  VAL B CB    1 
ATOM   3008 C  CG1   . VAL B 1 50  ? 32.004  -18.208 40.259  1.00 32.63 ? 86  VAL B CG1   1 
ATOM   3009 C  CG2   . VAL B 1 50  ? 31.113  -20.540 40.358  1.00 38.00 ? 86  VAL B CG2   1 
ATOM   3010 N  N     . ALA B 1 51  ? 30.159  -16.614 37.865  1.00 25.90 ? 87  ALA B N     1 
ATOM   3011 C  CA    . ALA B 1 51  ? 30.613  -15.490 37.046  1.00 28.79 ? 87  ALA B CA    1 
ATOM   3012 C  C     . ALA B 1 51  ? 31.888  -14.924 37.641  1.00 29.86 ? 87  ALA B C     1 
ATOM   3013 O  O     . ALA B 1 51  ? 32.007  -14.819 38.853  1.00 29.92 ? 87  ALA B O     1 
ATOM   3014 C  CB    . ALA B 1 51  ? 29.551  -14.411 36.981  1.00 30.20 ? 87  ALA B CB    1 
ATOM   3015 N  N     . PHE B 1 52  ? 32.846  -14.553 36.802  1.00 27.46 ? 88  PHE B N     1 
ATOM   3016 C  CA    . PHE B 1 52  ? 33.983  -13.800 37.313  1.00 27.80 ? 88  PHE B CA    1 
ATOM   3017 C  C     . PHE B 1 52  ? 34.295  -12.619 36.390  1.00 29.20 ? 88  PHE B C     1 
ATOM   3018 O  O     . PHE B 1 52  ? 33.500  -12.297 35.499  1.00 27.94 ? 88  PHE B O     1 
ATOM   3019 C  CB    . PHE B 1 52  ? 35.194  -14.710 37.575  1.00 26.71 ? 88  PHE B CB    1 
ATOM   3020 C  CG    . PHE B 1 52  ? 35.797  -15.303 36.335  1.00 28.98 ? 88  PHE B CG    1 
ATOM   3021 C  CD1   . PHE B 1 52  ? 36.888  -14.699 35.728  1.00 31.46 ? 88  PHE B CD1   1 
ATOM   3022 C  CD2   . PHE B 1 52  ? 35.280  -16.463 35.782  1.00 30.52 ? 88  PHE B CD2   1 
ATOM   3023 C  CE1   . PHE B 1 52  ? 37.447  -15.229 34.587  1.00 32.68 ? 88  PHE B CE1   1 
ATOM   3024 C  CE2   . PHE B 1 52  ? 35.844  -17.015 34.635  1.00 29.83 ? 88  PHE B CE2   1 
ATOM   3025 C  CZ    . PHE B 1 52  ? 36.928  -16.398 34.040  1.00 35.17 ? 88  PHE B CZ    1 
ATOM   3026 N  N     . GLY B 1 53  ? 35.414  -11.939 36.617  1.00 29.57 ? 89  GLY B N     1 
ATOM   3027 C  CA    . GLY B 1 53  ? 35.751  -10.799 35.776  1.00 32.91 ? 89  GLY B CA    1 
ATOM   3028 C  C     . GLY B 1 53  ? 34.867  -9.572  35.962  1.00 33.16 ? 89  GLY B C     1 
ATOM   3029 O  O     . GLY B 1 53  ? 34.179  -9.424  36.975  1.00 28.56 ? 89  GLY B O     1 
ATOM   3030 N  N     . SER B 1 54  ? 34.879  -8.684  34.969  1.00 34.67 ? 90  SER B N     1 
ATOM   3031 C  CA    . SER B 1 54  ? 34.370  -7.321  35.151  1.00 33.12 ? 90  SER B CA    1 
ATOM   3032 C  C     . SER B 1 54  ? 32.878  -7.196  35.494  1.00 36.90 ? 90  SER B C     1 
ATOM   3033 O  O     . SER B 1 54  ? 32.495  -6.329  36.281  1.00 39.06 ? 90  SER B O     1 
ATOM   3034 C  CB    . SER B 1 54  ? 34.763  -6.431  33.963  1.00 36.39 ? 90  SER B CB    1 
ATOM   3035 O  OG    . SER B 1 54  ? 34.229  -6.910  32.746  1.00 42.84 ? 90  SER B OG    1 
ATOM   3036 N  N     . LEU B 1 55  ? 32.029  -8.051  34.939  1.00 36.25 ? 91  LEU B N     1 
ATOM   3037 C  CA    . LEU B 1 55  ? 30.617  -8.011  35.328  1.00 40.30 ? 91  LEU B CA    1 
ATOM   3038 C  C     . LEU B 1 55  ? 30.411  -8.350  36.808  1.00 43.51 ? 91  LEU B C     1 
ATOM   3039 O  O     . LEU B 1 55  ? 29.573  -7.750  37.492  1.00 44.18 ? 91  LEU B O     1 
ATOM   3040 C  CB    . LEU B 1 55  ? 29.796  -8.965  34.467  1.00 42.54 ? 91  LEU B CB    1 
ATOM   3041 C  CG    . LEU B 1 55  ? 29.350  -8.435  33.112  1.00 44.63 ? 91  LEU B CG    1 
ATOM   3042 C  CD1   . LEU B 1 55  ? 28.637  -9.526  32.342  1.00 45.82 ? 91  LEU B CD1   1 
ATOM   3043 C  CD2   . LEU B 1 55  ? 28.443  -7.232  33.309  1.00 44.03 ? 91  LEU B CD2   1 
ATOM   3044 N  N     . GLU B 1 56  ? 31.171  -9.329  37.290  1.00 37.60 ? 92  GLU B N     1 
ATOM   3045 C  CA    . GLU B 1 56  ? 31.085  -9.748  38.682  1.00 36.16 ? 92  GLU B CA    1 
ATOM   3046 C  C     . GLU B 1 56  ? 31.706  -8.699  39.600  1.00 35.54 ? 92  GLU B C     1 
ATOM   3047 O  O     . GLU B 1 56  ? 31.218  -8.452  40.694  1.00 34.45 ? 92  GLU B O     1 
ATOM   3048 C  CB    . GLU B 1 56  ? 31.788  -11.096 38.875  1.00 36.66 ? 92  GLU B CB    1 
ATOM   3049 C  CG    . GLU B 1 56  ? 31.589  -11.688 40.256  1.00 39.26 ? 92  GLU B CG    1 
ATOM   3050 C  CD    . GLU B 1 56  ? 30.122  -11.682 40.678  1.00 47.57 ? 92  GLU B CD    1 
ATOM   3051 O  OE1   . GLU B 1 56  ? 29.786  -10.985 41.664  1.00 60.05 ? 92  GLU B OE1   1 
ATOM   3052 O  OE2   . GLU B 1 56  ? 29.307  -12.364 40.019  1.00 43.82 ? 92  GLU B OE2   1 
ATOM   3053 N  N     . SER B 1 57  ? 32.788  -8.077  39.153  1.00 32.39 ? 93  SER B N     1 
ATOM   3054 C  CA    . SER B 1 57  ? 33.449  -7.066  39.978  1.00 33.60 ? 93  SER B CA    1 
ATOM   3055 C  C     . SER B 1 57  ? 32.761  -5.709  39.865  1.00 34.49 ? 93  SER B C     1 
ATOM   3056 O  O     . SER B 1 57  ? 32.979  -4.815  40.686  1.00 34.85 ? 93  SER B O     1 
ATOM   3057 C  CB    . SER B 1 57  ? 34.919  -6.947  39.587  1.00 32.28 ? 93  SER B CB    1 
ATOM   3058 O  OG    . SER B 1 57  ? 35.049  -6.646  38.211  1.00 33.89 ? 93  SER B OG    1 
ATOM   3059 N  N     . GLY B 1 58  ? 31.926  -5.552  38.844  1.00 35.19 ? 94  GLY B N     1 
ATOM   3060 C  CA    . GLY B 1 58  ? 31.276  -4.276  38.613  1.00 35.45 ? 94  GLY B CA    1 
ATOM   3061 C  C     . GLY B 1 58  ? 32.250  -3.261  38.038  1.00 33.75 ? 94  GLY B C     1 
ATOM   3062 O  O     . GLY B 1 58  ? 32.126  -2.062  38.288  1.00 42.51 ? 94  GLY B O     1 
ATOM   3063 N  N     . LEU B 1 59  ? 33.234  -3.743  37.285  1.00 28.61 ? 95  LEU B N     1 
ATOM   3064 C  CA    . LEU B 1 59  ? 34.193  -2.869  36.614  1.00 29.36 ? 95  LEU B CA    1 
ATOM   3065 C  C     . LEU B 1 59  ? 34.057  -2.985  35.101  1.00 29.95 ? 95  LEU B C     1 
ATOM   3066 O  O     . LEU B 1 59  ? 35.059  -3.013  34.384  1.00 33.62 ? 95  LEU B O     1 
ATOM   3067 C  CB    . LEU B 1 59  ? 35.626  -3.206  37.033  1.00 24.91 ? 95  LEU B CB    1 
ATOM   3068 C  CG    . LEU B 1 59  ? 35.991  -3.055  38.513  1.00 27.76 ? 95  LEU B CG    1 
ATOM   3069 C  CD1   . LEU B 1 59  ? 37.387  -3.601  38.780  1.00 24.99 ? 95  LEU B CD1   1 
ATOM   3070 C  CD2   . LEU B 1 59  ? 35.907  -1.600  38.959  1.00 22.92 ? 95  LEU B CD2   1 
ATOM   3071 N  N     . ALA B 1 60  ? 32.820  -3.043  34.613  1.00 31.57 ? 96  ALA B N     1 
ATOM   3072 C  CA    . ALA B 1 60  ? 32.589  -3.335  33.196  1.00 33.69 ? 96  ALA B CA    1 
ATOM   3073 C  C     . ALA B 1 60  ? 32.159  -2.114  32.385  1.00 27.60 ? 96  ALA B C     1 
ATOM   3074 O  O     . ALA B 1 60  ? 31.375  -1.289  32.853  1.00 32.36 ? 96  ALA B O     1 
ATOM   3075 C  CB    . ALA B 1 60  ? 31.564  -4.448  33.039  1.00 36.15 ? 96  ALA B CB    1 
ATOM   3076 N  N     . LEU B 1 61  ? 32.659  -2.031  31.161  1.00 36.68 ? 97  LEU B N     1 
ATOM   3077 C  CA    . LEU B 1 61  ? 32.196  -1.040  30.198  1.00 35.81 ? 97  LEU B CA    1 
ATOM   3078 C  C     . LEU B 1 61  ? 30.955  -1.565  29.474  1.00 37.51 ? 97  LEU B C     1 
ATOM   3079 O  O     . LEU B 1 61  ? 30.639  -2.756  29.558  1.00 36.65 ? 97  LEU B O     1 
ATOM   3080 C  CB    . LEU B 1 61  ? 33.305  -0.756  29.186  1.00 35.86 ? 97  LEU B CB    1 
ATOM   3081 C  CG    . LEU B 1 61  ? 34.582  -0.122  29.733  1.00 33.41 ? 97  LEU B CG    1 
ATOM   3082 C  CD1   . LEU B 1 61  ? 35.694  -0.143  28.690  1.00 36.48 ? 97  LEU B CD1   1 
ATOM   3083 C  CD2   . LEU B 1 61  ? 34.312  1.312   30.193  1.00 28.91 ? 97  LEU B CD2   1 
ATOM   3084 N  N     . LYS B 1 62  ? 30.253  -0.675  28.774  1.00 39.74 ? 98  LYS B N     1 
ATOM   3085 C  CA    . LYS B 1 62  ? 29.193  -1.075  27.844  1.00 42.69 ? 98  LYS B CA    1 
ATOM   3086 C  C     . LYS B 1 62  ? 29.648  -2.226  26.955  1.00 40.21 ? 98  LYS B C     1 
ATOM   3087 O  O     . LYS B 1 62  ? 30.796  -2.253  26.514  1.00 41.32 ? 98  LYS B O     1 
ATOM   3088 C  CB    . LYS B 1 62  ? 28.820  0.100   26.942  1.00 41.96 ? 98  LYS B CB    1 
ATOM   3089 C  CG    . LYS B 1 62  ? 27.391  0.554   27.064  1.00 41.13 ? 98  LYS B CG    1 
ATOM   3090 C  CD    . LYS B 1 62  ? 27.327  2.068   27.176  1.00 38.75 ? 98  LYS B CD    1 
ATOM   3091 C  CE    . LYS B 1 62  ? 25.925  2.537   27.516  1.00 44.42 ? 98  LYS B CE    1 
ATOM   3092 N  NZ    . LYS B 1 62  ? 25.858  4.022   27.462  1.00 46.17 ? 98  LYS B NZ    1 
ATOM   3093 N  N     . ASN B 1 63  ? 28.746  -3.177  26.708  1.00 39.48 ? 99  ASN B N     1 
ATOM   3094 C  CA    . ASN B 1 63  ? 28.996  -4.287  25.780  1.00 44.23 ? 99  ASN B CA    1 
ATOM   3095 C  C     . ASN B 1 63  ? 30.219  -5.154  26.108  1.00 45.34 ? 99  ASN B C     1 
ATOM   3096 O  O     . ASN B 1 63  ? 30.887  -5.671  25.214  1.00 46.04 ? 99  ASN B O     1 
ATOM   3097 C  CB    . ASN B 1 63  ? 29.066  -3.770  24.334  1.00 48.51 ? 99  ASN B CB    1 
ATOM   3098 C  CG    . ASN B 1 63  ? 27.947  -2.780  24.012  1.00 50.48 ? 99  ASN B CG    1 
ATOM   3099 O  OD1   . ASN B 1 63  ? 28.201  -1.677  23.528  1.00 57.18 ? 99  ASN B OD1   1 
ATOM   3100 N  ND2   . ASN B 1 63  ? 26.706  -3.165  24.300  1.00 47.31 ? 99  ASN B ND2   1 
ATOM   3101 N  N     . SER B 1 64  ? 30.513  -5.314  27.392  1.00 43.30 ? 100 SER B N     1 
ATOM   3102 C  CA    . SER B 1 64  ? 31.628  -6.162  27.796  1.00 42.17 ? 100 SER B CA    1 
ATOM   3103 C  C     . SER B 1 64  ? 31.271  -7.634  27.638  1.00 37.33 ? 100 SER B C     1 
ATOM   3104 O  O     . SER B 1 64  ? 30.097  -8.000  27.580  1.00 39.79 ? 100 SER B O     1 
ATOM   3105 C  CB    . SER B 1 64  ? 32.035  -5.872  29.241  1.00 43.46 ? 100 SER B CB    1 
ATOM   3106 O  OG    . SER B 1 64  ? 30.900  -5.780  30.085  1.00 42.78 ? 100 SER B OG    1 
ATOM   3107 N  N     . ASP B 1 65  ? 32.292  -8.475  27.570  1.00 40.61 ? 101 ASP B N     1 
ATOM   3108 C  CA    . ASP B 1 65  ? 32.082  -9.909  27.481  1.00 45.29 ? 101 ASP B CA    1 
ATOM   3109 C  C     . ASP B 1 65  ? 31.763  -10.482 28.860  1.00 41.19 ? 101 ASP B C     1 
ATOM   3110 O  O     . ASP B 1 65  ? 32.157  -9.910  29.879  1.00 39.92 ? 101 ASP B O     1 
ATOM   3111 C  CB    . ASP B 1 65  ? 33.340  -10.577 26.933  1.00 45.50 ? 101 ASP B CB    1 
ATOM   3112 C  CG    . ASP B 1 65  ? 34.024  -9.745  25.859  1.00 54.66 ? 101 ASP B CG    1 
ATOM   3113 O  OD1   . ASP B 1 65  ? 34.738  -8.775  26.214  1.00 55.46 ? 101 ASP B OD1   1 
ATOM   3114 O  OD2   . ASP B 1 65  ? 33.852  -10.066 24.662  1.00 59.09 ? 101 ASP B OD2   1 
ATOM   3115 N  N     . MET B 1 66  ? 31.036  -11.595 28.885  1.00 38.76 ? 102 MET B N     1 
ATOM   3116 C  CA    . MET B 1 66  ? 30.816  -12.351 30.117  1.00 37.70 ? 102 MET B CA    1 
ATOM   3117 C  C     . MET B 1 66  ? 31.914  -13.403 30.250  1.00 38.08 ? 102 MET B C     1 
ATOM   3118 O  O     . MET B 1 66  ? 32.305  -14.034 29.265  1.00 38.63 ? 102 MET B O     1 
ATOM   3119 C  CB    . MET B 1 66  ? 29.450  -13.050 30.102  1.00 40.04 ? 102 MET B CB    1 
ATOM   3120 C  CG    . MET B 1 66  ? 28.249  -12.129 29.927  1.00 48.73 ? 102 MET B CG    1 
ATOM   3121 S  SD    . MET B 1 66  ? 26.671  -12.982 30.197  1.00 56.28 ? 102 MET B SD    1 
ATOM   3122 C  CE    . MET B 1 66  ? 26.809  -13.405 31.930  1.00 33.33 ? 102 MET B CE    1 
ATOM   3123 N  N     . ASP B 1 67  ? 32.433  -13.575 31.458  1.00 31.10 ? 103 ASP B N     1 
ATOM   3124 C  CA    . ASP B 1 67  ? 33.412  -14.622 31.720  1.00 32.99 ? 103 ASP B CA    1 
ATOM   3125 C  C     . ASP B 1 67  ? 32.796  -15.510 32.784  1.00 31.85 ? 103 ASP B C     1 
ATOM   3126 O  O     . ASP B 1 67  ? 32.429  -15.024 33.854  1.00 27.13 ? 103 ASP B O     1 
ATOM   3127 C  CB    . ASP B 1 67  ? 34.728  -14.024 32.236  1.00 35.82 ? 103 ASP B CB    1 
ATOM   3128 C  CG    . ASP B 1 67  ? 35.555  -13.365 31.133  1.00 41.46 ? 103 ASP B CG    1 
ATOM   3129 O  OD1   . ASP B 1 67  ? 35.833  -14.029 30.107  1.00 45.71 ? 103 ASP B OD1   1 
ATOM   3130 O  OD2   . ASP B 1 67  ? 35.932  -12.181 31.297  1.00 48.44 ? 103 ASP B OD2   1 
ATOM   3131 N  N     . LEU B 1 68  ? 32.655  -16.800 32.494  1.00 28.10 ? 104 LEU B N     1 
ATOM   3132 C  CA    . LEU B 1 68  ? 32.003  -17.699 33.436  1.00 24.51 ? 104 LEU B CA    1 
ATOM   3133 C  C     . LEU B 1 68  ? 32.855  -18.935 33.636  1.00 28.77 ? 104 LEU B C     1 
ATOM   3134 O  O     . LEU B 1 68  ? 33.659  -19.292 32.778  1.00 25.86 ? 104 LEU B O     1 
ATOM   3135 C  CB    . LEU B 1 68  ? 30.611  -18.112 32.948  1.00 27.63 ? 104 LEU B CB    1 
ATOM   3136 C  CG    . LEU B 1 68  ? 29.610  -17.049 32.510  1.00 34.83 ? 104 LEU B CG    1 
ATOM   3137 C  CD1   . LEU B 1 68  ? 28.362  -17.733 31.968  1.00 35.85 ? 104 LEU B CD1   1 
ATOM   3138 C  CD2   . LEU B 1 68  ? 29.232  -16.149 33.672  1.00 29.22 ? 104 LEU B CD2   1 
ATOM   3139 N  N     . CYS B 1 69  ? 32.681  -19.583 34.782  1.00 25.85 ? 105 CYS B N     1 
ATOM   3140 C  CA    . CYS B 1 69  ? 33.450  -20.774 35.083  1.00 27.89 ? 105 CYS B CA    1 
ATOM   3141 C  C     . CYS B 1 69  ? 32.478  -21.822 35.587  1.00 25.71 ? 105 CYS B C     1 
ATOM   3142 O  O     . CYS B 1 69  ? 31.645  -21.519 36.442  1.00 25.52 ? 105 CYS B O     1 
ATOM   3143 C  CB    . CYS B 1 69  ? 34.464  -20.461 36.184  1.00 24.89 ? 105 CYS B CB    1 
ATOM   3144 S  SG    . CYS B 1 69  ? 35.652  -21.751 36.471  1.00 48.96 ? 105 CYS B SG    1 
ATOM   3145 N  N     . VAL B 1 70  ? 32.585  -23.043 35.068  1.00 27.43 ? 106 VAL B N     1 
ATOM   3146 C  CA    . VAL B 1 70  ? 31.825  -24.167 35.606  1.00 27.94 ? 106 VAL B CA    1 
ATOM   3147 C  C     . VAL B 1 70  ? 32.669  -24.819 36.690  1.00 30.51 ? 106 VAL B C     1 
ATOM   3148 O  O     . VAL B 1 70  ? 33.806  -25.214 36.430  1.00 31.99 ? 106 VAL B O     1 
ATOM   3149 C  CB    . VAL B 1 70  ? 31.508  -25.227 34.524  1.00 30.50 ? 106 VAL B CB    1 
ATOM   3150 C  CG1   . VAL B 1 70  ? 30.914  -26.474 35.169  1.00 26.27 ? 106 VAL B CG1   1 
ATOM   3151 C  CG2   . VAL B 1 70  ? 30.545  -24.676 33.477  1.00 24.29 ? 106 VAL B CG2   1 
ATOM   3152 N  N     . LEU B 1 71  ? 32.122  -24.931 37.898  1.00 27.11 ? 107 LEU B N     1 
ATOM   3153 C  CA    . LEU B 1 71  ? 32.842  -25.556 39.013  1.00 33.02 ? 107 LEU B CA    1 
ATOM   3154 C  C     . LEU B 1 71  ? 32.295  -26.938 39.322  1.00 40.14 ? 107 LEU B C     1 
ATOM   3155 O  O     . LEU B 1 71  ? 31.083  -27.148 39.291  1.00 32.32 ? 107 LEU B O     1 
ATOM   3156 C  CB    . LEU B 1 71  ? 32.725  -24.708 40.278  1.00 31.50 ? 107 LEU B CB    1 
ATOM   3157 C  CG    . LEU B 1 71  ? 33.446  -23.368 40.308  1.00 34.93 ? 107 LEU B CG    1 
ATOM   3158 C  CD1   . LEU B 1 71  ? 33.494  -22.829 41.727  1.00 37.07 ? 107 LEU B CD1   1 
ATOM   3159 C  CD2   . LEU B 1 71  ? 34.843  -23.516 39.746  1.00 34.48 ? 107 LEU B CD2   1 
ATOM   3160 N  N     . MET B 1 72  ? 33.191  -27.874 39.626  1.00 44.92 ? 108 MET B N     1 
ATOM   3161 C  CA    . MET B 1 72  ? 32.796  -29.189 40.120  1.00 54.51 ? 108 MET B CA    1 
ATOM   3162 C  C     . MET B 1 72  ? 33.802  -29.703 41.148  1.00 57.96 ? 108 MET B C     1 
ATOM   3163 O  O     . MET B 1 72  ? 35.013  -29.529 40.970  1.00 57.12 ? 108 MET B O     1 
ATOM   3164 C  CB    . MET B 1 72  ? 32.709  -30.205 38.979  1.00 53.53 ? 108 MET B CB    1 
ATOM   3165 C  CG    . MET B 1 72  ? 31.737  -29.868 37.873  1.00 48.06 ? 108 MET B CG    1 
ATOM   3166 S  SD    . MET B 1 72  ? 31.439  -31.286 36.802  1.00 69.43 ? 108 MET B SD    1 
ATOM   3167 C  CE    . MET B 1 72  ? 30.199  -32.183 37.737  1.00 50.76 ? 108 MET B CE    1 
ATOM   3168 N  N     . ASP B 1 73  ? 33.288  -30.331 42.207  1.00 61.77 ? 109 ASP B N     1 
ATOM   3169 C  CA    . ASP B 1 73  ? 34.085  -31.118 43.160  1.00 63.05 ? 109 ASP B CA    1 
ATOM   3170 C  C     . ASP B 1 73  ? 35.369  -30.444 43.652  1.00 68.54 ? 109 ASP B C     1 
ATOM   3171 O  O     . ASP B 1 73  ? 35.350  -29.647 44.590  1.00 72.65 ? 109 ASP B O     1 
ATOM   3172 C  CB    . ASP B 1 73  ? 34.404  -32.512 42.587  1.00 60.63 ? 109 ASP B CB    1 
ATOM   3173 C  CG    . ASP B 1 73  ? 35.258  -32.453 41.317  1.00 68.89 ? 109 ASP B CG    1 
ATOM   3174 O  OD1   . ASP B 1 73  ? 36.434  -32.017 41.390  1.00 66.38 ? 109 ASP B OD1   1 
ATOM   3175 O  OD2   . ASP B 1 73  ? 34.751  -32.842 40.242  1.00 70.68 ? 109 ASP B OD2   1 
ATOM   3176 N  N     . THR B 1 80  ? 33.335  -34.178 29.109  1.00 56.28 ? 116 THR B N     1 
ATOM   3177 C  CA    . THR B 1 80  ? 32.403  -34.940 29.937  1.00 58.23 ? 116 THR B CA    1 
ATOM   3178 C  C     . THR B 1 80  ? 31.104  -34.159 30.136  1.00 54.24 ? 116 THR B C     1 
ATOM   3179 O  O     . THR B 1 80  ? 30.215  -34.180 29.279  1.00 52.57 ? 116 THR B O     1 
ATOM   3180 C  CB    . THR B 1 80  ? 33.026  -35.312 31.307  1.00 56.93 ? 116 THR B CB    1 
ATOM   3181 O  OG1   . THR B 1 80  ? 33.678  -34.166 31.870  1.00 61.41 ? 116 THR B OG1   1 
ATOM   3182 C  CG2   . THR B 1 80  ? 34.045  -36.415 31.141  1.00 56.84 ? 116 THR B CG2   1 
ATOM   3183 N  N     . ILE B 1 81  ? 30.989  -33.476 31.269  1.00 52.77 ? 117 ILE B N     1 
ATOM   3184 C  CA    . ILE B 1 81  ? 29.884  -32.553 31.477  1.00 47.33 ? 117 ILE B CA    1 
ATOM   3185 C  C     . ILE B 1 81  ? 30.033  -31.395 30.495  1.00 43.44 ? 117 ILE B C     1 
ATOM   3186 O  O     . ILE B 1 81  ? 29.049  -30.905 29.941  1.00 45.34 ? 117 ILE B O     1 
ATOM   3187 C  CB    . ILE B 1 81  ? 29.873  -32.019 32.921  1.00 48.98 ? 117 ILE B CB    1 
ATOM   3188 C  CG1   . ILE B 1 81  ? 29.278  -30.606 32.970  1.00 47.70 ? 117 ILE B CG1   1 
ATOM   3189 C  CG2   . ILE B 1 81  ? 31.282  -32.019 33.476  1.00 55.16 ? 117 ILE B CG2   1 
ATOM   3190 C  CD1   . ILE B 1 81  ? 29.288  -29.969 34.345  1.00 50.53 ? 117 ILE B CD1   1 
ATOM   3191 N  N     . ALA B 1 82  ? 31.279  -30.980 30.279  1.00 43.92 ? 118 ALA B N     1 
ATOM   3192 C  CA    . ALA B 1 82  ? 31.614  -29.926 29.325  1.00 44.82 ? 118 ALA B CA    1 
ATOM   3193 C  C     . ALA B 1 82  ? 30.983  -30.169 27.956  1.00 42.09 ? 118 ALA B C     1 
ATOM   3194 O  O     . ALA B 1 82  ? 30.314  -29.291 27.408  1.00 39.65 ? 118 ALA B O     1 
ATOM   3195 C  CB    . ALA B 1 82  ? 33.118  -29.802 29.193  1.00 45.13 ? 118 ALA B CB    1 
ATOM   3196 N  N     . LEU B 1 83  ? 31.193  -31.362 27.404  1.00 44.11 ? 119 LEU B N     1 
ATOM   3197 C  CA    . LEU B 1 83  ? 30.619  -31.683 26.100  1.00 43.83 ? 119 LEU B CA    1 
ATOM   3198 C  C     . LEU B 1 83  ? 29.093  -31.682 26.123  1.00 40.49 ? 119 LEU B C     1 
ATOM   3199 O  O     . LEU B 1 83  ? 28.468  -31.033 25.275  1.00 40.71 ? 119 LEU B O     1 
ATOM   3200 C  CB    . LEU B 1 83  ? 31.141  -33.018 25.553  1.00 47.26 ? 119 LEU B CB    1 
ATOM   3201 C  CG    . LEU B 1 83  ? 31.612  -32.959 24.093  1.00 51.49 ? 119 LEU B CG    1 
ATOM   3202 C  CD1   . LEU B 1 83  ? 31.954  -34.346 23.560  1.00 49.25 ? 119 LEU B CD1   1 
ATOM   3203 C  CD2   . LEU B 1 83  ? 30.591  -32.266 23.187  1.00 47.52 ? 119 LEU B CD2   1 
ATOM   3204 N  N     . GLN B 1 84  ? 28.485  -32.385 27.081  1.00 42.86 ? 120 GLN B N     1 
ATOM   3205 C  CA    . GLN B 1 84  ? 27.021  -32.415 27.119  1.00 41.35 ? 120 GLN B CA    1 
ATOM   3206 C  C     . GLN B 1 84  ? 26.422  -31.063 27.478  1.00 38.17 ? 120 GLN B C     1 
ATOM   3207 O  O     . GLN B 1 84  ? 25.306  -30.763 27.068  1.00 38.58 ? 120 GLN B O     1 
ATOM   3208 C  CB    . GLN B 1 84  ? 26.437  -33.567 27.969  1.00 45.10 ? 120 GLN B CB    1 
ATOM   3209 C  CG    . GLN B 1 84  ? 27.134  -33.854 29.291  1.00 49.78 ? 120 GLN B CG    1 
ATOM   3210 C  CD    . GLN B 1 84  ? 26.494  -35.009 30.062  1.00 48.59 ? 120 GLN B CD    1 
ATOM   3211 O  OE1   . GLN B 1 84  ? 25.318  -35.337 29.865  1.00 47.65 ? 120 GLN B OE1   1 
ATOM   3212 N  NE2   . GLN B 1 84  ? 27.271  -35.626 30.948  1.00 53.71 ? 120 GLN B NE2   1 
ATOM   3213 N  N     . PHE B 1 85  ? 27.167  -30.239 28.218  1.00 40.30 ? 121 PHE B N     1 
ATOM   3214 C  CA    . PHE B 1 85  ? 26.745  -28.859 28.456  1.00 36.99 ? 121 PHE B CA    1 
ATOM   3215 C  C     . PHE B 1 85  ? 26.703  -28.121 27.116  1.00 34.18 ? 121 PHE B C     1 
ATOM   3216 O  O     . PHE B 1 85  ? 25.720  -27.464 26.779  1.00 35.19 ? 121 PHE B O     1 
ATOM   3217 C  CB    . PHE B 1 85  ? 27.707  -28.148 29.422  1.00 36.22 ? 121 PHE B CB    1 
ATOM   3218 C  CG    . PHE B 1 85  ? 27.203  -26.815 29.924  1.00 31.16 ? 121 PHE B CG    1 
ATOM   3219 C  CD1   . PHE B 1 85  ? 25.842  -26.561 30.037  1.00 30.49 ? 121 PHE B CD1   1 
ATOM   3220 C  CD2   . PHE B 1 85  ? 28.100  -25.815 30.281  1.00 33.87 ? 121 PHE B CD2   1 
ATOM   3221 C  CE1   . PHE B 1 85  ? 25.378  -25.329 30.502  1.00 29.94 ? 121 PHE B CE1   1 
ATOM   3222 C  CE2   . PHE B 1 85  ? 27.654  -24.587 30.741  1.00 34.87 ? 121 PHE B CE2   1 
ATOM   3223 C  CZ    . PHE B 1 85  ? 26.287  -24.341 30.857  1.00 31.89 ? 121 PHE B CZ    1 
ATOM   3224 N  N     . TYR B 1 86  ? 27.779  -28.237 26.349  1.00 38.20 ? 122 TYR B N     1 
ATOM   3225 C  CA    . TYR B 1 86  ? 27.848  -27.577 25.051  1.00 38.08 ? 122 TYR B CA    1 
ATOM   3226 C  C     . TYR B 1 86  ? 26.765  -28.078 24.097  1.00 38.91 ? 122 TYR B C     1 
ATOM   3227 O  O     . TYR B 1 86  ? 26.036  -27.280 23.497  1.00 36.27 ? 122 TYR B O     1 
ATOM   3228 C  CB    . TYR B 1 86  ? 29.225  -27.776 24.416  1.00 39.27 ? 122 TYR B CB    1 
ATOM   3229 C  CG    . TYR B 1 86  ? 29.293  -27.245 23.001  1.00 44.81 ? 122 TYR B CG    1 
ATOM   3230 C  CD1   . TYR B 1 86  ? 29.086  -25.893 22.739  1.00 39.12 ? 122 TYR B CD1   1 
ATOM   3231 C  CD2   . TYR B 1 86  ? 29.545  -28.091 21.930  1.00 41.37 ? 122 TYR B CD2   1 
ATOM   3232 C  CE1   . TYR B 1 86  ? 29.139  -25.394 21.451  1.00 44.38 ? 122 TYR B CE1   1 
ATOM   3233 C  CE2   . TYR B 1 86  ? 29.603  -27.600 20.634  1.00 46.21 ? 122 TYR B CE2   1 
ATOM   3234 C  CZ    . TYR B 1 86  ? 29.397  -26.252 20.404  1.00 42.50 ? 122 TYR B CZ    1 
ATOM   3235 O  OH    . TYR B 1 86  ? 29.450  -25.750 19.122  1.00 42.21 ? 122 TYR B OH    1 
ATOM   3236 N  N     . GLU B 1 87  ? 26.678  -29.401 23.957  1.00 42.32 ? 123 GLU B N     1 
ATOM   3237 C  CA    . GLU B 1 87  ? 25.688  -30.022 23.078  1.00 45.55 ? 123 GLU B CA    1 
ATOM   3238 C  C     . GLU B 1 87  ? 24.307  -29.540 23.484  1.00 45.21 ? 123 GLU B C     1 
ATOM   3239 O  O     . GLU B 1 87  ? 23.498  -29.151 22.642  1.00 50.53 ? 123 GLU B O     1 
ATOM   3240 C  CB    . GLU B 1 87  ? 25.768  -31.552 23.168  1.00 48.98 ? 123 GLU B CB    1 
ATOM   3241 C  CG    . GLU B 1 87  ? 25.304  -32.292 21.913  1.00 55.53 ? 123 GLU B CG    1 
ATOM   3242 C  CD    . GLU B 1 87  ? 23.958  -32.990 22.085  1.00 66.17 ? 123 GLU B CD    1 
ATOM   3243 O  OE1   . GLU B 1 87  ? 23.130  -32.505 22.894  1.00 67.93 ? 123 GLU B OE1   1 
ATOM   3244 O  OE2   . GLU B 1 87  ? 23.732  -34.025 21.412  1.00 62.64 ? 123 GLU B OE2   1 
ATOM   3245 N  N     . GLU B 1 88  ? 24.054  -29.527 24.787  1.00 45.32 ? 124 GLU B N     1 
ATOM   3246 C  CA    . GLU B 1 88  ? 22.769  -29.076 25.298  1.00 44.68 ? 124 GLU B CA    1 
ATOM   3247 C  C     . GLU B 1 88  ? 22.515  -27.607 24.965  1.00 43.47 ? 124 GLU B C     1 
ATOM   3248 O  O     . GLU B 1 88  ? 21.411  -27.229 24.563  1.00 48.85 ? 124 GLU B O     1 
ATOM   3249 C  CB    . GLU B 1 88  ? 22.700  -29.289 26.806  1.00 42.95 ? 124 GLU B CB    1 
ATOM   3250 C  CG    . GLU B 1 88  ? 21.516  -28.623 27.448  1.00 46.60 ? 124 GLU B CG    1 
ATOM   3251 C  CD    . GLU B 1 88  ? 20.216  -29.347 27.187  1.00 54.79 ? 124 GLU B CD    1 
ATOM   3252 O  OE1   . GLU B 1 88  ? 19.143  -28.727 27.375  1.00 60.30 ? 124 GLU B OE1   1 
ATOM   3253 O  OE2   . GLU B 1 88  ? 20.268  -30.536 26.801  1.00 59.02 ? 124 GLU B OE2   1 
ATOM   3254 N  N     . LEU B 1 89  ? 23.543  -26.782 25.135  1.00 39.08 ? 125 LEU B N     1 
ATOM   3255 C  CA    . LEU B 1 89  ? 23.428  -25.350 24.860  1.00 45.15 ? 125 LEU B CA    1 
ATOM   3256 C  C     . LEU B 1 89  ? 23.069  -25.068 23.393  1.00 47.17 ? 125 LEU B C     1 
ATOM   3257 O  O     . LEU B 1 89  ? 22.193  -24.256 23.110  1.00 49.68 ? 125 LEU B O     1 
ATOM   3258 C  CB    . LEU B 1 89  ? 24.720  -24.618 25.249  1.00 41.15 ? 125 LEU B CB    1 
ATOM   3259 C  CG    . LEU B 1 89  ? 24.950  -24.402 26.743  1.00 35.19 ? 125 LEU B CG    1 
ATOM   3260 C  CD1   . LEU B 1 89  ? 26.347  -23.863 27.008  1.00 37.73 ? 125 LEU B CD1   1 
ATOM   3261 C  CD2   . LEU B 1 89  ? 23.915  -23.442 27.269  1.00 36.47 ? 125 LEU B CD2   1 
ATOM   3262 N  N     . ILE B 1 90  ? 23.744  -25.733 22.459  1.00 46.86 ? 126 ILE B N     1 
ATOM   3263 C  CA    . ILE B 1 90  ? 23.445  -25.495 21.046  1.00 50.72 ? 126 ILE B CA    1 
ATOM   3264 C  C     . ILE B 1 90  ? 22.116  -26.130 20.629  1.00 50.90 ? 126 ILE B C     1 
ATOM   3265 O  O     . ILE B 1 90  ? 21.364  -25.556 19.839  1.00 53.94 ? 126 ILE B O     1 
ATOM   3266 C  CB    . ILE B 1 90  ? 24.593  -25.919 20.106  1.00 49.32 ? 126 ILE B CB    1 
ATOM   3267 C  CG1   . ILE B 1 90  ? 24.905  -27.404 20.242  1.00 46.87 ? 126 ILE B CG1   1 
ATOM   3268 C  CG2   . ILE B 1 90  ? 25.829  -25.060 20.343  1.00 47.38 ? 126 ILE B CG2   1 
ATOM   3269 C  CD1   . ILE B 1 90  ? 24.586  -28.178 18.980  1.00 53.67 ? 126 ILE B CD1   1 
ATOM   3270 N  N     . ALA B 1 91  ? 21.822  -27.306 21.176  1.00 49.79 ? 127 ALA B N     1 
ATOM   3271 C  CA    . ALA B 1 91  ? 20.525  -27.933 20.963  1.00 52.05 ? 127 ALA B CA    1 
ATOM   3272 C  C     . ALA B 1 91  ? 19.438  -26.982 21.444  1.00 50.53 ? 127 ALA B C     1 
ATOM   3273 O  O     . ALA B 1 91  ? 18.344  -26.926 20.885  1.00 56.13 ? 127 ALA B O     1 
ATOM   3274 C  CB    . ALA B 1 91  ? 20.448  -29.245 21.704  1.00 49.05 ? 127 ALA B CB    1 
ATOM   3275 N  N     . GLU B 1 92  ? 19.757  -26.224 22.485  1.00 54.04 ? 128 GLU B N     1 
ATOM   3276 C  CA    . GLU B 1 92  ? 18.848  -25.217 23.015  1.00 53.22 ? 128 GLU B CA    1 
ATOM   3277 C  C     . GLU B 1 92  ? 18.761  -24.017 22.080  1.00 56.71 ? 128 GLU B C     1 
ATOM   3278 O  O     . GLU B 1 92  ? 17.871  -23.176 22.219  1.00 56.87 ? 128 GLU B O     1 
ATOM   3279 C  CB    . GLU B 1 92  ? 19.327  -24.749 24.391  1.00 51.20 ? 128 GLU B CB    1 
ATOM   3280 C  CG    . GLU B 1 92  ? 18.211  -24.479 25.367  1.00 55.90 ? 128 GLU B CG    1 
ATOM   3281 C  CD    . GLU B 1 92  ? 17.337  -25.698 25.582  1.00 62.09 ? 128 GLU B CD    1 
ATOM   3282 O  OE1   . GLU B 1 92  ? 17.628  -26.484 26.512  1.00 63.26 ? 128 GLU B OE1   1 
ATOM   3283 O  OE2   . GLU B 1 92  ? 16.363  -25.878 24.815  1.00 61.84 ? 128 GLU B OE2   1 
ATOM   3284 N  N     . GLY B 1 93  ? 19.695  -23.926 21.137  1.00 53.94 ? 129 GLY B N     1 
ATOM   3285 C  CA    . GLY B 1 93  ? 19.700  -22.817 20.200  1.00 51.65 ? 129 GLY B CA    1 
ATOM   3286 C  C     . GLY B 1 93  ? 20.593  -21.667 20.623  1.00 52.64 ? 129 GLY B C     1 
ATOM   3287 O  O     . GLY B 1 93  ? 20.252  -20.497 20.430  1.00 55.92 ? 129 GLY B O     1 
ATOM   3288 N  N     . PHE B 1 94  ? 21.731  -21.994 21.223  1.00 50.51 ? 130 PHE B N     1 
ATOM   3289 C  CA    . PHE B 1 94  ? 22.784  -21.005 21.409  1.00 50.28 ? 130 PHE B CA    1 
ATOM   3290 C  C     . PHE B 1 94  ? 23.744  -21.187 20.250  1.00 47.40 ? 130 PHE B C     1 
ATOM   3291 O  O     . PHE B 1 94  ? 23.841  -22.274 19.680  1.00 47.93 ? 130 PHE B O     1 
ATOM   3292 C  CB    . PHE B 1 94  ? 23.534  -21.221 22.726  1.00 48.81 ? 130 PHE B CB    1 
ATOM   3293 C  CG    . PHE B 1 94  ? 22.775  -20.779 23.947  1.00 51.48 ? 130 PHE B CG    1 
ATOM   3294 C  CD1   . PHE B 1 94  ? 22.830  -19.460 24.379  1.00 47.51 ? 130 PHE B CD1   1 
ATOM   3295 C  CD2   . PHE B 1 94  ? 22.028  -21.690 24.678  1.00 52.08 ? 130 PHE B CD2   1 
ATOM   3296 C  CE1   . PHE B 1 94  ? 22.137  -19.055 25.508  1.00 49.79 ? 130 PHE B CE1   1 
ATOM   3297 C  CE2   . PHE B 1 94  ? 21.334  -21.293 25.809  1.00 45.56 ? 130 PHE B CE2   1 
ATOM   3298 C  CZ    . PHE B 1 94  ? 21.389  -19.975 26.225  1.00 48.07 ? 130 PHE B CZ    1 
ATOM   3299 N  N     . GLU B 1 95  ? 24.447  -20.126 19.892  1.00 47.77 ? 131 GLU B N     1 
ATOM   3300 C  CA    . GLU B 1 95  ? 25.454  -20.239 18.854  1.00 48.40 ? 131 GLU B CA    1 
ATOM   3301 C  C     . GLU B 1 95  ? 26.835  -20.095 19.471  1.00 41.68 ? 131 GLU B C     1 
ATOM   3302 O  O     . GLU B 1 95  ? 27.081  -19.194 20.277  1.00 42.84 ? 131 GLU B O     1 
ATOM   3303 C  CB    . GLU B 1 95  ? 25.204  -19.215 17.738  1.00 50.63 ? 131 GLU B CB    1 
ATOM   3304 C  CG    . GLU B 1 95  ? 24.221  -19.729 16.675  1.00 55.84 ? 131 GLU B CG    1 
ATOM   3305 C  CD    . GLU B 1 95  ? 23.508  -18.619 15.917  1.00 63.21 ? 131 GLU B CD    1 
ATOM   3306 O  OE1   . GLU B 1 95  ? 22.863  -18.922 14.887  1.00 65.89 ? 131 GLU B OE1   1 
ATOM   3307 O  OE2   . GLU B 1 95  ? 23.578  -17.450 16.353  1.00 61.24 ? 131 GLU B OE2   1 
ATOM   3308 N  N     . GLY B 1 96  ? 27.730  -21.008 19.122  1.00 37.95 ? 132 GLY B N     1 
ATOM   3309 C  CA    . GLY B 1 96  ? 29.083  -20.931 19.625  1.00 32.34 ? 132 GLY B CA    1 
ATOM   3310 C  C     . GLY B 1 96  ? 29.876  -22.180 19.346  1.00 33.45 ? 132 GLY B C     1 
ATOM   3311 O  O     . GLY B 1 96  ? 29.412  -23.081 18.645  1.00 40.21 ? 132 GLY B O     1 
ATOM   3312 N  N     . LYS B 1 97  ? 31.074  -22.244 19.916  1.00 32.68 ? 133 LYS B N     1 
ATOM   3313 C  CA    . LYS B 1 97  ? 31.999  -23.329 19.633  1.00 36.23 ? 133 LYS B CA    1 
ATOM   3314 C  C     . LYS B 1 97  ? 32.571  -23.909 20.918  1.00 41.94 ? 133 LYS B C     1 
ATOM   3315 O  O     . LYS B 1 97  ? 32.810  -23.179 21.886  1.00 40.54 ? 133 LYS B O     1 
ATOM   3316 C  CB    . LYS B 1 97  ? 33.136  -22.819 18.740  1.00 41.60 ? 133 LYS B CB    1 
ATOM   3317 C  CG    . LYS B 1 97  ? 32.715  -22.558 17.302  1.00 39.10 ? 133 LYS B CG    1 
ATOM   3318 C  CD    . LYS B 1 97  ? 32.481  -23.864 16.548  1.00 47.21 ? 133 LYS B CD    1 
ATOM   3319 C  CE    . LYS B 1 97  ? 31.147  -23.861 15.807  1.00 51.82 ? 133 LYS B CE    1 
ATOM   3320 N  NZ    . LYS B 1 97  ? 31.009  -25.088 14.967  1.00 53.91 ? 133 LYS B NZ    1 
ATOM   3321 N  N     . PHE B 1 98  ? 32.771  -25.222 20.935  1.00 40.26 ? 134 PHE B N     1 
ATOM   3322 C  CA    . PHE B 1 98  ? 33.458  -25.864 22.049  1.00 39.92 ? 134 PHE B CA    1 
ATOM   3323 C  C     . PHE B 1 98  ? 34.897  -26.126 21.637  1.00 47.52 ? 134 PHE B C     1 
ATOM   3324 O  O     . PHE B 1 98  ? 35.186  -27.071 20.896  1.00 49.35 ? 134 PHE B O     1 
ATOM   3325 C  CB    . PHE B 1 98  ? 32.765  -27.170 22.452  1.00 44.25 ? 134 PHE B CB    1 
ATOM   3326 C  CG    . PHE B 1 98  ? 33.371  -27.847 23.665  1.00 48.30 ? 134 PHE B CG    1 
ATOM   3327 C  CD1   . PHE B 1 98  ? 34.272  -27.182 24.490  1.00 44.42 ? 134 PHE B CD1   1 
ATOM   3328 C  CD2   . PHE B 1 98  ? 33.044  -29.164 23.968  1.00 50.36 ? 134 PHE B CD2   1 
ATOM   3329 C  CE1   . PHE B 1 98  ? 34.832  -27.816 25.597  1.00 50.16 ? 134 PHE B CE1   1 
ATOM   3330 C  CE2   . PHE B 1 98  ? 33.601  -29.805 25.073  1.00 45.80 ? 134 PHE B CE2   1 
ATOM   3331 C  CZ    . PHE B 1 98  ? 34.493  -29.133 25.887  1.00 46.92 ? 134 PHE B CZ    1 
ATOM   3332 N  N     . LEU B 1 99  ? 35.794  -25.278 22.124  1.00 45.77 ? 135 LEU B N     1 
ATOM   3333 C  CA    . LEU B 1 99  ? 37.220  -25.433 21.877  1.00 51.56 ? 135 LEU B CA    1 
ATOM   3334 C  C     . LEU B 1 99  ? 37.828  -26.261 23.001  1.00 54.21 ? 135 LEU B C     1 
ATOM   3335 O  O     . LEU B 1 99  ? 37.648  -25.935 24.173  1.00 57.57 ? 135 LEU B O     1 
ATOM   3336 C  CB    . LEU B 1 99  ? 37.911  -24.064 21.842  1.00 46.48 ? 135 LEU B CB    1 
ATOM   3337 C  CG    . LEU B 1 99  ? 37.652  -23.020 20.744  1.00 48.89 ? 135 LEU B CG    1 
ATOM   3338 C  CD1   . LEU B 1 99  ? 36.713  -23.501 19.646  1.00 49.68 ? 135 LEU B CD1   1 
ATOM   3339 C  CD2   . LEU B 1 99  ? 37.130  -21.736 21.349  1.00 48.63 ? 135 LEU B CD2   1 
ATOM   3340 N  N     . GLN B 1 100 ? 38.536  -27.334 22.655  1.00 63.62 ? 136 GLN B N     1 
ATOM   3341 C  CA    . GLN B 1 100 ? 39.288  -28.096 23.656  1.00 65.17 ? 136 GLN B CA    1 
ATOM   3342 C  C     . GLN B 1 100 ? 40.765  -28.228 23.314  1.00 68.08 ? 136 GLN B C     1 
ATOM   3343 O  O     . GLN B 1 100 ? 41.559  -28.660 24.148  1.00 74.99 ? 136 GLN B O     1 
ATOM   3344 C  CB    . GLN B 1 100 ? 38.674  -29.476 23.922  1.00 66.89 ? 136 GLN B CB    1 
ATOM   3345 C  CG    . GLN B 1 100 ? 38.027  -30.165 22.726  1.00 66.40 ? 136 GLN B CG    1 
ATOM   3346 C  CD    . GLN B 1 100 ? 37.121  -31.303 23.163  1.00 64.97 ? 136 GLN B CD    1 
ATOM   3347 O  OE1   . GLN B 1 100 ? 37.241  -31.811 24.279  1.00 64.74 ? 136 GLN B OE1   1 
ATOM   3348 N  NE2   . GLN B 1 100 ? 36.196  -31.694 22.295  1.00 67.69 ? 136 GLN B NE2   1 
ATOM   3349 N  N     . ILE B 1 104 ? 43.136  -26.732 27.432  1.00 68.42 ? 140 ILE B N     1 
ATOM   3350 C  CA    . ILE B 1 104 ? 42.275  -26.100 28.424  1.00 69.58 ? 140 ILE B CA    1 
ATOM   3351 C  C     . ILE B 1 104 ? 40.931  -25.722 27.795  1.00 66.78 ? 140 ILE B C     1 
ATOM   3352 O  O     . ILE B 1 104 ? 40.803  -24.646 27.204  1.00 68.29 ? 140 ILE B O     1 
ATOM   3353 C  CB    . ILE B 1 104 ? 42.931  -24.832 29.015  1.00 70.20 ? 140 ILE B CB    1 
ATOM   3354 C  CG1   . ILE B 1 104 ? 44.444  -24.839 28.771  1.00 72.75 ? 140 ILE B CG1   1 
ATOM   3355 C  CG2   . ILE B 1 104 ? 42.612  -24.710 30.499  1.00 66.47 ? 140 ILE B CG2   1 
ATOM   3356 C  CD1   . ILE B 1 104 ? 45.118  -23.486 29.008  1.00 67.80 ? 140 ILE B CD1   1 
ATOM   3357 N  N     . PRO B 1 105 ? 39.922  -26.601 27.938  1.00 64.18 ? 141 PRO B N     1 
ATOM   3358 C  CA    . PRO B 1 105 ? 38.625  -26.462 27.256  1.00 58.78 ? 141 PRO B CA    1 
ATOM   3359 C  C     . PRO B 1 105 ? 37.876  -25.171 27.596  1.00 54.91 ? 141 PRO B C     1 
ATOM   3360 O  O     . PRO B 1 105 ? 37.938  -24.697 28.732  1.00 53.92 ? 141 PRO B O     1 
ATOM   3361 C  CB    . PRO B 1 105 ? 37.837  -27.681 27.748  1.00 56.68 ? 141 PRO B CB    1 
ATOM   3362 C  CG    . PRO B 1 105 ? 38.476  -28.060 29.043  1.00 58.04 ? 141 PRO B CG    1 
ATOM   3363 C  CD    . PRO B 1 105 ? 39.937  -27.743 28.870  1.00 63.73 ? 141 PRO B CD    1 
ATOM   3364 N  N     . ILE B 1 106 ? 37.175  -24.623 26.604  1.00 49.05 ? 142 ILE B N     1 
ATOM   3365 C  CA    . ILE B 1 106 ? 36.432  -23.369 26.742  1.00 43.20 ? 142 ILE B CA    1 
ATOM   3366 C  C     . ILE B 1 106 ? 35.221  -23.393 25.813  1.00 38.11 ? 142 ILE B C     1 
ATOM   3367 O  O     . ILE B 1 106 ? 35.337  -23.786 24.652  1.00 39.44 ? 142 ILE B O     1 
ATOM   3368 C  CB    . ILE B 1 106 ? 37.309  -22.161 26.345  1.00 42.51 ? 142 ILE B CB    1 
ATOM   3369 C  CG1   . ILE B 1 106 ? 38.363  -21.865 27.419  1.00 53.45 ? 142 ILE B CG1   1 
ATOM   3370 C  CG2   . ILE B 1 106 ? 36.452  -20.931 26.079  1.00 43.08 ? 142 ILE B CG2   1 
ATOM   3371 C  CD1   . ILE B 1 106 ? 39.740  -21.498 26.856  1.00 54.83 ? 142 ILE B CD1   1 
ATOM   3372 N  N     . ILE B 1 107 ? 34.058  -22.985 26.313  1.00 31.64 ? 143 ILE B N     1 
ATOM   3373 C  CA    . ILE B 1 107 ? 32.913  -22.779 25.438  1.00 32.68 ? 143 ILE B CA    1 
ATOM   3374 C  C     . ILE B 1 107 ? 32.791  -21.293 25.130  1.00 35.72 ? 143 ILE B C     1 
ATOM   3375 O  O     . ILE B 1 107 ? 32.673  -20.483 26.046  1.00 34.27 ? 143 ILE B O     1 
ATOM   3376 C  CB    . ILE B 1 107 ? 31.606  -23.269 26.072  1.00 28.70 ? 143 ILE B CB    1 
ATOM   3377 C  CG1   . ILE B 1 107 ? 31.677  -24.779 26.319  1.00 31.68 ? 143 ILE B CG1   1 
ATOM   3378 C  CG2   . ILE B 1 107 ? 30.432  -22.921 25.168  1.00 29.35 ? 143 ILE B CG2   1 
ATOM   3379 C  CD1   . ILE B 1 107 ? 30.537  -25.337 27.194  1.00 34.46 ? 143 ILE B CD1   1 
ATOM   3380 N  N     . LYS B 1 108 ? 32.835  -20.926 23.852  1.00 35.89 ? 144 LYS B N     1 
ATOM   3381 C  CA    . LYS B 1 108 ? 32.609  -19.531 23.472  1.00 36.99 ? 144 LYS B CA    1 
ATOM   3382 C  C     . LYS B 1 108 ? 31.238  -19.393 22.848  1.00 35.63 ? 144 LYS B C     1 
ATOM   3383 O  O     . LYS B 1 108 ? 30.982  -19.967 21.792  1.00 32.87 ? 144 LYS B O     1 
ATOM   3384 C  CB    . LYS B 1 108 ? 33.650  -19.032 22.470  1.00 36.99 ? 144 LYS B CB    1 
ATOM   3385 C  CG    . LYS B 1 108 ? 35.014  -18.724 23.051  1.00 46.12 ? 144 LYS B CG    1 
ATOM   3386 C  CD    . LYS B 1 108 ? 35.828  -17.875 22.071  1.00 53.46 ? 144 LYS B CD    1 
ATOM   3387 C  CE    . LYS B 1 108 ? 37.306  -18.286 22.021  1.00 62.04 ? 144 LYS B CE    1 
ATOM   3388 N  NZ    . LYS B 1 108 ? 38.031  -17.706 20.832  1.00 51.38 ? 144 LYS B NZ    1 
ATOM   3389 N  N     . LEU B 1 109 ? 30.367  -18.623 23.492  1.00 31.04 ? 145 LEU B N     1 
ATOM   3390 C  CA    . LEU B 1 109 ? 29.042  -18.339 22.952  1.00 34.21 ? 145 LEU B CA    1 
ATOM   3391 C  C     . LEU B 1 109 ? 29.070  -16.931 22.387  1.00 36.56 ? 145 LEU B C     1 
ATOM   3392 O  O     . LEU B 1 109 ? 29.704  -16.046 22.962  1.00 39.70 ? 145 LEU B O     1 
ATOM   3393 C  CB    . LEU B 1 109 ? 27.970  -18.461 24.038  1.00 35.47 ? 145 LEU B CB    1 
ATOM   3394 C  CG    . LEU B 1 109 ? 27.862  -19.804 24.771  1.00 39.40 ? 145 LEU B CG    1 
ATOM   3395 C  CD1   . LEU B 1 109 ? 26.812  -19.766 25.884  1.00 39.55 ? 145 LEU B CD1   1 
ATOM   3396 C  CD2   . LEU B 1 109 ? 27.553  -20.937 23.806  1.00 34.35 ? 145 LEU B CD2   1 
ATOM   3397 N  N     . THR B 1 110 ? 28.399  -16.721 21.258  1.00 38.61 ? 146 THR B N     1 
ATOM   3398 C  CA    . THR B 1 110 ? 28.492  -15.445 20.546  1.00 40.80 ? 146 THR B CA    1 
ATOM   3399 C  C     . THR B 1 110 ? 27.136  -14.811 20.269  1.00 49.87 ? 146 THR B C     1 
ATOM   3400 O  O     . THR B 1 110 ? 27.069  -13.664 19.813  1.00 49.43 ? 146 THR B O     1 
ATOM   3401 C  CB    . THR B 1 110 ? 29.237  -15.594 19.207  1.00 48.60 ? 146 THR B CB    1 
ATOM   3402 O  OG1   . THR B 1 110 ? 28.600  -16.613 18.428  1.00 45.86 ? 146 THR B OG1   1 
ATOM   3403 C  CG2   . THR B 1 110 ? 30.697  -15.980 19.435  1.00 42.82 ? 146 THR B CG2   1 
ATOM   3404 N  N     . SER B 1 111 ? 26.067  -15.561 20.538  1.00 52.91 ? 147 SER B N     1 
ATOM   3405 C  CA    . SER B 1 111 ? 24.699  -15.062 20.379  1.00 55.49 ? 147 SER B CA    1 
ATOM   3406 C  C     . SER B 1 111 ? 23.675  -16.030 20.976  1.00 53.06 ? 147 SER B C     1 
ATOM   3407 O  O     . SER B 1 111 ? 23.989  -17.188 21.274  1.00 57.54 ? 147 SER B O     1 
ATOM   3408 C  CB    . SER B 1 111 ? 24.372  -14.808 18.900  1.00 57.92 ? 147 SER B CB    1 
ATOM   3409 O  OG    . SER B 1 111 ? 23.894  -15.985 18.268  1.00 55.86 ? 147 SER B OG    1 
ATOM   3410 N  N     . PHE B 1 121 ? 26.267  -10.226 22.806  1.00 61.78 ? 157 PHE B N     1 
ATOM   3411 C  CA    . PHE B 1 121 ? 26.509  -11.364 23.685  1.00 57.06 ? 157 PHE B CA    1 
ATOM   3412 C  C     . PHE B 1 121 ? 27.781  -12.120 23.305  1.00 56.94 ? 157 PHE B C     1 
ATOM   3413 O  O     . PHE B 1 121 ? 27.807  -12.876 22.337  1.00 55.12 ? 157 PHE B O     1 
ATOM   3414 C  CB    . PHE B 1 121 ? 25.310  -12.318 23.673  1.00 57.22 ? 157 PHE B CB    1 
ATOM   3415 C  CG    . PHE B 1 121 ? 25.344  -13.356 24.766  1.00 57.60 ? 157 PHE B CG    1 
ATOM   3416 C  CD1   . PHE B 1 121 ? 25.388  -12.975 26.101  1.00 60.29 ? 157 PHE B CD1   1 
ATOM   3417 C  CD2   . PHE B 1 121 ? 25.308  -14.712 24.458  1.00 57.50 ? 157 PHE B CD2   1 
ATOM   3418 C  CE1   . PHE B 1 121 ? 25.412  -13.930 27.113  1.00 59.12 ? 157 PHE B CE1   1 
ATOM   3419 C  CE2   . PHE B 1 121 ? 25.328  -15.676 25.466  1.00 54.31 ? 157 PHE B CE2   1 
ATOM   3420 C  CZ    . PHE B 1 121 ? 25.380  -15.282 26.794  1.00 50.50 ? 157 PHE B CZ    1 
ATOM   3421 N  N     . GLN B 1 122 ? 28.843  -11.896 24.066  1.00 55.52 ? 158 GLN B N     1 
ATOM   3422 C  CA    . GLN B 1 122 ? 30.033  -12.723 23.955  1.00 47.24 ? 158 GLN B CA    1 
ATOM   3423 C  C     . GLN B 1 122 ? 30.362  -13.288 25.328  1.00 47.25 ? 158 GLN B C     1 
ATOM   3424 O  O     . GLN B 1 122 ? 30.731  -12.559 26.259  1.00 43.62 ? 158 GLN B O     1 
ATOM   3425 C  CB    . GLN B 1 122 ? 31.215  -11.933 23.392  1.00 55.92 ? 158 GLN B CB    1 
ATOM   3426 C  CG    . GLN B 1 122 ? 31.147  -11.711 21.885  1.00 57.73 ? 158 GLN B CG    1 
ATOM   3427 C  CD    . GLN B 1 122 ? 32.522  -11.622 21.242  1.00 62.48 ? 158 GLN B CD    1 
ATOM   3428 O  OE1   . GLN B 1 122 ? 32.702  -11.987 20.077  1.00 66.01 ? 158 GLN B OE1   1 
ATOM   3429 N  NE2   . GLN B 1 122 ? 33.501  -11.135 22.000  1.00 58.30 ? 158 GLN B NE2   1 
ATOM   3430 N  N     . CYS B 1 123 ? 30.223  -14.596 25.453  1.00 42.61 ? 159 CYS B N     1 
ATOM   3431 C  CA    . CYS B 1 123 ? 30.390  -15.232 26.740  1.00 35.35 ? 159 CYS B CA    1 
ATOM   3432 C  C     . CYS B 1 123 ? 31.406  -16.355 26.623  1.00 37.52 ? 159 CYS B C     1 
ATOM   3433 O  O     . CYS B 1 123 ? 31.292  -17.217 25.748  1.00 33.38 ? 159 CYS B O     1 
ATOM   3434 C  CB    . CYS B 1 123 ? 29.036  -15.760 27.198  1.00 41.55 ? 159 CYS B CB    1 
ATOM   3435 S  SG    . CYS B 1 123 ? 29.094  -16.796 28.627  1.00 52.44 ? 159 CYS B SG    1 
ATOM   3436 N  N     . ALA B 1 124 ? 32.418  -16.333 27.484  1.00 32.44 ? 160 ALA B N     1 
ATOM   3437 C  CA    . ALA B 1 124 ? 33.369  -17.442 27.548  1.00 30.45 ? 160 ALA B CA    1 
ATOM   3438 C  C     . ALA B 1 124 ? 33.115  -18.251 28.826  1.00 30.05 ? 160 ALA B C     1 
ATOM   3439 O  O     . ALA B 1 124 ? 33.030  -17.696 29.927  1.00 30.83 ? 160 ALA B O     1 
ATOM   3440 C  CB    . ALA B 1 124 ? 34.805  -16.938 27.492  1.00 28.34 ? 160 ALA B CB    1 
ATOM   3441 N  N     . ILE B 1 125 ? 32.974  -19.561 28.679  1.00 26.49 ? 161 ILE B N     1 
ATOM   3442 C  CA    . ILE B 1 125 ? 32.770  -20.412 29.838  1.00 25.87 ? 161 ILE B CA    1 
ATOM   3443 C  C     . ILE B 1 125 ? 33.952  -21.358 29.974  1.00 26.78 ? 161 ILE B C     1 
ATOM   3444 O  O     . ILE B 1 125 ? 34.162  -22.208 29.111  1.00 29.21 ? 161 ILE B O     1 
ATOM   3445 C  CB    . ILE B 1 125 ? 31.490  -21.250 29.694  1.00 27.90 ? 161 ILE B CB    1 
ATOM   3446 C  CG1   . ILE B 1 125 ? 30.289  -20.353 29.373  1.00 30.11 ? 161 ILE B CG1   1 
ATOM   3447 C  CG2   . ILE B 1 125 ? 31.243  -22.066 30.958  1.00 31.08 ? 161 ILE B CG2   1 
ATOM   3448 C  CD1   . ILE B 1 125 ? 29.002  -21.133 29.119  1.00 35.21 ? 161 ILE B CD1   1 
ATOM   3449 N  N     . GLY B 1 126 ? 34.709  -21.219 31.057  1.00 28.87 ? 162 GLY B N     1 
ATOM   3450 C  CA    . GLY B 1 126 ? 35.805  -22.130 31.343  1.00 31.45 ? 162 GLY B CA    1 
ATOM   3451 C  C     . GLY B 1 126 ? 35.424  -23.168 32.380  1.00 33.57 ? 162 GLY B C     1 
ATOM   3452 O  O     . GLY B 1 126 ? 34.291  -23.199 32.876  1.00 32.19 ? 162 GLY B O     1 
ATOM   3453 N  N     . PHE B 1 127 ? 36.377  -24.019 32.729  1.00 34.07 ? 163 PHE B N     1 
ATOM   3454 C  CA    . PHE B 1 127 ? 36.088  -25.126 33.624  1.00 35.41 ? 163 PHE B CA    1 
ATOM   3455 C  C     . PHE B 1 127 ? 37.096  -25.171 34.766  1.00 35.82 ? 163 PHE B C     1 
ATOM   3456 O  O     . PHE B 1 127 ? 38.298  -25.304 34.534  1.00 39.54 ? 163 PHE B O     1 
ATOM   3457 C  CB    . PHE B 1 127 ? 36.027  -26.435 32.822  1.00 32.42 ? 163 PHE B CB    1 
ATOM   3458 C  CG    . PHE B 1 127 ? 34.877  -26.476 31.849  1.00 31.91 ? 163 PHE B CG    1 
ATOM   3459 C  CD1   . PHE B 1 127 ? 33.659  -27.037 32.220  1.00 35.81 ? 163 PHE B CD1   1 
ATOM   3460 C  CD2   . PHE B 1 127 ? 34.995  -25.911 30.589  1.00 36.28 ? 163 PHE B CD2   1 
ATOM   3461 C  CE1   . PHE B 1 127 ? 32.585  -27.051 31.342  1.00 34.51 ? 163 PHE B CE1   1 
ATOM   3462 C  CE2   . PHE B 1 127 ? 33.926  -25.913 29.702  1.00 36.57 ? 163 PHE B CE2   1 
ATOM   3463 C  CZ    . PHE B 1 127 ? 32.719  -26.486 30.082  1.00 35.92 ? 163 PHE B CZ    1 
ATOM   3464 N  N     . ASN B 1 128 ? 36.593  -25.006 35.991  1.00 36.50 ? 164 ASN B N     1 
ATOM   3465 C  CA    . ASN B 1 128 ? 37.420  -25.028 37.200  1.00 36.08 ? 164 ASN B CA    1 
ATOM   3466 C  C     . ASN B 1 128 ? 38.567  -23.994 37.229  1.00 35.83 ? 164 ASN B C     1 
ATOM   3467 O  O     . ASN B 1 128 ? 39.698  -24.321 37.574  1.00 41.03 ? 164 ASN B O     1 
ATOM   3468 C  CB    . ASN B 1 128 ? 37.959  -26.444 37.446  1.00 43.39 ? 164 ASN B CB    1 
ATOM   3469 C  CG    . ASN B 1 128 ? 36.863  -27.428 37.826  1.00 44.56 ? 164 ASN B CG    1 
ATOM   3470 O  OD1   . ASN B 1 128 ? 35.911  -27.078 38.530  1.00 42.50 ? 164 ASN B OD1   1 
ATOM   3471 N  ND2   . ASN B 1 128 ? 36.992  -28.665 37.358  1.00 45.22 ? 164 ASN B ND2   1 
ATOM   3472 N  N     . ASN B 1 129 ? 38.262  -22.750 36.877  1.00 37.84 ? 165 ASN B N     1 
ATOM   3473 C  CA    . ASN B 1 129 ? 39.254  -21.670 36.909  1.00 39.00 ? 165 ASN B CA    1 
ATOM   3474 C  C     . ASN B 1 129 ? 39.170  -20.934 38.237  1.00 35.98 ? 165 ASN B C     1 
ATOM   3475 O  O     . ASN B 1 129 ? 38.772  -19.763 38.288  1.00 31.96 ? 165 ASN B O     1 
ATOM   3476 C  CB    . ASN B 1 129 ? 38.991  -20.693 35.761  1.00 37.33 ? 165 ASN B CB    1 
ATOM   3477 C  CG    . ASN B 1 129 ? 40.144  -19.729 35.521  1.00 41.88 ? 165 ASN B CG    1 
ATOM   3478 O  OD1   . ASN B 1 129 ? 40.974  -19.479 36.403  1.00 39.44 ? 165 ASN B OD1   1 
ATOM   3479 N  ND2   . ASN B 1 129 ? 40.187  -19.167 34.319  1.00 44.94 ? 165 ASN B ND2   1 
ATOM   3480 N  N     . ARG B 1 130 ? 39.539  -21.612 39.318  1.00 31.88 ? 166 ARG B N     1 
ATOM   3481 C  CA    . ARG B 1 130 ? 39.337  -21.049 40.645  1.00 29.70 ? 166 ARG B CA    1 
ATOM   3482 C  C     . ARG B 1 130 ? 40.179  -19.801 40.915  1.00 28.76 ? 166 ARG B C     1 
ATOM   3483 O  O     . ARG B 1 130 ? 39.699  -18.884 41.568  1.00 30.34 ? 166 ARG B O     1 
ATOM   3484 C  CB    . ARG B 1 130 ? 39.528  -22.110 41.729  1.00 32.03 ? 166 ARG B CB    1 
ATOM   3485 C  CG    . ARG B 1 130 ? 38.464  -23.206 41.673  1.00 35.98 ? 166 ARG B CG    1 
ATOM   3486 C  CD    . ARG B 1 130 ? 38.698  -24.320 42.679  1.00 47.01 ? 166 ARG B CD    1 
ATOM   3487 N  NE    . ARG B 1 130 ? 37.519  -25.182 42.792  1.00 50.51 ? 166 ARG B NE    1 
ATOM   3488 C  CZ    . ARG B 1 130 ? 37.250  -26.195 41.974  1.00 50.27 ? 166 ARG B CZ    1 
ATOM   3489 N  NH1   . ARG B 1 130 ? 38.079  -26.481 40.980  1.00 48.75 ? 166 ARG B NH1   1 
ATOM   3490 N  NH2   . ARG B 1 130 ? 36.154  -26.924 42.151  1.00 52.44 ? 166 ARG B NH2   1 
ATOM   3491 N  N     . LEU B 1 131 ? 41.406  -19.751 40.396  1.00 31.77 ? 167 LEU B N     1 
ATOM   3492 C  CA    . LEU B 1 131 ? 42.256  -18.562 40.584  1.00 31.59 ? 167 LEU B CA    1 
ATOM   3493 C  C     . LEU B 1 131 ? 41.593  -17.285 40.096  1.00 29.37 ? 167 LEU B C     1 
ATOM   3494 O  O     . LEU B 1 131 ? 41.637  -16.253 40.774  1.00 28.89 ? 167 LEU B O     1 
ATOM   3495 C  CB    . LEU B 1 131 ? 43.601  -18.708 39.865  1.00 38.42 ? 167 LEU B CB    1 
ATOM   3496 C  CG    . LEU B 1 131 ? 44.737  -19.432 40.576  1.00 39.25 ? 167 LEU B CG    1 
ATOM   3497 C  CD1   . LEU B 1 131 ? 44.973  -18.899 41.983  1.00 35.27 ? 167 LEU B CD1   1 
ATOM   3498 C  CD2   . LEU B 1 131 ? 44.440  -20.889 40.630  1.00 42.38 ? 167 LEU B CD2   1 
ATOM   3499 N  N     . ALA B 1 132 ? 40.987  -17.348 38.911  1.00 29.85 ? 168 ALA B N     1 
ATOM   3500 C  CA    . ALA B 1 132 ? 40.351  -16.170 38.325  1.00 34.07 ? 168 ALA B CA    1 
ATOM   3501 C  C     . ALA B 1 132 ? 39.173  -15.717 39.175  1.00 27.83 ? 168 ALA B C     1 
ATOM   3502 O  O     . ALA B 1 132 ? 38.891  -14.518 39.286  1.00 28.97 ? 168 ALA B O     1 
ATOM   3503 C  CB    . ALA B 1 132 ? 39.912  -16.441 36.887  1.00 31.62 ? 168 ALA B CB    1 
ATOM   3504 N  N     . ILE B 1 133 ? 38.469  -16.683 39.757  1.00 24.96 ? 169 ILE B N     1 
ATOM   3505 C  CA    . ILE B 1 133 ? 37.382  -16.367 40.657  1.00 27.91 ? 169 ILE B CA    1 
ATOM   3506 C  C     . ILE B 1 133 ? 37.935  -15.632 41.875  1.00 26.80 ? 169 ILE B C     1 
ATOM   3507 O  O     . ILE B 1 133 ? 37.332  -14.688 42.373  1.00 24.44 ? 169 ILE B O     1 
ATOM   3508 C  CB    . ILE B 1 133 ? 36.628  -17.645 41.086  1.00 28.29 ? 169 ILE B CB    1 
ATOM   3509 C  CG1   . ILE B 1 133 ? 35.931  -18.269 39.870  1.00 28.08 ? 169 ILE B CG1   1 
ATOM   3510 C  CG2   . ILE B 1 133 ? 35.636  -17.337 42.199  1.00 30.57 ? 169 ILE B CG2   1 
ATOM   3511 C  CD1   . ILE B 1 133 ? 35.473  -19.709 40.082  1.00 30.96 ? 169 ILE B CD1   1 
ATOM   3512 N  N     . HIS B 1 134 ? 39.085  -16.065 42.367  1.00 22.73 ? 170 HIS B N     1 
ATOM   3513 C  CA    . HIS B 1 134 ? 39.662  -15.394 43.528  1.00 25.53 ? 170 HIS B CA    1 
ATOM   3514 C  C     . HIS B 1 134 ? 40.274  -14.012 43.204  1.00 24.71 ? 170 HIS B C     1 
ATOM   3515 O  O     . HIS B 1 134 ? 40.173  -13.092 44.029  1.00 25.23 ? 170 HIS B O     1 
ATOM   3516 C  CB    . HIS B 1 134 ? 40.643  -16.319 44.259  1.00 28.09 ? 170 HIS B CB    1 
ATOM   3517 C  CG    . HIS B 1 134 ? 39.958  -17.370 45.073  1.00 27.04 ? 170 HIS B CG    1 
ATOM   3518 N  ND1   . HIS B 1 134 ? 39.702  -18.637 44.593  1.00 32.63 ? 170 HIS B ND1   1 
ATOM   3519 C  CD2   . HIS B 1 134 ? 39.428  -17.322 46.317  1.00 25.72 ? 170 HIS B CD2   1 
ATOM   3520 C  CE1   . HIS B 1 134 ? 39.067  -19.333 45.520  1.00 26.11 ? 170 HIS B CE1   1 
ATOM   3521 N  NE2   . HIS B 1 134 ? 38.892  -18.561 46.576  1.00 30.58 ? 170 HIS B NE2   1 
ATOM   3522 N  N     . ASN B 1 135 ? 40.890  -13.871 42.023  1.00 25.41 ? 171 ASN B N     1 
ATOM   3523 C  CA    . ASN B 1 135 ? 41.352  -12.561 41.532  1.00 27.56 ? 171 ASN B CA    1 
ATOM   3524 C  C     . ASN B 1 135 ? 40.183  -11.588 41.535  1.00 27.77 ? 171 ASN B C     1 
ATOM   3525 O  O     . ASN B 1 135 ? 40.305  -10.443 41.948  1.00 22.30 ? 171 ASN B O     1 
ATOM   3526 C  CB    . ASN B 1 135 ? 41.886  -12.654 40.083  1.00 31.10 ? 171 ASN B CB    1 
ATOM   3527 C  CG    . ASN B 1 135 ? 43.214  -13.384 39.976  1.00 37.22 ? 171 ASN B CG    1 
ATOM   3528 O  OD1   . ASN B 1 135 ? 43.930  -13.535 40.965  1.00 41.06 ? 171 ASN B OD1   1 
ATOM   3529 N  ND2   . ASN B 1 135 ? 43.559  -13.826 38.760  1.00 32.85 ? 171 ASN B ND2   1 
ATOM   3530 N  N     . THR B 1 136 ? 39.039  -12.065 41.064  1.00 25.71 ? 172 THR B N     1 
ATOM   3531 C  CA    . THR B 1 136 ? 37.831  -11.248 40.984  1.00 23.26 ? 172 THR B CA    1 
ATOM   3532 C  C     . THR B 1 136 ? 37.261  -10.894 42.353  1.00 26.92 ? 172 THR B C     1 
ATOM   3533 O  O     . THR B 1 136 ? 36.732  -9.795  42.548  1.00 25.40 ? 172 THR B O     1 
ATOM   3534 C  CB    . THR B 1 136 ? 36.754  -11.957 40.122  1.00 25.74 ? 172 THR B CB    1 
ATOM   3535 O  OG1   . THR B 1 136 ? 37.232  -12.048 38.774  1.00 27.64 ? 172 THR B OG1   1 
ATOM   3536 C  CG2   . THR B 1 136 ? 35.424  -11.188 40.142  1.00 25.60 ? 172 THR B CG2   1 
ATOM   3537 N  N     . LEU B 1 137 ? 37.358  -11.823 43.300  1.00 23.99 ? 173 LEU B N     1 
ATOM   3538 C  CA    . LEU B 1 137 ? 36.937  -11.549 44.670  1.00 24.47 ? 173 LEU B CA    1 
ATOM   3539 C  C     . LEU B 1 137 ? 37.765  -10.410 45.234  1.00 23.97 ? 173 LEU B C     1 
ATOM   3540 O  O     . LEU B 1 137 ? 37.263  -9.558  45.956  1.00 23.09 ? 173 LEU B O     1 
ATOM   3541 C  CB    . LEU B 1 137 ? 37.131  -12.789 45.542  1.00 27.02 ? 173 LEU B CB    1 
ATOM   3542 C  CG    . LEU B 1 137 ? 36.161  -13.939 45.292  1.00 31.97 ? 173 LEU B CG    1 
ATOM   3543 C  CD1   . LEU B 1 137 ? 36.407  -15.077 46.296  1.00 36.32 ? 173 LEU B CD1   1 
ATOM   3544 C  CD2   . LEU B 1 137 ? 34.740  -13.417 45.391  1.00 32.36 ? 173 LEU B CD2   1 
ATOM   3545 N  N     . LEU B 1 138 ? 39.051  -10.407 44.909  1.00 22.77 ? 174 LEU B N     1 
ATOM   3546 C  CA    . LEU B 1 138 ? 39.930  -9.363  45.413  1.00 22.77 ? 174 LEU B CA    1 
ATOM   3547 C  C     . LEU B 1 138 ? 39.527  -8.017  44.819  1.00 22.83 ? 174 LEU B C     1 
ATOM   3548 O  O     . LEU B 1 138 ? 39.313  -7.048  45.549  1.00 19.30 ? 174 LEU B O     1 
ATOM   3549 C  CB    . LEU B 1 138 ? 41.387  -9.686  45.094  1.00 20.75 ? 174 LEU B CB    1 
ATOM   3550 C  CG    . LEU B 1 138 ? 42.414  -8.653  45.568  1.00 23.04 ? 174 LEU B CG    1 
ATOM   3551 C  CD1   . LEU B 1 138 ? 42.427  -8.551  47.095  1.00 23.20 ? 174 LEU B CD1   1 
ATOM   3552 C  CD2   . LEU B 1 138 ? 43.793  -9.012  45.050  1.00 24.48 ? 174 LEU B CD2   1 
ATOM   3553 N  N     . LEU B 1 139 ? 39.396  -7.967  43.499  1.00 20.14 ? 175 LEU B N     1 
ATOM   3554 C  CA    . LEU B 1 139 ? 38.969  -6.735  42.826  1.00 18.44 ? 175 LEU B CA    1 
ATOM   3555 C  C     . LEU B 1 139 ? 37.596  -6.307  43.299  1.00 24.75 ? 175 LEU B C     1 
ATOM   3556 O  O     . LEU B 1 139 ? 37.345  -5.115  43.456  1.00 21.60 ? 175 LEU B O     1 
ATOM   3557 C  CB    . LEU B 1 139 ? 38.978  -6.925  41.296  1.00 21.92 ? 175 LEU B CB    1 
ATOM   3558 C  CG    . LEU B 1 139 ? 40.266  -6.673  40.515  1.00 28.25 ? 175 LEU B CG    1 
ATOM   3559 C  CD1   . LEU B 1 139 ? 41.499  -7.156  41.217  1.00 31.48 ? 175 LEU B CD1   1 
ATOM   3560 C  CD2   . LEU B 1 139 ? 40.179  -7.318  39.137  1.00 30.03 ? 175 LEU B CD2   1 
ATOM   3561 N  N     . SER B 1 140 ? 36.707  -7.266  43.560  1.00 20.94 ? 176 SER B N     1 
ATOM   3562 C  CA    . SER B 1 140 ? 35.375  -6.907  44.046  1.00 21.17 ? 176 SER B CA    1 
ATOM   3563 C  C     . SER B 1 140 ? 35.423  -6.236  45.410  1.00 23.24 ? 176 SER B C     1 
ATOM   3564 O  O     . SER B 1 140 ? 34.678  -5.288  45.667  1.00 22.63 ? 176 SER B O     1 
ATOM   3565 C  CB    . SER B 1 140 ? 34.461  -8.138  44.110  1.00 26.75 ? 176 SER B CB    1 
ATOM   3566 O  OG    . SER B 1 140 ? 34.167  -8.604  42.812  1.00 32.73 ? 176 SER B OG    1 
ATOM   3567 N  N     . SER B 1 141 ? 36.285  -6.730  46.291  1.00 19.88 ? 177 SER B N     1 
ATOM   3568 C  CA    . SER B 1 141 ? 36.412  -6.126  47.615  1.00 22.34 ? 177 SER B CA    1 
ATOM   3569 C  C     . SER B 1 141 ? 36.896  -4.686  47.571  1.00 22.77 ? 177 SER B C     1 
ATOM   3570 O  O     . SER B 1 141 ? 36.412  -3.841  48.332  1.00 22.53 ? 177 SER B O     1 
ATOM   3571 C  CB    . SER B 1 141 ? 37.337  -6.949  48.504  1.00 23.29 ? 177 SER B CB    1 
ATOM   3572 O  OG    . SER B 1 141 ? 36.726  -8.181  48.822  1.00 30.39 ? 177 SER B OG    1 
ATOM   3573 N  N     . TYR B 1 142 ? 37.864  -4.412  46.700  1.00 21.76 ? 178 TYR B N     1 
ATOM   3574 C  CA    . TYR B 1 142 ? 38.381  -3.064  46.557  1.00 19.98 ? 178 TYR B CA    1 
ATOM   3575 C  C     . TYR B 1 142 ? 37.310  -2.128  46.022  1.00 22.41 ? 178 TYR B C     1 
ATOM   3576 O  O     . TYR B 1 142 ? 37.185  -0.999  46.496  1.00 22.59 ? 178 TYR B O     1 
ATOM   3577 C  CB    . TYR B 1 142 ? 39.659  -3.049  45.699  1.00 18.61 ? 178 TYR B CB    1 
ATOM   3578 C  CG    . TYR B 1 142 ? 40.902  -3.373  46.499  1.00 19.09 ? 178 TYR B CG    1 
ATOM   3579 C  CD1   . TYR B 1 142 ? 41.297  -2.553  47.543  1.00 23.35 ? 178 TYR B CD1   1 
ATOM   3580 C  CD2   . TYR B 1 142 ? 41.683  -4.491  46.207  1.00 22.25 ? 178 TYR B CD2   1 
ATOM   3581 C  CE1   . TYR B 1 142 ? 42.428  -2.833  48.282  1.00 22.62 ? 178 TYR B CE1   1 
ATOM   3582 C  CE2   . TYR B 1 142 ? 42.824  -4.780  46.943  1.00 25.70 ? 178 TYR B CE2   1 
ATOM   3583 C  CZ    . TYR B 1 142 ? 43.181  -3.937  47.986  1.00 24.71 ? 178 TYR B CZ    1 
ATOM   3584 O  OH    . TYR B 1 142 ? 44.312  -4.182  48.731  1.00 25.71 ? 178 TYR B OH    1 
ATOM   3585 N  N     . THR B 1 143 ? 36.483  -2.587  45.087  1.00 22.58 ? 179 THR B N     1 
ATOM   3586 C  CA    A THR B 1 143 ? 35.438  -1.702  44.561  0.58 23.51 ? 179 THR B CA    1 
ATOM   3587 C  CA    B THR B 1 143 ? 35.436  -1.716  44.547  0.42 23.56 ? 179 THR B CA    1 
ATOM   3588 C  C     . THR B 1 143 ? 34.416  -1.353  45.636  1.00 26.86 ? 179 THR B C     1 
ATOM   3589 O  O     . THR B 1 143 ? 33.827  -0.272  45.615  1.00 24.72 ? 179 THR B O     1 
ATOM   3590 C  CB    A THR B 1 143 ? 34.712  -2.294  43.345  0.58 23.85 ? 179 THR B CB    1 
ATOM   3591 C  CB    B THR B 1 143 ? 34.750  -2.329  43.285  0.42 23.90 ? 179 THR B CB    1 
ATOM   3592 O  OG1   A THR B 1 143 ? 33.873  -3.375  43.770  0.58 30.48 ? 179 THR B OG1   1 
ATOM   3593 O  OG1   B THR B 1 143 ? 34.249  -1.289  42.443  0.42 23.56 ? 179 THR B OG1   1 
ATOM   3594 C  CG2   A THR B 1 143 ? 35.712  -2.801  42.336  0.58 21.78 ? 179 THR B CG2   1 
ATOM   3595 C  CG2   B THR B 1 143 ? 33.606  -3.245  43.659  0.42 29.70 ? 179 THR B CG2   1 
ATOM   3596 N  N     . LYS B 1 144 ? 34.221  -2.253  46.601  1.00 24.91 ? 180 LYS B N     1 
ATOM   3597 C  CA    . LYS B 1 144 ? 33.294  -1.982  47.705  1.00 25.56 ? 180 LYS B CA    1 
ATOM   3598 C  C     . LYS B 1 144 ? 33.898  -1.071  48.762  1.00 26.62 ? 180 LYS B C     1 
ATOM   3599 O  O     . LYS B 1 144 ? 33.174  -0.399  49.488  1.00 27.13 ? 180 LYS B O     1 
ATOM   3600 C  CB    . LYS B 1 144 ? 32.838  -3.288  48.377  1.00 26.23 ? 180 LYS B CB    1 
ATOM   3601 C  CG    . LYS B 1 144 ? 32.109  -4.253  47.456  1.00 30.17 ? 180 LYS B CG    1 
ATOM   3602 C  CD    . LYS B 1 144 ? 31.571  -5.446  48.247  1.00 38.50 ? 180 LYS B CD    1 
ATOM   3603 C  CE    . LYS B 1 144 ? 30.881  -6.458  47.342  1.00 43.93 ? 180 LYS B CE    1 
ATOM   3604 N  NZ    . LYS B 1 144 ? 30.072  -7.446  48.128  1.00 57.77 ? 180 LYS B NZ    1 
ATOM   3605 N  N     . LEU B 1 145 ? 35.222  -1.066  48.862  1.00 25.12 ? 181 LEU B N     1 
ATOM   3606 C  CA    . LEU B 1 145 ? 35.935  -0.240  49.848  1.00 26.29 ? 181 LEU B CA    1 
ATOM   3607 C  C     . LEU B 1 145 ? 35.916  1.251   49.519  1.00 31.51 ? 181 LEU B C     1 
ATOM   3608 O  O     . LEU B 1 145 ? 35.826  2.084   50.423  1.00 31.73 ? 181 LEU B O     1 
ATOM   3609 C  CB    . LEU B 1 145 ? 37.390  -0.702  50.010  1.00 26.25 ? 181 LEU B CB    1 
ATOM   3610 C  CG    . LEU B 1 145 ? 37.705  -1.752  51.072  1.00 33.49 ? 181 LEU B CG    1 
ATOM   3611 C  CD1   . LEU B 1 145 ? 39.207  -2.037  51.133  1.00 27.08 ? 181 LEU B CD1   1 
ATOM   3612 C  CD2   . LEU B 1 145 ? 37.178  -1.297  52.433  1.00 36.53 ? 181 LEU B CD2   1 
ATOM   3613 N  N     . ASP B 1 146 ? 36.004  1.602   48.236  1.00 26.44 ? 182 ASP B N     1 
ATOM   3614 C  CA    . ASP B 1 146 ? 36.013  3.020   47.865  1.00 27.58 ? 182 ASP B CA    1 
ATOM   3615 C  C     . ASP B 1 146 ? 35.312  3.282   46.528  1.00 26.32 ? 182 ASP B C     1 
ATOM   3616 O  O     . ASP B 1 146 ? 35.651  2.681   45.503  1.00 23.69 ? 182 ASP B O     1 
ATOM   3617 C  CB    . ASP B 1 146 ? 37.451  3.558   47.834  1.00 30.46 ? 182 ASP B CB    1 
ATOM   3618 C  CG    . ASP B 1 146 ? 37.520  5.087   47.970  1.00 36.17 ? 182 ASP B CG    1 
ATOM   3619 O  OD1   . ASP B 1 146 ? 37.054  5.800   47.044  1.00 32.79 ? 182 ASP B OD1   1 
ATOM   3620 O  OD2   . ASP B 1 146 ? 38.039  5.581   49.008  1.00 33.84 ? 182 ASP B OD2   1 
ATOM   3621 N  N     . ALA B 1 147 ? 34.353  4.200   46.534  1.00 23.99 ? 183 ALA B N     1 
ATOM   3622 C  CA    . ALA B 1 147 ? 33.524  4.452   45.354  1.00 23.69 ? 183 ALA B CA    1 
ATOM   3623 C  C     . ALA B 1 147 ? 34.261  5.155   44.224  1.00 23.67 ? 183 ALA B C     1 
ATOM   3624 O  O     . ALA B 1 147 ? 33.720  5.295   43.125  1.00 22.78 ? 183 ALA B O     1 
ATOM   3625 C  CB    . ALA B 1 147 ? 32.257  5.255   45.738  1.00 28.74 ? 183 ALA B CB    1 
ATOM   3626 N  N     . ARG B 1 148 ? 35.477  5.625   44.489  1.00 23.89 ? 184 ARG B N     1 
ATOM   3627 C  CA    . ARG B 1 148 ? 36.265  6.287   43.450  1.00 23.18 ? 184 ARG B CA    1 
ATOM   3628 C  C     . ARG B 1 148 ? 36.893  5.270   42.506  1.00 24.35 ? 184 ARG B C     1 
ATOM   3629 O  O     . ARG B 1 148 ? 37.242  5.600   41.371  1.00 20.72 ? 184 ARG B O     1 
ATOM   3630 C  CB    . ARG B 1 148 ? 37.348  7.161   44.088  1.00 21.99 ? 184 ARG B CB    1 
ATOM   3631 C  CG    . ARG B 1 148 ? 36.785  8.446   44.750  1.00 21.31 ? 184 ARG B CG    1 
ATOM   3632 C  CD    . ARG B 1 148 ? 37.848  9.164   45.572  1.00 26.02 ? 184 ARG B CD    1 
ATOM   3633 N  NE    . ARG B 1 148 ? 38.256  8.390   46.742  1.00 23.10 ? 184 ARG B NE    1 
ATOM   3634 C  CZ    . ARG B 1 148 ? 39.231  8.739   47.572  1.00 28.80 ? 184 ARG B CZ    1 
ATOM   3635 N  NH1   . ARG B 1 148 ? 39.912  9.859   47.364  1.00 27.63 ? 184 ARG B NH1   1 
ATOM   3636 N  NH2   . ARG B 1 148 ? 39.523  7.971   48.616  1.00 28.16 ? 184 ARG B NH2   1 
ATOM   3637 N  N     . LEU B 1 149 ? 37.027  4.029   42.964  1.00 17.12 ? 185 LEU B N     1 
ATOM   3638 C  CA    . LEU B 1 149 ? 37.752  3.015   42.176  1.00 20.36 ? 185 LEU B CA    1 
ATOM   3639 C  C     . LEU B 1 149 ? 37.056  2.662   40.872  1.00 19.96 ? 185 LEU B C     1 
ATOM   3640 O  O     . LEU B 1 149 ? 37.687  2.667   39.814  1.00 20.34 ? 185 LEU B O     1 
ATOM   3641 C  CB    . LEU B 1 149 ? 38.016  1.743   42.988  1.00 17.72 ? 185 LEU B CB    1 
ATOM   3642 C  CG    . LEU B 1 149 ? 38.730  0.637   42.205  1.00 20.13 ? 185 LEU B CG    1 
ATOM   3643 C  CD1   . LEU B 1 149 ? 40.121  1.108   41.829  1.00 16.73 ? 185 LEU B CD1   1 
ATOM   3644 C  CD2   . LEU B 1 149 ? 38.815  -0.647  43.002  1.00 22.70 ? 185 LEU B CD2   1 
ATOM   3645 N  N     . LYS B 1 150 ? 35.755  2.377   40.934  1.00 19.61 ? 186 LYS B N     1 
ATOM   3646 C  CA    . LYS B 1 150 ? 35.023  2.006   39.713  1.00 22.73 ? 186 LYS B CA    1 
ATOM   3647 C  C     . LYS B 1 150 ? 35.115  3.023   38.554  1.00 24.12 ? 186 LYS B C     1 
ATOM   3648 O  O     . LYS B 1 150 ? 35.470  2.635   37.442  1.00 20.33 ? 186 LYS B O     1 
ATOM   3649 C  CB    . LYS B 1 150 ? 33.562  1.643   40.006  1.00 25.08 ? 186 LYS B CB    1 
ATOM   3650 C  CG    . LYS B 1 150 ? 32.785  1.222   38.760  1.00 26.19 ? 186 LYS B CG    1 
ATOM   3651 C  CD    . LYS B 1 150 ? 31.286  1.141   39.034  1.00 34.89 ? 186 LYS B CD    1 
ATOM   3652 C  CE    . LYS B 1 150 ? 30.504  0.834   37.747  1.00 33.42 ? 186 LYS B CE    1 
ATOM   3653 N  NZ    . LYS B 1 150 ? 29.026  0.882   37.979  1.00 41.63 ? 186 LYS B NZ    1 
ATOM   3654 N  N     . PRO B 1 151 ? 34.796  4.316   38.799  1.00 20.96 ? 187 PRO B N     1 
ATOM   3655 C  CA    . PRO B 1 151 ? 34.980  5.233   37.661  1.00 21.84 ? 187 PRO B CA    1 
ATOM   3656 C  C     . PRO B 1 151 ? 36.436  5.351   37.213  1.00 20.62 ? 187 PRO B C     1 
ATOM   3657 O  O     . PRO B 1 151 ? 36.690  5.474   36.010  1.00 18.67 ? 187 PRO B O     1 
ATOM   3658 C  CB    . PRO B 1 151 ? 34.453  6.582   38.191  1.00 20.07 ? 187 PRO B CB    1 
ATOM   3659 C  CG    . PRO B 1 151 ? 34.506  6.470   39.691  1.00 23.14 ? 187 PRO B CG    1 
ATOM   3660 C  CD    . PRO B 1 151 ? 34.223  5.000   39.974  1.00 21.82 ? 187 PRO B CD    1 
ATOM   3661 N  N     . MET B 1 152 ? 37.385  5.302   38.143  1.00 19.22 ? 188 MET B N     1 
ATOM   3662 C  CA    . MET B 1 152 ? 38.784  5.433   37.770  1.00 22.50 ? 188 MET B CA    1 
ATOM   3663 C  C     . MET B 1 152 ? 39.174  4.283   36.865  1.00 22.99 ? 188 MET B C     1 
ATOM   3664 O  O     . MET B 1 152 ? 39.870  4.474   35.855  1.00 19.51 ? 188 MET B O     1 
ATOM   3665 C  CB    . MET B 1 152 ? 39.674  5.454   39.007  1.00 24.63 ? 188 MET B CB    1 
ATOM   3666 C  CG    . MET B 1 152 ? 41.120  5.708   38.676  1.00 27.55 ? 188 MET B CG    1 
ATOM   3667 S  SD    . MET B 1 152 ? 42.092  5.791   40.170  1.00 27.30 ? 188 MET B SD    1 
ATOM   3668 C  CE    . MET B 1 152 ? 43.683  6.305   39.511  1.00 25.52 ? 188 MET B CE    1 
ATOM   3669 N  N     . VAL B 1 153 ? 38.696  3.087   37.205  1.00 20.02 ? 189 VAL B N     1 
ATOM   3670 C  CA    . VAL B 1 153 ? 39.025  1.908   36.412  1.00 18.06 ? 189 VAL B CA    1 
ATOM   3671 C  C     . VAL B 1 153 ? 38.366  1.938   35.051  1.00 18.84 ? 189 VAL B C     1 
ATOM   3672 O  O     . VAL B 1 153 ? 39.019  1.653   34.050  1.00 18.86 ? 189 VAL B O     1 
ATOM   3673 C  CB    . VAL B 1 153 ? 38.675  0.591   37.148  1.00 16.97 ? 189 VAL B CB    1 
ATOM   3674 C  CG1   . VAL B 1 153 ? 38.652  -0.580  36.163  1.00 15.81 ? 189 VAL B CG1   1 
ATOM   3675 C  CG2   . VAL B 1 153 ? 39.688  0.354   38.254  1.00 20.62 ? 189 VAL B CG2   1 
ATOM   3676 N  N     . LEU B 1 154 ? 37.083  2.275   35.006  1.00 20.43 ? 190 LEU B N     1 
ATOM   3677 C  CA    . LEU B 1 154 ? 36.386  2.345   33.720  1.00 22.10 ? 190 LEU B CA    1 
ATOM   3678 C  C     . LEU B 1 154 ? 37.077  3.373   32.814  1.00 23.52 ? 190 LEU B C     1 
ATOM   3679 O  O     . LEU B 1 154 ? 37.315  3.109   31.633  1.00 21.28 ? 190 LEU B O     1 
ATOM   3680 C  CB    . LEU B 1 154 ? 34.903  2.708   33.893  1.00 21.28 ? 190 LEU B CB    1 
ATOM   3681 C  CG    . LEU B 1 154 ? 33.960  1.747   34.627  1.00 29.17 ? 190 LEU B CG    1 
ATOM   3682 C  CD1   . LEU B 1 154 ? 32.514  1.954   34.192  1.00 25.66 ? 190 LEU B CD1   1 
ATOM   3683 C  CD2   . LEU B 1 154 ? 34.368  0.325   34.375  1.00 25.51 ? 190 LEU B CD2   1 
ATOM   3684 N  N     . LEU B 1 155 ? 37.423  4.531   33.373  1.00 21.73 ? 191 LEU B N     1 
ATOM   3685 C  CA    . LEU B 1 155 ? 38.085  5.573   32.581  1.00 22.01 ? 191 LEU B CA    1 
ATOM   3686 C  C     . LEU B 1 155 ? 39.455  5.125   32.037  1.00 21.44 ? 191 LEU B C     1 
ATOM   3687 O  O     . LEU B 1 155 ? 39.778  5.395   30.873  1.00 22.70 ? 191 LEU B O     1 
ATOM   3688 C  CB    . LEU B 1 155 ? 38.193  6.873   33.382  1.00 21.95 ? 191 LEU B CB    1 
ATOM   3689 C  CG    . LEU B 1 155 ? 36.829  7.493   33.683  1.00 22.16 ? 191 LEU B CG    1 
ATOM   3690 C  CD1   . LEU B 1 155 ? 36.928  8.608   34.723  1.00 25.12 ? 191 LEU B CD1   1 
ATOM   3691 C  CD2   . LEU B 1 155 ? 36.166  8.009   32.412  1.00 22.91 ? 191 LEU B CD2   1 
ATOM   3692 N  N     . VAL B 1 156 ? 40.248  4.444   32.867  1.00 21.26 ? 192 VAL B N     1 
ATOM   3693 C  CA    . VAL B 1 156 ? 41.546  3.911   32.431  1.00 21.42 ? 192 VAL B CA    1 
ATOM   3694 C  C     . VAL B 1 156 ? 41.398  2.867   31.322  1.00 20.40 ? 192 VAL B C     1 
ATOM   3695 O  O     . VAL B 1 156 ? 42.154  2.884   30.331  1.00 19.00 ? 192 VAL B O     1 
ATOM   3696 C  CB    . VAL B 1 156 ? 42.387  3.363   33.614  1.00 15.62 ? 192 VAL B CB    1 
ATOM   3697 C  CG1   . VAL B 1 156 ? 43.618  2.633   33.100  1.00 17.16 ? 192 VAL B CG1   1 
ATOM   3698 C  CG2   . VAL B 1 156 ? 42.822  4.502   34.546  1.00 18.96 ? 192 VAL B CG2   1 
ATOM   3699 N  N     . LYS B 1 157 ? 40.422  1.971   31.478  1.00 19.76 ? 193 LYS B N     1 
ATOM   3700 C  CA    . LYS B 1 157 ? 40.139  0.961   30.456  1.00 18.76 ? 193 LYS B CA    1 
ATOM   3701 C  C     . LYS B 1 157 ? 39.740  1.597   29.122  1.00 25.36 ? 193 LYS B C     1 
ATOM   3702 O  O     . LYS B 1 157 ? 40.146  1.145   28.047  1.00 23.43 ? 193 LYS B O     1 
ATOM   3703 C  CB    . LYS B 1 157 ? 38.997  0.043   30.932  1.00 22.28 ? 193 LYS B CB    1 
ATOM   3704 C  CG    . LYS B 1 157 ? 39.402  -0.983  32.003  1.00 22.35 ? 193 LYS B CG    1 
ATOM   3705 C  CD    . LYS B 1 157 ? 38.197  -1.903  32.328  1.00 23.12 ? 193 LYS B CD    1 
ATOM   3706 C  CE    . LYS B 1 157 ? 38.595  -3.120  33.141  1.00 34.24 ? 193 LYS B CE    1 
ATOM   3707 N  NZ    . LYS B 1 157 ? 37.399  -3.968  33.506  1.00 29.22 ? 193 LYS B NZ    1 
ATOM   3708 N  N     . HIS B 1 158 ? 38.917  2.634   29.218  1.00 22.25 ? 194 HIS B N     1 
ATOM   3709 C  CA    . HIS B 1 158 ? 38.370  3.351   28.077  1.00 22.34 ? 194 HIS B CA    1 
ATOM   3710 C  C     . HIS B 1 158 ? 39.478  4.113   27.351  1.00 23.44 ? 194 HIS B C     1 
ATOM   3711 O  O     . HIS B 1 158 ? 39.542  4.126   26.124  1.00 25.05 ? 194 HIS B O     1 
ATOM   3712 C  CB    . HIS B 1 158 ? 37.305  4.322   28.595  1.00 23.48 ? 194 HIS B CB    1 
ATOM   3713 C  CG    . HIS B 1 158 ? 36.633  5.129   27.526  1.00 26.41 ? 194 HIS B CG    1 
ATOM   3714 N  ND1   . HIS B 1 158 ? 35.967  4.552   26.465  1.00 30.64 ? 194 HIS B ND1   1 
ATOM   3715 C  CD2   . HIS B 1 158 ? 36.503  6.468   27.370  1.00 28.90 ? 194 HIS B CD2   1 
ATOM   3716 C  CE1   . HIS B 1 158 ? 35.459  5.503   25.701  1.00 31.08 ? 194 HIS B CE1   1 
ATOM   3717 N  NE2   . HIS B 1 158 ? 35.771  6.674   26.225  1.00 30.16 ? 194 HIS B NE2   1 
ATOM   3718 N  N     . TRP B 1 159 ? 40.346  4.753   28.125  1.00 21.39 ? 195 TRP B N     1 
ATOM   3719 C  CA    . TRP B 1 159 ? 41.546  5.390   27.600  1.00 22.78 ? 195 TRP B CA    1 
ATOM   3720 C  C     . TRP B 1 159 ? 42.478  4.389   26.911  1.00 26.81 ? 195 TRP B C     1 
ATOM   3721 O  O     . TRP B 1 159 ? 42.989  4.651   25.815  1.00 27.62 ? 195 TRP B O     1 
ATOM   3722 C  CB    . TRP B 1 159 ? 42.268  6.082   28.750  1.00 23.02 ? 195 TRP B CB    1 
ATOM   3723 C  CG    . TRP B 1 159 ? 43.668  6.509   28.460  1.00 22.18 ? 195 TRP B CG    1 
ATOM   3724 C  CD1   . TRP B 1 159 ? 44.062  7.603   27.742  1.00 25.63 ? 195 TRP B CD1   1 
ATOM   3725 C  CD2   . TRP B 1 159 ? 44.865  5.890   28.935  1.00 22.39 ? 195 TRP B CD2   1 
ATOM   3726 N  NE1   . TRP B 1 159 ? 45.430  7.687   27.725  1.00 24.56 ? 195 TRP B NE1   1 
ATOM   3727 C  CE2   . TRP B 1 159 ? 45.948  6.648   28.449  1.00 24.08 ? 195 TRP B CE2   1 
ATOM   3728 C  CE3   . TRP B 1 159 ? 45.129  4.754   29.703  1.00 21.97 ? 195 TRP B CE3   1 
ATOM   3729 C  CZ2   . TRP B 1 159 ? 47.276  6.312   28.714  1.00 27.71 ? 195 TRP B CZ2   1 
ATOM   3730 C  CZ3   . TRP B 1 159 ? 46.449  4.427   29.978  1.00 22.28 ? 195 TRP B CZ3   1 
ATOM   3731 C  CH2   . TRP B 1 159 ? 47.505  5.200   29.480  1.00 22.87 ? 195 TRP B CH2   1 
ATOM   3732 N  N     . ALA B 1 160 ? 42.704  3.241   27.540  1.00 21.12 ? 196 ALA B N     1 
ATOM   3733 C  CA    . ALA B 1 160 ? 43.609  2.247   26.960  1.00 25.21 ? 196 ALA B CA    1 
ATOM   3734 C  C     . ALA B 1 160 ? 43.044  1.668   25.662  1.00 27.93 ? 196 ALA B C     1 
ATOM   3735 O  O     . ALA B 1 160 ? 43.785  1.404   24.710  1.00 27.10 ? 196 ALA B O     1 
ATOM   3736 C  CB    . ALA B 1 160 ? 43.907  1.143   27.958  1.00 23.95 ? 196 ALA B CB    1 
ATOM   3737 N  N     . LYS B 1 161 ? 41.727  1.470   25.629  1.00 24.36 ? 197 LYS B N     1 
ATOM   3738 C  CA    . LYS B 1 161 ? 41.065  0.973   24.431  1.00 27.10 ? 197 LYS B CA    1 
ATOM   3739 C  C     . LYS B 1 161 ? 41.198  2.006   23.307  1.00 32.74 ? 197 LYS B C     1 
ATOM   3740 O  O     . LYS B 1 161 ? 41.556  1.666   22.173  1.00 29.76 ? 197 LYS B O     1 
ATOM   3741 C  CB    . LYS B 1 161 ? 39.586  0.705   24.723  1.00 31.79 ? 197 LYS B CB    1 
ATOM   3742 C  CG    . LYS B 1 161 ? 38.814  0.095   23.567  1.00 41.72 ? 197 LYS B CG    1 
ATOM   3743 C  CD    . LYS B 1 161 ? 37.300  0.226   23.758  1.00 46.84 ? 197 LYS B CD    1 
ATOM   3744 C  CE    . LYS B 1 161 ? 36.717  -0.873  24.644  1.00 54.59 ? 197 LYS B CE    1 
ATOM   3745 N  NZ    . LYS B 1 161 ? 35.212  -0.797  24.734  1.00 52.34 ? 197 LYS B NZ    1 
ATOM   3746 N  N     . ARG B 1 162 ? 40.906  3.263   23.639  1.00 29.34 ? 198 ARG B N     1 
ATOM   3747 C  CA    . ARG B 1 162 ? 40.913  4.347   22.654  1.00 30.96 ? 198 ARG B CA    1 
ATOM   3748 C  C     . ARG B 1 162 ? 42.298  4.607   22.087  1.00 31.16 ? 198 ARG B C     1 
ATOM   3749 O  O     . ARG B 1 162 ? 42.441  4.951   20.913  1.00 36.81 ? 198 ARG B O     1 
ATOM   3750 C  CB    . ARG B 1 162 ? 40.364  5.632   23.270  1.00 31.78 ? 198 ARG B CB    1 
ATOM   3751 C  CG    . ARG B 1 162 ? 38.861  5.677   23.408  1.00 32.08 ? 198 ARG B CG    1 
ATOM   3752 C  CD    . ARG B 1 162 ? 38.181  5.876   22.069  1.00 40.89 ? 198 ARG B CD    1 
ATOM   3753 N  NE    . ARG B 1 162 ? 36.753  5.589   22.138  1.00 42.71 ? 198 ARG B NE    1 
ATOM   3754 C  CZ    . ARG B 1 162 ? 35.817  6.486   22.436  1.00 43.56 ? 198 ARG B CZ    1 
ATOM   3755 N  NH1   . ARG B 1 162 ? 36.150  7.743   22.691  1.00 38.99 ? 198 ARG B NH1   1 
ATOM   3756 N  NH2   . ARG B 1 162 ? 34.541  6.122   22.481  1.00 47.22 ? 198 ARG B NH2   1 
ATOM   3757 N  N     . LYS B 1 163 ? 43.316  4.452   22.926  1.00 26.63 ? 199 LYS B N     1 
ATOM   3758 C  CA    . LYS B 1 163 ? 44.691  4.687   22.513  1.00 29.28 ? 199 LYS B CA    1 
ATOM   3759 C  C     . LYS B 1 163 ? 45.334  3.428   21.950  1.00 31.18 ? 199 LYS B C     1 
ATOM   3760 O  O     . LYS B 1 163 ? 46.535  3.417   21.680  1.00 29.26 ? 199 LYS B O     1 
ATOM   3761 C  CB    . LYS B 1 163 ? 45.542  5.204   23.683  1.00 26.29 ? 199 LYS B CB    1 
ATOM   3762 C  CG    . LYS B 1 163 ? 45.064  6.505   24.327  1.00 29.70 ? 199 LYS B CG    1 
ATOM   3763 C  CD    . LYS B 1 163 ? 44.696  7.551   23.302  1.00 31.79 ? 199 LYS B CD    1 
ATOM   3764 C  CE    . LYS B 1 163 ? 44.550  8.924   23.966  1.00 36.63 ? 199 LYS B CE    1 
ATOM   3765 N  NZ    . LYS B 1 163 ? 43.963  9.941   23.043  1.00 37.50 ? 199 LYS B NZ    1 
ATOM   3766 N  N     . GLN B 1 164 ? 44.546  2.365   21.812  1.00 32.08 ? 200 GLN B N     1 
ATOM   3767 C  CA    . GLN B 1 164 ? 45.033  1.100   21.246  1.00 30.02 ? 200 GLN B CA    1 
ATOM   3768 C  C     . GLN B 1 164 ? 46.215  0.497   21.999  1.00 31.62 ? 200 GLN B C     1 
ATOM   3769 O  O     . GLN B 1 164 ? 47.166  0.006   21.375  1.00 28.40 ? 200 GLN B O     1 
ATOM   3770 C  CB    . GLN B 1 164 ? 45.417  1.283   19.770  1.00 39.97 ? 200 GLN B CB    1 
ATOM   3771 C  CG    . GLN B 1 164 ? 44.438  0.650   18.785  1.00 44.35 ? 200 GLN B CG    1 
ATOM   3772 C  CD    . GLN B 1 164 ? 43.577  1.673   18.079  1.00 54.84 ? 200 GLN B CD    1 
ATOM   3773 O  OE1   . GLN B 1 164 ? 42.681  2.271   18.683  1.00 55.36 ? 200 GLN B OE1   1 
ATOM   3774 N  NE2   . GLN B 1 164 ? 43.849  1.893   16.792  1.00 57.46 ? 200 GLN B NE2   1 
ATOM   3775 N  N     . ILE B 1 165 ? 46.167  0.527   23.334  1.00 24.06 ? 201 ILE B N     1 
ATOM   3776 C  CA    . ILE B 1 165 ? 47.225  -0.084  24.128  1.00 24.34 ? 201 ILE B CA    1 
ATOM   3777 C  C     . ILE B 1 165 ? 46.630  -1.175  25.034  1.00 22.07 ? 201 ILE B C     1 
ATOM   3778 O  O     . ILE B 1 165 ? 47.198  -1.531  26.064  1.00 22.01 ? 201 ILE B O     1 
ATOM   3779 C  CB    . ILE B 1 165 ? 48.019  0.957   24.932  1.00 29.49 ? 201 ILE B CB    1 
ATOM   3780 C  CG1   . ILE B 1 165 ? 47.072  1.863   25.723  1.00 24.14 ? 201 ILE B CG1   1 
ATOM   3781 C  CG2   . ILE B 1 165 ? 48.927  1.788   23.999  1.00 24.83 ? 201 ILE B CG2   1 
ATOM   3782 C  CD1   . ILE B 1 165 ? 47.791  2.909   26.592  1.00 22.51 ? 201 ILE B CD1   1 
ATOM   3783 N  N     . ASN B 1 166 ? 45.493  -1.709  24.600  1.00 24.00 ? 202 ASN B N     1 
ATOM   3784 C  CA    . ASN B 1 166 ? 44.755  -2.726  25.335  1.00 25.57 ? 202 ASN B CA    1 
ATOM   3785 C  C     . ASN B 1 166 ? 44.567  -3.979  24.467  1.00 29.98 ? 202 ASN B C     1 
ATOM   3786 O  O     . ASN B 1 166 ? 43.492  -4.568  24.437  1.00 28.95 ? 202 ASN B O     1 
ATOM   3787 C  CB    . ASN B 1 166 ? 43.400  -2.151  25.766  1.00 27.50 ? 202 ASN B CB    1 
ATOM   3788 C  CG    . ASN B 1 166 ? 42.593  -3.114  26.623  1.00 30.27 ? 202 ASN B CG    1 
ATOM   3789 O  OD1   . ASN B 1 166 ? 43.149  -3.895  27.405  1.00 32.61 ? 202 ASN B OD1   1 
ATOM   3790 N  ND2   . ASN B 1 166 ? 41.279  -3.082  26.461  1.00 27.87 ? 202 ASN B ND2   1 
ATOM   3791 N  N     . SER B 1 167 ? 45.626  -4.373  23.764  1.00 26.72 ? 203 SER B N     1 
ATOM   3792 C  CA    . SER B 1 167 ? 45.578  -5.527  22.859  1.00 30.67 ? 203 SER B CA    1 
ATOM   3793 C  C     . SER B 1 167 ? 46.705  -6.482  23.202  1.00 30.97 ? 203 SER B C     1 
ATOM   3794 O  O     . SER B 1 167 ? 47.816  -6.352  22.679  1.00 30.29 ? 203 SER B O     1 
ATOM   3795 C  CB    . SER B 1 167 ? 45.711  -5.070  21.401  1.00 32.10 ? 203 SER B CB    1 
ATOM   3796 O  OG    . SER B 1 167 ? 44.647  -4.212  21.028  1.00 35.19 ? 203 SER B OG    1 
ATOM   3797 N  N     . PRO B 1 168 ? 46.429  -7.445  24.092  1.00 29.67 ? 204 PRO B N     1 
ATOM   3798 C  CA    . PRO B 1 168 ? 47.472  -8.354  24.568  1.00 32.51 ? 204 PRO B CA    1 
ATOM   3799 C  C     . PRO B 1 168 ? 47.931  -9.280  23.449  1.00 42.01 ? 204 PRO B C     1 
ATOM   3800 O  O     . PRO B 1 168 ? 49.059  -9.780  23.476  1.00 40.76 ? 204 PRO B O     1 
ATOM   3801 C  CB    . PRO B 1 168 ? 46.769  -9.151  25.675  1.00 34.33 ? 204 PRO B CB    1 
ATOM   3802 C  CG    . PRO B 1 168 ? 45.548  -8.375  26.015  1.00 34.31 ? 204 PRO B CG    1 
ATOM   3803 C  CD    . PRO B 1 168 ? 45.143  -7.670  24.773  1.00 32.02 ? 204 PRO B CD    1 
ATOM   3804 N  N     . TYR B 1 169 ? 47.064  -9.484  22.463  1.00 38.91 ? 205 TYR B N     1 
ATOM   3805 C  CA    . TYR B 1 169 ? 47.405  -10.301 21.306  1.00 43.12 ? 205 TYR B CA    1 
ATOM   3806 C  C     . TYR B 1 169 ? 48.276  -9.552  20.300  1.00 43.21 ? 205 TYR B C     1 
ATOM   3807 O  O     . TYR B 1 169 ? 48.753  -10.133 19.323  1.00 49.52 ? 205 TYR B O     1 
ATOM   3808 C  CB    . TYR B 1 169 ? 46.129  -10.861 20.664  1.00 45.80 ? 205 TYR B CB    1 
ATOM   3809 C  CG    . TYR B 1 169 ? 45.493  -11.926 21.528  1.00 51.37 ? 205 TYR B CG    1 
ATOM   3810 C  CD1   . TYR B 1 169 ? 46.283  -12.720 22.353  1.00 53.88 ? 205 TYR B CD1   1 
ATOM   3811 C  CD2   . TYR B 1 169 ? 44.118  -12.130 21.538  1.00 52.66 ? 205 TYR B CD2   1 
ATOM   3812 C  CE1   . TYR B 1 169 ? 45.732  -13.692 23.155  1.00 58.22 ? 205 TYR B CE1   1 
ATOM   3813 C  CE2   . TYR B 1 169 ? 43.550  -13.108 22.343  1.00 57.52 ? 205 TYR B CE2   1 
ATOM   3814 C  CZ    . TYR B 1 169 ? 44.367  -13.886 23.149  1.00 62.80 ? 205 TYR B CZ    1 
ATOM   3815 O  OH    . TYR B 1 169 ? 43.831  -14.863 23.957  1.00 62.29 ? 205 TYR B OH    1 
ATOM   3816 N  N     . PHE B 1 170 ? 48.511  -8.268  20.560  1.00 42.78 ? 206 PHE B N     1 
ATOM   3817 C  CA    . PHE B 1 170 ? 49.363  -7.470  19.691  1.00 35.67 ? 206 PHE B CA    1 
ATOM   3818 C  C     . PHE B 1 170 ? 50.408  -6.637  20.440  1.00 36.75 ? 206 PHE B C     1 
ATOM   3819 O  O     . PHE B 1 170 ? 50.752  -5.532  20.025  1.00 37.41 ? 206 PHE B O     1 
ATOM   3820 C  CB    . PHE B 1 170 ? 48.513  -6.638  18.723  1.00 40.52 ? 206 PHE B CB    1 
ATOM   3821 C  CG    . PHE B 1 170 ? 47.621  -7.481  17.850  1.00 47.13 ? 206 PHE B CG    1 
ATOM   3822 C  CD1   . PHE B 1 170 ? 48.146  -8.157  16.753  1.00 47.48 ? 206 PHE B CD1   1 
ATOM   3823 C  CD2   . PHE B 1 170 ? 46.275  -7.639  18.149  1.00 47.70 ? 206 PHE B CD2   1 
ATOM   3824 C  CE1   . PHE B 1 170 ? 47.338  -8.959  15.952  1.00 53.62 ? 206 PHE B CE1   1 
ATOM   3825 C  CE2   . PHE B 1 170 ? 45.454  -8.441  17.353  1.00 51.65 ? 206 PHE B CE2   1 
ATOM   3826 C  CZ    . PHE B 1 170 ? 45.989  -9.100  16.253  1.00 56.60 ? 206 PHE B CZ    1 
ATOM   3827 N  N     . GLY B 1 171 ? 50.923  -7.191  21.535  1.00 30.79 ? 207 GLY B N     1 
ATOM   3828 C  CA    . GLY B 1 171 ? 52.092  -6.638  22.194  1.00 32.09 ? 207 GLY B CA    1 
ATOM   3829 C  C     . GLY B 1 171 ? 51.843  -5.581  23.266  1.00 28.50 ? 207 GLY B C     1 
ATOM   3830 O  O     . GLY B 1 171 ? 52.803  -5.047  23.828  1.00 25.97 ? 207 GLY B O     1 
ATOM   3831 N  N     . THR B 1 172 ? 50.577  -5.269  23.538  1.00 28.91 ? 208 THR B N     1 
ATOM   3832 C  CA    . THR B 1 172 ? 50.240  -4.403  24.671  1.00 28.98 ? 208 THR B CA    1 
ATOM   3833 C  C     . THR B 1 172 ? 49.586  -5.174  25.850  1.00 30.19 ? 208 THR B C     1 
ATOM   3834 O  O     . THR B 1 172 ? 49.845  -6.360  26.023  1.00 26.26 ? 208 THR B O     1 
ATOM   3835 C  CB    . THR B 1 172 ? 49.481  -3.125  24.241  1.00 26.21 ? 208 THR B CB    1 
ATOM   3836 O  OG1   . THR B 1 172 ? 48.307  -3.468  23.493  1.00 27.10 ? 208 THR B OG1   1 
ATOM   3837 C  CG2   . THR B 1 172 ? 50.397  -2.261  23.370  1.00 27.66 ? 208 THR B CG2   1 
ATOM   3838 N  N     . LEU B 1 173 ? 48.761  -4.509  26.658  1.00 25.54 ? 209 LEU B N     1 
ATOM   3839 C  CA    . LEU B 1 173 ? 48.409  -5.039  27.985  1.00 24.35 ? 209 LEU B CA    1 
ATOM   3840 C  C     . LEU B 1 173 ? 46.924  -5.382  28.151  1.00 26.03 ? 209 LEU B C     1 
ATOM   3841 O  O     . LEU B 1 173 ? 46.062  -4.710  27.593  1.00 25.16 ? 209 LEU B O     1 
ATOM   3842 C  CB    . LEU B 1 173 ? 48.857  -4.033  29.058  1.00 24.26 ? 209 LEU B CB    1 
ATOM   3843 C  CG    . LEU B 1 173 ? 48.753  -4.425  30.533  1.00 22.12 ? 209 LEU B CG    1 
ATOM   3844 C  CD1   . LEU B 1 173 ? 49.689  -5.581  30.865  1.00 18.25 ? 209 LEU B CD1   1 
ATOM   3845 C  CD2   . LEU B 1 173 ? 49.061  -3.201  31.415  1.00 22.51 ? 209 LEU B CD2   1 
ATOM   3846 N  N     . SER B 1 174 ? 46.613  -6.433  28.908  1.00 21.11 ? 210 SER B N     1 
ATOM   3847 C  CA    . SER B 1 174 ? 45.214  -6.794  29.141  1.00 25.71 ? 210 SER B CA    1 
ATOM   3848 C  C     . SER B 1 174 ? 44.532  -5.746  30.020  1.00 23.09 ? 210 SER B C     1 
ATOM   3849 O  O     . SER B 1 174 ? 45.200  -5.004  30.738  1.00 20.76 ? 210 SER B O     1 
ATOM   3850 C  CB    . SER B 1 174 ? 45.114  -8.155  29.821  1.00 26.60 ? 210 SER B CB    1 
ATOM   3851 O  OG    . SER B 1 174 ? 45.817  -8.139  31.056  1.00 24.45 ? 210 SER B OG    1 
ATOM   3852 N  N     . SER B 1 175 ? 43.207  -5.688  29.961  1.00 22.57 ? 211 SER B N     1 
ATOM   3853 C  CA    . SER B 1 175 ? 42.441  -4.831  30.868  1.00 24.59 ? 211 SER B CA    1 
ATOM   3854 C  C     . SER B 1 175 ? 42.748  -5.144  32.330  1.00 25.42 ? 211 SER B C     1 
ATOM   3855 O  O     . SER B 1 175 ? 42.813  -4.236  33.170  1.00 22.21 ? 211 SER B O     1 
ATOM   3856 C  CB    . SER B 1 175 ? 40.948  -4.981  30.603  1.00 27.90 ? 211 SER B CB    1 
ATOM   3857 O  OG    . SER B 1 175 ? 40.629  -4.484  29.318  1.00 34.35 ? 211 SER B OG    1 
ATOM   3858 N  N     . TYR B 1 176 ? 42.939  -6.426  32.627  1.00 25.21 ? 212 TYR B N     1 
ATOM   3859 C  CA    . TYR B 1 176 ? 43.276  -6.852  33.980  1.00 26.12 ? 212 TYR B CA    1 
ATOM   3860 C  C     . TYR B 1 176 ? 44.611  -6.244  34.398  1.00 22.97 ? 212 TYR B C     1 
ATOM   3861 O  O     . TYR B 1 176 ? 44.752  -5.795  35.531  1.00 20.72 ? 212 TYR B O     1 
ATOM   3862 C  CB    . TYR B 1 176 ? 43.311  -8.388  34.070  1.00 28.18 ? 212 TYR B CB    1 
ATOM   3863 C  CG    . TYR B 1 176 ? 43.679  -8.939  35.433  1.00 25.35 ? 212 TYR B CG    1 
ATOM   3864 C  CD1   . TYR B 1 176 ? 42.943  -8.603  36.561  1.00 26.57 ? 212 TYR B CD1   1 
ATOM   3865 C  CD2   . TYR B 1 176 ? 44.743  -9.824  35.579  1.00 26.75 ? 212 TYR B CD2   1 
ATOM   3866 C  CE1   . TYR B 1 176 ? 43.266  -9.119  37.801  1.00 27.92 ? 212 TYR B CE1   1 
ATOM   3867 C  CE2   . TYR B 1 176 ? 45.076  -10.341 36.809  1.00 26.16 ? 212 TYR B CE2   1 
ATOM   3868 C  CZ    . TYR B 1 176 ? 44.327  -9.986  37.916  1.00 27.01 ? 212 TYR B CZ    1 
ATOM   3869 O  OH    . TYR B 1 176 ? 44.641  -10.488 39.152  1.00 27.62 ? 212 TYR B OH    1 
ATOM   3870 N  N     . GLY B 1 177 ? 45.574  -6.210  33.473  1.00 19.28 ? 213 GLY B N     1 
ATOM   3871 C  CA    . GLY B 1 177 ? 46.838  -5.526  33.703  1.00 19.61 ? 213 GLY B CA    1 
ATOM   3872 C  C     . GLY B 1 177 ? 46.663  -4.071  34.145  1.00 19.89 ? 213 GLY B C     1 
ATOM   3873 O  O     . GLY B 1 177 ? 47.293  -3.630  35.107  1.00 19.88 ? 213 GLY B O     1 
ATOM   3874 N  N     . TYR B 1 178 ? 45.816  -3.327  33.448  1.00 18.91 ? 214 TYR B N     1 
ATOM   3875 C  CA    . TYR B 1 178 ? 45.584  -1.921  33.801  1.00 21.00 ? 214 TYR B CA    1 
ATOM   3876 C  C     . TYR B 1 178 ? 44.921  -1.812  35.168  1.00 17.83 ? 214 TYR B C     1 
ATOM   3877 O  O     . TYR B 1 178 ? 45.243  -0.905  35.930  1.00 19.40 ? 214 TYR B O     1 
ATOM   3878 C  CB    . TYR B 1 178 ? 44.755  -1.210  32.719  1.00 17.46 ? 214 TYR B CB    1 
ATOM   3879 C  CG    . TYR B 1 178 ? 45.594  -0.951  31.482  1.00 20.08 ? 214 TYR B CG    1 
ATOM   3880 C  CD1   . TYR B 1 178 ? 45.476  -1.739  30.344  1.00 21.14 ? 214 TYR B CD1   1 
ATOM   3881 C  CD2   . TYR B 1 178 ? 46.544  0.056   31.486  1.00 21.57 ? 214 TYR B CD2   1 
ATOM   3882 C  CE1   . TYR B 1 178 ? 46.290  -1.506  29.220  1.00 21.39 ? 214 TYR B CE1   1 
ATOM   3883 C  CE2   . TYR B 1 178 ? 47.336  0.302   30.398  1.00 23.77 ? 214 TYR B CE2   1 
ATOM   3884 C  CZ    . TYR B 1 178 ? 47.221  -0.487  29.270  1.00 24.24 ? 214 TYR B CZ    1 
ATOM   3885 O  OH    . TYR B 1 178 ? 48.052  -0.210  28.200  1.00 20.09 ? 214 TYR B OH    1 
ATOM   3886 N  N     . VAL B 1 179 ? 43.997  -2.720  35.489  1.00 17.42 ? 215 VAL B N     1 
ATOM   3887 C  CA    . VAL B 1 179 ? 43.348  -2.668  36.814  1.00 17.16 ? 215 VAL B CA    1 
ATOM   3888 C  C     . VAL B 1 179 ? 44.386  -2.849  37.905  1.00 17.34 ? 215 VAL B C     1 
ATOM   3889 O  O     . VAL B 1 179 ? 44.379  -2.137  38.906  1.00 18.73 ? 215 VAL B O     1 
ATOM   3890 C  CB    . VAL B 1 179 ? 42.234  -3.746  36.977  1.00 20.11 ? 215 VAL B CB    1 
ATOM   3891 C  CG1   . VAL B 1 179 ? 41.701  -3.748  38.400  1.00 19.21 ? 215 VAL B CG1   1 
ATOM   3892 C  CG2   . VAL B 1 179 ? 41.107  -3.465  36.012  1.00 23.84 ? 215 VAL B CG2   1 
ATOM   3893 N  N     . LEU B 1 180 ? 45.295  -3.792  37.706  1.00 16.14 ? 216 LEU B N     1 
ATOM   3894 C  CA    . LEU B 1 180 ? 46.366  -4.010  38.676  1.00 20.19 ? 216 LEU B CA    1 
ATOM   3895 C  C     . LEU B 1 180 ? 47.285  -2.782  38.785  1.00 19.05 ? 216 LEU B C     1 
ATOM   3896 O  O     . LEU B 1 180 ? 47.725  -2.416  39.886  1.00 18.35 ? 216 LEU B O     1 
ATOM   3897 C  CB    . LEU B 1 180 ? 47.180  -5.266  38.320  1.00 19.70 ? 216 LEU B CB    1 
ATOM   3898 C  CG    . LEU B 1 180 ? 46.463  -6.616  38.497  1.00 20.80 ? 216 LEU B CG    1 
ATOM   3899 C  CD1   . LEU B 1 180 ? 47.432  -7.776  38.331  1.00 24.40 ? 216 LEU B CD1   1 
ATOM   3900 C  CD2   . LEU B 1 180 ? 45.729  -6.698  39.834  1.00 23.65 ? 216 LEU B CD2   1 
ATOM   3901 N  N     . MET B 1 181 ? 47.587  -2.142  37.657  1.00 16.43 ? 217 MET B N     1 
ATOM   3902 C  CA    . MET B 1 181 ? 48.375  -0.909  37.708  1.00 19.33 ? 217 MET B CA    1 
ATOM   3903 C  C     . MET B 1 181 ? 47.643  0.164   38.494  1.00 18.37 ? 217 MET B C     1 
ATOM   3904 O  O     . MET B 1 181 ? 48.271  0.922   39.247  1.00 18.90 ? 217 MET B O     1 
ATOM   3905 C  CB    . MET B 1 181 ? 48.704  -0.393  36.300  1.00 18.18 ? 217 MET B CB    1 
ATOM   3906 C  CG    . MET B 1 181 ? 49.723  -1.273  35.579  1.00 17.53 ? 217 MET B CG    1 
ATOM   3907 S  SD    . MET B 1 181 ? 49.930  -0.792  33.860  1.00 27.70 ? 217 MET B SD    1 
ATOM   3908 C  CE    . MET B 1 181 ? 50.769  0.765   34.096  1.00 24.92 ? 217 MET B CE    1 
ATOM   3909 N  N     . VAL B 1 182 ? 46.323  0.224   38.334  1.00 16.22 ? 218 VAL B N     1 
ATOM   3910 C  CA    . VAL B 1 182 ? 45.521  1.204   39.095  1.00 17.29 ? 218 VAL B CA    1 
ATOM   3911 C  C     . VAL B 1 182 ? 45.581  0.897   40.596  1.00 20.02 ? 218 VAL B C     1 
ATOM   3912 O  O     . VAL B 1 182 ? 45.851  1.785   41.421  1.00 18.03 ? 218 VAL B O     1 
ATOM   3913 C  CB    . VAL B 1 182 ? 44.038  1.286   38.587  1.00 17.84 ? 218 VAL B CB    1 
ATOM   3914 C  CG1   . VAL B 1 182 ? 43.153  2.058   39.577  1.00 17.98 ? 218 VAL B CG1   1 
ATOM   3915 C  CG2   . VAL B 1 182 ? 43.963  1.941   37.188  1.00 18.16 ? 218 VAL B CG2   1 
ATOM   3916 N  N     . LEU B 1 183 ? 45.328  -0.354  40.960  1.00 17.29 ? 219 LEU B N     1 
ATOM   3917 C  CA    . LEU B 1 183 ? 45.409  -0.751  42.370  1.00 17.73 ? 219 LEU B CA    1 
ATOM   3918 C  C     . LEU B 1 183 ? 46.781  -0.532  42.995  1.00 17.38 ? 219 LEU B C     1 
ATOM   3919 O  O     . LEU B 1 183 ? 46.877  -0.079  44.136  1.00 17.39 ? 219 LEU B O     1 
ATOM   3920 C  CB    . LEU B 1 183 ? 44.988  -2.215  42.559  1.00 20.39 ? 219 LEU B CB    1 
ATOM   3921 C  CG    . LEU B 1 183 ? 43.499  -2.519  42.363  1.00 21.46 ? 219 LEU B CG    1 
ATOM   3922 C  CD1   . LEU B 1 183 ? 43.259  -4.038  42.387  1.00 23.50 ? 219 LEU B CD1   1 
ATOM   3923 C  CD2   . LEU B 1 183 ? 42.681  -1.840  43.467  1.00 22.80 ? 219 LEU B CD2   1 
ATOM   3924 N  N     . TYR B 1 184 ? 47.844  -0.850  42.268  1.00 18.61 ? 220 TYR B N     1 
ATOM   3925 C  CA    . TYR B 1 184 ? 49.187  -0.696  42.819  1.00 17.85 ? 220 TYR B CA    1 
ATOM   3926 C  C     . TYR B 1 184 ? 49.425  0.777   43.129  1.00 20.97 ? 220 TYR B C     1 
ATOM   3927 O  O     . TYR B 1 184 ? 49.960  1.134   44.181  1.00 20.36 ? 220 TYR B O     1 
ATOM   3928 C  CB    . TYR B 1 184 ? 50.242  -1.197  41.836  1.00 21.15 ? 220 TYR B CB    1 
ATOM   3929 C  CG    . TYR B 1 184 ? 51.663  -0.971  42.322  1.00 20.57 ? 220 TYR B CG    1 
ATOM   3930 C  CD1   . TYR B 1 184 ? 52.237  -1.810  43.272  1.00 20.54 ? 220 TYR B CD1   1 
ATOM   3931 C  CD2   . TYR B 1 184 ? 52.422  0.082   41.832  1.00 23.63 ? 220 TYR B CD2   1 
ATOM   3932 C  CE1   . TYR B 1 184 ? 53.545  -1.612  43.715  1.00 22.13 ? 220 TYR B CE1   1 
ATOM   3933 C  CE2   . TYR B 1 184 ? 53.715  0.303   42.273  1.00 23.68 ? 220 TYR B CE2   1 
ATOM   3934 C  CZ    . TYR B 1 184 ? 54.273  -0.545  43.201  1.00 27.42 ? 220 TYR B CZ    1 
ATOM   3935 O  OH    . TYR B 1 184 ? 55.563  -0.300  43.613  1.00 27.12 ? 220 TYR B OH    1 
ATOM   3936 N  N     . TYR B 1 185 ? 49.002  1.637   42.220  1.00 17.58 ? 221 TYR B N     1 
ATOM   3937 C  CA    . TYR B 1 185 ? 49.123  3.070   42.470  1.00 22.65 ? 221 TYR B CA    1 
ATOM   3938 C  C     . TYR B 1 185 ? 48.325  3.520   43.706  1.00 22.46 ? 221 TYR B C     1 
ATOM   3939 O  O     . TYR B 1 185 ? 48.829  4.285   44.542  1.00 20.90 ? 221 TYR B O     1 
ATOM   3940 C  CB    . TYR B 1 185 ? 48.707  3.862   41.227  1.00 20.86 ? 221 TYR B CB    1 
ATOM   3941 C  CG    . TYR B 1 185 ? 48.647  5.333   41.481  1.00 18.27 ? 221 TYR B CG    1 
ATOM   3942 C  CD1   . TYR B 1 185 ? 49.816  6.099   41.499  1.00 22.45 ? 221 TYR B CD1   1 
ATOM   3943 C  CD2   . TYR B 1 185 ? 47.432  5.970   41.714  1.00 22.80 ? 221 TYR B CD2   1 
ATOM   3944 C  CE1   . TYR B 1 185 ? 49.775  7.445   41.747  1.00 22.46 ? 221 TYR B CE1   1 
ATOM   3945 C  CE2   . TYR B 1 185 ? 47.383  7.335   41.958  1.00 23.91 ? 221 TYR B CE2   1 
ATOM   3946 C  CZ    . TYR B 1 185 ? 48.563  8.056   41.974  1.00 25.72 ? 221 TYR B CZ    1 
ATOM   3947 O  OH    . TYR B 1 185 ? 48.538  9.411   42.224  1.00 29.55 ? 221 TYR B OH    1 
ATOM   3948 N  N     . LEU B 1 186 ? 47.084  3.048   43.820  1.00 18.06 ? 222 LEU B N     1 
ATOM   3949 C  CA    . LEU B 1 186 ? 46.195  3.483   44.898  1.00 21.37 ? 222 LEU B CA    1 
ATOM   3950 C  C     . LEU B 1 186 ? 46.591  2.915   46.257  1.00 22.25 ? 222 LEU B C     1 
ATOM   3951 O  O     . LEU B 1 186 ? 46.218  3.450   47.298  1.00 23.83 ? 222 LEU B O     1 
ATOM   3952 C  CB    . LEU B 1 186 ? 44.742  3.111   44.582  1.00 17.75 ? 222 LEU B CB    1 
ATOM   3953 C  CG    . LEU B 1 186 ? 44.092  3.764   43.357  1.00 22.53 ? 222 LEU B CG    1 
ATOM   3954 C  CD1   . LEU B 1 186 ? 42.669  3.233   43.195  1.00 20.99 ? 222 LEU B CD1   1 
ATOM   3955 C  CD2   . LEU B 1 186 ? 44.090  5.302   43.494  1.00 22.11 ? 222 LEU B CD2   1 
ATOM   3956 N  N     . ILE B 1 187 ? 47.333  1.817   46.251  1.00 21.90 ? 223 ILE B N     1 
ATOM   3957 C  CA    . ILE B 1 187 ? 47.708  1.168   47.502  1.00 23.31 ? 223 ILE B CA    1 
ATOM   3958 C  C     . ILE B 1 187 ? 49.105  1.599   47.931  1.00 24.53 ? 223 ILE B C     1 
ATOM   3959 O  O     . ILE B 1 187 ? 49.322  2.000   49.080  1.00 24.62 ? 223 ILE B O     1 
ATOM   3960 C  CB    . ILE B 1 187 ? 47.692  -0.354  47.362  1.00 19.18 ? 223 ILE B CB    1 
ATOM   3961 C  CG1   . ILE B 1 187 ? 46.258  -0.868  47.202  1.00 19.94 ? 223 ILE B CG1   1 
ATOM   3962 C  CG2   . ILE B 1 187 ? 48.378  -1.016  48.564  1.00 23.16 ? 223 ILE B CG2   1 
ATOM   3963 C  CD1   . ILE B 1 187 ? 46.193  -2.317  46.731  1.00 19.35 ? 223 ILE B CD1   1 
ATOM   3964 N  N     . HIS B 1 188 ? 50.053  1.529   47.004  1.00 20.85 ? 224 HIS B N     1 
ATOM   3965 C  CA    . HIS B 1 188 ? 51.467  1.671   47.364  1.00 23.68 ? 224 HIS B CA    1 
ATOM   3966 C  C     . HIS B 1 188 ? 52.182  2.938   46.909  1.00 26.29 ? 224 HIS B C     1 
ATOM   3967 O  O     . HIS B 1 188 ? 53.298  3.192   47.347  1.00 31.88 ? 224 HIS B O     1 
ATOM   3968 C  CB    . HIS B 1 188 ? 52.262  0.457   46.862  1.00 24.19 ? 224 HIS B CB    1 
ATOM   3969 C  CG    . HIS B 1 188 ? 51.918  -0.806  47.572  1.00 27.57 ? 224 HIS B CG    1 
ATOM   3970 N  ND1   . HIS B 1 188 ? 52.152  -0.981  48.919  1.00 25.80 ? 224 HIS B ND1   1 
ATOM   3971 C  CD2   . HIS B 1 188 ? 51.334  -1.946  47.137  1.00 23.82 ? 224 HIS B CD2   1 
ATOM   3972 C  CE1   . HIS B 1 188 ? 51.738  -2.181  49.279  1.00 30.27 ? 224 HIS B CE1   1 
ATOM   3973 N  NE2   . HIS B 1 188 ? 51.237  -2.788  48.216  1.00 27.39 ? 224 HIS B NE2   1 
ATOM   3974 N  N     . VAL B 1 189 ? 51.584  3.717   46.021  1.00 23.52 ? 225 VAL B N     1 
ATOM   3975 C  CA    . VAL B 1 189 ? 52.272  4.920   45.533  1.00 23.10 ? 225 VAL B CA    1 
ATOM   3976 C  C     . VAL B 1 189 ? 51.747  6.189   46.190  1.00 29.89 ? 225 VAL B C     1 
ATOM   3977 O  O     . VAL B 1 189 ? 52.503  6.961   46.795  1.00 31.51 ? 225 VAL B O     1 
ATOM   3978 C  CB    . VAL B 1 189 ? 52.154  5.096   44.012  1.00 22.04 ? 225 VAL B CB    1 
ATOM   3979 C  CG1   . VAL B 1 189 ? 52.982  6.327   43.554  1.00 22.79 ? 225 VAL B CG1   1 
ATOM   3980 C  CG2   . VAL B 1 189 ? 52.645  3.868   43.287  1.00 18.85 ? 225 VAL B CG2   1 
ATOM   3981 N  N     . ILE B 1 190 ? 50.444  6.404   46.073  1.00 24.15 ? 226 ILE B N     1 
ATOM   3982 C  CA    . ILE B 1 190 ? 49.856  7.659   46.496  1.00 26.35 ? 226 ILE B CA    1 
ATOM   3983 C  C     . ILE B 1 190 ? 49.886  7.779   48.020  1.00 28.93 ? 226 ILE B C     1 
ATOM   3984 O  O     . ILE B 1 190 ? 49.731  6.785   48.730  1.00 27.41 ? 226 ILE B O     1 
ATOM   3985 C  CB    . ILE B 1 190 ? 48.425  7.814   45.927  1.00 23.30 ? 226 ILE B CB    1 
ATOM   3986 C  CG1   . ILE B 1 190 ? 47.958  9.268   46.037  1.00 27.76 ? 226 ILE B CG1   1 
ATOM   3987 C  CG2   . ILE B 1 190 ? 47.444  6.810   46.574  1.00 24.64 ? 226 ILE B CG2   1 
ATOM   3988 C  CD1   . ILE B 1 190 ? 46.528  9.471   45.650  1.00 29.15 ? 226 ILE B CD1   1 
ATOM   3989 N  N     . LYS B 1 191 ? 50.133  8.995   48.509  1.00 33.13 ? 227 LYS B N     1 
ATOM   3990 C  CA    . LYS B 1 191 ? 50.209  9.271   49.947  1.00 33.61 ? 227 LYS B CA    1 
ATOM   3991 C  C     . LYS B 1 191 ? 49.207  10.364  50.295  1.00 32.55 ? 227 LYS B C     1 
ATOM   3992 O  O     . LYS B 1 191 ? 49.190  11.410  49.654  1.00 33.94 ? 227 LYS B O     1 
ATOM   3993 C  CB    . LYS B 1 191 ? 51.622  9.717   50.350  1.00 37.86 ? 227 LYS B CB    1 
ATOM   3994 C  CG    . LYS B 1 191 ? 52.730  8.731   49.990  1.00 36.85 ? 227 LYS B CG    1 
ATOM   3995 C  CD    . LYS B 1 191 ? 52.583  7.413   50.744  1.00 35.78 ? 227 LYS B CD    1 
ATOM   3996 C  CE    . LYS B 1 191 ? 53.310  6.277   50.022  1.00 37.47 ? 227 LYS B CE    1 
ATOM   3997 N  NZ    . LYS B 1 191 ? 53.299  5.011   50.802  1.00 45.29 ? 227 LYS B NZ    1 
ATOM   3998 N  N     . PRO B 1 192 ? 48.327  10.110  51.277  1.00 32.74 ? 228 PRO B N     1 
ATOM   3999 C  CA    . PRO B 1 192 ? 48.107  8.854   52.002  1.00 30.78 ? 228 PRO B CA    1 
ATOM   4000 C  C     . PRO B 1 192 ? 47.514  7.811   51.058  1.00 28.74 ? 228 PRO B C     1 
ATOM   4001 O  O     . PRO B 1 192 ? 46.988  8.188   50.001  1.00 29.78 ? 228 PRO B O     1 
ATOM   4002 C  CB    . PRO B 1 192 ? 47.051  9.239   53.051  1.00 29.94 ? 228 PRO B CB    1 
ATOM   4003 C  CG    . PRO B 1 192 ? 47.052  10.750  53.093  1.00 35.56 ? 228 PRO B CG    1 
ATOM   4004 C  CD    . PRO B 1 192 ? 47.378  11.155  51.694  1.00 34.39 ? 228 PRO B CD    1 
ATOM   4005 N  N     . PRO B 1 193 ? 47.615  6.525   51.416  1.00 29.82 ? 229 PRO B N     1 
ATOM   4006 C  CA    . PRO B 1 193 ? 47.039  5.494   50.546  1.00 30.35 ? 229 PRO B CA    1 
ATOM   4007 C  C     . PRO B 1 193 ? 45.530  5.679   50.393  1.00 30.88 ? 229 PRO B C     1 
ATOM   4008 O  O     . PRO B 1 193 ? 44.873  6.131   51.329  1.00 27.05 ? 229 PRO B O     1 
ATOM   4009 C  CB    . PRO B 1 193 ? 47.317  4.199   51.314  1.00 29.81 ? 229 PRO B CB    1 
ATOM   4010 C  CG    . PRO B 1 193 ? 48.516  4.513   52.181  1.00 36.22 ? 229 PRO B CG    1 
ATOM   4011 C  CD    . PRO B 1 193 ? 48.309  5.947   52.584  1.00 34.08 ? 229 PRO B CD    1 
ATOM   4012 N  N     . VAL B 1 194 ? 44.991  5.356   49.223  1.00 25.90 ? 230 VAL B N     1 
ATOM   4013 C  CA    . VAL B 1 194 ? 43.547  5.269   49.065  1.00 24.11 ? 230 VAL B CA    1 
ATOM   4014 C  C     . VAL B 1 194 ? 43.024  4.003   49.750  1.00 27.46 ? 230 VAL B C     1 
ATOM   4015 O  O     . VAL B 1 194 ? 41.967  4.033   50.374  1.00 24.83 ? 230 VAL B O     1 
ATOM   4016 C  CB    . VAL B 1 194 ? 43.127  5.312   47.576  1.00 25.09 ? 230 VAL B CB    1 
ATOM   4017 C  CG1   . VAL B 1 194 ? 41.703  4.826   47.401  1.00 29.24 ? 230 VAL B CG1   1 
ATOM   4018 C  CG2   . VAL B 1 194 ? 43.277  6.747   47.017  1.00 26.15 ? 230 VAL B CG2   1 
ATOM   4019 N  N     . PHE B 1 195 ? 43.794  2.916   49.638  1.00 26.98 ? 231 PHE B N     1 
ATOM   4020 C  CA    . PHE B 1 195 ? 43.436  1.568   50.104  1.00 27.03 ? 231 PHE B CA    1 
ATOM   4021 C  C     . PHE B 1 195 ? 44.560  0.983   50.919  1.00 22.52 ? 231 PHE B C     1 
ATOM   4022 O  O     . PHE B 1 195 ? 45.719  1.216   50.604  1.00 28.38 ? 231 PHE B O     1 
ATOM   4023 C  CB    . PHE B 1 195 ? 43.417  0.603   48.909  1.00 26.20 ? 231 PHE B CB    1 
ATOM   4024 C  CG    . PHE B 1 195 ? 42.277  0.776   47.999  1.00 26.33 ? 231 PHE B CG    1 
ATOM   4025 C  CD1   . PHE B 1 195 ? 41.004  0.979   48.495  1.00 24.47 ? 231 PHE B CD1   1 
ATOM   4026 C  CD2   . PHE B 1 195 ? 42.474  0.709   46.630  1.00 21.07 ? 231 PHE B CD2   1 
ATOM   4027 C  CE1   . PHE B 1 195 ? 39.939  1.123   47.640  1.00 27.62 ? 231 PHE B CE1   1 
ATOM   4028 C  CE2   . PHE B 1 195 ? 41.418  0.854   45.770  1.00 22.92 ? 231 PHE B CE2   1 
ATOM   4029 C  CZ    . PHE B 1 195 ? 40.145  1.063   46.274  1.00 25.74 ? 231 PHE B CZ    1 
ATOM   4030 N  N     . PRO B 1 196 ? 44.243  0.124   51.899  1.00 27.13 ? 232 PRO B N     1 
ATOM   4031 C  CA    . PRO B 1 196 ? 45.313  -0.707  52.457  1.00 24.13 ? 232 PRO B CA    1 
ATOM   4032 C  C     . PRO B 1 196 ? 45.548  -1.887  51.533  1.00 23.14 ? 232 PRO B C     1 
ATOM   4033 O  O     . PRO B 1 196 ? 44.713  -2.147  50.665  1.00 23.21 ? 232 PRO B O     1 
ATOM   4034 C  CB    . PRO B 1 196 ? 44.700  -1.211  53.765  1.00 28.43 ? 232 PRO B CB    1 
ATOM   4035 C  CG    . PRO B 1 196 ? 43.234  -1.276  53.469  1.00 28.45 ? 232 PRO B CG    1 
ATOM   4036 C  CD    . PRO B 1 196 ? 42.970  -0.064  52.612  1.00 25.76 ? 232 PRO B CD    1 
ATOM   4037 N  N     . ASN B 1 197 ? 46.657  -2.597  51.700  1.00 22.00 ? 233 ASN B N     1 
ATOM   4038 C  CA    . ASN B 1 197 ? 46.855  -3.842  50.975  1.00 23.03 ? 233 ASN B CA    1 
ATOM   4039 C  C     . ASN B 1 197 ? 46.170  -4.975  51.726  1.00 25.05 ? 233 ASN B C     1 
ATOM   4040 O  O     . ASN B 1 197 ? 46.610  -5.367  52.816  1.00 24.72 ? 233 ASN B O     1 
ATOM   4041 C  CB    . ASN B 1 197 ? 48.349  -4.141  50.832  1.00 23.73 ? 233 ASN B CB    1 
ATOM   4042 C  CG    . ASN B 1 197 ? 48.624  -5.350  49.963  1.00 26.37 ? 233 ASN B CG    1 
ATOM   4043 O  OD1   . ASN B 1 197 ? 47.933  -6.368  50.048  1.00 27.84 ? 233 ASN B OD1   1 
ATOM   4044 N  ND2   . ASN B 1 197 ? 49.650  -5.250  49.124  1.00 23.66 ? 233 ASN B ND2   1 
ATOM   4045 N  N     . LEU B 1 198 ? 45.112  -5.523  51.136  1.00 22.30 ? 234 LEU B N     1 
ATOM   4046 C  CA    . LEU B 1 198 ? 44.314  -6.554  51.806  1.00 23.33 ? 234 LEU B CA    1 
ATOM   4047 C  C     . LEU B 1 198 ? 45.043  -7.888  51.980  1.00 25.24 ? 234 LEU B C     1 
ATOM   4048 O  O     . LEU B 1 198 ? 44.656  -8.705  52.831  1.00 23.90 ? 234 LEU B O     1 
ATOM   4049 C  CB    . LEU B 1 198 ? 42.983  -6.776  51.069  1.00 21.27 ? 234 LEU B CB    1 
ATOM   4050 C  CG    . LEU B 1 198 ? 42.011  -5.602  51.093  1.00 27.39 ? 234 LEU B CG    1 
ATOM   4051 C  CD1   . LEU B 1 198 ? 40.675  -5.981  50.437  1.00 25.38 ? 234 LEU B CD1   1 
ATOM   4052 C  CD2   . LEU B 1 198 ? 41.787  -5.103  52.530  1.00 24.56 ? 234 LEU B CD2   1 
ATOM   4053 N  N     . LEU B 1 199 ? 46.076  -8.125  51.173  1.00 22.93 ? 235 LEU B N     1 
ATOM   4054 C  CA    . LEU B 1 199 ? 46.873  -9.344  51.310  1.00 26.27 ? 235 LEU B CA    1 
ATOM   4055 C  C     . LEU B 1 199 ? 47.786  -9.286  52.533  1.00 26.32 ? 235 LEU B C     1 
ATOM   4056 O  O     . LEU B 1 199 ? 48.165  -10.324 53.083  1.00 25.52 ? 235 LEU B O     1 
ATOM   4057 C  CB    . LEU B 1 199 ? 47.700  -9.623  50.054  1.00 23.85 ? 235 LEU B CB    1 
ATOM   4058 C  CG    . LEU B 1 199 ? 47.020  -10.246 48.833  1.00 29.07 ? 235 LEU B CG    1 
ATOM   4059 C  CD1   . LEU B 1 199 ? 46.004  -9.301  48.237  1.00 28.70 ? 235 LEU B CD1   1 
ATOM   4060 C  CD2   . LEU B 1 199 ? 48.065  -10.619 47.787  1.00 29.67 ? 235 LEU B CD2   1 
ATOM   4061 N  N     . LEU B 1 200 ? 48.104  -8.070  52.968  1.00 26.63 ? 236 LEU B N     1 
ATOM   4062 C  CA    . LEU B 1 200 ? 49.066  -7.844  54.047  1.00 29.31 ? 236 LEU B CA    1 
ATOM   4063 C  C     . LEU B 1 200 ? 48.389  -7.416  55.341  1.00 31.28 ? 236 LEU B C     1 
ATOM   4064 O  O     . LEU B 1 200 ? 49.034  -6.891  56.257  1.00 30.35 ? 236 LEU B O     1 
ATOM   4065 C  CB    . LEU B 1 200 ? 50.082  -6.780  53.626  1.00 30.63 ? 236 LEU B CB    1 
ATOM   4066 C  CG    . LEU B 1 200 ? 50.885  -7.076  52.358  1.00 33.61 ? 236 LEU B CG    1 
ATOM   4067 C  CD1   . LEU B 1 200 ? 51.919  -5.972  52.088  1.00 36.01 ? 236 LEU B CD1   1 
ATOM   4068 C  CD2   . LEU B 1 200 ? 51.555  -8.430  52.438  1.00 37.00 ? 236 LEU B CD2   1 
ATOM   4069 N  N     . SER B 1 201 ? 47.081  -7.628  55.417  1.00 28.97 ? 237 SER B N     1 
ATOM   4070 C  CA    . SER B 1 201 ? 46.349  -7.336  56.643  1.00 30.23 ? 237 SER B CA    1 
ATOM   4071 C  C     . SER B 1 201 ? 46.691  -8.377  57.698  1.00 29.47 ? 237 SER B C     1 
ATOM   4072 O  O     . SER B 1 201 ? 46.821  -9.561  57.390  1.00 30.49 ? 237 SER B O     1 
ATOM   4073 C  CB    . SER B 1 201 ? 44.844  -7.353  56.398  1.00 32.94 ? 237 SER B CB    1 
ATOM   4074 O  OG    . SER B 1 201 ? 44.134  -7.578  57.607  1.00 36.99 ? 237 SER B OG    1 
ATOM   4075 N  N     . PRO B 1 202 ? 46.836  -7.936  58.954  1.00 29.65 ? 238 PRO B N     1 
ATOM   4076 C  CA    . PRO B 1 202 ? 47.080  -8.885  60.046  1.00 28.62 ? 238 PRO B CA    1 
ATOM   4077 C  C     . PRO B 1 202 ? 45.976  -9.936  60.178  1.00 29.16 ? 238 PRO B C     1 
ATOM   4078 O  O     . PRO B 1 202 ? 46.246  -10.997 60.738  1.00 30.64 ? 238 PRO B O     1 
ATOM   4079 C  CB    . PRO B 1 202 ? 47.109  -7.991  61.296  1.00 31.87 ? 238 PRO B CB    1 
ATOM   4080 C  CG    . PRO B 1 202 ? 46.411  -6.699  60.881  1.00 32.61 ? 238 PRO B CG    1 
ATOM   4081 C  CD    . PRO B 1 202 ? 46.748  -6.541  59.423  1.00 28.98 ? 238 PRO B CD    1 
ATOM   4082 N  N     . LEU B 1 203 ? 44.772  -9.653  59.679  1.00 24.51 ? 239 LEU B N     1 
ATOM   4083 C  CA    . LEU B 1 203 ? 43.648  -10.592 59.778  1.00 32.47 ? 239 LEU B CA    1 
ATOM   4084 C  C     . LEU B 1 203 ? 43.542  -11.540 58.571  1.00 36.49 ? 239 LEU B C     1 
ATOM   4085 O  O     . LEU B 1 203 ? 42.665  -12.402 58.520  1.00 33.31 ? 239 LEU B O     1 
ATOM   4086 C  CB    . LEU B 1 203 ? 42.327  -9.840  59.979  1.00 39.37 ? 239 LEU B CB    1 
ATOM   4087 C  CG    . LEU B 1 203 ? 41.821  -9.596  61.409  1.00 41.32 ? 239 LEU B CG    1 
ATOM   4088 C  CD1   . LEU B 1 203 ? 42.921  -9.771  62.442  1.00 36.89 ? 239 LEU B CD1   1 
ATOM   4089 C  CD2   . LEU B 1 203 ? 41.199  -8.213  61.540  1.00 47.46 ? 239 LEU B CD2   1 
ATOM   4090 N  N     . LYS B 1 204 ? 44.424  -11.370 57.596  1.00 26.46 ? 240 LYS B N     1 
ATOM   4091 C  CA    . LYS B 1 204 ? 44.440  -12.260 56.438  1.00 30.73 ? 240 LYS B CA    1 
ATOM   4092 C  C     . LYS B 1 204 ? 44.774  -13.677 56.873  1.00 33.25 ? 240 LYS B C     1 
ATOM   4093 O  O     . LYS B 1 204 ? 45.658  -13.884 57.700  1.00 32.78 ? 240 LYS B O     1 
ATOM   4094 C  CB    . LYS B 1 204 ? 45.469  -11.773 55.409  1.00 28.46 ? 240 LYS B CB    1 
ATOM   4095 C  CG    . LYS B 1 204 ? 45.704  -12.725 54.228  1.00 26.24 ? 240 LYS B CG    1 
ATOM   4096 C  CD    . LYS B 1 204 ? 47.003  -13.491 54.391  1.00 29.95 ? 240 LYS B CD    1 
ATOM   4097 C  CE    . LYS B 1 204 ? 47.173  -14.537 53.290  1.00 29.90 ? 240 LYS B CE    1 
ATOM   4098 N  NZ    . LYS B 1 204 ? 48.431  -15.324 53.425  1.00 36.44 ? 240 LYS B NZ    1 
ATOM   4099 N  N     . GLN B 1 205 ? 44.072  -14.656 56.311  1.00 27.76 ? 241 GLN B N     1 
ATOM   4100 C  CA    . GLN B 1 205 ? 44.365  -16.050 56.596  1.00 31.70 ? 241 GLN B CA    1 
ATOM   4101 C  C     . GLN B 1 205 ? 44.801  -16.757 55.326  1.00 27.41 ? 241 GLN B C     1 
ATOM   4102 O  O     . GLN B 1 205 ? 44.304  -16.460 54.238  1.00 26.43 ? 241 GLN B O     1 
ATOM   4103 C  CB    . GLN B 1 205 ? 43.118  -16.746 57.137  1.00 32.84 ? 241 GLN B CB    1 
ATOM   4104 C  CG    . GLN B 1 205 ? 42.438  -16.002 58.280  1.00 41.74 ? 241 GLN B CG    1 
ATOM   4105 C  CD    . GLN B 1 205 ? 43.242  -16.071 59.563  1.00 44.48 ? 241 GLN B CD    1 
ATOM   4106 O  OE1   . GLN B 1 205 ? 43.443  -17.148 60.118  1.00 47.95 ? 241 GLN B OE1   1 
ATOM   4107 N  NE2   . GLN B 1 205 ? 43.721  -14.921 60.033  1.00 48.04 ? 241 GLN B NE2   1 
ATOM   4108 N  N     . GLU B 1 206 ? 45.711  -17.710 55.472  1.00 28.34 ? 242 GLU B N     1 
ATOM   4109 C  CA    . GLU B 1 206 ? 46.163  -18.496 54.338  1.00 28.23 ? 242 GLU B CA    1 
ATOM   4110 C  C     . GLU B 1 206 ? 45.011  -19.336 53.808  1.00 30.50 ? 242 GLU B C     1 
ATOM   4111 O  O     . GLU B 1 206 ? 44.293  -19.969 54.579  1.00 28.86 ? 242 GLU B O     1 
ATOM   4112 C  CB    . GLU B 1 206 ? 47.317  -19.414 54.743  1.00 36.11 ? 242 GLU B CB    1 
ATOM   4113 C  CG    . GLU B 1 206 ? 47.969  -20.118 53.550  1.00 38.89 ? 242 GLU B CG    1 
ATOM   4114 C  CD    . GLU B 1 206 ? 49.047  -21.119 53.946  1.00 44.45 ? 242 GLU B CD    1 
ATOM   4115 O  OE1   . GLU B 1 206 ? 48.703  -22.272 54.291  1.00 44.03 ? 242 GLU B OE1   1 
ATOM   4116 O  OE2   . GLU B 1 206 ? 50.240  -20.753 53.891  1.00 48.30 ? 242 GLU B OE2   1 
ATOM   4117 N  N     . LYS B 1 207 ? 44.816  -19.323 52.496  1.00 24.70 ? 243 LYS B N     1 
ATOM   4118 C  CA    . LYS B 1 207 ? 43.897  -20.261 51.858  1.00 28.35 ? 243 LYS B CA    1 
ATOM   4119 C  C     . LYS B 1 207 ? 44.532  -20.727 50.550  1.00 28.04 ? 243 LYS B C     1 
ATOM   4120 O  O     . LYS B 1 207 ? 44.746  -19.924 49.638  1.00 24.27 ? 243 LYS B O     1 
ATOM   4121 C  CB    . LYS B 1 207 ? 42.541  -19.605 51.589  1.00 32.02 ? 243 LYS B CB    1 
ATOM   4122 C  CG    . LYS B 1 207 ? 41.531  -20.530 50.891  1.00 34.58 ? 243 LYS B CG    1 
ATOM   4123 C  CD    . LYS B 1 207 ? 40.303  -19.757 50.391  1.00 37.49 ? 243 LYS B CD    1 
ATOM   4124 C  CE    . LYS B 1 207 ? 39.806  -18.747 51.413  1.00 46.65 ? 243 LYS B CE    1 
ATOM   4125 N  NZ    . LYS B 1 207 ? 38.613  -17.965 50.947  1.00 48.96 ? 243 LYS B NZ    1 
ATOM   4126 N  N     . ILE B 1 208 ? 44.841  -22.020 50.466  1.00 24.74 ? 244 ILE B N     1 
ATOM   4127 C  CA    . ILE B 1 208 ? 45.523  -22.557 49.291  1.00 30.03 ? 244 ILE B CA    1 
ATOM   4128 C  C     . ILE B 1 208 ? 44.517  -23.038 48.250  1.00 29.22 ? 244 ILE B C     1 
ATOM   4129 O  O     . ILE B 1 208 ? 43.680  -23.902 48.530  1.00 29.11 ? 244 ILE B O     1 
ATOM   4130 C  CB    . ILE B 1 208 ? 46.466  -23.732 49.650  1.00 28.76 ? 244 ILE B CB    1 
ATOM   4131 C  CG1   . ILE B 1 208 ? 47.514  -23.297 50.676  1.00 29.74 ? 244 ILE B CG1   1 
ATOM   4132 C  CG2   . ILE B 1 208 ? 47.117  -24.287 48.389  1.00 29.87 ? 244 ILE B CG2   1 
ATOM   4133 C  CD1   . ILE B 1 208 ? 48.374  -22.117 50.233  1.00 30.43 ? 244 ILE B CD1   1 
ATOM   4134 N  N     . VAL B 1 209 ? 44.597  -22.470 47.051  1.00 25.60 ? 245 VAL B N     1 
ATOM   4135 C  CA    . VAL B 1 209 ? 43.765  -22.900 45.928  1.00 26.43 ? 245 VAL B CA    1 
ATOM   4136 C  C     . VAL B 1 209 ? 44.680  -23.076 44.716  1.00 30.67 ? 245 VAL B C     1 
ATOM   4137 O  O     . VAL B 1 209 ? 45.396  -22.147 44.322  1.00 30.87 ? 245 VAL B O     1 
ATOM   4138 C  CB    . VAL B 1 209 ? 42.633  -21.883 45.631  1.00 26.54 ? 245 VAL B CB    1 
ATOM   4139 C  CG1   . VAL B 1 209 ? 41.838  -22.319 44.421  1.00 35.77 ? 245 VAL B CG1   1 
ATOM   4140 C  CG2   . VAL B 1 209 ? 41.694  -21.777 46.812  1.00 27.86 ? 245 VAL B CG2   1 
ATOM   4141 N  N     . ASP B 1 210 ? 44.676  -24.281 44.152  1.00 32.05 ? 246 ASP B N     1 
ATOM   4142 C  CA    . ASP B 1 210 ? 45.591  -24.657 43.070  1.00 30.06 ? 246 ASP B CA    1 
ATOM   4143 C  C     . ASP B 1 210 ? 47.063  -24.371 43.351  1.00 34.07 ? 246 ASP B C     1 
ATOM   4144 O  O     . ASP B 1 210 ? 47.800  -23.939 42.464  1.00 36.19 ? 246 ASP B O     1 
ATOM   4145 C  CB    . ASP B 1 210 ? 45.173  -24.017 41.746  1.00 36.68 ? 246 ASP B CB    1 
ATOM   4146 C  CG    . ASP B 1 210 ? 43.829  -24.515 41.256  1.00 43.47 ? 246 ASP B CG    1 
ATOM   4147 O  OD1   . ASP B 1 210 ? 43.490  -25.687 41.532  1.00 52.16 ? 246 ASP B OD1   1 
ATOM   4148 O  OD2   . ASP B 1 210 ? 43.107  -23.730 40.600  1.00 49.08 ? 246 ASP B OD2   1 
ATOM   4149 N  N     . GLY B 1 211 ? 47.493  -24.611 44.584  1.00 31.22 ? 247 GLY B N     1 
ATOM   4150 C  CA    . GLY B 1 211 ? 48.891  -24.435 44.931  1.00 30.09 ? 247 GLY B CA    1 
ATOM   4151 C  C     . GLY B 1 211 ? 49.314  -23.002 45.189  1.00 33.42 ? 247 GLY B C     1 
ATOM   4152 O  O     . GLY B 1 211 ? 50.505  -22.737 45.380  1.00 33.05 ? 247 GLY B O     1 
ATOM   4153 N  N     . PHE B 1 212 ? 48.357  -22.072 45.186  1.00 24.89 ? 248 PHE B N     1 
ATOM   4154 C  CA    . PHE B 1 212 ? 48.667  -20.689 45.529  1.00 28.33 ? 248 PHE B CA    1 
ATOM   4155 C  C     . PHE B 1 212 ? 47.834  -20.200 46.694  1.00 24.77 ? 248 PHE B C     1 
ATOM   4156 O  O     . PHE B 1 212 ? 46.686  -20.604 46.851  1.00 25.76 ? 248 PHE B O     1 
ATOM   4157 C  CB    . PHE B 1 212 ? 48.451  -19.753 44.336  1.00 27.58 ? 248 PHE B CB    1 
ATOM   4158 C  CG    . PHE B 1 212 ? 49.298  -20.086 43.153  1.00 29.30 ? 248 PHE B CG    1 
ATOM   4159 C  CD1   . PHE B 1 212 ? 50.639  -19.712 43.114  1.00 33.56 ? 248 PHE B CD1   1 
ATOM   4160 C  CD2   . PHE B 1 212 ? 48.756  -20.766 42.074  1.00 32.03 ? 248 PHE B CD2   1 
ATOM   4161 C  CE1   . PHE B 1 212 ? 51.428  -20.034 42.015  1.00 34.61 ? 248 PHE B CE1   1 
ATOM   4162 C  CE2   . PHE B 1 212 ? 49.536  -21.086 40.967  1.00 34.63 ? 248 PHE B CE2   1 
ATOM   4163 C  CZ    . PHE B 1 212 ? 50.873  -20.718 40.942  1.00 35.35 ? 248 PHE B CZ    1 
ATOM   4164 N  N     . ASP B 1 213 ? 48.423  -19.313 47.490  1.00 25.41 ? 249 ASP B N     1 
ATOM   4165 C  CA    . ASP B 1 213 ? 47.717  -18.664 48.583  1.00 28.01 ? 249 ASP B CA    1 
ATOM   4166 C  C     . ASP B 1 213 ? 46.873  -17.535 48.003  1.00 26.59 ? 249 ASP B C     1 
ATOM   4167 O  O     . ASP B 1 213 ? 47.414  -16.563 47.479  1.00 28.18 ? 249 ASP B O     1 
ATOM   4168 C  CB    . ASP B 1 213 ? 48.720  -18.124 49.609  1.00 29.14 ? 249 ASP B CB    1 
ATOM   4169 C  CG    . ASP B 1 213 ? 48.055  -17.661 50.907  1.00 34.86 ? 249 ASP B CG    1 
ATOM   4170 O  OD1   . ASP B 1 213 ? 46.800  -17.613 50.970  1.00 29.39 ? 249 ASP B OD1   1 
ATOM   4171 O  OD2   . ASP B 1 213 ? 48.795  -17.326 51.864  1.00 36.82 ? 249 ASP B OD2   1 
ATOM   4172 N  N     . VAL B 1 214 ? 45.554  -17.681 48.064  1.00 21.71 ? 250 VAL B N     1 
ATOM   4173 C  CA    . VAL B 1 214 ? 44.642  -16.657 47.556  1.00 26.84 ? 250 VAL B CA    1 
ATOM   4174 C  C     . VAL B 1 214 ? 43.966  -15.926 48.694  1.00 24.69 ? 250 VAL B C     1 
ATOM   4175 O  O     . VAL B 1 214 ? 42.990  -15.204 48.489  1.00 24.94 ? 250 VAL B O     1 
ATOM   4176 C  CB    . VAL B 1 214 ? 43.548  -17.244 46.629  1.00 29.08 ? 250 VAL B CB    1 
ATOM   4177 C  CG1   . VAL B 1 214 ? 44.174  -17.870 45.412  1.00 26.31 ? 250 VAL B CG1   1 
ATOM   4178 C  CG2   . VAL B 1 214 ? 42.668  -18.253 47.386  1.00 28.62 ? 250 VAL B CG2   1 
ATOM   4179 N  N     . GLY B 1 215 ? 44.476  -16.122 49.904  1.00 23.95 ? 251 GLY B N     1 
ATOM   4180 C  CA    . GLY B 1 215 ? 43.872  -15.506 51.067  1.00 25.89 ? 251 GLY B CA    1 
ATOM   4181 C  C     . GLY B 1 215 ? 44.083  -14.007 51.078  1.00 24.24 ? 251 GLY B C     1 
ATOM   4182 O  O     . GLY B 1 215 ? 45.129  -13.501 50.649  1.00 25.75 ? 251 GLY B O     1 
ATOM   4183 N  N     . PHE B 1 216 ? 43.073  -13.287 51.544  1.00 23.00 ? 252 PHE B N     1 
ATOM   4184 C  CA    . PHE B 1 216 ? 43.212  -11.858 51.817  1.00 28.50 ? 252 PHE B CA    1 
ATOM   4185 C  C     . PHE B 1 216 ? 42.128  -11.452 52.804  1.00 28.18 ? 252 PHE B C     1 
ATOM   4186 O  O     . PHE B 1 216 ? 41.146  -12.187 52.978  1.00 24.98 ? 252 PHE B O     1 
ATOM   4187 C  CB    . PHE B 1 216 ? 43.121  -11.029 50.523  1.00 24.14 ? 252 PHE B CB    1 
ATOM   4188 C  CG    . PHE B 1 216 ? 41.769  -11.043 49.876  1.00 23.17 ? 252 PHE B CG    1 
ATOM   4189 C  CD1   . PHE B 1 216 ? 40.835  -10.049 50.175  1.00 24.45 ? 252 PHE B CD1   1 
ATOM   4190 C  CD2   . PHE B 1 216 ? 41.438  -12.024 48.946  1.00 25.85 ? 252 PHE B CD2   1 
ATOM   4191 C  CE1   . PHE B 1 216 ? 39.592  -10.040 49.575  1.00 26.24 ? 252 PHE B CE1   1 
ATOM   4192 C  CE2   . PHE B 1 216 ? 40.192  -12.024 48.333  1.00 24.84 ? 252 PHE B CE2   1 
ATOM   4193 C  CZ    . PHE B 1 216 ? 39.260  -11.032 48.655  1.00 25.63 ? 252 PHE B CZ    1 
ATOM   4194 N  N     . ASP B 1 217 ? 42.312  -10.306 53.458  1.00 25.13 ? 253 ASP B N     1 
ATOM   4195 C  CA    . ASP B 1 217 ? 41.311  -9.794  54.401  1.00 33.61 ? 253 ASP B CA    1 
ATOM   4196 C  C     . ASP B 1 217 ? 40.082  -9.300  53.657  1.00 33.94 ? 253 ASP B C     1 
ATOM   4197 O  O     . ASP B 1 217 ? 40.093  -8.205  53.103  1.00 32.74 ? 253 ASP B O     1 
ATOM   4198 C  CB    . ASP B 1 217 ? 41.889  -8.663  55.263  1.00 29.80 ? 253 ASP B CB    1 
ATOM   4199 C  CG    . ASP B 1 217 ? 40.881  -8.104  56.280  1.00 41.23 ? 253 ASP B CG    1 
ATOM   4200 O  OD1   . ASP B 1 217 ? 39.814  -8.725  56.496  1.00 42.63 ? 253 ASP B OD1   1 
ATOM   4201 O  OD2   . ASP B 1 217 ? 41.163  -7.031  56.865  1.00 42.48 ? 253 ASP B OD2   1 
ATOM   4202 N  N     . ASP B 1 218 ? 39.021  -10.105 53.653  1.00 32.83 ? 254 ASP B N     1 
ATOM   4203 C  CA    . ASP B 1 218 ? 37.802  -9.742  52.930  1.00 39.27 ? 254 ASP B CA    1 
ATOM   4204 C  C     . ASP B 1 218 ? 36.661  -9.273  53.833  1.00 46.36 ? 254 ASP B C     1 
ATOM   4205 O  O     . ASP B 1 218 ? 35.501  -9.275  53.418  1.00 48.80 ? 254 ASP B O     1 
ATOM   4206 C  CB    . ASP B 1 218 ? 37.329  -10.901 52.050  1.00 36.08 ? 254 ASP B CB    1 
ATOM   4207 C  CG    . ASP B 1 218 ? 36.985  -12.143 52.854  1.00 50.77 ? 254 ASP B CG    1 
ATOM   4208 O  OD1   . ASP B 1 218 ? 37.222  -12.139 54.085  1.00 48.01 ? 254 ASP B OD1   1 
ATOM   4209 O  OD2   . ASP B 1 218 ? 36.496  -13.125 52.247  1.00 44.30 ? 254 ASP B OD2   1 
ATOM   4210 N  N     . LYS B 1 219 ? 36.989  -8.857  55.054  1.00 48.03 ? 255 LYS B N     1 
ATOM   4211 C  CA    . LYS B 1 219 ? 35.984  -8.324  55.973  1.00 44.23 ? 255 LYS B CA    1 
ATOM   4212 C  C     . LYS B 1 219 ? 36.090  -6.808  56.058  1.00 46.08 ? 255 LYS B C     1 
ATOM   4213 O  O     . LYS B 1 219 ? 36.693  -6.247  56.979  1.00 42.75 ? 255 LYS B O     1 
ATOM   4214 C  CB    . LYS B 1 219 ? 36.108  -8.978  57.349  1.00 47.71 ? 255 LYS B CB    1 
ATOM   4215 C  CG    . LYS B 1 219 ? 35.923  -10.494 57.305  1.00 51.67 ? 255 LYS B CG    1 
ATOM   4216 C  CD    . LYS B 1 219 ? 34.768  -10.890 56.376  1.00 51.42 ? 255 LYS B CD    1 
ATOM   4217 C  CE    . LYS B 1 219 ? 34.494  -12.387 56.432  1.00 53.22 ? 255 LYS B CE    1 
ATOM   4218 N  NZ    . LYS B 1 219 ? 34.295  -12.842 57.838  1.00 58.73 ? 255 LYS B NZ    1 
ATOM   4219 N  N     . LEU B 1 220 ? 35.464  -6.156  55.087  1.00 44.94 ? 256 LEU B N     1 
ATOM   4220 C  CA    . LEU B 1 220 ? 35.628  -4.730  54.842  1.00 44.61 ? 256 LEU B CA    1 
ATOM   4221 C  C     . LEU B 1 220 ? 35.078  -3.806  55.936  1.00 45.75 ? 256 LEU B C     1 
ATOM   4222 O  O     . LEU B 1 220 ? 35.505  -2.656  56.055  1.00 44.10 ? 256 LEU B O     1 
ATOM   4223 C  CB    . LEU B 1 220 ? 34.990  -4.401  53.493  1.00 45.29 ? 256 LEU B CB    1 
ATOM   4224 C  CG    . LEU B 1 220 ? 35.465  -5.382  52.414  1.00 41.68 ? 256 LEU B CG    1 
ATOM   4225 C  CD1   . LEU B 1 220 ? 34.766  -5.152  51.088  1.00 43.39 ? 256 LEU B CD1   1 
ATOM   4226 C  CD2   . LEU B 1 220 ? 36.982  -5.297  52.238  1.00 38.29 ? 256 LEU B CD2   1 
ATOM   4227 N  N     . GLU B 1 221 ? 34.141  -4.306  56.738  1.00 44.77 ? 257 GLU B N     1 
ATOM   4228 C  CA    . GLU B 1 221 ? 33.494  -3.475  57.757  1.00 48.99 ? 257 GLU B CA    1 
ATOM   4229 C  C     . GLU B 1 221 ? 34.469  -2.971  58.823  1.00 44.73 ? 257 GLU B C     1 
ATOM   4230 O  O     . GLU B 1 221 ? 34.192  -1.982  59.500  1.00 48.61 ? 257 GLU B O     1 
ATOM   4231 C  CB    . GLU B 1 221 ? 32.341  -4.234  58.431  1.00 54.82 ? 257 GLU B CB    1 
ATOM   4232 C  CG    . GLU B 1 221 ? 31.549  -5.144  57.497  1.00 59.24 ? 257 GLU B CG    1 
ATOM   4233 C  CD    . GLU B 1 221 ? 31.987  -6.594  57.595  1.00 60.52 ? 257 GLU B CD    1 
ATOM   4234 O  OE1   . GLU B 1 221 ? 32.458  -6.991  58.687  1.00 61.68 ? 257 GLU B OE1   1 
ATOM   4235 O  OE2   . GLU B 1 221 ? 31.861  -7.337  56.592  1.00 59.72 ? 257 GLU B OE2   1 
ATOM   4236 N  N     . ASP B 1 222 ? 35.602  -3.655  58.971  1.00 43.32 ? 258 ASP B N     1 
ATOM   4237 C  CA    . ASP B 1 222 ? 36.600  -3.291  59.977  1.00 43.03 ? 258 ASP B CA    1 
ATOM   4238 C  C     . ASP B 1 222 ? 37.844  -2.617  59.386  1.00 44.62 ? 258 ASP B C     1 
ATOM   4239 O  O     . ASP B 1 222 ? 38.855  -2.424  60.068  1.00 38.42 ? 258 ASP B O     1 
ATOM   4240 C  CB    . ASP B 1 222 ? 36.981  -4.522  60.796  1.00 50.34 ? 258 ASP B CB    1 
ATOM   4241 C  CG    . ASP B 1 222 ? 35.778  -5.150  61.482  1.00 57.77 ? 258 ASP B CG    1 
ATOM   4242 O  OD1   . ASP B 1 222 ? 34.962  -4.385  62.042  1.00 56.64 ? 258 ASP B OD1   1 
ATOM   4243 O  OD2   . ASP B 1 222 ? 35.633  -6.394  61.443  1.00 60.23 ? 258 ASP B OD2   1 
ATOM   4244 N  N     . ILE B 1 223 ? 37.759  -2.257  58.112  1.00 42.54 ? 259 ILE B N     1 
ATOM   4245 C  CA    . ILE B 1 223 ? 38.827  -1.517  57.452  1.00 37.91 ? 259 ILE B CA    1 
ATOM   4246 C  C     . ILE B 1 223 ? 38.655  -0.034  57.754  1.00 37.05 ? 259 ILE B C     1 
ATOM   4247 O  O     . ILE B 1 223 ? 37.557  0.498   57.624  1.00 38.75 ? 259 ILE B O     1 
ATOM   4248 C  CB    . ILE B 1 223 ? 38.777  -1.714  55.925  1.00 40.71 ? 259 ILE B CB    1 
ATOM   4249 C  CG1   . ILE B 1 223 ? 38.812  -3.203  55.569  1.00 38.30 ? 259 ILE B CG1   1 
ATOM   4250 C  CG2   . ILE B 1 223 ? 39.907  -0.947  55.249  1.00 33.57 ? 259 ILE B CG2   1 
ATOM   4251 C  CD1   . ILE B 1 223 ? 40.079  -3.910  55.994  1.00 36.51 ? 259 ILE B CD1   1 
ATOM   4252 N  N     . PRO B 1 224 ? 39.737  0.644   58.162  1.00 39.88 ? 260 PRO B N     1 
ATOM   4253 C  CA    . PRO B 1 224 ? 39.611  2.076   58.448  1.00 44.86 ? 260 PRO B CA    1 
ATOM   4254 C  C     . PRO B 1 224 ? 39.285  2.866   57.188  1.00 47.46 ? 260 PRO B C     1 
ATOM   4255 O  O     . PRO B 1 224 ? 39.683  2.461   56.090  1.00 46.29 ? 260 PRO B O     1 
ATOM   4256 C  CB    . PRO B 1 224 ? 41.005  2.455   58.967  1.00 46.04 ? 260 PRO B CB    1 
ATOM   4257 C  CG    . PRO B 1 224 ? 41.915  1.374   58.473  1.00 45.00 ? 260 PRO B CG    1 
ATOM   4258 C  CD    . PRO B 1 224 ? 41.085  0.134   58.455  1.00 42.25 ? 260 PRO B CD    1 
ATOM   4259 N  N     . PRO B 1 225 ? 38.574  3.992   57.342  1.00 49.14 ? 261 PRO B N     1 
ATOM   4260 C  CA    . PRO B 1 225 ? 38.231  4.856   56.205  1.00 47.24 ? 261 PRO B CA    1 
ATOM   4261 C  C     . PRO B 1 225 ? 39.497  5.408   55.580  1.00 44.21 ? 261 PRO B C     1 
ATOM   4262 O  O     . PRO B 1 225 ? 40.495  5.551   56.295  1.00 39.49 ? 261 PRO B O     1 
ATOM   4263 C  CB    . PRO B 1 225 ? 37.461  6.016   56.856  1.00 49.67 ? 261 PRO B CB    1 
ATOM   4264 C  CG    . PRO B 1 225 ? 37.135  5.556   58.255  1.00 50.49 ? 261 PRO B CG    1 
ATOM   4265 C  CD    . PRO B 1 225 ? 38.224  4.608   58.632  1.00 45.17 ? 261 PRO B CD    1 
ATOM   4266 N  N     . SER B 1 226 ? 39.478  5.723   54.287  1.00 42.97 ? 262 SER B N     1 
ATOM   4267 C  CA    . SER B 1 226 ? 40.680  6.280   53.670  1.00 41.12 ? 262 SER B CA    1 
ATOM   4268 C  C     . SER B 1 226 ? 40.953  7.679   54.196  1.00 36.35 ? 262 SER B C     1 
ATOM   4269 O  O     . SER B 1 226 ? 40.028  8.460   54.395  1.00 41.46 ? 262 SER B O     1 
ATOM   4270 C  CB    . SER B 1 226 ? 40.558  6.332   52.147  1.00 36.93 ? 262 SER B CB    1 
ATOM   4271 O  OG    . SER B 1 226 ? 41.691  6.986   51.606  1.00 33.95 ? 262 SER B OG    1 
ATOM   4272 N  N     . GLN B 1 227 ? 42.222  8.002   54.415  1.00 38.25 ? 263 GLN B N     1 
ATOM   4273 C  CA    . GLN B 1 227 ? 42.584  9.375   54.750  1.00 41.86 ? 263 GLN B CA    1 
ATOM   4274 C  C     . GLN B 1 227 ? 42.969  10.145  53.508  1.00 39.75 ? 263 GLN B C     1 
ATOM   4275 O  O     . GLN B 1 227 ? 43.461  11.268  53.592  1.00 40.36 ? 263 GLN B O     1 
ATOM   4276 C  CB    . GLN B 1 227 ? 43.723  9.425   55.765  1.00 42.56 ? 263 GLN B CB    1 
ATOM   4277 C  CG    . GLN B 1 227 ? 43.291  9.110   57.189  1.00 43.90 ? 263 GLN B CG    1 
ATOM   4278 C  CD    . GLN B 1 227 ? 44.474  9.032   58.126  1.00 48.36 ? 263 GLN B CD    1 
ATOM   4279 O  OE1   . GLN B 1 227 ? 45.538  8.534   57.752  1.00 48.56 ? 263 GLN B OE1   1 
ATOM   4280 N  NE2   . GLN B 1 227 ? 44.306  9.538   59.341  1.00 48.04 ? 263 GLN B NE2   1 
ATOM   4281 N  N     . ASN B 1 228 ? 42.755  9.538   52.348  1.00 34.55 ? 264 ASN B N     1 
ATOM   4282 C  CA    . ASN B 1 228 ? 42.997  10.250  51.104  1.00 31.38 ? 264 ASN B CA    1 
ATOM   4283 C  C     . ASN B 1 228 ? 41.687  10.836  50.602  1.00 33.56 ? 264 ASN B C     1 
ATOM   4284 O  O     . ASN B 1 228 ? 40.721  10.104  50.355  1.00 30.70 ? 264 ASN B O     1 
ATOM   4285 C  CB    . ASN B 1 228 ? 43.621  9.329   50.052  1.00 31.40 ? 264 ASN B CB    1 
ATOM   4286 C  CG    . ASN B 1 228 ? 44.100  10.089  48.849  1.00 32.56 ? 264 ASN B CG    1 
ATOM   4287 O  OD1   . ASN B 1 228 ? 43.293  10.620  48.082  1.00 32.76 ? 264 ASN B OD1   1 
ATOM   4288 N  ND2   . ASN B 1 228 ? 45.418  10.196  48.697  1.00 30.23 ? 264 ASN B ND2   1 
ATOM   4289 N  N     . TYR B 1 229 ? 41.646  12.161  50.465  1.00 29.54 ? 265 TYR B N     1 
ATOM   4290 C  CA    . TYR B 1 229 ? 40.423  12.840  50.064  1.00 33.32 ? 265 TYR B CA    1 
ATOM   4291 C  C     . TYR B 1 229 ? 40.513  13.402  48.660  1.00 31.84 ? 265 TYR B C     1 
ATOM   4292 O  O     . TYR B 1 229 ? 39.736  14.283  48.288  1.00 30.97 ? 265 TYR B O     1 
ATOM   4293 C  CB    . TYR B 1 229 ? 40.078  13.946  51.071  1.00 36.23 ? 265 TYR B CB    1 
ATOM   4294 C  CG    . TYR B 1 229 ? 39.940  13.409  52.468  1.00 39.21 ? 265 TYR B CG    1 
ATOM   4295 C  CD1   . TYR B 1 229 ? 38.820  12.677  52.840  1.00 45.05 ? 265 TYR B CD1   1 
ATOM   4296 C  CD2   . TYR B 1 229 ? 40.942  13.605  53.408  1.00 41.33 ? 265 TYR B CD2   1 
ATOM   4297 C  CE1   . TYR B 1 229 ? 38.694  12.170  54.118  1.00 46.68 ? 265 TYR B CE1   1 
ATOM   4298 C  CE2   . TYR B 1 229 ? 40.825  13.101  54.686  1.00 47.96 ? 265 TYR B CE2   1 
ATOM   4299 C  CZ    . TYR B 1 229 ? 39.699  12.384  55.033  1.00 45.06 ? 265 TYR B CZ    1 
ATOM   4300 O  OH    . TYR B 1 229 ? 39.581  11.884  56.307  1.00 52.89 ? 265 TYR B OH    1 
ATOM   4301 N  N     . SER B 1 230 ? 41.449  12.879  47.873  1.00 26.31 ? 266 SER B N     1 
ATOM   4302 C  CA    . SER B 1 230 ? 41.635  13.371  46.515  1.00 29.63 ? 266 SER B CA    1 
ATOM   4303 C  C     . SER B 1 230 ? 40.384  13.139  45.686  1.00 29.99 ? 266 SER B C     1 
ATOM   4304 O  O     . SER B 1 230 ? 39.660  12.158  45.883  1.00 25.32 ? 266 SER B O     1 
ATOM   4305 C  CB    . SER B 1 230 ? 42.843  12.715  45.837  1.00 27.95 ? 266 SER B CB    1 
ATOM   4306 O  OG    . SER B 1 230 ? 44.015  12.905  46.593  1.00 33.95 ? 266 SER B OG    1 
ATOM   4307 N  N     . SER B 1 231 ? 40.125  14.060  44.767  1.00 24.23 ? 267 SER B N     1 
ATOM   4308 C  CA    . SER B 1 231 ? 39.039  13.894  43.811  1.00 27.22 ? 267 SER B CA    1 
ATOM   4309 C  C     . SER B 1 231 ? 39.432  12.851  42.770  1.00 20.07 ? 267 SER B C     1 
ATOM   4310 O  O     . SER B 1 231 ? 40.624  12.559  42.586  1.00 21.45 ? 267 SER B O     1 
ATOM   4311 C  CB    . SER B 1 231 ? 38.756  15.216  43.109  1.00 28.87 ? 267 SER B CB    1 
ATOM   4312 O  OG    . SER B 1 231 ? 39.850  15.577  42.288  1.00 30.52 ? 267 SER B OG    1 
ATOM   4313 N  N     . LEU B 1 232 ? 38.431  12.298  42.087  1.00 21.72 ? 268 LEU B N     1 
ATOM   4314 C  CA    . LEU B 1 232 ? 38.672  11.368  40.988  1.00 21.28 ? 268 LEU B CA    1 
ATOM   4315 C  C     . LEU B 1 232 ? 39.681  11.948  39.994  1.00 25.78 ? 268 LEU B C     1 
ATOM   4316 O  O     . LEU B 1 232 ? 40.547  11.234  39.497  1.00 21.37 ? 268 LEU B O     1 
ATOM   4317 C  CB    . LEU B 1 232 ? 37.351  11.039  40.285  1.00 21.14 ? 268 LEU B CB    1 
ATOM   4318 C  CG    . LEU B 1 232 ? 37.468  10.190  39.028  1.00 27.36 ? 268 LEU B CG    1 
ATOM   4319 C  CD1   . LEU B 1 232 ? 38.153  8.884   39.370  1.00 21.60 ? 268 LEU B CD1   1 
ATOM   4320 C  CD2   . LEU B 1 232 ? 36.101  9.953   38.416  1.00 23.40 ? 268 LEU B CD2   1 
ATOM   4321 N  N     . GLY B 1 233 ? 39.579  13.248  39.721  1.00 25.66 ? 269 GLY B N     1 
ATOM   4322 C  CA    . GLY B 1 233 ? 40.479  13.901  38.783  1.00 24.08 ? 269 GLY B CA    1 
ATOM   4323 C  C     . GLY B 1 233 ? 41.909  13.946  39.281  1.00 22.48 ? 269 GLY B C     1 
ATOM   4324 O  O     . GLY B 1 233 ? 42.844  13.701  38.511  1.00 24.47 ? 269 GLY B O     1 
ATOM   4325 N  N     . SER B 1 234 ? 42.095  14.254  40.561  1.00 23.69 ? 270 SER B N     1 
ATOM   4326 C  CA    . SER B 1 234 ? 43.443  14.243  41.131  1.00 25.62 ? 270 SER B CA    1 
ATOM   4327 C  C     . SER B 1 234 ? 44.063  12.848  41.068  1.00 26.02 ? 270 SER B C     1 
ATOM   4328 O  O     . SER B 1 234 ? 45.273  12.701  40.807  1.00 21.81 ? 270 SER B O     1 
ATOM   4329 C  CB    . SER B 1 234 ? 43.446  14.751  42.580  1.00 26.35 ? 270 SER B CB    1 
ATOM   4330 O  OG    . SER B 1 234 ? 43.067  16.115  42.638  1.00 36.80 ? 270 SER B OG    1 
ATOM   4331 N  N     . LEU B 1 235 ? 43.240  11.826  41.307  1.00 22.45 ? 271 LEU B N     1 
ATOM   4332 C  CA    . LEU B 1 235 ? 43.735  10.455  41.343  1.00 21.30 ? 271 LEU B CA    1 
ATOM   4333 C  C     . LEU B 1 235 ? 44.234  10.048  39.971  1.00 20.34 ? 271 LEU B C     1 
ATOM   4334 O  O     . LEU B 1 235 ? 45.319  9.489   39.844  1.00 21.08 ? 271 LEU B O     1 
ATOM   4335 C  CB    . LEU B 1 235 ? 42.643  9.468   41.794  1.00 16.63 ? 271 LEU B CB    1 
ATOM   4336 C  CG    . LEU B 1 235 ? 42.112  9.580   43.214  1.00 25.96 ? 271 LEU B CG    1 
ATOM   4337 C  CD1   . LEU B 1 235 ? 41.048  8.499   43.514  1.00 24.38 ? 271 LEU B CD1   1 
ATOM   4338 C  CD2   . LEU B 1 235 ? 43.264  9.481   44.216  1.00 26.52 ? 271 LEU B CD2   1 
ATOM   4339 N  N     . LEU B 1 236 ? 43.421  10.302  38.952  1.00 18.80 ? 272 LEU B N     1 
ATOM   4340 C  CA    . LEU B 1 236 ? 43.773  9.951   37.587  1.00 20.53 ? 272 LEU B CA    1 
ATOM   4341 C  C     . LEU B 1 236 ? 44.993  10.721  37.129  1.00 23.56 ? 272 LEU B C     1 
ATOM   4342 O  O     . LEU B 1 236 ? 45.864  10.155  36.470  1.00 21.57 ? 272 LEU B O     1 
ATOM   4343 C  CB    . LEU B 1 236 ? 42.617  10.210  36.623  1.00 23.96 ? 272 LEU B CB    1 
ATOM   4344 C  CG    . LEU B 1 236 ? 41.635  9.064   36.405  1.00 29.90 ? 272 LEU B CG    1 
ATOM   4345 C  CD1   . LEU B 1 236 ? 40.512  9.516   35.495  1.00 30.73 ? 272 LEU B CD1   1 
ATOM   4346 C  CD2   . LEU B 1 236 ? 42.390  7.888   35.777  1.00 27.37 ? 272 LEU B CD2   1 
ATOM   4347 N  N     . HIS B 1 237 ? 45.070  12.003  37.483  1.00 21.55 ? 273 HIS B N     1 
ATOM   4348 C  CA    . HIS B 1 237 ? 46.248  12.789  37.117  1.00 25.78 ? 273 HIS B CA    1 
ATOM   4349 C  C     . HIS B 1 237 ? 47.517  12.188  37.706  1.00 25.44 ? 273 HIS B C     1 
ATOM   4350 O  O     . HIS B 1 237 ? 48.522  12.022  37.011  1.00 24.30 ? 273 HIS B O     1 
ATOM   4351 C  CB    . HIS B 1 237 ? 46.110  14.239  37.565  1.00 27.99 ? 273 HIS B CB    1 
ATOM   4352 C  CG    . HIS B 1 237 ? 47.143  15.139  36.965  1.00 35.86 ? 273 HIS B CG    1 
ATOM   4353 N  ND1   . HIS B 1 237 ? 47.361  16.425  37.407  1.00 36.03 ? 273 HIS B ND1   1 
ATOM   4354 C  CD2   . HIS B 1 237 ? 48.019  14.934  35.954  1.00 38.12 ? 273 HIS B CD2   1 
ATOM   4355 C  CE1   . HIS B 1 237 ? 48.330  16.974  36.696  1.00 40.23 ? 273 HIS B CE1   1 
ATOM   4356 N  NE2   . HIS B 1 237 ? 48.746  16.093  35.805  1.00 42.03 ? 273 HIS B NE2   1 
ATOM   4357 N  N     . GLY B 1 238 ? 47.469  11.852  38.988  1.00 23.97 ? 274 GLY B N     1 
ATOM   4358 C  CA    . GLY B 1 238 ? 48.598  11.222  39.645  1.00 19.28 ? 274 GLY B CA    1 
ATOM   4359 C  C     . GLY B 1 238 ? 48.973  9.878   39.043  1.00 23.12 ? 274 GLY B C     1 
ATOM   4360 O  O     . GLY B 1 238 ? 50.161  9.558   38.934  1.00 22.34 ? 274 GLY B O     1 
ATOM   4361 N  N     . PHE B 1 239 ? 47.963  9.090   38.674  1.00 22.57 ? 275 PHE B N     1 
ATOM   4362 C  CA    . PHE B 1 239 ? 48.161  7.790   38.037  1.00 21.91 ? 275 PHE B CA    1 
ATOM   4363 C  C     . PHE B 1 239 ? 48.921  7.917   36.718  1.00 20.23 ? 275 PHE B C     1 
ATOM   4364 O  O     . PHE B 1 239 ? 49.873  7.159   36.446  1.00 19.67 ? 275 PHE B O     1 
ATOM   4365 C  CB    . PHE B 1 239 ? 46.790  7.139   37.806  1.00 19.34 ? 275 PHE B CB    1 
ATOM   4366 C  CG    . PHE B 1 239 ? 46.808  5.932   36.890  1.00 23.27 ? 275 PHE B CG    1 
ATOM   4367 C  CD1   . PHE B 1 239 ? 47.143  4.663   37.378  1.00 21.29 ? 275 PHE B CD1   1 
ATOM   4368 C  CD2   . PHE B 1 239 ? 46.426  6.058   35.551  1.00 22.13 ? 275 PHE B CD2   1 
ATOM   4369 C  CE1   . PHE B 1 239 ? 47.126  3.542   36.532  1.00 19.33 ? 275 PHE B CE1   1 
ATOM   4370 C  CE2   . PHE B 1 239 ? 46.411  4.950   34.696  1.00 21.87 ? 275 PHE B CE2   1 
ATOM   4371 C  CZ    . PHE B 1 239 ? 46.757  3.686   35.195  1.00 18.85 ? 275 PHE B CZ    1 
ATOM   4372 N  N     . PHE B 1 240 ? 48.490  8.847   35.879  1.00 22.97 ? 276 PHE B N     1 
ATOM   4373 C  CA    . PHE B 1 240 ? 49.168  9.041   34.595  1.00 25.71 ? 276 PHE B CA    1 
ATOM   4374 C  C     . PHE B 1 240 ? 50.611  9.469   34.813  1.00 26.38 ? 276 PHE B C     1 
ATOM   4375 O  O     . PHE B 1 240 ? 51.534  8.961   34.161  1.00 21.40 ? 276 PHE B O     1 
ATOM   4376 C  CB    . PHE B 1 240 ? 48.432  10.065  33.726  1.00 22.70 ? 276 PHE B CB    1 
ATOM   4377 C  CG    . PHE B 1 240 ? 47.145  9.550   33.135  1.00 23.07 ? 276 PHE B CG    1 
ATOM   4378 C  CD1   . PHE B 1 240 ? 45.960  10.258  33.301  1.00 22.66 ? 276 PHE B CD1   1 
ATOM   4379 C  CD2   . PHE B 1 240 ? 47.120  8.373   32.414  1.00 23.11 ? 276 PHE B CD2   1 
ATOM   4380 C  CE1   . PHE B 1 240 ? 44.769  9.791   32.768  1.00 24.62 ? 276 PHE B CE1   1 
ATOM   4381 C  CE2   . PHE B 1 240 ? 45.929  7.893   31.873  1.00 23.71 ? 276 PHE B CE2   1 
ATOM   4382 C  CZ    . PHE B 1 240 ? 44.751  8.623   32.046  1.00 21.56 ? 276 PHE B CZ    1 
ATOM   4383 N  N     . ARG B 1 241 ? 50.820  10.384  35.751  1.00 22.41 ? 277 ARG B N     1 
ATOM   4384 C  CA    . ARG B 1 241 ? 52.173  10.901  35.967  1.00 27.06 ? 277 ARG B CA    1 
ATOM   4385 C  C     . ARG B 1 241 ? 53.129  9.883   36.591  1.00 26.86 ? 277 ARG B C     1 
ATOM   4386 O  O     . ARG B 1 241 ? 54.320  9.866   36.273  1.00 23.08 ? 277 ARG B O     1 
ATOM   4387 C  CB    . ARG B 1 241 ? 52.153  12.209  36.770  1.00 31.90 ? 277 ARG B CB    1 
ATOM   4388 C  CG    . ARG B 1 241 ? 52.009  12.035  38.271  1.00 35.85 ? 277 ARG B CG    1 
ATOM   4389 C  CD    . ARG B 1 241 ? 52.351  13.324  39.044  1.00 48.27 ? 277 ARG B CD    1 
ATOM   4390 N  NE    . ARG B 1 241 ? 53.317  14.147  38.317  1.00 47.38 ? 277 ARG B NE    1 
ATOM   4391 C  CZ    . ARG B 1 241 ? 52.966  15.130  37.497  1.00 46.66 ? 277 ARG B CZ    1 
ATOM   4392 N  NH1   . ARG B 1 241 ? 53.886  15.834  36.851  1.00 47.86 ? 277 ARG B NH1   1 
ATOM   4393 N  NH2   . ARG B 1 241 ? 51.678  15.389  37.314  1.00 51.33 ? 277 ARG B NH2   1 
ATOM   4394 N  N     . PHE B 1 242 ? 52.616  9.023   37.467  1.00 22.38 ? 278 PHE B N     1 
ATOM   4395 C  CA    . PHE B 1 242 ? 53.448  7.974   38.019  1.00 22.30 ? 278 PHE B CA    1 
ATOM   4396 C  C     . PHE B 1 242 ? 53.985  7.027   36.943  1.00 23.62 ? 278 PHE B C     1 
ATOM   4397 O  O     . PHE B 1 242 ? 55.189  6.746   36.880  1.00 23.16 ? 278 PHE B O     1 
ATOM   4398 C  CB    . PHE B 1 242 ? 52.700  7.163   39.069  1.00 21.99 ? 278 PHE B CB    1 
ATOM   4399 C  CG    . PHE B 1 242 ? 53.513  6.034   39.611  1.00 25.32 ? 278 PHE B CG    1 
ATOM   4400 C  CD1   . PHE B 1 242 ? 54.622  6.293   40.404  1.00 23.53 ? 278 PHE B CD1   1 
ATOM   4401 C  CD2   . PHE B 1 242 ? 53.192  4.713   39.307  1.00 19.55 ? 278 PHE B CD2   1 
ATOM   4402 C  CE1   . PHE B 1 242 ? 55.393  5.265   40.899  1.00 24.19 ? 278 PHE B CE1   1 
ATOM   4403 C  CE2   . PHE B 1 242 ? 53.953  3.679   39.802  1.00 21.95 ? 278 PHE B CE2   1 
ATOM   4404 C  CZ    . PHE B 1 242 ? 55.054  3.949   40.606  1.00 25.32 ? 278 PHE B CZ    1 
ATOM   4405 N  N     . TYR B 1 243 ? 53.098  6.513   36.104  1.00 22.76 ? 279 TYR B N     1 
ATOM   4406 C  CA    . TYR B 1 243 ? 53.542  5.559   35.095  1.00 20.67 ? 279 TYR B CA    1 
ATOM   4407 C  C     . TYR B 1 243 ? 54.225  6.245   33.899  1.00 25.11 ? 279 TYR B C     1 
ATOM   4408 O  O     . TYR B 1 243 ? 54.957  5.605   33.143  1.00 22.51 ? 279 TYR B O     1 
ATOM   4409 C  CB    . TYR B 1 243 ? 52.386  4.650   34.663  1.00 21.93 ? 279 TYR B CB    1 
ATOM   4410 C  CG    . TYR B 1 243 ? 51.992  3.681   35.756  1.00 20.01 ? 279 TYR B CG    1 
ATOM   4411 C  CD1   . TYR B 1 243 ? 50.801  3.831   36.455  1.00 19.65 ? 279 TYR B CD1   1 
ATOM   4412 C  CD2   . TYR B 1 243 ? 52.847  2.645   36.119  1.00 22.27 ? 279 TYR B CD2   1 
ATOM   4413 C  CE1   . TYR B 1 243 ? 50.458  2.944   37.466  1.00 21.21 ? 279 TYR B CE1   1 
ATOM   4414 C  CE2   . TYR B 1 243 ? 52.514  1.753   37.127  1.00 21.18 ? 279 TYR B CE2   1 
ATOM   4415 C  CZ    . TYR B 1 243 ? 51.324  1.912   37.795  1.00 21.81 ? 279 TYR B CZ    1 
ATOM   4416 O  OH    . TYR B 1 243 ? 51.006  1.016   38.792  1.00 23.03 ? 279 TYR B OH    1 
ATOM   4417 N  N     . ALA B 1 244 ? 54.000  7.544   33.741  1.00 22.81 ? 280 ALA B N     1 
ATOM   4418 C  CA    . ALA B 1 244 ? 54.720  8.311   32.725  1.00 26.09 ? 280 ALA B CA    1 
ATOM   4419 C  C     . ALA B 1 244 ? 56.176  8.515   33.128  1.00 29.41 ? 280 ALA B C     1 
ATOM   4420 O  O     . ALA B 1 244 ? 57.089  8.263   32.336  1.00 30.68 ? 280 ALA B O     1 
ATOM   4421 C  CB    . ALA B 1 244 ? 54.041  9.672   32.467  1.00 25.26 ? 280 ALA B CB    1 
ATOM   4422 N  N     . TYR B 1 245 ? 56.396  8.949   34.368  1.00 28.93 ? 281 TYR B N     1 
ATOM   4423 C  CA    . TYR B 1 245 ? 57.676  9.567   34.722  1.00 33.30 ? 281 TYR B CA    1 
ATOM   4424 C  C     . TYR B 1 245 ? 58.414  8.958   35.914  1.00 34.52 ? 281 TYR B C     1 
ATOM   4425 O  O     . TYR B 1 245 ? 59.623  9.127   36.044  1.00 38.54 ? 281 TYR B O     1 
ATOM   4426 C  CB    . TYR B 1 245 ? 57.453  11.055  34.994  1.00 29.24 ? 281 TYR B CB    1 
ATOM   4427 C  CG    . TYR B 1 245 ? 56.904  11.832  33.826  1.00 26.66 ? 281 TYR B CG    1 
ATOM   4428 C  CD1   . TYR B 1 245 ? 55.841  12.707  33.997  1.00 32.41 ? 281 TYR B CD1   1 
ATOM   4429 C  CD2   . TYR B 1 245 ? 57.454  11.705  32.560  1.00 29.65 ? 281 TYR B CD2   1 
ATOM   4430 C  CE1   . TYR B 1 245 ? 55.333  13.435  32.933  1.00 35.29 ? 281 TYR B CE1   1 
ATOM   4431 C  CE2   . TYR B 1 245 ? 56.954  12.429  31.489  1.00 27.70 ? 281 TYR B CE2   1 
ATOM   4432 C  CZ    . TYR B 1 245 ? 55.905  13.292  31.683  1.00 27.96 ? 281 TYR B CZ    1 
ATOM   4433 O  OH    . TYR B 1 245 ? 55.390  14.009  30.625  1.00 31.51 ? 281 TYR B OH    1 
ATOM   4434 N  N     . LYS B 1 246 ? 57.694  8.258   36.784  1.00 25.50 ? 282 LYS B N     1 
ATOM   4435 C  CA    . LYS B 1 246 ? 58.281  7.795   38.044  1.00 26.86 ? 282 LYS B CA    1 
ATOM   4436 C  C     . LYS B 1 246 ? 58.575  6.283   38.061  1.00 31.86 ? 282 LYS B C     1 
ATOM   4437 O  O     . LYS B 1 246 ? 59.651  5.853   38.494  1.00 31.55 ? 282 LYS B O     1 
ATOM   4438 C  CB    . LYS B 1 246 ? 57.344  8.175   39.203  1.00 30.56 ? 282 LYS B CB    1 
ATOM   4439 C  CG    . LYS B 1 246 ? 58.017  8.749   40.443  1.00 44.35 ? 282 LYS B CG    1 
ATOM   4440 C  CD    . LYS B 1 246 ? 58.628  7.644   41.275  1.00 46.81 ? 282 LYS B CD    1 
ATOM   4441 C  CE    . LYS B 1 246 ? 59.521  8.200   42.374  1.00 51.16 ? 282 LYS B CE    1 
ATOM   4442 N  NZ    . LYS B 1 246 ? 60.127  7.093   43.174  1.00 53.63 ? 282 LYS B NZ    1 
ATOM   4443 N  N     . PHE B 1 247 ? 57.613  5.476   37.613  1.00 26.87 ? 283 PHE B N     1 
ATOM   4444 C  CA    . PHE B 1 247 ? 57.788  4.021   37.575  1.00 28.81 ? 283 PHE B CA    1 
ATOM   4445 C  C     . PHE B 1 247 ? 58.881  3.633   36.589  1.00 34.20 ? 283 PHE B C     1 
ATOM   4446 O  O     . PHE B 1 247 ? 58.940  4.185   35.487  1.00 29.96 ? 283 PHE B O     1 
ATOM   4447 C  CB    . PHE B 1 247 ? 56.483  3.332   37.165  1.00 27.77 ? 283 PHE B CB    1 
ATOM   4448 C  CG    . PHE B 1 247 ? 56.576  1.836   37.145  1.00 27.45 ? 283 PHE B CG    1 
ATOM   4449 C  CD1   . PHE B 1 247 ? 56.661  1.120   38.334  1.00 28.53 ? 283 PHE B CD1   1 
ATOM   4450 C  CD2   . PHE B 1 247 ? 56.579  1.140   35.941  1.00 28.00 ? 283 PHE B CD2   1 
ATOM   4451 C  CE1   . PHE B 1 247 ? 56.757  -0.265  38.322  1.00 27.95 ? 283 PHE B CE1   1 
ATOM   4452 C  CE2   . PHE B 1 247 ? 56.671  -0.240  35.922  1.00 29.49 ? 283 PHE B CE2   1 
ATOM   4453 C  CZ    . PHE B 1 247 ? 56.759  -0.944  37.113  1.00 28.64 ? 283 PHE B CZ    1 
ATOM   4454 N  N     . GLU B 1 248 ? 59.726  2.678   36.977  1.00 31.19 ? 284 GLU B N     1 
ATOM   4455 C  CA    . GLU B 1 248 ? 60.864  2.261   36.152  1.00 34.02 ? 284 GLU B CA    1 
ATOM   4456 C  C     . GLU B 1 248 ? 60.690  0.828   35.688  1.00 29.20 ? 284 GLU B C     1 
ATOM   4457 O  O     . GLU B 1 248 ? 61.136  -0.106  36.364  1.00 31.42 ? 284 GLU B O     1 
ATOM   4458 C  CB    . GLU B 1 248 ? 62.171  2.344   36.943  1.00 37.21 ? 284 GLU B CB    1 
ATOM   4459 C  CG    . GLU B 1 248 ? 62.395  3.634   37.713  1.00 41.56 ? 284 GLU B CG    1 
ATOM   4460 C  CD    . GLU B 1 248 ? 63.520  3.497   38.731  1.00 55.17 ? 284 GLU B CD    1 
ATOM   4461 O  OE1   . GLU B 1 248 ? 64.159  2.419   38.767  1.00 60.82 ? 284 GLU B OE1   1 
ATOM   4462 O  OE2   . GLU B 1 248 ? 63.764  4.458   39.494  1.00 58.70 ? 284 GLU B OE2   1 
ATOM   4463 N  N     . PRO B 1 249 ? 60.047  0.645   34.531  1.00 29.02 ? 285 PRO B N     1 
ATOM   4464 C  CA    . PRO B 1 249 ? 59.707  -0.705  34.055  1.00 29.87 ? 285 PRO B CA    1 
ATOM   4465 C  C     . PRO B 1 249 ? 60.915  -1.590  33.723  1.00 35.55 ? 285 PRO B C     1 
ATOM   4466 O  O     . PRO B 1 249 ? 60.788  -2.816  33.699  1.00 29.44 ? 285 PRO B O     1 
ATOM   4467 C  CB    . PRO B 1 249 ? 58.871  -0.436  32.797  1.00 33.86 ? 285 PRO B CB    1 
ATOM   4468 C  CG    . PRO B 1 249 ? 59.184  0.990   32.401  1.00 35.36 ? 285 PRO B CG    1 
ATOM   4469 C  CD    . PRO B 1 249 ? 59.468  1.704   33.682  1.00 32.27 ? 285 PRO B CD    1 
ATOM   4470 N  N     . ARG B 1 250 ? 62.072  -0.984  33.470  1.00 33.06 ? 286 ARG B N     1 
ATOM   4471 C  CA    . ARG B 1 250 ? 63.260  -1.775  33.174  1.00 39.70 ? 286 ARG B CA    1 
ATOM   4472 C  C     . ARG B 1 250 ? 63.790  -2.483  34.405  1.00 38.14 ? 286 ARG B C     1 
ATOM   4473 O  O     . ARG B 1 250 ? 64.443  -3.520  34.300  1.00 41.62 ? 286 ARG B O     1 
ATOM   4474 C  CB    . ARG B 1 250 ? 64.356  -0.892  32.574  1.00 42.55 ? 286 ARG B CB    1 
ATOM   4475 C  CG    . ARG B 1 250 ? 64.409  -0.965  31.068  1.00 46.06 ? 286 ARG B CG    1 
ATOM   4476 C  CD    . ARG B 1 250 ? 64.284  0.408   30.424  1.00 56.52 ? 286 ARG B CD    1 
ATOM   4477 N  NE    . ARG B 1 250 ? 65.540  0.825   29.806  1.00 62.06 ? 286 ARG B NE    1 
ATOM   4478 C  CZ    . ARG B 1 250 ? 66.031  0.304   28.684  1.00 62.63 ? 286 ARG B CZ    1 
ATOM   4479 N  NH1   . ARG B 1 250 ? 65.378  -0.668  28.056  1.00 61.63 ? 286 ARG B NH1   1 
ATOM   4480 N  NH2   . ARG B 1 250 ? 67.182  0.747   28.193  1.00 57.23 ? 286 ARG B NH2   1 
ATOM   4481 N  N     . GLU B 1 251 ? 63.510  -1.914  35.573  1.00 33.11 ? 287 GLU B N     1 
ATOM   4482 C  CA    . GLU B 1 251 ? 64.094  -2.395  36.821  1.00 36.76 ? 287 GLU B CA    1 
ATOM   4483 C  C     . GLU B 1 251 ? 63.073  -2.882  37.847  1.00 33.40 ? 287 GLU B C     1 
ATOM   4484 O  O     . GLU B 1 251 ? 63.424  -3.640  38.750  1.00 36.75 ? 287 GLU B O     1 
ATOM   4485 C  CB    . GLU B 1 251 ? 64.945  -1.290  37.471  1.00 41.99 ? 287 GLU B CB    1 
ATOM   4486 C  CG    . GLU B 1 251 ? 66.464  -1.526  37.446  1.00 54.61 ? 287 GLU B CG    1 
ATOM   4487 C  CD    . GLU B 1 251 ? 67.130  -1.056  36.155  1.00 55.33 ? 287 GLU B CD    1 
ATOM   4488 O  OE1   . GLU B 1 251 ? 66.452  -1.027  35.106  1.00 56.03 ? 287 GLU B OE1   1 
ATOM   4489 O  OE2   . GLU B 1 251 ? 68.333  -0.707  36.193  1.00 59.19 ? 287 GLU B OE2   1 
ATOM   4490 N  N     . LYS B 1 252 ? 61.826  -2.430  37.752  1.00 31.38 ? 288 LYS B N     1 
ATOM   4491 C  CA    . LYS B 1 252 ? 60.896  -2.673  38.857  1.00 33.49 ? 288 LYS B CA    1 
ATOM   4492 C  C     . LYS B 1 252 ? 59.688  -3.523  38.479  1.00 29.16 ? 288 LYS B C     1 
ATOM   4493 O  O     . LYS B 1 252 ? 59.307  -3.597  37.306  1.00 27.23 ? 288 LYS B O     1 
ATOM   4494 C  CB    . LYS B 1 252 ? 60.427  -1.351  39.476  1.00 35.11 ? 288 LYS B CB    1 
ATOM   4495 C  CG    . LYS B 1 252 ? 61.552  -0.414  39.906  1.00 39.36 ? 288 LYS B CG    1 
ATOM   4496 C  CD    . LYS B 1 252 ? 62.130  -0.831  41.250  1.00 43.23 ? 288 LYS B CD    1 
ATOM   4497 C  CE    . LYS B 1 252 ? 62.599  0.385   42.054  1.00 53.95 ? 288 LYS B CE    1 
ATOM   4498 N  NZ    . LYS B 1 252 ? 61.504  1.013   42.860  1.00 54.48 ? 288 LYS B NZ    1 
ATOM   4499 N  N     . VAL B 1 253 ? 59.086  -4.146  39.497  1.00 29.55 ? 289 VAL B N     1 
ATOM   4500 C  CA    . VAL B 1 253 ? 57.916  -5.011  39.325  1.00 29.99 ? 289 VAL B CA    1 
ATOM   4501 C  C     . VAL B 1 253 ? 56.730  -4.405  40.069  1.00 24.92 ? 289 VAL B C     1 
ATOM   4502 O  O     . VAL B 1 253 ? 56.888  -3.948  41.208  1.00 27.44 ? 289 VAL B O     1 
ATOM   4503 C  CB    . VAL B 1 253 ? 58.192  -6.409  39.902  1.00 29.18 ? 289 VAL B CB    1 
ATOM   4504 C  CG1   . VAL B 1 253 ? 56.930  -7.304  39.860  1.00 29.19 ? 289 VAL B CG1   1 
ATOM   4505 C  CG2   . VAL B 1 253 ? 59.345  -7.065  39.161  1.00 30.79 ? 289 VAL B CG2   1 
ATOM   4506 N  N     . VAL B 1 254 ? 55.557  -4.372  39.436  1.00 23.42 ? 290 VAL B N     1 
ATOM   4507 C  CA    . VAL B 1 254 ? 54.331  -4.009  40.153  1.00 23.35 ? 290 VAL B CA    1 
ATOM   4508 C  C     . VAL B 1 254 ? 53.962  -5.230  40.989  1.00 25.82 ? 290 VAL B C     1 
ATOM   4509 O  O     . VAL B 1 254 ? 53.869  -6.341  40.456  1.00 24.90 ? 290 VAL B O     1 
ATOM   4510 C  CB    . VAL B 1 254 ? 53.199  -3.593  39.174  1.00 24.61 ? 290 VAL B CB    1 
ATOM   4511 C  CG1   . VAL B 1 254 ? 51.831  -3.626  39.846  1.00 25.52 ? 290 VAL B CG1   1 
ATOM   4512 C  CG2   . VAL B 1 254 ? 53.484  -2.200  38.588  1.00 22.13 ? 290 VAL B CG2   1 
ATOM   4513 N  N     . THR B 1 255 ? 53.832  -5.049  42.304  1.00 24.67 ? 291 THR B N     1 
ATOM   4514 C  CA    . THR B 1 255 ? 53.608  -6.181  43.199  1.00 28.64 ? 291 THR B CA    1 
ATOM   4515 C  C     . THR B 1 255 ? 52.692  -5.792  44.349  1.00 24.96 ? 291 THR B C     1 
ATOM   4516 O  O     . THR B 1 255 ? 52.610  -4.617  44.719  1.00 22.54 ? 291 THR B O     1 
ATOM   4517 C  CB    . THR B 1 255 ? 54.934  -6.727  43.795  1.00 27.43 ? 291 THR B CB    1 
ATOM   4518 O  OG1   . THR B 1 255 ? 54.642  -7.793  44.699  1.00 35.25 ? 291 THR B OG1   1 
ATOM   4519 C  CG2   . THR B 1 255 ? 55.662  -5.637  44.564  1.00 29.06 ? 291 THR B CG2   1 
ATOM   4520 N  N     . PHE B 1 256 ? 52.019  -6.792  44.905  1.00 23.52 ? 292 PHE B N     1 
ATOM   4521 C  CA    . PHE B 1 256 ? 51.125  -6.601  46.036  1.00 27.80 ? 292 PHE B CA    1 
ATOM   4522 C  C     . PHE B 1 256 ? 51.603  -7.407  47.240  1.00 30.13 ? 292 PHE B C     1 
ATOM   4523 O  O     . PHE B 1 256 ? 50.863  -7.581  48.209  1.00 28.68 ? 292 PHE B O     1 
ATOM   4524 C  CB    . PHE B 1 256 ? 49.687  -6.982  45.638  1.00 25.91 ? 292 PHE B CB    1 
ATOM   4525 C  CG    . PHE B 1 256 ? 49.176  -6.202  44.453  1.00 24.93 ? 292 PHE B CG    1 
ATOM   4526 C  CD1   . PHE B 1 256 ? 48.612  -4.940  44.624  1.00 23.16 ? 292 PHE B CD1   1 
ATOM   4527 C  CD2   . PHE B 1 256 ? 49.301  -6.712  43.164  1.00 23.37 ? 292 PHE B CD2   1 
ATOM   4528 C  CE1   . PHE B 1 256 ? 48.172  -4.200  43.527  1.00 23.18 ? 292 PHE B CE1   1 
ATOM   4529 C  CE2   . PHE B 1 256 ? 48.858  -5.980  42.061  1.00 29.11 ? 292 PHE B CE2   1 
ATOM   4530 C  CZ    . PHE B 1 256 ? 48.294  -4.722  42.245  1.00 21.54 ? 292 PHE B CZ    1 
ATOM   4531 N  N     . ARG B 1 257 ? 52.852  -7.879  47.184  1.00 29.78 ? 293 ARG B N     1 
ATOM   4532 C  CA    . ARG B 1 257 ? 53.399  -8.739  48.242  1.00 35.82 ? 293 ARG B CA    1 
ATOM   4533 C  C     . ARG B 1 257 ? 54.443  -8.051  49.125  1.00 33.51 ? 293 ARG B C     1 
ATOM   4534 O  O     . ARG B 1 257 ? 55.100  -8.700  49.933  1.00 37.65 ? 293 ARG B O     1 
ATOM   4535 C  CB    . ARG B 1 257 ? 54.026  -10.006 47.645  1.00 32.36 ? 293 ARG B CB    1 
ATOM   4536 C  CG    . ARG B 1 257 ? 53.107  -10.834 46.761  1.00 36.38 ? 293 ARG B CG    1 
ATOM   4537 C  CD    . ARG B 1 257 ? 53.785  -12.147 46.366  1.00 42.77 ? 293 ARG B CD    1 
ATOM   4538 N  NE    . ARG B 1 257 ? 53.510  -13.214 47.327  1.00 49.92 ? 293 ARG B NE    1 
ATOM   4539 C  CZ    . ARG B 1 257 ? 54.442  -13.915 47.962  1.00 49.87 ? 293 ARG B CZ    1 
ATOM   4540 N  NH1   . ARG B 1 257 ? 55.728  -13.673 47.740  1.00 49.49 ? 293 ARG B NH1   1 
ATOM   4541 N  NH2   . ARG B 1 257 ? 54.089  -14.858 48.824  1.00 48.41 ? 293 ARG B NH2   1 
ATOM   4542 N  N     . ARG B 1 258 ? 54.612  -6.748  48.957  1.00 29.71 ? 294 ARG B N     1 
ATOM   4543 C  CA    . ARG B 1 258 ? 55.600  -6.012  49.736  1.00 31.20 ? 294 ARG B CA    1 
ATOM   4544 C  C     . ARG B 1 258 ? 54.949  -4.839  50.463  1.00 33.33 ? 294 ARG B C     1 
ATOM   4545 O  O     . ARG B 1 258 ? 54.155  -4.099  49.871  1.00 27.66 ? 294 ARG B O     1 
ATOM   4546 C  CB    . ARG B 1 258 ? 56.712  -5.495  48.825  1.00 34.21 ? 294 ARG B CB    1 
ATOM   4547 C  CG    . ARG B 1 258 ? 57.598  -6.571  48.211  1.00 36.67 ? 294 ARG B CG    1 
ATOM   4548 C  CD    . ARG B 1 258 ? 58.501  -7.203  49.259  1.00 42.93 ? 294 ARG B CD    1 
ATOM   4549 N  NE    . ARG B 1 258 ? 59.772  -7.646  48.683  1.00 50.87 ? 294 ARG B NE    1 
ATOM   4550 C  CZ    . ARG B 1 258 ? 60.124  -8.918  48.504  1.00 53.95 ? 294 ARG B CZ    1 
ATOM   4551 N  NH1   . ARG B 1 258 ? 59.303  -9.900  48.863  1.00 55.89 ? 294 ARG B NH1   1 
ATOM   4552 N  NH2   . ARG B 1 258 ? 61.307  -9.205  47.968  1.00 53.11 ? 294 ARG B NH2   1 
ATOM   4553 N  N     . PRO B 1 259 ? 55.302  -4.658  51.747  1.00 35.21 ? 295 PRO B N     1 
ATOM   4554 C  CA    . PRO B 1 259 ? 54.778  -3.568  52.584  1.00 37.88 ? 295 PRO B CA    1 
ATOM   4555 C  C     . PRO B 1 259 ? 54.943  -2.199  51.922  1.00 33.93 ? 295 PRO B C     1 
ATOM   4556 O  O     . PRO B 1 259 ? 54.043  -1.359  52.035  1.00 37.56 ? 295 PRO B O     1 
ATOM   4557 C  CB    . PRO B 1 259 ? 55.642  -3.654  53.851  1.00 37.70 ? 295 PRO B CB    1 
ATOM   4558 C  CG    . PRO B 1 259 ? 56.102  -5.083  53.903  1.00 43.08 ? 295 PRO B CG    1 
ATOM   4559 C  CD    . PRO B 1 259 ? 56.287  -5.491  52.463  1.00 36.51 ? 295 PRO B CD    1 
ATOM   4560 N  N     . ASP B 1 260 ? 56.057  -1.988  51.226  1.00 35.36 ? 296 ASP B N     1 
ATOM   4561 C  CA    . ASP B 1 260 ? 56.335  -0.702  50.573  1.00 39.26 ? 296 ASP B CA    1 
ATOM   4562 C  C     . ASP B 1 260 ? 56.116  -0.728  49.058  1.00 37.93 ? 296 ASP B C     1 
ATOM   4563 O  O     . ASP B 1 260 ? 56.317  0.282   48.382  1.00 35.65 ? 296 ASP B O     1 
ATOM   4564 C  CB    . ASP B 1 260 ? 57.772  -0.248  50.852  1.00 45.45 ? 296 ASP B CB    1 
ATOM   4565 C  CG    . ASP B 1 260 ? 58.803  -1.310  50.501  1.00 44.00 ? 296 ASP B CG    1 
ATOM   4566 O  OD1   . ASP B 1 260 ? 58.430  -2.360  49.932  1.00 41.33 ? 296 ASP B OD1   1 
ATOM   4567 O  OD2   . ASP B 1 260 ? 59.999  -1.093  50.797  1.00 52.34 ? 296 ASP B OD2   1 
ATOM   4568 N  N     . GLY B 1 261 ? 55.720  -1.882  48.531  1.00 32.03 ? 297 GLY B N     1 
ATOM   4569 C  CA    . GLY B 1 261 ? 55.491  -2.034  47.104  1.00 32.05 ? 297 GLY B CA    1 
ATOM   4570 C  C     . GLY B 1 261 ? 56.759  -2.031  46.266  1.00 33.38 ? 297 GLY B C     1 
ATOM   4571 O  O     . GLY B 1 261 ? 56.690  -1.902  45.039  1.00 28.61 ? 297 GLY B O     1 
ATOM   4572 N  N     . TYR B 1 262 ? 57.907  -2.190  46.928  1.00 32.18 ? 298 TYR B N     1 
ATOM   4573 C  CA    . TYR B 1 262 ? 59.212  -2.191  46.267  1.00 34.03 ? 298 TYR B CA    1 
ATOM   4574 C  C     . TYR B 1 262 ? 59.686  -3.614  45.982  1.00 36.02 ? 298 TYR B C     1 
ATOM   4575 O  O     . TYR B 1 262 ? 59.807  -4.434  46.893  1.00 38.70 ? 298 TYR B O     1 
ATOM   4576 C  CB    . TYR B 1 262 ? 60.253  -1.461  47.130  1.00 41.31 ? 298 TYR B CB    1 
ATOM   4577 C  CG    . TYR B 1 262 ? 61.643  -1.400  46.516  1.00 46.49 ? 298 TYR B CG    1 
ATOM   4578 C  CD1   . TYR B 1 262 ? 62.068  -0.278  45.814  1.00 46.72 ? 298 TYR B CD1   1 
ATOM   4579 C  CD2   . TYR B 1 262 ? 62.535  -2.466  46.649  1.00 49.86 ? 298 TYR B CD2   1 
ATOM   4580 C  CE1   . TYR B 1 262 ? 63.340  -0.220  45.258  1.00 48.47 ? 298 TYR B CE1   1 
ATOM   4581 C  CE2   . TYR B 1 262 ? 63.799  -2.420  46.090  1.00 50.56 ? 298 TYR B CE2   1 
ATOM   4582 C  CZ    . TYR B 1 262 ? 64.194  -1.299  45.396  1.00 49.03 ? 298 TYR B CZ    1 
ATOM   4583 O  OH    . TYR B 1 262 ? 65.458  -1.267  44.850  1.00 58.52 ? 298 TYR B OH    1 
ATOM   4584 N  N     . LEU B 1 263 ? 59.962  -3.895  44.712  1.00 32.59 ? 299 LEU B N     1 
ATOM   4585 C  CA    . LEU B 1 263 ? 60.435  -5.211  44.279  1.00 33.27 ? 299 LEU B CA    1 
ATOM   4586 C  C     . LEU B 1 263 ? 61.131  -5.030  42.936  1.00 34.29 ? 299 LEU B C     1 
ATOM   4587 O  O     . LEU B 1 263 ? 60.550  -4.469  42.002  1.00 29.24 ? 299 LEU B O     1 
ATOM   4588 C  CB    . LEU B 1 263 ? 59.256  -6.177  44.110  1.00 35.82 ? 299 LEU B CB    1 
ATOM   4589 C  CG    . LEU B 1 263 ? 59.410  -7.708  44.185  1.00 36.88 ? 299 LEU B CG    1 
ATOM   4590 C  CD1   . LEU B 1 263 ? 58.703  -8.394  43.032  1.00 37.43 ? 299 LEU B CD1   1 
ATOM   4591 C  CD2   . LEU B 1 263 ? 60.846  -8.148  44.252  1.00 37.80 ? 299 LEU B CD2   1 
ATOM   4592 N  N     . THR B 1 264 ? 62.373  -5.499  42.834  1.00 36.63 ? 300 THR B N     1 
ATOM   4593 C  CA    . THR B 1 264 ? 63.118  -5.398  41.581  1.00 34.97 ? 300 THR B CA    1 
ATOM   4594 C  C     . THR B 1 264 ? 62.957  -6.659  40.749  1.00 35.54 ? 300 THR B C     1 
ATOM   4595 O  O     . THR B 1 264 ? 62.686  -7.740  41.281  1.00 34.72 ? 300 THR B O     1 
ATOM   4596 C  CB    . THR B 1 264 ? 64.623  -5.170  41.814  1.00 36.93 ? 300 THR B CB    1 
ATOM   4597 O  OG1   . THR B 1 264 ? 65.159  -6.267  42.560  1.00 41.05 ? 300 THR B OG1   1 
ATOM   4598 C  CG2   . THR B 1 264 ? 64.868  -3.878  42.576  1.00 42.22 ? 300 THR B CG2   1 
ATOM   4599 N  N     . LYS B 1 265 ? 63.140  -6.521  39.442  1.00 34.59 ? 301 LYS B N     1 
ATOM   4600 C  CA    . LYS B 1 265 ? 63.088  -7.675  38.560  1.00 37.66 ? 301 LYS B CA    1 
ATOM   4601 C  C     . LYS B 1 265 ? 64.160  -8.688  38.942  1.00 41.71 ? 301 LYS B C     1 
ATOM   4602 O  O     . LYS B 1 265 ? 63.986  -9.884  38.722  1.00 40.02 ? 301 LYS B O     1 
ATOM   4603 C  CB    . LYS B 1 265 ? 63.255  -7.253  37.109  1.00 29.47 ? 301 LYS B CB    1 
ATOM   4604 C  CG    . LYS B 1 265 ? 62.076  -6.535  36.513  1.00 32.39 ? 301 LYS B CG    1 
ATOM   4605 C  CD    . LYS B 1 265 ? 62.488  -5.915  35.192  1.00 34.75 ? 301 LYS B CD    1 
ATOM   4606 C  CE    . LYS B 1 265 ? 61.325  -5.834  34.250  1.00 39.75 ? 301 LYS B CE    1 
ATOM   4607 N  NZ    . LYS B 1 265 ? 61.702  -5.185  32.958  1.00 38.52 ? 301 LYS B NZ    1 
ATOM   4608 N  N     . GLN B 1 266 ? 65.255  -8.203  39.527  1.00 41.07 ? 302 GLN B N     1 
ATOM   4609 C  CA    . GLN B 1 266 ? 66.363  -9.066  39.960  1.00 47.28 ? 302 GLN B CA    1 
ATOM   4610 C  C     . GLN B 1 266 ? 66.000  -9.971  41.141  1.00 47.99 ? 302 GLN B C     1 
ATOM   4611 O  O     . GLN B 1 266 ? 66.241  -11.181 41.089  1.00 51.77 ? 302 GLN B O     1 
ATOM   4612 C  CB    . GLN B 1 266 ? 67.607  -8.233  40.293  1.00 48.84 ? 302 GLN B CB    1 
ATOM   4613 C  CG    . GLN B 1 266 ? 68.354  -7.713  39.073  1.00 59.35 ? 302 GLN B CG    1 
ATOM   4614 C  CD    . GLN B 1 266 ? 69.273  -8.761  38.459  1.00 62.92 ? 302 GLN B CD    1 
ATOM   4615 O  OE1   . GLN B 1 266 ? 69.892  -9.558  39.171  1.00 61.65 ? 302 GLN B OE1   1 
ATOM   4616 N  NE2   . GLN B 1 266 ? 69.363  -8.766  37.132  1.00 59.44 ? 302 GLN B NE2   1 
ATOM   4617 N  N     . GLU B 1 267 ? 65.430  -9.394  42.199  1.00 44.33 ? 303 GLU B N     1 
ATOM   4618 C  CA    . GLU B 1 267 ? 64.954  -10.185 43.342  1.00 46.62 ? 303 GLU B CA    1 
ATOM   4619 C  C     . GLU B 1 267 ? 63.943  -11.219 42.881  1.00 47.20 ? 303 GLU B C     1 
ATOM   4620 O  O     . GLU B 1 267 ? 63.839  -12.303 43.448  1.00 49.13 ? 303 GLU B O     1 
ATOM   4621 C  CB    . GLU B 1 267 ? 64.267  -9.303  44.383  1.00 50.29 ? 303 GLU B CB    1 
ATOM   4622 C  CG    . GLU B 1 267 ? 65.100  -8.194  44.990  1.00 51.99 ? 303 GLU B CG    1 
ATOM   4623 C  CD    . GLU B 1 267 ? 64.270  -7.294  45.898  1.00 55.77 ? 303 GLU B CD    1 
ATOM   4624 O  OE1   . GLU B 1 267 ? 64.196  -6.069  45.624  1.00 53.19 ? 303 GLU B OE1   1 
ATOM   4625 O  OE2   . GLU B 1 267 ? 63.692  -7.817  46.882  1.00 55.27 ? 303 GLU B OE2   1 
ATOM   4626 N  N     . LYS B 1 268 ? 63.192  -10.864 41.846  1.00 44.39 ? 304 LYS B N     1 
ATOM   4627 C  CA    . LYS B 1 268 ? 62.103  -11.695 41.359  1.00 47.96 ? 304 LYS B CA    1 
ATOM   4628 C  C     . LYS B 1 268 ? 62.608  -12.773 40.402  1.00 46.51 ? 304 LYS B C     1 
ATOM   4629 O  O     . LYS B 1 268 ? 62.023  -13.854 40.306  1.00 49.70 ? 304 LYS B O     1 
ATOM   4630 C  CB    . LYS B 1 268 ? 61.043  -10.811 40.683  1.00 42.34 ? 304 LYS B CB    1 
ATOM   4631 C  CG    . LYS B 1 268 ? 59.799  -11.542 40.193  1.00 39.91 ? 304 LYS B CG    1 
ATOM   4632 C  CD    . LYS B 1 268 ? 58.968  -12.115 41.333  1.00 36.36 ? 304 LYS B CD    1 
ATOM   4633 C  CE    . LYS B 1 268 ? 57.908  -13.049 40.773  1.00 33.66 ? 304 LYS B CE    1 
ATOM   4634 N  NZ    . LYS B 1 268 ? 57.038  -13.610 41.831  1.00 34.97 ? 304 LYS B NZ    1 
ATOM   4635 N  N     . GLY B 1 269 ? 63.704  -12.484 39.707  1.00 47.21 ? 305 GLY B N     1 
ATOM   4636 C  CA    . GLY B 1 269 ? 64.231  -13.406 38.712  1.00 48.48 ? 305 GLY B CA    1 
ATOM   4637 C  C     . GLY B 1 269 ? 63.498  -13.265 37.394  1.00 47.81 ? 305 GLY B C     1 
ATOM   4638 O  O     . GLY B 1 269 ? 63.383  -14.221 36.626  1.00 47.35 ? 305 GLY B O     1 
ATOM   4639 N  N     . TRP B 1 270 ? 63.002  -12.056 37.141  1.00 45.39 ? 306 TRP B N     1 
ATOM   4640 C  CA    . TRP B 1 270 ? 62.229  -11.754 35.942  1.00 43.92 ? 306 TRP B CA    1 
ATOM   4641 C  C     . TRP B 1 270 ? 62.967  -10.750 35.055  1.00 45.89 ? 306 TRP B C     1 
ATOM   4642 O  O     . TRP B 1 270 ? 62.547  -9.604  34.915  1.00 44.14 ? 306 TRP B O     1 
ATOM   4643 C  CB    . TRP B 1 270 ? 60.870  -11.178 36.341  1.00 39.52 ? 306 TRP B CB    1 
ATOM   4644 C  CG    . TRP B 1 270 ? 59.832  -12.210 36.706  1.00 39.50 ? 306 TRP B CG    1 
ATOM   4645 C  CD1   . TRP B 1 270 ? 60.008  -13.565 36.800  1.00 37.32 ? 306 TRP B CD1   1 
ATOM   4646 C  CD2   . TRP B 1 270 ? 58.450  -11.962 37.007  1.00 34.55 ? 306 TRP B CD2   1 
ATOM   4647 N  NE1   . TRP B 1 270 ? 58.821  -14.169 37.145  1.00 41.63 ? 306 TRP B NE1   1 
ATOM   4648 C  CE2   . TRP B 1 270 ? 57.851  -13.207 37.280  1.00 38.03 ? 306 TRP B CE2   1 
ATOM   4649 C  CE3   . TRP B 1 270 ? 57.666  -10.805 37.073  1.00 36.71 ? 306 TRP B CE3   1 
ATOM   4650 C  CZ2   . TRP B 1 270 ? 56.496  -13.330 37.610  1.00 35.45 ? 306 TRP B CZ2   1 
ATOM   4651 C  CZ3   . TRP B 1 270 ? 56.331  -10.922 37.408  1.00 31.08 ? 306 TRP B CZ3   1 
ATOM   4652 C  CH2   . TRP B 1 270 ? 55.756  -12.180 37.675  1.00 31.89 ? 306 TRP B CH2   1 
ATOM   4653 N  N     . THR B 1 271 ? 64.067  -11.184 34.456  1.00 50.26 ? 307 THR B N     1 
ATOM   4654 C  CA    . THR B 1 271 ? 64.890  -10.298 33.643  1.00 54.86 ? 307 THR B CA    1 
ATOM   4655 C  C     . THR B 1 271 ? 64.785  -10.716 32.182  1.00 58.61 ? 307 THR B C     1 
ATOM   4656 O  O     . THR B 1 271 ? 64.215  -10.006 31.348  1.00 62.50 ? 307 THR B O     1 
ATOM   4657 C  CB    . THR B 1 271 ? 66.352  -10.389 34.073  1.00 54.66 ? 307 THR B CB    1 
ATOM   4658 O  OG1   . THR B 1 271 ? 66.820  -11.721 33.842  1.00 57.87 ? 307 THR B OG1   1 
ATOM   4659 C  CG2   . THR B 1 271 ? 66.491  -10.075 35.559  1.00 52.26 ? 307 THR B CG2   1 
ATOM   4660 N  N     . SER B 1 272 ? 65.342  -11.887 31.891  1.00 62.38 ? 308 SER B N     1 
ATOM   4661 C  CA    . SER B 1 272 ? 65.328  -12.460 30.550  1.00 62.42 ? 308 SER B CA    1 
ATOM   4662 C  C     . SER B 1 272 ? 63.986  -13.127 30.265  1.00 59.62 ? 308 SER B C     1 
ATOM   4663 O  O     . SER B 1 272 ? 63.299  -13.583 31.185  1.00 59.00 ? 308 SER B O     1 
ATOM   4664 C  CB    . SER B 1 272 ? 66.449  -13.494 30.404  1.00 63.09 ? 308 SER B CB    1 
ATOM   4665 O  OG    . SER B 1 272 ? 66.204  -14.630 31.222  1.00 62.30 ? 308 SER B OG    1 
ATOM   4666 N  N     . ALA B 1 273 ? 63.628  -13.191 28.985  1.00 59.70 ? 309 ALA B N     1 
ATOM   4667 C  CA    . ALA B 1 273 ? 62.355  -13.764 28.552  1.00 57.14 ? 309 ALA B CA    1 
ATOM   4668 C  C     . ALA B 1 273 ? 62.225  -15.236 28.944  1.00 60.41 ? 309 ALA B C     1 
ATOM   4669 O  O     . ALA B 1 273 ? 63.228  -15.895 29.214  1.00 62.17 ? 309 ALA B O     1 
ATOM   4670 C  CB    . ALA B 1 273 ? 62.185  -13.595 27.047  1.00 53.89 ? 309 ALA B CB    1 
ATOM   4671 N  N     . THR B 1 274 ? 60.983  -15.725 28.939  1.00 57.22 ? 310 THR B N     1 
ATOM   4672 C  CA    . THR B 1 274 ? 60.582  -17.067 29.404  1.00 58.71 ? 310 THR B CA    1 
ATOM   4673 C  C     . THR B 1 274 ? 61.602  -17.860 30.229  1.00 61.29 ? 310 THR B C     1 
ATOM   4674 O  O     . THR B 1 274 ? 61.882  -17.518 31.379  1.00 60.55 ? 310 THR B O     1 
ATOM   4675 C  CB    . THR B 1 274 ? 60.046  -17.947 28.247  1.00 55.64 ? 310 THR B CB    1 
ATOM   4676 O  OG1   . THR B 1 274 ? 59.581  -17.113 27.177  1.00 55.10 ? 310 THR B OG1   1 
ATOM   4677 C  CG2   . THR B 1 274 ? 58.899  -18.831 28.736  1.00 56.31 ? 310 THR B CG2   1 
ATOM   4678 N  N     . ASP B 1 286 ? 55.811  -15.362 29.057  1.00 53.09 ? 322 ASP B N     1 
ATOM   4679 C  CA    . ASP B 1 286 ? 57.000  -15.301 28.216  1.00 49.42 ? 322 ASP B CA    1 
ATOM   4680 C  C     . ASP B 1 286 ? 57.894  -14.102 28.560  1.00 46.45 ? 322 ASP B C     1 
ATOM   4681 O  O     . ASP B 1 286 ? 58.976  -14.276 29.125  1.00 48.14 ? 322 ASP B O     1 
ATOM   4682 C  CB    . ASP B 1 286 ? 56.627  -15.297 26.722  1.00 51.73 ? 322 ASP B CB    1 
ATOM   4683 C  CG    . ASP B 1 286 ? 56.286  -16.688 26.187  1.00 63.16 ? 322 ASP B CG    1 
ATOM   4684 O  OD1   . ASP B 1 286 ? 56.706  -17.017 25.050  1.00 65.09 ? 322 ASP B OD1   1 
ATOM   4685 O  OD2   . ASP B 1 286 ? 55.594  -17.448 26.898  1.00 66.03 ? 322 ASP B OD2   1 
ATOM   4686 N  N     . ARG B 1 287 ? 57.450  -12.890 28.234  1.00 39.60 ? 323 ARG B N     1 
ATOM   4687 C  CA    . ARG B 1 287 ? 58.321  -11.716 28.397  1.00 40.55 ? 323 ARG B CA    1 
ATOM   4688 C  C     . ARG B 1 287 ? 58.158  -10.985 29.726  1.00 39.39 ? 323 ARG B C     1 
ATOM   4689 O  O     . ARG B 1 287 ? 57.156  -11.148 30.428  1.00 36.42 ? 323 ARG B O     1 
ATOM   4690 C  CB    . ARG B 1 287 ? 58.123  -10.714 27.260  1.00 41.04 ? 323 ARG B CB    1 
ATOM   4691 C  CG    . ARG B 1 287 ? 57.590  -11.308 25.973  1.00 45.04 ? 323 ARG B CG    1 
ATOM   4692 C  CD    . ARG B 1 287 ? 56.627  -10.320 25.327  1.00 45.86 ? 323 ARG B CD    1 
ATOM   4693 N  NE    . ARG B 1 287 ? 56.199  -10.715 23.988  1.00 51.39 ? 323 ARG B NE    1 
ATOM   4694 C  CZ    . ARG B 1 287 ? 56.907  -10.478 22.887  1.00 55.12 ? 323 ARG B CZ    1 
ATOM   4695 N  NH1   . ARG B 1 287 ? 58.083  -9.868  22.975  1.00 56.19 ? 323 ARG B NH1   1 
ATOM   4696 N  NH2   . ARG B 1 287 ? 56.450  -10.858 21.700  1.00 59.43 ? 323 ARG B NH2   1 
ATOM   4697 N  N     . TYR B 1 288 ? 59.154  -10.165 30.048  1.00 33.93 ? 324 TYR B N     1 
ATOM   4698 C  CA    . TYR B 1 288 ? 59.161  -9.392  31.281  1.00 33.75 ? 324 TYR B CA    1 
ATOM   4699 C  C     . TYR B 1 288 ? 59.592  -7.946  31.025  1.00 31.51 ? 324 TYR B C     1 
ATOM   4700 O  O     . TYR B 1 288 ? 60.255  -7.335  31.863  1.00 33.34 ? 324 TYR B O     1 
ATOM   4701 C  CB    . TYR B 1 288 ? 60.092  -10.049 32.296  1.00 38.48 ? 324 TYR B CB    1 
ATOM   4702 C  CG    . TYR B 1 288 ? 59.784  -11.506 32.557  1.00 41.15 ? 324 TYR B CG    1 
ATOM   4703 C  CD1   . TYR B 1 288 ? 58.848  -11.879 33.515  1.00 38.21 ? 324 TYR B CD1   1 
ATOM   4704 C  CD2   . TYR B 1 288 ? 60.427  -12.509 31.841  1.00 41.68 ? 324 TYR B CD2   1 
ATOM   4705 C  CE1   . TYR B 1 288 ? 58.562  -13.220 33.757  1.00 37.37 ? 324 TYR B CE1   1 
ATOM   4706 C  CE2   . TYR B 1 288 ? 60.152  -13.843 32.073  1.00 47.69 ? 324 TYR B CE2   1 
ATOM   4707 C  CZ    . TYR B 1 288 ? 59.220  -14.193 33.033  1.00 47.52 ? 324 TYR B CZ    1 
ATOM   4708 O  OH    . TYR B 1 288 ? 58.949  -15.521 33.264  1.00 50.43 ? 324 TYR B OH    1 
ATOM   4709 N  N     . ILE B 1 289 ? 59.222  -7.423  29.856  1.00 32.15 ? 325 ILE B N     1 
ATOM   4710 C  CA    . ILE B 1 289 ? 59.452  -6.015  29.498  1.00 33.45 ? 325 ILE B CA    1 
ATOM   4711 C  C     . ILE B 1 289 ? 58.706  -5.129  30.494  1.00 30.18 ? 325 ILE B C     1 
ATOM   4712 O  O     . ILE B 1 289 ? 59.239  -4.141  31.020  1.00 30.22 ? 325 ILE B O     1 
ATOM   4713 C  CB    . ILE B 1 289 ? 58.917  -5.697  28.084  1.00 30.98 ? 325 ILE B CB    1 
ATOM   4714 C  CG1   . ILE B 1 289 ? 59.511  -6.647  27.037  1.00 38.69 ? 325 ILE B CG1   1 
ATOM   4715 C  CG2   . ILE B 1 289 ? 59.214  -4.259  27.715  1.00 32.40 ? 325 ILE B CG2   1 
ATOM   4716 C  CD1   . ILE B 1 289 ? 61.014  -6.507  26.865  1.00 36.69 ? 325 ILE B CD1   1 
ATOM   4717 N  N     . LEU B 1 290 ? 57.451  -5.488  30.728  1.00 28.67 ? 326 LEU B N     1 
ATOM   4718 C  CA    . LEU B 1 290 ? 56.651  -4.851  31.775  1.00 31.00 ? 326 LEU B CA    1 
ATOM   4719 C  C     . LEU B 1 290 ? 56.288  -5.925  32.787  1.00 28.91 ? 326 LEU B C     1 
ATOM   4720 O  O     . LEU B 1 290 ? 55.607  -6.893  32.450  1.00 27.01 ? 326 LEU B O     1 
ATOM   4721 C  CB    . LEU B 1 290 ? 55.385  -4.227  31.182  1.00 25.78 ? 326 LEU B CB    1 
ATOM   4722 C  CG    . LEU B 1 290 ? 54.357  -3.602  32.129  1.00 25.73 ? 326 LEU B CG    1 
ATOM   4723 C  CD1   . LEU B 1 290 ? 54.986  -2.483  32.960  1.00 28.02 ? 326 LEU B CD1   1 
ATOM   4724 C  CD2   . LEU B 1 290 ? 53.183  -3.062  31.327  1.00 30.49 ? 326 LEU B CD2   1 
ATOM   4725 N  N     . ALA B 1 291 ? 56.769  -5.772  34.016  1.00 29.47 ? 327 ALA B N     1 
ATOM   4726 C  CA    . ALA B 1 291 ? 56.561  -6.787  35.040  1.00 29.66 ? 327 ALA B CA    1 
ATOM   4727 C  C     . ALA B 1 291 ? 55.439  -6.390  35.998  1.00 29.61 ? 327 ALA B C     1 
ATOM   4728 O  O     . ALA B 1 291 ? 55.567  -5.401  36.730  1.00 24.71 ? 327 ALA B O     1 
ATOM   4729 C  CB    . ALA B 1 291 ? 57.842  -7.033  35.808  1.00 26.87 ? 327 ALA B CB    1 
ATOM   4730 N  N     . ILE B 1 292 ? 54.362  -7.179  35.991  1.00 24.31 ? 328 ILE B N     1 
ATOM   4731 C  CA    . ILE B 1 292 ? 53.230  -6.996  36.903  1.00 25.94 ? 328 ILE B CA    1 
ATOM   4732 C  C     . ILE B 1 292 ? 52.918  -8.353  37.534  1.00 26.28 ? 328 ILE B C     1 
ATOM   4733 O  O     . ILE B 1 292 ? 52.391  -9.256  36.880  1.00 25.65 ? 328 ILE B O     1 
ATOM   4734 C  CB    . ILE B 1 292 ? 51.981  -6.449  36.168  1.00 26.11 ? 328 ILE B CB    1 
ATOM   4735 C  CG1   . ILE B 1 292 ? 52.288  -5.108  35.499  1.00 23.55 ? 328 ILE B CG1   1 
ATOM   4736 C  CG2   . ILE B 1 292 ? 50.782  -6.287  37.122  1.00 24.26 ? 328 ILE B CG2   1 
ATOM   4737 C  CD1   . ILE B 1 292 ? 51.172  -4.600  34.604  1.00 23.49 ? 328 ILE B CD1   1 
ATOM   4738 N  N     . GLU B 1 293 ? 53.283  -8.505  38.797  1.00 23.96 ? 329 GLU B N     1 
ATOM   4739 C  CA    . GLU B 1 293 ? 53.102  -9.770  39.492  1.00 26.10 ? 329 GLU B CA    1 
ATOM   4740 C  C     . GLU B 1 293 ? 51.620  -9.940  39.846  1.00 28.58 ? 329 GLU B C     1 
ATOM   4741 O  O     . GLU B 1 293 ? 51.036  -9.070  40.504  1.00 30.55 ? 329 GLU B O     1 
ATOM   4742 C  CB    . GLU B 1 293 ? 53.958  -9.764  40.759  1.00 28.69 ? 329 GLU B CB    1 
ATOM   4743 C  CG    . GLU B 1 293 ? 54.013  -11.084 41.528  1.00 31.29 ? 329 GLU B CG    1 
ATOM   4744 C  CD    . GLU B 1 293 ? 54.817  -10.950 42.805  1.00 33.25 ? 329 GLU B CD    1 
ATOM   4745 O  OE1   . GLU B 1 293 ? 55.843  -11.646 42.937  1.00 35.02 ? 329 GLU B OE1   1 
ATOM   4746 O  OE2   . GLU B 1 293 ? 54.424  -10.135 43.671  1.00 37.94 ? 329 GLU B OE2   1 
ATOM   4747 N  N     . ASP B 1 294 ? 50.997  -11.019 39.378  1.00 25.36 ? 330 ASP B N     1 
ATOM   4748 C  CA    . ASP B 1 294 ? 49.626  -11.320 39.783  1.00 26.93 ? 330 ASP B CA    1 
ATOM   4749 C  C     . ASP B 1 294 ? 49.654  -11.479 41.291  1.00 29.18 ? 330 ASP B C     1 
ATOM   4750 O  O     . ASP B 1 294 ? 50.560  -12.116 41.832  1.00 26.40 ? 330 ASP B O     1 
ATOM   4751 C  CB    . ASP B 1 294 ? 49.108  -12.610 39.138  1.00 30.75 ? 330 ASP B CB    1 
ATOM   4752 C  CG    . ASP B 1 294 ? 47.619  -12.838 39.394  1.00 33.44 ? 330 ASP B CG    1 
ATOM   4753 O  OD1   . ASP B 1 294 ? 46.806  -12.392 38.553  1.00 35.06 ? 330 ASP B OD1   1 
ATOM   4754 O  OD2   . ASP B 1 294 ? 47.247  -13.445 40.440  1.00 32.41 ? 330 ASP B OD2   1 
ATOM   4755 N  N     . PRO B 1 295 ? 48.675  -10.889 41.976  1.00 25.99 ? 331 PRO B N     1 
ATOM   4756 C  CA    . PRO B 1 295 ? 48.700  -10.872 43.442  1.00 27.50 ? 331 PRO B CA    1 
ATOM   4757 C  C     . PRO B 1 295 ? 48.653  -12.256 44.087  1.00 27.80 ? 331 PRO B C     1 
ATOM   4758 O  O     . PRO B 1 295 ? 49.158  -12.384 45.196  1.00 27.78 ? 331 PRO B O     1 
ATOM   4759 C  CB    . PRO B 1 295 ? 47.448  -10.062 43.811  1.00 25.49 ? 331 PRO B CB    1 
ATOM   4760 C  CG    . PRO B 1 295 ? 46.611  -10.000 42.543  1.00 29.48 ? 331 PRO B CG    1 
ATOM   4761 C  CD    . PRO B 1 295 ? 47.594  -10.056 41.421  1.00 30.06 ? 331 PRO B CD    1 
ATOM   4762 N  N     . PHE B 1 296 ? 48.073  -13.248 43.408  1.00 25.40 ? 332 PHE B N     1 
ATOM   4763 C  CA    . PHE B 1 296 ? 47.938  -14.607 43.946  1.00 28.48 ? 332 PHE B CA    1 
ATOM   4764 C  C     . PHE B 1 296 ? 48.812  -15.612 43.194  1.00 30.83 ? 332 PHE B C     1 
ATOM   4765 O  O     . PHE B 1 296 ? 49.600  -16.340 43.798  1.00 26.16 ? 332 PHE B O     1 
ATOM   4766 C  CB    . PHE B 1 296 ? 46.467  -15.056 43.905  1.00 27.43 ? 332 PHE B CB    1 
ATOM   4767 C  CG    . PHE B 1 296 ? 45.545  -14.197 44.736  1.00 23.46 ? 332 PHE B CG    1 
ATOM   4768 C  CD1   . PHE B 1 296 ? 45.957  -13.700 45.970  1.00 26.56 ? 332 PHE B CD1   1 
ATOM   4769 C  CD2   . PHE B 1 296 ? 44.270  -13.881 44.277  1.00 25.19 ? 332 PHE B CD2   1 
ATOM   4770 C  CE1   . PHE B 1 296 ? 45.102  -12.893 46.740  1.00 25.03 ? 332 PHE B CE1   1 
ATOM   4771 C  CE2   . PHE B 1 296 ? 43.417  -13.092 45.032  1.00 25.04 ? 332 PHE B CE2   1 
ATOM   4772 C  CZ    . PHE B 1 296 ? 43.832  -12.589 46.259  1.00 21.58 ? 332 PHE B CZ    1 
ATOM   4773 N  N     . GLU B 1 297 ? 48.660  -15.661 41.876  1.00 27.24 ? 333 GLU B N     1 
ATOM   4774 C  CA    . GLU B 1 297 ? 49.458  -16.583 41.071  1.00 30.52 ? 333 GLU B CA    1 
ATOM   4775 C  C     . GLU B 1 297 ? 50.765  -15.874 40.737  1.00 28.90 ? 333 GLU B C     1 
ATOM   4776 O  O     . GLU B 1 297 ? 50.921  -15.307 39.651  1.00 30.75 ? 333 GLU B O     1 
ATOM   4777 C  CB    . GLU B 1 297 ? 48.714  -16.994 39.793  1.00 31.94 ? 333 GLU B CB    1 
ATOM   4778 C  CG    . GLU B 1 297 ? 49.448  -18.089 39.003  1.00 38.11 ? 333 GLU B CG    1 
ATOM   4779 C  CD    . GLU B 1 297 ? 48.773  -18.460 37.692  1.00 40.94 ? 333 GLU B CD    1 
ATOM   4780 O  OE1   . GLU B 1 297 ? 49.360  -19.272 36.943  1.00 48.48 ? 333 GLU B OE1   1 
ATOM   4781 O  OE2   . GLU B 1 297 ? 47.670  -17.947 37.413  1.00 43.37 ? 333 GLU B OE2   1 
ATOM   4782 N  N     . ILE B 1 298 ? 51.698  -15.910 41.683  1.00 29.15 ? 334 ILE B N     1 
ATOM   4783 C  CA    . ILE B 1 298 ? 52.822  -14.982 41.692  1.00 33.68 ? 334 ILE B CA    1 
ATOM   4784 C  C     . ILE B 1 298 ? 53.889  -15.297 40.653  1.00 34.48 ? 334 ILE B C     1 
ATOM   4785 O  O     . ILE B 1 298 ? 54.740  -14.468 40.371  1.00 30.85 ? 334 ILE B O     1 
ATOM   4786 C  CB    . ILE B 1 298 ? 53.446  -14.886 43.094  1.00 32.95 ? 334 ILE B CB    1 
ATOM   4787 C  CG1   . ILE B 1 298 ? 53.998  -16.246 43.530  1.00 35.25 ? 334 ILE B CG1   1 
ATOM   4788 C  CG2   . ILE B 1 298 ? 52.419  -14.343 44.087  1.00 33.61 ? 334 ILE B CG2   1 
ATOM   4789 C  CD1   . ILE B 1 298 ? 54.327  -16.320 45.003  1.00 42.18 ? 334 ILE B CD1   1 
ATOM   4790 N  N     . SER B 1 299 ? 53.827  -16.490 40.076  1.00 33.93 ? 335 SER B N     1 
ATOM   4791 C  CA    . SER B 1 299 ? 54.738  -16.867 39.003  1.00 32.67 ? 335 SER B CA    1 
ATOM   4792 C  C     . SER B 1 299 ? 54.253  -16.330 37.655  1.00 36.29 ? 335 SER B C     1 
ATOM   4793 O  O     . SER B 1 299 ? 54.945  -16.449 36.641  1.00 35.30 ? 335 SER B O     1 
ATOM   4794 C  CB    . SER B 1 299 ? 54.850  -18.389 38.936  1.00 36.84 ? 335 SER B CB    1 
ATOM   4795 O  OG    . SER B 1 299 ? 53.566  -18.987 38.988  1.00 32.65 ? 335 SER B OG    1 
ATOM   4796 N  N     . HIS B 1 300 ? 53.060  -15.743 37.647  1.00 28.97 ? 336 HIS B N     1 
ATOM   4797 C  CA    . HIS B 1 300 ? 52.466  -15.237 36.420  1.00 29.50 ? 336 HIS B CA    1 
ATOM   4798 C  C     . HIS B 1 300 ? 52.697  -13.727 36.263  1.00 28.84 ? 336 HIS B C     1 
ATOM   4799 O  O     . HIS B 1 300 ? 52.254  -12.938 37.097  1.00 26.24 ? 336 HIS B O     1 
ATOM   4800 C  CB    . HIS B 1 300 ? 50.971  -15.540 36.395  1.00 28.10 ? 336 HIS B CB    1 
ATOM   4801 C  CG    . HIS B 1 300 ? 50.258  -14.936 35.226  1.00 34.28 ? 336 HIS B CG    1 
ATOM   4802 N  ND1   . HIS B 1 300 ? 50.676  -15.123 33.924  1.00 38.64 ? 336 HIS B ND1   1 
ATOM   4803 C  CD2   . HIS B 1 300 ? 49.156  -14.152 35.158  1.00 31.61 ? 336 HIS B CD2   1 
ATOM   4804 C  CE1   . HIS B 1 300 ? 49.862  -14.480 33.105  1.00 36.63 ? 336 HIS B CE1   1 
ATOM   4805 N  NE2   . HIS B 1 300 ? 48.933  -13.880 33.828  1.00 35.30 ? 336 HIS B NE2   1 
ATOM   4806 N  N     . ASN B 1 301 ? 53.404  -13.334 35.207  1.00 26.60 ? 337 ASN B N     1 
ATOM   4807 C  CA    . ASN B 1 301 ? 53.521  -11.920 34.850  1.00 27.31 ? 337 ASN B CA    1 
ATOM   4808 C  C     . ASN B 1 301 ? 52.331  -11.506 33.995  1.00 27.44 ? 337 ASN B C     1 
ATOM   4809 O  O     . ASN B 1 301 ? 52.215  -11.901 32.832  1.00 25.37 ? 337 ASN B O     1 
ATOM   4810 C  CB    . ASN B 1 301 ? 54.830  -11.638 34.102  1.00 25.99 ? 337 ASN B CB    1 
ATOM   4811 C  CG    . ASN B 1 301 ? 54.942  -10.186 33.636  1.00 28.66 ? 337 ASN B CG    1 
ATOM   4812 O  OD1   . ASN B 1 301 ? 54.302  -9.280  34.191  1.00 27.88 ? 337 ASN B OD1   1 
ATOM   4813 N  ND2   . ASN B 1 301 ? 55.760  -9.956  32.611  1.00 24.87 ? 337 ASN B ND2   1 
ATOM   4814 N  N     . VAL B 1 302 ? 51.444  -10.700 34.564  1.00 24.17 ? 338 VAL B N     1 
ATOM   4815 C  CA    . VAL B 1 302 ? 50.263  -10.258 33.828  1.00 24.69 ? 338 VAL B CA    1 
ATOM   4816 C  C     . VAL B 1 302 ? 50.686  -9.442  32.599  1.00 20.86 ? 338 VAL B C     1 
ATOM   4817 O  O     . VAL B 1 302 ? 49.983  -9.401  31.586  1.00 24.46 ? 338 VAL B O     1 
ATOM   4818 C  CB    . VAL B 1 302 ? 49.312  -9.430  34.741  1.00 28.10 ? 338 VAL B CB    1 
ATOM   4819 C  CG1   . VAL B 1 302 ? 48.076  -8.978  33.979  1.00 22.83 ? 338 VAL B CG1   1 
ATOM   4820 C  CG2   . VAL B 1 302 ? 48.892  -10.264 35.967  1.00 25.96 ? 338 VAL B CG2   1 
ATOM   4821 N  N     . GLY B 1 303 ? 51.837  -8.795  32.693  1.00 24.32 ? 339 GLY B N     1 
ATOM   4822 C  CA    . GLY B 1 303 ? 52.340  -8.007  31.575  1.00 27.49 ? 339 GLY B CA    1 
ATOM   4823 C  C     . GLY B 1 303 ? 53.192  -8.801  30.605  1.00 31.65 ? 339 GLY B C     1 
ATOM   4824 O  O     . GLY B 1 303 ? 53.876  -8.219  29.781  1.00 27.91 ? 339 GLY B O     1 
ATOM   4825 N  N     . ARG B 1 304 ? 53.130  -10.131 30.675  1.00 27.89 ? 340 ARG B N     1 
ATOM   4826 C  CA    . ARG B 1 304 ? 54.000  -10.982 29.836  1.00 31.20 ? 340 ARG B CA    1 
ATOM   4827 C  C     . ARG B 1 304 ? 53.744  -10.825 28.332  1.00 32.08 ? 340 ARG B C     1 
ATOM   4828 O  O     . ARG B 1 304 ? 54.574  -11.220 27.510  1.00 31.68 ? 340 ARG B O     1 
ATOM   4829 C  CB    . ARG B 1 304 ? 53.819  -12.457 30.207  1.00 30.92 ? 340 ARG B CB    1 
ATOM   4830 C  CG    . ARG B 1 304 ? 52.446  -12.968 29.843  1.00 29.28 ? 340 ARG B CG    1 
ATOM   4831 C  CD    . ARG B 1 304 ? 52.341  -14.492 29.869  1.00 44.18 ? 340 ARG B CD    1 
ATOM   4832 N  NE    . ARG B 1 304 ? 51.139  -14.890 29.143  1.00 52.48 ? 340 ARG B NE    1 
ATOM   4833 C  CZ    . ARG B 1 304 ? 51.054  -14.945 27.814  1.00 56.21 ? 340 ARG B CZ    1 
ATOM   4834 N  NH1   . ARG B 1 304 ? 52.109  -14.654 27.058  1.00 50.04 ? 340 ARG B NH1   1 
ATOM   4835 N  NH2   . ARG B 1 304 ? 49.914  -15.298 27.237  1.00 62.96 ? 340 ARG B NH2   1 
ATOM   4836 N  N     . THR B 1 305 ? 52.586  -10.275 27.983  1.00 30.44 ? 341 THR B N     1 
ATOM   4837 C  CA    . THR B 1 305 ? 52.195  -10.059 26.589  1.00 32.09 ? 341 THR B CA    1 
ATOM   4838 C  C     . THR B 1 305 ? 52.813  -8.798  26.002  1.00 32.41 ? 341 THR B C     1 
ATOM   4839 O  O     . THR B 1 305 ? 52.768  -8.588  24.788  1.00 28.22 ? 341 THR B O     1 
ATOM   4840 C  CB    . THR B 1 305 ? 50.676  -9.882  26.455  1.00 33.15 ? 341 THR B CB    1 
ATOM   4841 O  OG1   . THR B 1 305 ? 50.255  -8.785  27.279  1.00 31.85 ? 341 THR B OG1   1 
ATOM   4842 C  CG2   . THR B 1 305 ? 49.929  -11.136 26.874  1.00 35.13 ? 341 THR B CG2   1 
ATOM   4843 N  N     . VAL B 1 306 ? 53.365  -7.946  26.860  1.00 29.46 ? 342 VAL B N     1 
ATOM   4844 C  CA    . VAL B 1 306 ? 53.839  -6.646  26.406  1.00 25.61 ? 342 VAL B CA    1 
ATOM   4845 C  C     . VAL B 1 306 ? 55.213  -6.737  25.733  1.00 27.86 ? 342 VAL B C     1 
ATOM   4846 O  O     . VAL B 1 306 ? 56.161  -7.239  26.327  1.00 30.61 ? 342 VAL B O     1 
ATOM   4847 C  CB    . VAL B 1 306 ? 53.917  -5.633  27.561  1.00 28.87 ? 342 VAL B CB    1 
ATOM   4848 C  CG1   . VAL B 1 306 ? 54.542  -4.338  27.062  1.00 27.55 ? 342 VAL B CG1   1 
ATOM   4849 C  CG2   . VAL B 1 306 ? 52.532  -5.377  28.139  1.00 23.55 ? 342 VAL B CG2   1 
ATOM   4850 N  N     . SER B 1 307 ? 55.312  -6.240  24.502  1.00 26.75 ? 343 SER B N     1 
ATOM   4851 C  CA    . SER B 1 307 ? 56.586  -6.221  23.781  1.00 34.66 ? 343 SER B CA    1 
ATOM   4852 C  C     . SER B 1 307 ? 57.350  -4.921  24.051  1.00 35.42 ? 343 SER B C     1 
ATOM   4853 O  O     . SER B 1 307 ? 56.810  -3.994  24.671  1.00 28.97 ? 343 SER B O     1 
ATOM   4854 C  CB    . SER B 1 307 ? 56.326  -6.357  22.284  1.00 32.27 ? 343 SER B CB    1 
ATOM   4855 O  OG    . SER B 1 307 ? 55.555  -5.266  21.823  1.00 35.18 ? 343 SER B OG    1 
ATOM   4856 N  N     . SER B 1 308 ? 58.602  -4.853  23.599  1.00 33.69 ? 344 SER B N     1 
ATOM   4857 C  CA    . SER B 1 308 ? 59.375  -3.609  23.664  1.00 34.51 ? 344 SER B CA    1 
ATOM   4858 C  C     . SER B 1 308 ? 58.631  -2.463  22.998  1.00 35.32 ? 344 SER B C     1 
ATOM   4859 O  O     . SER B 1 308 ? 58.559  -1.362  23.549  1.00 37.74 ? 344 SER B O     1 
ATOM   4860 C  CB    . SER B 1 308 ? 60.752  -3.766  23.004  1.00 39.47 ? 344 SER B CB    1 
ATOM   4861 O  OG    . SER B 1 308 ? 61.739  -4.090  23.964  1.00 45.47 ? 344 SER B OG    1 
ATOM   4862 N  N     . SER B 1 309 ? 58.068  -2.708  21.819  1.00 32.11 ? 345 SER B N     1 
ATOM   4863 C  CA    . SER B 1 309 ? 57.383  -1.625  21.115  1.00 37.13 ? 345 SER B CA    1 
ATOM   4864 C  C     . SER B 1 309 ? 56.031  -1.316  21.761  1.00 32.70 ? 345 SER B C     1 
ATOM   4865 O  O     . SER B 1 309 ? 55.607  -0.161  21.798  1.00 27.67 ? 345 SER B O     1 
ATOM   4866 C  CB    . SER B 1 309 ? 57.231  -1.924  19.622  1.00 35.43 ? 345 SER B CB    1 
ATOM   4867 O  OG    . SER B 1 309 ? 56.301  -2.966  19.399  1.00 46.97 ? 345 SER B OG    1 
ATOM   4868 N  N     . GLY B 1 310 ? 55.360  -2.355  22.263  1.00 30.70 ? 346 GLY B N     1 
ATOM   4869 C  CA    . GLY B 1 310 ? 54.140  -2.175  23.031  1.00 28.64 ? 346 GLY B CA    1 
ATOM   4870 C  C     . GLY B 1 310 ? 54.389  -1.246  24.210  1.00 27.25 ? 346 GLY B C     1 
ATOM   4871 O  O     . GLY B 1 310 ? 53.626  -0.298  24.431  1.00 25.94 ? 346 GLY B O     1 
ATOM   4872 N  N     . LEU B 1 311 ? 55.468  -1.496  24.952  1.00 22.78 ? 347 LEU B N     1 
ATOM   4873 C  CA    . LEU B 1 311 ? 55.789  -0.675  26.120  1.00 27.49 ? 347 LEU B CA    1 
ATOM   4874 C  C     . LEU B 1 311 ? 56.101  0.758   25.712  1.00 29.69 ? 347 LEU B C     1 
ATOM   4875 O  O     . LEU B 1 311 ? 55.739  1.712   26.415  1.00 24.62 ? 347 LEU B O     1 
ATOM   4876 C  CB    . LEU B 1 311 ? 56.966  -1.259  26.904  1.00 23.91 ? 347 LEU B CB    1 
ATOM   4877 C  CG    . LEU B 1 311 ? 57.333  -0.465  28.163  1.00 33.83 ? 347 LEU B CG    1 
ATOM   4878 C  CD1   . LEU B 1 311 ? 56.119  -0.313  29.101  1.00 30.84 ? 347 LEU B CD1   1 
ATOM   4879 C  CD2   . LEU B 1 311 ? 58.508  -1.087  28.909  1.00 35.25 ? 347 LEU B CD2   1 
ATOM   4880 N  N     . TYR B 1 312 ? 56.773  0.921   24.575  1.00 28.35 ? 348 TYR B N     1 
ATOM   4881 C  CA    . TYR B 1 312 ? 57.080  2.270   24.112  1.00 30.81 ? 348 TYR B CA    1 
ATOM   4882 C  C     . TYR B 1 312 ? 55.797  3.046   23.839  1.00 27.07 ? 348 TYR B C     1 
ATOM   4883 O  O     . TYR B 1 312 ? 55.715  4.229   24.163  1.00 24.64 ? 348 TYR B O     1 
ATOM   4884 C  CB    . TYR B 1 312 ? 58.009  2.261   22.887  1.00 32.25 ? 348 TYR B CB    1 
ATOM   4885 C  CG    . TYR B 1 312 ? 59.341  1.583   23.140  1.00 36.74 ? 348 TYR B CG    1 
ATOM   4886 C  CD1   . TYR B 1 312 ? 59.821  1.406   24.439  1.00 41.46 ? 348 TYR B CD1   1 
ATOM   4887 C  CD2   . TYR B 1 312 ? 60.118  1.113   22.082  1.00 40.98 ? 348 TYR B CD2   1 
ATOM   4888 C  CE1   . TYR B 1 312 ? 61.040  0.773   24.676  1.00 41.97 ? 348 TYR B CE1   1 
ATOM   4889 C  CE2   . TYR B 1 312 ? 61.344  0.483   22.309  1.00 40.36 ? 348 TYR B CE2   1 
ATOM   4890 C  CZ    . TYR B 1 312 ? 61.797  0.321   23.606  1.00 41.49 ? 348 TYR B CZ    1 
ATOM   4891 O  OH    . TYR B 1 312 ? 63.005  -0.303  23.835  1.00 44.12 ? 348 TYR B OH    1 
ATOM   4892 N  N     . ARG B 1 313 ? 54.785  2.384   23.274  1.00 24.96 ? 349 ARG B N     1 
ATOM   4893 C  CA    . ARG B 1 313 ? 53.528  3.080   23.002  1.00 26.89 ? 349 ARG B CA    1 
ATOM   4894 C  C     . ARG B 1 313 ? 52.711  3.327   24.276  1.00 25.88 ? 349 ARG B C     1 
ATOM   4895 O  O     . ARG B 1 313 ? 52.085  4.375   24.421  1.00 25.61 ? 349 ARG B O     1 
ATOM   4896 C  CB    . ARG B 1 313 ? 52.688  2.334   21.958  1.00 33.34 ? 349 ARG B CB    1 
ATOM   4897 C  CG    . ARG B 1 313 ? 53.240  2.466   20.531  1.00 43.70 ? 349 ARG B CG    1 
ATOM   4898 C  CD    . ARG B 1 313 ? 52.148  2.364   19.470  1.00 49.24 ? 349 ARG B CD    1 
ATOM   4899 N  NE    . ARG B 1 313 ? 51.292  1.198   19.667  1.00 49.27 ? 349 ARG B NE    1 
ATOM   4900 C  CZ    . ARG B 1 313 ? 50.044  1.258   20.122  1.00 47.42 ? 349 ARG B CZ    1 
ATOM   4901 N  NH1   . ARG B 1 313 ? 49.343  0.144   20.278  1.00 50.65 ? 349 ARG B NH1   1 
ATOM   4902 N  NH2   . ARG B 1 313 ? 49.496  2.429   20.422  1.00 42.58 ? 349 ARG B NH2   1 
ATOM   4903 N  N     . ILE B 1 314 ? 52.717  2.359   25.189  1.00 22.11 ? 350 ILE B N     1 
ATOM   4904 C  CA    . ILE B 1 314 ? 52.054  2.537   26.480  1.00 25.55 ? 350 ILE B CA    1 
ATOM   4905 C  C     . ILE B 1 314 ? 52.674  3.721   27.208  1.00 21.69 ? 350 ILE B C     1 
ATOM   4906 O  O     . ILE B 1 314 ? 51.966  4.656   27.592  1.00 21.49 ? 350 ILE B O     1 
ATOM   4907 C  CB    . ILE B 1 314 ? 52.148  1.275   27.344  1.00 24.01 ? 350 ILE B CB    1 
ATOM   4908 C  CG1   . ILE B 1 314 ? 51.274  0.171   26.748  1.00 25.39 ? 350 ILE B CG1   1 
ATOM   4909 C  CG2   . ILE B 1 314 ? 51.712  1.573   28.781  1.00 22.24 ? 350 ILE B CG2   1 
ATOM   4910 C  CD1   . ILE B 1 314 ? 51.681  -1.246  27.190  1.00 24.27 ? 350 ILE B CD1   1 
ATOM   4911 N  N     . ARG B 1 315 ? 53.994  3.694   27.381  1.00 25.34 ? 351 ARG B N     1 
ATOM   4912 C  CA    . ARG B 1 315 ? 54.710  4.808   28.016  1.00 26.39 ? 351 ARG B CA    1 
ATOM   4913 C  C     . ARG B 1 315 ? 54.443  6.134   27.318  1.00 26.19 ? 351 ARG B C     1 
ATOM   4914 O  O     . ARG B 1 315 ? 54.263  7.166   27.982  1.00 24.66 ? 351 ARG B O     1 
ATOM   4915 C  CB    . ARG B 1 315 ? 56.217  4.554   28.042  1.00 28.97 ? 351 ARG B CB    1 
ATOM   4916 C  CG    . ARG B 1 315 ? 56.646  3.445   28.982  1.00 32.98 ? 351 ARG B CG    1 
ATOM   4917 C  CD    . ARG B 1 315 ? 56.794  3.943   30.414  1.00 42.72 ? 351 ARG B CD    1 
ATOM   4918 N  NE    . ARG B 1 315 ? 58.032  4.701   30.630  1.00 47.43 ? 351 ARG B NE    1 
ATOM   4919 C  CZ    . ARG B 1 315 ? 58.440  5.133   31.822  1.00 45.06 ? 351 ARG B CZ    1 
ATOM   4920 N  NH1   . ARG B 1 315 ? 57.708  4.889   32.909  1.00 37.54 ? 351 ARG B NH1   1 
ATOM   4921 N  NH2   . ARG B 1 315 ? 59.576  5.809   31.934  1.00 42.84 ? 351 ARG B NH2   1 
ATOM   4922 N  N     . GLY B 1 316 ? 54.401  6.096   25.986  1.00 27.53 ? 352 GLY B N     1 
ATOM   4923 C  CA    . GLY B 1 316 ? 54.122  7.274   25.181  1.00 26.58 ? 352 GLY B CA    1 
ATOM   4924 C  C     . GLY B 1 316 ? 52.750  7.855   25.469  1.00 29.54 ? 352 GLY B C     1 
ATOM   4925 O  O     . GLY B 1 316 ? 52.579  9.082   25.517  1.00 24.15 ? 352 GLY B O     1 
ATOM   4926 N  N     . GLU B 1 317 ? 51.765  6.983   25.682  1.00 25.68 ? 353 GLU B N     1 
ATOM   4927 C  CA    . GLU B 1 317 ? 50.424  7.462   25.994  1.00 25.11 ? 353 GLU B CA    1 
ATOM   4928 C  C     . GLU B 1 317 ? 50.311  7.997   27.421  1.00 24.12 ? 353 GLU B C     1 
ATOM   4929 O  O     . GLU B 1 317 ? 49.571  8.956   27.667  1.00 26.97 ? 353 GLU B O     1 
ATOM   4930 C  CB    . GLU B 1 317 ? 49.359  6.396   25.702  1.00 25.81 ? 353 GLU B CB    1 
ATOM   4931 C  CG    . GLU B 1 317 ? 49.220  6.043   24.218  1.00 28.56 ? 353 GLU B CG    1 
ATOM   4932 C  CD    . GLU B 1 317 ? 48.686  7.189   23.352  1.00 39.04 ? 353 GLU B CD    1 
ATOM   4933 O  OE1   . GLU B 1 317 ? 48.680  7.027   22.110  1.00 43.79 ? 353 GLU B OE1   1 
ATOM   4934 O  OE2   . GLU B 1 317 ? 48.258  8.242   23.891  1.00 35.48 ? 353 GLU B OE2   1 
ATOM   4935 N  N     . PHE B 1 318 ? 51.045  7.398   28.357  1.00 20.94 ? 354 PHE B N     1 
ATOM   4936 C  CA    . PHE B 1 318 ? 51.071  7.926   29.725  1.00 23.44 ? 354 PHE B CA    1 
ATOM   4937 C  C     . PHE B 1 318 ? 51.621  9.358   29.717  1.00 26.48 ? 354 PHE B C     1 
ATOM   4938 O  O     . PHE B 1 318 ? 51.083  10.253  30.368  1.00 22.69 ? 354 PHE B O     1 
ATOM   4939 C  CB    . PHE B 1 318 ? 51.885  7.014   30.667  1.00 23.55 ? 354 PHE B CB    1 
ATOM   4940 C  CG    . PHE B 1 318 ? 51.063  5.896   31.299  1.00 24.10 ? 354 PHE B CG    1 
ATOM   4941 C  CD1   . PHE B 1 318 ? 51.227  4.572   30.902  1.00 20.45 ? 354 PHE B CD1   1 
ATOM   4942 C  CD2   . PHE B 1 318 ? 50.102  6.194   32.271  1.00 25.11 ? 354 PHE B CD2   1 
ATOM   4943 C  CE1   . PHE B 1 318 ? 50.459  3.550   31.472  1.00 23.08 ? 354 PHE B CE1   1 
ATOM   4944 C  CE2   . PHE B 1 318 ? 49.324  5.187   32.844  1.00 22.87 ? 354 PHE B CE2   1 
ATOM   4945 C  CZ    . PHE B 1 318 ? 49.505  3.862   32.454  1.00 21.41 ? 354 PHE B CZ    1 
ATOM   4946 N  N     . MET B 1 319 ? 52.700  9.566   28.974  1.00 23.79 ? 355 MET B N     1 
ATOM   4947 C  CA    . MET B 1 319 ? 53.322  10.885  28.899  1.00 27.14 ? 355 MET B CA    1 
ATOM   4948 C  C     . MET B 1 319 ? 52.416  11.899  28.223  1.00 21.47 ? 355 MET B C     1 
ATOM   4949 O  O     . MET B 1 319 ? 52.290  13.033  28.686  1.00 30.61 ? 355 MET B O     1 
ATOM   4950 C  CB    . MET B 1 319 ? 54.673  10.798  28.183  1.00 23.52 ? 355 MET B CB    1 
ATOM   4951 C  CG    . MET B 1 319 ? 55.716  10.021  28.952  1.00 26.32 ? 355 MET B CG    1 
ATOM   4952 S  SD    . MET B 1 319 ? 57.204  9.771   27.955  1.00 40.61 ? 355 MET B SD    1 
ATOM   4953 C  CE    . MET B 1 319 ? 58.267  8.905   29.127  1.00 37.80 ? 355 MET B CE    1 
ATOM   4954 N  N     . ALA B 1 320 ? 51.773  11.491  27.137  1.00 25.77 ? 356 ALA B N     1 
ATOM   4955 C  CA    . ALA B 1 320 ? 50.833  12.364  26.428  1.00 25.08 ? 356 ALA B CA    1 
ATOM   4956 C  C     . ALA B 1 320 ? 49.674  12.784  27.332  1.00 31.55 ? 356 ALA B C     1 
ATOM   4957 O  O     . ALA B 1 320 ? 49.199  13.925  27.277  1.00 27.02 ? 356 ALA B O     1 
ATOM   4958 C  CB    . ALA B 1 320 ? 50.306  11.671  25.191  1.00 28.01 ? 356 ALA B CB    1 
ATOM   4959 N  N     . ALA B 1 321 ? 49.200  11.849  28.151  1.00 23.85 ? 357 ALA B N     1 
ATOM   4960 C  CA    . ALA B 1 321 ? 48.113  12.135  29.074  1.00 24.60 ? 357 ALA B CA    1 
ATOM   4961 C  C     . ALA B 1 321 ? 48.598  13.111  30.128  1.00 25.00 ? 357 ALA B C     1 
ATOM   4962 O  O     . ALA B 1 321 ? 47.897  14.067  30.465  1.00 28.96 ? 357 ALA B O     1 
ATOM   4963 C  CB    . ALA B 1 321 ? 47.617  10.839  29.730  1.00 25.97 ? 357 ALA B CB    1 
ATOM   4964 N  N     . SER B 1 322 ? 49.791  12.853  30.664  1.00 26.82 ? 358 SER B N     1 
ATOM   4965 C  CA    . SER B 1 322 ? 50.373  13.724  31.679  1.00 28.63 ? 358 SER B CA    1 
ATOM   4966 C  C     . SER B 1 322 ? 50.591  15.132  31.138  1.00 35.90 ? 358 SER B C     1 
ATOM   4967 O  O     . SER B 1 322 ? 50.316  16.122  31.824  1.00 31.50 ? 358 SER B O     1 
ATOM   4968 C  CB    . SER B 1 322 ? 51.696  13.170  32.199  1.00 29.75 ? 358 SER B CB    1 
ATOM   4969 O  OG    . SER B 1 322 ? 51.528  11.893  32.779  1.00 34.79 ? 358 SER B OG    1 
ATOM   4970 N  N     . ARG B 1 323 ? 51.078  15.209  29.904  1.00 30.25 ? 359 ARG B N     1 
ATOM   4971 C  CA    . ARG B 1 323 ? 51.346  16.489  29.255  1.00 36.24 ? 359 ARG B CA    1 
ATOM   4972 C  C     . ARG B 1 323 ? 50.043  17.279  29.137  1.00 33.42 ? 359 ARG B C     1 
ATOM   4973 O  O     . ARG B 1 323 ? 50.000  18.466  29.418  1.00 33.59 ? 359 ARG B O     1 
ATOM   4974 C  CB    . ARG B 1 323 ? 51.956  16.240  27.866  1.00 29.30 ? 359 ARG B CB    1 
ATOM   4975 C  CG    . ARG B 1 323 ? 52.980  17.246  27.410  1.00 44.67 ? 359 ARG B CG    1 
ATOM   4976 C  CD    . ARG B 1 323 ? 53.577  16.829  26.062  1.00 39.63 ? 359 ARG B CD    1 
ATOM   4977 N  NE    . ARG B 1 323 ? 54.382  15.620  26.175  1.00 36.12 ? 359 ARG B NE    1 
ATOM   4978 C  CZ    . ARG B 1 323 ? 54.178  14.492  25.491  1.00 38.68 ? 359 ARG B CZ    1 
ATOM   4979 N  NH1   . ARG B 1 323 ? 53.182  14.381  24.615  1.00 43.38 ? 359 ARG B NH1   1 
ATOM   4980 N  NH2   . ARG B 1 323 ? 54.987  13.465  25.686  1.00 37.61 ? 359 ARG B NH2   1 
ATOM   4981 N  N     . LEU B 1 324 ? 48.970  16.601  28.749  1.00 33.58 ? 360 LEU B N     1 
ATOM   4982 C  CA    . LEU B 1 324 ? 47.659  17.239  28.620  1.00 34.48 ? 360 LEU B CA    1 
ATOM   4983 C  C     . LEU B 1 324 ? 47.149  17.852  29.929  1.00 39.44 ? 360 LEU B C     1 
ATOM   4984 O  O     . LEU B 1 324 ? 46.655  18.983  29.943  1.00 35.76 ? 360 LEU B O     1 
ATOM   4985 C  CB    . LEU B 1 324 ? 46.639  16.229  28.084  1.00 36.20 ? 360 LEU B CB    1 
ATOM   4986 C  CG    . LEU B 1 324 ? 45.181  16.673  27.981  1.00 33.51 ? 360 LEU B CG    1 
ATOM   4987 C  CD1   . LEU B 1 324 ? 45.035  17.815  26.989  1.00 42.46 ? 360 LEU B CD1   1 
ATOM   4988 C  CD2   . LEU B 1 324 ? 44.273  15.512  27.592  1.00 39.86 ? 360 LEU B CD2   1 
ATOM   4989 N  N     . LEU B 1 325 ? 47.278  17.115  31.029  1.00 33.21 ? 361 LEU B N     1 
ATOM   4990 C  CA    . LEU B 1 325 ? 46.735  17.566  32.316  1.00 35.87 ? 361 LEU B CA    1 
ATOM   4991 C  C     . LEU B 1 325 ? 47.607  18.624  33.007  1.00 39.57 ? 361 LEU B C     1 
ATOM   4992 O  O     . LEU B 1 325 ? 47.112  19.382  33.837  1.00 35.59 ? 361 LEU B O     1 
ATOM   4993 C  CB    . LEU B 1 325 ? 46.483  16.371  33.253  1.00 33.97 ? 361 LEU B CB    1 
ATOM   4994 C  CG    . LEU B 1 325 ? 45.582  15.285  32.662  1.00 34.68 ? 361 LEU B CG    1 
ATOM   4995 C  CD1   . LEU B 1 325 ? 45.423  14.069  33.587  1.00 33.45 ? 361 LEU B CD1   1 
ATOM   4996 C  CD2   . LEU B 1 325 ? 44.226  15.872  32.326  1.00 32.50 ? 361 LEU B CD2   1 
ATOM   4997 N  N     . ASN B 1 326 ? 48.900  18.667  32.676  1.00 37.88 ? 362 ASN B N     1 
ATOM   4998 C  CA    . ASN B 1 326 ? 49.803  19.674  33.251  1.00 40.68 ? 362 ASN B CA    1 
ATOM   4999 C  C     . ASN B 1 326 ? 49.913  20.905  32.361  1.00 44.50 ? 362 ASN B C     1 
ATOM   5000 O  O     . ASN B 1 326 ? 50.806  21.742  32.545  1.00 45.03 ? 362 ASN B O     1 
ATOM   5001 C  CB    . ASN B 1 326 ? 51.201  19.093  33.514  1.00 41.02 ? 362 ASN B CB    1 
ATOM   5002 C  CG    . ASN B 1 326 ? 51.515  18.948  35.011  1.00 51.00 ? 362 ASN B CG    1 
ATOM   5003 O  OD1   . ASN B 1 326 ? 50.618  19.016  35.867  1.00 46.30 ? 362 ASN B OD1   1 
ATOM   5004 N  ND2   . ASN B 1 326 ? 52.795  18.743  35.328  1.00 48.52 ? 362 ASN B ND2   1 
ATOM   5005 N  N     . SER B 1 327 ? 49.001  21.000  31.396  1.00 41.67 ? 363 SER B N     1 
ATOM   5006 C  CA    . SER B 1 327 ? 48.985  22.085  30.412  1.00 44.86 ? 363 SER B CA    1 
ATOM   5007 C  C     . SER B 1 327 ? 48.848  23.488  31.016  1.00 45.28 ? 363 SER B C     1 
ATOM   5008 O  O     . SER B 1 327 ? 48.103  23.694  31.977  1.00 41.00 ? 363 SER B O     1 
ATOM   5009 C  CB    . SER B 1 327 ? 47.859  21.846  29.400  1.00 41.78 ? 363 SER B CB    1 
ATOM   5010 O  OG    . SER B 1 327 ? 47.617  23.001  28.616  1.00 50.56 ? 363 SER B OG    1 
ATOM   5011 N  N     . ARG B 1 328 ? 49.573  24.446  30.439  1.00 48.81 ? 364 ARG B N     1 
ATOM   5012 C  CA    . ARG B 1 328 ? 49.474  25.851  30.835  1.00 49.17 ? 364 ARG B CA    1 
ATOM   5013 C  C     . ARG B 1 328 ? 48.225  26.503  30.243  1.00 52.07 ? 364 ARG B C     1 
ATOM   5014 O  O     . ARG B 1 328 ? 47.850  27.612  30.632  1.00 57.53 ? 364 ARG B O     1 
ATOM   5015 C  CB    . ARG B 1 328 ? 50.701  26.633  30.367  1.00 47.42 ? 364 ARG B CB    1 
ATOM   5016 C  CG    . ARG B 1 328 ? 52.037  26.070  30.823  1.00 48.65 ? 364 ARG B CG    1 
ATOM   5017 C  CD    . ARG B 1 328 ? 53.201  26.873  30.240  1.00 49.28 ? 364 ARG B CD    1 
ATOM   5018 N  NE    . ARG B 1 328 ? 53.227  26.847  28.775  1.00 50.82 ? 364 ARG B NE    1 
ATOM   5019 C  CZ    . ARG B 1 328 ? 52.789  27.833  27.993  1.00 51.36 ? 364 ARG B CZ    1 
ATOM   5020 N  NH1   . ARG B 1 328 ? 52.282  28.942  28.526  1.00 48.37 ? 364 ARG B NH1   1 
ATOM   5021 N  NH2   . ARG B 1 328 ? 52.853  27.710  26.674  1.00 52.82 ? 364 ARG B NH2   1 
ATOM   5022 N  N     . SER B 1 329 ? 47.589  25.813  29.300  1.00 49.36 ? 365 SER B N     1 
ATOM   5023 C  CA    . SER B 1 329 ? 46.409  26.339  28.618  1.00 55.20 ? 365 SER B CA    1 
ATOM   5024 C  C     . SER B 1 329 ? 45.199  26.410  29.541  1.00 55.82 ? 365 SER B C     1 
ATOM   5025 O  O     . SER B 1 329 ? 45.096  25.652  30.510  1.00 55.23 ? 365 SER B O     1 
ATOM   5026 C  CB    . SER B 1 329 ? 46.057  25.460  27.418  1.00 55.53 ? 365 SER B CB    1 
ATOM   5027 O  OG    . SER B 1 329 ? 47.210  25.130  26.669  1.00 54.32 ? 365 SER B OG    1 
ATOM   5028 N  N     . TYR B 1 330 ? 44.280  27.320  29.232  1.00 52.43 ? 366 TYR B N     1 
ATOM   5029 C  CA    . TYR B 1 330 ? 43.017  27.400  29.955  1.00 57.18 ? 366 TYR B CA    1 
ATOM   5030 C  C     . TYR B 1 330 ? 41.892  27.864  29.033  1.00 60.52 ? 366 TYR B C     1 
ATOM   5031 O  O     . TYR B 1 330 ? 41.980  28.931  28.419  1.00 60.85 ? 366 TYR B O     1 
ATOM   5032 C  CB    . TYR B 1 330 ? 43.130  28.301  31.191  1.00 56.98 ? 366 TYR B CB    1 
ATOM   5033 C  CG    . TYR B 1 330 ? 42.098  27.991  32.259  1.00 61.43 ? 366 TYR B CG    1 
ATOM   5034 C  CD1   . TYR B 1 330 ? 42.282  26.929  33.139  1.00 62.98 ? 366 TYR B CD1   1 
ATOM   5035 C  CD2   . TYR B 1 330 ? 40.945  28.756  32.386  1.00 60.51 ? 366 TYR B CD2   1 
ATOM   5036 C  CE1   . TYR B 1 330 ? 41.346  26.638  34.114  1.00 60.71 ? 366 TYR B CE1   1 
ATOM   5037 C  CE2   . TYR B 1 330 ? 40.003  28.475  33.360  1.00 60.19 ? 366 TYR B CE2   1 
ATOM   5038 C  CZ    . TYR B 1 330 ? 40.208  27.415  34.218  1.00 62.81 ? 366 TYR B CZ    1 
ATOM   5039 O  OH    . TYR B 1 330 ? 39.271  27.136  35.184  1.00 67.89 ? 366 TYR B OH    1 
ATOM   5040 N  N     . PRO B 1 331 ? 40.826  27.054  28.932  1.00 61.23 ? 367 PRO B N     1 
ATOM   5041 C  CA    . PRO B 1 331 ? 40.682  25.780  29.653  1.00 59.05 ? 367 PRO B CA    1 
ATOM   5042 C  C     . PRO B 1 331 ? 41.396  24.614  28.959  1.00 57.24 ? 367 PRO B C     1 
ATOM   5043 O  O     . PRO B 1 331 ? 41.733  24.708  27.777  1.00 54.77 ? 367 PRO B O     1 
ATOM   5044 C  CB    . PRO B 1 331 ? 39.162  25.538  29.642  1.00 57.73 ? 367 PRO B CB    1 
ATOM   5045 C  CG    . PRO B 1 331 ? 38.540  26.801  29.048  1.00 56.87 ? 367 PRO B CG    1 
ATOM   5046 C  CD    . PRO B 1 331 ? 39.603  27.402  28.193  1.00 59.07 ? 367 PRO B CD    1 
ATOM   5047 N  N     . ILE B 1 332 ? 41.628  23.531  29.700  1.00 53.22 ? 368 ILE B N     1 
ATOM   5048 C  CA    . ILE B 1 332 ? 42.261  22.334  29.148  1.00 47.19 ? 368 ILE B CA    1 
ATOM   5049 C  C     . ILE B 1 332 ? 41.245  21.556  28.310  1.00 44.24 ? 368 ILE B C     1 
ATOM   5050 O  O     . ILE B 1 332 ? 40.091  21.414  28.715  1.00 50.03 ? 368 ILE B O     1 
ATOM   5051 C  CB    . ILE B 1 332 ? 42.837  21.435  30.271  1.00 45.59 ? 368 ILE B CB    1 
ATOM   5052 C  CG1   . ILE B 1 332 ? 43.675  22.273  31.242  1.00 45.17 ? 368 ILE B CG1   1 
ATOM   5053 C  CG2   . ILE B 1 332 ? 43.660  20.286  29.691  1.00 43.59 ? 368 ILE B CG2   1 
ATOM   5054 C  CD1   . ILE B 1 332 ? 44.345  21.483  32.350  1.00 42.85 ? 368 ILE B CD1   1 
ATOM   5055 N  N     . PRO B 1 333 ? 41.661  21.081  27.121  1.00 48.40 ? 369 PRO B N     1 
ATOM   5056 C  CA    . PRO B 1 333 ? 40.858  20.205  26.252  1.00 44.02 ? 369 PRO B CA    1 
ATOM   5057 C  C     . PRO B 1 333 ? 40.890  18.741  26.702  1.00 43.15 ? 369 PRO B C     1 
ATOM   5058 O  O     . PRO B 1 333 ? 41.617  17.922  26.130  1.00 39.48 ? 369 PRO B O     1 
ATOM   5059 C  CB    . PRO B 1 333 ? 41.555  20.330  24.893  1.00 41.76 ? 369 PRO B CB    1 
ATOM   5060 C  CG    . PRO B 1 333 ? 42.969  20.663  25.229  1.00 43.34 ? 369 PRO B CG    1 
ATOM   5061 C  CD    . PRO B 1 333 ? 42.891  21.545  26.449  1.00 48.00 ? 369 PRO B CD    1 
ATOM   5062 N  N     . TYR B 1 334 ? 40.094  18.397  27.705  1.00 39.36 ? 370 TYR B N     1 
ATOM   5063 C  CA    . TYR B 1 334 ? 40.172  17.047  28.257  1.00 39.65 ? 370 TYR B CA    1 
ATOM   5064 C  C     . TYR B 1 334 ? 39.782  15.947  27.267  1.00 38.19 ? 370 TYR B C     1 
ATOM   5065 O  O     . TYR B 1 334 ? 40.269  14.831  27.377  1.00 42.07 ? 370 TYR B O     1 
ATOM   5066 C  CB    . TYR B 1 334 ? 39.354  16.944  29.543  1.00 34.75 ? 370 TYR B CB    1 
ATOM   5067 C  CG    . TYR B 1 334 ? 39.816  17.895  30.614  1.00 35.97 ? 370 TYR B CG    1 
ATOM   5068 C  CD1   . TYR B 1 334 ? 41.065  17.756  31.201  1.00 35.33 ? 370 TYR B CD1   1 
ATOM   5069 C  CD2   . TYR B 1 334 ? 39.004  18.930  31.037  1.00 32.34 ? 370 TYR B CD2   1 
ATOM   5070 C  CE1   . TYR B 1 334 ? 41.492  18.627  32.181  1.00 40.88 ? 370 TYR B CE1   1 
ATOM   5071 C  CE2   . TYR B 1 334 ? 39.419  19.807  32.015  1.00 37.63 ? 370 TYR B CE2   1 
ATOM   5072 C  CZ    . TYR B 1 334 ? 40.660  19.652  32.582  1.00 36.80 ? 370 TYR B CZ    1 
ATOM   5073 O  OH    . TYR B 1 334 ? 41.069  20.519  33.562  1.00 40.78 ? 370 TYR B OH    1 
ATOM   5074 N  N     . ASP B 1 335 ? 38.932  16.266  26.293  1.00 38.55 ? 371 ASP B N     1 
ATOM   5075 C  CA    . ASP B 1 335 ? 38.455  15.274  25.322  1.00 40.37 ? 371 ASP B CA    1 
ATOM   5076 C  C     . ASP B 1 335 ? 39.568  14.528  24.579  1.00 42.37 ? 371 ASP B C     1 
ATOM   5077 O  O     . ASP B 1 335 ? 39.397  13.370  24.177  1.00 36.47 ? 371 ASP B O     1 
ATOM   5078 C  CB    . ASP B 1 335 ? 37.527  15.925  24.293  1.00 45.81 ? 371 ASP B CB    1 
ATOM   5079 C  CG    . ASP B 1 335 ? 36.358  16.650  24.929  1.00 53.36 ? 371 ASP B CG    1 
ATOM   5080 O  OD1   . ASP B 1 335 ? 36.587  17.500  25.819  1.00 56.48 ? 371 ASP B OD1   1 
ATOM   5081 O  OD2   . ASP B 1 335 ? 35.206  16.371  24.529  1.00 55.47 ? 371 ASP B OD2   1 
ATOM   5082 N  N     . SER B 1 336 ? 40.706  15.185  24.390  1.00 38.90 ? 372 SER B N     1 
ATOM   5083 C  CA    . SER B 1 336 ? 41.797  14.573  23.634  1.00 42.02 ? 372 SER B CA    1 
ATOM   5084 C  C     . SER B 1 336 ? 42.337  13.353  24.379  1.00 38.65 ? 372 SER B C     1 
ATOM   5085 O  O     . SER B 1 336 ? 42.933  12.448  23.776  1.00 39.36 ? 372 SER B O     1 
ATOM   5086 C  CB    . SER B 1 336 ? 42.911  15.583  23.360  1.00 43.74 ? 372 SER B CB    1 
ATOM   5087 O  OG    . SER B 1 336 ? 43.480  16.046  24.564  1.00 46.44 ? 372 SER B OG    1 
ATOM   5088 N  N     . LEU B 1 337 ? 42.106  13.332  25.691  1.00 40.31 ? 373 LEU B N     1 
ATOM   5089 C  CA    . LEU B 1 337 ? 42.484  12.198  26.523  1.00 39.54 ? 373 LEU B CA    1 
ATOM   5090 C  C     . LEU B 1 337 ? 41.828  10.927  25.995  1.00 31.08 ? 373 LEU B C     1 
ATOM   5091 O  O     . LEU B 1 337 ? 42.438  9.863   25.990  1.00 34.34 ? 373 LEU B O     1 
ATOM   5092 C  CB    . LEU B 1 337 ? 42.106  12.446  27.984  1.00 36.54 ? 373 LEU B CB    1 
ATOM   5093 C  CG    . LEU B 1 337 ? 42.546  11.379  28.970  1.00 33.44 ? 373 LEU B CG    1 
ATOM   5094 C  CD1   . LEU B 1 337 ? 44.046  11.191  28.879  1.00 31.99 ? 373 LEU B CD1   1 
ATOM   5095 C  CD2   . LEU B 1 337 ? 42.129  11.746  30.399  1.00 34.11 ? 373 LEU B CD2   1 
ATOM   5096 N  N     . PHE B 1 338 ? 40.593  11.042  25.518  1.00 34.80 ? 374 PHE B N     1 
ATOM   5097 C  CA    . PHE B 1 338 ? 39.880  9.869   25.007  1.00 35.66 ? 374 PHE B CA    1 
ATOM   5098 C  C     . PHE B 1 338 ? 39.740  9.825   23.485  1.00 41.13 ? 374 PHE B C     1 
ATOM   5099 O  O     . PHE B 1 338 ? 38.949  9.042   22.950  1.00 39.68 ? 374 PHE B O     1 
ATOM   5100 C  CB    . PHE B 1 338 ? 38.512  9.724   25.686  1.00 30.44 ? 374 PHE B CB    1 
ATOM   5101 C  CG    . PHE B 1 338 ? 38.598  9.596   27.178  1.00 27.23 ? 374 PHE B CG    1 
ATOM   5102 C  CD1   . PHE B 1 338 ? 39.264  8.524   27.754  1.00 31.20 ? 374 PHE B CD1   1 
ATOM   5103 C  CD2   . PHE B 1 338 ? 38.013  10.544  28.007  1.00 30.48 ? 374 PHE B CD2   1 
ATOM   5104 C  CE1   . PHE B 1 338 ? 39.355  8.399   29.134  1.00 27.73 ? 374 PHE B CE1   1 
ATOM   5105 C  CE2   . PHE B 1 338 ? 38.100  10.435  29.395  1.00 32.67 ? 374 PHE B CE2   1 
ATOM   5106 C  CZ    . PHE B 1 338 ? 38.772  9.350   29.960  1.00 31.66 ? 374 PHE B CZ    1 
ATOM   5107 N  N     . GLU B 1 339 ? 40.516  10.650  22.787  1.00 41.30 ? 375 GLU B N     1 
ATOM   5108 C  CA    . GLU B 1 339 ? 40.538  10.594  21.323  1.00 45.77 ? 375 GLU B CA    1 
ATOM   5109 C  C     . GLU B 1 339 ? 41.333  9.384   20.826  1.00 46.68 ? 375 GLU B C     1 
ATOM   5110 O  O     . GLU B 1 339 ? 42.342  9.008   21.422  1.00 45.82 ? 375 GLU B O     1 
ATOM   5111 C  CB    . GLU B 1 339 ? 41.082  11.899  20.719  1.00 44.26 ? 375 GLU B CB    1 
ATOM   5112 C  CG    . GLU B 1 339 ? 40.095  13.066  20.796  1.00 52.28 ? 375 GLU B CG    1 
ATOM   5113 C  CD    . GLU B 1 339 ? 40.492  14.258  19.928  1.00 57.38 ? 375 GLU B CD    1 
ATOM   5114 O  OE1   . GLU B 1 339 ? 41.698  14.592  19.875  1.00 56.20 ? 375 GLU B OE1   1 
ATOM   5115 O  OE2   . GLU B 1 339 ? 39.590  14.860  19.302  1.00 59.76 ? 375 GLU B OE2   1 
ATOM   5116 N  N     . GLU B 1 340 ? 40.870  8.791   19.726  1.00 47.14 ? 376 GLU B N     1 
ATOM   5117 C  CA    . GLU B 1 340 ? 41.427  7.553   19.176  1.00 49.50 ? 376 GLU B CA    1 
ATOM   5118 C  C     . GLU B 1 340 ? 42.893  7.649   18.727  1.00 54.92 ? 376 GLU B C     1 
ATOM   5119 O  O     . GLU B 1 340 ? 43.380  8.733   18.401  1.00 58.07 ? 376 GLU B O     1 
ATOM   5120 C  CB    . GLU B 1 340 ? 40.559  7.080   18.006  1.00 53.66 ? 376 GLU B CB    1 
ATOM   5121 C  CG    . GLU B 1 340 ? 39.066  7.302   18.229  1.00 54.93 ? 376 GLU B CG    1 
ATOM   5122 C  CD    . GLU B 1 340 ? 38.276  6.009   18.300  1.00 59.88 ? 376 GLU B CD    1 
ATOM   5123 O  OE1   . GLU B 1 340 ? 38.753  4.992   17.752  1.00 62.96 ? 376 GLU B OE1   1 
ATOM   5124 O  OE2   . GLU B 1 340 ? 37.179  6.012   18.905  1.00 59.33 ? 376 GLU B OE2   1 
ATOM   5125 N  N     . ALA B 1 341 ? 43.576  6.499   18.716  1.00 51.29 ? 377 ALA B N     1 
ATOM   5126 C  CA    . ALA B 1 341 ? 44.983  6.383   18.310  1.00 52.77 ? 377 ALA B CA    1 
ATOM   5127 C  C     . ALA B 1 341 ? 45.935  7.166   19.212  1.00 53.96 ? 377 ALA B C     1 
ATOM   5128 O  O     . ALA B 1 341 ? 46.703  6.583   19.982  1.00 55.72 ? 377 ALA B O     1 
ATOM   5129 C  CB    . ALA B 1 341 ? 45.168  6.788   16.836  1.00 58.81 ? 377 ALA B CB    1 
ATOM   5130 O  "O5'" . A   C 2 1   ? 13.617  21.440  15.176  0.70 40.68 ? 58  A   D "O5'" 1 
ATOM   5131 C  "C5'" . A   C 2 1   ? 12.332  20.926  15.494  0.70 36.54 ? 58  A   D "C5'" 1 
ATOM   5132 C  "C4'" . A   C 2 1   ? 11.240  21.639  14.732  0.70 34.86 ? 58  A   D "C4'" 1 
ATOM   5133 O  "O4'" . A   C 2 1   ? 11.419  23.076  14.845  0.70 38.25 ? 58  A   D "O4'" 1 
ATOM   5134 C  "C3'" . A   C 2 1   ? 11.191  21.393  13.230  0.70 36.78 ? 58  A   D "C3'" 1 
ATOM   5135 O  "O3'" . A   C 2 1   ? 10.547  20.177  12.887  0.70 35.50 ? 58  A   D "O3'" 1 
ATOM   5136 C  "C2'" . A   C 2 1   ? 10.453  22.624  12.725  0.70 37.04 ? 58  A   D "C2'" 1 
ATOM   5137 O  "O2'" . A   C 2 1   ? 9.061   22.500  12.969  0.70 36.74 ? 58  A   D "O2'" 1 
ATOM   5138 C  "C1'" . A   C 2 1   ? 11.012  23.707  13.646  0.70 40.00 ? 58  A   D "C1'" 1 
ATOM   5139 N  N9    . A   C 2 1   ? 12.178  24.383  13.044  0.70 37.10 ? 58  A   D N9    1 
ATOM   5140 C  C8    . A   C 2 1   ? 13.494  24.306  13.446  0.70 38.37 ? 58  A   D C8    1 
ATOM   5141 N  N7    . A   C 2 1   ? 14.311  25.021  12.709  0.70 39.02 ? 58  A   D N7    1 
ATOM   5142 C  C5    . A   C 2 1   ? 13.484  25.610  11.757  0.70 36.02 ? 58  A   D C5    1 
ATOM   5143 C  C6    . A   C 2 1   ? 13.751  26.480  10.687  0.70 37.30 ? 58  A   D C6    1 
ATOM   5144 N  N6    . A   C 2 1   ? 14.971  26.928  10.381  0.70 35.47 ? 58  A   D N6    1 
ATOM   5145 N  N1    . A   C 2 1   ? 12.708  26.879  9.927   0.70 36.81 ? 58  A   D N1    1 
ATOM   5146 C  C2    . A   C 2 1   ? 11.484  26.425  10.228  0.70 34.85 ? 58  A   D C2    1 
ATOM   5147 N  N3    . A   C 2 1   ? 11.108  25.606  11.207  0.70 36.47 ? 58  A   D N3    1 
ATOM   5148 C  C4    . A   C 2 1   ? 12.167  25.227  11.949  0.70 38.33 ? 58  A   D C4    1 
ATOM   5149 P  P     . U   C 2 2   ? 11.193  19.185  11.795  0.72 36.25 ? 59  U   D P     1 
ATOM   5150 O  OP1   . U   C 2 2   ? 10.187  18.122  11.544  0.72 37.81 ? 59  U   D OP1   1 
ATOM   5151 O  OP2   . U   C 2 2   ? 12.569  18.804  12.208  0.72 24.74 ? 59  U   D OP2   1 
ATOM   5152 O  "O5'" . U   C 2 2   ? 11.330  20.085  10.481  0.72 33.00 ? 59  U   D "O5'" 1 
ATOM   5153 C  "C5'" . U   C 2 2   ? 10.190  20.586  9.789   0.72 31.09 ? 59  U   D "C5'" 1 
ATOM   5154 C  "C4'" . U   C 2 2   ? 10.593  21.483  8.638   0.72 32.37 ? 59  U   D "C4'" 1 
ATOM   5155 O  "O4'" . U   C 2 2   ? 11.233  22.685  9.147   0.72 32.43 ? 59  U   D "O4'" 1 
ATOM   5156 C  "C3'" . U   C 2 2   ? 11.618  20.898  7.673   0.72 29.72 ? 59  U   D "C3'" 1 
ATOM   5157 O  "O3'" . U   C 2 2   ? 11.041  20.038  6.704   0.72 31.24 ? 59  U   D "O3'" 1 
ATOM   5158 C  "C2'" . U   C 2 2   ? 12.263  22.140  7.071   0.72 30.30 ? 59  U   D "C2'" 1 
ATOM   5159 O  "O2'" . U   C 2 2   ? 11.452  22.681  6.031   0.72 26.85 ? 59  U   D "O2'" 1 
ATOM   5160 C  "C1'" . U   C 2 2   ? 12.257  23.100  8.266   0.72 33.25 ? 59  U   D "C1'" 1 
ATOM   5161 N  N1    . U   C 2 2   ? 13.546  23.064  8.992   0.72 28.85 ? 59  U   D N1    1 
ATOM   5162 C  C2    . U   C 2 2   ? 14.598  23.774  8.453   0.72 31.41 ? 59  U   D C2    1 
ATOM   5163 O  O2    . U   C 2 2   ? 14.482  24.426  7.425   0.72 29.26 ? 59  U   D O2    1 
ATOM   5164 N  N3    . U   C 2 2   ? 15.780  23.698  9.157   0.72 33.27 ? 59  U   D N3    1 
ATOM   5165 C  C4    . U   C 2 2   ? 16.003  22.990  10.320  0.72 34.72 ? 59  U   D C4    1 
ATOM   5166 O  O4    . U   C 2 2   ? 17.119  23.008  10.845  0.72 33.96 ? 59  U   D O4    1 
ATOM   5167 C  C5    . U   C 2 2   ? 14.862  22.275  10.808  0.72 34.74 ? 59  U   D C5    1 
ATOM   5168 C  C6    . U   C 2 2   ? 13.697  22.327  10.146  0.72 32.60 ? 59  U   D C6    1 
ATOM   5169 O  "O5'" . A   D 2 1   ? 43.317  -11.001 27.442  0.66 33.31 ? 58  A   H "O5'" 1 
ATOM   5170 C  "C5'" . A   D 2 1   ? 42.510  -10.594 28.536  0.66 34.70 ? 58  A   H "C5'" 1 
ATOM   5171 C  "C4'" . A   D 2 1   ? 41.244  -11.414 28.633  0.66 38.59 ? 58  A   H "C4'" 1 
ATOM   5172 O  "O4'" . A   D 2 1   ? 41.549  -12.823 28.437  0.66 35.60 ? 58  A   H "O4'" 1 
ATOM   5173 C  "C3'" . A   D 2 1   ? 40.540  -11.368 29.981  0.66 39.16 ? 58  A   H "C3'" 1 
ATOM   5174 O  "O3'" . A   D 2 1   ? 39.713  -10.232 30.142  0.66 40.94 ? 58  A   H "O3'" 1 
ATOM   5175 C  "C2'" . A   D 2 1   ? 39.777  -12.683 30.011  0.66 37.12 ? 58  A   H "C2'" 1 
ATOM   5176 O  "O2'" . A   D 2 1   ? 38.589  -12.590 29.238  0.66 38.38 ? 58  A   H "O2'" 1 
ATOM   5177 C  "C1'" . A   D 2 1   ? 40.765  -13.614 29.306  0.66 37.85 ? 58  A   H "C1'" 1 
ATOM   5178 N  N9    . A   D 2 1   ? 41.681  -14.248 30.270  0.66 37.51 ? 58  A   H N9    1 
ATOM   5179 C  C8    . A   D 2 1   ? 43.054  -14.140 30.306  0.66 37.51 ? 58  A   H C8    1 
ATOM   5180 N  N7    . A   D 2 1   ? 43.612  -14.806 31.286  0.66 38.11 ? 58  A   H N7    1 
ATOM   5181 C  C5    . A   D 2 1   ? 42.531  -15.396 31.943  0.66 39.56 ? 58  A   H C5    1 
ATOM   5182 C  C6    . A   D 2 1   ? 42.448  -16.235 33.075  0.66 41.68 ? 58  A   H C6    1 
ATOM   5183 N  N6    . A   D 2 1   ? 43.508  -16.651 33.773  0.66 39.54 ? 58  A   H N6    1 
ATOM   5184 N  N1    . A   D 2 1   ? 41.222  -16.642 33.470  0.66 35.42 ? 58  A   H N1    1 
ATOM   5185 C  C2    . A   D 2 1   ? 40.157  -16.231 32.772  0.66 37.71 ? 58  A   H C2    1 
ATOM   5186 N  N3    . A   D 2 1   ? 40.098  -15.445 31.700  0.66 37.07 ? 58  A   H N3    1 
ATOM   5187 C  C4    . A   D 2 1   ? 41.334  -15.057 31.327  0.66 39.84 ? 58  A   H C4    1 
ATOM   5188 P  P     . U   D 2 2   ? 40.094  -9.121  31.236  0.68 42.39 ? 59  U   H P     1 
ATOM   5189 O  OP1   . U   D 2 2   ? 39.014  -8.095  31.248  0.68 32.73 ? 59  U   H OP1   1 
ATOM   5190 O  OP2   . U   D 2 2   ? 41.520  -8.747  30.984  0.68 30.39 ? 59  U   H OP2   1 
ATOM   5191 O  "O5'" . U   D 2 2   ? 40.048  -9.911  32.619  0.68 37.00 ? 59  U   H "O5'" 1 
ATOM   5192 C  "C5'" . U   D 2 2   ? 38.908  -10.674 32.995  0.68 36.21 ? 59  U   H "C5'" 1 
ATOM   5193 C  "C4'" . U   D 2 2   ? 39.195  -11.520 34.211  0.68 35.84 ? 59  U   H "C4'" 1 
ATOM   5194 O  "O4'" . U   D 2 2   ? 40.022  -12.661 33.854  0.68 34.28 ? 59  U   H "O4'" 1 
ATOM   5195 C  "C3'" . U   D 2 2   ? 39.980  -10.840 35.322  0.68 32.53 ? 59  U   H "C3'" 1 
ATOM   5196 O  "O3'" . U   D 2 2   ? 39.177  -9.988  36.122  0.68 31.52 ? 59  U   H "O3'" 1 
ATOM   5197 C  "C2'" . U   D 2 2   ? 40.558  -12.026 36.080  0.68 33.86 ? 59  U   H "C2'" 1 
ATOM   5198 O  "O2'" . U   D 2 2   ? 39.561  -12.627 36.897  0.68 32.06 ? 59  U   H "O2'" 1 
ATOM   5199 C  "C1'" . U   D 2 2   ? 40.885  -12.981 34.930  0.68 34.79 ? 59  U   H "C1'" 1 
ATOM   5200 N  N1    . U   D 2 2   ? 42.288  -12.829 34.481  0.68 32.93 ? 59  U   H N1    1 
ATOM   5201 C  C2    . U   D 2 2   ? 43.271  -13.460 35.227  0.68 35.75 ? 59  U   H C2    1 
ATOM   5202 O  O2    . U   D 2 2   ? 43.014  -14.133 36.222  0.68 34.67 ? 59  U   H O2    1 
ATOM   5203 N  N3    . U   D 2 2   ? 44.560  -13.286 34.770  0.68 33.97 ? 59  U   H N3    1 
ATOM   5204 C  C4    . U   D 2 2   ? 44.943  -12.552 33.664  0.68 35.34 ? 59  U   H C4    1 
ATOM   5205 O  O4    . U   D 2 2   ? 46.140  -12.469 33.365  0.68 35.42 ? 59  U   H O4    1 
ATOM   5206 C  C5    . U   D 2 2   ? 43.861  -11.934 32.951  0.68 35.70 ? 59  U   H C5    1 
ATOM   5207 C  C6    . U   D 2 2   ? 42.602  -12.083 33.369  0.68 35.71 ? 59  U   H C6    1 
HETATM 5208 MG MG    . MG  E 3 .   ? 17.575  -1.547  17.943  1.00 42.85 ? 401 MG  A MG    1 
HETATM 5209 MG MG    . MG  F 3 .   ? 9.308   -5.242  -1.652  1.00 38.06 ? 402 MG  A MG    1 
HETATM 5210 BR BR    . BR  G 4 .   ? 30.351  -0.683  6.256   1.00 52.73 ? 403 BR  A BR    1 
HETATM 5211 MG MG    . MG  H 3 .   ? 19.145  -23.329 38.787  1.00 31.18 ? 401 MG  B MG    1 
HETATM 5212 BR BR    . BR  I 4 .   ? 39.164  -6.648  34.946  0.71 38.59 ? 402 BR  B BR    1 
HETATM 5213 BR BR    . BR  J 4 .   ? 10.976  16.853  7.467   0.78 30.79 ? 101 BR  D BR    1 
HETATM 5214 O  O     . HOH K 5 .   ? 27.683  16.369  -1.493  1.00 22.37 ? 501 HOH A O     1 
HETATM 5215 O  O     . HOH K 5 .   ? 2.361   21.595  7.275   1.00 27.20 ? 502 HOH A O     1 
HETATM 5216 O  O     . HOH K 5 .   ? 15.244  -10.036 5.949   1.00 30.42 ? 503 HOH A O     1 
HETATM 5217 O  O     . HOH K 5 .   ? 18.877  19.360  14.905  1.00 26.46 ? 504 HOH A O     1 
HETATM 5218 O  O     . HOH K 5 .   ? 26.256  7.187   -4.311  1.00 28.38 ? 505 HOH A O     1 
HETATM 5219 O  O     . HOH K 5 .   ? 13.043  18.622  21.485  1.00 34.58 ? 506 HOH A O     1 
HETATM 5220 O  O     . HOH K 5 .   ? 15.104  -8.010  -0.273  1.00 34.96 ? 507 HOH A O     1 
HETATM 5221 O  O     . HOH K 5 .   ? 10.847  -2.184  -1.654  1.00 22.89 ? 508 HOH A O     1 
HETATM 5222 O  O     . HOH K 5 .   ? 8.620   8.266   -1.872  1.00 24.41 ? 509 HOH A O     1 
HETATM 5223 O  O     . HOH K 5 .   ? 1.620   37.509  -2.121  1.00 45.83 ? 510 HOH A O     1 
HETATM 5224 O  O     . HOH K 5 .   ? 20.673  -2.506  -7.598  1.00 34.09 ? 511 HOH A O     1 
HETATM 5225 O  O     . HOH K 5 .   ? 26.518  19.344  16.944  1.00 32.27 ? 512 HOH A O     1 
HETATM 5226 O  O     . HOH K 5 .   ? -3.408  9.877   10.760  1.00 34.66 ? 513 HOH A O     1 
HETATM 5227 O  O     . HOH K 5 .   ? 29.767  15.264  11.715  1.00 27.43 ? 514 HOH A O     1 
HETATM 5228 O  O     . HOH K 5 .   ? 7.240   40.827  23.686  1.00 44.56 ? 515 HOH A O     1 
HETATM 5229 O  O     . HOH K 5 .   ? 28.312  18.955  23.983  1.00 40.15 ? 516 HOH A O     1 
HETATM 5230 O  O     . HOH K 5 .   ? 18.793  1.274   17.573  1.00 25.20 ? 517 HOH A O     1 
HETATM 5231 O  O     . HOH K 5 .   ? 31.605  14.418  3.732   1.00 23.71 ? 518 HOH A O     1 
HETATM 5232 O  O     . HOH K 5 .   ? 26.182  0.819   4.361   1.00 21.36 ? 519 HOH A O     1 
HETATM 5233 O  O     . HOH K 5 .   ? 24.837  20.692  1.805   1.00 23.86 ? 520 HOH A O     1 
HETATM 5234 O  O     . HOH K 5 .   ? 28.457  5.152   21.115  1.00 40.84 ? 521 HOH A O     1 
HETATM 5235 O  O     . HOH K 5 .   ? 14.181  32.758  4.415   1.00 37.43 ? 522 HOH A O     1 
HETATM 5236 O  O     . HOH K 5 .   ? 14.095  -12.740 10.227  1.00 45.66 ? 523 HOH A O     1 
HETATM 5237 O  O     . HOH K 5 .   ? 13.511  11.765  20.909  1.00 31.10 ? 524 HOH A O     1 
HETATM 5238 O  O     . HOH K 5 .   ? 21.325  25.436  -4.875  1.00 30.93 ? 525 HOH A O     1 
HETATM 5239 O  O     . HOH K 5 .   ? 26.578  14.583  -7.941  1.00 37.93 ? 526 HOH A O     1 
HETATM 5240 O  O     . HOH K 5 .   ? 13.299  -1.950  -5.737  1.00 33.67 ? 527 HOH A O     1 
HETATM 5241 O  O     . HOH K 5 .   ? 12.357  17.673  15.065  1.00 34.42 ? 528 HOH A O     1 
HETATM 5242 O  O     . HOH K 5 .   ? -10.938 36.537  4.232   1.00 26.59 ? 529 HOH A O     1 
HETATM 5243 O  O     . HOH K 5 .   ? -12.466 34.513  8.965   1.00 46.47 ? 530 HOH A O     1 
HETATM 5244 O  O     . HOH K 5 .   ? 24.786  26.634  12.476  1.00 29.05 ? 531 HOH A O     1 
HETATM 5245 O  O     . HOH K 5 .   ? 25.867  -2.648  19.797  1.00 46.16 ? 532 HOH A O     1 
HETATM 5246 O  O     . HOH K 5 .   ? 4.146   -5.786  4.417   1.00 32.10 ? 533 HOH A O     1 
HETATM 5247 O  O     . HOH K 5 .   ? 33.618  5.726   11.988  1.00 41.33 ? 534 HOH A O     1 
HETATM 5248 O  O     . HOH K 5 .   ? 28.778  1.632   4.834   1.00 33.75 ? 535 HOH A O     1 
HETATM 5249 O  O     . HOH K 5 .   ? 25.502  0.858   1.706   1.00 31.35 ? 536 HOH A O     1 
HETATM 5250 O  O     . HOH K 5 .   ? 9.328   33.449  12.088  1.00 25.80 ? 537 HOH A O     1 
HETATM 5251 O  O     . HOH K 5 .   ? 24.342  10.498  -6.937  1.00 30.81 ? 538 HOH A O     1 
HETATM 5252 O  O     . HOH K 5 .   ? 14.108  25.917  -4.788  1.00 31.05 ? 539 HOH A O     1 
HETATM 5253 O  O     . HOH K 5 .   ? 5.097   7.631   15.285  1.00 47.35 ? 540 HOH A O     1 
HETATM 5254 O  O     . HOH K 5 .   ? 6.691   40.476  15.905  1.00 37.16 ? 541 HOH A O     1 
HETATM 5255 O  O     . HOH K 5 .   ? 5.937   15.083  -2.687  1.00 33.44 ? 542 HOH A O     1 
HETATM 5256 O  O     . HOH K 5 .   ? 2.204   -3.984  4.546   1.00 38.18 ? 543 HOH A O     1 
HETATM 5257 O  O     . HOH K 5 .   ? 11.024  32.189  -2.908  1.00 37.44 ? 544 HOH A O     1 
HETATM 5258 O  O     . HOH K 5 .   ? 15.069  25.650  -8.894  1.00 32.44 ? 545 HOH A O     1 
HETATM 5259 O  O     . HOH K 5 .   ? 18.595  34.503  -8.734  1.00 34.84 ? 546 HOH A O     1 
HETATM 5260 O  O     . HOH K 5 .   ? 19.719  15.386  -12.262 1.00 39.28 ? 547 HOH A O     1 
HETATM 5261 O  O     . HOH K 5 .   ? 5.928   0.422   15.712  1.00 37.90 ? 548 HOH A O     1 
HETATM 5262 O  O     . HOH K 5 .   ? -7.325  27.832  1.171   1.00 35.62 ? 549 HOH A O     1 
HETATM 5263 O  O     . HOH K 5 .   ? 23.096  34.136  -12.491 1.00 47.20 ? 550 HOH A O     1 
HETATM 5264 O  O     . HOH K 5 .   ? 6.771   27.504  11.220  1.00 29.34 ? 551 HOH A O     1 
HETATM 5265 O  O     . HOH K 5 .   ? 9.013   -8.410  1.029   1.00 35.65 ? 552 HOH A O     1 
HETATM 5266 O  O     . HOH K 5 .   ? 15.692  17.325  -15.545 1.00 44.32 ? 553 HOH A O     1 
HETATM 5267 O  O     . HOH K 5 .   ? 25.027  -9.174  14.915  1.00 38.57 ? 554 HOH A O     1 
HETATM 5268 O  O     . HOH K 5 .   ? 32.152  14.828  16.743  1.00 34.39 ? 555 HOH A O     1 
HETATM 5269 O  O     . HOH K 5 .   ? 22.583  -1.159  -3.440  1.00 40.30 ? 556 HOH A O     1 
HETATM 5270 O  O     . HOH K 5 .   ? 0.274   -2.735  8.629   1.00 34.72 ? 557 HOH A O     1 
HETATM 5271 O  O     . HOH K 5 .   ? -4.530  31.338  24.198  1.00 41.67 ? 558 HOH A O     1 
HETATM 5272 O  O     . HOH K 5 .   ? 24.520  12.987  -8.170  1.00 34.05 ? 559 HOH A O     1 
HETATM 5273 O  O     . HOH K 5 .   ? 22.706  29.287  -13.161 1.00 38.54 ? 560 HOH A O     1 
HETATM 5274 O  O     . HOH K 5 .   ? 15.533  -12.421 1.961   1.00 41.00 ? 561 HOH A O     1 
HETATM 5275 O  O     . HOH K 5 .   ? 11.218  16.130  17.711  1.00 45.04 ? 562 HOH A O     1 
HETATM 5276 O  O     . HOH K 5 .   ? 6.531   21.321  -1.479  1.00 33.00 ? 563 HOH A O     1 
HETATM 5277 O  O     . HOH K 5 .   ? -12.535 21.876  18.338  1.00 49.00 ? 564 HOH A O     1 
HETATM 5278 O  O     . HOH K 5 .   ? 0.824   25.952  0.912   1.00 31.35 ? 565 HOH A O     1 
HETATM 5279 O  O     . HOH K 5 .   ? 30.370  11.790  21.557  1.00 42.36 ? 566 HOH A O     1 
HETATM 5280 O  O     . HOH K 5 .   ? 2.870   10.209  5.319   1.00 35.19 ? 567 HOH A O     1 
HETATM 5281 O  O     . HOH K 5 .   ? 17.174  24.731  -11.858 1.00 33.97 ? 568 HOH A O     1 
HETATM 5282 O  O     . HOH K 5 .   ? -13.872 28.262  11.334  1.00 46.02 ? 569 HOH A O     1 
HETATM 5283 O  O     . HOH K 5 .   ? -2.062  5.117   8.712   1.00 40.67 ? 570 HOH A O     1 
HETATM 5284 O  O     . HOH K 5 .   ? 27.501  1.381   0.295   1.00 37.10 ? 571 HOH A O     1 
HETATM 5285 O  O     . HOH K 5 .   ? 26.458  0.329   -1.775  1.00 38.56 ? 572 HOH A O     1 
HETATM 5286 O  O     . HOH K 5 .   ? 11.032  -7.654  -0.807  1.00 30.84 ? 573 HOH A O     1 
HETATM 5287 O  O     . HOH K 5 .   ? 29.777  2.423   2.079   1.00 42.04 ? 574 HOH A O     1 
HETATM 5288 O  O     . HOH K 5 .   ? 30.663  9.625   19.592  1.00 39.57 ? 575 HOH A O     1 
HETATM 5289 O  O     . HOH K 5 .   ? 31.954  -0.265  16.098  1.00 55.22 ? 576 HOH A O     1 
HETATM 5290 O  O     . HOH K 5 .   ? 22.114  4.747   22.682  1.00 38.33 ? 577 HOH A O     1 
HETATM 5291 O  O     . HOH K 5 .   ? 7.329   35.045  -1.915  1.00 52.73 ? 578 HOH A O     1 
HETATM 5292 O  O     . HOH K 5 .   ? 14.554  -12.514 4.380   1.00 36.84 ? 579 HOH A O     1 
HETATM 5293 O  O     . HOH K 5 .   ? 6.459   -9.832  9.737   1.00 47.21 ? 580 HOH A O     1 
HETATM 5294 O  O     . HOH K 5 .   ? 0.206   -3.465  6.144   1.00 42.36 ? 581 HOH A O     1 
HETATM 5295 O  O     . HOH K 5 .   ? -12.495 17.767  7.465   1.00 46.58 ? 582 HOH A O     1 
HETATM 5296 O  O     . HOH K 5 .   ? -2.601  32.557  0.824   1.00 23.59 ? 583 HOH A O     1 
HETATM 5297 O  O     . HOH K 5 .   ? 10.204  30.891  11.388  1.00 45.10 ? 584 HOH A O     1 
HETATM 5298 O  O     . HOH K 5 .   ? 8.773   29.405  9.976   1.00 37.48 ? 585 HOH A O     1 
HETATM 5299 O  O     . HOH K 5 .   ? 5.247   22.539  13.929  1.00 37.54 ? 586 HOH A O     1 
HETATM 5300 O  O     . HOH K 5 .   ? 8.930   31.290  -1.739  1.00 39.27 ? 587 HOH A O     1 
HETATM 5301 O  O     . HOH K 5 .   ? 7.202   8.440   -5.369  1.00 34.31 ? 588 HOH A O     1 
HETATM 5302 O  O     . HOH K 5 .   ? 17.857  13.553  23.303  1.00 44.51 ? 589 HOH A O     1 
HETATM 5303 O  O     . HOH K 5 .   ? 15.921  23.371  19.815  1.00 46.56 ? 590 HOH A O     1 
HETATM 5304 O  O     . HOH K 5 .   ? 27.454  3.437   -9.349  1.00 40.28 ? 591 HOH A O     1 
HETATM 5305 O  O     . HOH K 5 .   ? 17.063  8.569   -11.236 1.00 42.93 ? 592 HOH A O     1 
HETATM 5306 O  O     . HOH K 5 .   ? 7.180   13.227  -11.184 1.00 52.58 ? 593 HOH A O     1 
HETATM 5307 O  O     . HOH K 5 .   ? 23.309  -4.119  4.002   1.00 42.61 ? 594 HOH A O     1 
HETATM 5308 O  O     . HOH K 5 .   ? 31.020  4.099   1.354   1.00 43.06 ? 595 HOH A O     1 
HETATM 5309 O  O     . HOH K 5 .   ? 27.388  -14.119 6.026   1.00 44.03 ? 596 HOH A O     1 
HETATM 5310 O  O     . HOH K 5 .   ? 34.540  25.392  1.972   1.00 51.22 ? 597 HOH A O     1 
HETATM 5311 O  O     . HOH K 5 .   ? 7.373   24.860  17.033  1.00 47.66 ? 598 HOH A O     1 
HETATM 5312 O  O     . HOH K 5 .   ? 11.070  10.565  21.730  1.00 37.42 ? 599 HOH A O     1 
HETATM 5313 O  O     . HOH K 5 .   ? 8.935   -9.120  13.965  1.00 47.43 ? 600 HOH A O     1 
HETATM 5314 O  O     . HOH K 5 .   ? 7.006   -2.681  15.550  1.00 42.67 ? 601 HOH A O     1 
HETATM 5315 O  O     . HOH K 5 .   ? 8.897   42.073  27.627  1.00 41.49 ? 602 HOH A O     1 
HETATM 5316 O  O     . HOH K 5 .   ? 5.477   4.974   26.422  1.00 47.55 ? 603 HOH A O     1 
HETATM 5317 O  O     . HOH K 5 .   ? 34.731  28.865  5.890   1.00 48.36 ? 604 HOH A O     1 
HETATM 5318 O  O     . HOH K 5 .   ? 12.956  -8.270  -1.124  1.00 39.72 ? 605 HOH A O     1 
HETATM 5319 O  O     . HOH K 5 .   ? 16.817  -9.911  -6.873  1.00 49.81 ? 606 HOH A O     1 
HETATM 5320 O  O     . HOH K 5 .   ? 0.631   8.916   4.160   1.00 45.65 ? 607 HOH A O     1 
HETATM 5321 O  O     . HOH K 5 .   ? -2.943  2.954   2.219   1.00 46.87 ? 608 HOH A O     1 
HETATM 5322 O  O     . HOH K 5 .   ? 9.738   17.561  4.854   1.00 34.38 ? 609 HOH A O     1 
HETATM 5323 O  O     . HOH K 5 .   ? 4.112   20.339  7.862   1.00 35.31 ? 610 HOH A O     1 
HETATM 5324 O  O     . HOH K 5 .   ? 1.370   15.711  0.765   1.00 49.61 ? 611 HOH A O     1 
HETATM 5325 O  O     . HOH K 5 .   ? 5.806   14.072  10.958  1.00 38.54 ? 612 HOH A O     1 
HETATM 5326 O  O     . HOH K 5 .   ? 6.725   19.380  9.635   1.00 43.64 ? 613 HOH A O     1 
HETATM 5327 O  O     . HOH K 5 .   ? 9.415   33.359  19.642  1.00 38.90 ? 614 HOH A O     1 
HETATM 5328 O  O     . HOH K 5 .   ? 7.922   7.241   -8.043  1.00 39.58 ? 615 HOH A O     1 
HETATM 5329 O  O     . HOH K 5 .   ? 10.758  40.020  16.199  1.00 50.64 ? 616 HOH A O     1 
HETATM 5330 O  O     . HOH K 5 .   ? 13.290  25.791  -7.534  1.00 41.58 ? 617 HOH A O     1 
HETATM 5331 O  O     . HOH K 5 .   ? 16.235  27.500  -10.562 1.00 39.53 ? 618 HOH A O     1 
HETATM 5332 O  O     . HOH K 5 .   ? 17.381  -2.427  20.635  1.00 51.49 ? 619 HOH A O     1 
HETATM 5333 O  O     . HOH K 5 .   ? 22.227  19.825  25.228  1.00 47.84 ? 620 HOH A O     1 
HETATM 5334 O  O     . HOH K 5 .   ? 22.903  17.048  25.825  1.00 44.34 ? 621 HOH A O     1 
HETATM 5335 O  O     . HOH K 5 .   ? 32.886  0.086   2.776   1.00 47.01 ? 622 HOH A O     1 
HETATM 5336 O  O     . HOH K 5 .   ? 22.791  15.633  -10.755 1.00 35.11 ? 623 HOH A O     1 
HETATM 5337 O  O     . HOH K 5 .   ? 23.173  28.386  -1.220  1.00 39.70 ? 624 HOH A O     1 
HETATM 5338 O  O     . HOH K 5 .   ? 25.833  27.575  -5.509  1.00 48.21 ? 625 HOH A O     1 
HETATM 5339 O  O     . HOH K 5 .   ? 18.591  37.363  -2.068  1.00 42.23 ? 626 HOH A O     1 
HETATM 5340 O  O     . HOH K 5 .   ? 15.406  18.558  -18.018 1.00 53.81 ? 627 HOH A O     1 
HETATM 5341 O  O     . HOH K 5 .   ? 18.484  -8.154  7.651   1.00 43.46 ? 628 HOH A O     1 
HETATM 5342 O  O     . HOH K 5 .   ? 16.893  -9.913  8.038   1.00 44.56 ? 629 HOH A O     1 
HETATM 5343 O  O     . HOH K 5 .   ? 32.667  9.789   6.640   1.00 38.83 ? 630 HOH A O     1 
HETATM 5344 O  O     . HOH K 5 .   ? 32.974  8.203   4.860   1.00 50.45 ? 631 HOH A O     1 
HETATM 5345 O  O     . HOH K 5 .   ? 37.336  18.696  2.819   1.00 43.38 ? 632 HOH A O     1 
HETATM 5346 O  O     . HOH K 5 .   ? 9.291   13.324  13.389  1.00 41.64 ? 633 HOH A O     1 
HETATM 5347 O  O     . HOH K 5 .   ? 10.824  11.755  14.242  1.00 37.78 ? 634 HOH A O     1 
HETATM 5348 O  O     . HOH K 5 .   ? 2.229   -7.804  5.490   1.00 42.30 ? 635 HOH A O     1 
HETATM 5349 O  O     . HOH K 5 .   ? 31.820  22.028  18.284  1.00 35.17 ? 636 HOH A O     1 
HETATM 5350 O  O     . HOH K 5 .   ? 29.067  26.726  17.439  1.00 54.62 ? 637 HOH A O     1 
HETATM 5351 O  O     . HOH K 5 .   ? 13.521  30.897  17.288  1.00 53.32 ? 638 HOH A O     1 
HETATM 5352 O  O     . HOH K 5 .   ? 26.888  27.672  22.011  1.00 55.75 ? 639 HOH A O     1 
HETATM 5353 O  O     . HOH K 5 .   ? 16.523  -17.619 18.970  1.00 53.56 ? 640 HOH A O     1 
HETATM 5354 O  O     . HOH K 5 .   ? 24.781  -7.384  22.589  1.00 53.04 ? 641 HOH A O     1 
HETATM 5355 O  O     . HOH K 5 .   ? -7.703  38.948  20.475  1.00 46.77 ? 642 HOH A O     1 
HETATM 5356 O  O     . HOH K 5 .   ? 12.883  36.514  -1.287  1.00 47.82 ? 643 HOH A O     1 
HETATM 5357 O  O     . HOH K 5 .   ? 19.055  22.866  14.199  1.00 45.08 ? 644 HOH A O     1 
HETATM 5358 O  O     . HOH K 5 .   ? 8.314   14.646  11.408  1.00 42.42 ? 645 HOH A O     1 
HETATM 5359 O  O     . HOH K 5 .   ? 4.623   5.585   21.100  1.00 42.97 ? 646 HOH A O     1 
HETATM 5360 O  O     . HOH K 5 .   ? 7.181   -6.257  0.786   1.00 33.67 ? 647 HOH A O     1 
HETATM 5361 O  O     . HOH K 5 .   ? -5.035  32.468  -1.434  1.00 35.90 ? 648 HOH A O     1 
HETATM 5362 O  O     . HOH K 5 .   ? 6.454   6.698   19.139  1.00 44.45 ? 649 HOH A O     1 
HETATM 5363 O  O     . HOH K 5 .   ? -1.116  11.733  1.784   1.00 46.77 ? 650 HOH A O     1 
HETATM 5364 O  O     . HOH K 5 .   ? -9.940  43.488  7.913   1.00 33.90 ? 651 HOH A O     1 
HETATM 5365 O  O     . HOH K 5 .   ? 7.199   34.938  18.950  1.00 30.02 ? 652 HOH A O     1 
HETATM 5366 O  O     . HOH K 5 .   ? 16.225  8.446   -9.067  1.00 39.87 ? 653 HOH A O     1 
HETATM 5367 O  O     . HOH K 5 .   ? 3.961   6.399   17.498  1.00 48.13 ? 654 HOH A O     1 
HETATM 5368 O  O     . HOH K 5 .   ? 11.950  -7.263  20.664  1.00 47.16 ? 655 HOH A O     1 
HETATM 5369 O  O     . HOH K 5 .   ? 20.376  6.117   -10.084 1.00 40.28 ? 656 HOH A O     1 
HETATM 5370 O  O     . HOH K 5 .   ? 30.349  -4.639  14.615  1.00 49.00 ? 657 HOH A O     1 
HETATM 5371 O  O     . HOH K 5 .   ? 21.608  -5.380  0.433   1.00 45.17 ? 658 HOH A O     1 
HETATM 5372 O  O     . HOH K 5 .   ? 23.610  -7.162  4.083   1.00 52.97 ? 659 HOH A O     1 
HETATM 5373 O  O     . HOH K 5 .   ? 33.092  -1.613  14.743  1.00 55.64 ? 660 HOH A O     1 
HETATM 5374 O  O     . HOH K 5 .   ? 9.936   -15.764 3.583   1.00 51.23 ? 661 HOH A O     1 
HETATM 5375 O  O     . HOH K 5 .   ? 3.294   -4.582  13.243  1.00 56.37 ? 662 HOH A O     1 
HETATM 5376 O  O     . HOH K 5 .   ? 8.593   -10.203 8.414   1.00 35.34 ? 663 HOH A O     1 
HETATM 5377 O  O     . HOH K 5 .   ? 3.138   9.195   15.089  1.00 44.52 ? 664 HOH A O     1 
HETATM 5378 O  O     . HOH K 5 .   ? 3.130   7.352   13.807  1.00 40.23 ? 665 HOH A O     1 
HETATM 5379 O  O     . HOH K 5 .   ? -12.293 23.300  3.837   1.00 39.83 ? 666 HOH A O     1 
HETATM 5380 O  O     . HOH K 5 .   ? -9.662  19.191  3.241   1.00 34.34 ? 667 HOH A O     1 
HETATM 5381 O  O     . HOH K 5 .   ? -8.767  29.274  2.320   1.00 36.65 ? 668 HOH A O     1 
HETATM 5382 O  O     . HOH K 5 .   ? -7.995  40.202  1.919   1.00 20.40 ? 669 HOH A O     1 
HETATM 5383 O  O     . HOH K 5 .   ? 4.668   12.106  15.827  1.00 51.98 ? 670 HOH A O     1 
HETATM 5384 O  O     . HOH K 5 .   ? 16.974  26.861  6.239   1.00 34.37 ? 671 HOH A O     1 
HETATM 5385 O  O     . HOH K 5 .   ? 17.017  22.032  14.433  1.00 48.31 ? 672 HOH A O     1 
HETATM 5386 O  O     . HOH K 5 .   ? 34.847  9.897   13.528  1.00 38.59 ? 673 HOH A O     1 
HETATM 5387 O  O     . HOH K 5 .   ? 30.074  23.785  0.839   1.00 44.11 ? 674 HOH A O     1 
HETATM 5388 O  O     . HOH K 5 .   ? 28.590  10.566  -4.423  1.00 34.40 ? 675 HOH A O     1 
HETATM 5389 O  O     . HOH K 5 .   ? 25.102  0.133   20.617  1.00 35.70 ? 676 HOH A O     1 
HETATM 5390 O  O     . HOH K 5 .   ? -15.156 33.570  23.915  1.00 58.27 ? 677 HOH A O     1 
HETATM 5391 O  O     . HOH K 5 .   ? 4.437   41.883  15.404  1.00 49.31 ? 678 HOH A O     1 
HETATM 5392 O  O     . HOH K 5 .   ? 3.405   41.277  0.195   1.00 52.25 ? 679 HOH A O     1 
HETATM 5393 O  O     . HOH K 5 .   ? 17.797  -3.477  18.653  1.00 47.46 ? 680 HOH A O     1 
HETATM 5394 O  O     . HOH K 5 .   ? 30.036  28.866  17.323  1.00 54.11 ? 681 HOH A O     1 
HETATM 5395 O  O     . HOH K 5 .   ? 27.134  9.102   -7.154  1.00 47.66 ? 682 HOH A O     1 
HETATM 5396 O  O     . HOH K 5 .   ? 7.293   44.339  7.278   1.00 61.70 ? 683 HOH A O     1 
HETATM 5397 O  O     . HOH K 5 .   ? 11.061  35.183  11.282  1.00 42.61 ? 684 HOH A O     1 
HETATM 5398 O  O     . HOH K 5 .   ? 5.261   44.244  8.098   1.00 64.95 ? 685 HOH A O     1 
HETATM 5399 O  O     . HOH K 5 .   ? 15.359  12.680  24.702  1.00 45.17 ? 686 HOH A O     1 
HETATM 5400 O  O     . HOH K 5 .   ? 17.779  25.034  7.414   1.00 43.33 ? 687 HOH A O     1 
HETATM 5401 O  O     . HOH K 5 .   ? 10.888  34.263  -3.724  1.00 45.79 ? 688 HOH A O     1 
HETATM 5402 O  O     . HOH K 5 .   ? 4.361   19.012  9.432   1.00 40.94 ? 689 HOH A O     1 
HETATM 5403 O  O     . HOH K 5 .   ? 5.276   17.029  14.402  1.00 50.84 ? 690 HOH A O     1 
HETATM 5404 O  O     . HOH K 5 .   ? 18.012  0.147   21.259  1.00 43.01 ? 691 HOH A O     1 
HETATM 5405 O  O     . HOH K 5 .   ? 4.003   -8.039  13.183  1.00 58.88 ? 692 HOH A O     1 
HETATM 5406 O  O     . HOH K 5 .   ? 8.001   25.319  12.436  1.00 44.44 ? 693 HOH A O     1 
HETATM 5407 O  O     . HOH K 5 .   ? 5.923   40.405  11.630  1.00 53.62 ? 694 HOH A O     1 
HETATM 5408 O  O     . HOH K 5 .   ? 18.442  25.094  14.765  1.00 50.85 ? 695 HOH A O     1 
HETATM 5409 O  O     . HOH L 5 .   ? 30.895  -11.784 34.085  1.00 22.62 ? 501 HOH B O     1 
HETATM 5410 O  O     . HOH L 5 .   ? 53.591  -4.634  47.341  1.00 30.54 ? 502 HOH B O     1 
HETATM 5411 O  O     . HOH L 5 .   ? 19.791  -30.395 38.822  1.00 22.83 ? 503 HOH B O     1 
HETATM 5412 O  O     . HOH L 5 .   ? 24.947  -22.565 39.939  1.00 24.31 ? 504 HOH B O     1 
HETATM 5413 O  O     . HOH L 5 .   ? 34.356  1.632   43.304  1.00 20.93 ? 505 HOH B O     1 
HETATM 5414 O  O     . HOH L 5 .   ? 40.077  18.577  42.754  1.00 42.68 ? 506 HOH B O     1 
HETATM 5415 O  O     . HOH L 5 .   ? 47.239  9.403   26.175  1.00 28.52 ? 507 HOH B O     1 
HETATM 5416 O  O     . HOH L 5 .   ? 40.856  20.517  36.709  1.00 29.16 ? 508 HOH B O     1 
HETATM 5417 O  O     . HOH L 5 .   ? 52.083  -9.121  43.475  1.00 30.51 ? 509 HOH B O     1 
HETATM 5418 O  O     . HOH L 5 .   ? 44.253  -8.457  21.719  1.00 30.12 ? 510 HOH B O     1 
HETATM 5419 O  O     . HOH L 5 .   ? 40.942  -25.084 40.495  1.00 48.60 ? 511 HOH B O     1 
HETATM 5420 O  O     . HOH L 5 .   ? 52.030  10.528  40.803  1.00 30.64 ? 512 HOH B O     1 
HETATM 5421 O  O     . HOH L 5 .   ? 34.555  20.041  32.954  1.00 38.57 ? 513 HOH B O     1 
HETATM 5422 O  O     . HOH L 5 .   ? 35.727  12.344  43.330  1.00 24.61 ? 514 HOH B O     1 
HETATM 5423 O  O     . HOH L 5 .   ? 41.854  -7.318  27.711  1.00 37.70 ? 515 HOH B O     1 
HETATM 5424 O  O     . HOH L 5 .   ? 41.819  16.346  44.995  1.00 32.32 ? 516 HOH B O     1 
HETATM 5425 O  O     . HOH L 5 .   ? 47.420  -14.430 49.499  1.00 26.65 ? 517 HOH B O     1 
HETATM 5426 O  O     . HOH L 5 .   ? 50.882  4.419   49.314  1.00 30.73 ? 518 HOH B O     1 
HETATM 5427 O  O     . HOH L 5 .   ? 50.501  -4.899  57.174  1.00 33.28 ? 519 HOH B O     1 
HETATM 5428 O  O     . HOH L 5 .   ? 43.903  -1.886  22.091  1.00 33.63 ? 520 HOH B O     1 
HETATM 5429 O  O     . HOH L 5 .   ? 51.165  11.174  46.731  1.00 36.59 ? 521 HOH B O     1 
HETATM 5430 O  O     . HOH L 5 .   ? 38.928  -6.025  58.377  1.00 41.13 ? 522 HOH B O     1 
HETATM 5431 O  O     . HOH L 5 .   ? 40.217  -15.611 48.779  1.00 37.77 ? 523 HOH B O     1 
HETATM 5432 O  O     . HOH L 5 .   ? 48.610  -8.597  29.371  1.00 29.97 ? 524 HOH B O     1 
HETATM 5433 O  O     . HOH L 5 .   ? 31.744  1.349   46.525  1.00 34.70 ? 525 HOH B O     1 
HETATM 5434 O  O     . HOH L 5 .   ? 44.327  6.266   53.802  1.00 36.13 ? 526 HOH B O     1 
HETATM 5435 O  O     . HOH L 5 .   ? 32.031  -14.968 41.573  1.00 44.10 ? 527 HOH B O     1 
HETATM 5436 O  O     . HOH L 5 .   ? 48.810  -1.784  53.354  1.00 35.83 ? 528 HOH B O     1 
HETATM 5437 O  O     . HOH L 5 .   ? 20.507  -28.735 30.203  1.00 46.89 ? 529 HOH B O     1 
HETATM 5438 O  O     . HOH L 5 .   ? 46.136  -26.734 45.908  1.00 33.09 ? 530 HOH B O     1 
HETATM 5439 O  O     . HOH L 5 .   ? 63.227  -3.386  26.068  1.00 50.12 ? 531 HOH B O     1 
HETATM 5440 O  O     . HOH L 5 .   ? 47.411  21.914  34.023  1.00 42.39 ? 532 HOH B O     1 
HETATM 5441 O  O     . HOH L 5 .   ? 49.929  -16.579 46.460  1.00 29.35 ? 533 HOH B O     1 
HETATM 5442 O  O     . HOH L 5 .   ? 48.642  -3.214  20.871  1.00 39.93 ? 534 HOH B O     1 
HETATM 5443 O  O     . HOH L 5 .   ? 42.630  20.549  34.905  1.00 44.10 ? 535 HOH B O     1 
HETATM 5444 O  O     . HOH L 5 .   ? 48.689  1.125   51.683  1.00 32.72 ? 536 HOH B O     1 
HETATM 5445 O  O     . HOH L 5 .   ? 34.822  -4.079  30.311  1.00 36.84 ? 537 HOH B O     1 
HETATM 5446 O  O     . HOH L 5 .   ? 33.873  9.394   25.362  1.00 50.40 ? 538 HOH B O     1 
HETATM 5447 O  O     . HOH L 5 .   ? 51.981  -19.427 36.945  1.00 40.66 ? 539 HOH B O     1 
HETATM 5448 O  O     . HOH L 5 .   ? 42.480  -26.207 44.890  1.00 42.48 ? 540 HOH B O     1 
HETATM 5449 O  O     . HOH L 5 .   ? 37.327  12.345  47.697  1.00 34.57 ? 541 HOH B O     1 
HETATM 5450 O  O     . HOH L 5 .   ? 44.395  -23.666 52.716  1.00 30.74 ? 542 HOH B O     1 
HETATM 5451 O  O     . HOH L 5 .   ? 32.777  -26.572 18.378  1.00 49.24 ? 543 HOH B O     1 
HETATM 5452 O  O     . HOH L 5 .   ? 29.601  -2.949  36.224  1.00 41.47 ? 544 HOH B O     1 
HETATM 5453 O  O     . HOH L 5 .   ? 24.797  -1.494  36.485  1.00 52.53 ? 545 HOH B O     1 
HETATM 5454 O  O     . HOH L 5 .   ? 30.018  -0.600  34.861  1.00 37.25 ? 546 HOH B O     1 
HETATM 5455 O  O     . HOH L 5 .   ? 31.677  -5.748  43.662  1.00 44.48 ? 547 HOH B O     1 
HETATM 5456 O  O     . HOH L 5 .   ? 17.458  -26.588 35.820  1.00 30.75 ? 548 HOH B O     1 
HETATM 5457 O  O     . HOH L 5 .   ? 34.221  18.592  40.209  1.00 33.42 ? 549 HOH B O     1 
HETATM 5458 O  O     . HOH L 5 .   ? 47.613  12.337  47.753  1.00 37.56 ? 550 HOH B O     1 
HETATM 5459 O  O     . HOH L 5 .   ? 46.247  -27.573 40.451  1.00 51.33 ? 551 HOH B O     1 
HETATM 5460 O  O     . HOH L 5 .   ? 27.042  -23.112 16.750  1.00 42.37 ? 552 HOH B O     1 
HETATM 5461 O  O     . HOH L 5 .   ? 56.615  14.476  28.501  1.00 34.75 ? 553 HOH B O     1 
HETATM 5462 O  O     . HOH L 5 .   ? 42.277  -22.269 38.759  1.00 41.89 ? 554 HOH B O     1 
HETATM 5463 O  O     . HOH L 5 .   ? 41.514  -14.247 55.040  1.00 32.54 ? 555 HOH B O     1 
HETATM 5464 O  O     . HOH L 5 .   ? 19.216  -19.522 37.673  1.00 39.41 ? 556 HOH B O     1 
HETATM 5465 O  O     . HOH L 5 .   ? 40.223  -14.834 51.535  1.00 36.49 ? 557 HOH B O     1 
HETATM 5466 O  O     . HOH L 5 .   ? 54.323  -5.502  19.332  1.00 41.86 ? 558 HOH B O     1 
HETATM 5467 O  O     . HOH L 5 .   ? 17.440  -20.581 39.187  1.00 35.72 ? 559 HOH B O     1 
HETATM 5468 O  O     . HOH L 5 .   ? 56.555  -7.876  29.132  1.00 31.30 ? 560 HOH B O     1 
HETATM 5469 O  O     . HOH L 5 .   ? 58.453  -3.537  34.831  1.00 29.31 ? 561 HOH B O     1 
HETATM 5470 O  O     . HOH L 5 .   ? 58.362  -2.360  42.830  1.00 31.46 ? 562 HOH B O     1 
HETATM 5471 O  O     . HOH L 5 .   ? 51.745  18.547  38.903  1.00 38.77 ? 563 HOH B O     1 
HETATM 5472 O  O     . HOH L 5 .   ? 54.529  -15.218 33.145  1.00 36.53 ? 564 HOH B O     1 
HETATM 5473 O  O     . HOH L 5 .   ? 30.135  15.587  36.261  1.00 31.06 ? 565 HOH B O     1 
HETATM 5474 O  O     . HOH L 5 .   ? 27.051  0.816   35.731  1.00 38.74 ? 566 HOH B O     1 
HETATM 5475 O  O     . HOH L 5 .   ? 38.166  -28.430 45.214  1.00 60.64 ? 567 HOH B O     1 
HETATM 5476 O  O     . HOH L 5 .   ? 31.983  -17.023 43.443  1.00 39.73 ? 568 HOH B O     1 
HETATM 5477 O  O     . HOH L 5 .   ? 38.099  -19.833 32.705  1.00 44.45 ? 569 HOH B O     1 
HETATM 5478 O  O     . HOH L 5 .   ? 36.356  -21.356 44.035  1.00 41.55 ? 570 HOH B O     1 
HETATM 5479 O  O     . HOH L 5 .   ? 43.265  -18.080 36.388  1.00 42.97 ? 571 HOH B O     1 
HETATM 5480 O  O     . HOH L 5 .   ? 31.338  -3.387  52.452  1.00 49.30 ? 572 HOH B O     1 
HETATM 5481 O  O     . HOH L 5 .   ? 40.991  2.849   53.668  1.00 43.29 ? 573 HOH B O     1 
HETATM 5482 O  O     . HOH L 5 .   ? 35.926  1.090   54.801  1.00 46.40 ? 574 HOH B O     1 
HETATM 5483 O  O     . HOH L 5 .   ? 31.499  1.893   43.218  1.00 41.39 ? 575 HOH B O     1 
HETATM 5484 O  O     . HOH L 5 .   ? 53.885  -9.478  20.943  1.00 51.21 ? 576 HOH B O     1 
HETATM 5485 O  O     . HOH L 5 .   ? 61.996  -10.158 28.625  1.00 41.32 ? 577 HOH B O     1 
HETATM 5486 O  O     . HOH L 5 .   ? 51.164  7.352   54.201  1.00 46.96 ? 578 HOH B O     1 
HETATM 5487 O  O     . HOH L 5 .   ? 49.034  -16.036 56.257  1.00 41.36 ? 579 HOH B O     1 
HETATM 5488 O  O     . HOH L 5 .   ? 46.954  -17.972 58.196  1.00 44.72 ? 580 HOH B O     1 
HETATM 5489 O  O     . HOH L 5 .   ? 57.179  -11.683 45.242  1.00 43.10 ? 581 HOH B O     1 
HETATM 5490 O  O     . HOH L 5 .   ? 61.554  -2.775  30.484  1.00 35.98 ? 582 HOH B O     1 
HETATM 5491 O  O     . HOH L 5 .   ? 59.769  -7.383  22.798  1.00 37.93 ? 583 HOH B O     1 
HETATM 5492 O  O     . HOH L 5 .   ? 45.576  -16.210 37.896  1.00 45.15 ? 584 HOH B O     1 
HETATM 5493 O  O     . HOH L 5 .   ? 34.060  6.473   18.768  1.00 48.49 ? 585 HOH B O     1 
HETATM 5494 O  O     . HOH L 5 .   ? 39.380  23.087  37.735  1.00 40.20 ? 586 HOH B O     1 
HETATM 5495 O  O     . HOH L 5 .   ? 28.185  21.704  32.442  1.00 53.28 ? 587 HOH B O     1 
HETATM 5496 O  O     . HOH L 5 .   ? 30.488  15.819  39.152  1.00 36.35 ? 588 HOH B O     1 
HETATM 5497 O  O     . HOH L 5 .   ? 31.230  15.594  28.704  1.00 50.76 ? 589 HOH B O     1 
HETATM 5498 O  O     . HOH L 5 .   ? 28.708  -9.165  25.204  1.00 54.07 ? 590 HOH B O     1 
HETATM 5499 O  O     . HOH L 5 .   ? 20.717  -17.941 41.661  1.00 37.97 ? 591 HOH B O     1 
HETATM 5500 O  O     . HOH L 5 .   ? 32.528  16.484  39.812  1.00 33.20 ? 592 HOH B O     1 
HETATM 5501 O  O     . HOH L 5 .   ? 37.690  -6.796  36.298  1.00 39.29 ? 593 HOH B O     1 
HETATM 5502 O  O     . HOH L 5 .   ? 28.262  -15.909 40.196  1.00 41.75 ? 594 HOH B O     1 
HETATM 5503 O  O     . HOH L 5 .   ? 29.602  -31.974 19.225  1.00 55.87 ? 595 HOH B O     1 
HETATM 5504 O  O     . HOH L 5 .   ? 38.620  -24.095 31.051  1.00 45.46 ? 596 HOH B O     1 
HETATM 5505 O  O     . HOH L 5 .   ? 36.930  5.200   53.333  1.00 46.88 ? 597 HOH B O     1 
HETATM 5506 O  O     . HOH L 5 .   ? 41.416  -6.802  25.249  1.00 43.87 ? 598 HOH B O     1 
HETATM 5507 O  O     . HOH L 5 .   ? 51.386  -9.743  22.741  1.00 42.33 ? 599 HOH B O     1 
HETATM 5508 O  O     . HOH L 5 .   ? 46.029  -4.342  55.275  1.00 36.67 ? 600 HOH B O     1 
HETATM 5509 O  O     . HOH L 5 .   ? 51.325  -16.299 51.113  1.00 41.31 ? 601 HOH B O     1 
HETATM 5510 O  O     . HOH L 5 .   ? 39.761  -12.144 57.032  1.00 51.35 ? 602 HOH B O     1 
HETATM 5511 O  O     . HOH L 5 .   ? 28.684  -6.268  55.220  1.00 58.76 ? 603 HOH B O     1 
HETATM 5512 O  O     . HOH L 5 .   ? 31.410  -10.009 54.188  1.00 53.48 ? 604 HOH B O     1 
HETATM 5513 O  O     . HOH L 5 .   ? 44.007  13.875  50.937  1.00 40.19 ? 605 HOH B O     1 
HETATM 5514 O  O     . HOH L 5 .   ? 50.817  10.739  43.006  1.00 38.18 ? 606 HOH B O     1 
HETATM 5515 O  O     . HOH L 5 .   ? 54.763  10.391  40.699  1.00 39.53 ? 607 HOH B O     1 
HETATM 5516 O  O     . HOH L 5 .   ? 50.918  -13.678 47.408  1.00 38.01 ? 608 HOH B O     1 
HETATM 5517 O  O     . HOH L 5 .   ? 61.742  -6.438  48.108  1.00 47.64 ? 609 HOH B O     1 
HETATM 5518 O  O     . HOH L 5 .   ? 46.154  12.181  25.055  1.00 40.57 ? 610 HOH B O     1 
HETATM 5519 O  O     . HOH L 5 .   ? 54.027  10.870  24.300  1.00 37.93 ? 611 HOH B O     1 
HETATM 5520 O  O     . HOH L 5 .   ? 27.471  12.079  30.441  1.00 40.46 ? 612 HOH B O     1 
HETATM 5521 O  O     . HOH L 5 .   ? 27.802  9.959   37.964  1.00 42.81 ? 613 HOH B O     1 
HETATM 5522 O  O     . HOH L 5 .   ? 20.917  -17.906 39.127  1.00 45.08 ? 614 HOH B O     1 
HETATM 5523 O  O     . HOH L 5 .   ? 18.193  -29.377 17.953  1.00 55.33 ? 615 HOH B O     1 
HETATM 5524 O  O     . HOH L 5 .   ? 47.384  10.064  22.825  1.00 45.64 ? 616 HOH B O     1 
HETATM 5525 O  O     . HOH L 5 .   ? 41.563  -0.719  21.493  1.00 41.44 ? 617 HOH B O     1 
HETATM 5526 O  O     . HOH L 5 .   ? 25.371  -33.319 17.594  1.00 53.84 ? 618 HOH B O     1 
HETATM 5527 O  O     . HOH L 5 .   ? 17.847  -14.836 29.143  1.00 43.15 ? 619 HOH B O     1 
HETATM 5528 O  O     . HOH L 5 .   ? 53.351  1.282   50.555  1.00 41.77 ? 620 HOH B O     1 
HETATM 5529 O  O     . HOH L 5 .   ? 55.116  7.002   46.850  1.00 37.09 ? 621 HOH B O     1 
HETATM 5530 O  O     . HOH L 5 .   ? 59.634  2.252   39.849  1.00 38.64 ? 622 HOH B O     1 
HETATM 5531 O  O     . HOH L 5 .   ? 63.819  -5.935  31.575  1.00 42.78 ? 623 HOH B O     1 
HETATM 5532 O  O     . HOH L 5 .   ? 52.915  -19.038 27.321  1.00 51.56 ? 624 HOH B O     1 
HETATM 5533 O  O     . HOH L 5 .   ? 56.016  1.266   19.385  1.00 38.61 ? 625 HOH B O     1 
HETATM 5534 O  O     . HOH L 5 .   ? 57.804  6.166   24.684  1.00 39.89 ? 626 HOH B O     1 
HETATM 5535 O  O     . HOH L 5 .   ? 32.465  25.130  37.886  1.00 59.79 ? 627 HOH B O     1 
HETATM 5536 O  O     . HOH L 5 .   ? 73.380  -9.176  38.324  1.00 54.64 ? 628 HOH B O     1 
HETATM 5537 O  O     . HOH L 5 .   ? 16.051  -16.426 34.056  1.00 50.77 ? 629 HOH B O     1 
HETATM 5538 O  O     . HOH L 5 .   ? 18.249  -9.523  35.378  1.00 44.91 ? 630 HOH B O     1 
HETATM 5539 O  O     . HOH L 5 .   ? 17.514  -23.353 30.482  1.00 45.14 ? 631 HOH B O     1 
HETATM 5540 O  O     . HOH L 5 .   ? 63.102  2.028   33.819  1.00 36.33 ? 632 HOH B O     1 
HETATM 5541 O  O     . HOH L 5 .   ? 61.841  6.983   38.662  1.00 42.07 ? 633 HOH B O     1 
HETATM 5542 O  O     . HOH L 5 .   ? 60.329  -4.031  49.854  1.00 51.93 ? 634 HOH B O     1 
HETATM 5543 O  O     . HOH L 5 .   ? 36.144  -18.314 31.074  1.00 37.33 ? 635 HOH B O     1 
HETATM 5544 O  O     . HOH L 5 .   ? 52.292  -8.951  19.123  1.00 51.54 ? 636 HOH B O     1 
HETATM 5545 O  O     . HOH L 5 .   ? 56.160  11.795  38.978  1.00 41.58 ? 637 HOH B O     1 
HETATM 5546 O  O     . HOH L 5 .   ? 54.595  23.321  28.303  1.00 50.37 ? 638 HOH B O     1 
HETATM 5547 O  O     . HOH L 5 .   ? 25.036  -0.773  28.486  1.00 44.60 ? 639 HOH B O     1 
HETATM 5548 O  O     . HOH L 5 .   ? 25.868  3.948   30.377  1.00 40.24 ? 640 HOH B O     1 
HETATM 5549 O  O     . HOH L 5 .   ? 27.093  -8.138  23.924  1.00 58.01 ? 641 HOH B O     1 
HETATM 5550 O  O     . HOH L 5 .   ? 35.733  -33.174 38.138  1.00 60.14 ? 642 HOH B O     1 
HETATM 5551 O  O     . HOH L 5 .   ? 30.810  -32.206 40.813  1.00 56.93 ? 643 HOH B O     1 
HETATM 5552 O  O     . HOH L 5 .   ? 21.396  -22.971 40.293  1.00 39.13 ? 644 HOH B O     1 
HETATM 5553 O  O     . HOH L 5 .   ? 23.047  6.902   36.965  1.00 53.24 ? 645 HOH B O     1 
HETATM 5554 O  O     . HOH L 5 .   ? 32.308  -35.731 36.005  1.00 60.00 ? 646 HOH B O     1 
HETATM 5555 O  O     . HOH L 5 .   ? 34.370  -32.160 30.983  1.00 53.87 ? 647 HOH B O     1 
HETATM 5556 O  O     . HOH L 5 .   ? 36.578  2.398   21.377  1.00 51.34 ? 648 HOH B O     1 
HETATM 5557 O  O     . HOH L 5 .   ? 37.635  18.476  43.505  1.00 48.61 ? 649 HOH B O     1 
HETATM 5558 O  O     . HOH L 5 .   ? 36.430  20.398  43.855  1.00 50.11 ? 650 HOH B O     1 
HETATM 5559 O  O     . HOH L 5 .   ? 45.490  -12.379 27.292  1.00 46.16 ? 651 HOH B O     1 
HETATM 5560 O  O     . HOH L 5 .   ? 46.079  -14.448 36.517  1.00 44.17 ? 652 HOH B O     1 
HETATM 5561 O  O     . HOH M 5 .   ? 17.111  21.237  12.420  1.00 39.77 ? 201 HOH D O     1 
HETATM 5562 O  O     . HOH M 5 .   ? 17.343  27.439  10.253  1.00 46.55 ? 202 HOH D O     1 
HETATM 5563 O  O     . HOH M 5 .   ? 11.803  28.392  13.988  1.00 48.74 ? 203 HOH D O     1 
HETATM 5564 O  O     . HOH M 5 .   ? 17.032  25.746  12.902  1.00 44.24 ? 204 HOH D O     1 
HETATM 5565 O  O     . HOH M 5 .   ? 11.202  20.455  4.469   1.00 36.93 ? 205 HOH D O     1 
HETATM 5566 O  O     . HOH M 5 .   ? 8.454   16.928  11.725  1.00 47.44 ? 206 HOH D O     1 
HETATM 5567 O  O     . HOH N 5 .   ? 46.185  -10.612 31.837  1.00 34.49 ? 101 HOH H O     1 
HETATM 5568 O  O     . HOH N 5 .   ? 37.953  -6.393  31.895  1.00 44.36 ? 102 HOH H O     1 
HETATM 5569 O  O     . HOH N 5 .   ? 38.745  -10.200 38.168  1.00 44.83 ? 103 HOH H O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   37  ?   ?   ?   A . n 
A 1 2   ASP 2   38  38  ASP ASP A . n 
A 1 3   MET 3   39  39  MET MET A . n 
A 1 4   SER 4   40  40  SER SER A . n 
A 1 5   HIS 5   41  41  HIS HIS A . n 
A 1 6   LYS 6   42  42  LYS LYS A . n 
A 1 7   GLU 7   43  43  GLU GLU A . n 
A 1 8   PHE 8   44  44  PHE PHE A . n 
A 1 9   THR 9   45  45  THR THR A . n 
A 1 10  LYS 10  46  46  LYS LYS A . n 
A 1 11  PHE 11  47  47  PHE PHE A . n 
A 1 12  CYS 12  48  48  CYS CYS A . n 
A 1 13  TYR 13  49  49  TYR TYR A . n 
A 1 14  GLU 14  50  50  GLU GLU A . n 
A 1 15  VAL 15  51  51  VAL VAL A . n 
A 1 16  TYR 16  52  52  TYR TYR A . n 
A 1 17  ASN 17  53  53  ASN ASN A . n 
A 1 18  GLU 18  54  54  GLU GLU A . n 
A 1 19  ILE 19  55  55  ILE ILE A . n 
A 1 20  LYS 20  56  56  LYS LYS A . n 
A 1 21  ILE 21  57  57  ILE ILE A . n 
A 1 22  SER 22  58  58  SER SER A . n 
A 1 23  ASP 23  59  59  ASP ASP A . n 
A 1 24  LYS 24  60  60  LYS LYS A . n 
A 1 25  GLU 25  61  61  GLU GLU A . n 
A 1 26  PHE 26  62  62  PHE PHE A . n 
A 1 27  LYS 27  63  63  LYS LYS A . n 
A 1 28  GLU 28  64  64  GLU GLU A . n 
A 1 29  LYS 29  65  65  LYS LYS A . n 
A 1 30  ARG 30  66  66  ARG ARG A . n 
A 1 31  ALA 31  67  67  ALA ALA A . n 
A 1 32  ALA 32  68  68  ALA ALA A . n 
A 1 33  LEU 33  69  69  LEU LEU A . n 
A 1 34  ASP 34  70  70  ASP ASP A . n 
A 1 35  THR 35  71  71  THR THR A . n 
A 1 36  LEU 36  72  72  LEU LEU A . n 
A 1 37  ARG 37  73  73  ARG ARG A . n 
A 1 38  LEU 38  74  74  LEU LEU A . n 
A 1 39  CYS 39  75  75  CYS CYS A . n 
A 1 40  LEU 40  76  76  LEU LEU A . n 
A 1 41  LYS 41  77  77  LYS LYS A . n 
A 1 42  ARG 42  78  78  ARG ARG A . n 
A 1 43  ILE 43  79  79  ILE ILE A . n 
A 1 44  SER 44  80  80  SER SER A . n 
A 1 45  PRO 45  81  81  PRO PRO A . n 
A 1 46  ASP 46  82  82  ASP ASP A . n 
A 1 47  ALA 47  83  83  ALA ALA A . n 
A 1 48  GLU 48  84  84  GLU GLU A . n 
A 1 49  LEU 49  85  85  LEU LEU A . n 
A 1 50  VAL 50  86  86  VAL VAL A . n 
A 1 51  ALA 51  87  87  ALA ALA A . n 
A 1 52  PHE 52  88  88  PHE PHE A . n 
A 1 53  GLY 53  89  89  GLY GLY A . n 
A 1 54  SER 54  90  90  SER SER A . n 
A 1 55  LEU 55  91  91  LEU LEU A . n 
A 1 56  GLU 56  92  92  GLU GLU A . n 
A 1 57  SER 57  93  93  SER SER A . n 
A 1 58  GLY 58  94  94  GLY GLY A . n 
A 1 59  LEU 59  95  95  LEU LEU A . n 
A 1 60  ALA 60  96  96  ALA ALA A . n 
A 1 61  LEU 61  97  97  LEU LEU A . n 
A 1 62  LYS 62  98  98  LYS LYS A . n 
A 1 63  ASN 63  99  99  ASN ASN A . n 
A 1 64  SER 64  100 100 SER SER A . n 
A 1 65  ASP 65  101 101 ASP ASP A . n 
A 1 66  MET 66  102 102 MET MET A . n 
A 1 67  ASP 67  103 103 ASP ASP A . n 
A 1 68  LEU 68  104 104 LEU LEU A . n 
A 1 69  CYS 69  105 105 CYS CYS A . n 
A 1 70  VAL 70  106 106 VAL VAL A . n 
A 1 71  LEU 71  107 107 LEU LEU A . n 
A 1 72  MET 72  108 108 MET MET A . n 
A 1 73  ASP 73  109 109 ASP ASP A . n 
A 1 74  SER 74  110 ?   ?   ?   A . n 
A 1 75  ARG 75  111 ?   ?   ?   A . n 
A 1 76  VAL 76  112 ?   ?   ?   A . n 
A 1 77  GLN 77  113 ?   ?   ?   A . n 
A 1 78  SER 78  114 ?   ?   ?   A . n 
A 1 79  ASP 79  115 ?   ?   ?   A . n 
A 1 80  THR 80  116 116 THR THR A . n 
A 1 81  ILE 81  117 117 ILE ILE A . n 
A 1 82  ALA 82  118 118 ALA ALA A . n 
A 1 83  LEU 83  119 119 LEU LEU A . n 
A 1 84  GLN 84  120 120 GLN GLN A . n 
A 1 85  PHE 85  121 121 PHE PHE A . n 
A 1 86  TYR 86  122 122 TYR TYR A . n 
A 1 87  GLU 87  123 123 GLU GLU A . n 
A 1 88  GLU 88  124 124 GLU GLU A . n 
A 1 89  LEU 89  125 125 LEU LEU A . n 
A 1 90  ILE 90  126 126 ILE ILE A . n 
A 1 91  ALA 91  127 127 ALA ALA A . n 
A 1 92  GLU 92  128 128 GLU GLU A . n 
A 1 93  GLY 93  129 129 GLY GLY A . n 
A 1 94  PHE 94  130 130 PHE PHE A . n 
A 1 95  GLU 95  131 131 GLU GLU A . n 
A 1 96  GLY 96  132 132 GLY GLY A . n 
A 1 97  LYS 97  133 133 LYS LYS A . n 
A 1 98  PHE 98  134 134 PHE PHE A . n 
A 1 99  LEU 99  135 135 LEU LEU A . n 
A 1 100 GLN 100 136 136 GLN GLN A . n 
A 1 101 ARG 101 137 137 ARG ARG A . n 
A 1 102 ALA 102 138 138 ALA ALA A . n 
A 1 103 ARG 103 139 139 ARG ARG A . n 
A 1 104 ILE 104 140 140 ILE ILE A . n 
A 1 105 PRO 105 141 141 PRO PRO A . n 
A 1 106 ILE 106 142 142 ILE ILE A . n 
A 1 107 ILE 107 143 143 ILE ILE A . n 
A 1 108 LYS 108 144 144 LYS LYS A . n 
A 1 109 LEU 109 145 145 LEU LEU A . n 
A 1 110 THR 110 146 146 THR THR A . n 
A 1 111 SER 111 147 147 SER SER A . n 
A 1 112 ASP 112 148 148 ASP ASP A . n 
A 1 113 THR 113 149 149 THR THR A . n 
A 1 114 LYS 114 150 150 LYS LYS A . n 
A 1 115 ASN 115 151 151 ASN ASN A . n 
A 1 116 GLY 116 152 152 GLY GLY A . n 
A 1 117 PHE 117 153 153 PHE PHE A . n 
A 1 118 GLY 118 154 154 GLY GLY A . n 
A 1 119 ALA 119 155 155 ALA ALA A . n 
A 1 120 SER 120 156 156 SER SER A . n 
A 1 121 PHE 121 157 157 PHE PHE A . n 
A 1 122 GLN 122 158 158 GLN GLN A . n 
A 1 123 CYS 123 159 159 CYS CYS A . n 
A 1 124 ALA 124 160 160 ALA ALA A . n 
A 1 125 ILE 125 161 161 ILE ILE A . n 
A 1 126 GLY 126 162 162 GLY GLY A . n 
A 1 127 PHE 127 163 163 PHE PHE A . n 
A 1 128 ASN 128 164 164 ASN ASN A . n 
A 1 129 ASN 129 165 165 ASN ASN A . n 
A 1 130 ARG 130 166 166 ARG ARG A . n 
A 1 131 LEU 131 167 167 LEU LEU A . n 
A 1 132 ALA 132 168 168 ALA ALA A . n 
A 1 133 ILE 133 169 169 ILE ILE A . n 
A 1 134 HIS 134 170 170 HIS HIS A . n 
A 1 135 ASN 135 171 171 ASN ASN A . n 
A 1 136 THR 136 172 172 THR THR A . n 
A 1 137 LEU 137 173 173 LEU LEU A . n 
A 1 138 LEU 138 174 174 LEU LEU A . n 
A 1 139 LEU 139 175 175 LEU LEU A . n 
A 1 140 SER 140 176 176 SER SER A . n 
A 1 141 SER 141 177 177 SER SER A . n 
A 1 142 TYR 142 178 178 TYR TYR A . n 
A 1 143 THR 143 179 179 THR THR A . n 
A 1 144 LYS 144 180 180 LYS LYS A . n 
A 1 145 LEU 145 181 181 LEU LEU A . n 
A 1 146 ASP 146 182 182 ASP ASP A . n 
A 1 147 ALA 147 183 183 ALA ALA A . n 
A 1 148 ARG 148 184 184 ARG ARG A . n 
A 1 149 LEU 149 185 185 LEU LEU A . n 
A 1 150 LYS 150 186 186 LYS LYS A . n 
A 1 151 PRO 151 187 187 PRO PRO A . n 
A 1 152 MET 152 188 188 MET MET A . n 
A 1 153 VAL 153 189 189 VAL VAL A . n 
A 1 154 LEU 154 190 190 LEU LEU A . n 
A 1 155 LEU 155 191 191 LEU LEU A . n 
A 1 156 VAL 156 192 192 VAL VAL A . n 
A 1 157 LYS 157 193 193 LYS LYS A . n 
A 1 158 HIS 158 194 194 HIS HIS A . n 
A 1 159 TRP 159 195 195 TRP TRP A . n 
A 1 160 ALA 160 196 196 ALA ALA A . n 
A 1 161 LYS 161 197 197 LYS LYS A . n 
A 1 162 ARG 162 198 198 ARG ARG A . n 
A 1 163 LYS 163 199 199 LYS LYS A . n 
A 1 164 GLN 164 200 200 GLN GLN A . n 
A 1 165 ILE 165 201 201 ILE ILE A . n 
A 1 166 ASN 166 202 202 ASN ASN A . n 
A 1 167 SER 167 203 203 SER SER A . n 
A 1 168 PRO 168 204 204 PRO PRO A . n 
A 1 169 TYR 169 205 205 TYR TYR A . n 
A 1 170 PHE 170 206 206 PHE PHE A . n 
A 1 171 GLY 171 207 207 GLY GLY A . n 
A 1 172 THR 172 208 208 THR THR A . n 
A 1 173 LEU 173 209 209 LEU LEU A . n 
A 1 174 SER 174 210 210 SER SER A . n 
A 1 175 SER 175 211 211 SER SER A . n 
A 1 176 TYR 176 212 212 TYR TYR A . n 
A 1 177 GLY 177 213 213 GLY GLY A . n 
A 1 178 TYR 178 214 214 TYR TYR A . n 
A 1 179 VAL 179 215 215 VAL VAL A . n 
A 1 180 LEU 180 216 216 LEU LEU A . n 
A 1 181 MET 181 217 217 MET MET A . n 
A 1 182 VAL 182 218 218 VAL VAL A . n 
A 1 183 LEU 183 219 219 LEU LEU A . n 
A 1 184 TYR 184 220 220 TYR TYR A . n 
A 1 185 TYR 185 221 221 TYR TYR A . n 
A 1 186 LEU 186 222 222 LEU LEU A . n 
A 1 187 ILE 187 223 223 ILE ILE A . n 
A 1 188 HIS 188 224 224 HIS HIS A . n 
A 1 189 VAL 189 225 225 VAL VAL A . n 
A 1 190 ILE 190 226 226 ILE ILE A . n 
A 1 191 LYS 191 227 227 LYS LYS A . n 
A 1 192 PRO 192 228 228 PRO PRO A . n 
A 1 193 PRO 193 229 229 PRO PRO A . n 
A 1 194 VAL 194 230 230 VAL VAL A . n 
A 1 195 PHE 195 231 231 PHE PHE A . n 
A 1 196 PRO 196 232 232 PRO PRO A . n 
A 1 197 ASN 197 233 233 ASN ASN A . n 
A 1 198 LEU 198 234 234 LEU LEU A . n 
A 1 199 LEU 199 235 235 LEU LEU A . n 
A 1 200 LEU 200 236 236 LEU LEU A . n 
A 1 201 SER 201 237 237 SER SER A . n 
A 1 202 PRO 202 238 238 PRO PRO A . n 
A 1 203 LEU 203 239 239 LEU LEU A . n 
A 1 204 LYS 204 240 240 LYS LYS A . n 
A 1 205 GLN 205 241 241 GLN GLN A . n 
A 1 206 GLU 206 242 242 GLU GLU A . n 
A 1 207 LYS 207 243 243 LYS LYS A . n 
A 1 208 ILE 208 244 244 ILE ILE A . n 
A 1 209 VAL 209 245 245 VAL VAL A . n 
A 1 210 ASP 210 246 246 ASP ASP A . n 
A 1 211 GLY 211 247 247 GLY GLY A . n 
A 1 212 PHE 212 248 248 PHE PHE A . n 
A 1 213 ASP 213 249 249 ASP ASP A . n 
A 1 214 VAL 214 250 250 VAL VAL A . n 
A 1 215 GLY 215 251 251 GLY GLY A . n 
A 1 216 PHE 216 252 252 PHE PHE A . n 
A 1 217 ASP 217 253 253 ASP ASP A . n 
A 1 218 ASP 218 254 254 ASP ASP A . n 
A 1 219 LYS 219 255 255 LYS LYS A . n 
A 1 220 LEU 220 256 256 LEU LEU A . n 
A 1 221 GLU 221 257 257 GLU GLU A . n 
A 1 222 ASP 222 258 258 ASP ASP A . n 
A 1 223 ILE 223 259 259 ILE ILE A . n 
A 1 224 PRO 224 260 260 PRO PRO A . n 
A 1 225 PRO 225 261 261 PRO PRO A . n 
A 1 226 SER 226 262 262 SER SER A . n 
A 1 227 GLN 227 263 263 GLN GLN A . n 
A 1 228 ASN 228 264 264 ASN ASN A . n 
A 1 229 TYR 229 265 265 TYR TYR A . n 
A 1 230 SER 230 266 266 SER SER A . n 
A 1 231 SER 231 267 267 SER SER A . n 
A 1 232 LEU 232 268 268 LEU LEU A . n 
A 1 233 GLY 233 269 269 GLY GLY A . n 
A 1 234 SER 234 270 270 SER SER A . n 
A 1 235 LEU 235 271 271 LEU LEU A . n 
A 1 236 LEU 236 272 272 LEU LEU A . n 
A 1 237 HIS 237 273 273 HIS HIS A . n 
A 1 238 GLY 238 274 274 GLY GLY A . n 
A 1 239 PHE 239 275 275 PHE PHE A . n 
A 1 240 PHE 240 276 276 PHE PHE A . n 
A 1 241 ARG 241 277 277 ARG ARG A . n 
A 1 242 PHE 242 278 278 PHE PHE A . n 
A 1 243 TYR 243 279 279 TYR TYR A . n 
A 1 244 ALA 244 280 280 ALA ALA A . n 
A 1 245 TYR 245 281 281 TYR TYR A . n 
A 1 246 LYS 246 282 282 LYS LYS A . n 
A 1 247 PHE 247 283 283 PHE PHE A . n 
A 1 248 GLU 248 284 284 GLU GLU A . n 
A 1 249 PRO 249 285 285 PRO PRO A . n 
A 1 250 ARG 250 286 286 ARG ARG A . n 
A 1 251 GLU 251 287 287 GLU GLU A . n 
A 1 252 LYS 252 288 288 LYS LYS A . n 
A 1 253 VAL 253 289 289 VAL VAL A . n 
A 1 254 VAL 254 290 290 VAL VAL A . n 
A 1 255 THR 255 291 291 THR THR A . n 
A 1 256 PHE 256 292 292 PHE PHE A . n 
A 1 257 ARG 257 293 293 ARG ARG A . n 
A 1 258 ARG 258 294 294 ARG ARG A . n 
A 1 259 PRO 259 295 295 PRO PRO A . n 
A 1 260 ASP 260 296 296 ASP ASP A . n 
A 1 261 GLY 261 297 297 GLY GLY A . n 
A 1 262 TYR 262 298 298 TYR TYR A . n 
A 1 263 LEU 263 299 299 LEU LEU A . n 
A 1 264 THR 264 300 300 THR THR A . n 
A 1 265 LYS 265 301 301 LYS LYS A . n 
A 1 266 GLN 266 302 302 GLN GLN A . n 
A 1 267 GLU 267 303 303 GLU GLU A . n 
A 1 268 LYS 268 304 304 LYS LYS A . n 
A 1 269 GLY 269 305 305 GLY GLY A . n 
A 1 270 TRP 270 306 306 TRP TRP A . n 
A 1 271 THR 271 307 307 THR THR A . n 
A 1 272 SER 272 308 308 SER SER A . n 
A 1 273 ALA 273 309 ?   ?   ?   A . n 
A 1 274 THR 274 310 ?   ?   ?   A . n 
A 1 275 GLU 275 311 ?   ?   ?   A . n 
A 1 276 HIS 276 312 ?   ?   ?   A . n 
A 1 277 THR 277 313 ?   ?   ?   A . n 
A 1 278 GLY 278 314 ?   ?   ?   A . n 
A 1 279 SER 279 315 ?   ?   ?   A . n 
A 1 280 ALA 280 316 ?   ?   ?   A . n 
A 1 281 ASP 281 317 ?   ?   ?   A . n 
A 1 282 GLN 282 318 ?   ?   ?   A . n 
A 1 283 ILE 283 319 ?   ?   ?   A . n 
A 1 284 ILE 284 320 ?   ?   ?   A . n 
A 1 285 LYS 285 321 ?   ?   ?   A . n 
A 1 286 ASP 286 322 ?   ?   ?   A . n 
A 1 287 ARG 287 323 323 ARG ARG A . n 
A 1 288 TYR 288 324 324 TYR TYR A . n 
A 1 289 ILE 289 325 325 ILE ILE A . n 
A 1 290 LEU 290 326 326 LEU LEU A . n 
A 1 291 ALA 291 327 327 ALA ALA A . n 
A 1 292 ILE 292 328 328 ILE ILE A . n 
A 1 293 GLU 293 329 329 GLU GLU A . n 
A 1 294 ASP 294 330 330 ASP ASP A . n 
A 1 295 PRO 295 331 331 PRO PRO A . n 
A 1 296 PHE 296 332 332 PHE PHE A . n 
A 1 297 GLU 297 333 333 GLU GLU A . n 
A 1 298 ILE 298 334 334 ILE ILE A . n 
A 1 299 SER 299 335 335 SER SER A . n 
A 1 300 HIS 300 336 336 HIS HIS A . n 
A 1 301 ASN 301 337 337 ASN ASN A . n 
A 1 302 VAL 302 338 338 VAL VAL A . n 
A 1 303 GLY 303 339 339 GLY GLY A . n 
A 1 304 ARG 304 340 340 ARG ARG A . n 
A 1 305 THR 305 341 341 THR THR A . n 
A 1 306 VAL 306 342 342 VAL VAL A . n 
A 1 307 SER 307 343 343 SER SER A . n 
A 1 308 SER 308 344 344 SER SER A . n 
A 1 309 SER 309 345 345 SER SER A . n 
A 1 310 GLY 310 346 346 GLY GLY A . n 
A 1 311 LEU 311 347 347 LEU LEU A . n 
A 1 312 TYR 312 348 348 TYR TYR A . n 
A 1 313 ARG 313 349 349 ARG ARG A . n 
A 1 314 ILE 314 350 350 ILE ILE A . n 
A 1 315 ARG 315 351 351 ARG ARG A . n 
A 1 316 GLY 316 352 352 GLY GLY A . n 
A 1 317 GLU 317 353 353 GLU GLU A . n 
A 1 318 PHE 318 354 354 PHE PHE A . n 
A 1 319 MET 319 355 355 MET MET A . n 
A 1 320 ALA 320 356 356 ALA ALA A . n 
A 1 321 ALA 321 357 357 ALA ALA A . n 
A 1 322 SER 322 358 358 SER SER A . n 
A 1 323 ARG 323 359 359 ARG ARG A . n 
A 1 324 LEU 324 360 360 LEU LEU A . n 
A 1 325 LEU 325 361 361 LEU LEU A . n 
A 1 326 ASN 326 362 362 ASN ASN A . n 
A 1 327 SER 327 363 363 SER SER A . n 
A 1 328 ARG 328 364 364 ARG ARG A . n 
A 1 329 SER 329 365 365 SER SER A . n 
A 1 330 TYR 330 366 366 TYR TYR A . n 
A 1 331 PRO 331 367 367 PRO PRO A . n 
A 1 332 ILE 332 368 368 ILE ILE A . n 
A 1 333 PRO 333 369 369 PRO PRO A . n 
A 1 334 TYR 334 370 370 TYR TYR A . n 
A 1 335 ASP 335 371 371 ASP ASP A . n 
A 1 336 SER 336 372 372 SER SER A . n 
A 1 337 LEU 337 373 373 LEU LEU A . n 
A 1 338 PHE 338 374 374 PHE PHE A . n 
A 1 339 GLU 339 375 375 GLU GLU A . n 
A 1 340 GLU 340 376 376 GLU GLU A . n 
A 1 341 ALA 341 377 377 ALA ALA A . n 
B 1 1   GLY 1   37  ?   ?   ?   B . n 
B 1 2   ASP 2   38  ?   ?   ?   B . n 
B 1 3   MET 3   39  39  MET MET B . n 
B 1 4   SER 4   40  40  SER SER B . n 
B 1 5   HIS 5   41  41  HIS HIS B . n 
B 1 6   LYS 6   42  42  LYS LYS B . n 
B 1 7   GLU 7   43  43  GLU GLU B . n 
B 1 8   PHE 8   44  44  PHE PHE B . n 
B 1 9   THR 9   45  45  THR THR B . n 
B 1 10  LYS 10  46  46  LYS LYS B . n 
B 1 11  PHE 11  47  47  PHE PHE B . n 
B 1 12  CYS 12  48  48  CYS CYS B . n 
B 1 13  TYR 13  49  49  TYR TYR B . n 
B 1 14  GLU 14  50  50  GLU GLU B . n 
B 1 15  VAL 15  51  51  VAL VAL B . n 
B 1 16  TYR 16  52  52  TYR TYR B . n 
B 1 17  ASN 17  53  53  ASN ASN B . n 
B 1 18  GLU 18  54  54  GLU GLU B . n 
B 1 19  ILE 19  55  55  ILE ILE B . n 
B 1 20  LYS 20  56  56  LYS LYS B . n 
B 1 21  ILE 21  57  57  ILE ILE B . n 
B 1 22  SER 22  58  58  SER SER B . n 
B 1 23  ASP 23  59  59  ASP ASP B . n 
B 1 24  LYS 24  60  60  LYS LYS B . n 
B 1 25  GLU 25  61  61  GLU GLU B . n 
B 1 26  PHE 26  62  62  PHE PHE B . n 
B 1 27  LYS 27  63  63  LYS LYS B . n 
B 1 28  GLU 28  64  64  GLU GLU B . n 
B 1 29  LYS 29  65  65  LYS LYS B . n 
B 1 30  ARG 30  66  66  ARG ARG B . n 
B 1 31  ALA 31  67  67  ALA ALA B . n 
B 1 32  ALA 32  68  68  ALA ALA B . n 
B 1 33  LEU 33  69  69  LEU LEU B . n 
B 1 34  ASP 34  70  70  ASP ASP B . n 
B 1 35  THR 35  71  71  THR THR B . n 
B 1 36  LEU 36  72  72  LEU LEU B . n 
B 1 37  ARG 37  73  73  ARG ARG B . n 
B 1 38  LEU 38  74  74  LEU LEU B . n 
B 1 39  CYS 39  75  75  CYS CYS B . n 
B 1 40  LEU 40  76  76  LEU LEU B . n 
B 1 41  LYS 41  77  77  LYS LYS B . n 
B 1 42  ARG 42  78  78  ARG ARG B . n 
B 1 43  ILE 43  79  79  ILE ILE B . n 
B 1 44  SER 44  80  80  SER SER B . n 
B 1 45  PRO 45  81  81  PRO PRO B . n 
B 1 46  ASP 46  82  82  ASP ASP B . n 
B 1 47  ALA 47  83  83  ALA ALA B . n 
B 1 48  GLU 48  84  84  GLU GLU B . n 
B 1 49  LEU 49  85  85  LEU LEU B . n 
B 1 50  VAL 50  86  86  VAL VAL B . n 
B 1 51  ALA 51  87  87  ALA ALA B . n 
B 1 52  PHE 52  88  88  PHE PHE B . n 
B 1 53  GLY 53  89  89  GLY GLY B . n 
B 1 54  SER 54  90  90  SER SER B . n 
B 1 55  LEU 55  91  91  LEU LEU B . n 
B 1 56  GLU 56  92  92  GLU GLU B . n 
B 1 57  SER 57  93  93  SER SER B . n 
B 1 58  GLY 58  94  94  GLY GLY B . n 
B 1 59  LEU 59  95  95  LEU LEU B . n 
B 1 60  ALA 60  96  96  ALA ALA B . n 
B 1 61  LEU 61  97  97  LEU LEU B . n 
B 1 62  LYS 62  98  98  LYS LYS B . n 
B 1 63  ASN 63  99  99  ASN ASN B . n 
B 1 64  SER 64  100 100 SER SER B . n 
B 1 65  ASP 65  101 101 ASP ASP B . n 
B 1 66  MET 66  102 102 MET MET B . n 
B 1 67  ASP 67  103 103 ASP ASP B . n 
B 1 68  LEU 68  104 104 LEU LEU B . n 
B 1 69  CYS 69  105 105 CYS CYS B . n 
B 1 70  VAL 70  106 106 VAL VAL B . n 
B 1 71  LEU 71  107 107 LEU LEU B . n 
B 1 72  MET 72  108 108 MET MET B . n 
B 1 73  ASP 73  109 109 ASP ASP B . n 
B 1 74  SER 74  110 ?   ?   ?   B . n 
B 1 75  ARG 75  111 ?   ?   ?   B . n 
B 1 76  VAL 76  112 ?   ?   ?   B . n 
B 1 77  GLN 77  113 ?   ?   ?   B . n 
B 1 78  SER 78  114 ?   ?   ?   B . n 
B 1 79  ASP 79  115 ?   ?   ?   B . n 
B 1 80  THR 80  116 116 THR THR B . n 
B 1 81  ILE 81  117 117 ILE ILE B . n 
B 1 82  ALA 82  118 118 ALA ALA B . n 
B 1 83  LEU 83  119 119 LEU LEU B . n 
B 1 84  GLN 84  120 120 GLN GLN B . n 
B 1 85  PHE 85  121 121 PHE PHE B . n 
B 1 86  TYR 86  122 122 TYR TYR B . n 
B 1 87  GLU 87  123 123 GLU GLU B . n 
B 1 88  GLU 88  124 124 GLU GLU B . n 
B 1 89  LEU 89  125 125 LEU LEU B . n 
B 1 90  ILE 90  126 126 ILE ILE B . n 
B 1 91  ALA 91  127 127 ALA ALA B . n 
B 1 92  GLU 92  128 128 GLU GLU B . n 
B 1 93  GLY 93  129 129 GLY GLY B . n 
B 1 94  PHE 94  130 130 PHE PHE B . n 
B 1 95  GLU 95  131 131 GLU GLU B . n 
B 1 96  GLY 96  132 132 GLY GLY B . n 
B 1 97  LYS 97  133 133 LYS LYS B . n 
B 1 98  PHE 98  134 134 PHE PHE B . n 
B 1 99  LEU 99  135 135 LEU LEU B . n 
B 1 100 GLN 100 136 136 GLN GLN B . n 
B 1 101 ARG 101 137 ?   ?   ?   B . n 
B 1 102 ALA 102 138 ?   ?   ?   B . n 
B 1 103 ARG 103 139 ?   ?   ?   B . n 
B 1 104 ILE 104 140 140 ILE ILE B . n 
B 1 105 PRO 105 141 141 PRO PRO B . n 
B 1 106 ILE 106 142 142 ILE ILE B . n 
B 1 107 ILE 107 143 143 ILE ILE B . n 
B 1 108 LYS 108 144 144 LYS LYS B . n 
B 1 109 LEU 109 145 145 LEU LEU B . n 
B 1 110 THR 110 146 146 THR THR B . n 
B 1 111 SER 111 147 147 SER SER B . n 
B 1 112 ASP 112 148 ?   ?   ?   B . n 
B 1 113 THR 113 149 ?   ?   ?   B . n 
B 1 114 LYS 114 150 ?   ?   ?   B . n 
B 1 115 ASN 115 151 ?   ?   ?   B . n 
B 1 116 GLY 116 152 ?   ?   ?   B . n 
B 1 117 PHE 117 153 ?   ?   ?   B . n 
B 1 118 GLY 118 154 ?   ?   ?   B . n 
B 1 119 ALA 119 155 ?   ?   ?   B . n 
B 1 120 SER 120 156 ?   ?   ?   B . n 
B 1 121 PHE 121 157 157 PHE PHE B . n 
B 1 122 GLN 122 158 158 GLN GLN B . n 
B 1 123 CYS 123 159 159 CYS CYS B . n 
B 1 124 ALA 124 160 160 ALA ALA B . n 
B 1 125 ILE 125 161 161 ILE ILE B . n 
B 1 126 GLY 126 162 162 GLY GLY B . n 
B 1 127 PHE 127 163 163 PHE PHE B . n 
B 1 128 ASN 128 164 164 ASN ASN B . n 
B 1 129 ASN 129 165 165 ASN ASN B . n 
B 1 130 ARG 130 166 166 ARG ARG B . n 
B 1 131 LEU 131 167 167 LEU LEU B . n 
B 1 132 ALA 132 168 168 ALA ALA B . n 
B 1 133 ILE 133 169 169 ILE ILE B . n 
B 1 134 HIS 134 170 170 HIS HIS B . n 
B 1 135 ASN 135 171 171 ASN ASN B . n 
B 1 136 THR 136 172 172 THR THR B . n 
B 1 137 LEU 137 173 173 LEU LEU B . n 
B 1 138 LEU 138 174 174 LEU LEU B . n 
B 1 139 LEU 139 175 175 LEU LEU B . n 
B 1 140 SER 140 176 176 SER SER B . n 
B 1 141 SER 141 177 177 SER SER B . n 
B 1 142 TYR 142 178 178 TYR TYR B . n 
B 1 143 THR 143 179 179 THR THR B . n 
B 1 144 LYS 144 180 180 LYS LYS B . n 
B 1 145 LEU 145 181 181 LEU LEU B . n 
B 1 146 ASP 146 182 182 ASP ASP B . n 
B 1 147 ALA 147 183 183 ALA ALA B . n 
B 1 148 ARG 148 184 184 ARG ARG B . n 
B 1 149 LEU 149 185 185 LEU LEU B . n 
B 1 150 LYS 150 186 186 LYS LYS B . n 
B 1 151 PRO 151 187 187 PRO PRO B . n 
B 1 152 MET 152 188 188 MET MET B . n 
B 1 153 VAL 153 189 189 VAL VAL B . n 
B 1 154 LEU 154 190 190 LEU LEU B . n 
B 1 155 LEU 155 191 191 LEU LEU B . n 
B 1 156 VAL 156 192 192 VAL VAL B . n 
B 1 157 LYS 157 193 193 LYS LYS B . n 
B 1 158 HIS 158 194 194 HIS HIS B . n 
B 1 159 TRP 159 195 195 TRP TRP B . n 
B 1 160 ALA 160 196 196 ALA ALA B . n 
B 1 161 LYS 161 197 197 LYS LYS B . n 
B 1 162 ARG 162 198 198 ARG ARG B . n 
B 1 163 LYS 163 199 199 LYS LYS B . n 
B 1 164 GLN 164 200 200 GLN GLN B . n 
B 1 165 ILE 165 201 201 ILE ILE B . n 
B 1 166 ASN 166 202 202 ASN ASN B . n 
B 1 167 SER 167 203 203 SER SER B . n 
B 1 168 PRO 168 204 204 PRO PRO B . n 
B 1 169 TYR 169 205 205 TYR TYR B . n 
B 1 170 PHE 170 206 206 PHE PHE B . n 
B 1 171 GLY 171 207 207 GLY GLY B . n 
B 1 172 THR 172 208 208 THR THR B . n 
B 1 173 LEU 173 209 209 LEU LEU B . n 
B 1 174 SER 174 210 210 SER SER B . n 
B 1 175 SER 175 211 211 SER SER B . n 
B 1 176 TYR 176 212 212 TYR TYR B . n 
B 1 177 GLY 177 213 213 GLY GLY B . n 
B 1 178 TYR 178 214 214 TYR TYR B . n 
B 1 179 VAL 179 215 215 VAL VAL B . n 
B 1 180 LEU 180 216 216 LEU LEU B . n 
B 1 181 MET 181 217 217 MET MET B . n 
B 1 182 VAL 182 218 218 VAL VAL B . n 
B 1 183 LEU 183 219 219 LEU LEU B . n 
B 1 184 TYR 184 220 220 TYR TYR B . n 
B 1 185 TYR 185 221 221 TYR TYR B . n 
B 1 186 LEU 186 222 222 LEU LEU B . n 
B 1 187 ILE 187 223 223 ILE ILE B . n 
B 1 188 HIS 188 224 224 HIS HIS B . n 
B 1 189 VAL 189 225 225 VAL VAL B . n 
B 1 190 ILE 190 226 226 ILE ILE B . n 
B 1 191 LYS 191 227 227 LYS LYS B . n 
B 1 192 PRO 192 228 228 PRO PRO B . n 
B 1 193 PRO 193 229 229 PRO PRO B . n 
B 1 194 VAL 194 230 230 VAL VAL B . n 
B 1 195 PHE 195 231 231 PHE PHE B . n 
B 1 196 PRO 196 232 232 PRO PRO B . n 
B 1 197 ASN 197 233 233 ASN ASN B . n 
B 1 198 LEU 198 234 234 LEU LEU B . n 
B 1 199 LEU 199 235 235 LEU LEU B . n 
B 1 200 LEU 200 236 236 LEU LEU B . n 
B 1 201 SER 201 237 237 SER SER B . n 
B 1 202 PRO 202 238 238 PRO PRO B . n 
B 1 203 LEU 203 239 239 LEU LEU B . n 
B 1 204 LYS 204 240 240 LYS LYS B . n 
B 1 205 GLN 205 241 241 GLN GLN B . n 
B 1 206 GLU 206 242 242 GLU GLU B . n 
B 1 207 LYS 207 243 243 LYS LYS B . n 
B 1 208 ILE 208 244 244 ILE ILE B . n 
B 1 209 VAL 209 245 245 VAL VAL B . n 
B 1 210 ASP 210 246 246 ASP ASP B . n 
B 1 211 GLY 211 247 247 GLY GLY B . n 
B 1 212 PHE 212 248 248 PHE PHE B . n 
B 1 213 ASP 213 249 249 ASP ASP B . n 
B 1 214 VAL 214 250 250 VAL VAL B . n 
B 1 215 GLY 215 251 251 GLY GLY B . n 
B 1 216 PHE 216 252 252 PHE PHE B . n 
B 1 217 ASP 217 253 253 ASP ASP B . n 
B 1 218 ASP 218 254 254 ASP ASP B . n 
B 1 219 LYS 219 255 255 LYS LYS B . n 
B 1 220 LEU 220 256 256 LEU LEU B . n 
B 1 221 GLU 221 257 257 GLU GLU B . n 
B 1 222 ASP 222 258 258 ASP ASP B . n 
B 1 223 ILE 223 259 259 ILE ILE B . n 
B 1 224 PRO 224 260 260 PRO PRO B . n 
B 1 225 PRO 225 261 261 PRO PRO B . n 
B 1 226 SER 226 262 262 SER SER B . n 
B 1 227 GLN 227 263 263 GLN GLN B . n 
B 1 228 ASN 228 264 264 ASN ASN B . n 
B 1 229 TYR 229 265 265 TYR TYR B . n 
B 1 230 SER 230 266 266 SER SER B . n 
B 1 231 SER 231 267 267 SER SER B . n 
B 1 232 LEU 232 268 268 LEU LEU B . n 
B 1 233 GLY 233 269 269 GLY GLY B . n 
B 1 234 SER 234 270 270 SER SER B . n 
B 1 235 LEU 235 271 271 LEU LEU B . n 
B 1 236 LEU 236 272 272 LEU LEU B . n 
B 1 237 HIS 237 273 273 HIS HIS B . n 
B 1 238 GLY 238 274 274 GLY GLY B . n 
B 1 239 PHE 239 275 275 PHE PHE B . n 
B 1 240 PHE 240 276 276 PHE PHE B . n 
B 1 241 ARG 241 277 277 ARG ARG B . n 
B 1 242 PHE 242 278 278 PHE PHE B . n 
B 1 243 TYR 243 279 279 TYR TYR B . n 
B 1 244 ALA 244 280 280 ALA ALA B . n 
B 1 245 TYR 245 281 281 TYR TYR B . n 
B 1 246 LYS 246 282 282 LYS LYS B . n 
B 1 247 PHE 247 283 283 PHE PHE B . n 
B 1 248 GLU 248 284 284 GLU GLU B . n 
B 1 249 PRO 249 285 285 PRO PRO B . n 
B 1 250 ARG 250 286 286 ARG ARG B . n 
B 1 251 GLU 251 287 287 GLU GLU B . n 
B 1 252 LYS 252 288 288 LYS LYS B . n 
B 1 253 VAL 253 289 289 VAL VAL B . n 
B 1 254 VAL 254 290 290 VAL VAL B . n 
B 1 255 THR 255 291 291 THR THR B . n 
B 1 256 PHE 256 292 292 PHE PHE B . n 
B 1 257 ARG 257 293 293 ARG ARG B . n 
B 1 258 ARG 258 294 294 ARG ARG B . n 
B 1 259 PRO 259 295 295 PRO PRO B . n 
B 1 260 ASP 260 296 296 ASP ASP B . n 
B 1 261 GLY 261 297 297 GLY GLY B . n 
B 1 262 TYR 262 298 298 TYR TYR B . n 
B 1 263 LEU 263 299 299 LEU LEU B . n 
B 1 264 THR 264 300 300 THR THR B . n 
B 1 265 LYS 265 301 301 LYS LYS B . n 
B 1 266 GLN 266 302 302 GLN GLN B . n 
B 1 267 GLU 267 303 303 GLU GLU B . n 
B 1 268 LYS 268 304 304 LYS LYS B . n 
B 1 269 GLY 269 305 305 GLY GLY B . n 
B 1 270 TRP 270 306 306 TRP TRP B . n 
B 1 271 THR 271 307 307 THR THR B . n 
B 1 272 SER 272 308 308 SER SER B . n 
B 1 273 ALA 273 309 309 ALA ALA B . n 
B 1 274 THR 274 310 310 THR THR B . n 
B 1 275 GLU 275 311 ?   ?   ?   B . n 
B 1 276 HIS 276 312 ?   ?   ?   B . n 
B 1 277 THR 277 313 ?   ?   ?   B . n 
B 1 278 GLY 278 314 ?   ?   ?   B . n 
B 1 279 SER 279 315 ?   ?   ?   B . n 
B 1 280 ALA 280 316 ?   ?   ?   B . n 
B 1 281 ASP 281 317 ?   ?   ?   B . n 
B 1 282 GLN 282 318 ?   ?   ?   B . n 
B 1 283 ILE 283 319 ?   ?   ?   B . n 
B 1 284 ILE 284 320 ?   ?   ?   B . n 
B 1 285 LYS 285 321 ?   ?   ?   B . n 
B 1 286 ASP 286 322 322 ASP ASP B . n 
B 1 287 ARG 287 323 323 ARG ARG B . n 
B 1 288 TYR 288 324 324 TYR TYR B . n 
B 1 289 ILE 289 325 325 ILE ILE B . n 
B 1 290 LEU 290 326 326 LEU LEU B . n 
B 1 291 ALA 291 327 327 ALA ALA B . n 
B 1 292 ILE 292 328 328 ILE ILE B . n 
B 1 293 GLU 293 329 329 GLU GLU B . n 
B 1 294 ASP 294 330 330 ASP ASP B . n 
B 1 295 PRO 295 331 331 PRO PRO B . n 
B 1 296 PHE 296 332 332 PHE PHE B . n 
B 1 297 GLU 297 333 333 GLU GLU B . n 
B 1 298 ILE 298 334 334 ILE ILE B . n 
B 1 299 SER 299 335 335 SER SER B . n 
B 1 300 HIS 300 336 336 HIS HIS B . n 
B 1 301 ASN 301 337 337 ASN ASN B . n 
B 1 302 VAL 302 338 338 VAL VAL B . n 
B 1 303 GLY 303 339 339 GLY GLY B . n 
B 1 304 ARG 304 340 340 ARG ARG B . n 
B 1 305 THR 305 341 341 THR THR B . n 
B 1 306 VAL 306 342 342 VAL VAL B . n 
B 1 307 SER 307 343 343 SER SER B . n 
B 1 308 SER 308 344 344 SER SER B . n 
B 1 309 SER 309 345 345 SER SER B . n 
B 1 310 GLY 310 346 346 GLY GLY B . n 
B 1 311 LEU 311 347 347 LEU LEU B . n 
B 1 312 TYR 312 348 348 TYR TYR B . n 
B 1 313 ARG 313 349 349 ARG ARG B . n 
B 1 314 ILE 314 350 350 ILE ILE B . n 
B 1 315 ARG 315 351 351 ARG ARG B . n 
B 1 316 GLY 316 352 352 GLY GLY B . n 
B 1 317 GLU 317 353 353 GLU GLU B . n 
B 1 318 PHE 318 354 354 PHE PHE B . n 
B 1 319 MET 319 355 355 MET MET B . n 
B 1 320 ALA 320 356 356 ALA ALA B . n 
B 1 321 ALA 321 357 357 ALA ALA B . n 
B 1 322 SER 322 358 358 SER SER B . n 
B 1 323 ARG 323 359 359 ARG ARG B . n 
B 1 324 LEU 324 360 360 LEU LEU B . n 
B 1 325 LEU 325 361 361 LEU LEU B . n 
B 1 326 ASN 326 362 362 ASN ASN B . n 
B 1 327 SER 327 363 363 SER SER B . n 
B 1 328 ARG 328 364 364 ARG ARG B . n 
B 1 329 SER 329 365 365 SER SER B . n 
B 1 330 TYR 330 366 366 TYR TYR B . n 
B 1 331 PRO 331 367 367 PRO PRO B . n 
B 1 332 ILE 332 368 368 ILE ILE B . n 
B 1 333 PRO 333 369 369 PRO PRO B . n 
B 1 334 TYR 334 370 370 TYR TYR B . n 
B 1 335 ASP 335 371 371 ASP ASP B . n 
B 1 336 SER 336 372 372 SER SER B . n 
B 1 337 LEU 337 373 373 LEU LEU B . n 
B 1 338 PHE 338 374 374 PHE PHE B . n 
B 1 339 GLU 339 375 375 GLU GLU B . n 
B 1 340 GLU 340 376 376 GLU GLU B . n 
B 1 341 ALA 341 377 377 ALA ALA B . n 
C 2 1   A   1   58  58  A   AR  D . n 
C 2 2   U   2   59  59  U   UR  D . n 
D 2 1   A   1   58  58  A   AR  H . n 
D 2 2   U   2   59  59  U   UR  H . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,F,G,J,K,M 
2 1 B,D,H,I,L,N     
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1190  ? 
1 MORE         -24   ? 
1 'SSA (A^2)'  16230 ? 
2 'ABSA (A^2)' 1000  ? 
2 MORE         -15   ? 
2 'SSA (A^2)'  15530 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_conn_angle.id                    1 
_pdbx_struct_conn_angle.ptnr1_label_atom_id   O 
_pdbx_struct_conn_angle.ptnr1_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr1_label_asym_id   K 
_pdbx_struct_conn_angle.ptnr1_label_comp_id   HOH 
_pdbx_struct_conn_angle.ptnr1_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id    HOH 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id     680 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr1_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr2_label_atom_id   MG 
_pdbx_struct_conn_angle.ptnr2_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr2_label_asym_id   E 
_pdbx_struct_conn_angle.ptnr2_label_comp_id   MG 
_pdbx_struct_conn_angle.ptnr2_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id    MG 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id     401 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr2_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr3_label_atom_id   O 
_pdbx_struct_conn_angle.ptnr3_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr3_label_asym_id   K 
_pdbx_struct_conn_angle.ptnr3_label_comp_id   HOH 
_pdbx_struct_conn_angle.ptnr3_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id    HOH 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id     619 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr3_symmetry        1_555 
_pdbx_struct_conn_angle.value                 52.6 
_pdbx_struct_conn_angle.value_esd             ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-12-18 
2 'Structure model' 1 1 2014-01-15 
3 'Structure model' 1 2 2014-03-26 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC   'data collection' Quantum                       ? 1 
PHASER phasing           .                             ? 2 
PHENIX refinement        '(phenix.refine: 1.8.1_1168)' ? 3 
XDS    'data reduction'  package                       ? 4 
XDS    'data scaling'    package                       ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 BR    B BR  402 ? ? O B HOH 593 ? ? 2.01 
2  1 O     A HOH 573 ? ? O A HOH 605 ? ? 2.04 
3  1 OH    B TYR 370 ? ? O B HOH 535 ? ? 2.06 
4  1 O     A HOH 610 ? ? O A HOH 689 ? ? 2.07 
5  1 "O3'" H U   59  ? ? O H HOH 103 ? ? 2.10 
6  1 OP1   H U   59  ? ? O H HOH 102 ? ? 2.11 
7  1 OP1   D U   59  ? ? O D HOH 206 ? ? 2.11 
8  1 O     A HOH 672 ? ? O D HOH 201 ? ? 2.17 
9  1 O     A ALA 138 ? ? O A HOH 616 ? ? 2.17 
10 1 OH    A TYR 370 ? ? O A HOH 629 ? ? 2.19 
11 1 O     A HOH 683 ? ? O A HOH 685 ? ? 2.19 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     592 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     644 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_656 
_pdbx_validate_symm_contact.dist              2.15 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ILE A 140 ? ? 66.77   87.60   
2 1 THR A 208 ? ? -112.04 -150.68 
3 1 VAL A 225 ? ? -106.47 -61.04  
4 1 TRP A 306 ? ? -104.99 66.30   
5 1 SER A 365 ? ? -57.38  177.00  
6 1 PRO A 367 ? ? 14.95   108.20  
7 1 THR B 208 ? ? -107.55 -152.81 
8 1 TRP B 306 ? ? -115.11 69.25   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   TYR 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    366 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   PRO 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    367 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -131.71 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 37  ? A GLY 1   
2  1 Y 1 A SER 110 ? A SER 74  
3  1 Y 1 A ARG 111 ? A ARG 75  
4  1 Y 1 A VAL 112 ? A VAL 76  
5  1 Y 1 A GLN 113 ? A GLN 77  
6  1 Y 1 A SER 114 ? A SER 78  
7  1 Y 1 A ASP 115 ? A ASP 79  
8  1 Y 1 A ALA 309 ? A ALA 273 
9  1 Y 1 A THR 310 ? A THR 274 
10 1 Y 1 A GLU 311 ? A GLU 275 
11 1 Y 1 A HIS 312 ? A HIS 276 
12 1 Y 1 A THR 313 ? A THR 277 
13 1 Y 1 A GLY 314 ? A GLY 278 
14 1 Y 1 A SER 315 ? A SER 279 
15 1 Y 1 A ALA 316 ? A ALA 280 
16 1 Y 1 A ASP 317 ? A ASP 281 
17 1 Y 1 A GLN 318 ? A GLN 282 
18 1 Y 1 A ILE 319 ? A ILE 283 
19 1 Y 1 A ILE 320 ? A ILE 284 
20 1 Y 1 A LYS 321 ? A LYS 285 
21 1 Y 1 A ASP 322 ? A ASP 286 
22 1 Y 1 B GLY 37  ? B GLY 1   
23 1 Y 1 B ASP 38  ? B ASP 2   
24 1 Y 1 B SER 110 ? B SER 74  
25 1 Y 1 B ARG 111 ? B ARG 75  
26 1 Y 1 B VAL 112 ? B VAL 76  
27 1 Y 1 B GLN 113 ? B GLN 77  
28 1 Y 1 B SER 114 ? B SER 78  
29 1 Y 1 B ASP 115 ? B ASP 79  
30 1 Y 1 B ARG 137 ? B ARG 101 
31 1 Y 1 B ALA 138 ? B ALA 102 
32 1 Y 1 B ARG 139 ? B ARG 103 
33 1 Y 1 B ASP 148 ? B ASP 112 
34 1 Y 1 B THR 149 ? B THR 113 
35 1 Y 1 B LYS 150 ? B LYS 114 
36 1 Y 1 B ASN 151 ? B ASN 115 
37 1 Y 1 B GLY 152 ? B GLY 116 
38 1 Y 1 B PHE 153 ? B PHE 117 
39 1 Y 1 B GLY 154 ? B GLY 118 
40 1 Y 1 B ALA 155 ? B ALA 119 
41 1 Y 1 B SER 156 ? B SER 120 
42 1 Y 1 B GLU 311 ? B GLU 275 
43 1 Y 1 B HIS 312 ? B HIS 276 
44 1 Y 1 B THR 313 ? B THR 277 
45 1 Y 1 B GLY 314 ? B GLY 278 
46 1 Y 1 B SER 315 ? B SER 279 
47 1 Y 1 B ALA 316 ? B ALA 280 
48 1 Y 1 B ASP 317 ? B ASP 281 
49 1 Y 1 B GLN 318 ? B GLN 282 
50 1 Y 1 B ILE 319 ? B ILE 283 
51 1 Y 1 B ILE 320 ? B ILE 284 
52 1 Y 1 B LYS 321 ? B LYS 285 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'MAGNESIUM ION' MG  
4 'BROMIDE ION'   BR  
5 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 MG  1   401 1   MG  MG  A . 
F 3 MG  1   402 3   MG  MG  A . 
G 4 BR  1   403 1   BR  BR  A . 
H 3 MG  1   401 2   MG  MG  B . 
I 4 BR  1   402 1   BR  BR  B . 
J 4 BR  1   101 1   BR  BR  D . 
K 5 HOH 1   501 4   HOH HOH A . 
K 5 HOH 2   502 5   HOH HOH A . 
K 5 HOH 3   503 6   HOH HOH A . 
K 5 HOH 4   504 8   HOH HOH A . 
K 5 HOH 5   505 9   HOH HOH A . 
K 5 HOH 6   506 10  HOH HOH A . 
K 5 HOH 7   507 12  HOH HOH A . 
K 5 HOH 8   508 13  HOH HOH A . 
K 5 HOH 9   509 14  HOH HOH A . 
K 5 HOH 10  510 16  HOH HOH A . 
K 5 HOH 11  511 17  HOH HOH A . 
K 5 HOH 12  512 18  HOH HOH A . 
K 5 HOH 13  513 20  HOH HOH A . 
K 5 HOH 14  514 22  HOH HOH A . 
K 5 HOH 15  515 24  HOH HOH A . 
K 5 HOH 16  516 25  HOH HOH A . 
K 5 HOH 17  517 26  HOH HOH A . 
K 5 HOH 18  518 27  HOH HOH A . 
K 5 HOH 19  519 29  HOH HOH A . 
K 5 HOH 20  520 30  HOH HOH A . 
K 5 HOH 21  521 36  HOH HOH A . 
K 5 HOH 22  522 44  HOH HOH A . 
K 5 HOH 23  523 48  HOH HOH A . 
K 5 HOH 24  524 49  HOH HOH A . 
K 5 HOH 25  525 50  HOH HOH A . 
K 5 HOH 26  526 51  HOH HOH A . 
K 5 HOH 27  527 53  HOH HOH A . 
K 5 HOH 28  528 54  HOH HOH A . 
K 5 HOH 29  529 55  HOH HOH A . 
K 5 HOH 30  530 56  HOH HOH A . 
K 5 HOH 31  531 58  HOH HOH A . 
K 5 HOH 32  532 59  HOH HOH A . 
K 5 HOH 33  533 60  HOH HOH A . 
K 5 HOH 34  534 62  HOH HOH A . 
K 5 HOH 35  535 63  HOH HOH A . 
K 5 HOH 36  536 64  HOH HOH A . 
K 5 HOH 37  537 66  HOH HOH A . 
K 5 HOH 38  538 67  HOH HOH A . 
K 5 HOH 39  539 68  HOH HOH A . 
K 5 HOH 40  540 73  HOH HOH A . 
K 5 HOH 41  541 74  HOH HOH A . 
K 5 HOH 42  542 75  HOH HOH A . 
K 5 HOH 43  543 76  HOH HOH A . 
K 5 HOH 44  544 78  HOH HOH A . 
K 5 HOH 45  545 80  HOH HOH A . 
K 5 HOH 46  546 83  HOH HOH A . 
K 5 HOH 47  547 84  HOH HOH A . 
K 5 HOH 48  548 86  HOH HOH A . 
K 5 HOH 49  549 89  HOH HOH A . 
K 5 HOH 50  550 91  HOH HOH A . 
K 5 HOH 51  551 93  HOH HOH A . 
K 5 HOH 52  552 94  HOH HOH A . 
K 5 HOH 53  553 96  HOH HOH A . 
K 5 HOH 54  554 99  HOH HOH A . 
K 5 HOH 55  555 101 HOH HOH A . 
K 5 HOH 56  556 102 HOH HOH A . 
K 5 HOH 57  557 104 HOH HOH A . 
K 5 HOH 58  558 105 HOH HOH A . 
K 5 HOH 59  559 106 HOH HOH A . 
K 5 HOH 60  560 112 HOH HOH A . 
K 5 HOH 61  561 114 HOH HOH A . 
K 5 HOH 62  562 115 HOH HOH A . 
K 5 HOH 63  563 117 HOH HOH A . 
K 5 HOH 64  564 118 HOH HOH A . 
K 5 HOH 65  565 119 HOH HOH A . 
K 5 HOH 66  566 120 HOH HOH A . 
K 5 HOH 67  567 122 HOH HOH A . 
K 5 HOH 68  568 124 HOH HOH A . 
K 5 HOH 69  569 125 HOH HOH A . 
K 5 HOH 70  570 126 HOH HOH A . 
K 5 HOH 71  571 128 HOH HOH A . 
K 5 HOH 72  572 131 HOH HOH A . 
K 5 HOH 73  573 133 HOH HOH A . 
K 5 HOH 74  574 134 HOH HOH A . 
K 5 HOH 75  575 136 HOH HOH A . 
K 5 HOH 76  576 137 HOH HOH A . 
K 5 HOH 77  577 138 HOH HOH A . 
K 5 HOH 78  578 139 HOH HOH A . 
K 5 HOH 79  579 145 HOH HOH A . 
K 5 HOH 80  580 146 HOH HOH A . 
K 5 HOH 81  581 147 HOH HOH A . 
K 5 HOH 82  582 148 HOH HOH A . 
K 5 HOH 83  583 149 HOH HOH A . 
K 5 HOH 84  584 150 HOH HOH A . 
K 5 HOH 85  585 151 HOH HOH A . 
K 5 HOH 86  586 152 HOH HOH A . 
K 5 HOH 87  587 154 HOH HOH A . 
K 5 HOH 88  588 155 HOH HOH A . 
K 5 HOH 89  589 156 HOH HOH A . 
K 5 HOH 90  590 157 HOH HOH A . 
K 5 HOH 91  591 158 HOH HOH A . 
K 5 HOH 92  592 159 HOH HOH A . 
K 5 HOH 93  593 160 HOH HOH A . 
K 5 HOH 94  594 161 HOH HOH A . 
K 5 HOH 95  595 162 HOH HOH A . 
K 5 HOH 96  596 163 HOH HOH A . 
K 5 HOH 97  597 164 HOH HOH A . 
K 5 HOH 98  598 165 HOH HOH A . 
K 5 HOH 99  599 167 HOH HOH A . 
K 5 HOH 100 600 168 HOH HOH A . 
K 5 HOH 101 601 169 HOH HOH A . 
K 5 HOH 102 602 179 HOH HOH A . 
K 5 HOH 103 603 190 HOH HOH A . 
K 5 HOH 104 604 193 HOH HOH A . 
K 5 HOH 105 605 194 HOH HOH A . 
K 5 HOH 106 606 195 HOH HOH A . 
K 5 HOH 107 607 196 HOH HOH A . 
K 5 HOH 108 608 197 HOH HOH A . 
K 5 HOH 109 609 199 HOH HOH A . 
K 5 HOH 110 610 200 HOH HOH A . 
K 5 HOH 111 611 201 HOH HOH A . 
K 5 HOH 112 612 202 HOH HOH A . 
K 5 HOH 113 613 203 HOH HOH A . 
K 5 HOH 114 614 204 HOH HOH A . 
K 5 HOH 115 615 205 HOH HOH A . 
K 5 HOH 116 616 206 HOH HOH A . 
K 5 HOH 117 617 207 HOH HOH A . 
K 5 HOH 118 618 208 HOH HOH A . 
K 5 HOH 119 619 209 HOH HOH A . 
K 5 HOH 120 620 210 HOH HOH A . 
K 5 HOH 121 621 211 HOH HOH A . 
K 5 HOH 122 622 212 HOH HOH A . 
K 5 HOH 123 623 213 HOH HOH A . 
K 5 HOH 124 624 214 HOH HOH A . 
K 5 HOH 125 625 215 HOH HOH A . 
K 5 HOH 126 626 216 HOH HOH A . 
K 5 HOH 127 627 217 HOH HOH A . 
K 5 HOH 128 628 218 HOH HOH A . 
K 5 HOH 129 629 219 HOH HOH A . 
K 5 HOH 130 630 220 HOH HOH A . 
K 5 HOH 131 631 221 HOH HOH A . 
K 5 HOH 132 632 223 HOH HOH A . 
K 5 HOH 133 633 250 HOH HOH A . 
K 5 HOH 134 634 251 HOH HOH A . 
K 5 HOH 135 635 253 HOH HOH A . 
K 5 HOH 136 636 254 HOH HOH A . 
K 5 HOH 137 637 255 HOH HOH A . 
K 5 HOH 138 638 256 HOH HOH A . 
K 5 HOH 139 639 257 HOH HOH A . 
K 5 HOH 140 640 261 HOH HOH A . 
K 5 HOH 141 641 266 HOH HOH A . 
K 5 HOH 142 642 267 HOH HOH A . 
K 5 HOH 143 643 268 HOH HOH A . 
K 5 HOH 144 644 269 HOH HOH A . 
K 5 HOH 145 645 270 HOH HOH A . 
K 5 HOH 146 646 280 HOH HOH A . 
K 5 HOH 147 647 284 HOH HOH A . 
K 5 HOH 148 648 285 HOH HOH A . 
K 5 HOH 149 649 286 HOH HOH A . 
K 5 HOH 150 650 287 HOH HOH A . 
K 5 HOH 151 651 288 HOH HOH A . 
K 5 HOH 152 652 289 HOH HOH A . 
K 5 HOH 153 653 290 HOH HOH A . 
K 5 HOH 154 654 291 HOH HOH A . 
K 5 HOH 155 655 292 HOH HOH A . 
K 5 HOH 156 656 293 HOH HOH A . 
K 5 HOH 157 657 294 HOH HOH A . 
K 5 HOH 158 658 295 HOH HOH A . 
K 5 HOH 159 659 296 HOH HOH A . 
K 5 HOH 160 660 297 HOH HOH A . 
K 5 HOH 161 661 298 HOH HOH A . 
K 5 HOH 162 662 299 HOH HOH A . 
K 5 HOH 163 663 300 HOH HOH A . 
K 5 HOH 164 664 301 HOH HOH A . 
K 5 HOH 165 665 302 HOH HOH A . 
K 5 HOH 166 666 303 HOH HOH A . 
K 5 HOH 167 667 304 HOH HOH A . 
K 5 HOH 168 668 305 HOH HOH A . 
K 5 HOH 169 669 306 HOH HOH A . 
K 5 HOH 170 670 307 HOH HOH A . 
K 5 HOH 171 671 308 HOH HOH A . 
K 5 HOH 172 672 310 HOH HOH A . 
K 5 HOH 173 673 311 HOH HOH A . 
K 5 HOH 174 674 312 HOH HOH A . 
K 5 HOH 175 675 313 HOH HOH A . 
K 5 HOH 176 676 314 HOH HOH A . 
K 5 HOH 177 677 323 HOH HOH A . 
K 5 HOH 178 678 327 HOH HOH A . 
K 5 HOH 179 679 328 HOH HOH A . 
K 5 HOH 180 680 332 HOH HOH A . 
K 5 HOH 181 681 333 HOH HOH A . 
K 5 HOH 182 682 334 HOH HOH A . 
K 5 HOH 183 683 337 HOH HOH A . 
K 5 HOH 184 684 338 HOH HOH A . 
K 5 HOH 185 685 339 HOH HOH A . 
K 5 HOH 186 686 340 HOH HOH A . 
K 5 HOH 187 687 341 HOH HOH A . 
K 5 HOH 188 688 342 HOH HOH A . 
K 5 HOH 189 689 343 HOH HOH A . 
K 5 HOH 190 690 344 HOH HOH A . 
K 5 HOH 191 691 345 HOH HOH A . 
K 5 HOH 192 692 346 HOH HOH A . 
K 5 HOH 193 693 347 HOH HOH A . 
K 5 HOH 194 694 355 HOH HOH A . 
K 5 HOH 195 695 356 HOH HOH A . 
L 5 HOH 1   501 1   HOH HOH B . 
L 5 HOH 2   502 2   HOH HOH B . 
L 5 HOH 3   503 3   HOH HOH B . 
L 5 HOH 4   504 7   HOH HOH B . 
L 5 HOH 5   505 11  HOH HOH B . 
L 5 HOH 6   506 15  HOH HOH B . 
L 5 HOH 7   507 19  HOH HOH B . 
L 5 HOH 8   508 21  HOH HOH B . 
L 5 HOH 9   509 23  HOH HOH B . 
L 5 HOH 10  510 28  HOH HOH B . 
L 5 HOH 11  511 31  HOH HOH B . 
L 5 HOH 12  512 32  HOH HOH B . 
L 5 HOH 13  513 33  HOH HOH B . 
L 5 HOH 14  514 34  HOH HOH B . 
L 5 HOH 15  515 35  HOH HOH B . 
L 5 HOH 16  516 37  HOH HOH B . 
L 5 HOH 17  517 38  HOH HOH B . 
L 5 HOH 18  518 39  HOH HOH B . 
L 5 HOH 19  519 40  HOH HOH B . 
L 5 HOH 20  520 41  HOH HOH B . 
L 5 HOH 21  521 42  HOH HOH B . 
L 5 HOH 22  522 43  HOH HOH B . 
L 5 HOH 23  523 45  HOH HOH B . 
L 5 HOH 24  524 46  HOH HOH B . 
L 5 HOH 25  525 47  HOH HOH B . 
L 5 HOH 26  526 52  HOH HOH B . 
L 5 HOH 27  527 57  HOH HOH B . 
L 5 HOH 28  528 61  HOH HOH B . 
L 5 HOH 29  529 65  HOH HOH B . 
L 5 HOH 30  530 69  HOH HOH B . 
L 5 HOH 31  531 70  HOH HOH B . 
L 5 HOH 32  532 71  HOH HOH B . 
L 5 HOH 33  533 72  HOH HOH B . 
L 5 HOH 34  534 77  HOH HOH B . 
L 5 HOH 35  535 79  HOH HOH B . 
L 5 HOH 36  536 81  HOH HOH B . 
L 5 HOH 37  537 85  HOH HOH B . 
L 5 HOH 38  538 87  HOH HOH B . 
L 5 HOH 39  539 88  HOH HOH B . 
L 5 HOH 40  540 90  HOH HOH B . 
L 5 HOH 41  541 92  HOH HOH B . 
L 5 HOH 42  542 95  HOH HOH B . 
L 5 HOH 43  543 97  HOH HOH B . 
L 5 HOH 44  544 98  HOH HOH B . 
L 5 HOH 45  545 100 HOH HOH B . 
L 5 HOH 46  546 103 HOH HOH B . 
L 5 HOH 47  547 107 HOH HOH B . 
L 5 HOH 48  548 108 HOH HOH B . 
L 5 HOH 49  549 109 HOH HOH B . 
L 5 HOH 50  550 110 HOH HOH B . 
L 5 HOH 51  551 111 HOH HOH B . 
L 5 HOH 52  552 113 HOH HOH B . 
L 5 HOH 53  553 116 HOH HOH B . 
L 5 HOH 54  554 121 HOH HOH B . 
L 5 HOH 55  555 123 HOH HOH B . 
L 5 HOH 56  556 127 HOH HOH B . 
L 5 HOH 57  557 129 HOH HOH B . 
L 5 HOH 58  558 130 HOH HOH B . 
L 5 HOH 59  559 135 HOH HOH B . 
L 5 HOH 60  560 140 HOH HOH B . 
L 5 HOH 61  561 141 HOH HOH B . 
L 5 HOH 62  562 142 HOH HOH B . 
L 5 HOH 63  563 143 HOH HOH B . 
L 5 HOH 64  564 144 HOH HOH B . 
L 5 HOH 65  565 170 HOH HOH B . 
L 5 HOH 66  566 171 HOH HOH B . 
L 5 HOH 67  567 172 HOH HOH B . 
L 5 HOH 68  568 173 HOH HOH B . 
L 5 HOH 69  569 174 HOH HOH B . 
L 5 HOH 70  570 175 HOH HOH B . 
L 5 HOH 71  571 176 HOH HOH B . 
L 5 HOH 72  572 177 HOH HOH B . 
L 5 HOH 73  573 178 HOH HOH B . 
L 5 HOH 74  574 180 HOH HOH B . 
L 5 HOH 75  575 181 HOH HOH B . 
L 5 HOH 76  576 182 HOH HOH B . 
L 5 HOH 77  577 183 HOH HOH B . 
L 5 HOH 78  578 184 HOH HOH B . 
L 5 HOH 79  579 185 HOH HOH B . 
L 5 HOH 80  580 186 HOH HOH B . 
L 5 HOH 81  581 187 HOH HOH B . 
L 5 HOH 82  582 188 HOH HOH B . 
L 5 HOH 83  583 189 HOH HOH B . 
L 5 HOH 84  584 191 HOH HOH B . 
L 5 HOH 85  585 222 HOH HOH B . 
L 5 HOH 86  586 224 HOH HOH B . 
L 5 HOH 87  587 225 HOH HOH B . 
L 5 HOH 88  588 226 HOH HOH B . 
L 5 HOH 89  589 227 HOH HOH B . 
L 5 HOH 90  590 228 HOH HOH B . 
L 5 HOH 91  591 229 HOH HOH B . 
L 5 HOH 92  592 230 HOH HOH B . 
L 5 HOH 93  593 231 HOH HOH B . 
L 5 HOH 94  594 232 HOH HOH B . 
L 5 HOH 95  595 233 HOH HOH B . 
L 5 HOH 96  596 234 HOH HOH B . 
L 5 HOH 97  597 235 HOH HOH B . 
L 5 HOH 98  598 236 HOH HOH B . 
L 5 HOH 99  599 237 HOH HOH B . 
L 5 HOH 100 600 238 HOH HOH B . 
L 5 HOH 101 601 239 HOH HOH B . 
L 5 HOH 102 602 240 HOH HOH B . 
L 5 HOH 103 603 241 HOH HOH B . 
L 5 HOH 104 604 242 HOH HOH B . 
L 5 HOH 105 605 243 HOH HOH B . 
L 5 HOH 106 606 244 HOH HOH B . 
L 5 HOH 107 607 245 HOH HOH B . 
L 5 HOH 108 608 246 HOH HOH B . 
L 5 HOH 109 609 247 HOH HOH B . 
L 5 HOH 110 610 248 HOH HOH B . 
L 5 HOH 111 611 249 HOH HOH B . 
L 5 HOH 112 612 252 HOH HOH B . 
L 5 HOH 113 613 258 HOH HOH B . 
L 5 HOH 114 614 259 HOH HOH B . 
L 5 HOH 115 615 260 HOH HOH B . 
L 5 HOH 116 616 263 HOH HOH B . 
L 5 HOH 117 617 264 HOH HOH B . 
L 5 HOH 118 618 265 HOH HOH B . 
L 5 HOH 119 619 271 HOH HOH B . 
L 5 HOH 120 620 275 HOH HOH B . 
L 5 HOH 121 621 276 HOH HOH B . 
L 5 HOH 122 622 277 HOH HOH B . 
L 5 HOH 123 623 278 HOH HOH B . 
L 5 HOH 124 624 279 HOH HOH B . 
L 5 HOH 125 625 281 HOH HOH B . 
L 5 HOH 126 626 282 HOH HOH B . 
L 5 HOH 127 627 283 HOH HOH B . 
L 5 HOH 128 628 315 HOH HOH B . 
L 5 HOH 129 629 316 HOH HOH B . 
L 5 HOH 130 630 317 HOH HOH B . 
L 5 HOH 131 631 318 HOH HOH B . 
L 5 HOH 132 632 319 HOH HOH B . 
L 5 HOH 133 633 320 HOH HOH B . 
L 5 HOH 134 634 321 HOH HOH B . 
L 5 HOH 135 635 322 HOH HOH B . 
L 5 HOH 136 636 324 HOH HOH B . 
L 5 HOH 137 637 325 HOH HOH B . 
L 5 HOH 138 638 326 HOH HOH B . 
L 5 HOH 139 639 329 HOH HOH B . 
L 5 HOH 140 640 330 HOH HOH B . 
L 5 HOH 141 641 331 HOH HOH B . 
L 5 HOH 142 642 335 HOH HOH B . 
L 5 HOH 143 643 336 HOH HOH B . 
L 5 HOH 144 644 348 HOH HOH B . 
L 5 HOH 145 645 349 HOH HOH B . 
L 5 HOH 146 646 350 HOH HOH B . 
L 5 HOH 147 647 351 HOH HOH B . 
L 5 HOH 148 648 352 HOH HOH B . 
L 5 HOH 149 649 353 HOH HOH B . 
L 5 HOH 150 650 354 HOH HOH B . 
L 5 HOH 151 651 192 HOH HOH B . 
L 5 HOH 152 652 262 HOH HOH B . 
M 5 HOH 1   201 82  HOH HOH D . 
M 5 HOH 2   202 132 HOH HOH D . 
M 5 HOH 3   203 153 HOH HOH D . 
M 5 HOH 4   204 166 HOH HOH D . 
M 5 HOH 5   205 198 HOH HOH D . 
M 5 HOH 6   206 309 HOH HOH D . 
N 5 HOH 1   101 272 HOH HOH H . 
N 5 HOH 2   102 273 HOH HOH H . 
N 5 HOH 3   103 274 HOH HOH H . 
#