data_4NLG
# 
_entry.id   4NLG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4NLG         
NDB   NA2779       
RCSB  RCSB083351   
WWPDB D_1000083351 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4NLG 
_pdbx_database_status.recvd_initial_deposition_date   2013-11-14 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mukherjee, P.' 1 
'Wilson, R.C.'  2 
'Pata, J.D.'    3 
# 
_citation.id                        primary 
_citation.title                     
;Three Residues of the Interdomain Linker Determine the Conformation and Single-base Deletion Fidelity of Y-family Translesion Polymerases.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            289 
_citation.page_first                6323 
_citation.page_last                 6331 
_citation.year                      2014 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24415763 
_citation.pdbx_database_id_DOI      10.1074/jbc.M113.537860 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Mukherjee, P.' 1 
primary 'Wilson, R.C.'  2 
primary 'Lahiri, I.'    3 
primary 'Pata, J.D.'    4 
# 
_cell.entry_id           4NLG 
_cell.length_a           120.193 
_cell.length_b           103.067 
_cell.length_c           53.049 
_cell.angle_alpha        90.00 
_cell.angle_beta         105.39 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4NLG 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase IV'                                                 41022.805 1  2.7.7.7 'K242R, I243K, P244S' ? 
?              
2 polymer     syn "5'-D(*GP*GP*CP*AP*CP*TP*GP*AP*TP*CP*GP*GP*G)-3'"                   4032.622  1  ?       ?                     ? 
'primer DNA'   
3 polymer     syn "5'-D(*TP*TP*AP*CP*GP*CP*CP*CP*TP*GP*AP*TP*CP*AP*GP*TP*GP*CP*C)-3'" 5756.723  1  ?       ?                     ? 
'template DNA' 
4 non-polymer syn 'CALCIUM ION'                                                       40.078    2  ?       ?                     ? 
?              
5 non-polymer syn "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"                                  467.157   1  ?       ?                     ? 
?              
6 water       nat water                                                               18.015    41 ?       ?                     ? 
?              
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Pol IV' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MIVIFVDFDYFFAQVEEVLNPQYKGKPLVVCVYSGRTKTSGAVATANYEARKLGVKAGMPIIKAMQIAPSAIYVPMRKPI
YEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKEKITVTVGVAPNKILAKIIADKSK
PNGLGVIRPTEVQDFLNELDIDEIPGIGSVLARRLNELGIQKLRDILSKNYNELEKITGKAKALYLLKLAQNKYSEPVEN
KSRKSHGRYLTLPYNTRDVKVILPYLKKAINEAYNKVNGIPMRITVIAIMEDLDILSKGKKFKHGISIDNAYKVAEDLLR
ELLVRDKRRNVRRIGVKLDNIIINKTNLSDFFDIGGHHHHHH
;
;MIVIFVDFDYFFAQVEEVLNPQYKGKPLVVCVYSGRTKTSGAVATANYEARKLGVKAGMPIIKAMQIAPSAIYVPMRKPI
YEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKEKITVTVGVAPNKILAKIIADKSK
PNGLGVIRPTEVQDFLNELDIDEIPGIGSVLARRLNELGIQKLRDILSKNYNELEKITGKAKALYLLKLAQNKYSEPVEN
KSRKSHGRYLTLPYNTRDVKVILPYLKKAINEAYNKVNGIPMRITVIAIMEDLDILSKGKKFKHGISIDNAYKVAEDLLR
ELLVRDKRRNVRRIGVKLDNIIINKTNLSDFFDIGGHHHHHH
;
A ? 
2 polydeoxyribonucleotide no no '(DG)(DG)(DC)(DA)(DC)(DT)(DG)(DA)(DT)(DC)(DG)(DG)(DG)' GGCACTGATCGGG P ? 
3 polydeoxyribonucleotide no no '(DT)(DT)(DA)(DC)(DG)(DC)(DC)(DC)(DT)(DG)(DA)(DT)(DC)(DA)(DG)(DT)(DG)(DC)(DC)' TTACGCCCTGATCAGTGCC 
T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ILE n 
1 3   VAL n 
1 4   ILE n 
1 5   PHE n 
1 6   VAL n 
1 7   ASP n 
1 8   PHE n 
1 9   ASP n 
1 10  TYR n 
1 11  PHE n 
1 12  PHE n 
1 13  ALA n 
1 14  GLN n 
1 15  VAL n 
1 16  GLU n 
1 17  GLU n 
1 18  VAL n 
1 19  LEU n 
1 20  ASN n 
1 21  PRO n 
1 22  GLN n 
1 23  TYR n 
1 24  LYS n 
1 25  GLY n 
1 26  LYS n 
1 27  PRO n 
1 28  LEU n 
1 29  VAL n 
1 30  VAL n 
1 31  CYS n 
1 32  VAL n 
1 33  TYR n 
1 34  SER n 
1 35  GLY n 
1 36  ARG n 
1 37  THR n 
1 38  LYS n 
1 39  THR n 
1 40  SER n 
1 41  GLY n 
1 42  ALA n 
1 43  VAL n 
1 44  ALA n 
1 45  THR n 
1 46  ALA n 
1 47  ASN n 
1 48  TYR n 
1 49  GLU n 
1 50  ALA n 
1 51  ARG n 
1 52  LYS n 
1 53  LEU n 
1 54  GLY n 
1 55  VAL n 
1 56  LYS n 
1 57  ALA n 
1 58  GLY n 
1 59  MET n 
1 60  PRO n 
1 61  ILE n 
1 62  ILE n 
1 63  LYS n 
1 64  ALA n 
1 65  MET n 
1 66  GLN n 
1 67  ILE n 
1 68  ALA n 
1 69  PRO n 
1 70  SER n 
1 71  ALA n 
1 72  ILE n 
1 73  TYR n 
1 74  VAL n 
1 75  PRO n 
1 76  MET n 
1 77  ARG n 
1 78  LYS n 
1 79  PRO n 
1 80  ILE n 
1 81  TYR n 
1 82  GLU n 
1 83  ALA n 
1 84  PHE n 
1 85  SER n 
1 86  ASN n 
1 87  ARG n 
1 88  ILE n 
1 89  MET n 
1 90  ASN n 
1 91  LEU n 
1 92  LEU n 
1 93  ASN n 
1 94  LYS n 
1 95  HIS n 
1 96  ALA n 
1 97  ASP n 
1 98  LYS n 
1 99  ILE n 
1 100 GLU n 
1 101 VAL n 
1 102 ALA n 
1 103 SER n 
1 104 ILE n 
1 105 ASP n 
1 106 GLU n 
1 107 ALA n 
1 108 TYR n 
1 109 LEU n 
1 110 ASP n 
1 111 VAL n 
1 112 THR n 
1 113 ASN n 
1 114 LYS n 
1 115 VAL n 
1 116 GLU n 
1 117 GLY n 
1 118 ASN n 
1 119 PHE n 
1 120 GLU n 
1 121 ASN n 
1 122 GLY n 
1 123 ILE n 
1 124 GLU n 
1 125 LEU n 
1 126 ALA n 
1 127 ARG n 
1 128 LYS n 
1 129 ILE n 
1 130 LYS n 
1 131 GLN n 
1 132 GLU n 
1 133 ILE n 
1 134 LEU n 
1 135 GLU n 
1 136 LYS n 
1 137 GLU n 
1 138 LYS n 
1 139 ILE n 
1 140 THR n 
1 141 VAL n 
1 142 THR n 
1 143 VAL n 
1 144 GLY n 
1 145 VAL n 
1 146 ALA n 
1 147 PRO n 
1 148 ASN n 
1 149 LYS n 
1 150 ILE n 
1 151 LEU n 
1 152 ALA n 
1 153 LYS n 
1 154 ILE n 
1 155 ILE n 
1 156 ALA n 
1 157 ASP n 
1 158 LYS n 
1 159 SER n 
1 160 LYS n 
1 161 PRO n 
1 162 ASN n 
1 163 GLY n 
1 164 LEU n 
1 165 GLY n 
1 166 VAL n 
1 167 ILE n 
1 168 ARG n 
1 169 PRO n 
1 170 THR n 
1 171 GLU n 
1 172 VAL n 
1 173 GLN n 
1 174 ASP n 
1 175 PHE n 
1 176 LEU n 
1 177 ASN n 
1 178 GLU n 
1 179 LEU n 
1 180 ASP n 
1 181 ILE n 
1 182 ASP n 
1 183 GLU n 
1 184 ILE n 
1 185 PRO n 
1 186 GLY n 
1 187 ILE n 
1 188 GLY n 
1 189 SER n 
1 190 VAL n 
1 191 LEU n 
1 192 ALA n 
1 193 ARG n 
1 194 ARG n 
1 195 LEU n 
1 196 ASN n 
1 197 GLU n 
1 198 LEU n 
1 199 GLY n 
1 200 ILE n 
1 201 GLN n 
1 202 LYS n 
1 203 LEU n 
1 204 ARG n 
1 205 ASP n 
1 206 ILE n 
1 207 LEU n 
1 208 SER n 
1 209 LYS n 
1 210 ASN n 
1 211 TYR n 
1 212 ASN n 
1 213 GLU n 
1 214 LEU n 
1 215 GLU n 
1 216 LYS n 
1 217 ILE n 
1 218 THR n 
1 219 GLY n 
1 220 LYS n 
1 221 ALA n 
1 222 LYS n 
1 223 ALA n 
1 224 LEU n 
1 225 TYR n 
1 226 LEU n 
1 227 LEU n 
1 228 LYS n 
1 229 LEU n 
1 230 ALA n 
1 231 GLN n 
1 232 ASN n 
1 233 LYS n 
1 234 TYR n 
1 235 SER n 
1 236 GLU n 
1 237 PRO n 
1 238 VAL n 
1 239 GLU n 
1 240 ASN n 
1 241 LYS n 
1 242 SER n 
1 243 ARG n 
1 244 LYS n 
1 245 SER n 
1 246 HIS n 
1 247 GLY n 
1 248 ARG n 
1 249 TYR n 
1 250 LEU n 
1 251 THR n 
1 252 LEU n 
1 253 PRO n 
1 254 TYR n 
1 255 ASN n 
1 256 THR n 
1 257 ARG n 
1 258 ASP n 
1 259 VAL n 
1 260 LYS n 
1 261 VAL n 
1 262 ILE n 
1 263 LEU n 
1 264 PRO n 
1 265 TYR n 
1 266 LEU n 
1 267 LYS n 
1 268 LYS n 
1 269 ALA n 
1 270 ILE n 
1 271 ASN n 
1 272 GLU n 
1 273 ALA n 
1 274 TYR n 
1 275 ASN n 
1 276 LYS n 
1 277 VAL n 
1 278 ASN n 
1 279 GLY n 
1 280 ILE n 
1 281 PRO n 
1 282 MET n 
1 283 ARG n 
1 284 ILE n 
1 285 THR n 
1 286 VAL n 
1 287 ILE n 
1 288 ALA n 
1 289 ILE n 
1 290 MET n 
1 291 GLU n 
1 292 ASP n 
1 293 LEU n 
1 294 ASP n 
1 295 ILE n 
1 296 LEU n 
1 297 SER n 
1 298 LYS n 
1 299 GLY n 
1 300 LYS n 
1 301 LYS n 
1 302 PHE n 
1 303 LYS n 
1 304 HIS n 
1 305 GLY n 
1 306 ILE n 
1 307 SER n 
1 308 ILE n 
1 309 ASP n 
1 310 ASN n 
1 311 ALA n 
1 312 TYR n 
1 313 LYS n 
1 314 VAL n 
1 315 ALA n 
1 316 GLU n 
1 317 ASP n 
1 318 LEU n 
1 319 LEU n 
1 320 ARG n 
1 321 GLU n 
1 322 LEU n 
1 323 LEU n 
1 324 VAL n 
1 325 ARG n 
1 326 ASP n 
1 327 LYS n 
1 328 ARG n 
1 329 ARG n 
1 330 ASN n 
1 331 VAL n 
1 332 ARG n 
1 333 ARG n 
1 334 ILE n 
1 335 GLY n 
1 336 VAL n 
1 337 LYS n 
1 338 LEU n 
1 339 ASP n 
1 340 ASN n 
1 341 ILE n 
1 342 ILE n 
1 343 ILE n 
1 344 ASN n 
1 345 LYS n 
1 346 THR n 
1 347 ASN n 
1 348 LEU n 
1 349 SER n 
1 350 ASP n 
1 351 PHE n 
1 352 PHE n 
1 353 ASP n 
1 354 ILE n 
1 355 GLY n 
1 356 GLY n 
1 357 HIS n 
1 358 HIS n 
1 359 HIS n 
1 360 HIS n 
1 361 HIS n 
1 362 HIS n 
2 1   DG  n 
2 2   DG  n 
2 3   DC  n 
2 4   DA  n 
2 5   DC  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DT  n 
2 10  DC  n 
2 11  DG  n 
2 12  DG  n 
2 13  DG  n 
3 1   DT  n 
3 2   DT  n 
3 3   DA  n 
3 4   DC  n 
3 5   DG  n 
3 6   DC  n 
3 7   DC  n 
3 8   DC  n 
3 9   DT  n 
3 10  DG  n 
3 11  DA  n 
3 12  DT  n 
3 13  DC  n 
3 14  DA  n 
3 15  DG  n 
3 16  DT  n 
3 17  DG  n 
3 18  DC  n 
3 19  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'dbh, Saci_0554' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Sulfolobus acidocaldarius' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2285 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BLR(DE3) pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPO4_SULAC Q4JB80 1 
;MIVIFVDFDYFFAQVEEVLNPQYKGKPLVVCVYSGRTKTSGAVATANYEARKLGVKAGMPIIKAMQIAPSAIYVPMRKPI
YEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKEKITVTVGVAPNKILAKIIADKSK
PNGLGVIRPTEVQDFLNELDIDEIPGIGSVLARRLNELGIQKLRDILSKNYNELEKITGKAKALYLLKLAQNKYSEPVEN
KSKIPHGRYLTLPYNTRDVKVILPYLKKAINEAYNKVNGIPMRITVIAIMEDLDILSKGKKFKHGISIDNAYKVAEDLLR
ELLVRDKRRNVRRIGVKLDNIIINKTNLSDFFDI
;
1 ? 
2 PDB 4NLG       4NLG   2 GGCACTGATCGGG 1 ? 
3 PDB 4NLG       4NLG   3 TTACGCCCTGATCAGTGCC 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4NLG A 1 ? 354 ? Q4JB80 1 ? 354 ? 1 354 
2 2 4NLG P 1 ? 13  ? 4NLG   1 ? 13  ? 1 13  
3 3 4NLG T 1 ? 19  ? 4NLG   1 ? 19  ? 1 19  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4NLG ARG A 243 ? UNP Q4JB80 LYS 243 'ENGINEERED MUTATION' 243 1  
1 4NLG LYS A 244 ? UNP Q4JB80 ILE 244 'ENGINEERED MUTATION' 244 2  
1 4NLG SER A 245 ? UNP Q4JB80 PRO 245 'ENGINEERED MUTATION' 245 3  
1 4NLG GLY A 355 ? UNP Q4JB80 ?   ?   'EXPRESSION TAG'      355 4  
1 4NLG GLY A 356 ? UNP Q4JB80 ?   ?   'EXPRESSION TAG'      356 5  
1 4NLG HIS A 357 ? UNP Q4JB80 ?   ?   'EXPRESSION TAG'      357 6  
1 4NLG HIS A 358 ? UNP Q4JB80 ?   ?   'EXPRESSION TAG'      358 7  
1 4NLG HIS A 359 ? UNP Q4JB80 ?   ?   'EXPRESSION TAG'      359 8  
1 4NLG HIS A 360 ? UNP Q4JB80 ?   ?   'EXPRESSION TAG'      360 9  
1 4NLG HIS A 361 ? UNP Q4JB80 ?   ?   'EXPRESSION TAG'      361 10 
1 4NLG HIS A 362 ? UNP Q4JB80 ?   ?   'EXPRESSION TAG'      362 11 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'       133.103 
CA  non-polymer         . 'CALCIUM ION'                        ? 'Ca 2'             40.078  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'   307.197 
DCP non-polymer         . "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"   ? 'C9 H16 N3 O13 P3' 467.157 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'       119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          4NLG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.12 
_exptl_crystal.density_percent_sol   60.54 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
'14% PEG3350, 0.1 M calcium acetate, 5% glycerol, 0.25 M sucrose, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2012-07-24 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'double crystal Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1 
# 
_reflns.entry_id                     4NLG 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            2.4 
_reflns.number_obs                   23003 
_reflns.number_all                   25089 
_reflns.percent_possible_obs         91.7 
_reflns.pdbx_Rmerge_I_obs            0.044 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        23.2 
_reflns.B_iso_Wilson_estimate        45.97 
_reflns.pdbx_redundancy              2.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.43 
_reflns_shell.percent_possible_all   80.7 
_reflns_shell.Rmerge_I_obs           0.191 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.9 
_reflns_shell.pdbx_redundancy        1.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1042 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4NLG 
_refine.ls_number_reflns_obs                     22557 
_refine.ls_number_reflns_all                     24385 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.18 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             28.696 
_refine.ls_d_res_high                            2.400 
_refine.ls_percent_reflns_obs                    92.47 
_refine.ls_R_factor_obs                          0.1769 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1739 
_refine.ls_R_factor_R_free                       0.2310 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.15 
_refine.ls_number_reflns_R_free                  1161 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 4F4Y' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.32 
_refine.pdbx_overall_phase_error                 27.95 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2733 
_refine_hist.pdbx_number_atoms_nucleic_acid   632 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             41 
_refine_hist.number_atoms_total               3436 
_refine_hist.d_res_high                       2.400 
_refine_hist.d_res_low                        28.696 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.009  ? ? 3508 ? 'X-RAY DIFFRACTION' 
f_angle_d          1.180  ? ? 4866 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 20.949 ? ? 1407 ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.047  ? ? 560  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.005  ? ? 506  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 2.400  2.5092  2315 0.2517 81.0 0.3291 . . 130 . . . . 'X-RAY DIFFRACTION' 
. 2.5092 2.6414  2507 0.2484 86.0 0.3186 . . 127 . . . . 'X-RAY DIFFRACTION' 
. 2.6414 2.8068  2557 0.2385 89.0 0.3219 . . 137 . . . . 'X-RAY DIFFRACTION' 
. 2.8068 3.0233  2650 0.2241 92.0 0.2823 . . 148 . . . . 'X-RAY DIFFRACTION' 
. 3.0233 3.3271  2778 0.1880 96.0 0.2468 . . 151 . . . . 'X-RAY DIFFRACTION' 
. 3.3271 3.8076  2809 0.1746 97.0 0.2265 . . 150 . . . . 'X-RAY DIFFRACTION' 
. 3.8076 4.7936  2868 0.1436 99.0 0.2003 . . 153 . . . . 'X-RAY DIFFRACTION' 
. 4.7936 28.6977 2912 0.1450 99.0 0.1974 . . 165 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4NLG 
_struct.title                     'Y-family DNA polymerase chimera Dbh-Dpo4(243-245)-Dbh' 
_struct.pdbx_descriptor           'DNA polymerase IV (E.C.2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4NLG 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'translesion synthesis, TRANSFERASE-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 10  ? ASN A 20  ? TYR A 10  ASN A 20  1 ? 11 
HELX_P HELX_P2  2  PRO A 21  ? LYS A 24  ? PRO A 21  LYS A 24  5 ? 4  
HELX_P HELX_P3  3  ASN A 47  ? LEU A 53  ? ASN A 47  LEU A 53  1 ? 7  
HELX_P HELX_P4  4  PRO A 60  ? ALA A 68  ? PRO A 60  ALA A 68  1 ? 9  
HELX_P HELX_P5  5  ARG A 77  ? LYS A 94  ? ARG A 77  LYS A 94  1 ? 18 
HELX_P HELX_P6  6  ASN A 118 ? LYS A 138 ? ASN A 118 LYS A 138 1 ? 21 
HELX_P HELX_P7  7  ASN A 148 ? LYS A 158 ? ASN A 148 LYS A 158 1 ? 11 
HELX_P HELX_P8  8  ARG A 168 ? THR A 170 ? ARG A 168 THR A 170 5 ? 3  
HELX_P HELX_P9  9  GLU A 171 ? LEU A 179 ? GLU A 171 LEU A 179 1 ? 9  
HELX_P HELX_P10 10 GLY A 188 ? GLU A 197 ? GLY A 188 GLU A 197 1 ? 10 
HELX_P HELX_P11 11 ARG A 204 ? LYS A 209 ? ARG A 204 LYS A 209 1 ? 6  
HELX_P HELX_P12 12 ASN A 210 ? LEU A 214 ? ASN A 210 LEU A 214 5 ? 5  
HELX_P HELX_P13 13 THR A 218 ? GLN A 231 ? THR A 218 GLN A 231 1 ? 14 
HELX_P HELX_P14 14 ASP A 258 ? ASN A 275 ? ASP A 258 ASN A 275 1 ? 18 
HELX_P HELX_P15 15 SER A 307 ? LYS A 327 ? SER A 307 LYS A 327 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E CA  .   CA    ? ? ? 1_555 F DCP .  O3G ? ? A CA  402 A DCP 403 1_555 ? ? ? ? ? ? ?            2.225 ? 
metalc2  metalc ? ? A PHE 8   O     ? ? ? 1_555 E CA  .  CA  ? ? A PHE 8   A CA  402 1_555 ? ? ? ? ? ? ?            2.235 ? 
metalc3  metalc ? ? A ASP 105 OD2   ? ? ? 1_555 E CA  .  CA  ? ? A ASP 105 A CA  402 1_555 ? ? ? ? ? ? ?            2.326 ? 
metalc4  metalc ? ? E CA  .   CA    ? ? ? 1_555 F DCP .  O2A ? ? A CA  402 A DCP 403 1_555 ? ? ? ? ? ? ?            2.409 ? 
metalc5  metalc ? ? E CA  .   CA    ? ? ? 1_555 F DCP .  O2B ? ? A CA  402 A DCP 403 1_555 ? ? ? ? ? ? ?            2.425 ? 
metalc6  metalc ? ? A ASP 105 OD1   ? ? ? 1_555 D CA  .  CA  ? ? A ASP 105 A CA  401 1_555 ? ? ? ? ? ? ?            2.465 ? 
metalc7  metalc ? ? A ASP 7   OD1   ? ? ? 1_555 E CA  .  CA  ? ? A ASP 7   A CA  402 1_555 ? ? ? ? ? ? ?            2.488 ? 
metalc8  metalc ? ? A ASP 7   OD1   ? ? ? 1_555 D CA  .  CA  ? ? A ASP 7   A CA  401 1_555 ? ? ? ? ? ? ?            2.509 ? 
metalc9  metalc ? ? D CA  .   CA    ? ? ? 1_555 F DCP .  O2A ? ? A CA  401 A DCP 403 1_555 ? ? ? ? ? ? ?            2.554 ? 
metalc10 metalc ? ? B DG  13  "O3'" ? ? ? 1_555 D CA  .  CA  ? ? P DG  13  A CA  401 1_555 ? ? ? ? ? ? ?            2.647 ? 
metalc11 metalc ? ? A ASP 7   OD2   ? ? ? 1_555 D CA  .  CA  ? ? A ASP 7   A CA  401 1_555 ? ? ? ? ? ? ?            2.718 ? 
metalc12 metalc ? ? A GLU 106 OE1   ? ? ? 1_555 D CA  .  CA  ? ? A GLU 106 A CA  401 1_555 ? ? ? ? ? ? ?            3.155 ? 
metalc13 metalc ? ? D CA  .   CA    ? ? ? 1_555 G HOH .  O   ? ? A CA  401 A HOH 508 1_555 ? ? ? ? ? ? ?            2.374 ? 
hydrog1  hydrog ? ? B DG  1   N1    ? ? ? 1_555 C DC  19 N3  ? ? P DG  1   T DC  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DG  1   N2    ? ? ? 1_555 C DC  19 O2  ? ? P DG  1   T DC  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  1   O6    ? ? ? 1_555 C DC  19 N4  ? ? P DG  1   T DC  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DG  2   N1    ? ? ? 1_555 C DC  18 N3  ? ? P DG  2   T DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  2   N2    ? ? ? 1_555 C DC  18 O2  ? ? P DG  2   T DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  2   O6    ? ? ? 1_555 C DC  18 N4  ? ? P DG  2   T DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DC  3   N3    ? ? ? 1_555 C DG  17 N1  ? ? P DC  3   T DG  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DC  3   N4    ? ? ? 1_555 C DG  17 O6  ? ? P DC  3   T DG  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DC  3   O2    ? ? ? 1_555 C DG  17 N2  ? ? P DC  3   T DG  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DA  4   N1    ? ? ? 1_555 C DT  16 N3  ? ? P DA  4   T DT  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DA  4   N6    ? ? ? 1_555 C DT  16 O4  ? ? P DA  4   T DT  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  5   N3    ? ? ? 1_555 C DG  15 N1  ? ? P DC  5   T DG  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DC  5   N4    ? ? ? 1_555 C DG  15 O6  ? ? P DC  5   T DG  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DC  5   O2    ? ? ? 1_555 C DG  15 N2  ? ? P DC  5   T DG  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  14 N1  ? ? P DT  6   T DA  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  14 N6  ? ? P DT  6   T DA  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DG  7   N1    ? ? ? 1_555 C DC  13 N3  ? ? P DG  7   T DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DG  7   N2    ? ? ? 1_555 C DC  13 O2  ? ? P DG  7   T DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DG  7   O6    ? ? ? 1_555 C DC  13 N4  ? ? P DG  7   T DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  12 N3  ? ? P DA  8   T DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  12 O4  ? ? P DA  8   T DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DT  9   N3    ? ? ? 1_555 C DA  11 N1  ? ? P DT  9   T DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DT  9   O4    ? ? ? 1_555 C DA  11 N6  ? ? P DT  9   T DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DC  10  N3    ? ? ? 1_555 C DG  10 N1  ? ? P DC  10  T DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DC  10  N4    ? ? ? 1_555 C DG  10 O6  ? ? P DC  10  T DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DC  10  O2    ? ? ? 1_555 C DG  10 N2  ? ? P DC  10  T DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DG  11  N1    ? ? ? 1_555 C DC  8  N3  ? ? P DG  11  T DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DG  11  N2    ? ? ? 1_555 C DC  8  O2  ? ? P DG  11  T DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DG  11  O6    ? ? ? 1_555 C DC  8  N4  ? ? P DG  11  T DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DG  12  N1    ? ? ? 1_555 C DC  7  N3  ? ? P DG  12  T DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DG  12  N2    ? ? ? 1_555 C DC  7  O2  ? ? P DG  12  T DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? B DG  12  O6    ? ? ? 1_555 C DC  7  N4  ? ? P DG  12  T DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? B DG  13  N1    ? ? ? 1_555 C DC  6  N3  ? ? P DG  13  T DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? B DG  13  N2    ? ? ? 1_555 C DC  6  O2  ? ? P DG  13  T DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? B DG  13  O6    ? ? ? 1_555 C DC  6  N4  ? ? P DG  13  T DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           160 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            160 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    161 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     161 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -7.62 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 98  ? SER A 103 ? LYS A 98  SER A 103 
A 2 GLU A 106 ? ASP A 110 ? GLU A 106 ASP A 110 
A 3 VAL A 3   ? PHE A 8   ? VAL A 3   PHE A 8   
A 4 VAL A 141 ? ALA A 146 ? VAL A 141 ALA A 146 
A 5 LEU A 164 ? VAL A 166 ? LEU A 164 VAL A 166 
B 1 GLY A 41  ? ALA A 46  ? GLY A 41  ALA A 46  
B 2 LEU A 28  ? TYR A 33  ? LEU A 28  TYR A 33  
B 3 ILE A 72  ? PRO A 75  ? ILE A 72  PRO A 75  
C 1 SER A 245 ? THR A 256 ? SER A 245 THR A 256 
C 2 VAL A 331 ? ILE A 343 ? VAL A 331 ILE A 343 
C 3 GLY A 279 ? MET A 290 ? GLY A 279 MET A 290 
C 4 ILE A 295 ? LYS A 301 ? ILE A 295 LYS A 301 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 100 ? N GLU A 100 O TYR A 108 ? O TYR A 108 
A 2 3 O LEU A 109 ? O LEU A 109 N ILE A 4   ? N ILE A 4   
A 3 4 N VAL A 3   ? N VAL A 3   O ALA A 146 ? O ALA A 146 
A 4 5 N VAL A 143 ? N VAL A 143 O GLY A 165 ? O GLY A 165 
B 1 2 O ALA A 42  ? O ALA A 42  N VAL A 32  ? N VAL A 32  
B 2 3 N CYS A 31  ? N CYS A 31  O VAL A 74  ? O VAL A 74  
C 1 2 N LEU A 250 ? N LEU A 250 O ILE A 334 ? O ILE A 334 
C 2 3 O ARG A 332 ? O ARG A 332 N ILE A 289 ? N ILE A 289 
C 3 4 N VAL A 286 ? N VAL A 286 O LYS A 298 ? O LYS A 298 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA A 401'  
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 402'  
AC3 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE DCP A 403' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7  ASP A 7   ? ASP A 7   . ? 1_555 ? 
2  AC1 7  ASP A 105 ? ASP A 105 . ? 1_555 ? 
3  AC1 7  GLU A 106 ? GLU A 106 . ? 1_555 ? 
4  AC1 7  CA  E .   ? CA  A 402 . ? 1_555 ? 
5  AC1 7  DCP F .   ? DCP A 403 . ? 1_555 ? 
6  AC1 7  HOH G .   ? HOH A 508 . ? 1_555 ? 
7  AC1 7  DG  B 13  ? DG  P 13  . ? 1_555 ? 
8  AC2 5  ASP A 7   ? ASP A 7   . ? 1_555 ? 
9  AC2 5  PHE A 8   ? PHE A 8   . ? 1_555 ? 
10 AC2 5  ASP A 105 ? ASP A 105 . ? 1_555 ? 
11 AC2 5  CA  D .   ? CA  A 401 . ? 1_555 ? 
12 AC2 5  DCP F .   ? DCP A 403 . ? 1_555 ? 
13 AC3 16 ASP A 7   ? ASP A 7   . ? 1_555 ? 
14 AC3 16 PHE A 8   ? PHE A 8   . ? 1_555 ? 
15 AC3 16 ASP A 9   ? ASP A 9   . ? 1_555 ? 
16 AC3 16 TYR A 10  ? TYR A 10  . ? 1_555 ? 
17 AC3 16 PHE A 11  ? PHE A 11  . ? 1_555 ? 
18 AC3 16 PHE A 12  ? PHE A 12  . ? 1_555 ? 
19 AC3 16 THR A 45  ? THR A 45  . ? 1_555 ? 
20 AC3 16 TYR A 48  ? TYR A 48  . ? 1_555 ? 
21 AC3 16 ARG A 51  ? ARG A 51  . ? 1_555 ? 
22 AC3 16 ASP A 105 ? ASP A 105 . ? 1_555 ? 
23 AC3 16 LYS A 160 ? LYS A 160 . ? 1_555 ? 
24 AC3 16 CA  D .   ? CA  A 401 . ? 1_555 ? 
25 AC3 16 CA  E .   ? CA  A 402 . ? 1_555 ? 
26 AC3 16 HOH G .   ? HOH A 513 . ? 1_555 ? 
27 AC3 16 DG  B 13  ? DG  P 13  . ? 1_555 ? 
28 AC3 16 DG  C 5   ? DG  T 5   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4NLG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4NLG 
_atom_sites.fract_transf_matrix[1][1]   0.008320 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002290 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009702 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019552 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
H  
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 1   ? 50.438  230.899 20.830  1.00 79.01  ? 1   MET A N     1 
ATOM   2    C  CA    . MET A 1 1   ? 49.246  230.056 20.803  1.00 74.56  ? 1   MET A CA    1 
ATOM   3    C  C     . MET A 1 1   ? 49.084  229.421 19.410  1.00 78.73  ? 1   MET A C     1 
ATOM   4    O  O     . MET A 1 1   ? 49.629  229.934 18.427  1.00 80.51  ? 1   MET A O     1 
ATOM   5    C  CB    . MET A 1 1   ? 48.006  230.875 21.189  1.00 71.94  ? 1   MET A CB    1 
ATOM   6    C  CG    . MET A 1 1   ? 46.824  230.027 21.657  1.00 79.16  ? 1   MET A CG    1 
ATOM   7    S  SD    . MET A 1 1   ? 45.289  230.916 22.061  1.00 97.50  ? 1   MET A SD    1 
ATOM   8    C  CE    . MET A 1 1   ? 44.811  231.589 20.468  1.00 75.07  ? 1   MET A CE    1 
ATOM   9    N  N     . ILE A 1 2   ? 48.358  228.303 19.330  1.00 73.26  ? 2   ILE A N     1 
ATOM   10   C  CA    . ILE A 1 2   ? 48.096  227.619 18.063  1.00 72.57  ? 2   ILE A CA    1 
ATOM   11   C  C     . ILE A 1 2   ? 46.644  227.152 17.992  1.00 69.13  ? 2   ILE A C     1 
ATOM   12   O  O     . ILE A 1 2   ? 46.150  226.445 18.875  1.00 65.73  ? 2   ILE A O     1 
ATOM   13   C  CB    . ILE A 1 2   ? 49.030  226.398 17.844  1.00 76.16  ? 2   ILE A CB    1 
ATOM   14   C  CG1   . ILE A 1 2   ? 50.495  226.837 17.801  1.00 75.16  ? 2   ILE A CG1   1 
ATOM   15   C  CG2   . ILE A 1 2   ? 48.674  225.662 16.529  1.00 72.08  ? 2   ILE A CG2   1 
ATOM   16   C  CD1   . ILE A 1 2   ? 51.481  225.687 17.794  1.00 76.59  ? 2   ILE A CD1   1 
ATOM   17   H  HG12  . ILE A 1 2   ? 50.642  227.357 16.995  1.00 90.19  ? 2   ILE A HG12  1 
ATOM   18   H  HG13  . ILE A 1 2   ? 50.681  227.382 18.581  1.00 90.19  ? 2   ILE A HG13  1 
ATOM   19   H  HG21  . ILE A 1 2   ? 49.272  224.906 16.419  1.00 86.50  ? 2   ILE A HG21  1 
ATOM   20   H  HG22  . ILE A 1 2   ? 47.756  225.353 16.579  1.00 86.50  ? 2   ILE A HG22  1 
ATOM   21   H  HG23  . ILE A 1 2   ? 48.778  226.276 15.786  1.00 86.50  ? 2   ILE A HG23  1 
ATOM   22   N  N     . VAL A 1 3   ? 45.956  227.534 16.925  1.00 66.33  ? 3   VAL A N     1 
ATOM   23   C  CA    . VAL A 1 3   ? 44.548  227.219 16.830  1.00 57.68  ? 3   VAL A CA    1 
ATOM   24   C  C     . VAL A 1 3   ? 44.269  226.461 15.541  1.00 57.78  ? 3   VAL A C     1 
ATOM   25   O  O     . VAL A 1 3   ? 44.823  226.767 14.495  1.00 67.14  ? 3   VAL A O     1 
ATOM   26   C  CB    . VAL A 1 3   ? 43.680  228.499 16.919  1.00 54.67  ? 3   VAL A CB    1 
ATOM   27   C  CG1   . VAL A 1 3   ? 42.205  228.144 16.871  1.00 59.11  ? 3   VAL A CG1   1 
ATOM   28   C  CG2   . VAL A 1 3   ? 43.973  229.251 18.216  1.00 61.70  ? 3   VAL A CG2   1 
ATOM   29   H  HG11  . VAL A 1 3   ? 41.682  228.959 16.928  1.00 70.93  ? 3   VAL A HG11  1 
ATOM   30   H  HG12  . VAL A 1 3   ? 42.017  227.688 16.035  1.00 70.93  ? 3   VAL A HG12  1 
ATOM   31   H  HG13  . VAL A 1 3   ? 41.995  227.563 17.619  1.00 70.93  ? 3   VAL A HG13  1 
ATOM   32   H  HG21  . VAL A 1 3   ? 43.420  230.047 18.251  1.00 74.04  ? 3   VAL A HG21  1 
ATOM   33   H  HG22  . VAL A 1 3   ? 43.769  228.673 18.968  1.00 74.04  ? 3   VAL A HG22  1 
ATOM   34   H  HG23  . VAL A 1 3   ? 44.911  229.498 18.232  1.00 74.04  ? 3   VAL A HG23  1 
ATOM   35   N  N     . ILE A 1 4   ? 43.436  225.439 15.654  1.00 58.14  ? 4   ILE A N     1 
ATOM   36   C  CA    . ILE A 1 4   ? 42.900  224.729 14.510  1.00 61.02  ? 4   ILE A CA    1 
ATOM   37   C  C     . ILE A 1 4   ? 41.404  224.945 14.442  1.00 61.98  ? 4   ILE A C     1 
ATOM   38   O  O     . ILE A 1 4   ? 40.647  224.442 15.265  1.00 65.14  ? 4   ILE A O     1 
ATOM   39   C  CB    . ILE A 1 4   ? 43.193  223.228 14.575  1.00 61.62  ? 4   ILE A CB    1 
ATOM   40   C  CG1   . ILE A 1 4   ? 44.693  222.988 14.446  1.00 62.62  ? 4   ILE A CG1   1 
ATOM   41   C  CG2   . ILE A 1 4   ? 42.447  222.495 13.462  1.00 62.74  ? 4   ILE A CG2   1 
ATOM   42   C  CD1   . ILE A 1 4   ? 45.085  221.556 14.617  1.00 71.53  ? 4   ILE A CD1   1 
ATOM   43   H  HG12  . ILE A 1 4   ? 44.981  223.272 13.564  1.00 75.15  ? 4   ILE A HG12  1 
ATOM   44   H  HG13  . ILE A 1 4   ? 45.153  223.506 15.125  1.00 75.15  ? 4   ILE A HG13  1 
ATOM   45   H  HG21  . ILE A 1 4   ? 42.646  221.547 13.520  1.00 75.29  ? 4   ILE A HG21  1 
ATOM   46   H  HG22  . ILE A 1 4   ? 41.495  222.641 13.571  1.00 75.29  ? 4   ILE A HG22  1 
ATOM   47   H  HG23  . ILE A 1 4   ? 42.740  222.842 12.605  1.00 75.29  ? 4   ILE A HG23  1 
ATOM   48   N  N     . PHE A 1 5   ? 40.981  225.704 13.446  1.00 64.10  ? 5   PHE A N     1 
ATOM   49   C  CA    . PHE A 1 5   ? 39.568  225.967 13.245  1.00 52.29  ? 5   PHE A CA    1 
ATOM   50   C  C     . PHE A 1 5   ? 39.040  224.970 12.208  1.00 50.61  ? 5   PHE A C     1 
ATOM   51   O  O     . PHE A 1 5   ? 39.762  224.567 11.298  1.00 51.42  ? 5   PHE A O     1 
ATOM   52   C  CB    . PHE A 1 5   ? 39.373  227.419 12.813  1.00 48.24  ? 5   PHE A CB    1 
ATOM   53   C  CG    . PHE A 1 5   ? 37.971  227.755 12.398  1.00 41.98  ? 5   PHE A CG    1 
ATOM   54   C  CD1   . PHE A 1 5   ? 36.970  227.898 13.336  1.00 40.88  ? 5   PHE A CD1   1 
ATOM   55   C  CD2   . PHE A 1 5   ? 37.663  227.956 11.055  1.00 42.97  ? 5   PHE A CD2   1 
ATOM   56   C  CE1   . PHE A 1 5   ? 35.670  228.224 12.947  1.00 42.39  ? 5   PHE A CE1   1 
ATOM   57   C  CE2   . PHE A 1 5   ? 36.380  228.290 10.659  1.00 39.02  ? 5   PHE A CE2   1 
ATOM   58   C  CZ    . PHE A 1 5   ? 35.379  228.422 11.595  1.00 38.72  ? 5   PHE A CZ    1 
ATOM   59   N  N     . VAL A 1 6   ? 37.791  224.551 12.363  1.00 44.20  ? 6   VAL A N     1 
ATOM   60   C  CA    . VAL A 1 6   ? 37.253  223.508 11.528  1.00 40.21  ? 6   VAL A CA    1 
ATOM   61   C  C     . VAL A 1 6   ? 35.834  223.864 11.166  1.00 42.40  ? 6   VAL A C     1 
ATOM   62   O  O     . VAL A 1 6   ? 35.008  224.159 12.030  1.00 38.08  ? 6   VAL A O     1 
ATOM   63   C  CB    . VAL A 1 6   ? 37.312  222.144 12.221  1.00 44.73  ? 6   VAL A CB    1 
ATOM   64   C  CG1   . VAL A 1 6   ? 36.614  221.062 11.382  1.00 37.93  ? 6   VAL A CG1   1 
ATOM   65   C  CG2   . VAL A 1 6   ? 38.773  221.757 12.468  1.00 53.70  ? 6   VAL A CG2   1 
ATOM   66   H  HG11  . VAL A 1 6   ? 36.672  220.214 11.851  1.00 45.52  ? 6   VAL A HG11  1 
ATOM   67   H  HG12  . VAL A 1 6   ? 35.685  221.309 11.258  1.00 45.52  ? 6   VAL A HG12  1 
ATOM   68   H  HG13  . VAL A 1 6   ? 37.058  220.995 10.522  1.00 45.52  ? 6   VAL A HG13  1 
ATOM   69   H  HG21  . VAL A 1 6   ? 38.800  220.893 12.907  1.00 64.44  ? 6   VAL A HG21  1 
ATOM   70   H  HG22  . VAL A 1 6   ? 39.235  221.712 11.617  1.00 64.44  ? 6   VAL A HG22  1 
ATOM   71   H  HG23  . VAL A 1 6   ? 39.186  222.429 13.034  1.00 64.44  ? 6   VAL A HG23  1 
ATOM   72   N  N     . ASP A 1 7   ? 35.576  223.881 9.865   1.00 40.95  ? 7   ASP A N     1 
ATOM   73   C  CA    . ASP A 1 7   ? 34.291  224.296 9.349   1.00 40.15  ? 7   ASP A CA    1 
ATOM   74   C  C     . ASP A 1 7   ? 33.888  223.229 8.335   1.00 43.87  ? 7   ASP A C     1 
ATOM   75   O  O     . ASP A 1 7   ? 34.638  222.980 7.395   1.00 45.15  ? 7   ASP A O     1 
ATOM   76   C  CB    . ASP A 1 7   ? 34.397  225.698 8.730   1.00 41.00  ? 7   ASP A CB    1 
ATOM   77   C  CG    . ASP A 1 7   ? 33.026  226.389 8.563   1.00 53.48  ? 7   ASP A CG    1 
ATOM   78   O  OD1   . ASP A 1 7   ? 31.970  225.725 8.677   1.00 57.15  ? 7   ASP A OD1   1 
ATOM   79   O  OD2   . ASP A 1 7   ? 33.009  227.615 8.329   1.00 55.71  1 7   ASP A OD2   1 
ATOM   80   N  N     . PHE A 1 8   ? 32.752  222.560 8.553   1.00 40.59  ? 8   PHE A N     1 
ATOM   81   C  CA    . PHE A 1 8   ? 32.345  221.456 7.674   1.00 42.00  ? 8   PHE A CA    1 
ATOM   82   C  C     . PHE A 1 8   ? 31.882  222.036 6.322   1.00 40.66  ? 8   PHE A C     1 
ATOM   83   O  O     . PHE A 1 8   ? 31.278  223.103 6.302   1.00 35.70  ? 8   PHE A O     1 
ATOM   84   C  CB    . PHE A 1 8   ? 31.230  220.609 8.311   1.00 38.47  ? 8   PHE A CB    1 
ATOM   85   C  CG    . PHE A 1 8   ? 31.483  220.226 9.746   1.00 45.29  ? 8   PHE A CG    1 
ATOM   86   C  CD1   . PHE A 1 8   ? 30.421  219.916 10.585  1.00 48.98  ? 8   PHE A CD1   1 
ATOM   87   C  CD2   . PHE A 1 8   ? 32.777  220.152 10.259  1.00 47.66  ? 8   PHE A CD2   1 
ATOM   88   C  CE1   . PHE A 1 8   ? 30.641  219.556 11.915  1.00 42.16  ? 8   PHE A CE1   1 
ATOM   89   C  CE2   . PHE A 1 8   ? 32.997  219.785 11.575  1.00 44.21  ? 8   PHE A CE2   1 
ATOM   90   C  CZ    . PHE A 1 8   ? 31.918  219.498 12.410  1.00 38.74  ? 8   PHE A CZ    1 
ATOM   91   N  N     . ASP A 1 9   ? 32.169  221.366 5.202   1.00 38.13  ? 9   ASP A N     1 
ATOM   92   C  CA    . ASP A 1 9   ? 31.829  221.931 3.863   1.00 39.54  ? 9   ASP A CA    1 
ATOM   93   C  C     . ASP A 1 9   ? 30.343  221.740 3.539   1.00 37.47  ? 9   ASP A C     1 
ATOM   94   O  O     . ASP A 1 9   ? 29.785  220.697 3.872   1.00 35.83  ? 9   ASP A O     1 
ATOM   95   C  CB    . ASP A 1 9   ? 32.680  221.292 2.761   1.00 28.87  ? 9   ASP A CB    1 
ATOM   96   C  CG    . ASP A 1 9   ? 34.155  221.657 2.866   1.00 44.47  ? 9   ASP A CG    1 
ATOM   97   O  OD1   . ASP A 1 9   ? 34.996  220.784 2.582   1.00 43.96  ? 9   ASP A OD1   1 
ATOM   98   O  OD2   . ASP A 1 9   ? 34.481  222.811 3.237   1.00 45.91  1 9   ASP A OD2   1 
ATOM   99   N  N     . TYR A 1 10  ? 29.725  222.741 2.904   1.00 40.08  ? 10  TYR A N     1 
ATOM   100  C  CA    . TYR A 1 10  ? 28.284  222.740 2.593   1.00 40.68  ? 10  TYR A CA    1 
ATOM   101  C  C     . TYR A 1 10  ? 27.508  221.720 3.459   1.00 38.15  ? 10  TYR A C     1 
ATOM   102  O  O     . TYR A 1 10  ? 26.848  220.791 2.965   1.00 38.57  ? 10  TYR A O     1 
ATOM   103  C  CB    . TYR A 1 10  ? 28.068  222.501 1.075   1.00 42.72  ? 10  TYR A CB    1 
ATOM   104  C  CG    . TYR A 1 10  ? 28.575  221.176 0.521   1.00 38.79  ? 10  TYR A CG    1 
ATOM   105  C  CD1   . TYR A 1 10  ? 27.685  220.215 0.042   1.00 38.87  ? 10  TYR A CD1   1 
ATOM   106  C  CD2   . TYR A 1 10  ? 29.943  220.891 0.465   1.00 34.45  ? 10  TYR A CD2   1 
ATOM   107  C  CE1   . TYR A 1 10  ? 28.145  218.982 -0.463  1.00 35.53  ? 10  TYR A CE1   1 
ATOM   108  C  CE2   . TYR A 1 10  ? 30.418  219.651 -0.034  1.00 30.77  ? 10  TYR A CE2   1 
ATOM   109  C  CZ    . TYR A 1 10  ? 29.509  218.711 -0.487  1.00 36.18  ? 10  TYR A CZ    1 
ATOM   110  O  OH    . TYR A 1 10  ? 29.964  217.505 -0.996  1.00 42.85  ? 10  TYR A OH    1 
ATOM   111  N  N     . PHE A 1 11  ? 27.612  221.911 4.775   1.00 38.11  ? 11  PHE A N     1 
ATOM   112  C  CA    . PHE A 1 11  ? 27.382  220.833 5.749   1.00 38.41  ? 11  PHE A CA    1 
ATOM   113  C  C     . PHE A 1 11  ? 26.058  220.089 5.615   1.00 35.80  ? 11  PHE A C     1 
ATOM   114  O  O     . PHE A 1 11  ? 26.063  218.877 5.383   1.00 41.29  ? 11  PHE A O     1 
ATOM   115  C  CB    . PHE A 1 11  ? 27.506  221.379 7.183   1.00 37.49  ? 11  PHE A CB    1 
ATOM   116  C  CG    . PHE A 1 11  ? 27.312  220.323 8.264   1.00 32.47  ? 11  PHE A CG    1 
ATOM   117  C  CD1   . PHE A 1 11  ? 27.999  219.116 8.208   1.00 30.91  ? 11  PHE A CD1   1 
ATOM   118  C  CD2   . PHE A 1 11  ? 26.463  220.550 9.338   1.00 33.94  ? 11  PHE A CD2   1 
ATOM   119  C  CE1   . PHE A 1 11  ? 27.835  218.123 9.216   1.00 34.77  ? 11  PHE A CE1   1 
ATOM   120  C  CE2   . PHE A 1 11  ? 26.298  219.570 10.353  1.00 42.95  ? 11  PHE A CE2   1 
ATOM   121  C  CZ    . PHE A 1 11  ? 26.981  218.356 10.280  1.00 37.63  ? 11  PHE A CZ    1 
ATOM   122  N  N     . PHE A 1 12  ? 24.925  220.768 5.795   1.00 29.23  ? 12  PHE A N     1 
ATOM   123  C  CA    . PHE A 1 12  ? 23.643  220.045 5.698   1.00 30.37  ? 12  PHE A CA    1 
ATOM   124  C  C     . PHE A 1 12  ? 23.511  219.324 4.343   1.00 34.36  ? 12  PHE A C     1 
ATOM   125  O  O     . PHE A 1 12  ? 23.052  218.179 4.302   1.00 35.16  ? 12  PHE A O     1 
ATOM   126  C  CB    . PHE A 1 12  ? 22.442  220.972 5.913   1.00 27.24  ? 12  PHE A CB    1 
ATOM   127  C  CG    . PHE A 1 12  ? 22.395  221.600 7.281   1.00 40.38  ? 12  PHE A CG    1 
ATOM   128  C  CD1   . PHE A 1 12  ? 23.439  221.426 8.178   1.00 45.83  ? 12  PHE A CD1   1 
ATOM   129  C  CD2   . PHE A 1 12  ? 21.293  222.358 7.679   1.00 41.27  ? 12  PHE A CD2   1 
ATOM   130  C  CE1   . PHE A 1 12  ? 23.395  222.001 9.450   1.00 46.21  ? 12  PHE A CE1   1 
ATOM   131  C  CE2   . PHE A 1 12  ? 21.252  222.935 8.931   1.00 42.70  ? 12  PHE A CE2   1 
ATOM   132  C  CZ    . PHE A 1 12  ? 22.302  222.741 9.825   1.00 39.93  ? 12  PHE A CZ    1 
ATOM   133  N  N     . ALA A 1 13  ? 23.919  219.968 3.242   1.00 32.57  ? 13  ALA A N     1 
ATOM   134  C  CA    . ALA A 1 13  ? 23.810  219.315 1.930   1.00 29.77  ? 13  ALA A CA    1 
ATOM   135  C  C     . ALA A 1 13  ? 24.807  218.183 1.853   1.00 31.67  ? 13  ALA A C     1 
ATOM   136  O  O     . ALA A 1 13  ? 24.474  217.115 1.343   1.00 42.29  ? 13  ALA A O     1 
ATOM   137  C  CB    . ALA A 1 13  ? 24.038  220.327 0.740   1.00 24.59  ? 13  ALA A CB    1 
ATOM   138  N  N     . GLN A 1 14  ? 26.025  218.380 2.373   1.00 34.40  ? 14  GLN A N     1 
ATOM   139  C  CA    . GLN A 1 14  ? 27.010  217.284 2.313   1.00 37.35  ? 14  GLN A CA    1 
ATOM   140  C  C     . GLN A 1 14  ? 26.544  216.058 3.099   1.00 41.64  ? 14  GLN A C     1 
ATOM   141  O  O     . GLN A 1 14  ? 26.831  214.917 2.709   1.00 44.76  ? 14  GLN A O     1 
ATOM   142  C  CB    . GLN A 1 14  ? 28.388  217.705 2.820   1.00 30.32  ? 14  GLN A CB    1 
ATOM   143  C  CG    . GLN A 1 14  ? 29.429  216.585 2.657   1.00 31.11  ? 14  GLN A CG    1 
ATOM   144  C  CD    . GLN A 1 14  ? 30.835  217.020 3.070   1.00 40.55  ? 14  GLN A CD    1 
ATOM   145  O  OE1   . GLN A 1 14  ? 31.824  216.349 2.750   1.00 38.02  ? 14  GLN A OE1   1 
ATOM   146  N  NE2   . GLN A 1 14  ? 30.926  218.122 3.821   1.00 42.20  ? 14  GLN A NE2   1 
ATOM   147  N  N     . VAL A 1 15  ? 25.820  216.280 4.192   1.00 36.73  ? 15  VAL A N     1 
ATOM   148  C  CA    . VAL A 1 15  ? 25.275  215.149 4.945   1.00 39.20  ? 15  VAL A CA    1 
ATOM   149  C  C     . VAL A 1 15  ? 24.220  214.392 4.135   1.00 38.83  ? 15  VAL A C     1 
ATOM   150  O  O     . VAL A 1 15  ? 24.217  213.150 4.109   1.00 36.08  ? 15  VAL A O     1 
ATOM   151  C  CB    . VAL A 1 15  ? 24.676  215.598 6.294   1.00 42.02  ? 15  VAL A CB    1 
ATOM   152  C  CG1   . VAL A 1 15  ? 24.016  214.424 7.002   1.00 34.57  ? 15  VAL A CG1   1 
ATOM   153  C  CG2   . VAL A 1 15  ? 25.778  216.178 7.176   1.00 42.90  ? 15  VAL A CG2   1 
ATOM   154  H  HG11  . VAL A 1 15  ? 23.648  214.731 7.846   1.00 41.48  ? 15  VAL A HG11  1 
ATOM   155  H  HG12  . VAL A 1 15  ? 23.308  214.073 6.440   1.00 41.48  ? 15  VAL A HG12  1 
ATOM   156  H  HG13  . VAL A 1 15  ? 24.683  213.737 7.162   1.00 41.48  ? 15  VAL A HG13  1 
ATOM   157  H  HG21  . VAL A 1 15  ? 25.392  216.457 8.021   1.00 51.49  ? 15  VAL A HG21  1 
ATOM   158  H  HG22  . VAL A 1 15  ? 26.451  215.496 7.328   1.00 51.49  ? 15  VAL A HG22  1 
ATOM   159  H  HG23  . VAL A 1 15  ? 26.175  216.940 6.725   1.00 51.49  ? 15  VAL A HG23  1 
ATOM   160  N  N     . GLU A 1 16  ? 23.319  215.124 3.482   1.00 33.82  ? 16  GLU A N     1 
ATOM   161  C  CA    . GLU A 1 16  ? 22.313  214.479 2.641   1.00 30.05  ? 16  GLU A CA    1 
ATOM   162  C  C     . GLU A 1 16  ? 23.026  213.661 1.549   1.00 37.32  ? 16  GLU A C     1 
ATOM   163  O  O     . GLU A 1 16  ? 22.568  212.567 1.202   1.00 44.99  ? 16  GLU A O     1 
ATOM   164  C  CB    . GLU A 1 16  ? 21.335  215.522 2.052   1.00 34.62  ? 16  GLU A CB    1 
ATOM   165  C  CG    . GLU A 1 16  ? 20.382  216.190 3.111   1.00 31.01  ? 16  GLU A CG    1 
ATOM   166  C  CD    . GLU A 1 16  ? 19.264  215.271 3.590   1.00 43.77  ? 16  GLU A CD    1 
ATOM   167  O  OE1   . GLU A 1 16  ? 18.427  215.714 4.400   1.00 53.51  ? 16  GLU A OE1   1 
ATOM   168  O  OE2   . GLU A 1 16  ? 19.196  214.105 3.145   1.00 50.27  1 16  GLU A OE2   1 
ATOM   169  N  N     . GLU A 1 17  ? 24.183  214.128 1.066   1.00 39.14  ? 17  GLU A N     1 
ATOM   170  C  CA    . GLU A 1 17  ? 24.966  213.320 0.105   1.00 40.89  ? 17  GLU A CA    1 
ATOM   171  C  C     . GLU A 1 17  ? 25.557  212.037 0.702   1.00 44.80  ? 17  GLU A C     1 
ATOM   172  O  O     . GLU A 1 17  ? 25.600  210.998 0.045   1.00 49.05  ? 17  GLU A O     1 
ATOM   173  C  CB    . GLU A 1 17  ? 26.109  214.135 -0.499  1.00 38.37  ? 17  GLU A CB    1 
ATOM   174  C  CG    . GLU A 1 17  ? 25.645  215.306 -1.345  1.00 43.04  ? 17  GLU A CG    1 
ATOM   175  C  CD    . GLU A 1 17  ? 26.808  216.122 -1.889  1.00 49.70  ? 17  GLU A CD    1 
ATOM   176  O  OE1   . GLU A 1 17  ? 27.978  215.764 -1.616  1.00 54.60  ? 17  GLU A OE1   1 
ATOM   177  O  OE2   . GLU A 1 17  ? 26.549  217.121 -2.592  1.00 53.84  1 17  GLU A OE2   1 
ATOM   178  N  N     . VAL A 1 18  ? 26.052  212.105 1.934   1.00 50.11  ? 18  VAL A N     1 
ATOM   179  C  CA    . VAL A 1 18  ? 26.598  210.914 2.565   1.00 41.60  ? 18  VAL A CA    1 
ATOM   180  C  C     . VAL A 1 18  ? 25.428  209.946 2.728   1.00 43.79  ? 18  VAL A C     1 
ATOM   181  O  O     . VAL A 1 18  ? 25.553  208.755 2.463   1.00 50.35  ? 18  VAL A O     1 
ATOM   182  C  CB    . VAL A 1 18  ? 27.305  211.252 3.905   1.00 49.21  ? 18  VAL A CB    1 
ATOM   183  C  CG1   . VAL A 1 18  ? 27.790  209.979 4.652   1.00 43.67  ? 18  VAL A CG1   1 
ATOM   184  C  CG2   . VAL A 1 18  ? 28.490  212.158 3.630   1.00 39.91  ? 18  VAL A CG2   1 
ATOM   185  H  HG11  . VAL A 1 18  ? 28.222  210.244 5.479   1.00 52.41  ? 18  VAL A HG11  1 
ATOM   186  H  HG12  . VAL A 1 18  ? 27.024  209.416 4.845   1.00 52.41  ? 18  VAL A HG12  1 
ATOM   187  H  HG13  . VAL A 1 18  ? 28.418  209.502 4.088   1.00 52.41  ? 18  VAL A HG13  1 
ATOM   188  H  HG21  . VAL A 1 18  ? 28.928  212.366 4.469   1.00 47.90  ? 18  VAL A HG21  1 
ATOM   189  H  HG22  . VAL A 1 18  ? 29.107  211.699 3.039   1.00 47.90  ? 18  VAL A HG22  1 
ATOM   190  H  HG23  . VAL A 1 18  ? 28.173  212.973 3.210   1.00 47.90  ? 18  VAL A HG23  1 
ATOM   191  N  N     . LEU A 1 19  ? 24.258  210.472 3.074   1.00 40.73  ? 19  LEU A N     1 
ATOM   192  C  CA    . LEU A 1 19  ? 23.090  209.605 3.271   1.00 44.26  ? 19  LEU A CA    1 
ATOM   193  C  C     . LEU A 1 19  ? 22.448  209.130 1.961   1.00 47.11  ? 19  LEU A C     1 
ATOM   194  O  O     . LEU A 1 19  ? 21.827  208.076 1.929   1.00 49.71  ? 19  LEU A O     1 
ATOM   195  C  CB    . LEU A 1 19  ? 22.049  210.316 4.138   1.00 47.06  ? 19  LEU A CB    1 
ATOM   196  C  CG    . LEU A 1 19  ? 22.444  210.557 5.614   1.00 47.34  ? 19  LEU A CG    1 
ATOM   197  C  CD1   . LEU A 1 19  ? 21.222  210.634 6.516   1.00 44.12  ? 19  LEU A CD1   1 
ATOM   198  C  CD2   . LEU A 1 19  ? 23.404  209.502 6.092   1.00 41.92  ? 19  LEU A CD2   1 
ATOM   199  N  N     . ASN A 1 20  ? 22.593  209.914 0.892   1.00 48.24  ? 20  ASN A N     1 
ATOM   200  C  CA    . ASN A 1 20  ? 22.130  209.517 -0.449  1.00 44.90  ? 20  ASN A CA    1 
ATOM   201  C  C     . ASN A 1 20  ? 23.162  209.850 -1.517  1.00 43.53  ? 20  ASN A C     1 
ATOM   202  O  O     . ASN A 1 20  ? 23.119  210.923 -2.097  1.00 43.28  ? 20  ASN A O     1 
ATOM   203  C  CB    . ASN A 1 20  ? 20.834  210.223 -0.830  1.00 40.22  ? 20  ASN A CB    1 
ATOM   204  C  CG    . ASN A 1 20  ? 19.818  210.237 0.280   1.00 48.75  ? 20  ASN A CG    1 
ATOM   205  O  OD1   . ASN A 1 20  ? 18.909  209.401 0.309   1.00 53.79  ? 20  ASN A OD1   1 
ATOM   206  N  ND2   . ASN A 1 20  ? 19.944  211.204 1.193   1.00 41.36  ? 20  ASN A ND2   1 
ATOM   207  N  N     . PRO A 1 21  ? 24.099  208.947 -1.763  1.00 42.89  ? 21  PRO A N     1 
ATOM   208  C  CA    . PRO A 1 21  ? 25.161  209.172 -2.753  1.00 59.35  ? 21  PRO A CA    1 
ATOM   209  C  C     . PRO A 1 21  ? 24.678  209.549 -4.180  1.00 55.48  ? 21  PRO A C     1 
ATOM   210  O  O     . PRO A 1 21  ? 25.459  210.134 -4.922  1.00 51.84  ? 21  PRO A O     1 
ATOM   211  C  CB    . PRO A 1 21  ? 25.893  207.829 -2.770  1.00 64.89  ? 21  PRO A CB    1 
ATOM   212  C  CG    . PRO A 1 21  ? 25.666  207.272 -1.363  1.00 58.95  ? 21  PRO A CG    1 
ATOM   213  C  CD    . PRO A 1 21  ? 24.258  207.679 -1.030  1.00 50.81  ? 21  PRO A CD    1 
ATOM   214  N  N     . GLN A 1 22  ? 23.441  209.231 -4.554  1.00 53.95  ? 22  GLN A N     1 
ATOM   215  C  CA    . GLN A 1 22  ? 22.906  209.651 -5.862  1.00 49.86  ? 22  GLN A CA    1 
ATOM   216  C  C     . GLN A 1 22  ? 22.909  211.160 -5.988  1.00 57.01  ? 22  GLN A C     1 
ATOM   217  O  O     . GLN A 1 22  ? 23.067  211.698 -7.081  1.00 63.01  ? 22  GLN A O     1 
ATOM   218  C  CB    . GLN A 1 22  ? 21.493  209.139 -6.040  1.00 47.61  ? 22  GLN A CB    1 
ATOM   219  C  CG    . GLN A 1 22  ? 21.075  208.329 -4.826  1.00 71.12  ? 22  GLN A CG    1 
ATOM   220  C  CD    . GLN A 1 22  ? 19.793  208.816 -4.220  1.00 77.66  ? 22  GLN A CD    1 
ATOM   221  O  OE1   . GLN A 1 22  ? 19.030  209.542 -4.860  1.00 86.38  ? 22  GLN A OE1   1 
ATOM   222  N  NE2   . GLN A 1 22  ? 19.536  208.417 -2.982  1.00 69.43  ? 22  GLN A NE2   1 
ATOM   223  N  N     . TYR A 1 23  ? 22.723  211.842 -4.862  1.00 42.31  ? 23  TYR A N     1 
ATOM   224  C  CA    . TYR A 1 23  ? 22.708  213.284 -4.878  1.00 40.20  ? 23  TYR A CA    1 
ATOM   225  C  C     . TYR A 1 23  ? 24.077  213.860 -5.211  1.00 48.61  ? 23  TYR A C     1 
ATOM   226  O  O     . TYR A 1 23  ? 24.173  214.997 -5.681  1.00 54.01  ? 23  TYR A O     1 
ATOM   227  C  CB    . TYR A 1 23  ? 22.258  213.843 -3.545  1.00 35.02  ? 23  TYR A CB    1 
ATOM   228  C  CG    . TYR A 1 23  ? 20.832  213.533 -3.177  1.00 39.74  ? 23  TYR A CG    1 
ATOM   229  C  CD1   . TYR A 1 23  ? 20.387  213.703 -1.868  1.00 50.36  ? 23  TYR A CD1   1 
ATOM   230  C  CD2   . TYR A 1 23  ? 19.933  213.088 -4.116  1.00 42.96  ? 23  TYR A CD2   1 
ATOM   231  C  CE1   . TYR A 1 23  ? 19.069  213.439 -1.506  1.00 51.09  ? 23  TYR A CE1   1 
ATOM   232  C  CE2   . TYR A 1 23  ? 18.615  212.812 -3.767  1.00 52.52  ? 23  TYR A CE2   1 
ATOM   233  C  CZ    . TYR A 1 23  ? 18.193  212.991 -2.460  1.00 59.79  ? 23  TYR A CZ    1 
ATOM   234  O  OH    . TYR A 1 23  ? 16.893  212.731 -2.100  1.00 74.33  ? 23  TYR A OH    1 
ATOM   235  N  N     . LYS A 1 24  ? 25.139  213.095 -4.971  1.00 42.09  ? 24  LYS A N     1 
ATOM   236  C  CA    . LYS A 1 24  ? 26.472  213.659 -5.162  1.00 42.49  ? 24  LYS A CA    1 
ATOM   237  C  C     . LYS A 1 24  ? 26.743  213.939 -6.642  1.00 51.33  ? 24  LYS A C     1 
ATOM   238  O  O     . LYS A 1 24  ? 26.420  213.118 -7.504  1.00 61.61  ? 24  LYS A O     1 
ATOM   239  C  CB    . LYS A 1 24  ? 27.554  212.739 -4.604  1.00 44.18  ? 24  LYS A CB    1 
ATOM   240  C  CG    . LYS A 1 24  ? 28.873  213.482 -4.375  1.00 57.58  ? 24  LYS A CG    1 
ATOM   241  C  CD    . LYS A 1 24  ? 30.092  212.561 -4.282  1.00 63.92  ? 24  LYS A CD    1 
ATOM   242  C  CE    . LYS A 1 24  ? 31.198  213.228 -3.470  1.00 64.72  ? 24  LYS A CE    1 
ATOM   243  N  NZ    . LYS A 1 24  ? 30.688  213.552 -2.091  1.00 68.51  1 24  LYS A NZ    1 
ATOM   244  N  N     . GLY A 1 25  ? 27.326  215.095 -6.934  1.00 41.94  ? 25  GLY A N     1 
ATOM   245  C  CA    . GLY A 1 25  ? 27.723  215.403 -8.302  1.00 48.98  ? 25  GLY A CA    1 
ATOM   246  C  C     . GLY A 1 25  ? 26.756  216.343 -8.996  1.00 53.02  ? 25  GLY A C     1 
ATOM   247  O  O     . GLY A 1 25  ? 27.094  216.977 -9.992  1.00 61.07  ? 25  GLY A O     1 
ATOM   248  N  N     . LYS A 1 26  ? 25.553  216.432 -8.435  1.00 52.63  ? 26  LYS A N     1 
ATOM   249  C  CA    . LYS A 1 26  ? 24.444  217.212 -8.980  1.00 41.23  ? 26  LYS A CA    1 
ATOM   250  C  C     . LYS A 1 26  ? 23.943  218.299 -8.020  1.00 48.85  ? 26  LYS A C     1 
ATOM   251  O  O     . LYS A 1 26  ? 24.047  218.166 -6.794  1.00 45.27  ? 26  LYS A O     1 
ATOM   252  C  CB    . LYS A 1 26  ? 23.311  216.267 -9.321  1.00 48.10  ? 26  LYS A CB    1 
ATOM   253  C  CG    . LYS A 1 26  ? 23.791  215.038 -10.086 1.00 67.41  ? 26  LYS A CG    1 
ATOM   254  C  CD    . LYS A 1 26  ? 22.708  213.987 -10.195 1.00 86.27  ? 26  LYS A CD    1 
ATOM   255  C  CE    . LYS A 1 26  ? 22.944  213.120 -11.423 1.00 108.16 ? 26  LYS A CE    1 
ATOM   256  N  NZ    . LYS A 1 26  ? 21.675  212.541 -11.963 1.00 119.13 1 26  LYS A NZ    1 
ATOM   257  N  N     . PRO A 1 27  ? 23.399  219.379 -8.580  1.00 43.30  ? 27  PRO A N     1 
ATOM   258  C  CA    . PRO A 1 27  ? 22.775  220.454 -7.798  1.00 27.62  ? 27  PRO A CA    1 
ATOM   259  C  C     . PRO A 1 27  ? 21.906  219.910 -6.672  1.00 37.64  ? 27  PRO A C     1 
ATOM   260  O  O     . PRO A 1 27  ? 20.975  219.174 -6.983  1.00 32.45  ? 27  PRO A O     1 
ATOM   261  C  CB    . PRO A 1 27  ? 21.894  221.166 -8.825  1.00 38.33  ? 27  PRO A CB    1 
ATOM   262  C  CG    . PRO A 1 27  ? 22.592  220.919 -10.196 1.00 30.02  ? 27  PRO A CG    1 
ATOM   263  C  CD    . PRO A 1 27  ? 23.323  219.592 -10.047 1.00 38.58  ? 27  PRO A CD    1 
ATOM   264  N  N     . LEU A 1 28  ? 22.177  220.257 -5.405  1.00 33.87  ? 28  LEU A N     1 
ATOM   265  C  CA    . LEU A 1 28  ? 21.321  219.808 -4.307  1.00 36.39  ? 28  LEU A CA    1 
ATOM   266  C  C     . LEU A 1 28  ? 21.044  220.955 -3.347  1.00 31.21  ? 28  LEU A C     1 
ATOM   267  O  O     . LEU A 1 28  ? 21.959  221.691 -2.984  1.00 31.57  ? 28  LEU A O     1 
ATOM   268  C  CB    . LEU A 1 28  ? 21.962  218.635 -3.570  1.00 37.33  ? 28  LEU A CB    1 
ATOM   269  C  CG    . LEU A 1 28  ? 21.203  218.236 -2.299  1.00 44.45  ? 28  LEU A CG    1 
ATOM   270  C  CD1   . LEU A 1 28  ? 19.941  217.442 -2.658  1.00 43.05  ? 28  LEU A CD1   1 
ATOM   271  C  CD2   . LEU A 1 28  ? 22.118  217.471 -1.333  1.00 29.48  ? 28  LEU A CD2   1 
ATOM   272  N  N     . VAL A 1 29  ? 19.781  221.116 -2.960  1.00 34.86  ? 29  VAL A N     1 
ATOM   273  C  CA    . VAL A 1 29  ? 19.356  222.244 -2.145  1.00 37.60  ? 29  VAL A CA    1 
ATOM   274  C  C     . VAL A 1 29  ? 18.587  221.757 -0.923  1.00 44.74  ? 29  VAL A C     1 
ATOM   275  O  O     . VAL A 1 29  ? 17.581  221.054 -1.066  1.00 48.79  ? 29  VAL A O     1 
ATOM   276  C  CB    . VAL A 1 29  ? 18.465  223.204 -2.942  1.00 39.62  ? 29  VAL A CB    1 
ATOM   277  C  CG1   . VAL A 1 29  ? 18.123  224.447 -2.100  1.00 39.19  ? 29  VAL A CG1   1 
ATOM   278  C  CG2   . VAL A 1 29  ? 19.144  223.597 -4.232  1.00 38.99  ? 29  VAL A CG2   1 
ATOM   279  H  HG11  . VAL A 1 29  ? 17.560  225.038 -2.624  1.00 47.03  ? 29  VAL A HG11  1 
ATOM   280  H  HG12  . VAL A 1 29  ? 17.654  224.166 -1.299  1.00 47.03  ? 29  VAL A HG12  1 
ATOM   281  H  HG13  . VAL A 1 29  ? 18.946  224.900 -1.859  1.00 47.03  ? 29  VAL A HG13  1 
ATOM   282  H  HG21  . VAL A 1 29  ? 18.566  224.203 -4.721  1.00 46.79  ? 29  VAL A HG21  1 
ATOM   283  H  HG22  . VAL A 1 29  ? 19.985  224.035 -4.026  1.00 46.79  ? 29  VAL A HG22  1 
ATOM   284  H  HG23  . VAL A 1 29  ? 19.307  222.798 -4.758  1.00 46.79  ? 29  VAL A HG23  1 
ATOM   285  N  N     . VAL A 1 30  ? 19.068  222.115 0.273   1.00 41.18  ? 30  VAL A N     1 
ATOM   286  C  CA    . VAL A 1 30  ? 18.395  221.762 1.527   1.00 32.33  ? 30  VAL A CA    1 
ATOM   287  C  C     . VAL A 1 30  ? 17.476  222.916 1.957   1.00 30.42  ? 30  VAL A C     1 
ATOM   288  O  O     . VAL A 1 30  ? 17.947  224.025 2.213   1.00 28.62  ? 30  VAL A O     1 
ATOM   289  C  CB    . VAL A 1 30  ? 19.409  221.443 2.658   1.00 36.79  ? 30  VAL A CB    1 
ATOM   290  C  CG1   . VAL A 1 30  ? 18.684  221.239 3.973   1.00 43.74  ? 30  VAL A CG1   1 
ATOM   291  C  CG2   . VAL A 1 30  ? 20.257  220.198 2.344   1.00 33.73  ? 30  VAL A CG2   1 
ATOM   292  H  HG11  . VAL A 1 30  ? 19.335  221.042 4.665   1.00 52.49  ? 30  VAL A HG11  1 
ATOM   293  H  HG12  . VAL A 1 30  ? 18.200  222.050 4.195   1.00 52.49  ? 30  VAL A HG12  1 
ATOM   294  H  HG13  . VAL A 1 30  ? 18.064  220.499 3.880   1.00 52.49  ? 30  VAL A HG13  1 
ATOM   295  H  HG21  . VAL A 1 30  ? 20.872  220.042 3.078   1.00 40.48  ? 30  VAL A HG21  1 
ATOM   296  H  HG22  . VAL A 1 30  ? 19.669  219.434 2.237   1.00 40.48  ? 30  VAL A HG22  1 
ATOM   297  H  HG23  . VAL A 1 30  ? 20.752  220.352 1.524   1.00 40.48  ? 30  VAL A HG23  1 
ATOM   298  N  N     . CYS A 1 31  ? 16.172  222.660 2.080   1.00 31.48  ? 31  CYS A N     1 
ATOM   299  C  CA    . CYS A 1 31  ? 15.222  223.770 2.196   1.00 37.26  ? 31  CYS A CA    1 
ATOM   300  C  C     . CYS A 1 31  ? 14.434  223.741 3.490   1.00 45.06  ? 31  CYS A C     1 
ATOM   301  O  O     . CYS A 1 31  ? 14.105  222.663 3.999   1.00 43.15  ? 31  CYS A O     1 
ATOM   302  C  CB    . CYS A 1 31  ? 14.237  223.760 1.013   1.00 46.40  ? 31  CYS A CB    1 
ATOM   303  S  SG    . CYS A 1 31  ? 15.041  223.676 -0.604  1.00 43.43  ? 31  CYS A SG    1 
ATOM   304  N  N     . VAL A 1 32  ? 14.099  224.923 4.004   1.00 37.44  ? 32  VAL A N     1 
ATOM   305  C  CA    . VAL A 1 32  ? 13.247  224.974 5.179   1.00 38.19  ? 32  VAL A CA    1 
ATOM   306  C  C     . VAL A 1 32  ? 11.808  225.267 4.726   1.00 38.43  ? 32  VAL A C     1 
ATOM   307  O  O     . VAL A 1 32  ? 11.438  226.415 4.457   1.00 38.16  ? 32  VAL A O     1 
ATOM   308  C  CB    . VAL A 1 32  ? 13.733  226.030 6.206   1.00 30.71  ? 32  VAL A CB    1 
ATOM   309  C  CG1   . VAL A 1 32  ? 12.976  225.897 7.470   1.00 33.56  ? 32  VAL A CG1   1 
ATOM   310  C  CG2   . VAL A 1 32  ? 15.214  225.861 6.512   1.00 26.23  ? 32  VAL A CG2   1 
ATOM   311  H  HG11  . VAL A 1 32  ? 13.293  226.564 8.099   1.00 40.27  ? 32  VAL A HG11  1 
ATOM   312  H  HG12  . VAL A 1 32  ? 12.033  226.034 7.289   1.00 40.27  ? 32  VAL A HG12  1 
ATOM   313  H  HG13  . VAL A 1 32  ? 13.119  225.007 7.830   1.00 40.27  ? 32  VAL A HG13  1 
ATOM   314  H  HG21  . VAL A 1 32  ? 15.481  226.536 7.155   1.00 31.47  ? 32  VAL A HG21  1 
ATOM   315  H  HG22  . VAL A 1 32  ? 15.361  224.976 6.880   1.00 31.47  ? 32  VAL A HG22  1 
ATOM   316  H  HG23  . VAL A 1 32  ? 15.719  225.967 5.691   1.00 31.47  ? 32  VAL A HG23  1 
ATOM   317  N  N     . TYR A 1 33  ? 10.995  224.223 4.614   1.00 39.70  ? 33  TYR A N     1 
ATOM   318  C  CA    . TYR A 1 33  ? 9.608   224.423 4.186   1.00 41.49  ? 33  TYR A CA    1 
ATOM   319  C  C     . TYR A 1 33  ? 8.719   224.891 5.326   1.00 46.78  ? 33  TYR A C     1 
ATOM   320  O  O     . TYR A 1 33  ? 8.467   224.171 6.298   1.00 51.75  ? 33  TYR A O     1 
ATOM   321  C  CB    . TYR A 1 33  ? 9.028   223.151 3.595   1.00 41.84  ? 33  TYR A CB    1 
ATOM   322  C  CG    . TYR A 1 33  ? 9.674   222.703 2.309   1.00 50.69  ? 33  TYR A CG    1 
ATOM   323  C  CD1   . TYR A 1 33  ? 10.591  221.670 2.305   1.00 51.44  ? 33  TYR A CD1   1 
ATOM   324  C  CD2   . TYR A 1 33  ? 9.353   223.308 1.085   1.00 45.58  ? 33  TYR A CD2   1 
ATOM   325  C  CE1   . TYR A 1 33  ? 11.167  221.240 1.133   1.00 50.45  ? 33  TYR A CE1   1 
ATOM   326  C  CE2   . TYR A 1 33  ? 9.923   222.875 -0.081  1.00 44.80  ? 33  TYR A CE2   1 
ATOM   327  C  CZ    . TYR A 1 33  ? 10.834  221.837 -0.049  1.00 42.99  ? 33  TYR A CZ    1 
ATOM   328  O  OH    . TYR A 1 33  ? 11.425  221.387 -1.193  1.00 46.45  ? 33  TYR A OH    1 
ATOM   329  N  N     . SER A 1 34  ? 8.235   226.111 5.170   1.00 36.70  ? 34  SER A N     1 
ATOM   330  C  CA    . SER A 1 34  ? 7.374   226.747 6.123   1.00 37.38  ? 34  SER A CA    1 
ATOM   331  C  C     . SER A 1 34  ? 6.029   226.048 6.340   1.00 48.93  ? 34  SER A C     1 
ATOM   332  O  O     . SER A 1 34  ? 5.398   226.219 7.396   1.00 59.63  ? 34  SER A O     1 
ATOM   333  C  CB    . SER A 1 34  ? 7.117   228.156 5.659   1.00 45.45  ? 34  SER A CB    1 
ATOM   334  O  OG    . SER A 1 34  ? 5.911   228.162 4.936   1.00 52.74  ? 34  SER A OG    1 
ATOM   335  N  N     . GLY A 1 35  ? 5.576   225.296 5.338   1.00 45.39  ? 35  GLY A N     1 
ATOM   336  C  CA    . GLY A 1 35  ? 4.304   224.579 5.408   1.00 37.60  ? 35  GLY A CA    1 
ATOM   337  C  C     . GLY A 1 35  ? 3.151   225.317 4.742   1.00 54.43  ? 35  GLY A C     1 
ATOM   338  O  O     . GLY A 1 35  ? 2.172   224.705 4.264   1.00 53.61  ? 35  GLY A O     1 
ATOM   339  N  N     . ARG A 1 36  ? 3.267   226.643 4.708   1.00 50.68  ? 36  ARG A N     1 
ATOM   340  C  CA    . ARG A 1 36  ? 2.237   227.493 4.131   1.00 59.09  ? 36  ARG A CA    1 
ATOM   341  C  C     . ARG A 1 36  ? 1.814   227.058 2.714   1.00 63.91  ? 36  ARG A C     1 
ATOM   342  O  O     . ARG A 1 36  ? 0.628   226.876 2.450   1.00 72.76  ? 36  ARG A O     1 
ATOM   343  C  CB    . ARG A 1 36  ? 2.722   228.932 4.129   1.00 62.02  ? 36  ARG A CB    1 
ATOM   344  C  CG    . ARG A 1 36  ? 1.733   229.884 3.536   1.00 71.47  ? 36  ARG A CG    1 
ATOM   345  C  CD    . ARG A 1 36  ? 1.892   231.227 4.178   1.00 70.73  ? 36  ARG A CD    1 
ATOM   346  N  NE    . ARG A 1 36  ? 1.615   231.173 5.603   1.00 65.00  ? 36  ARG A NE    1 
ATOM   347  C  CZ    . ARG A 1 36  ? 1.380   232.256 6.335   1.00 73.06  ? 36  ARG A CZ    1 
ATOM   348  N  NH1   . ARG A 1 36  ? 1.399   233.449 5.752   1.00 76.79  1 36  ARG A NH1   1 
ATOM   349  N  NH2   . ARG A 1 36  ? 1.132   232.161 7.642   1.00 67.96  ? 36  ARG A NH2   1 
ATOM   350  N  N     . THR A 1 37  ? 2.778   226.891 1.811   1.00 59.13  ? 37  THR A N     1 
ATOM   351  C  CA    . THR A 1 37  ? 2.515   226.231 0.536   1.00 64.54  ? 37  THR A CA    1 
ATOM   352  C  C     . THR A 1 37  ? 3.591   225.184 0.280   1.00 69.14  ? 37  THR A C     1 
ATOM   353  O  O     . THR A 1 37  ? 4.437   224.940 1.142   1.00 70.26  ? 37  THR A O     1 
ATOM   354  C  CB    . THR A 1 37  ? 2.464   227.214 -0.647  1.00 72.65  ? 37  THR A CB    1 
ATOM   355  O  OG1   . THR A 1 37  ? 2.289   226.474 -1.865  1.00 92.84  ? 37  THR A OG1   1 
ATOM   356  C  CG2   . THR A 1 37  ? 3.745   228.026 -0.745  1.00 60.14  ? 37  THR A CG2   1 
ATOM   357  H  HG21  . THR A 1 37  ? 4.503   227.435 -0.873  1.00 72.17  ? 37  THR A HG21  1 
ATOM   358  H  HG22  . THR A 1 37  ? 3.693   228.638 -1.496  1.00 72.17  ? 37  THR A HG22  1 
ATOM   359  H  HG23  . THR A 1 37  ? 3.877   228.537 0.069   1.00 72.17  ? 37  THR A HG23  1 
ATOM   360  N  N     . LYS A 1 38  ? 3.569   224.565 -0.897  1.00 68.94  ? 38  LYS A N     1 
ATOM   361  C  CA    . LYS A 1 38  ? 4.551   223.525 -1.192  1.00 68.56  ? 38  LYS A CA    1 
ATOM   362  C  C     . LYS A 1 38  ? 5.948   224.079 -1.532  1.00 63.58  ? 38  LYS A C     1 
ATOM   363  O  O     . LYS A 1 38  ? 6.904   223.319 -1.631  1.00 65.36  ? 38  LYS A O     1 
ATOM   364  C  CB    . LYS A 1 38  ? 4.052   222.635 -2.330  1.00 74.72  ? 38  LYS A CB    1 
ATOM   365  C  CG    . LYS A 1 38  ? 2.822   221.799 -1.976  1.00 83.53  ? 38  LYS A CG    1 
ATOM   366  C  CD    . LYS A 1 38  ? 2.512   220.752 -3.061  1.00 90.08  ? 38  LYS A CD    1 
ATOM   367  C  CE    . LYS A 1 38  ? 3.540   219.604 -3.079  1.00 91.39  ? 38  LYS A CE    1 
ATOM   368  N  NZ    . LYS A 1 38  ? 4.941   220.030 -3.397  1.00 87.90  1 38  LYS A NZ    1 
ATOM   369  N  N     . THR A 1 39  ? 6.072   225.396 -1.682  1.00 61.73  ? 39  THR A N     1 
ATOM   370  C  CA    . THR A 1 39  ? 7.362   226.034 -1.989  1.00 60.27  ? 39  THR A CA    1 
ATOM   371  C  C     . THR A 1 39  ? 7.746   227.196 -1.029  1.00 47.69  ? 39  THR A C     1 
ATOM   372  O  O     . THR A 1 39  ? 8.865   227.726 -1.081  1.00 43.85  ? 39  THR A O     1 
ATOM   373  C  CB    . THR A 1 39  ? 7.368   226.596 -3.420  1.00 61.88  ? 39  THR A CB    1 
ATOM   374  O  OG1   . THR A 1 39  ? 6.476   227.715 -3.480  1.00 64.96  ? 39  THR A OG1   1 
ATOM   375  C  CG2   . THR A 1 39  ? 6.924   225.542 -4.420  1.00 61.04  ? 39  THR A CG2   1 
ATOM   376  H  HG21  . THR A 1 39  ? 6.025   225.246 -4.211  1.00 73.25  ? 39  THR A HG21  1 
ATOM   377  H  HG22  . THR A 1 39  ? 6.934   225.912 -5.317  1.00 73.25  ? 39  THR A HG22  1 
ATOM   378  H  HG23  . THR A 1 39  ? 7.523   224.780 -4.387  1.00 73.25  ? 39  THR A HG23  1 
ATOM   379  N  N     . SER A 1 40  ? 6.814   227.625 -0.184  1.00 45.36  ? 40  SER A N     1 
ATOM   380  C  CA    . SER A 1 40  ? 7.140   228.630 0.826   1.00 48.13  ? 40  SER A CA    1 
ATOM   381  C  C     . SER A 1 40  ? 8.291   228.111 1.692   1.00 44.63  ? 40  SER A C     1 
ATOM   382  O  O     . SER A 1 40  ? 8.247   226.992 2.221   1.00 39.78  ? 40  SER A O     1 
ATOM   383  C  CB    . SER A 1 40  ? 5.930   228.949 1.697   1.00 53.19  ? 40  SER A CB    1 
ATOM   384  O  OG    . SER A 1 40  ? 5.380   227.740 2.193   1.00 57.35  ? 40  SER A OG    1 
ATOM   385  N  N     . GLY A 1 41  ? 9.345   228.905 1.803   1.00 40.76  ? 41  GLY A N     1 
ATOM   386  C  CA    . GLY A 1 41  ? 10.473  228.477 2.593   1.00 43.59  ? 41  GLY A CA    1 
ATOM   387  C  C     . GLY A 1 41  ? 11.737  229.175 2.196   1.00 43.76  ? 41  GLY A C     1 
ATOM   388  O  O     . GLY A 1 41  ? 11.743  230.024 1.302   1.00 42.41  ? 41  GLY A O     1 
ATOM   389  N  N     . ALA A 1 42  ? 12.819  228.802 2.865   1.00 41.85  ? 42  ALA A N     1 
ATOM   390  C  CA    . ALA A 1 42  ? 14.111  229.398 2.600   1.00 34.39  ? 42  ALA A CA    1 
ATOM   391  C  C     . ALA A 1 42  ? 15.124  228.306 2.417   1.00 32.84  ? 42  ALA A C     1 
ATOM   392  O  O     . ALA A 1 42  ? 14.965  227.192 2.923   1.00 36.41  ? 42  ALA A O     1 
ATOM   393  C  CB    . ALA A 1 42  ? 14.523  230.323 3.729   1.00 36.39  ? 42  ALA A CB    1 
ATOM   394  N  N     . VAL A 1 43  ? 16.166  228.627 1.676   1.00 32.27  ? 43  VAL A N     1 
ATOM   395  C  CA    . VAL A 1 43  ? 17.220  227.677 1.441   1.00 32.51  ? 43  VAL A CA    1 
ATOM   396  C  C     . VAL A 1 43  ? 18.065  227.663 2.705   1.00 35.84  ? 43  VAL A C     1 
ATOM   397  O  O     . VAL A 1 43  ? 18.385  228.715 3.243   1.00 34.00  ? 43  VAL A O     1 
ATOM   398  C  CB    . VAL A 1 43  ? 18.065  228.057 0.207   1.00 32.61  ? 43  VAL A CB    1 
ATOM   399  C  CG1   . VAL A 1 43  ? 19.337  227.242 0.171   1.00 31.51  ? 43  VAL A CG1   1 
ATOM   400  C  CG2   . VAL A 1 43  ? 17.246  227.869 -1.082  1.00 33.00  ? 43  VAL A CG2   1 
ATOM   401  H  HG11  . VAL A 1 43  ? 19.853  227.496 -0.611  1.00 37.81  ? 43  VAL A HG11  1 
ATOM   402  H  HG12  . VAL A 1 43  ? 19.848  227.418 0.976   1.00 37.81  ? 43  VAL A HG12  1 
ATOM   403  H  HG13  . VAL A 1 43  ? 19.107  226.300 0.124   1.00 37.81  ? 43  VAL A HG13  1 
ATOM   404  H  HG21  . VAL A 1 43  ? 17.795  228.113 -1.843  1.00 39.60  ? 43  VAL A HG21  1 
ATOM   405  H  HG22  . VAL A 1 43  ? 16.977  226.940 -1.152  1.00 39.60  ? 43  VAL A HG22  1 
ATOM   406  H  HG23  . VAL A 1 43  ? 16.462  228.438 -1.044  1.00 39.60  ? 43  VAL A HG23  1 
ATOM   407  N  N     . ALA A 1 44  ? 18.445  226.487 3.180   1.00 30.07  ? 44  ALA A N     1 
ATOM   408  C  CA    . ALA A 1 44  ? 19.341  226.451 4.327   1.00 36.65  ? 44  ALA A CA    1 
ATOM   409  C  C     . ALA A 1 44  ? 20.761  226.350 3.813   1.00 34.34  ? 44  ALA A C     1 
ATOM   410  O  O     . ALA A 1 44  ? 21.656  227.075 4.254   1.00 39.57  ? 44  ALA A O     1 
ATOM   411  C  CB    . ALA A 1 44  ? 19.001  225.266 5.273   1.00 32.22  ? 44  ALA A CB    1 
ATOM   412  N  N     . THR A 1 45  ? 20.955  225.429 2.877   1.00 30.18  ? 45  THR A N     1 
ATOM   413  C  CA    . THR A 1 45  ? 22.248  225.244 2.252   1.00 29.36  ? 45  THR A CA    1 
ATOM   414  C  C     . THR A 1 45  ? 22.115  224.553 0.869   1.00 43.04  ? 45  THR A C     1 
ATOM   415  O  O     . THR A 1 45  ? 21.195  223.769 0.606   1.00 45.39  ? 45  THR A O     1 
ATOM   416  C  CB    . THR A 1 45  ? 23.186  224.455 3.188   1.00 36.44  ? 45  THR A CB    1 
ATOM   417  O  OG1   . THR A 1 45  ? 24.481  224.308 2.590   1.00 47.79  ? 45  THR A OG1   1 
ATOM   418  C  CG2   . THR A 1 45  ? 22.630  223.111 3.517   1.00 37.91  ? 45  THR A CG2   1 
ATOM   419  H  HG21  . THR A 1 45  ? 22.509  222.594 2.705   1.00 45.49  ? 45  THR A HG21  1 
ATOM   420  H  HG22  . THR A 1 45  ? 23.237  222.636 4.106   1.00 45.49  ? 45  THR A HG22  1 
ATOM   421  H  HG23  . THR A 1 45  ? 21.772  223.206 3.960   1.00 45.49  ? 45  THR A HG23  1 
ATOM   422  N  N     . ALA A 1 46  ? 23.045  224.875 -0.013  1.00 31.91  ? 46  ALA A N     1 
ATOM   423  C  CA    . ALA A 1 46  ? 23.155  224.237 -1.298  1.00 33.69  ? 46  ALA A CA    1 
ATOM   424  C  C     . ALA A 1 46  ? 24.558  223.666 -1.447  1.00 39.76  ? 46  ALA A C     1 
ATOM   425  O  O     . ALA A 1 46  ? 25.535  224.234 -0.891  1.00 26.18  ? 46  ALA A O     1 
ATOM   426  C  CB    . ALA A 1 46  ? 22.869  225.263 -2.439  1.00 34.54  ? 46  ALA A CB    1 
ATOM   427  N  N     . ASN A 1 47  ? 24.684  222.595 -2.241  1.00 34.62  ? 47  ASN A N     1 
ATOM   428  C  CA    . ASN A 1 47  ? 26.002  222.071 -2.470  1.00 31.73  ? 47  ASN A CA    1 
ATOM   429  C  C     . ASN A 1 47  ? 26.596  222.945 -3.527  1.00 31.95  ? 47  ASN A C     1 
ATOM   430  O  O     . ASN A 1 47  ? 25.930  223.870 -4.015  1.00 35.29  ? 47  ASN A O     1 
ATOM   431  C  CB    . ASN A 1 47  ? 25.994  220.585 -2.833  1.00 25.06  ? 47  ASN A CB    1 
ATOM   432  C  CG    . ASN A 1 47  ? 25.287  220.274 -4.147  1.00 43.15  ? 47  ASN A CG    1 
ATOM   433  O  OD1   . ASN A 1 47  ? 24.835  221.164 -4.875  1.00 40.06  ? 47  ASN A OD1   1 
ATOM   434  N  ND2   . ASN A 1 47  ? 25.221  218.972 -4.470  1.00 34.23  ? 47  ASN A ND2   1 
ATOM   435  N  N     . TYR A 1 48  ? 27.857  222.709 -3.849  1.00 35.72  ? 48  TYR A N     1 
ATOM   436  C  CA    . TYR A 1 48  ? 28.585  223.649 -4.692  1.00 39.72  ? 48  TYR A CA    1 
ATOM   437  C  C     . TYR A 1 48  ? 28.089  223.648 -6.148  1.00 43.70  ? 48  TYR A C     1 
ATOM   438  O  O     . TYR A 1 48  ? 28.171  224.668 -6.848  1.00 41.50  ? 48  TYR A O     1 
ATOM   439  C  CB    . TYR A 1 48  ? 30.089  223.354 -4.602  1.00 46.18  ? 48  TYR A CB    1 
ATOM   440  C  CG    . TYR A 1 48  ? 30.678  223.968 -3.348  1.00 59.69  ? 48  TYR A CG    1 
ATOM   441  C  CD1   . TYR A 1 48  ? 31.160  225.274 -3.354  1.00 76.44  ? 48  TYR A CD1   1 
ATOM   442  C  CD2   . TYR A 1 48  ? 30.704  223.268 -2.153  1.00 62.66  ? 48  TYR A CD2   1 
ATOM   443  C  CE1   . TYR A 1 48  ? 31.677  225.855 -2.210  1.00 87.22  ? 48  TYR A CE1   1 
ATOM   444  C  CE2   . TYR A 1 48  ? 31.215  223.836 -1.002  1.00 75.49  ? 48  TYR A CE2   1 
ATOM   445  C  CZ    . TYR A 1 48  ? 31.700  225.132 -1.033  1.00 85.94  ? 48  TYR A CZ    1 
ATOM   446  O  OH    . TYR A 1 48  ? 32.217  225.706 0.110   1.00 86.20  ? 48  TYR A OH    1 
ATOM   447  N  N     . GLU A 1 49  ? 27.564  222.511 -6.596  1.00 38.15  ? 49  GLU A N     1 
ATOM   448  C  CA    . GLU A 1 49  ? 26.952  222.447 -7.922  1.00 35.65  ? 49  GLU A CA    1 
ATOM   449  C  C     . GLU A 1 49  ? 25.788  223.424 -7.977  1.00 39.78  ? 49  GLU A C     1 
ATOM   450  O  O     . GLU A 1 49  ? 25.643  224.149 -8.965  1.00 49.28  ? 49  GLU A O     1 
ATOM   451  C  CB    . GLU A 1 49  ? 26.490  221.024 -8.264  1.00 29.76  ? 49  GLU A CB    1 
ATOM   452  C  CG    . GLU A 1 49  ? 27.625  220.054 -8.529  1.00 38.45  ? 49  GLU A CG    1 
ATOM   453  C  CD    . GLU A 1 49  ? 28.357  219.569 -7.255  1.00 68.69  ? 49  GLU A CD    1 
ATOM   454  O  OE1   . GLU A 1 49  ? 27.968  219.942 -6.115  1.00 52.48  ? 49  GLU A OE1   1 
ATOM   455  O  OE2   . GLU A 1 49  ? 29.338  218.803 -7.412  1.00 70.76  1 49  GLU A OE2   1 
ATOM   456  N  N     . ALA A 1 50  ? 24.980  223.479 -6.918  1.00 36.33  ? 50  ALA A N     1 
ATOM   457  C  CA    . ALA A 1 50  ? 23.834  224.405 -6.884  1.00 37.09  ? 50  ALA A CA    1 
ATOM   458  C  C     . ALA A 1 50  ? 24.287  225.844 -6.753  1.00 42.83  ? 50  ALA A C     1 
ATOM   459  O  O     . ALA A 1 50  ? 23.655  226.765 -7.307  1.00 44.43  ? 50  ALA A O     1 
ATOM   460  C  CB    . ALA A 1 50  ? 22.885  224.065 -5.754  1.00 29.49  ? 50  ALA A CB    1 
ATOM   461  N  N     . ARG A 1 51  ? 25.384  226.056 -6.037  1.00 42.22  ? 51  ARG A N     1 
ATOM   462  C  CA    . ARG A 1 51  ? 25.877  227.414 -5.919  1.00 46.79  ? 51  ARG A CA    1 
ATOM   463  C  C     . ARG A 1 51  ? 26.342  227.928 -7.297  1.00 48.79  ? 51  ARG A C     1 
ATOM   464  O  O     . ARG A 1 51  ? 26.237  229.121 -7.555  1.00 47.66  ? 51  ARG A O     1 
ATOM   465  C  CB    . ARG A 1 51  ? 26.991  227.518 -4.875  1.00 43.35  ? 51  ARG A CB    1 
ATOM   466  C  CG    . ARG A 1 51  ? 26.533  227.153 -3.475  1.00 44.44  ? 51  ARG A CG    1 
ATOM   467  C  CD    . ARG A 1 51  ? 27.612  227.289 -2.409  1.00 37.62  ? 51  ARG A CD    1 
ATOM   468  N  NE    . ARG A 1 51  ? 27.194  226.635 -1.168  1.00 42.97  ? 51  ARG A NE    1 
ATOM   469  C  CZ    . ARG A 1 51  ? 27.911  226.611 -0.043  1.00 48.89  ? 51  ARG A CZ    1 
ATOM   470  N  NH1   . ARG A 1 51  ? 29.097  227.212 0.005   1.00 41.78  1 51  ARG A NH1   1 
ATOM   471  N  NH2   . ARG A 1 51  ? 27.445  225.979 1.037   1.00 53.96  ? 51  ARG A NH2   1 
ATOM   472  N  N     . LYS A 1 52  ? 26.807  227.038 -8.182  1.00 45.08  ? 52  LYS A N     1 
ATOM   473  C  CA    . LYS A 1 52  ? 27.288  227.447 -9.509  1.00 41.49  ? 52  LYS A CA    1 
ATOM   474  C  C     . LYS A 1 52  ? 26.162  228.091 -10.320 1.00 47.74  ? 52  LYS A C     1 
ATOM   475  O  O     . LYS A 1 52  ? 26.411  228.902 -11.217 1.00 50.83  ? 52  LYS A O     1 
ATOM   476  C  CB    . LYS A 1 52  ? 27.856  226.269 -10.313 1.00 49.04  ? 52  LYS A CB    1 
ATOM   477  C  CG    . LYS A 1 52  ? 29.130  225.652 -9.784  1.00 56.27  ? 52  LYS A CG    1 
ATOM   478  C  CD    . LYS A 1 52  ? 30.066  225.267 -10.921 1.00 64.38  ? 52  LYS A CD    1 
ATOM   479  C  CE    . LYS A 1 52  ? 30.961  224.072 -10.592 1.00 69.21  ? 52  LYS A CE    1 
ATOM   480  N  NZ    . LYS A 1 52  ? 30.290  222.754 -10.859 1.00 73.33  1 52  LYS A NZ    1 
ATOM   481  N  N     . LEU A 1 53  ? 24.928  227.718 -9.989  1.00 43.81  ? 53  LEU A N     1 
ATOM   482  C  CA    . LEU A 1 53  ? 23.727  228.232 -10.644 1.00 39.36  ? 53  LEU A CA    1 
ATOM   483  C  C     . LEU A 1 53  ? 23.096  229.436 -9.936  1.00 45.60  ? 53  LEU A C     1 
ATOM   484  O  O     . LEU A 1 53  ? 22.038  229.916 -10.357 1.00 49.09  ? 53  LEU A O     1 
ATOM   485  C  CB    . LEU A 1 53  ? 22.689  227.115 -10.749 1.00 32.18  ? 53  LEU A CB    1 
ATOM   486  C  CG    . LEU A 1 53  ? 23.257  225.820 -11.344 1.00 42.75  ? 53  LEU A CG    1 
ATOM   487  C  CD1   . LEU A 1 53  ? 22.252  224.651 -11.248 1.00 41.67  ? 53  LEU A CD1   1 
ATOM   488  C  CD2   . LEU A 1 53  ? 23.716  226.049 -12.782 1.00 42.94  ? 53  LEU A CD2   1 
ATOM   489  N  N     . GLY A 1 54  ? 23.716  229.903 -8.851  1.00 48.87  ? 54  GLY A N     1 
ATOM   490  C  CA    . GLY A 1 54  ? 23.192  231.048 -8.133  1.00 44.80  ? 54  GLY A CA    1 
ATOM   491  C  C     . GLY A 1 54  ? 22.457  230.746 -6.832  1.00 44.15  ? 54  GLY A C     1 
ATOM   492  O  O     . GLY A 1 54  ? 22.073  231.672 -6.110  1.00 41.67  ? 54  GLY A O     1 
ATOM   493  N  N     . VAL A 1 55  ? 22.235  229.473 -6.517  1.00 40.28  ? 55  VAL A N     1 
ATOM   494  C  CA    . VAL A 1 55  ? 21.541  229.169 -5.256  1.00 47.40  ? 55  VAL A CA    1 
ATOM   495  C  C     . VAL A 1 55  ? 22.364  229.626 -4.030  1.00 46.29  ? 55  VAL A C     1 
ATOM   496  O  O     . VAL A 1 55  ? 23.573  229.402 -3.969  1.00 44.37  ? 55  VAL A O     1 
ATOM   497  C  CB    . VAL A 1 55  ? 21.218  227.686 -5.148  1.00 48.48  ? 55  VAL A CB    1 
ATOM   498  C  CG1   . VAL A 1 55  ? 20.365  227.417 -3.907  1.00 47.83  ? 55  VAL A CG1   1 
ATOM   499  C  CG2   . VAL A 1 55  ? 20.492  227.250 -6.404  1.00 35.11  ? 55  VAL A CG2   1 
ATOM   500  H  HG11  . VAL A 1 55  ? 20.170  226.468 -3.857  1.00 57.39  ? 55  VAL A HG11  1 
ATOM   501  H  HG12  . VAL A 1 55  ? 20.857  227.696 -3.119  1.00 57.39  ? 55  VAL A HG12  1 
ATOM   502  H  HG13  . VAL A 1 55  ? 19.539  227.921 -3.977  1.00 57.39  ? 55  VAL A HG13  1 
ATOM   503  H  HG21  . VAL A 1 55  ? 20.285  226.305 -6.337  1.00 42.13  ? 55  VAL A HG21  1 
ATOM   504  H  HG22  . VAL A 1 55  ? 19.673  227.763 -6.488  1.00 42.13  ? 55  VAL A HG22  1 
ATOM   505  H  HG23  . VAL A 1 55  ? 21.064  227.411 -7.171  1.00 42.13  ? 55  VAL A HG23  1 
ATOM   506  N  N     . LYS A 1 56  ? 21.701  230.294 -3.087  1.00 43.66  ? 56  LYS A N     1 
ATOM   507  C  CA    . LYS A 1 56  ? 22.358  230.942 -1.944  1.00 44.86  ? 56  LYS A CA    1 
ATOM   508  C  C     . LYS A 1 56  ? 21.625  230.652 -0.619  1.00 49.16  ? 56  LYS A C     1 
ATOM   509  O  O     . LYS A 1 56  ? 20.391  230.586 -0.589  1.00 53.90  ? 56  LYS A O     1 
ATOM   510  C  CB    . LYS A 1 56  ? 22.413  232.448 -2.175  1.00 50.66  ? 56  LYS A CB    1 
ATOM   511  C  CG    . LYS A 1 56  ? 23.786  232.992 -2.461  1.00 62.11  ? 56  LYS A CG    1 
ATOM   512  C  CD    . LYS A 1 56  ? 23.721  234.465 -2.803  1.00 63.89  ? 56  LYS A CD    1 
ATOM   513  C  CE    . LYS A 1 56  ? 25.058  234.975 -3.363  1.00 72.89  ? 56  LYS A CE    1 
ATOM   514  N  NZ    . LYS A 1 56  ? 24.999  236.400 -3.891  1.00 71.16  1 56  LYS A NZ    1 
ATOM   515  N  N     . ALA A 1 57  ? 22.353  230.492 0.486   1.00 43.57  ? 57  ALA A N     1 
ATOM   516  C  CA    . ALA A 1 57  ? 21.651  230.292 1.756   1.00 41.25  ? 57  ALA A CA    1 
ATOM   517  C  C     . ALA A 1 57  ? 20.820  231.529 2.063   1.00 42.19  ? 57  ALA A C     1 
ATOM   518  O  O     . ALA A 1 57  ? 21.217  232.666 1.778   1.00 45.67  ? 57  ALA A O     1 
ATOM   519  C  CB    . ALA A 1 57  ? 22.608  229.994 2.893   1.00 30.57  ? 57  ALA A CB    1 
ATOM   520  N  N     . GLY A 1 58  ? 19.639  231.297 2.611   1.00 42.21  ? 58  GLY A N     1 
ATOM   521  C  CA    . GLY A 1 58  ? 18.762  232.381 2.992   1.00 34.32  ? 58  GLY A CA    1 
ATOM   522  C  C     . GLY A 1 58  ? 17.779  232.768 1.906   1.00 41.54  ? 58  GLY A C     1 
ATOM   523  O  O     . GLY A 1 58  ? 16.820  233.513 2.175   1.00 39.25  ? 58  GLY A O     1 
ATOM   524  N  N     . MET A 1 59  ? 17.991  232.287 0.679   1.00 39.81  ? 59  MET A N     1 
ATOM   525  C  CA    . MET A 1 59  ? 17.159  232.772 -0.427  1.00 39.31  ? 59  MET A CA    1 
ATOM   526  C  C     . MET A 1 59  ? 15.828  232.013 -0.428  1.00 40.26  ? 59  MET A C     1 
ATOM   527  O  O     . MET A 1 59  ? 15.755  230.862 0.021   1.00 42.12  ? 59  MET A O     1 
ATOM   528  C  CB    . MET A 1 59  ? 17.925  232.676 -1.754  1.00 44.04  ? 59  MET A CB    1 
ATOM   529  C  CG    . MET A 1 59  ? 17.468  231.657 -2.778  1.00 53.32  ? 59  MET A CG    1 
ATOM   530  S  SD    . MET A 1 59  ? 18.547  231.613 -4.262  1.00 54.97  ? 59  MET A SD    1 
ATOM   531  C  CE    . MET A 1 59  ? 18.611  233.314 -4.810  1.00 56.63  ? 59  MET A CE    1 
ATOM   532  N  N     . PRO A 1 60  ? 14.743  232.686 -0.846  1.00 40.99  ? 60  PRO A N     1 
ATOM   533  C  CA    . PRO A 1 60  ? 13.435  232.026 -0.891  1.00 39.75  ? 60  PRO A CA    1 
ATOM   534  C  C     . PRO A 1 60  ? 13.481  230.855 -1.851  1.00 45.76  ? 60  PRO A C     1 
ATOM   535  O  O     . PRO A 1 60  ? 14.173  230.937 -2.860  1.00 42.72  ? 60  PRO A O     1 
ATOM   536  C  CB    . PRO A 1 60  ? 12.504  233.124 -1.396  1.00 42.86  ? 60  PRO A CB    1 
ATOM   537  C  CG    . PRO A 1 60  ? 13.180  234.397 -0.960  1.00 40.40  ? 60  PRO A CG    1 
ATOM   538  C  CD    . PRO A 1 60  ? 14.643  234.116 -1.168  1.00 41.95  ? 60  PRO A CD    1 
ATOM   539  N  N     . ILE A 1 61  ? 12.767  229.785 -1.528  1.00 37.93  ? 61  ILE A N     1 
ATOM   540  C  CA    . ILE A 1 61  ? 12.856  228.557 -2.286  1.00 35.88  ? 61  ILE A CA    1 
ATOM   541  C  C     . ILE A 1 61  ? 12.414  228.735 -3.736  1.00 42.82  ? 61  ILE A C     1 
ATOM   542  O  O     . ILE A 1 61  ? 13.073  228.189 -4.622  1.00 39.60  ? 61  ILE A O     1 
ATOM   543  C  CB    . ILE A 1 61  ? 12.040  227.435 -1.610  1.00 39.23  ? 61  ILE A CB    1 
ATOM   544  C  CG1   . ILE A 1 61  ? 12.672  227.095 -0.256  1.00 47.58  ? 61  ILE A CG1   1 
ATOM   545  C  CG2   . ILE A 1 61  ? 12.028  226.171 -2.462  1.00 31.10  ? 61  ILE A CG2   1 
ATOM   546  C  CD1   . ILE A 1 61  ? 11.914  226.063 0.554   1.00 46.26  ? 61  ILE A CD1   1 
ATOM   547  H  HG12  . ILE A 1 61  ? 13.566  226.750 -0.409  1.00 57.10  ? 61  ILE A HG12  1 
ATOM   548  H  HG13  . ILE A 1 61  ? 12.722  227.906 0.275   1.00 57.10  ? 61  ILE A HG13  1 
ATOM   549  H  HG21  . ILE A 1 61  ? 11.508  225.489 -2.007  1.00 37.32  ? 61  ILE A HG21  1 
ATOM   550  H  HG22  . ILE A 1 61  ? 11.629  226.374 -3.322  1.00 37.32  ? 61  ILE A HG22  1 
ATOM   551  H  HG23  . ILE A 1 61  ? 12.940  225.864 -2.584  1.00 37.32  ? 61  ILE A HG23  1 
ATOM   552  N  N     . ILE A 1 62  ? 11.345  229.503 -3.987  1.00 46.64  ? 62  ILE A N     1 
ATOM   553  C  CA    . ILE A 1 62  ? 10.890  229.716 -5.358  1.00 64.60  ? 62  ILE A CA    1 
ATOM   554  C  C     . ILE A 1 62  ? 11.891  230.513 -6.155  1.00 54.38  ? 62  ILE A C     1 
ATOM   555  O  O     . ILE A 1 62  ? 11.947  230.389 -7.376  1.00 53.10  ? 62  ILE A O     1 
ATOM   556  C  CB    . ILE A 1 62  ? 9.554   230.456 -5.452  1.00 80.90  ? 62  ILE A CB    1 
ATOM   557  C  CG1   . ILE A 1 62  ? 9.025   230.396 -6.879  1.00 83.11  ? 62  ILE A CG1   1 
ATOM   558  C  CG2   . ILE A 1 62  ? 9.672   231.870 -4.905  1.00 103.09 ? 62  ILE A CG2   1 
ATOM   559  C  CD1   . ILE A 1 62  ? 8.663   229.003 -7.305  1.00 94.55  ? 62  ILE A CD1   1 
ATOM   560  H  HG12  . ILE A 1 62  ? 8.230   230.946 -6.944  1.00 99.73  ? 62  ILE A HG12  1 
ATOM   561  H  HG13  . ILE A 1 62  ? 9.708   230.726 -7.483  1.00 99.73  ? 62  ILE A HG13  1 
ATOM   562  H  HG21  . ILE A 1 62  ? 9.944   231.826 -3.974  1.00 123.71 ? 62  ILE A HG21  1 
ATOM   563  H  HG22  . ILE A 1 62  ? 10.337  232.354 -5.420  1.00 123.71 ? 62  ILE A HG22  1 
ATOM   564  H  HG23  . ILE A 1 62  ? 8.810   232.311 -4.977  1.00 123.71 ? 62  ILE A HG23  1 
ATOM   565  N  N     . LYS A 1 63  ? 12.663  231.352 -5.478  1.00 37.86  ? 63  LYS A N     1 
ATOM   566  C  CA    . LYS A 1 63  ? 13.704  232.074 -6.184  1.00 46.70  ? 63  LYS A CA    1 
ATOM   567  C  C     . LYS A 1 63  ? 14.715  231.049 -6.661  1.00 53.05  ? 63  LYS A C     1 
ATOM   568  O  O     . LYS A 1 63  ? 15.156  231.070 -7.808  1.00 55.54  ? 63  LYS A O     1 
ATOM   569  C  CB    . LYS A 1 63  ? 14.366  233.119 -5.302  1.00 45.29  ? 63  LYS A CB    1 
ATOM   570  C  CG    . LYS A 1 63  ? 15.061  234.233 -6.048  1.00 59.25  ? 63  LYS A CG    1 
ATOM   571  C  CD    . LYS A 1 63  ? 14.760  235.604 -5.397  1.00 71.99  ? 63  LYS A CD    1 
ATOM   572  C  CE    . LYS A 1 63  ? 15.945  236.161 -4.586  1.00 77.60  ? 63  LYS A CE    1 
ATOM   573  N  NZ    . LYS A 1 63  ? 17.099  236.623 -5.424  1.00 77.16  1 63  LYS A NZ    1 
ATOM   574  N  N     . ALA A 1 64  ? 15.062  230.135 -5.767  1.00 48.98  ? 64  ALA A N     1 
ATOM   575  C  CA    . ALA A 1 64  ? 16.081  229.164 -6.077  1.00 49.07  ? 64  ALA A CA    1 
ATOM   576  C  C     . ALA A 1 64  ? 15.592  228.307 -7.230  1.00 43.79  ? 64  ALA A C     1 
ATOM   577  O  O     . ALA A 1 64  ? 16.378  227.896 -8.067  1.00 48.45  ? 64  ALA A O     1 
ATOM   578  C  CB    . ALA A 1 64  ? 16.418  228.307 -4.868  1.00 26.35  ? 64  ALA A CB    1 
ATOM   579  N  N     . MET A 1 65  ? 14.294  228.050 -7.277  1.00 40.29  ? 65  MET A N     1 
ATOM   580  C  CA    . MET A 1 65  ? 13.750  227.174 -8.313  1.00 40.81  ? 65  MET A CA    1 
ATOM   581  C  C     . MET A 1 65  ? 13.648  227.853 -9.687  1.00 39.61  ? 65  MET A C     1 
ATOM   582  O  O     . MET A 1 65  ? 13.646  227.162 -10.685 1.00 50.87  ? 65  MET A O     1 
ATOM   583  C  CB    . MET A 1 65  ? 12.395  226.625 -7.872  1.00 43.80  ? 65  MET A CB    1 
ATOM   584  C  CG    . MET A 1 65  ? 12.492  225.850 -6.540  1.00 42.46  ? 65  MET A CG    1 
ATOM   585  S  SD    . MET A 1 65  ? 10.955  225.048 -6.048  1.00 54.60  ? 65  MET A SD    1 
ATOM   586  C  CE    . MET A 1 65  ? 9.869   226.434 -5.904  1.00 44.89  ? 65  MET A CE    1 
ATOM   587  N  N     . GLN A 1 66  ? 13.603  229.185 -9.749  1.00 40.01  ? 66  GLN A N     1 
ATOM   588  C  CA    . GLN A 1 66  ? 13.690  229.867 -11.046 1.00 44.03  ? 66  GLN A CA    1 
ATOM   589  C  C     . GLN A 1 66  ? 15.103  229.765 -11.627 1.00 47.24  ? 66  GLN A C     1 
ATOM   590  O  O     . GLN A 1 66  ? 15.252  229.710 -12.831 1.00 58.83  ? 66  GLN A O     1 
ATOM   591  C  CB    . GLN A 1 66  ? 13.290  231.351 -10.974 1.00 41.62  ? 66  GLN A CB    1 
ATOM   592  C  CG    . GLN A 1 66  ? 12.057  231.673 -10.124 1.00 59.43  ? 66  GLN A CG    1 
ATOM   593  C  CD    . GLN A 1 66  ? 10.842  230.813 -10.444 1.00 68.31  ? 66  GLN A CD    1 
ATOM   594  O  OE1   . GLN A 1 66  ? 10.814  229.616 -10.155 1.00 63.83  ? 66  GLN A OE1   1 
ATOM   595  N  NE2   . GLN A 1 66  ? 9.820   231.432 -11.027 1.00 83.24  ? 66  GLN A NE2   1 
ATOM   596  N  N     . ILE A 1 67  ? 16.143  229.727 -10.797 1.00 42.96  ? 67  ILE A N     1 
ATOM   597  C  CA    . ILE A 1 67  ? 17.485  229.736 -11.371 1.00 41.90  ? 67  ILE A CA    1 
ATOM   598  C  C     . ILE A 1 67  ? 18.093  228.348 -11.455 1.00 48.04  ? 67  ILE A C     1 
ATOM   599  O  O     . ILE A 1 67  ? 19.023  228.123 -12.227 1.00 56.01  ? 67  ILE A O     1 
ATOM   600  C  CB    . ILE A 1 67  ? 18.449  230.634 -10.591 1.00 41.84  ? 67  ILE A CB    1 
ATOM   601  C  CG1   . ILE A 1 67  ? 18.419  230.307 -9.100  1.00 39.08  ? 67  ILE A CG1   1 
ATOM   602  C  CG2   . ILE A 1 67  ? 18.117  232.085 -10.814 1.00 42.68  ? 67  ILE A CG2   1 
ATOM   603  C  CD1   . ILE A 1 67  ? 19.335  231.171 -8.313  1.00 38.18  ? 67  ILE A CD1   1 
ATOM   604  H  HG12  . ILE A 1 67  ? 17.518  230.438 -8.765  1.00 46.89  ? 67  ILE A HG12  1 
ATOM   605  H  HG13  . ILE A 1 67  ? 18.691  229.385 -8.972  1.00 46.89  ? 67  ILE A HG13  1 
ATOM   606  H  HG21  . ILE A 1 67  ? 18.741  232.632 -10.311 1.00 51.22  ? 67  ILE A HG21  1 
ATOM   607  H  HG22  . ILE A 1 67  ? 18.191  232.284 -11.760 1.00 51.22  ? 67  ILE A HG22  1 
ATOM   608  H  HG23  . ILE A 1 67  ? 17.211  232.251 -10.510 1.00 51.22  ? 67  ILE A HG23  1 
ATOM   609  N  N     . ALA A 1 68  ? 17.556  227.420 -10.673 1.00 45.28  ? 68  ALA A N     1 
ATOM   610  C  CA    . ALA A 1 68  ? 18.074  226.055 -10.607 1.00 41.87  ? 68  ALA A CA    1 
ATOM   611  C  C     . ALA A 1 68  ? 16.928  225.055 -10.521 1.00 40.06  ? 68  ALA A C     1 
ATOM   612  O  O     . ALA A 1 68  ? 16.841  224.287 -9.575  1.00 46.69  ? 68  ALA A O     1 
ATOM   613  C  CB    . ALA A 1 68  ? 19.008  225.895 -9.408  1.00 41.60  ? 68  ALA A CB    1 
ATOM   614  N  N     . PRO A 1 69  ? 16.059  225.053 -11.529 1.00 45.78  ? 69  PRO A N     1 
ATOM   615  C  CA    . PRO A 1 69  ? 14.820  224.275 -11.612 1.00 40.17  ? 69  PRO A CA    1 
ATOM   616  C  C     . PRO A 1 69  ? 15.081  222.787 -11.651 1.00 41.08  ? 69  PRO A C     1 
ATOM   617  O  O     . PRO A 1 69  ? 14.154  222.015 -11.445 1.00 47.18  ? 69  PRO A O     1 
ATOM   618  C  CB    . PRO A 1 69  ? 14.203  224.717 -12.952 1.00 43.70  ? 69  PRO A CB    1 
ATOM   619  C  CG    . PRO A 1 69  ? 15.061  225.811 -13.478 1.00 39.30  ? 69  PRO A CG    1 
ATOM   620  C  CD    . PRO A 1 69  ? 16.392  225.681 -12.819 1.00 49.33  ? 69  PRO A CD    1 
ATOM   621  N  N     . SER A 1 70  ? 16.313  222.372 -11.928 1.00 37.42  ? 70  SER A N     1 
ATOM   622  C  CA    . SER A 1 70  ? 16.571  220.940 -12.018 1.00 39.67  ? 70  SER A CA    1 
ATOM   623  C  C     . SER A 1 70  ? 17.369  220.394 -10.838 1.00 41.16  ? 70  SER A C     1 
ATOM   624  O  O     . SER A 1 70  ? 17.646  219.194 -10.776 1.00 44.33  ? 70  SER A O     1 
ATOM   625  C  CB    . SER A 1 70  ? 17.275  220.622 -13.337 1.00 50.11  ? 70  SER A CB    1 
ATOM   626  O  OG    . SER A 1 70  ? 16.352  220.814 -14.412 1.00 60.12  ? 70  SER A OG    1 
ATOM   627  N  N     . ALA A 1 71  ? 17.722  221.271 -9.900  1.00 33.05  ? 71  ALA A N     1 
ATOM   628  C  CA    . ALA A 1 71  ? 18.352  220.835 -8.667  1.00 44.13  ? 71  ALA A CA    1 
ATOM   629  C  C     . ALA A 1 71  ? 17.378  219.907 -7.952  1.00 40.98  ? 71  ALA A C     1 
ATOM   630  O  O     . ALA A 1 71  ? 16.167  219.943 -8.212  1.00 43.92  ? 71  ALA A O     1 
ATOM   631  C  CB    . ALA A 1 71  ? 18.727  222.036 -7.775  1.00 35.09  ? 71  ALA A CB    1 
ATOM   632  N  N     . ILE A 1 72  ? 17.923  219.073 -7.073  1.00 41.02  ? 72  ILE A N     1 
ATOM   633  C  CA    . ILE A 1 72  ? 17.139  218.294 -6.101  1.00 39.26  ? 72  ILE A CA    1 
ATOM   634  C  C     . ILE A 1 72  ? 16.844  219.145 -4.864  1.00 41.29  ? 72  ILE A C     1 
ATOM   635  O  O     . ILE A 1 72  ? 17.765  219.674 -4.229  1.00 37.81  ? 72  ILE A O     1 
ATOM   636  C  CB    . ILE A 1 72  ? 17.897  217.019 -5.694  1.00 44.32  ? 72  ILE A CB    1 
ATOM   637  C  CG1   . ILE A 1 72  ? 18.114  216.111 -6.925  1.00 59.97  ? 72  ILE A CG1   1 
ATOM   638  C  CG2   . ILE A 1 72  ? 17.158  216.268 -4.599  1.00 38.67  ? 72  ILE A CG2   1 
ATOM   639  C  CD1   . ILE A 1 72  ? 19.556  215.645 -7.094  1.00 73.13  ? 72  ILE A CD1   1 
ATOM   640  H  HG12  . ILE A 1 72  ? 17.556  215.323 -6.835  1.00 71.97  ? 72  ILE A HG12  1 
ATOM   641  H  HG13  . ILE A 1 72  ? 17.865  216.602 -7.724  1.00 71.97  ? 72  ILE A HG13  1 
ATOM   642  H  HG21  . ILE A 1 72  ? 17.073  216.845 -3.823  1.00 46.40  ? 72  ILE A HG21  1 
ATOM   643  H  HG22  . ILE A 1 72  ? 16.278  216.021 -4.925  1.00 46.40  ? 72  ILE A HG22  1 
ATOM   644  H  HG23  . ILE A 1 72  ? 17.661  215.472 -4.367  1.00 46.40  ? 72  ILE A HG23  1 
ATOM   645  N  N     . TYR A 1 73  ? 15.567  219.310 -4.534  1.00 41.32  ? 73  TYR A N     1 
ATOM   646  C  CA    . TYR A 1 73  ? 15.208  220.039 -3.322  1.00 42.69  ? 73  TYR A CA    1 
ATOM   647  C  C     . TYR A 1 73  ? 14.772  219.097 -2.195  1.00 46.07  ? 73  TYR A C     1 
ATOM   648  O  O     . TYR A 1 73  ? 13.782  218.394 -2.315  1.00 55.25  ? 73  TYR A O     1 
ATOM   649  C  CB    . TYR A 1 73  ? 14.115  221.070 -3.622  1.00 30.23  ? 73  TYR A CB    1 
ATOM   650  C  CG    . TYR A 1 73  ? 14.641  222.155 -4.542  1.00 40.24  ? 73  TYR A CG    1 
ATOM   651  C  CD1   . TYR A 1 73  ? 14.639  221.974 -5.930  1.00 27.14  ? 73  TYR A CD1   1 
ATOM   652  C  CD2   . TYR A 1 73  ? 15.183  223.328 -4.032  1.00 25.29  ? 73  TYR A CD2   1 
ATOM   653  C  CE1   . TYR A 1 73  ? 15.142  222.943 -6.770  1.00 39.89  ? 73  TYR A CE1   1 
ATOM   654  C  CE2   . TYR A 1 73  ? 15.697  224.293 -4.869  1.00 40.52  ? 73  TYR A CE2   1 
ATOM   655  C  CZ    . TYR A 1 73  ? 15.670  224.099 -6.245  1.00 40.18  ? 73  TYR A CZ    1 
ATOM   656  O  OH    . TYR A 1 73  ? 16.173  225.062 -7.105  1.00 44.59  ? 73  TYR A OH    1 
ATOM   657  N  N     . VAL A 1 74  ? 15.516  219.087 -1.093  1.00 42.58  ? 74  VAL A N     1 
ATOM   658  C  CA    . VAL A 1 74  ? 15.153  218.230 0.041   1.00 34.21  ? 74  VAL A CA    1 
ATOM   659  C  C     . VAL A 1 74  ? 14.905  219.055 1.294   1.00 41.67  ? 74  VAL A C     1 
ATOM   660  O  O     . VAL A 1 74  ? 15.610  220.046 1.556   1.00 40.01  ? 74  VAL A O     1 
ATOM   661  C  CB    . VAL A 1 74  ? 16.238  217.174 0.351   1.00 27.67  ? 74  VAL A CB    1 
ATOM   662  C  CG1   . VAL A 1 74  ? 16.391  216.210 -0.803  1.00 33.37  ? 74  VAL A CG1   1 
ATOM   663  C  CG2   . VAL A 1 74  ? 17.566  217.819 0.655   1.00 27.94  ? 74  VAL A CG2   1 
ATOM   664  H  HG11  . VAL A 1 74  ? 17.077  215.560 -0.582  1.00 40.05  ? 74  VAL A HG11  1 
ATOM   665  H  HG12  . VAL A 1 74  ? 15.545  215.761 -0.953  1.00 40.05  ? 74  VAL A HG12  1 
ATOM   666  H  HG13  . VAL A 1 74  ? 16.648  216.706 -1.596  1.00 40.05  ? 74  VAL A HG13  1 
ATOM   667  H  HG21  . VAL A 1 74  ? 18.218  217.125 0.843   1.00 33.53  ? 74  VAL A HG21  1 
ATOM   668  H  HG22  . VAL A 1 74  ? 17.848  218.338 -0.114  1.00 33.53  ? 74  VAL A HG22  1 
ATOM   669  H  HG23  . VAL A 1 74  ? 17.466  218.398 1.427   1.00 33.53  ? 74  VAL A HG23  1 
ATOM   670  N  N     . PRO A 1 75  ? 13.894  218.654 2.072   1.00 45.92  ? 75  PRO A N     1 
ATOM   671  C  CA    . PRO A 1 75  ? 13.557  219.262 3.363   1.00 45.60  ? 75  PRO A CA    1 
ATOM   672  C  C     . PRO A 1 75  ? 14.692  219.077 4.382   1.00 47.42  ? 75  PRO A C     1 
ATOM   673  O  O     . PRO A 1 75  ? 15.425  218.075 4.375   1.00 37.64  ? 75  PRO A O     1 
ATOM   674  C  CB    . PRO A 1 75  ? 12.321  218.493 3.790   1.00 43.31  ? 75  PRO A CB    1 
ATOM   675  C  CG    . PRO A 1 75  ? 12.535  217.134 3.169   1.00 46.40  ? 75  PRO A CG    1 
ATOM   676  C  CD    . PRO A 1 75  ? 13.145  217.409 1.838   1.00 45.11  ? 75  PRO A CD    1 
ATOM   677  N  N     . MET A 1 76  ? 14.850  220.061 5.251   1.00 49.60  ? 76  MET A N     1 
ATOM   678  C  CA    . MET A 1 76  ? 15.892  219.974 6.238   1.00 49.10  ? 76  MET A CA    1 
ATOM   679  C  C     . MET A 1 76  ? 15.599  218.869 7.251   1.00 46.43  ? 76  MET A C     1 
ATOM   680  O  O     . MET A 1 76  ? 14.458  218.656 7.667   1.00 40.74  ? 76  MET A O     1 
ATOM   681  C  CB    . MET A 1 76  ? 16.067  221.305 6.942   1.00 56.61  ? 76  MET A CB    1 
ATOM   682  C  CG    . MET A 1 76  ? 17.291  221.324 7.805   1.00 63.38  ? 76  MET A CG    1 
ATOM   683  S  SD    . MET A 1 76  ? 17.573  222.948 8.408   1.00 51.66  ? 76  MET A SD    1 
ATOM   684  C  CE    . MET A 1 76  ? 16.138  223.201 9.438   1.00 47.67  ? 76  MET A CE    1 
ATOM   685  N  N     . ARG A 1 77  ? 16.643  218.140 7.607   1.00 44.02  ? 77  ARG A N     1 
ATOM   686  C  CA    . ARG A 1 77  ? 16.537  217.126 8.643   1.00 45.83  ? 77  ARG A CA    1 
ATOM   687  C  C     . ARG A 1 77  ? 17.550  217.453 9.749   1.00 41.81  ? 77  ARG A C     1 
ATOM   688  O  O     . ARG A 1 77  ? 18.560  216.764 9.925   1.00 42.50  ? 77  ARG A O     1 
ATOM   689  C  CB    . ARG A 1 77  ? 16.755  215.742 8.038   1.00 38.59  ? 77  ARG A CB    1 
ATOM   690  C  CG    . ARG A 1 77  ? 15.726  215.437 6.996   1.00 38.24  ? 77  ARG A CG    1 
ATOM   691  C  CD    . ARG A 1 77  ? 15.748  213.983 6.577   1.00 37.38  ? 77  ARG A CD    1 
ATOM   692  N  NE    . ARG A 1 77  ? 16.927  213.657 5.775   1.00 43.26  ? 77  ARG A NE    1 
ATOM   693  C  CZ    . ARG A 1 77  ? 17.290  212.410 5.503   1.00 42.42  ? 77  ARG A CZ    1 
ATOM   694  N  NH1   . ARG A 1 77  ? 16.565  211.415 5.993   1.00 39.97  1 77  ARG A NH1   1 
ATOM   695  N  NH2   . ARG A 1 77  ? 18.381  212.151 4.778   1.00 43.68  ? 77  ARG A NH2   1 
ATOM   696  N  N     . LYS A 1 78  ? 17.288  218.541 10.463  1.00 38.18  ? 78  LYS A N     1 
ATOM   697  C  CA    . LYS A 1 78  ? 18.244  219.037 11.453  1.00 46.35  ? 78  LYS A CA    1 
ATOM   698  C  C     . LYS A 1 78  ? 18.695  217.997 12.497  1.00 41.55  ? 78  LYS A C     1 
ATOM   699  O  O     . LYS A 1 78  ? 19.849  218.015 12.888  1.00 45.23  ? 78  LYS A O     1 
ATOM   700  C  CB    . LYS A 1 78  ? 17.686  220.256 12.184  1.00 47.82  ? 78  LYS A CB    1 
ATOM   701  C  CG    . LYS A 1 78  ? 18.781  221.111 12.805  1.00 52.29  ? 78  LYS A CG    1 
ATOM   702  C  CD    . LYS A 1 78  ? 18.344  222.559 12.926  1.00 61.00  ? 78  LYS A CD    1 
ATOM   703  C  CE    . LYS A 1 78  ? 19.401  223.384 13.611  1.00 68.55  ? 78  LYS A CE    1 
ATOM   704  N  NZ    . LYS A 1 78  ? 18.768  224.478 14.385  1.00 76.73  1 78  LYS A NZ    1 
ATOM   705  N  N     . PRO A 1 79  ? 17.805  217.093 12.941  1.00 37.78  ? 79  PRO A N     1 
ATOM   706  C  CA    . PRO A 1 79  ? 18.316  216.135 13.944  1.00 42.44  ? 79  PRO A CA    1 
ATOM   707  C  C     . PRO A 1 79  ? 19.442  215.264 13.404  1.00 49.59  ? 79  PRO A C     1 
ATOM   708  O  O     . PRO A 1 79  ? 20.368  214.977 14.159  1.00 47.43  ? 79  PRO A O     1 
ATOM   709  C  CB    . PRO A 1 79  ? 17.090  215.283 14.295  1.00 37.44  ? 79  PRO A CB    1 
ATOM   710  C  CG    . PRO A 1 79  ? 15.919  216.182 14.034  1.00 38.08  ? 79  PRO A CG    1 
ATOM   711  C  CD    . PRO A 1 79  ? 16.336  217.060 12.848  1.00 41.85  ? 79  PRO A CD    1 
ATOM   712  N  N     . ILE A 1 80  ? 19.391  214.879 12.124  1.00 48.69  ? 80  ILE A N     1 
ATOM   713  C  CA    . ILE A 1 80  ? 20.458  214.052 11.558  1.00 40.10  ? 80  ILE A CA    1 
ATOM   714  C  C     . ILE A 1 80  ? 21.753  214.850 11.434  1.00 39.71  ? 80  ILE A C     1 
ATOM   715  O  O     . ILE A 1 80  ? 22.848  214.311 11.631  1.00 46.53  ? 80  ILE A O     1 
ATOM   716  C  CB    . ILE A 1 80  ? 20.112  213.482 10.162  1.00 45.15  ? 80  ILE A CB    1 
ATOM   717  C  CG1   . ILE A 1 80  ? 18.694  212.901 10.121  1.00 40.32  ? 80  ILE A CG1   1 
ATOM   718  C  CG2   . ILE A 1 80  ? 21.163  212.436 9.753   1.00 52.93  ? 80  ILE A CG2   1 
ATOM   719  C  CD1   . ILE A 1 80  ? 18.416  211.982 8.896   1.00 42.84  ? 80  ILE A CD1   1 
ATOM   720  H  HG12  . ILE A 1 80  ? 18.550  212.375 10.923  1.00 48.39  ? 80  ILE A HG12  1 
ATOM   721  H  HG13  . ILE A 1 80  ? 18.058  213.633 10.091  1.00 48.39  ? 80  ILE A HG13  1 
ATOM   722  H  HG21  . ILE A 1 80  ? 20.936  212.086 8.878   1.00 63.52  ? 80  ILE A HG21  1 
ATOM   723  H  HG22  . ILE A 1 80  ? 22.035  212.859 9.725   1.00 63.52  ? 80  ILE A HG22  1 
ATOM   724  H  HG23  . ILE A 1 80  ? 21.164  211.719 10.407  1.00 63.52  ? 80  ILE A HG23  1 
ATOM   725  N  N     . TYR A 1 81  ? 21.639  216.130 11.106  1.00 38.68  ? 81  TYR A N     1 
ATOM   726  C  CA    . TYR A 1 81  ? 22.842  216.934 10.910  1.00 45.15  ? 81  TYR A CA    1 
ATOM   727  C  C     . TYR A 1 81  ? 23.450  217.187 12.276  1.00 42.31  ? 81  TYR A C     1 
ATOM   728  O  O     . TYR A 1 81  ? 24.667  217.230 12.414  1.00 48.24  ? 81  TYR A O     1 
ATOM   729  C  CB    . TYR A 1 81  ? 22.556  218.260 10.184  1.00 39.64  ? 81  TYR A CB    1 
ATOM   730  C  CG    . TYR A 1 81  ? 21.608  218.147 9.017   1.00 36.93  ? 81  TYR A CG    1 
ATOM   731  C  CD1   . TYR A 1 81  ? 20.694  219.165 8.741   1.00 43.90  ? 81  TYR A CD1   1 
ATOM   732  C  CD2   . TYR A 1 81  ? 21.620  217.031 8.174   1.00 43.99  ? 81  TYR A CD2   1 
ATOM   733  C  CE1   . TYR A 1 81  ? 19.799  219.077 7.651   1.00 40.93  ? 81  TYR A CE1   1 
ATOM   734  C  CE2   . TYR A 1 81  ? 20.724  216.927 7.091   1.00 39.57  ? 81  TYR A CE2   1 
ATOM   735  C  CZ    . TYR A 1 81  ? 19.827  217.960 6.846   1.00 40.08  ? 81  TYR A CZ    1 
ATOM   736  O  OH    . TYR A 1 81  ? 18.952  217.870 5.820   1.00 46.85  ? 81  TYR A OH    1 
ATOM   737  N  N     . GLU A 1 82  ? 22.596  217.325 13.285  1.00 42.21  ? 82  GLU A N     1 
ATOM   738  C  CA    . GLU A 1 82  ? 23.039  217.503 14.665  1.00 47.91  ? 82  GLU A CA    1 
ATOM   739  C  C     . GLU A 1 82  ? 23.836  216.294 15.146  1.00 46.97  ? 82  GLU A C     1 
ATOM   740  O  O     . GLU A 1 82  ? 24.869  216.432 15.810  1.00 42.20  ? 82  GLU A O     1 
ATOM   741  C  CB    . GLU A 1 82  ? 21.843  217.762 15.587  1.00 51.39  ? 82  GLU A CB    1 
ATOM   742  C  CG    . GLU A 1 82  ? 21.849  219.159 16.209  1.00 60.75  ? 82  GLU A CG    1 
ATOM   743  C  CD    . GLU A 1 82  ? 20.455  219.762 16.409  1.00 61.99  ? 82  GLU A CD    1 
ATOM   744  O  OE1   . GLU A 1 82  ? 19.462  219.010 16.567  1.00 64.15  ? 82  GLU A OE1   1 
ATOM   745  O  OE2   . GLU A 1 82  ? 20.358  221.009 16.417  1.00 54.91  1 82  GLU A OE2   1 
ATOM   746  N  N     . ALA A 1 83  ? 23.371  215.104 14.785  1.00 45.29  ? 83  ALA A N     1 
ATOM   747  C  CA    . ALA A 1 83  ? 24.076  213.887 15.162  1.00 41.44  ? 83  ALA A CA    1 
ATOM   748  C  C     . ALA A 1 83  ? 25.463  213.865 14.532  1.00 47.71  ? 83  ALA A C     1 
ATOM   749  O  O     . ALA A 1 83  ? 26.476  213.739 15.232  1.00 50.20  ? 83  ALA A O     1 
ATOM   750  C  CB    . ALA A 1 83  ? 23.292  212.680 14.743  1.00 37.04  ? 83  ALA A CB    1 
ATOM   751  N  N     . PHE A 1 84  ? 25.490  213.986 13.205  1.00 43.81  ? 84  PHE A N     1 
ATOM   752  C  CA    . PHE A 1 84  ? 26.731  214.055 12.449  1.00 41.51  ? 84  PHE A CA    1 
ATOM   753  C  C     . PHE A 1 84  ? 27.727  214.999 13.085  1.00 45.42  ? 84  PHE A C     1 
ATOM   754  O  O     . PHE A 1 84  ? 28.913  214.686 13.213  1.00 49.18  ? 84  PHE A O     1 
ATOM   755  C  CB    . PHE A 1 84  ? 26.461  214.509 11.015  1.00 45.67  ? 84  PHE A CB    1 
ATOM   756  C  CG    . PHE A 1 84  ? 26.406  213.386 10.025  1.00 44.06  ? 84  PHE A CG    1 
ATOM   757  C  CD1   . PHE A 1 84  ? 25.270  212.606 9.903   1.00 43.85  ? 84  PHE A CD1   1 
ATOM   758  C  CD2   . PHE A 1 84  ? 27.490  213.114 9.208   1.00 40.56  ? 84  PHE A CD2   1 
ATOM   759  C  CE1   . PHE A 1 84  ? 25.216  211.563 8.985   1.00 44.72  ? 84  PHE A CE1   1 
ATOM   760  C  CE2   . PHE A 1 84  ? 27.435  212.073 8.285   1.00 43.03  ? 84  PHE A CE2   1 
ATOM   761  C  CZ    . PHE A 1 84  ? 26.296  211.297 8.183   1.00 42.26  ? 84  PHE A CZ    1 
ATOM   762  N  N     . SER A 1 85  ? 27.239  216.173 13.465  1.00 40.12  ? 85  SER A N     1 
ATOM   763  C  CA    . SER A 1 85  ? 28.098  217.169 14.062  1.00 40.84  ? 85  SER A CA    1 
ATOM   764  C  C     . SER A 1 85  ? 28.577  216.718 15.453  1.00 47.40  ? 85  SER A C     1 
ATOM   765  O  O     . SER A 1 85  ? 29.778  216.809 15.769  1.00 46.34  ? 85  SER A O     1 
ATOM   766  C  CB    . SER A 1 85  ? 27.379  218.500 14.151  1.00 38.06  ? 85  SER A CB    1 
ATOM   767  O  OG    . SER A 1 85  ? 28.118  219.361 14.986  1.00 41.22  ? 85  SER A OG    1 
ATOM   768  N  N     . ASN A 1 86  ? 27.656  216.224 16.278  1.00 43.73  ? 86  ASN A N     1 
ATOM   769  C  CA    . ASN A 1 86  ? 28.063  215.728 17.596  1.00 42.95  ? 86  ASN A CA    1 
ATOM   770  C  C     . ASN A 1 86  ? 29.176  214.731 17.405  1.00 48.69  ? 86  ASN A C     1 
ATOM   771  O  O     . ASN A 1 86  ? 30.222  214.843 18.033  1.00 55.04  ? 86  ASN A O     1 
ATOM   772  C  CB    . ASN A 1 86  ? 26.909  215.085 18.374  1.00 43.12  ? 86  ASN A CB    1 
ATOM   773  C  CG    . ASN A 1 86  ? 25.829  216.096 18.773  1.00 54.98  ? 86  ASN A CG    1 
ATOM   774  O  OD1   . ASN A 1 86  ? 26.040  217.309 18.678  1.00 56.53  ? 86  ASN A OD1   1 
ATOM   775  N  ND2   . ASN A 1 86  ? 24.661  215.597 19.209  1.00 50.95  ? 86  ASN A ND2   1 
ATOM   776  N  N     . ARG A 1 87  ? 28.981  213.778 16.502  1.00 45.59  ? 87  ARG A N     1 
ATOM   777  C  CA    . ARG A 1 87  ? 30.004  212.767 16.314  1.00 47.58  ? 87  ARG A CA    1 
ATOM   778  C  C     . ARG A 1 87  ? 31.344  213.395 15.912  1.00 54.31  ? 87  ARG A C     1 
ATOM   779  O  O     . ARG A 1 87  ? 32.400  212.991 16.405  1.00 58.08  ? 87  ARG A O     1 
ATOM   780  C  CB    . ARG A 1 87  ? 29.572  211.740 15.272  1.00 48.93  ? 87  ARG A CB    1 
ATOM   781  C  CG    . ARG A 1 87  ? 28.564  210.723 15.763  1.00 45.40  ? 87  ARG A CG    1 
ATOM   782  C  CD    . ARG A 1 87  ? 28.613  209.480 14.886  1.00 44.16  ? 87  ARG A CD    1 
ATOM   783  N  NE    . ARG A 1 87  ? 28.494  209.809 13.468  1.00 58.10  ? 87  ARG A NE    1 
ATOM   784  C  CZ    . ARG A 1 87  ? 27.342  209.928 12.809  1.00 52.53  ? 87  ARG A CZ    1 
ATOM   785  N  NH1   . ARG A 1 87  ? 26.194  209.742 13.445  1.00 42.69  1 87  ARG A NH1   1 
ATOM   786  N  NH2   . ARG A 1 87  ? 27.341  210.230 11.506  1.00 51.62  ? 87  ARG A NH2   1 
ATOM   787  N  N     . ILE A 1 88  ? 31.307  214.394 15.032  1.00 54.76  ? 88  ILE A N     1 
ATOM   788  C  CA    . ILE A 1 88  ? 32.554  214.980 14.569  1.00 50.44  ? 88  ILE A CA    1 
ATOM   789  C  C     . ILE A 1 88  ? 33.198  215.811 15.695  1.00 52.72  ? 88  ILE A C     1 
ATOM   790  O  O     . ILE A 1 88  ? 34.405  215.718 15.937  1.00 59.56  ? 88  ILE A O     1 
ATOM   791  C  CB    . ILE A 1 88  ? 32.337  215.812 13.310  1.00 45.53  ? 88  ILE A CB    1 
ATOM   792  C  CG1   . ILE A 1 88  ? 31.883  214.892 12.173  1.00 46.14  ? 88  ILE A CG1   1 
ATOM   793  C  CG2   . ILE A 1 88  ? 33.626  216.526 12.912  1.00 44.01  ? 88  ILE A CG2   1 
ATOM   794  C  CD1   . ILE A 1 88  ? 31.353  215.646 10.938  1.00 39.11  ? 88  ILE A CD1   1 
ATOM   795  H  HG12  . ILE A 1 88  ? 32.636  214.350 11.889  1.00 55.37  ? 88  ILE A HG12  1 
ATOM   796  H  HG13  . ILE A 1 88  ? 31.170  214.320 12.499  1.00 55.37  ? 88  ILE A HG13  1 
ATOM   797  H  HG21  . ILE A 1 88  ? 33.900  217.110 13.637  1.00 52.81  ? 88  ILE A HG21  1 
ATOM   798  H  HG22  . ILE A 1 88  ? 34.314  215.864 12.742  1.00 52.81  ? 88  ILE A HG22  1 
ATOM   799  H  HG23  . ILE A 1 88  ? 33.463  217.048 12.110  1.00 52.81  ? 88  ILE A HG23  1 
ATOM   800  N  N     . MET A 1 89  ? 32.404  216.602 16.404  1.00 39.34  ? 89  MET A N     1 
ATOM   801  C  CA    . MET A 1 89  ? 32.956  217.352 17.518  1.00 45.35  ? 89  MET A CA    1 
ATOM   802  C  C     . MET A 1 89  ? 33.628  216.401 18.511  1.00 55.35  ? 89  MET A C     1 
ATOM   803  O  O     . MET A 1 89  ? 34.664  216.733 19.074  1.00 58.19  ? 89  MET A O     1 
ATOM   804  C  CB    . MET A 1 89  ? 31.876  218.173 18.202  1.00 44.89  ? 89  MET A CB    1 
ATOM   805  C  CG    . MET A 1 89  ? 31.151  219.078 17.240  1.00 48.86  ? 89  MET A CG    1 
ATOM   806  S  SD    . MET A 1 89  ? 32.316  220.171 16.406  1.00 46.72  ? 89  MET A SD    1 
ATOM   807  C  CE    . MET A 1 89  ? 31.187  221.169 15.414  1.00 54.11  ? 89  MET A CE    1 
ATOM   808  N  N     . ASN A 1 90  ? 33.061  215.213 18.700  1.00 58.98  ? 90  ASN A N     1 
ATOM   809  C  CA    . ASN A 1 90  ? 33.698  214.196 19.534  1.00 64.08  ? 90  ASN A CA    1 
ATOM   810  C  C     . ASN A 1 90  ? 35.067  213.795 18.995  1.00 65.04  ? 90  ASN A C     1 
ATOM   811  O  O     . ASN A 1 90  ? 35.999  213.573 19.762  1.00 71.72  ? 90  ASN A O     1 
ATOM   812  C  CB    . ASN A 1 90  ? 32.819  212.949 19.651  1.00 75.38  ? 90  ASN A CB    1 
ATOM   813  C  CG    . ASN A 1 90  ? 31.638  213.150 20.567  1.00 84.59  ? 90  ASN A CG    1 
ATOM   814  O  OD1   . ASN A 1 90  ? 31.723  213.883 21.547  1.00 85.89  ? 90  ASN A OD1   1 
ATOM   815  N  ND2   . ASN A 1 90  ? 30.523  212.491 20.254  1.00 88.68  ? 90  ASN A ND2   1 
ATOM   816  N  N     . LEU A 1 91  ? 35.198  213.692 17.675  1.00 56.17  ? 91  LEU A N     1 
ATOM   817  C  CA    . LEU A 1 91  ? 36.474  213.272 17.101  1.00 52.57  ? 91  LEU A CA    1 
ATOM   818  C  C     . LEU A 1 91  ? 37.519  214.353 17.273  1.00 52.43  ? 91  LEU A C     1 
ATOM   819  O  O     . LEU A 1 91  ? 38.702  214.064 17.496  1.00 49.78  ? 91  LEU A O     1 
ATOM   820  C  CB    . LEU A 1 91  ? 36.335  212.941 15.622  1.00 56.20  ? 91  LEU A CB    1 
ATOM   821  C  CG    . LEU A 1 91  ? 35.472  211.735 15.295  1.00 57.88  ? 91  LEU A CG    1 
ATOM   822  C  CD1   . LEU A 1 91  ? 35.297  211.615 13.796  1.00 49.00  ? 91  LEU A CD1   1 
ATOM   823  C  CD2   . LEU A 1 91  ? 36.118  210.494 15.874  1.00 51.81  ? 91  LEU A CD2   1 
ATOM   824  N  N     . LEU A 1 92  ? 37.083  215.600 17.140  1.00 44.91  ? 92  LEU A N     1 
ATOM   825  C  CA    . LEU A 1 92  ? 38.000  216.717 17.284  1.00 59.10  ? 92  LEU A CA    1 
ATOM   826  C  C     . LEU A 1 92  ? 38.489  216.773 18.734  1.00 60.74  ? 92  LEU A C     1 
ATOM   827  O  O     . LEU A 1 92  ? 39.665  217.043 19.003  1.00 62.50  ? 92  LEU A O     1 
ATOM   828  C  CB    . LEU A 1 92  ? 37.322  218.023 16.872  1.00 51.12  ? 92  LEU A CB    1 
ATOM   829  C  CG    . LEU A 1 92  ? 36.900  218.084 15.404  1.00 49.53  ? 92  LEU A CG    1 
ATOM   830  C  CD1   . LEU A 1 92  ? 36.253  219.420 15.073  1.00 48.23  ? 92  LEU A CD1   1 
ATOM   831  C  CD2   . LEU A 1 92  ? 38.110  217.855 14.533  1.00 45.90  ? 92  LEU A CD2   1 
ATOM   832  N  N     . ASN A 1 93  ? 37.567  216.491 19.647  1.00 62.78  ? 93  ASN A N     1 
ATOM   833  C  CA    . ASN A 1 93  ? 37.829  216.418 21.080  1.00 68.63  ? 93  ASN A CA    1 
ATOM   834  C  C     . ASN A 1 93  ? 39.213  215.840 21.410  1.00 70.83  ? 93  ASN A C     1 
ATOM   835  O  O     . ASN A 1 93  ? 40.046  216.515 22.010  1.00 72.23  ? 93  ASN A O     1 
ATOM   836  C  CB    . ASN A 1 93  ? 36.732  215.577 21.738  1.00 80.40  ? 93  ASN A CB    1 
ATOM   837  C  CG    . ASN A 1 93  ? 36.359  216.057 23.116  1.00 95.30  ? 93  ASN A CG    1 
ATOM   838  O  OD1   . ASN A 1 93  ? 36.671  217.180 23.509  1.00 102.08 ? 93  ASN A OD1   1 
ATOM   839  N  ND2   . ASN A 1 93  ? 35.671  215.204 23.861  1.00 101.85 ? 93  ASN A ND2   1 
ATOM   840  N  N     . LYS A 1 94  ? 39.469  214.609 20.973  1.00 71.67  ? 94  LYS A N     1 
ATOM   841  C  CA    . LYS A 1 94  ? 40.679  213.877 21.366  1.00 71.30  ? 94  LYS A CA    1 
ATOM   842  C  C     . LYS A 1 94  ? 41.960  214.533 20.850  1.00 72.91  ? 94  LYS A C     1 
ATOM   843  O  O     . LYS A 1 94  ? 43.069  214.133 21.227  1.00 67.40  ? 94  LYS A O     1 
ATOM   844  C  CB    . LYS A 1 94  ? 40.623  212.421 20.867  1.00 72.55  ? 94  LYS A CB    1 
ATOM   845  C  CG    . LYS A 1 94  ? 39.222  211.852 20.642  1.00 78.20  ? 94  LYS A CG    1 
ATOM   846  C  CD    . LYS A 1 94  ? 38.333  212.012 21.867  1.00 89.74  ? 94  LYS A CD    1 
ATOM   847  C  CE    . LYS A 1 94  ? 37.037  211.229 21.718  1.00 93.38  ? 94  LYS A CE    1 
ATOM   848  N  NZ    . LYS A 1 94  ? 37.289  209.760 21.826  1.00 96.65  1 94  LYS A NZ    1 
ATOM   849  N  N     . HIS A 1 95  ? 41.812  215.531 19.981  1.00 78.00  ? 95  HIS A N     1 
ATOM   850  C  CA    . HIS A 1 95  ? 42.968  216.193 19.378  1.00 80.93  ? 95  HIS A CA    1 
ATOM   851  C  C     . HIS A 1 95  ? 43.246  217.551 20.003  1.00 84.94  ? 95  HIS A C     1 
ATOM   852  O  O     . HIS A 1 95  ? 44.204  218.233 19.643  1.00 96.86  ? 95  HIS A O     1 
ATOM   853  C  CB    . HIS A 1 95  ? 42.757  216.344 17.873  1.00 71.49  ? 95  HIS A CB    1 
ATOM   854  C  CG    . HIS A 1 95  ? 42.644  215.039 17.157  1.00 71.76  ? 95  HIS A CG    1 
ATOM   855  N  ND1   . HIS A 1 95  ? 43.711  214.182 17.005  1.00 74.99  ? 95  HIS A ND1   1 
ATOM   856  C  CD2   . HIS A 1 95  ? 41.586  214.433 16.566  1.00 72.07  ? 95  HIS A CD2   1 
ATOM   857  C  CE1   . HIS A 1 95  ? 43.322  213.110 16.339  1.00 79.34  ? 95  HIS A CE1   1 
ATOM   858  N  NE2   . HIS A 1 95  ? 42.035  213.237 16.061  1.00 77.83  ? 95  HIS A NE2   1 
ATOM   859  N  N     . ALA A 1 96  ? 42.411  217.929 20.957  1.00 75.48  ? 96  ALA A N     1 
ATOM   860  C  CA    . ALA A 1 96  ? 42.422  219.287 21.457  1.00 71.21  ? 96  ALA A CA    1 
ATOM   861  C  C     . ALA A 1 96  ? 42.643  219.388 22.973  1.00 72.42  ? 96  ALA A C     1 
ATOM   862  O  O     . ALA A 1 96  ? 42.010  218.674 23.764  1.00 66.73  ? 96  ALA A O     1 
ATOM   863  C  CB    . ALA A 1 96  ? 41.115  219.970 21.069  1.00 66.27  ? 96  ALA A CB    1 
ATOM   864  N  N     . ASP A 1 97  ? 43.542  220.292 23.359  1.00 73.10  ? 97  ASP A N     1 
ATOM   865  C  CA    . ASP A 1 97  ? 43.657  220.732 24.745  1.00 77.26  ? 97  ASP A CA    1 
ATOM   866  C  C     . ASP A 1 97  ? 42.333  221.321 25.187  1.00 75.75  ? 97  ASP A C     1 
ATOM   867  O  O     . ASP A 1 97  ? 41.794  220.960 26.232  1.00 75.99  ? 97  ASP A O     1 
ATOM   868  C  CB    . ASP A 1 97  ? 44.761  221.773 24.902  1.00 80.48  ? 97  ASP A CB    1 
ATOM   869  C  CG    . ASP A 1 97  ? 46.106  221.251 24.486  1.00 88.48  ? 97  ASP A CG    1 
ATOM   870  O  OD1   . ASP A 1 97  ? 46.302  220.016 24.548  1.00 85.98  ? 97  ASP A OD1   1 
ATOM   871  O  OD2   . ASP A 1 97  ? 46.961  222.076 24.096  1.00 95.81  1 97  ASP A OD2   1 
ATOM   872  N  N     . LYS A 1 98  ? 41.831  222.248 24.378  1.00 72.80  ? 98  LYS A N     1 
ATOM   873  C  CA    . LYS A 1 98  ? 40.500  222.807 24.552  1.00 68.30  ? 98  LYS A CA    1 
ATOM   874  C  C     . LYS A 1 98  ? 39.794  222.879 23.203  1.00 67.22  ? 98  LYS A C     1 
ATOM   875  O  O     . LYS A 1 98  ? 40.420  223.134 22.175  1.00 63.65  ? 98  LYS A O     1 
ATOM   876  C  CB    . LYS A 1 98  ? 40.557  224.202 25.169  1.00 67.17  ? 98  LYS A CB    1 
ATOM   877  C  CG    . LYS A 1 98  ? 41.566  224.363 26.279  1.00 79.34  ? 98  LYS A CG    1 
ATOM   878  C  CD    . LYS A 1 98  ? 41.133  225.470 27.213  1.00 86.45  ? 98  LYS A CD    1 
ATOM   879  C  CE    . LYS A 1 98  ? 40.099  224.965 28.216  1.00 92.40  ? 98  LYS A CE    1 
ATOM   880  N  NZ    . LYS A 1 98  ? 40.730  224.180 29.325  1.00 97.70  1 98  LYS A NZ    1 
ATOM   881  N  N     . ILE A 1 99  ? 38.487  222.657 23.219  1.00 59.31  ? 99  ILE A N     1 
ATOM   882  C  CA    . ILE A 1 99  ? 37.687  222.811 22.031  1.00 56.55  ? 99  ILE A CA    1 
ATOM   883  C  C     . ILE A 1 99  ? 36.520  223.749 22.322  1.00 61.36  ? 99  ILE A C     1 
ATOM   884  O  O     . ILE A 1 99  ? 35.830  223.606 23.331  1.00 60.98  ? 99  ILE A O     1 
ATOM   885  C  CB    . ILE A 1 99  ? 37.160  221.448 21.505  1.00 58.36  ? 99  ILE A CB    1 
ATOM   886  C  CG1   . ILE A 1 99  ? 36.324  221.650 20.231  1.00 54.53  ? 99  ILE A CG1   1 
ATOM   887  C  CG2   . ILE A 1 99  ? 36.330  220.741 22.542  1.00 51.17  ? 99  ILE A CG2   1 
ATOM   888  C  CD1   . ILE A 1 99  ? 35.750  220.367 19.668  1.00 56.51  ? 99  ILE A CD1   1 
ATOM   889  H  HG12  . ILE A 1 99  ? 35.583  222.242 20.433  1.00 65.43  ? 99  ILE A HG12  1 
ATOM   890  H  HG13  . ILE A 1 99  ? 36.886  222.047 19.548  1.00 65.43  ? 99  ILE A HG13  1 
ATOM   891  H  HG21  . ILE A 1 99  ? 36.876  220.581 23.328  1.00 61.40  ? 99  ILE A HG21  1 
ATOM   892  H  HG22  . ILE A 1 99  ? 35.571  221.300 22.774  1.00 61.40  ? 99  ILE A HG22  1 
ATOM   893  H  HG23  . ILE A 1 99  ? 36.020  219.897 22.177  1.00 61.40  ? 99  ILE A HG23  1 
ATOM   894  N  N     . GLU A 1 100 ? 36.324  224.723 21.439  1.00 59.54  ? 100 GLU A N     1 
ATOM   895  C  CA    . GLU A 1 100 ? 35.196  225.632 21.528  1.00 51.11  ? 100 GLU A CA    1 
ATOM   896  C  C     . GLU A 1 100 ? 34.272  225.340 20.373  1.00 50.74  ? 100 GLU A C     1 
ATOM   897  O  O     . GLU A 1 100 ? 34.547  225.702 19.235  1.00 49.08  ? 100 GLU A O     1 
ATOM   898  C  CB    . GLU A 1 100 ? 35.663  227.084 21.491  1.00 52.44  ? 100 GLU A CB    1 
ATOM   899  C  CG    . GLU A 1 100 ? 34.566  228.128 21.588  1.00 51.43  ? 100 GLU A CG    1 
ATOM   900  C  CD    . GLU A 1 100 ? 35.129  229.544 21.564  1.00 59.56  ? 100 GLU A CD    1 
ATOM   901  O  OE1   . GLU A 1 100 ? 34.375  230.479 21.235  1.00 64.32  ? 100 GLU A OE1   1 
ATOM   902  O  OE2   . GLU A 1 100 ? 36.332  229.723 21.876  1.00 60.32  1 100 GLU A OE2   1 
ATOM   903  N  N     . VAL A 1 101 ? 33.188  224.642 20.652  1.00 52.10  ? 101 VAL A N     1 
ATOM   904  C  CA    . VAL A 1 101 ? 32.221  224.377 19.618  1.00 43.95  ? 101 VAL A CA    1 
ATOM   905  C  C     . VAL A 1 101 ? 31.436  225.652 19.368  1.00 45.29  ? 101 VAL A C     1 
ATOM   906  O  O     . VAL A 1 101 ? 30.652  226.080 20.210  1.00 46.07  ? 101 VAL A O     1 
ATOM   907  C  CB    . VAL A 1 101 ? 31.309  223.221 19.999  1.00 45.91  ? 101 VAL A CB    1 
ATOM   908  C  CG1   . VAL A 1 101 ? 30.230  223.029 18.950  1.00 45.10  ? 101 VAL A CG1   1 
ATOM   909  C  CG2   . VAL A 1 101 ? 32.141  221.951 20.148  1.00 44.06  ? 101 VAL A CG2   1 
ATOM   910  H  HG11  . VAL A 1 101 ? 29.662  222.288 19.214  1.00 54.13  ? 101 VAL A HG11  1 
ATOM   911  H  HG12  . VAL A 1 101 ? 29.705  223.842 18.885  1.00 54.13  ? 101 VAL A HG12  1 
ATOM   912  H  HG13  . VAL A 1 101 ? 30.650  222.837 18.097  1.00 54.13  ? 101 VAL A HG13  1 
ATOM   913  H  HG21  . VAL A 1 101 ? 31.555  221.217 20.391  1.00 52.87  ? 101 VAL A HG21  1 
ATOM   914  H  HG22  . VAL A 1 101 ? 32.579  221.760 19.304  1.00 52.87  ? 101 VAL A HG22  1 
ATOM   915  H  HG23  . VAL A 1 101 ? 32.805  222.089 20.842  1.00 52.87  ? 101 VAL A HG23  1 
ATOM   916  N  N     . ALA A 1 102 ? 31.672  226.262 18.204  1.00 47.27  ? 102 ALA A N     1 
ATOM   917  C  CA    . ALA A 1 102 ? 31.144  227.589 17.924  1.00 44.48  ? 102 ALA A CA    1 
ATOM   918  C  C     . ALA A 1 102 ? 29.754  227.527 17.350  1.00 47.68  ? 102 ALA A C     1 
ATOM   919  O  O     . ALA A 1 102 ? 28.990  228.475 17.495  1.00 47.00  ? 102 ALA A O     1 
ATOM   920  C  CB    . ALA A 1 102 ? 32.068  228.356 16.988  1.00 37.47  ? 102 ALA A CB    1 
ATOM   921  N  N     . SER A 1 103 ? 29.420  226.410 16.711  1.00 48.02  ? 103 SER A N     1 
ATOM   922  C  CA    . SER A 1 103 ? 28.129  226.277 16.047  1.00 43.40  ? 103 SER A CA    1 
ATOM   923  C  C     . SER A 1 103 ? 27.968  224.861 15.549  1.00 44.50  ? 103 SER A C     1 
ATOM   924  O  O     . SER A 1 103 ? 28.810  224.002 15.802  1.00 44.44  ? 103 SER A O     1 
ATOM   925  C  CB    . SER A 1 103 ? 28.003  227.264 14.874  1.00 45.16  ? 103 SER A CB    1 
ATOM   926  O  OG    . SER A 1 103 ? 28.662  226.760 13.717  1.00 49.25  ? 103 SER A OG    1 
ATOM   927  N  N     . ILE A 1 104 ? 26.902  224.606 14.809  1.00 42.89  ? 104 ILE A N     1 
ATOM   928  C  CA    . ILE A 1 104 ? 26.606  223.229 14.503  1.00 41.95  ? 104 ILE A CA    1 
ATOM   929  C  C     . ILE A 1 104 ? 27.679  222.675 13.559  1.00 43.15  ? 104 ILE A C     1 
ATOM   930  O  O     . ILE A 1 104 ? 27.878  221.464 13.482  1.00 44.63  ? 104 ILE A O     1 
ATOM   931  C  CB    . ILE A 1 104 ? 25.192  223.077 13.916  1.00 40.87  ? 104 ILE A CB    1 
ATOM   932  C  CG1   . ILE A 1 104 ? 24.783  221.601 13.847  1.00 34.09  ? 104 ILE A CG1   1 
ATOM   933  C  CG2   . ILE A 1 104 ? 25.057  223.790 12.555  1.00 40.65  ? 104 ILE A CG2   1 
ATOM   934  C  CD1   . ILE A 1 104 ? 23.351  221.430 13.395  1.00 32.54  ? 104 ILE A CD1   1 
ATOM   935  H  HG12  . ILE A 1 104 ? 25.356  221.141 13.214  1.00 40.90  ? 104 ILE A HG12  1 
ATOM   936  H  HG13  . ILE A 1 104 ? 24.871  221.204 14.727  1.00 40.90  ? 104 ILE A HG13  1 
ATOM   937  H  HG21  . ILE A 1 104 ? 24.154  223.668 12.224  1.00 48.79  ? 104 ILE A HG21  1 
ATOM   938  H  HG22  . ILE A 1 104 ? 25.242  224.734 12.674  1.00 48.79  ? 104 ILE A HG22  1 
ATOM   939  H  HG23  . ILE A 1 104 ? 25.693  223.403 11.933  1.00 48.79  ? 104 ILE A HG23  1 
ATOM   940  N  N     . ASP A 1 105 ? 28.428  223.547 12.896  1.00 38.58  ? 105 ASP A N     1 
ATOM   941  C  CA    . ASP A 1 105 ? 29.360  223.037 11.893  1.00 37.42  ? 105 ASP A CA    1 
ATOM   942  C  C     . ASP A 1 105 ? 30.773  223.621 11.999  1.00 38.79  ? 105 ASP A C     1 
ATOM   943  O  O     . ASP A 1 105 ? 31.580  223.518 11.079  1.00 44.81  ? 105 ASP A O     1 
ATOM   944  C  CB    . ASP A 1 105 ? 28.744  223.256 10.485  1.00 36.31  ? 105 ASP A CB    1 
ATOM   945  C  CG    . ASP A 1 105 ? 29.406  224.377 9.699   1.00 38.32  ? 105 ASP A CG    1 
ATOM   946  O  OD1   . ASP A 1 105 ? 29.638  225.483 10.214  1.00 36.78  ? 105 ASP A OD1   1 
ATOM   947  O  OD2   . ASP A 1 105 ? 29.703  224.121 8.526   1.00 41.57  1 105 ASP A OD2   1 
ATOM   948  N  N     . GLU A 1 106 ? 31.100  224.203 13.139  1.00 44.50  ? 106 GLU A N     1 
ATOM   949  C  CA    . GLU A 1 106 ? 32.451  224.700 13.302  1.00 45.37  ? 106 GLU A CA    1 
ATOM   950  C  C     . GLU A 1 106 ? 32.961  224.729 14.759  1.00 48.77  ? 106 GLU A C     1 
ATOM   951  O  O     . GLU A 1 106 ? 32.200  224.908 15.708  1.00 51.28  ? 106 GLU A O     1 
ATOM   952  C  CB    . GLU A 1 106 ? 32.542  226.097 12.680  1.00 54.31  ? 106 GLU A CB    1 
ATOM   953  C  CG    . GLU A 1 106 ? 31.543  227.097 13.220  1.00 60.34  ? 106 GLU A CG    1 
ATOM   954  C  CD    . GLU A 1 106 ? 31.509  228.375 12.406  1.00 75.71  ? 106 GLU A CD    1 
ATOM   955  O  OE1   . GLU A 1 106 ? 32.461  228.617 11.648  1.00 80.59  ? 106 GLU A OE1   1 
ATOM   956  O  OE2   . GLU A 1 106 ? 30.528  229.138 12.509  1.00 84.12  1 106 GLU A OE2   1 
ATOM   957  N  N     . ALA A 1 107 ? 34.274  224.573 14.910  1.00 40.82  ? 107 ALA A N     1 
ATOM   958  C  CA    . ALA A 1 107 ? 34.902  224.569 16.200  1.00 39.66  ? 107 ALA A CA    1 
ATOM   959  C  C     . ALA A 1 107 ? 36.332  225.084 16.117  1.00 46.25  ? 107 ALA A C     1 
ATOM   960  O  O     . ALA A 1 107 ? 36.964  225.015 15.068  1.00 48.26  ? 107 ALA A O     1 
ATOM   961  C  CB    . ALA A 1 107 ? 34.882  223.161 16.779  1.00 49.76  ? 107 ALA A CB    1 
ATOM   962  N  N     . TYR A 1 108 ? 36.828  225.607 17.237  1.00 54.86  ? 108 TYR A N     1 
ATOM   963  C  CA    . TYR A 1 108 ? 38.243  225.940 17.409  1.00 55.25  ? 108 TYR A CA    1 
ATOM   964  C  C     . TYR A 1 108 ? 38.858  224.964 18.383  1.00 59.10  ? 108 TYR A C     1 
ATOM   965  O  O     . TYR A 1 108 ? 38.250  224.592 19.386  1.00 60.01  ? 108 TYR A O     1 
ATOM   966  C  CB    . TYR A 1 108 ? 38.456  227.367 17.934  1.00 51.86  ? 108 TYR A CB    1 
ATOM   967  C  CG    . TYR A 1 108 ? 37.736  228.440 17.151  1.00 60.61  ? 108 TYR A CG    1 
ATOM   968  C  CD1   . TYR A 1 108 ? 36.358  228.558 17.227  1.00 63.72  ? 108 TYR A CD1   1 
ATOM   969  C  CD2   . TYR A 1 108 ? 38.432  229.346 16.353  1.00 62.38  ? 108 TYR A CD2   1 
ATOM   970  C  CE1   . TYR A 1 108 ? 35.681  229.520 16.525  1.00 60.67  ? 108 TYR A CE1   1 
ATOM   971  C  CE2   . TYR A 1 108 ? 37.754  230.331 15.649  1.00 63.72  ? 108 TYR A CE2   1 
ATOM   972  C  CZ    . TYR A 1 108 ? 36.373  230.402 15.746  1.00 58.99  ? 108 TYR A CZ    1 
ATOM   973  O  OH    . TYR A 1 108 ? 35.652  231.344 15.066  1.00 61.79  ? 108 TYR A OH    1 
ATOM   974  N  N     . LEU A 1 109 ? 40.078  224.561 18.073  1.00 62.49  ? 109 LEU A N     1 
ATOM   975  C  CA    . LEU A 1 109 ? 40.835  223.656 18.905  1.00 57.45  ? 109 LEU A CA    1 
ATOM   976  C  C     . LEU A 1 109 ? 42.111  224.372 19.246  1.00 62.85  ? 109 LEU A C     1 
ATOM   977  O  O     . LEU A 1 109 ? 42.791  224.885 18.347  1.00 60.33  ? 109 LEU A O     1 
ATOM   978  C  CB    . LEU A 1 109 ? 41.146  222.343 18.180  1.00 58.32  ? 109 LEU A CB    1 
ATOM   979  C  CG    . LEU A 1 109 ? 40.016  221.388 17.790  1.00 56.10  ? 109 LEU A CG    1 
ATOM   980  C  CD1   . LEU A 1 109 ? 38.993  222.054 16.902  1.00 49.05  ? 109 LEU A CD1   1 
ATOM   981  C  CD2   . LEU A 1 109 ? 40.578  220.139 17.125  1.00 55.05  ? 109 LEU A CD2   1 
ATOM   982  N  N     . ASP A 1 110 ? 42.420  224.442 20.539  1.00 63.40  ? 110 ASP A N     1 
ATOM   983  C  CA    . ASP A 1 110 ? 43.724  224.905 20.980  1.00 59.70  ? 110 ASP A CA    1 
ATOM   984  C  C     . ASP A 1 110 ? 44.587  223.654 20.997  1.00 65.28  ? 110 ASP A C     1 
ATOM   985  O  O     . ASP A 1 110 ? 44.299  222.721 21.745  1.00 79.59  ? 110 ASP A O     1 
ATOM   986  C  CB    . ASP A 1 110 ? 43.629  225.579 22.360  1.00 60.61  ? 110 ASP A CB    1 
ATOM   987  C  CG    . ASP A 1 110 ? 44.863  226.405 22.718  1.00 71.17  ? 110 ASP A CG    1 
ATOM   988  O  OD1   . ASP A 1 110 ? 46.004  225.968 22.430  1.00 70.56  ? 110 ASP A OD1   1 
ATOM   989  O  OD2   . ASP A 1 110 ? 44.682  227.502 23.304  1.00 78.06  1 110 ASP A OD2   1 
ATOM   990  N  N     . VAL A 1 111 ? 45.609  223.602 20.148  1.00 64.06  ? 111 VAL A N     1 
ATOM   991  C  CA    . VAL A 1 111 ? 46.456  222.409 20.068  1.00 66.38  ? 111 VAL A CA    1 
ATOM   992  C  C     . VAL A 1 111 ? 47.885  222.703 20.489  1.00 75.74  ? 111 VAL A C     1 
ATOM   993  O  O     . VAL A 1 111 ? 48.779  221.875 20.302  1.00 86.13  ? 111 VAL A O     1 
ATOM   994  C  CB    . VAL A 1 111 ? 46.462  221.797 18.638  1.00 75.97  ? 111 VAL A CB    1 
ATOM   995  C  CG1   . VAL A 1 111 ? 45.073  221.290 18.282  1.00 66.35  ? 111 VAL A CG1   1 
ATOM   996  C  CG2   . VAL A 1 111 ? 47.009  222.800 17.587  1.00 68.92  ? 111 VAL A CG2   1 
ATOM   997  H  HG11  . VAL A 1 111 ? 44.476  221.457 19.027  1.00 79.62  ? 111 VAL A HG11  1 
ATOM   998  H  HG12  . VAL A 1 111 ? 44.759  221.759 17.493  1.00 79.62  ? 111 VAL A HG12  1 
ATOM   999  H  HG13  . VAL A 1 111 ? 45.122  220.338 18.103  1.00 79.62  ? 111 VAL A HG13  1 
ATOM   1000 H  HG21  . VAL A 1 111 ? 47.245  223.627 18.034  1.00 82.71  ? 111 VAL A HG21  1 
ATOM   1001 H  HG22  . VAL A 1 111 ? 47.793  222.416 17.164  1.00 82.71  ? 111 VAL A HG22  1 
ATOM   1002 H  HG23  . VAL A 1 111 ? 46.322  222.966 16.923  1.00 82.71  ? 111 VAL A HG23  1 
ATOM   1003 N  N     . THR A 1 112 ? 48.086  223.890 21.049  1.00 72.50  ? 112 THR A N     1 
ATOM   1004 C  CA    . THR A 1 112 ? 49.380  224.327 21.547  1.00 83.59  ? 112 THR A CA    1 
ATOM   1005 C  C     . THR A 1 112 ? 50.150  223.238 22.304  1.00 85.88  ? 112 THR A C     1 
ATOM   1006 O  O     . THR A 1 112 ? 51.321  222.978 22.017  1.00 85.54  ? 112 THR A O     1 
ATOM   1007 C  CB    . THR A 1 112 ? 49.193  225.538 22.465  1.00 91.98  ? 112 THR A CB    1 
ATOM   1008 O  OG1   . THR A 1 112 ? 48.335  225.163 23.547  1.00 100.70 ? 112 THR A OG1   1 
ATOM   1009 C  CG2   . THR A 1 112 ? 48.520  226.655 21.735  1.00 84.21  ? 112 THR A CG2   1 
ATOM   1010 H  HG21  . THR A 1 112 ? 47.648  226.368 21.421  1.00 101.05 ? 112 THR A HG21  1 
ATOM   1011 H  HG22  . THR A 1 112 ? 48.407  227.416 22.326  1.00 101.05 ? 112 THR A HG22  1 
ATOM   1012 H  HG23  . THR A 1 112 ? 49.056  226.924 20.973  1.00 101.05 ? 112 THR A HG23  1 
ATOM   1013 N  N     . ASN A 1 113 ? 49.489  222.602 23.266  1.00 87.19  ? 113 ASN A N     1 
ATOM   1014 C  CA    . ASN A 1 113 ? 50.140  221.580 24.081  1.00 87.09  ? 113 ASN A CA    1 
ATOM   1015 C  C     . ASN A 1 113 ? 50.254  220.253 23.336  1.00 84.78  ? 113 ASN A C     1 
ATOM   1016 O  O     . ASN A 1 113 ? 51.267  219.563 23.444  1.00 82.79  ? 113 ASN A O     1 
ATOM   1017 C  CB    . ASN A 1 113 ? 49.388  221.375 25.403  1.00 84.61  ? 113 ASN A CB    1 
ATOM   1018 C  CG    . ASN A 1 113 ? 49.639  222.491 26.407  1.00 91.93  ? 113 ASN A CG    1 
ATOM   1019 O  OD1   . ASN A 1 113 ? 50.727  223.071 26.462  1.00 99.13  ? 113 ASN A OD1   1 
ATOM   1020 N  ND2   . ASN A 1 113 ? 48.631  222.786 27.219  1.00 88.78  ? 113 ASN A ND2   1 
ATOM   1021 N  N     . LYS A 1 114 ? 49.214  219.909 22.575  1.00 81.29  ? 114 LYS A N     1 
ATOM   1022 C  CA    . LYS A 1 114 ? 49.190  218.674 21.782  1.00 85.43  ? 114 LYS A CA    1 
ATOM   1023 C  C     . LYS A 1 114 ? 50.397  218.546 20.837  1.00 87.80  ? 114 LYS A C     1 
ATOM   1024 O  O     . LYS A 1 114 ? 51.050  217.500 20.790  1.00 89.17  ? 114 LYS A O     1 
ATOM   1025 C  CB    . LYS A 1 114 ? 47.890  218.590 20.972  1.00 90.29  ? 114 LYS A CB    1 
ATOM   1026 C  CG    . LYS A 1 114 ? 47.131  217.263 21.110  1.00 96.15  ? 114 LYS A CG    1 
ATOM   1027 C  CD    . LYS A 1 114 ? 46.588  217.055 22.530  1.00 98.96  ? 114 LYS A CD    1 
ATOM   1028 C  CE    . LYS A 1 114 ? 45.681  215.825 22.618  1.00 94.97  ? 114 LYS A CE    1 
ATOM   1029 N  NZ    . LYS A 1 114 ? 45.020  215.678 23.953  1.00 89.94  1 114 LYS A NZ    1 
ATOM   1030 N  N     . VAL A 1 115 ? 50.695  219.616 20.101  1.00 89.70  ? 115 VAL A N     1 
ATOM   1031 C  CA    . VAL A 1 115 ? 51.771  219.613 19.102  1.00 90.36  ? 115 VAL A CA    1 
ATOM   1032 C  C     . VAL A 1 115 ? 53.125  219.963 19.716  1.00 90.68  ? 115 VAL A C     1 
ATOM   1033 O  O     . VAL A 1 115 ? 54.062  220.356 19.012  1.00 90.29  ? 115 VAL A O     1 
ATOM   1034 C  CB    . VAL A 1 115 ? 51.473  220.602 17.950  1.00 82.44  ? 115 VAL A CB    1 
ATOM   1035 C  CG1   . VAL A 1 115 ? 50.060  220.438 17.493  1.00 82.32  ? 115 VAL A CG1   1 
ATOM   1036 C  CG2   . VAL A 1 115 ? 51.690  222.051 18.385  1.00 83.87  ? 115 VAL A CG2   1 
ATOM   1037 H  HG11  . VAL A 1 115 ? 49.887  221.063 16.772  1.00 98.78  ? 115 VAL A HG11  1 
ATOM   1038 H  HG12  . VAL A 1 115 ? 49.932  219.529 17.181  1.00 98.78  ? 115 VAL A HG12  1 
ATOM   1039 H  HG13  . VAL A 1 115 ? 49.465  220.619 18.237  1.00 98.78  ? 115 VAL A HG13  1 
ATOM   1040 H  HG21  . VAL A 1 115 ? 51.493  222.637 17.638  1.00 100.64 ? 115 VAL A HG21  1 
ATOM   1041 H  HG22  . VAL A 1 115 ? 51.097  222.249 19.127  1.00 100.64 ? 115 VAL A HG22  1 
ATOM   1042 H  HG23  . VAL A 1 115 ? 52.613  222.163 18.660  1.00 100.64 ? 115 VAL A HG23  1 
ATOM   1043 N  N     . GLU A 1 116 ? 53.214  219.816 21.033  1.00 97.44  ? 116 GLU A N     1 
ATOM   1044 C  CA    . GLU A 1 116 ? 54.420  220.170 21.778  1.00 109.01 ? 116 GLU A CA    1 
ATOM   1045 C  C     . GLU A 1 116 ? 54.921  221.567 21.405  1.00 102.93 ? 116 GLU A C     1 
ATOM   1046 O  O     . GLU A 1 116 ? 56.122  221.837 21.430  1.00 105.78 ? 116 GLU A O     1 
ATOM   1047 C  CB    . GLU A 1 116 ? 55.518  219.132 21.549  1.00 119.79 ? 116 GLU A CB    1 
ATOM   1048 C  CG    . GLU A 1 116 ? 55.230  217.778 22.177  1.00 127.60 ? 116 GLU A CG    1 
ATOM   1049 C  CD    . GLU A 1 116 ? 56.342  216.776 21.926  1.00 140.77 ? 116 GLU A CD    1 
ATOM   1050 O  OE1   . GLU A 1 116 ? 57.224  217.062 21.084  1.00 144.69 ? 116 GLU A OE1   1 
ATOM   1051 O  OE2   . GLU A 1 116 ? 56.337  215.706 22.573  1.00 145.56 1 116 GLU A OE2   1 
ATOM   1052 N  N     . GLY A 1 117 ? 53.988  222.444 21.049  1.00 91.43  ? 117 GLY A N     1 
ATOM   1053 C  CA    . GLY A 1 117 ? 54.304  223.839 20.823  1.00 91.37  ? 117 GLY A CA    1 
ATOM   1054 C  C     . GLY A 1 117 ? 54.724  224.165 19.410  1.00 99.22  ? 117 GLY A C     1 
ATOM   1055 O  O     . GLY A 1 117 ? 54.705  225.327 19.009  1.00 103.28 ? 117 GLY A O     1 
ATOM   1056 N  N     . ASN A 1 118 ? 55.096  223.146 18.643  1.00 103.51 ? 118 ASN A N     1 
ATOM   1057 C  CA    . ASN A 1 118 ? 55.620  223.384 17.302  1.00 102.20 ? 118 ASN A CA    1 
ATOM   1058 C  C     . ASN A 1 118 ? 54.543  223.630 16.254  1.00 95.71  ? 118 ASN A C     1 
ATOM   1059 O  O     . ASN A 1 118 ? 53.619  222.829 16.105  1.00 86.71  ? 118 ASN A O     1 
ATOM   1060 C  CB    . ASN A 1 118 ? 56.485  222.220 16.849  1.00 105.76 ? 118 ASN A CB    1 
ATOM   1061 C  CG    . ASN A 1 118 ? 56.893  222.356 15.414  1.00 114.00 ? 118 ASN A CG    1 
ATOM   1062 O  OD1   . ASN A 1 118 ? 56.527  221.539 14.572  1.00 116.70 ? 118 ASN A OD1   1 
ATOM   1063 N  ND2   . ASN A 1 118 ? 57.622  223.423 15.109  1.00 120.68 ? 118 ASN A ND2   1 
ATOM   1064 N  N     . PHE A 1 119 ? 54.689  224.722 15.507  1.00 96.38  ? 119 PHE A N     1 
ATOM   1065 C  CA    . PHE A 1 119 ? 53.648  225.146 14.580  1.00 91.20  ? 119 PHE A CA    1 
ATOM   1066 C  C     . PHE A 1 119 ? 53.433  224.123 13.475  1.00 93.18  ? 119 PHE A C     1 
ATOM   1067 O  O     . PHE A 1 119 ? 52.294  223.792 13.146  1.00 90.74  ? 119 PHE A O     1 
ATOM   1068 C  CB    . PHE A 1 119 ? 53.966  226.517 13.972  1.00 88.34  ? 119 PHE A CB    1 
ATOM   1069 C  CG    . PHE A 1 119 ? 52.748  227.234 13.454  1.00 92.59  ? 119 PHE A CG    1 
ATOM   1070 C  CD1   . PHE A 1 119 ? 51.899  227.901 14.324  1.00 94.16  ? 119 PHE A CD1   1 
ATOM   1071 C  CD2   . PHE A 1 119 ? 52.433  227.218 12.101  1.00 97.26  ? 119 PHE A CD2   1 
ATOM   1072 C  CE1   . PHE A 1 119 ? 50.763  228.548 13.860  1.00 93.12  ? 119 PHE A CE1   1 
ATOM   1073 C  CE2   . PHE A 1 119 ? 51.295  227.867 11.624  1.00 95.52  ? 119 PHE A CE2   1 
ATOM   1074 C  CZ    . PHE A 1 119 ? 50.459  228.530 12.506  1.00 93.01  ? 119 PHE A CZ    1 
ATOM   1075 N  N     . GLU A 1 120 ? 54.524  223.611 12.914  1.00 97.72  ? 120 GLU A N     1 
ATOM   1076 C  CA    . GLU A 1 120 ? 54.433  222.637 11.828  1.00 96.88  ? 120 GLU A CA    1 
ATOM   1077 C  C     . GLU A 1 120 ? 53.796  221.325 12.298  1.00 94.00  ? 120 GLU A C     1 
ATOM   1078 O  O     . GLU A 1 120 ? 53.051  220.683 11.542  1.00 91.46  ? 120 GLU A O     1 
ATOM   1079 C  CB    . GLU A 1 120 ? 55.816  222.372 11.224  1.00 101.67 ? 120 GLU A CB    1 
ATOM   1080 C  CG    . GLU A 1 120 ? 56.439  223.578 10.527  1.00 105.68 ? 120 GLU A CG    1 
ATOM   1081 C  CD    . GLU A 1 120 ? 55.745  223.934 9.226   1.00 107.16 ? 120 GLU A CD    1 
ATOM   1082 O  OE1   . GLU A 1 120 ? 55.421  225.125 9.026   1.00 106.13 ? 120 GLU A OE1   1 
ATOM   1083 O  OE2   . GLU A 1 120 ? 55.531  223.023 8.399   1.00 109.61 1 120 GLU A OE2   1 
ATOM   1084 N  N     . ASN A 1 121 ? 54.096  220.933 13.537  1.00 89.81  ? 121 ASN A N     1 
ATOM   1085 C  CA    . ASN A 1 121 ? 53.435  219.794 14.170  1.00 90.06  ? 121 ASN A CA    1 
ATOM   1086 C  C     . ASN A 1 121 ? 51.922  219.920 14.079  1.00 88.51  ? 121 ASN A C     1 
ATOM   1087 O  O     . ASN A 1 121 ? 51.226  218.980 13.701  1.00 90.41  ? 121 ASN A O     1 
ATOM   1088 C  CB    . ASN A 1 121 ? 53.847  219.674 15.640  1.00 97.13  ? 121 ASN A CB    1 
ATOM   1089 C  CG    . ASN A 1 121 ? 55.125  218.883 15.827  1.00 101.95 ? 121 ASN A CG    1 
ATOM   1090 O  OD1   . ASN A 1 121 ? 55.422  217.971 15.049  1.00 102.78 ? 121 ASN A OD1   1 
ATOM   1091 N  ND2   . ASN A 1 121 ? 55.889  219.222 16.868  1.00 97.68  ? 121 ASN A ND2   1 
ATOM   1092 N  N     . GLY A 1 122 ? 51.425  221.098 14.437  1.00 83.24  ? 122 GLY A N     1 
ATOM   1093 C  CA    . GLY A 1 122 ? 50.011  221.388 14.360  1.00 78.64  ? 122 GLY A CA    1 
ATOM   1094 C  C     . GLY A 1 122 ? 49.449  221.298 12.951  1.00 73.23  ? 122 GLY A C     1 
ATOM   1095 O  O     . GLY A 1 122 ? 48.310  220.848 12.758  1.00 63.70  ? 122 GLY A O     1 
ATOM   1096 N  N     . ILE A 1 123 ? 50.228  221.741 11.967  1.00 79.22  ? 123 ILE A N     1 
ATOM   1097 C  CA    . ILE A 1 123 ? 49.784  221.667 10.573  1.00 79.66  ? 123 ILE A CA    1 
ATOM   1098 C  C     . ILE A 1 123 ? 49.553  220.210 10.198  1.00 73.17  ? 123 ILE A C     1 
ATOM   1099 O  O     . ILE A 1 123 ? 48.483  219.864 9.705   1.00 67.02  ? 123 ILE A O     1 
ATOM   1100 C  CB    . ILE A 1 123 ? 50.786  222.321 9.607   1.00 85.83  ? 123 ILE A CB    1 
ATOM   1101 C  CG1   . ILE A 1 123 ? 50.708  223.840 9.736   1.00 84.97  ? 123 ILE A CG1   1 
ATOM   1102 C  CG2   . ILE A 1 123 ? 50.477  221.940 8.166   1.00 84.87  ? 123 ILE A CG2   1 
ATOM   1103 C  CD1   . ILE A 1 123 ? 51.713  224.574 8.879   1.00 85.42  ? 123 ILE A CD1   1 
ATOM   1104 H  HG12  . ILE A 1 123 ? 49.822  224.132 9.471   1.00 101.96 ? 123 ILE A HG12  1 
ATOM   1105 H  HG13  . ILE A 1 123 ? 50.871  224.085 10.661  1.00 101.96 ? 123 ILE A HG13  1 
ATOM   1106 H  HG21  . ILE A 1 123 ? 51.123  222.366 7.582   1.00 101.84 ? 123 ILE A HG21  1 
ATOM   1107 H  HG22  . ILE A 1 123 ? 50.533  220.976 8.076   1.00 101.84 ? 123 ILE A HG22  1 
ATOM   1108 H  HG23  . ILE A 1 123 ? 49.582  222.242 7.946   1.00 101.84 ? 123 ILE A HG23  1 
ATOM   1109 N  N     . GLU A 1 124 ? 50.542  219.362 10.476  1.00 70.09  ? 124 GLU A N     1 
ATOM   1110 C  CA    . GLU A 1 124 ? 50.407  217.918 10.299  1.00 75.95  ? 124 GLU A CA    1 
ATOM   1111 C  C     . GLU A 1 124 ? 49.163  217.371 11.009  1.00 70.52  ? 124 GLU A C     1 
ATOM   1112 O  O     . GLU A 1 124 ? 48.425  216.549 10.452  1.00 73.73  ? 124 GLU A O     1 
ATOM   1113 C  CB    . GLU A 1 124 ? 51.671  217.199 10.795  1.00 83.40  ? 124 GLU A CB    1 
ATOM   1114 C  CG    . GLU A 1 124 ? 51.519  215.693 10.979  1.00 98.02  ? 124 GLU A CG    1 
ATOM   1115 C  CD    . GLU A 1 124 ? 50.834  215.017 9.799   1.00 114.01 ? 124 GLU A CD    1 
ATOM   1116 O  OE1   . GLU A 1 124 ? 51.088  215.418 8.641   1.00 115.34 ? 124 GLU A OE1   1 
ATOM   1117 O  OE2   . GLU A 1 124 ? 50.022  214.093 10.035  1.00 122.12 1 124 GLU A OE2   1 
ATOM   1118 N  N     . LEU A 1 125 ? 48.919  217.844 12.225  1.00 67.85  ? 125 LEU A N     1 
ATOM   1119 C  CA    . LEU A 1 125 ? 47.740  217.435 12.980  1.00 70.42  ? 125 LEU A CA    1 
ATOM   1120 C  C     . LEU A 1 125 ? 46.451  217.836 12.259  1.00 73.06  ? 125 LEU A C     1 
ATOM   1121 O  O     . LEU A 1 125 ? 45.533  217.032 12.124  1.00 74.70  ? 125 LEU A O     1 
ATOM   1122 C  CB    . LEU A 1 125 ? 47.775  218.034 14.386  1.00 75.06  ? 125 LEU A CB    1 
ATOM   1123 C  CG    . LEU A 1 125 ? 46.514  217.871 15.234  1.00 74.53  ? 125 LEU A CG    1 
ATOM   1124 C  CD1   . LEU A 1 125 ? 46.183  216.406 15.431  1.00 73.83  ? 125 LEU A CD1   1 
ATOM   1125 C  CD2   . LEU A 1 125 ? 46.706  218.567 16.564  1.00 78.61  ? 125 LEU A CD2   1 
ATOM   1126 N  N     . ALA A 1 126 ? 46.389  219.083 11.806  1.00 71.22  ? 126 ALA A N     1 
ATOM   1127 C  CA    . ALA A 1 126 ? 45.300  219.532 10.948  1.00 68.56  ? 126 ALA A CA    1 
ATOM   1128 C  C     . ALA A 1 126 ? 45.078  218.568 9.781   1.00 65.23  ? 126 ALA A C     1 
ATOM   1129 O  O     . ALA A 1 126 ? 43.941  218.254 9.443   1.00 59.42  ? 126 ALA A O     1 
ATOM   1130 C  CB    . ALA A 1 126 ? 45.578  220.941 10.424  1.00 70.39  ? 126 ALA A CB    1 
ATOM   1131 N  N     . ARG A 1 127 ? 46.159  218.087 9.173   1.00 68.36  ? 127 ARG A N     1 
ATOM   1132 C  CA    . ARG A 1 127 ? 46.035  217.150 8.057   1.00 67.88  ? 127 ARG A CA    1 
ATOM   1133 C  C     . ARG A 1 127 ? 45.416  215.831 8.505   1.00 69.23  ? 127 ARG A C     1 
ATOM   1134 O  O     . ARG A 1 127 ? 44.455  215.343 7.890   1.00 64.18  ? 127 ARG A O     1 
ATOM   1135 C  CB    . ARG A 1 127 ? 47.393  216.887 7.408   1.00 73.19  ? 127 ARG A CB    1 
ATOM   1136 C  CG    . ARG A 1 127 ? 47.579  217.599 6.092   1.00 78.45  ? 127 ARG A CG    1 
ATOM   1137 C  CD    . ARG A 1 127 ? 48.850  217.163 5.404   1.00 90.36  ? 127 ARG A CD    1 
ATOM   1138 N  NE    . ARG A 1 127 ? 50.036  217.687 6.075   1.00 102.36 ? 127 ARG A NE    1 
ATOM   1139 C  CZ    . ARG A 1 127 ? 50.624  218.841 5.763   1.00 104.23 ? 127 ARG A CZ    1 
ATOM   1140 N  NH1   . ARG A 1 127 ? 50.131  219.597 4.784   1.00 97.96  1 127 ARG A NH1   1 
ATOM   1141 N  NH2   . ARG A 1 127 ? 51.704  219.237 6.431   1.00 106.96 ? 127 ARG A NH2   1 
ATOM   1142 N  N     . LYS A 1 128 ? 45.963  215.274 9.586   1.00 75.47  ? 128 LYS A N     1 
ATOM   1143 C  CA    . LYS A 1 128 ? 45.509  213.997 10.125  1.00 78.31  ? 128 LYS A CA    1 
ATOM   1144 C  C     . LYS A 1 128 ? 44.025  214.076 10.485  1.00 75.62  ? 128 LYS A C     1 
ATOM   1145 O  O     . LYS A 1 128 ? 43.263  213.129 10.285  1.00 82.85  ? 128 LYS A O     1 
ATOM   1146 C  CB    . LYS A 1 128 ? 46.353  213.615 11.339  1.00 87.74  ? 128 LYS A CB    1 
ATOM   1147 C  CG    . LYS A 1 128 ? 46.340  212.131 11.699  1.00 101.65 ? 128 LYS A CG    1 
ATOM   1148 C  CD    . LYS A 1 128 ? 45.083  211.747 12.471  1.00 106.31 ? 128 LYS A CD    1 
ATOM   1149 C  CE    . LYS A 1 128 ? 45.289  210.457 13.257  1.00 112.68 ? 128 LYS A CE    1 
ATOM   1150 N  NZ    . LYS A 1 128 ? 44.141  210.185 14.168  1.00 112.60 1 128 LYS A NZ    1 
ATOM   1151 N  N     . ILE A 1 129 ? 43.625  215.235 10.989  1.00 61.83  ? 129 ILE A N     1 
ATOM   1152 C  CA    . ILE A 1 129 ? 42.237  215.507 11.341  1.00 60.83  ? 129 ILE A CA    1 
ATOM   1153 C  C     . ILE A 1 129 ? 41.298  215.487 10.135  1.00 59.53  ? 129 ILE A C     1 
ATOM   1154 O  O     . ILE A 1 129 ? 40.209  214.907 10.204  1.00 60.01  ? 129 ILE A O     1 
ATOM   1155 C  CB    . ILE A 1 129 ? 42.118  216.884 12.062  1.00 65.05  ? 129 ILE A CB    1 
ATOM   1156 C  CG1   . ILE A 1 129 ? 42.588  216.755 13.514  1.00 67.40  ? 129 ILE A CG1   1 
ATOM   1157 C  CG2   . ILE A 1 129 ? 40.687  217.459 11.986  1.00 51.11  ? 129 ILE A CG2   1 
ATOM   1158 C  CD1   . ILE A 1 129 ? 42.578  218.059 14.289  1.00 73.32  ? 129 ILE A CD1   1 
ATOM   1159 H  HG12  . ILE A 1 129 ? 42.004  216.132 13.976  1.00 80.89  ? 129 ILE A HG12  1 
ATOM   1160 H  HG13  . ILE A 1 129 ? 43.497  216.416 13.518  1.00 80.89  ? 129 ILE A HG13  1 
ATOM   1161 H  HG21  . ILE A 1 129 ? 40.665  218.312 12.447  1.00 61.34  ? 129 ILE A HG21  1 
ATOM   1162 H  HG22  . ILE A 1 129 ? 40.445  217.579 11.055  1.00 61.34  ? 129 ILE A HG22  1 
ATOM   1163 H  HG23  . ILE A 1 129 ? 40.075  216.837 12.410  1.00 61.34  ? 129 ILE A HG23  1 
ATOM   1164 N  N     . LYS A 1 130 ? 41.701  216.137 9.044   1.00 58.93  ? 130 LYS A N     1 
ATOM   1165 C  CA    . LYS A 1 130 ? 40.863  216.171 7.855   1.00 53.71  ? 130 LYS A CA    1 
ATOM   1166 C  C     . LYS A 1 130 ? 40.698  214.743 7.365   1.00 52.50  ? 130 LYS A C     1 
ATOM   1167 O  O     . LYS A 1 130 ? 39.602  214.335 6.980   1.00 54.14  ? 130 LYS A O     1 
ATOM   1168 C  CB    . LYS A 1 130 ? 41.460  217.061 6.758   1.00 62.36  ? 130 LYS A CB    1 
ATOM   1169 C  CG    . LYS A 1 130 ? 41.148  218.552 6.890   1.00 64.73  ? 130 LYS A CG    1 
ATOM   1170 C  CD    . LYS A 1 130 ? 41.947  219.388 5.878   1.00 63.41  ? 130 LYS A CD    1 
ATOM   1171 C  CE    . LYS A 1 130 ? 41.510  219.130 4.442   1.00 56.15  ? 130 LYS A CE    1 
ATOM   1172 N  NZ    . LYS A 1 130 ? 40.150  219.667 4.186   1.00 49.84  1 130 LYS A NZ    1 
ATOM   1173 N  N     . GLN A 1 131 ? 41.779  213.971 7.423   1.00 51.29  ? 131 GLN A N     1 
ATOM   1174 C  CA    . GLN A 1 131 ? 41.729  212.578 6.974   1.00 60.79  ? 131 GLN A CA    1 
ATOM   1175 C  C     . GLN A 1 131 ? 40.810  211.734 7.858   1.00 62.73  ? 131 GLN A C     1 
ATOM   1176 O  O     . GLN A 1 131 ? 40.032  210.925 7.352   1.00 66.92  ? 131 GLN A O     1 
ATOM   1177 C  CB    . GLN A 1 131 ? 43.133  211.956 6.940   1.00 64.69  ? 131 GLN A CB    1 
ATOM   1178 C  CG    . GLN A 1 131 ? 44.105  212.631 5.986   1.00 81.46  ? 131 GLN A CG    1 
ATOM   1179 C  CD    . GLN A 1 131 ? 45.531  212.107 6.133   1.00 101.40 ? 131 GLN A CD    1 
ATOM   1180 O  OE1   . GLN A 1 131 ? 45.922  211.610 7.194   1.00 114.68 ? 131 GLN A OE1   1 
ATOM   1181 N  NE2   . GLN A 1 131 ? 46.314  212.220 5.064   1.00 102.16 ? 131 GLN A NE2   1 
ATOM   1182 N  N     . GLU A 1 132 ? 40.887  211.930 9.173   1.00 51.02  ? 132 GLU A N     1 
ATOM   1183 C  CA    . GLU A 1 132 ? 40.079  211.139 10.085  1.00 55.00  ? 132 GLU A CA    1 
ATOM   1184 C  C     . GLU A 1 132 ? 38.597  211.387 9.839   1.00 50.84  ? 132 GLU A C     1 
ATOM   1185 O  O     . GLU A 1 132 ? 37.798  210.457 9.809   1.00 58.67  ? 132 GLU A O     1 
ATOM   1186 C  CB    . GLU A 1 132 ? 40.440  211.449 11.547  1.00 63.74  ? 132 GLU A CB    1 
ATOM   1187 C  CG    . GLU A 1 132 ? 39.884  210.435 12.535  1.00 72.65  ? 132 GLU A CG    1 
ATOM   1188 C  CD    . GLU A 1 132 ? 40.104  210.828 13.977  1.00 85.02  ? 132 GLU A CD    1 
ATOM   1189 O  OE1   . GLU A 1 132 ? 39.456  210.234 14.865  1.00 88.73  ? 132 GLU A OE1   1 
ATOM   1190 O  OE2   . GLU A 1 132 ? 40.930  211.729 14.223  1.00 89.30  1 132 GLU A OE2   1 
ATOM   1191 N  N     . ILE A 1 133 ? 38.227  212.643 9.645   1.00 45.10  ? 133 ILE A N     1 
ATOM   1192 C  CA    . ILE A 1 133 ? 36.823  212.986 9.480   1.00 46.65  ? 133 ILE A CA    1 
ATOM   1193 C  C     . ILE A 1 133 ? 36.308  212.439 8.132   1.00 59.52  ? 133 ILE A C     1 
ATOM   1194 O  O     . ILE A 1 133 ? 35.169  211.975 8.036   1.00 59.26  ? 133 ILE A O     1 
ATOM   1195 C  CB    . ILE A 1 133 ? 36.621  214.519 9.589   1.00 51.20  ? 133 ILE A CB    1 
ATOM   1196 C  CG1   . ILE A 1 133 ? 37.068  215.005 10.975  1.00 59.08  ? 133 ILE A CG1   1 
ATOM   1197 C  CG2   . ILE A 1 133 ? 35.166  214.924 9.320   1.00 45.79  ? 133 ILE A CG2   1 
ATOM   1198 C  CD1   . ILE A 1 133 ? 36.883  216.499 11.220  1.00 54.81  ? 133 ILE A CD1   1 
ATOM   1199 H  HG12  . ILE A 1 133 ? 36.556  214.532 11.649  1.00 70.90  ? 133 ILE A HG12  1 
ATOM   1200 H  HG13  . ILE A 1 133 ? 38.011  214.805 11.084  1.00 70.90  ? 133 ILE A HG13  1 
ATOM   1201 H  HG21  . ILE A 1 133 ? 35.087  215.887 9.398   1.00 54.94  ? 133 ILE A HG21  1 
ATOM   1202 H  HG22  . ILE A 1 133 ? 34.921  214.644 8.424   1.00 54.94  ? 133 ILE A HG22  1 
ATOM   1203 H  HG23  . ILE A 1 133 ? 34.592  214.490 9.971   1.00 54.94  ? 133 ILE A HG23  1 
ATOM   1204 N  N     . LEU A 1 134 ? 37.158  212.471 7.105   1.00 59.39  ? 134 LEU A N     1 
ATOM   1205 C  CA    . LEU A 1 134 ? 36.790  211.944 5.790   1.00 60.68  ? 134 LEU A CA    1 
ATOM   1206 C  C     . LEU A 1 134 ? 36.649  210.421 5.846   1.00 62.04  ? 134 LEU A C     1 
ATOM   1207 O  O     . LEU A 1 134 ? 35.698  209.853 5.310   1.00 57.95  ? 134 LEU A O     1 
ATOM   1208 C  CB    . LEU A 1 134 ? 37.828  212.343 4.720   1.00 56.70  ? 134 LEU A CB    1 
ATOM   1209 C  CG    . LEU A 1 134 ? 37.570  211.884 3.273   1.00 51.93  ? 134 LEU A CG    1 
ATOM   1210 C  CD1   . LEU A 1 134 ? 36.539  212.763 2.608   1.00 43.66  ? 134 LEU A CD1   1 
ATOM   1211 C  CD2   . LEU A 1 134 ? 38.852  211.840 2.448   1.00 50.89  ? 134 LEU A CD2   1 
ATOM   1212 N  N     . GLU A 1 135 ? 37.599  209.771 6.508   1.00 66.63  ? 135 GLU A N     1 
ATOM   1213 C  CA    . GLU A 1 135 ? 37.600  208.317 6.648   1.00 66.77  ? 135 GLU A CA    1 
ATOM   1214 C  C     . GLU A 1 135 ? 36.431  207.815 7.483   1.00 62.95  ? 135 GLU A C     1 
ATOM   1215 O  O     . GLU A 1 135 ? 35.703  206.913 7.080   1.00 68.51  ? 135 GLU A O     1 
ATOM   1216 C  CB    . GLU A 1 135 ? 38.911  207.850 7.281   1.00 73.50  ? 135 GLU A CB    1 
ATOM   1217 C  CG    . GLU A 1 135 ? 39.096  206.347 7.327   1.00 88.57  ? 135 GLU A CG    1 
ATOM   1218 C  CD    . GLU A 1 135 ? 39.768  205.820 6.081   1.00 109.07 ? 135 GLU A CD    1 
ATOM   1219 O  OE1   . GLU A 1 135 ? 39.997  206.622 5.146   1.00 111.00 ? 135 GLU A OE1   1 
ATOM   1220 O  OE2   . GLU A 1 135 ? 40.073  204.607 6.036   1.00 123.27 1 135 GLU A OE2   1 
ATOM   1221 N  N     . LYS A 1 136 ? 36.263  208.400 8.662   1.00 58.67  ? 136 LYS A N     1 
ATOM   1222 C  CA    . LYS A 1 136 ? 35.258  207.938 9.612   1.00 54.41  ? 136 LYS A CA    1 
ATOM   1223 C  C     . LYS A 1 136 ? 33.824  208.323 9.221   1.00 57.95  ? 136 LYS A C     1 
ATOM   1224 O  O     . LYS A 1 136 ? 32.906  207.509 9.300   1.00 65.00  ? 136 LYS A O     1 
ATOM   1225 C  CB    . LYS A 1 136 ? 35.580  208.484 11.007  1.00 51.62  ? 136 LYS A CB    1 
ATOM   1226 C  CG    . LYS A 1 136 ? 36.789  207.806 11.654  1.00 66.29  ? 136 LYS A CG    1 
ATOM   1227 C  CD    . LYS A 1 136 ? 36.663  207.776 13.168  1.00 69.16  ? 136 LYS A CD    1 
ATOM   1228 C  CE    . LYS A 1 136 ? 37.887  207.169 13.820  1.00 71.70  ? 136 LYS A CE    1 
ATOM   1229 N  NZ    . LYS A 1 136 ? 37.747  207.272 15.299  1.00 78.62  1 136 LYS A NZ    1 
ATOM   1230 N  N     . GLU A 1 137 ? 33.645  209.563 8.787   1.00 47.42  ? 137 GLU A N     1 
ATOM   1231 C  CA    . GLU A 1 137 ? 32.322  210.113 8.558   1.00 47.56  ? 137 GLU A CA    1 
ATOM   1232 C  C     . GLU A 1 137 ? 32.044  210.468 7.080   1.00 48.76  ? 137 GLU A C     1 
ATOM   1233 O  O     . GLU A 1 137 ? 30.947  210.943 6.736   1.00 52.65  ? 137 GLU A O     1 
ATOM   1234 C  CB    . GLU A 1 137 ? 32.141  211.365 9.429   1.00 46.12  ? 137 GLU A CB    1 
ATOM   1235 C  CG    . GLU A 1 137 ? 31.997  211.059 10.898  1.00 50.71  ? 137 GLU A CG    1 
ATOM   1236 C  CD    . GLU A 1 137 ? 30.726  210.301 11.169  1.00 60.52  ? 137 GLU A CD    1 
ATOM   1237 O  OE1   . GLU A 1 137 ? 29.876  210.216 10.251  1.00 54.93  ? 137 GLU A OE1   1 
ATOM   1238 O  OE2   . GLU A 1 137 ? 30.576  209.785 12.295  1.00 74.21  1 137 GLU A OE2   1 
ATOM   1239 N  N     . LYS A 1 138 ? 33.034  210.270 6.216   1.00 45.93  ? 138 LYS A N     1 
ATOM   1240 C  CA    . LYS A 1 138 ? 32.871  210.627 4.808   1.00 58.27  ? 138 LYS A CA    1 
ATOM   1241 C  C     . LYS A 1 138 ? 32.467  212.106 4.631   1.00 60.23  ? 138 LYS A C     1 
ATOM   1242 O  O     . LYS A 1 138 ? 31.827  212.462 3.649   1.00 60.29  ? 138 LYS A O     1 
ATOM   1243 C  CB    . LYS A 1 138 ? 31.828  209.711 4.145   1.00 52.72  ? 138 LYS A CB    1 
ATOM   1244 C  CG    . LYS A 1 138 ? 32.360  208.375 3.622   1.00 58.30  ? 138 LYS A CG    1 
ATOM   1245 C  CD    . LYS A 1 138 ? 33.048  207.552 4.684   1.00 72.78  ? 138 LYS A CD    1 
ATOM   1246 C  CE    . LYS A 1 138 ? 33.762  206.338 4.073   1.00 83.01  ? 138 LYS A CE    1 
ATOM   1247 N  NZ    . LYS A 1 138 ? 35.010  206.704 3.330   1.00 86.50  1 138 LYS A NZ    1 
ATOM   1248 N  N     . ILE A 1 139 ? 32.834  212.954 5.592   1.00 58.61  ? 139 ILE A N     1 
ATOM   1249 C  CA    . ILE A 1 139 ? 32.566  214.393 5.510   1.00 47.91  ? 139 ILE A CA    1 
ATOM   1250 C  C     . ILE A 1 139 ? 33.846  215.154 5.210   1.00 51.29  ? 139 ILE A C     1 
ATOM   1251 O  O     . ILE A 1 139 ? 34.877  214.917 5.846   1.00 56.74  ? 139 ILE A O     1 
ATOM   1252 C  CB    . ILE A 1 139 ? 31.966  214.945 6.822   1.00 41.73  ? 139 ILE A CB    1 
ATOM   1253 C  CG1   . ILE A 1 139 ? 30.586  214.350 7.074   1.00 44.58  ? 139 ILE A CG1   1 
ATOM   1254 C  CG2   . ILE A 1 139 ? 31.866  216.463 6.776   1.00 44.17  ? 139 ILE A CG2   1 
ATOM   1255 C  CD1   . ILE A 1 139 ? 29.540  214.814 6.083   1.00 43.37  ? 139 ILE A CD1   1 
ATOM   1256 H  HG12  . ILE A 1 139 ? 30.645  213.384 7.013   1.00 53.49  ? 139 ILE A HG12  1 
ATOM   1257 H  HG13  . ILE A 1 139 ? 30.291  214.607 7.961   1.00 53.49  ? 139 ILE A HG13  1 
ATOM   1258 H  HG21  . ILE A 1 139 ? 31.487  216.779 7.611   1.00 53.01  ? 139 ILE A HG21  1 
ATOM   1259 H  HG22  . ILE A 1 139 ? 32.754  216.833 6.655   1.00 53.01  ? 139 ILE A HG22  1 
ATOM   1260 H  HG23  . ILE A 1 139 ? 31.296  216.719 6.035   1.00 53.01  ? 139 ILE A HG23  1 
ATOM   1261 N  N     . THR A 1 140 ? 33.796  216.077 4.252   1.00 48.47  ? 140 THR A N     1 
ATOM   1262 C  CA    . THR A 1 140 ? 34.976  216.898 4.001   1.00 46.87  ? 140 THR A CA    1 
ATOM   1263 C  C     . THR A 1 140 ? 34.824  218.222 4.711   1.00 46.29  ? 140 THR A C     1 
ATOM   1264 O  O     . THR A 1 140 ? 33.712  218.751 4.846   1.00 47.40  ? 140 THR A O     1 
ATOM   1265 C  CB    . THR A 1 140 ? 35.229  217.178 2.512   1.00 44.93  ? 140 THR A CB    1 
ATOM   1266 O  OG1   . THR A 1 140 ? 34.308  218.170 2.072   1.00 47.03  ? 140 THR A OG1   1 
ATOM   1267 C  CG2   . THR A 1 140 ? 35.060  215.939 1.688   1.00 43.70  ? 140 THR A CG2   1 
ATOM   1268 H  HG21  . THR A 1 140 ? 34.157  215.598 1.785   1.00 52.43  ? 140 THR A HG21  1 
ATOM   1269 H  HG22  . THR A 1 140 ? 35.224  216.138 0.753   1.00 52.43  ? 140 THR A HG22  1 
ATOM   1270 H  HG23  . THR A 1 140 ? 35.687  215.259 1.981   1.00 52.43  ? 140 THR A HG23  1 
ATOM   1271 N  N     . VAL A 1 141 ? 35.953  218.765 5.141   1.00 42.69  ? 141 VAL A N     1 
ATOM   1272 C  CA    . VAL A 1 141 ? 35.947  219.987 5.915   1.00 38.68  ? 141 VAL A CA    1 
ATOM   1273 C  C     . VAL A 1 141 ? 37.074  220.914 5.498   1.00 43.26  ? 141 VAL A C     1 
ATOM   1274 O  O     . VAL A 1 141 ? 38.023  220.490 4.826   1.00 44.35  ? 141 VAL A O     1 
ATOM   1275 C  CB    . VAL A 1 141 ? 36.079  219.690 7.397   1.00 41.35  ? 141 VAL A CB    1 
ATOM   1276 C  CG1   . VAL A 1 141 ? 34.883  218.892 7.892   1.00 44.30  ? 141 VAL A CG1   1 
ATOM   1277 C  CG2   . VAL A 1 141 ? 37.400  218.948 7.669   1.00 44.27  ? 141 VAL A CG2   1 
ATOM   1278 H  HG11  . VAL A 1 141 ? 34.992  218.716 8.840   1.00 53.15  ? 141 VAL A HG11  1 
ATOM   1279 H  HG12  . VAL A 1 141 ? 34.076  219.409 7.742   1.00 53.15  ? 141 VAL A HG12  1 
ATOM   1280 H  HG13  . VAL A 1 141 ? 34.837  218.056 7.403   1.00 53.15  ? 141 VAL A HG13  1 
ATOM   1281 H  HG21  . VAL A 1 141 ? 37.470  218.765 8.619   1.00 53.12  ? 141 VAL A HG21  1 
ATOM   1282 H  HG22  . VAL A 1 141 ? 37.403  218.115 7.171   1.00 53.12  ? 141 VAL A HG22  1 
ATOM   1283 H  HG23  . VAL A 1 141 ? 38.140  219.507 7.384   1.00 53.12  ? 141 VAL A HG23  1 
ATOM   1284 N  N     . THR A 1 142 ? 36.952  222.175 5.908   1.00 43.16  ? 142 THR A N     1 
ATOM   1285 C  CA    . THR A 1 142 ? 37.992  223.163 5.728   1.00 45.13  ? 142 THR A CA    1 
ATOM   1286 C  C     . THR A 1 142 ? 38.578  223.502 7.099   1.00 50.78  ? 142 THR A C     1 
ATOM   1287 O  O     . THR A 1 142 ? 37.836  223.608 8.078   1.00 53.45  ? 142 THR A O     1 
ATOM   1288 C  CB    . THR A 1 142 ? 37.449  224.421 5.054   1.00 49.10  ? 142 THR A CB    1 
ATOM   1289 O  OG1   . THR A 1 142 ? 36.884  224.076 3.779   1.00 56.23  ? 142 THR A OG1   1 
ATOM   1290 C  CG2   . THR A 1 142 ? 38.562  225.432 4.857   1.00 50.53  ? 142 THR A CG2   1 
ATOM   1291 H  HG21  . THR A 1 142 ? 38.214  226.229 4.429   1.00 60.63  ? 142 THR A HG21  1 
ATOM   1292 H  HG22  . THR A 1 142 ? 38.944  225.676 5.715   1.00 60.63  ? 142 THR A HG22  1 
ATOM   1293 H  HG23  . THR A 1 142 ? 39.259  225.053 4.299   1.00 60.63  ? 142 THR A HG23  1 
ATOM   1294 N  N     . VAL A 1 143 ? 39.903  223.653 7.168   1.00 52.77  ? 143 VAL A N     1 
ATOM   1295 C  CA    . VAL A 1 143 ? 40.577  224.000 8.412   1.00 54.03  ? 143 VAL A CA    1 
ATOM   1296 C  C     . VAL A 1 143 ? 41.462  225.232 8.270   1.00 62.00  ? 143 VAL A C     1 
ATOM   1297 O  O     . VAL A 1 143 ? 41.945  225.553 7.178   1.00 60.78  ? 143 VAL A O     1 
ATOM   1298 C  CB    . VAL A 1 143 ? 41.460  222.843 8.936   1.00 57.31  ? 143 VAL A CB    1 
ATOM   1299 C  CG1   . VAL A 1 143 ? 40.631  221.593 9.134   1.00 53.76  ? 143 VAL A CG1   1 
ATOM   1300 C  CG2   . VAL A 1 143 ? 42.640  222.593 7.999   1.00 67.63  ? 143 VAL A CG2   1 
ATOM   1301 H  HG11  . VAL A 1 143 ? 39.712  221.782 8.889   1.00 64.51  ? 143 VAL A HG11  1 
ATOM   1302 H  HG12  . VAL A 1 143 ? 40.986  220.887 8.572   1.00 64.51  ? 143 VAL A HG12  1 
ATOM   1303 H  HG13  . VAL A 1 143 ? 40.678  221.328 10.067  1.00 64.51  ? 143 VAL A HG13  1 
ATOM   1304 H  HG21  . VAL A 1 143 ? 42.593  223.218 7.258   1.00 81.15  ? 143 VAL A HG21  1 
ATOM   1305 H  HG22  . VAL A 1 143 ? 43.466  222.723 8.490   1.00 81.15  ? 143 VAL A HG22  1 
ATOM   1306 H  HG23  . VAL A 1 143 ? 42.592  221.682 7.667   1.00 81.15  ? 143 VAL A HG23  1 
ATOM   1307 N  N     . GLY A 1 144 ? 41.697  225.902 9.394   1.00 63.25  ? 144 GLY A N     1 
ATOM   1308 C  CA    . GLY A 1 144 ? 42.632  227.009 9.441   1.00 58.89  ? 144 GLY A CA    1 
ATOM   1309 C  C     . GLY A 1 144 ? 43.577  226.776 10.593  1.00 63.42  ? 144 GLY A C     1 
ATOM   1310 O  O     . GLY A 1 144 ? 43.174  226.234 11.627  1.00 65.71  ? 144 GLY A O     1 
ATOM   1311 N  N     . VAL A 1 145 ? 44.833  227.165 10.418  1.00 60.82  ? 145 VAL A N     1 
ATOM   1312 C  CA    . VAL A 1 145 ? 45.841  226.938 11.436  1.00 64.28  ? 145 VAL A CA    1 
ATOM   1313 C  C     . VAL A 1 145 ? 46.676  228.199 11.634  1.00 79.45  ? 145 VAL A C     1 
ATOM   1314 O  O     . VAL A 1 145 ? 47.548  228.521 10.825  1.00 92.23  ? 145 VAL A O     1 
ATOM   1315 C  CB    . VAL A 1 145 ? 46.749  225.746 11.080  1.00 65.99  ? 145 VAL A CB    1 
ATOM   1316 C  CG1   . VAL A 1 145 ? 47.573  225.334 12.277  1.00 61.06  ? 145 VAL A CG1   1 
ATOM   1317 C  CG2   . VAL A 1 145 ? 45.910  224.564 10.603  1.00 67.69  ? 145 VAL A CG2   1 
ATOM   1318 H  HG11  . VAL A 1 145 ? 48.135  224.584 12.029  1.00 73.27  ? 145 VAL A HG11  1 
ATOM   1319 H  HG12  . VAL A 1 145 ? 48.122  226.083 12.555  1.00 73.27  ? 145 VAL A HG12  1 
ATOM   1320 H  HG13  . VAL A 1 145 ? 46.975  225.076 12.997  1.00 73.27  ? 145 VAL A HG13  1 
ATOM   1321 H  HG21  . VAL A 1 145 ? 46.500  223.826 10.384  1.00 81.23  ? 145 VAL A HG21  1 
ATOM   1322 H  HG22  . VAL A 1 145 ? 45.301  224.303 11.312  1.00 81.23  ? 145 VAL A HG22  1 
ATOM   1323 H  HG23  . VAL A 1 145 ? 45.408  224.831 9.817   1.00 81.23  ? 145 VAL A HG23  1 
ATOM   1324 N  N     . ALA A 1 146 ? 46.390  228.910 12.720  1.00 70.95  ? 146 ALA A N     1 
ATOM   1325 C  CA    . ALA A 1 146 ? 47.014  230.190 12.993  1.00 74.90  ? 146 ALA A CA    1 
ATOM   1326 C  C     . ALA A 1 146 ? 47.223  230.362 14.508  1.00 75.82  ? 146 ALA A C     1 
ATOM   1327 O  O     . ALA A 1 146 ? 46.689  229.577 15.298  1.00 68.37  ? 146 ALA A O     1 
ATOM   1328 C  CB    . ALA A 1 146 ? 46.159  231.318 12.421  1.00 62.60  ? 146 ALA A CB    1 
ATOM   1329 N  N     . PRO A 1 147 ? 48.004  231.383 14.912  1.00 76.33  ? 147 PRO A N     1 
ATOM   1330 C  CA    . PRO A 1 147 ? 48.318  231.628 16.324  1.00 80.29  ? 147 PRO A CA    1 
ATOM   1331 C  C     . PRO A 1 147 ? 47.099  231.988 17.182  1.00 81.12  ? 147 PRO A C     1 
ATOM   1332 O  O     . PRO A 1 147 ? 47.147  231.777 18.390  1.00 77.10  ? 147 PRO A O     1 
ATOM   1333 C  CB    . PRO A 1 147 ? 49.303  232.797 16.256  1.00 80.76  ? 147 PRO A CB    1 
ATOM   1334 C  CG    . PRO A 1 147 ? 49.909  232.703 14.876  1.00 74.66  ? 147 PRO A CG    1 
ATOM   1335 C  CD    . PRO A 1 147 ? 48.761  232.286 14.027  1.00 75.26  ? 147 PRO A CD    1 
ATOM   1336 N  N     . ASN A 1 148 ? 46.029  232.508 16.581  1.00 81.15  ? 148 ASN A N     1 
ATOM   1337 C  CA    . ASN A 1 148 ? 44.812  232.779 17.346  1.00 76.85  ? 148 ASN A CA    1 
ATOM   1338 C  C     . ASN A 1 148 ? 43.543  232.339 16.631  1.00 78.83  ? 148 ASN A C     1 
ATOM   1339 O  O     . ASN A 1 148 ? 43.585  231.795 15.528  1.00 81.62  ? 148 ASN A O     1 
ATOM   1340 C  CB    . ASN A 1 148 ? 44.706  234.265 17.699  1.00 73.54  ? 148 ASN A CB    1 
ATOM   1341 C  CG    . ASN A 1 148 ? 44.602  235.154 16.475  1.00 79.21  ? 148 ASN A CG    1 
ATOM   1342 O  OD1   . ASN A 1 148 ? 43.905  234.833 15.513  1.00 80.76  ? 148 ASN A OD1   1 
ATOM   1343 N  ND2   . ASN A 1 148 ? 45.305  236.280 16.504  1.00 81.73  ? 148 ASN A ND2   1 
ATOM   1344 N  N     . LYS A 1 149 ? 42.412  232.599 17.277  1.00 76.68  ? 149 LYS A N     1 
ATOM   1345 C  CA    . LYS A 1 149 ? 41.122  232.118 16.811  1.00 69.40  ? 149 LYS A CA    1 
ATOM   1346 C  C     . LYS A 1 149 ? 40.636  232.869 15.593  1.00 69.65  ? 149 LYS A C     1 
ATOM   1347 O  O     . LYS A 1 149 ? 40.168  232.271 14.622  1.00 66.59  ? 149 LYS A O     1 
ATOM   1348 C  CB    . LYS A 1 149 ? 40.081  232.227 17.923  1.00 69.96  ? 149 LYS A CB    1 
ATOM   1349 C  CG    . LYS A 1 149 ? 39.858  230.932 18.675  1.00 72.83  ? 149 LYS A CG    1 
ATOM   1350 C  CD    . LYS A 1 149 ? 39.280  231.181 20.057  1.00 75.46  ? 149 LYS A CD    1 
ATOM   1351 C  CE    . LYS A 1 149 ? 37.917  231.838 19.993  1.00 71.38  ? 149 LYS A CE    1 
ATOM   1352 N  NZ    . LYS A 1 149 ? 37.538  232.328 21.345  1.00 71.46  1 149 LYS A NZ    1 
ATOM   1353 N  N     . ILE A 1 150 ? 40.726  234.189 15.655  1.00 72.51  ? 150 ILE A N     1 
ATOM   1354 C  CA    . ILE A 1 150 ? 40.178  235.004 14.591  1.00 73.64  ? 150 ILE A CA    1 
ATOM   1355 C  C     . ILE A 1 150 ? 40.924  234.727 13.282  1.00 71.30  ? 150 ILE A C     1 
ATOM   1356 O  O     . ILE A 1 150 ? 40.308  234.604 12.226  1.00 64.02  ? 150 ILE A O     1 
ATOM   1357 C  CB    . ILE A 1 150 ? 40.240  236.492 14.948  1.00 80.38  ? 150 ILE A CB    1 
ATOM   1358 C  CG1   . ILE A 1 150 ? 39.571  237.323 13.862  1.00 88.24  ? 150 ILE A CG1   1 
ATOM   1359 C  CG2   . ILE A 1 150 ? 41.674  236.943 15.142  1.00 90.93  ? 150 ILE A CG2   1 
ATOM   1360 C  CD1   . ILE A 1 150 ? 39.605  238.801 14.149  1.00 98.31  ? 150 ILE A CD1   1 
ATOM   1361 H  HG12  . ILE A 1 150 ? 40.029  237.170 13.021  1.00 105.88 ? 150 ILE A HG12  1 
ATOM   1362 H  HG13  . ILE A 1 150 ? 38.642  237.054 13.786  1.00 105.88 ? 150 ILE A HG13  1 
ATOM   1363 H  HG21  . ILE A 1 150 ? 42.072  236.428 15.862  1.00 109.11 ? 150 ILE A HG21  1 
ATOM   1364 H  HG22  . ILE A 1 150 ? 42.166  236.794 14.319  1.00 109.11 ? 150 ILE A HG22  1 
ATOM   1365 H  HG23  . ILE A 1 150 ? 41.681  237.886 15.367  1.00 109.11 ? 150 ILE A HG23  1 
ATOM   1366 N  N     . LEU A 1 151 ? 42.245  234.599 13.366  1.00 67.56  ? 151 LEU A N     1 
ATOM   1367 C  CA    . LEU A 1 151 ? 43.070  234.357 12.189  1.00 66.32  ? 151 LEU A CA    1 
ATOM   1368 C  C     . LEU A 1 151 ? 42.799  232.993 11.563  1.00 70.82  ? 151 LEU A C     1 
ATOM   1369 O  O     . LEU A 1 151 ? 42.697  232.878 10.343  1.00 74.61  ? 151 LEU A O     1 
ATOM   1370 C  CB    . LEU A 1 151 ? 44.555  234.481 12.540  1.00 64.44  ? 151 LEU A CB    1 
ATOM   1371 C  CG    . LEU A 1 151 ? 45.104  235.908 12.649  1.00 72.53  ? 151 LEU A CG    1 
ATOM   1372 C  CD1   . LEU A 1 151 ? 46.503  235.917 13.282  1.00 78.86  ? 151 LEU A CD1   1 
ATOM   1373 C  CD2   . LEU A 1 151 ? 45.121  236.603 11.286  1.00 70.75  ? 151 LEU A CD2   1 
ATOM   1374 N  N     . ALA A 1 152 ? 42.687  231.961 12.395  1.00 72.03  ? 152 ALA A N     1 
ATOM   1375 C  CA    . ALA A 1 152 ? 42.384  230.619 11.902  1.00 65.14  ? 152 ALA A CA    1 
ATOM   1376 C  C     . ALA A 1 152 ? 41.073  230.615 11.126  1.00 65.58  ? 152 ALA A C     1 
ATOM   1377 O  O     . ALA A 1 152 ? 40.925  229.900 10.144  1.00 68.74  ? 152 ALA A O     1 
ATOM   1378 C  CB    . ALA A 1 152 ? 42.320  229.628 13.053  1.00 56.73  ? 152 ALA A CB    1 
ATOM   1379 N  N     . LYS A 1 153 ? 40.119  231.419 11.573  1.00 64.37  ? 153 LYS A N     1 
ATOM   1380 C  CA    . LYS A 1 153 ? 38.831  231.506 10.900  1.00 61.22  ? 153 LYS A CA    1 
ATOM   1381 C  C     . LYS A 1 153 ? 38.958  232.216 9.557   1.00 61.97  ? 153 LYS A C     1 
ATOM   1382 O  O     . LYS A 1 153 ? 38.279  231.862 8.597   1.00 57.98  ? 153 LYS A O     1 
ATOM   1383 C  CB    . LYS A 1 153 ? 37.810  232.231 11.780  1.00 59.86  ? 153 LYS A CB    1 
ATOM   1384 C  CG    . LYS A 1 153 ? 36.606  232.764 11.023  1.00 55.86  ? 153 LYS A CG    1 
ATOM   1385 C  CD    . LYS A 1 153 ? 35.324  232.175 11.557  1.00 55.23  ? 153 LYS A CD    1 
ATOM   1386 C  CE    . LYS A 1 153 ? 34.136  232.615 10.715  1.00 57.37  ? 153 LYS A CE    1 
ATOM   1387 N  NZ    . LYS A 1 153 ? 33.006  231.638 10.858  1.00 58.33  1 153 LYS A NZ    1 
ATOM   1388 N  N     . ILE A 1 154 ? 39.831  233.216 9.489   1.00 63.24  ? 154 ILE A N     1 
ATOM   1389 C  CA    . ILE A 1 154 ? 39.969  234.008 8.271   1.00 62.50  ? 154 ILE A CA    1 
ATOM   1390 C  C     . ILE A 1 154 ? 40.616  233.176 7.166   1.00 60.53  ? 154 ILE A C     1 
ATOM   1391 O  O     . ILE A 1 154 ? 40.100  233.126 6.049   1.00 63.61  ? 154 ILE A O     1 
ATOM   1392 C  CB    . ILE A 1 154 ? 40.779  235.311 8.512   1.00 64.36  ? 154 ILE A CB    1 
ATOM   1393 C  CG1   . ILE A 1 154 ? 39.959  236.293 9.356   1.00 60.70  ? 154 ILE A CG1   1 
ATOM   1394 C  CG2   . ILE A 1 154 ? 41.138  235.984 7.187   1.00 67.12  ? 154 ILE A CG2   1 
ATOM   1395 C  CD1   . ILE A 1 154 ? 40.639  237.624 9.625   1.00 64.47  ? 154 ILE A CD1   1 
ATOM   1396 H  HG12  . ILE A 1 154 ? 39.127  236.477 8.894   1.00 72.84  ? 154 ILE A HG12  1 
ATOM   1397 H  HG13  . ILE A 1 154 ? 39.772  235.881 10.214  1.00 72.84  ? 154 ILE A HG13  1 
ATOM   1398 H  HG21  . ILE A 1 154 ? 41.642  236.792 7.370   1.00 80.55  ? 154 ILE A HG21  1 
ATOM   1399 H  HG22  . ILE A 1 154 ? 41.674  235.373 6.658   1.00 80.55  ? 154 ILE A HG22  1 
ATOM   1400 H  HG23  . ILE A 1 154 ? 40.321  236.204 6.713   1.00 80.55  ? 154 ILE A HG23  1 
ATOM   1401 N  N     . ILE A 1 155 ? 41.723  232.506 7.475   1.00 58.49  ? 155 ILE A N     1 
ATOM   1402 C  CA    . ILE A 1 155 ? 42.419  231.733 6.458   1.00 65.06  ? 155 ILE A CA    1 
ATOM   1403 C  C     . ILE A 1 155 ? 41.641  230.480 6.081   1.00 68.70  ? 155 ILE A C     1 
ATOM   1404 O  O     . ILE A 1 155 ? 41.779  229.972 4.971   1.00 73.66  ? 155 ILE A O     1 
ATOM   1405 C  CB    . ILE A 1 155 ? 43.834  231.335 6.906   1.00 69.44  ? 155 ILE A CB    1 
ATOM   1406 C  CG1   . ILE A 1 155 ? 44.729  231.077 5.687   1.00 71.27  ? 155 ILE A CG1   1 
ATOM   1407 C  CG2   . ILE A 1 155 ? 43.802  230.134 7.851   1.00 67.86  ? 155 ILE A CG2   1 
ATOM   1408 C  CD1   . ILE A 1 155 ? 44.939  232.298 4.812   1.00 70.72  ? 155 ILE A CD1   1 
ATOM   1409 H  HG12  . ILE A 1 155 ? 45.599  230.779 5.995   1.00 85.53  ? 155 ILE A HG12  1 
ATOM   1410 H  HG13  . ILE A 1 155 ? 44.320  230.387 5.140   1.00 85.53  ? 155 ILE A HG13  1 
ATOM   1411 H  HG21  . ILE A 1 155 ? 43.397  229.382 7.391   1.00 81.43  ? 155 ILE A HG21  1 
ATOM   1412 H  HG22  . ILE A 1 155 ? 44.710  229.913 8.111   1.00 81.43  ? 155 ILE A HG22  1 
ATOM   1413 H  HG23  . ILE A 1 155 ? 43.279  230.363 8.635   1.00 81.43  ? 155 ILE A HG23  1 
ATOM   1414 N  N     . ALA A 1 156 ? 40.831  229.970 6.998   1.00 67.49  ? 156 ALA A N     1 
ATOM   1415 C  CA    . ALA A 1 156 ? 39.973  228.844 6.654   1.00 62.32  ? 156 ALA A CA    1 
ATOM   1416 C  C     . ALA A 1 156 ? 38.960  229.286 5.606   1.00 57.06  ? 156 ALA A C     1 
ATOM   1417 O  O     . ALA A 1 156 ? 38.775  228.618 4.592   1.00 58.00  ? 156 ALA A O     1 
ATOM   1418 C  CB    . ALA A 1 156 ? 39.266  228.303 7.874   1.00 56.33  ? 156 ALA A CB    1 
ATOM   1419 N  N     . ASP A 1 157 ? 38.321  230.424 5.862   1.00 52.58  ? 157 ASP A N     1 
ATOM   1420 C  CA    . ASP A 1 157 ? 37.338  230.993 4.955   1.00 58.45  ? 157 ASP A CA    1 
ATOM   1421 C  C     . ASP A 1 157 ? 37.922  231.230 3.552   1.00 61.27  ? 157 ASP A C     1 
ATOM   1422 O  O     . ASP A 1 157 ? 37.265  230.943 2.555   1.00 62.28  ? 157 ASP A O     1 
ATOM   1423 C  CB    . ASP A 1 157 ? 36.776  232.298 5.530   1.00 67.67  ? 157 ASP A CB    1 
ATOM   1424 C  CG    . ASP A 1 157 ? 35.712  232.067 6.604   1.00 72.39  ? 157 ASP A CG    1 
ATOM   1425 O  OD1   . ASP A 1 157 ? 35.615  230.946 7.148   1.00 79.94  ? 157 ASP A OD1   1 
ATOM   1426 O  OD2   . ASP A 1 157 ? 34.974  233.022 6.914   1.00 75.13  1 157 ASP A OD2   1 
ATOM   1427 N  N     . LYS A 1 158 ? 39.155  231.730 3.483   1.00 62.14  ? 158 LYS A N     1 
ATOM   1428 C  CA    . LYS A 1 158 ? 39.841  231.937 2.205   1.00 60.28  ? 158 LYS A CA    1 
ATOM   1429 C  C     . LYS A 1 158 ? 40.244  230.632 1.534   1.00 62.90  ? 158 LYS A C     1 
ATOM   1430 O  O     . LYS A 1 158 ? 40.726  230.639 0.399   1.00 67.60  ? 158 LYS A O     1 
ATOM   1431 C  CB    . LYS A 1 158 ? 41.105  232.781 2.382   1.00 61.01  ? 158 LYS A CB    1 
ATOM   1432 C  CG    . LYS A 1 158 ? 40.902  234.252 2.702   1.00 68.41  ? 158 LYS A CG    1 
ATOM   1433 C  CD    . LYS A 1 158 ? 42.255  234.951 2.673   1.00 80.51  ? 158 LYS A CD    1 
ATOM   1434 C  CE    . LYS A 1 158 ? 42.142  236.458 2.813   1.00 91.78  ? 158 LYS A CE    1 
ATOM   1435 N  NZ    . LYS A 1 158 ? 43.327  237.156 2.200   1.00 101.38 1 158 LYS A NZ    1 
ATOM   1436 N  N     . SER A 1 159 ? 40.064  229.514 2.230   1.00 57.11  ? 159 SER A N     1 
ATOM   1437 C  CA    . SER A 1 159 ? 40.551  228.238 1.720   1.00 57.00  ? 159 SER A CA    1 
ATOM   1438 C  C     . SER A 1 159 ? 39.445  227.243 1.376   1.00 50.30  ? 159 SER A C     1 
ATOM   1439 O  O     . SER A 1 159 ? 39.714  226.219 0.758   1.00 59.59  ? 159 SER A O     1 
ATOM   1440 C  CB    . SER A 1 159 ? 41.512  227.612 2.727   1.00 66.36  ? 159 SER A CB    1 
ATOM   1441 O  OG    . SER A 1 159 ? 42.647  228.439 2.896   1.00 75.68  ? 159 SER A OG    1 
ATOM   1442 N  N     . LYS A 1 160 ? 38.208  227.538 1.771   1.00 48.90  ? 160 LYS A N     1 
ATOM   1443 C  CA    . LYS A 1 160 ? 37.056  226.733 1.366   1.00 52.05  ? 160 LYS A CA    1 
ATOM   1444 C  C     . LYS A 1 160 ? 37.025  226.581 -0.154  1.00 56.32  ? 160 LYS A C     1 
ATOM   1445 O  O     . LYS A 1 160 ? 37.491  227.467 -0.874  1.00 59.50  ? 160 LYS A O     1 
ATOM   1446 C  CB    . LYS A 1 160 ? 35.741  227.365 1.844   1.00 53.09  ? 160 LYS A CB    1 
ATOM   1447 C  CG    . LYS A 1 160 ? 35.627  227.604 3.339   1.00 54.15  ? 160 LYS A CG    1 
ATOM   1448 C  CD    . LYS A 1 160 ? 34.220  228.106 3.703   1.00 55.66  ? 160 LYS A CD    1 
ATOM   1449 C  CE    . LYS A 1 160 ? 34.028  228.328 5.222   1.00 48.72  ? 160 LYS A CE    1 
ATOM   1450 N  NZ    . LYS A 1 160 ? 32.572  228.517 5.596   1.00 50.25  1 160 LYS A NZ    1 
ATOM   1451 N  N     . PRO A 1 161 ? 36.507  225.445 -0.650  1.00 49.55  ? 161 PRO A N     1 
ATOM   1452 C  CA    . PRO A 1 161 ? 36.110  224.270 0.121   1.00 41.30  ? 161 PRO A CA    1 
ATOM   1453 C  C     . PRO A 1 161 ? 37.252  223.263 0.212   1.00 49.12  ? 161 PRO A C     1 
ATOM   1454 O  O     . PRO A 1 161 ? 38.269  223.425 -0.482  1.00 52.17  ? 161 PRO A O     1 
ATOM   1455 C  CB    . PRO A 1 161 ? 34.960  223.707 -0.699  1.00 50.17  ? 161 PRO A CB    1 
ATOM   1456 C  CG    . PRO A 1 161 ? 35.405  223.966 -2.111  1.00 46.18  ? 161 PRO A CG    1 
ATOM   1457 C  CD    . PRO A 1 161 ? 36.177  225.277 -2.079  1.00 48.09  ? 161 PRO A CD    1 
ATOM   1458 N  N     . ASN A 1 162 ? 37.078  222.254 1.064   1.00 55.52  ? 162 ASN A N     1 
ATOM   1459 C  CA    . ASN A 1 162 ? 38.091  221.233 1.353   1.00 53.77  ? 162 ASN A CA    1 
ATOM   1460 C  C     . ASN A 1 162 ? 39.498  221.789 1.579   1.00 52.39  ? 162 ASN A C     1 
ATOM   1461 O  O     . ASN A 1 162 ? 40.492  221.138 1.256   1.00 56.50  ? 162 ASN A O     1 
ATOM   1462 C  CB    . ASN A 1 162 ? 38.124  220.194 0.230   1.00 58.19  ? 162 ASN A CB    1 
ATOM   1463 C  CG    . ASN A 1 162 ? 38.612  218.834 0.712   1.00 67.99  ? 162 ASN A CG    1 
ATOM   1464 O  OD1   . ASN A 1 162 ? 38.960  218.667 1.881   1.00 77.12  ? 162 ASN A OD1   1 
ATOM   1465 N  ND2   . ASN A 1 162 ? 38.623  217.852 -0.183  1.00 64.00  ? 162 ASN A ND2   1 
ATOM   1466 N  N     . GLY A 1 163 ? 39.589  222.979 2.166   1.00 44.55  ? 163 GLY A N     1 
ATOM   1467 C  CA    . GLY A 1 163 ? 40.880  223.609 2.343   1.00 44.37  ? 163 GLY A CA    1 
ATOM   1468 C  C     . GLY A 1 163 ? 41.661  223.240 3.602   1.00 60.13  ? 163 GLY A C     1 
ATOM   1469 O  O     . GLY A 1 163 ? 41.138  222.653 4.573   1.00 57.47  ? 163 GLY A O     1 
ATOM   1470 N  N     . LEU A 1 164 ? 42.944  223.591 3.560   1.00 61.31  ? 164 LEU A N     1 
ATOM   1471 C  CA    . LEU A 1 164 ? 43.839  223.541 4.701   1.00 60.43  ? 164 LEU A CA    1 
ATOM   1472 C  C     . LEU A 1 164 ? 44.652  224.831 4.681   1.00 65.21  ? 164 LEU A C     1 
ATOM   1473 O  O     . LEU A 1 164 ? 45.777  224.855 4.190   1.00 71.92  ? 164 LEU A O     1 
ATOM   1474 C  CB    . LEU A 1 164 ? 44.744  222.312 4.642   1.00 56.39  ? 164 LEU A CB    1 
ATOM   1475 C  CG    . LEU A 1 164 ? 45.890  222.228 5.656   1.00 63.97  ? 164 LEU A CG    1 
ATOM   1476 C  CD1   . LEU A 1 164 ? 45.377  221.853 6.996   1.00 59.18  ? 164 LEU A CD1   1 
ATOM   1477 C  CD2   . LEU A 1 164 ? 46.933  221.218 5.224   1.00 75.58  ? 164 LEU A CD2   1 
ATOM   1478 N  N     . GLY A 1 165 ? 44.059  225.908 5.190   1.00 61.95  ? 165 GLY A N     1 
ATOM   1479 C  CA    . GLY A 1 165 ? 44.717  227.205 5.232   1.00 63.73  ? 165 GLY A CA    1 
ATOM   1480 C  C     . GLY A 1 165 ? 45.639  227.393 6.433   1.00 67.46  ? 165 GLY A C     1 
ATOM   1481 O  O     . GLY A 1 165 ? 45.438  226.792 7.497   1.00 64.61  ? 165 GLY A O     1 
ATOM   1482 N  N     . VAL A 1 166 ? 46.657  228.233 6.265   1.00 66.94  ? 166 VAL A N     1 
ATOM   1483 C  CA    . VAL A 1 166 ? 47.713  228.359 7.261   1.00 71.78  ? 166 VAL A CA    1 
ATOM   1484 C  C     . VAL A 1 166 ? 48.349  229.757 7.276   1.00 78.44  ? 166 VAL A C     1 
ATOM   1485 O  O     . VAL A 1 166 ? 48.725  230.305 6.235   1.00 85.56  ? 166 VAL A O     1 
ATOM   1486 C  CB    . VAL A 1 166 ? 48.839  227.303 7.032   1.00 64.95  ? 166 VAL A CB    1 
ATOM   1487 C  CG1   . VAL A 1 166 ? 49.887  227.381 8.137   1.00 68.91  ? 166 VAL A CG1   1 
ATOM   1488 C  CG2   . VAL A 1 166 ? 48.269  225.885 6.953   1.00 62.50  ? 166 VAL A CG2   1 
ATOM   1489 H  HG11  . VAL A 1 166 ? 50.572  226.715 7.969   1.00 82.70  ? 166 VAL A HG11  1 
ATOM   1490 H  HG12  . VAL A 1 166 ? 50.279  228.268 8.138   1.00 82.70  ? 166 VAL A HG12  1 
ATOM   1491 H  HG13  . VAL A 1 166 ? 49.459  227.207 8.990   1.00 82.70  ? 166 VAL A HG13  1 
ATOM   1492 H  HG21  . VAL A 1 166 ? 48.998  225.260 6.811   1.00 75.01  ? 166 VAL A HG21  1 
ATOM   1493 H  HG22  . VAL A 1 166 ? 47.815  225.681 7.785   1.00 75.01  ? 166 VAL A HG22  1 
ATOM   1494 H  HG23  . VAL A 1 166 ? 47.643  225.838 6.214   1.00 75.01  ? 166 VAL A HG23  1 
ATOM   1495 N  N     . ILE A 1 167 ? 48.478  230.315 8.475   1.00 72.29  ? 167 ILE A N     1 
ATOM   1496 C  CA    . ILE A 1 167 ? 49.193  231.562 8.690   1.00 74.29  ? 167 ILE A CA    1 
ATOM   1497 C  C     . ILE A 1 167 ? 50.210  231.334 9.793   1.00 84.99  ? 167 ILE A C     1 
ATOM   1498 O  O     . ILE A 1 167 ? 49.838  231.153 10.955  1.00 81.74  ? 167 ILE A O     1 
ATOM   1499 C  CB    . ILE A 1 167 ? 48.261  232.723 9.109   1.00 71.23  ? 167 ILE A CB    1 
ATOM   1500 C  CG1   . ILE A 1 167 ? 47.175  232.981 8.071   1.00 68.33  ? 167 ILE A CG1   1 
ATOM   1501 C  CG2   . ILE A 1 167 ? 49.062  234.000 9.360   1.00 75.15  ? 167 ILE A CG2   1 
ATOM   1502 C  CD1   . ILE A 1 167 ? 46.013  233.808 8.629   1.00 68.85  ? 167 ILE A CD1   1 
ATOM   1503 H  HG12  . ILE A 1 167 ? 47.559  233.467 7.325   1.00 81.99  ? 167 ILE A HG12  1 
ATOM   1504 H  HG13  . ILE A 1 167 ? 46.820  232.131 7.767   1.00 81.99  ? 167 ILE A HG13  1 
ATOM   1505 H  HG21  . ILE A 1 167 ? 48.452  234.708 9.621   1.00 90.18  ? 167 ILE A HG21  1 
ATOM   1506 H  HG22  . ILE A 1 167 ? 49.702  233.837 10.070  1.00 90.18  ? 167 ILE A HG22  1 
ATOM   1507 H  HG23  . ILE A 1 167 ? 49.527  234.246 8.545   1.00 90.18  ? 167 ILE A HG23  1 
ATOM   1508 N  N     . ARG A 1 168 ? 51.488  231.333 9.432   1.00 88.52  ? 168 ARG A N     1 
ATOM   1509 C  CA    . ARG A 1 168 ? 52.542  231.195 10.421  1.00 87.41  ? 168 ARG A CA    1 
ATOM   1510 C  C     . ARG A 1 168 ? 52.841  232.545 11.044  1.00 91.02  ? 168 ARG A C     1 
ATOM   1511 O  O     . ARG A 1 168 ? 52.698  233.572 10.375  1.00 91.81  ? 168 ARG A O     1 
ATOM   1512 C  CB    . ARG A 1 168 ? 53.805  230.629 9.790   1.00 90.42  ? 168 ARG A CB    1 
ATOM   1513 C  CG    . ARG A 1 168 ? 53.642  229.285 9.117   1.00 84.01  ? 168 ARG A CG    1 
ATOM   1514 C  CD    . ARG A 1 168 ? 54.970  228.852 8.505   1.00 87.28  ? 168 ARG A CD    1 
ATOM   1515 N  NE    . ARG A 1 168 ? 54.900  227.522 7.917   1.00 89.04  ? 168 ARG A NE    1 
ATOM   1516 C  CZ    . ARG A 1 168 ? 54.281  227.254 6.773   1.00 91.88  ? 168 ARG A CZ    1 
ATOM   1517 N  NH1   . ARG A 1 168 ? 53.673  228.227 6.101   1.00 89.32  1 168 ARG A NH1   1 
ATOM   1518 N  NH2   . ARG A 1 168 ? 54.259  226.014 6.305   1.00 95.63  ? 168 ARG A NH2   1 
ATOM   1519 N  N     . PRO A 1 169 ? 53.257  232.544 12.328  1.00 92.78  ? 169 PRO A N     1 
ATOM   1520 C  CA    . PRO A 1 169 ? 53.691  233.741 13.061  1.00 94.16  ? 169 PRO A CA    1 
ATOM   1521 C  C     . PRO A 1 169 ? 54.461  234.715 12.171  1.00 97.64  ? 169 PRO A C     1 
ATOM   1522 O  O     . PRO A 1 169 ? 54.100  235.894 12.099  1.00 97.42  ? 169 PRO A O     1 
ATOM   1523 C  CB    . PRO A 1 169 ? 54.585  233.160 14.155  1.00 91.22  ? 169 PRO A CB    1 
ATOM   1524 C  CG    . PRO A 1 169 ? 53.923  231.845 14.475  1.00 89.17  ? 169 PRO A CG    1 
ATOM   1525 C  CD    . PRO A 1 169 ? 53.307  231.339 13.180  1.00 87.30  ? 169 PRO A CD    1 
ATOM   1526 N  N     . THR A 1 170 ? 55.492  234.203 11.501  1.00 100.48 ? 170 THR A N     1 
ATOM   1527 C  CA    . THR A 1 170 ? 56.271  234.953 10.518  1.00 107.72 ? 170 THR A CA    1 
ATOM   1528 C  C     . THR A 1 170 ? 55.411  235.877 9.662   1.00 111.60 ? 170 THR A C     1 
ATOM   1529 O  O     . THR A 1 170 ? 55.598  237.095 9.639   1.00 114.13 ? 170 THR A O     1 
ATOM   1530 C  CB    . THR A 1 170 ? 57.021  233.991 9.579   1.00 107.34 ? 170 THR A CB    1 
ATOM   1531 O  OG1   . THR A 1 170 ? 57.687  232.987 10.354  1.00 105.07 ? 170 THR A OG1   1 
ATOM   1532 C  CG2   . THR A 1 170 ? 58.029  234.740 8.711   1.00 113.97 ? 170 THR A CG2   1 
ATOM   1533 H  HG21  . THR A 1 170 ? 58.681  235.189 9.272   1.00 136.76 ? 170 THR A HG21  1 
ATOM   1534 H  HG22  . THR A 1 170 ? 58.490  234.117 8.127   1.00 136.76 ? 170 THR A HG22  1 
ATOM   1535 H  HG23  . THR A 1 170 ? 57.571  235.401 8.168   1.00 136.76 ? 170 THR A HG23  1 
ATOM   1536 N  N     . GLU A 1 171 ? 54.453  235.272 8.972   1.00 108.80 ? 171 GLU A N     1 
ATOM   1537 C  CA    . GLU A 1 171 ? 53.610  235.975 8.021   1.00 107.56 ? 171 GLU A CA    1 
ATOM   1538 C  C     . GLU A 1 171 ? 52.360  236.585 8.656   1.00 100.69 ? 171 GLU A C     1 
ATOM   1539 O  O     . GLU A 1 171 ? 51.483  237.060 7.940   1.00 102.35 ? 171 GLU A O     1 
ATOM   1540 C  CB    . GLU A 1 171 ? 53.210  235.015 6.900   1.00 109.21 ? 171 GLU A CB    1 
ATOM   1541 C  CG    . GLU A 1 171 ? 53.010  233.593 7.398   1.00 111.89 ? 171 GLU A CG    1 
ATOM   1542 C  CD    . GLU A 1 171 ? 52.619  232.617 6.303   1.00 116.70 ? 171 GLU A CD    1 
ATOM   1543 O  OE1   . GLU A 1 171 ? 53.477  231.799 5.908   1.00 115.82 ? 171 GLU A OE1   1 
ATOM   1544 O  OE2   . GLU A 1 171 ? 51.452  232.653 5.851   1.00 119.55 1 171 GLU A OE2   1 
ATOM   1545 N  N     . VAL A 1 172 ? 52.267  236.572 9.985   1.00 94.60  ? 172 VAL A N     1 
ATOM   1546 C  CA    . VAL A 1 172 ? 51.104  237.159 10.653  1.00 93.60  ? 172 VAL A CA    1 
ATOM   1547 C  C     . VAL A 1 172 ? 51.068  238.671 10.471  1.00 100.58 ? 172 VAL A C     1 
ATOM   1548 O  O     . VAL A 1 172 ? 50.026  239.237 10.132  1.00 100.04 ? 172 VAL A O     1 
ATOM   1549 C  CB    . VAL A 1 172 ? 51.068  236.854 12.169  1.00 91.28  ? 172 VAL A CB    1 
ATOM   1550 C  CG1   . VAL A 1 172 ? 49.944  237.641 12.852  1.00 90.22  ? 172 VAL A CG1   1 
ATOM   1551 C  CG2   . VAL A 1 172 ? 50.874  235.380 12.417  1.00 87.19  ? 172 VAL A CG2   1 
ATOM   1552 H  HG11  . VAL A 1 172 ? 49.944  237.432 13.800  1.00 108.26 ? 172 VAL A HG11  1 
ATOM   1553 H  HG12  . VAL A 1 172 ? 50.100  238.590 12.723  1.00 108.26 ? 172 VAL A HG12  1 
ATOM   1554 H  HG13  . VAL A 1 172 ? 49.096  237.387 12.457  1.00 108.26 ? 172 VAL A HG13  1 
ATOM   1555 H  HG21  . VAL A 1 172 ? 50.855  235.221 13.373  1.00 104.62 ? 172 VAL A HG21  1 
ATOM   1556 H  HG22  . VAL A 1 172 ? 50.034  235.101 12.018  1.00 104.62 ? 172 VAL A HG22  1 
ATOM   1557 H  HG23  . VAL A 1 172 ? 51.610  234.893 12.014  1.00 104.62 ? 172 VAL A HG23  1 
ATOM   1558 N  N     . GLN A 1 173 ? 52.196  239.326 10.724  1.00 105.18 ? 173 GLN A N     1 
ATOM   1559 C  CA    . GLN A 1 173 ? 52.241  240.776 10.632  1.00 111.73 ? 173 GLN A CA    1 
ATOM   1560 C  C     . GLN A 1 173 ? 51.973  241.220 9.205   1.00 116.95 ? 173 GLN A C     1 
ATOM   1561 O  O     . GLN A 1 173 ? 51.318  242.237 8.977   1.00 117.65 ? 173 GLN A O     1 
ATOM   1562 C  CB    . GLN A 1 173 ? 53.583  241.317 11.122  1.00 118.44 ? 173 GLN A CB    1 
ATOM   1563 C  CG    . GLN A 1 173 ? 53.653  241.521 12.632  1.00 123.36 ? 173 GLN A CG    1 
ATOM   1564 C  CD    . GLN A 1 173 ? 52.708  242.610 13.135  1.00 126.57 ? 173 GLN A CD    1 
ATOM   1565 O  OE1   . GLN A 1 173 ? 51.797  243.043 12.426  1.00 125.78 ? 173 GLN A OE1   1 
ATOM   1566 N  NE2   . GLN A 1 173 ? 52.931  243.060 14.366  1.00 128.33 ? 173 GLN A NE2   1 
ATOM   1567 N  N     . ASP A 1 174 ? 52.459  240.442 8.245   1.00 120.67 ? 174 ASP A N     1 
ATOM   1568 C  CA    . ASP A 1 174 ? 52.229  240.746 6.838   1.00 127.16 ? 174 ASP A CA    1 
ATOM   1569 C  C     . ASP A 1 174 ? 50.755  240.613 6.486   1.00 121.36 ? 174 ASP A C     1 
ATOM   1570 O  O     . ASP A 1 174 ? 50.135  241.538 5.961   1.00 121.65 ? 174 ASP A O     1 
ATOM   1571 C  CB    . ASP A 1 174 ? 53.058  239.825 5.943   1.00 135.23 ? 174 ASP A CB    1 
ATOM   1572 C  CG    . ASP A 1 174 ? 54.547  240.001 6.147   1.00 144.72 ? 174 ASP A CG    1 
ATOM   1573 O  OD1   . ASP A 1 174 ? 54.981  241.138 6.436   1.00 150.09 ? 174 ASP A OD1   1 
ATOM   1574 O  OD2   . ASP A 1 174 ? 55.281  239.000 6.016   1.00 146.73 1 174 ASP A OD2   1 
ATOM   1575 N  N     . PHE A 1 175 ? 50.210  239.442 6.783   1.00 116.58 ? 175 PHE A N     1 
ATOM   1576 C  CA    . PHE A 1 175 ? 48.824  239.108 6.483   1.00 109.53 ? 175 PHE A CA    1 
ATOM   1577 C  C     . PHE A 1 175 ? 47.847  240.116 7.087   1.00 108.02 ? 175 PHE A C     1 
ATOM   1578 O  O     . PHE A 1 175 ? 46.877  240.520 6.443   1.00 105.11 ? 175 PHE A O     1 
ATOM   1579 C  CB    . PHE A 1 175 ? 48.532  237.702 6.994   1.00 97.80  ? 175 PHE A CB    1 
ATOM   1580 C  CG    . PHE A 1 175 ? 47.160  237.210 6.676   1.00 91.17  ? 175 PHE A CG    1 
ATOM   1581 C  CD1   . PHE A 1 175 ? 46.925  236.482 5.528   1.00 86.26  ? 175 PHE A CD1   1 
ATOM   1582 C  CD2   . PHE A 1 175 ? 46.106  237.448 7.544   1.00 90.33  ? 175 PHE A CD2   1 
ATOM   1583 C  CE1   . PHE A 1 175 ? 45.657  236.005 5.241   1.00 82.52  ? 175 PHE A CE1   1 
ATOM   1584 C  CE2   . PHE A 1 175 ? 44.841  236.979 7.262   1.00 85.42  ? 175 PHE A CE2   1 
ATOM   1585 C  CZ    . PHE A 1 175 ? 44.617  236.257 6.103   1.00 80.52  ? 175 PHE A CZ    1 
ATOM   1586 N  N     . LEU A 1 176 ? 48.118  240.516 8.326   1.00 107.27 ? 176 LEU A N     1 
ATOM   1587 C  CA    . LEU A 1 176 ? 47.313  241.521 9.008   1.00 105.10 ? 176 LEU A CA    1 
ATOM   1588 C  C     . LEU A 1 176 ? 47.291  242.828 8.226   1.00 114.73 ? 176 LEU A C     1 
ATOM   1589 O  O     . LEU A 1 176 ? 46.258  243.490 8.139   1.00 120.07 ? 176 LEU A O     1 
ATOM   1590 C  CB    . LEU A 1 176 ? 47.837  241.757 10.424  1.00 97.38  ? 176 LEU A CB    1 
ATOM   1591 C  CG    . LEU A 1 176 ? 47.234  240.821 11.462  1.00 91.06  ? 176 LEU A CG    1 
ATOM   1592 C  CD1   . LEU A 1 176 ? 47.941  240.962 12.800  1.00 90.07  ? 176 LEU A CD1   1 
ATOM   1593 C  CD2   . LEU A 1 176 ? 45.746  241.116 11.589  1.00 86.96  ? 176 LEU A CD2   1 
ATOM   1594 N  N     . ASN A 1 177 ? 48.429  243.199 7.654   1.00 119.38 ? 177 ASN A N     1 
ATOM   1595 C  CA    . ASN A 1 177 ? 48.483  244.386 6.811   1.00 127.37 ? 177 ASN A CA    1 
ATOM   1596 C  C     . ASN A 1 177 ? 47.656  244.198 5.546   1.00 130.48 ? 177 ASN A C     1 
ATOM   1597 O  O     . ASN A 1 177 ? 46.683  244.920 5.317   1.00 131.63 ? 177 ASN A O     1 
ATOM   1598 C  CB    . ASN A 1 177 ? 49.929  244.728 6.443   1.00 134.74 ? 177 ASN A CB    1 
ATOM   1599 C  CG    . ASN A 1 177 ? 50.720  245.268 7.620   1.00 138.56 ? 177 ASN A CG    1 
ATOM   1600 O  OD1   . ASN A 1 177 ? 50.148  245.718 8.614   1.00 140.66 ? 177 ASN A OD1   1 
ATOM   1601 N  ND2   . ASN A 1 177 ? 52.043  245.235 7.508   1.00 139.66 ? 177 ASN A ND2   1 
ATOM   1602 N  N     . GLU A 1 178 ? 48.044  243.211 4.740   1.00 132.14 ? 178 GLU A N     1 
ATOM   1603 C  CA    . GLU A 1 178 ? 47.395  242.931 3.460   1.00 133.35 ? 178 GLU A CA    1 
ATOM   1604 C  C     . GLU A 1 178 ? 45.926  242.573 3.644   1.00 125.01 ? 178 GLU A C     1 
ATOM   1605 O  O     . GLU A 1 178 ? 45.166  242.500 2.676   1.00 121.13 ? 178 GLU A O     1 
ATOM   1606 C  CB    . GLU A 1 178 ? 48.131  241.800 2.732   1.00 139.62 ? 178 GLU A CB    1 
ATOM   1607 C  CG    . GLU A 1 178 ? 49.564  242.155 2.334   1.00 148.94 ? 178 GLU A CG    1 
ATOM   1608 C  CD    . GLU A 1 178 ? 50.540  241.006 2.546   1.00 150.98 ? 178 GLU A CD    1 
ATOM   1609 O  OE1   . GLU A 1 178 ? 51.658  241.262 3.046   1.00 152.41 ? 178 GLU A OE1   1 
ATOM   1610 O  OE2   . GLU A 1 178 ? 50.190  239.852 2.213   1.00 149.62 1 178 GLU A OE2   1 
ATOM   1611 N  N     . LEU A 1 179 ? 45.541  242.355 4.899   1.00 121.72 ? 179 LEU A N     1 
ATOM   1612 C  CA    . LEU A 1 179 ? 44.170  242.018 5.257   1.00 113.59 ? 179 LEU A CA    1 
ATOM   1613 C  C     . LEU A 1 179 ? 43.195  243.160 4.980   1.00 123.87 ? 179 LEU A C     1 
ATOM   1614 O  O     . LEU A 1 179 ? 43.310  244.242 5.561   1.00 129.70 ? 179 LEU A O     1 
ATOM   1615 C  CB    . LEU A 1 179 ? 44.090  241.631 6.732   1.00 95.79  ? 179 LEU A CB    1 
ATOM   1616 C  CG    . LEU A 1 179 ? 42.762  240.982 7.100   1.00 86.36  ? 179 LEU A CG    1 
ATOM   1617 C  CD1   . LEU A 1 179 ? 42.641  239.655 6.360   1.00 80.64  ? 179 LEU A CD1   1 
ATOM   1618 C  CD2   . LEU A 1 179 ? 42.606  240.797 8.607   1.00 79.32  ? 179 LEU A CD2   1 
ATOM   1619 N  N     . ASP A 1 180 ? 42.233  242.908 4.097   1.00 125.47 ? 180 ASP A N     1 
ATOM   1620 C  CA    . ASP A 1 180 ? 41.149  243.853 3.835   1.00 127.53 ? 180 ASP A CA    1 
ATOM   1621 C  C     . ASP A 1 180 ? 40.325  244.011 5.116   1.00 123.01 ? 180 ASP A C     1 
ATOM   1622 O  O     . ASP A 1 180 ? 40.586  243.329 6.108   1.00 121.45 ? 180 ASP A O     1 
ATOM   1623 C  CB    . ASP A 1 180 ? 40.285  243.366 2.660   1.00 129.32 ? 180 ASP A CB    1 
ATOM   1624 C  CG    . ASP A 1 180 ? 39.360  244.445 2.110   1.00 132.26 ? 180 ASP A CG    1 
ATOM   1625 O  OD1   . ASP A 1 180 ? 39.268  244.584 0.869   1.00 129.51 ? 180 ASP A OD1   1 
ATOM   1626 O  OD2   . ASP A 1 180 ? 38.712  245.143 2.916   1.00 136.64 1 180 ASP A OD2   1 
ATOM   1627 N  N     . ILE A 1 181 ? 39.342  244.905 5.114   1.00 121.46 ? 181 ILE A N     1 
ATOM   1628 C  CA    . ILE A 1 181 ? 38.575  245.144 6.333   1.00 118.27 ? 181 ILE A CA    1 
ATOM   1629 C  C     . ILE A 1 181 ? 37.371  244.207 6.429   1.00 115.50 ? 181 ILE A C     1 
ATOM   1630 O  O     . ILE A 1 181 ? 37.076  243.685 7.503   1.00 108.46 ? 181 ILE A O     1 
ATOM   1631 C  CB    . ILE A 1 181 ? 38.102  246.624 6.441   1.00 112.43 ? 181 ILE A CB    1 
ATOM   1632 C  CG1   . ILE A 1 181 ? 37.599  246.924 7.861   1.00 105.98 ? 181 ILE A CG1   1 
ATOM   1633 C  CG2   . ILE A 1 181 ? 37.058  246.966 5.363   1.00 116.70 ? 181 ILE A CG2   1 
ATOM   1634 C  CD1   . ILE A 1 181 ? 37.091  248.344 8.056   1.00 105.46 ? 181 ILE A CD1   1 
ATOM   1635 H  HG12  . ILE A 1 181 ? 36.870  246.319 8.067   1.00 127.18 ? 181 ILE A HG12  1 
ATOM   1636 H  HG13  . ILE A 1 181 ? 38.328  246.783 8.485   1.00 127.18 ? 181 ILE A HG13  1 
ATOM   1637 H  HG21  . ILE A 1 181 ? 37.452  246.829 4.487   1.00 140.04 ? 181 ILE A HG21  1 
ATOM   1638 H  HG22  . ILE A 1 181 ? 36.288  246.385 5.474   1.00 140.04 ? 181 ILE A HG22  1 
ATOM   1639 H  HG23  . ILE A 1 181 ? 36.791  247.893 5.465   1.00 140.04 ? 181 ILE A HG23  1 
ATOM   1640 N  N     . ASP A 1 182 ? 36.698  243.983 5.301   1.00 120.18 ? 182 ASP A N     1 
ATOM   1641 C  CA    . ASP A 1 182 ? 35.482  243.166 5.262   1.00 119.21 ? 182 ASP A CA    1 
ATOM   1642 C  C     . ASP A 1 182 ? 35.764  241.687 5.503   1.00 110.98 ? 182 ASP A C     1 
ATOM   1643 O  O     . ASP A 1 182 ? 34.855  240.915 5.821   1.00 109.69 ? 182 ASP A O     1 
ATOM   1644 C  CB    . ASP A 1 182 ? 34.766  243.345 3.920   1.00 127.03 ? 182 ASP A CB    1 
ATOM   1645 C  CG    . ASP A 1 182 ? 34.058  244.680 3.817   1.00 136.15 ? 182 ASP A CG    1 
ATOM   1646 O  OD1   . ASP A 1 182 ? 33.769  245.272 4.879   1.00 144.79 ? 182 ASP A OD1   1 
ATOM   1647 O  OD2   . ASP A 1 182 ? 33.787  245.135 2.684   1.00 134.65 1 182 ASP A OD2   1 
ATOM   1648 N  N     . GLU A 1 183 ? 37.029  241.308 5.350   1.00 104.97 ? 183 GLU A N     1 
ATOM   1649 C  CA    . GLU A 1 183 ? 37.465  239.940 5.581   1.00 100.72 ? 183 GLU A CA    1 
ATOM   1650 C  C     . GLU A 1 183 ? 37.532  239.625 7.074   1.00 95.23  ? 183 GLU A C     1 
ATOM   1651 O  O     . GLU A 1 183 ? 37.888  238.515 7.469   1.00 91.80  ? 183 GLU A O     1 
ATOM   1652 C  CB    . GLU A 1 183 ? 38.829  239.702 4.931   1.00 108.65 ? 183 GLU A CB    1 
ATOM   1653 C  CG    . GLU A 1 183 ? 38.910  240.184 3.488   1.00 123.29 ? 183 GLU A CG    1 
ATOM   1654 C  CD    . GLU A 1 183 ? 40.200  239.768 2.795   1.00 135.65 ? 183 GLU A CD    1 
ATOM   1655 O  OE1   . GLU A 1 183 ? 40.253  238.625 2.296   1.00 137.06 ? 183 GLU A OE1   1 
ATOM   1656 O  OE2   . GLU A 1 183 ? 41.153  240.581 2.742   1.00 142.04 1 183 GLU A OE2   1 
ATOM   1657 N  N     . ILE A 1 184 ? 37.179  240.606 7.898   1.00 92.54  ? 184 ILE A N     1 
ATOM   1658 C  CA    . ILE A 1 184 ? 37.262  240.454 9.342   1.00 90.43  ? 184 ILE A CA    1 
ATOM   1659 C  C     . ILE A 1 184 ? 35.946  239.931 9.898   1.00 90.62  ? 184 ILE A C     1 
ATOM   1660 O  O     . ILE A 1 184 ? 34.872  240.323 9.455   1.00 92.52  ? 184 ILE A O     1 
ATOM   1661 C  CB    . ILE A 1 184 ? 37.632  241.788 10.026  1.00 92.32  ? 184 ILE A CB    1 
ATOM   1662 C  CG1   . ILE A 1 184 ? 38.968  242.317 9.479   1.00 94.40  ? 184 ILE A CG1   1 
ATOM   1663 C  CG2   . ILE A 1 184 ? 37.683  241.633 11.551  1.00 83.36  ? 184 ILE A CG2   1 
ATOM   1664 C  CD1   . ILE A 1 184 ? 39.173  243.805 9.686   1.00 96.82  ? 184 ILE A CD1   1 
ATOM   1665 H  HG12  . ILE A 1 184 ? 39.694  241.853 9.925   1.00 113.28 ? 184 ILE A HG12  1 
ATOM   1666 H  HG13  . ILE A 1 184 ? 39.005  242.143 8.525   1.00 113.28 ? 184 ILE A HG13  1 
ATOM   1667 H  HG21  . ILE A 1 184 ? 36.811  241.349 11.868  1.00 100.03 ? 184 ILE A HG21  1 
ATOM   1668 H  HG22  . ILE A 1 184 ? 38.351  240.967 11.778  1.00 100.03 ? 184 ILE A HG22  1 
ATOM   1669 H  HG23  . ILE A 1 184 ? 37.917  242.486 11.947  1.00 100.03 ? 184 ILE A HG23  1 
ATOM   1670 N  N     . PRO A 1 185 ? 36.033  239.004 10.853  1.00 92.31  ? 185 PRO A N     1 
ATOM   1671 C  CA    . PRO A 1 185 ? 34.868  238.452 11.549  1.00 87.61  ? 185 PRO A CA    1 
ATOM   1672 C  C     . PRO A 1 185 ? 34.329  239.424 12.588  1.00 86.30  ? 185 PRO A C     1 
ATOM   1673 O  O     . PRO A 1 185 ? 35.117  240.099 13.249  1.00 95.28  ? 185 PRO A O     1 
ATOM   1674 C  CB    . PRO A 1 185 ? 35.424  237.196 12.225  1.00 84.98  ? 185 PRO A CB    1 
ATOM   1675 C  CG    . PRO A 1 185 ? 36.752  236.945 11.581  1.00 87.15  ? 185 PRO A CG    1 
ATOM   1676 C  CD    . PRO A 1 185 ? 37.267  238.286 11.199  1.00 92.37  ? 185 PRO A CD    1 
ATOM   1677 N  N     . GLY A 1 186 ? 33.013  239.500 12.732  1.00 79.28  ? 186 GLY A N     1 
ATOM   1678 C  CA    . GLY A 1 186 ? 32.427  240.316 13.781  1.00 81.72  ? 186 GLY A CA    1 
ATOM   1679 C  C     . GLY A 1 186 ? 32.171  241.746 13.358  1.00 90.64  ? 186 GLY A C     1 
ATOM   1680 O  O     . GLY A 1 186 ? 32.029  242.632 14.199  1.00 94.13  ? 186 GLY A O     1 
ATOM   1681 N  N     . ILE A 1 187 ? 32.108  241.970 12.049  1.00 92.08  ? 187 ILE A N     1 
ATOM   1682 C  CA    . ILE A 1 187 ? 31.873  243.302 11.512  1.00 99.71  ? 187 ILE A CA    1 
ATOM   1683 C  C     . ILE A 1 187 ? 30.828  243.243 10.391  1.00 104.44 ? 187 ILE A C     1 
ATOM   1684 O  O     . ILE A 1 187 ? 31.116  242.806 9.268   1.00 101.08 ? 187 ILE A O     1 
ATOM   1685 C  CB    . ILE A 1 187 ? 33.176  243.929 10.987  1.00 104.06 ? 187 ILE A CB    1 
ATOM   1686 C  CG1   . ILE A 1 187 ? 34.019  242.848 10.328  1.00 108.41 ? 187 ILE A CG1   1 
ATOM   1687 C  CG2   . ILE A 1 187 ? 33.982  244.576 12.119  1.00 97.56  ? 187 ILE A CG2   1 
ATOM   1688 C  CD1   . ILE A 1 187 ? 34.928  243.368 9.271   1.00 115.47 ? 187 ILE A CD1   1 
ATOM   1689 H  HG12  . ILE A 1 187 ? 34.565  242.419 11.005  1.00 130.10 ? 187 ILE A HG12  1 
ATOM   1690 H  HG13  . ILE A 1 187 ? 33.429  242.196 9.919   1.00 130.10 ? 187 ILE A HG13  1 
ATOM   1691 H  HG21  . ILE A 1 187 ? 33.445  245.272 12.531  1.00 117.07 ? 187 ILE A HG21  1 
ATOM   1692 H  HG22  . ILE A 1 187 ? 34.205  243.898 12.775  1.00 117.07 ? 187 ILE A HG22  1 
ATOM   1693 H  HG23  . ILE A 1 187 ? 34.793  244.959 11.749  1.00 117.07 ? 187 ILE A HG23  1 
ATOM   1694 N  N     . GLY A 1 188 ? 29.611  243.684 10.709  1.00 107.91 ? 188 GLY A N     1 
ATOM   1695 C  CA    . GLY A 1 188 ? 28.485  243.599 9.794   1.00 107.87 ? 188 GLY A CA    1 
ATOM   1696 C  C     . GLY A 1 188 ? 28.732  244.314 8.485   1.00 111.08 ? 188 GLY A C     1 
ATOM   1697 O  O     . GLY A 1 188 ? 29.610  245.170 8.401   1.00 110.99 ? 188 GLY A O     1 
ATOM   1698 N  N     . SER A 1 189 ? 27.961  243.962 7.459   1.00 113.77 ? 189 SER A N     1 
ATOM   1699 C  CA    . SER A 1 189 ? 28.084  244.616 6.155   1.00 114.17 ? 189 SER A CA    1 
ATOM   1700 C  C     . SER A 1 189 ? 27.575  246.061 6.204   1.00 115.22 ? 189 SER A C     1 
ATOM   1701 O  O     . SER A 1 189 ? 27.803  246.840 5.278   1.00 120.62 ? 189 SER A O     1 
ATOM   1702 C  CB    . SER A 1 189 ? 27.340  243.823 5.076   1.00 110.92 ? 189 SER A CB    1 
ATOM   1703 O  OG    . SER A 1 189 ? 26.012  243.525 5.466   1.00 109.09 ? 189 SER A OG    1 
ATOM   1704 N  N     . VAL A 1 190 ? 26.888  246.405 7.291   1.00 111.07 ? 190 VAL A N     1 
ATOM   1705 C  CA    . VAL A 1 190 ? 26.526  247.787 7.589   1.00 108.68 ? 190 VAL A CA    1 
ATOM   1706 C  C     . VAL A 1 190 ? 27.720  248.518 8.202   1.00 109.53 ? 190 VAL A C     1 
ATOM   1707 O  O     . VAL A 1 190 ? 28.093  249.599 7.748   1.00 112.18 ? 190 VAL A O     1 
ATOM   1708 C  CB    . VAL A 1 190 ? 25.330  247.865 8.555   1.00 106.19 ? 190 VAL A CB    1 
ATOM   1709 C  CG1   . VAL A 1 190 ? 25.085  249.312 9.020   1.00 112.58 ? 190 VAL A CG1   1 
ATOM   1710 C  CG2   . VAL A 1 190 ? 24.093  247.246 7.919   1.00 101.81 ? 190 VAL A CG2   1 
ATOM   1711 H  HG11  . VAL A 1 190 ? 25.743  249.892 8.605   1.00 135.10 ? 190 VAL A HG11  1 
ATOM   1712 H  HG12  . VAL A 1 190 ? 24.192  249.582 8.754   1.00 135.10 ? 190 VAL A HG12  1 
ATOM   1713 H  HG13  . VAL A 1 190 ? 25.170  249.352 9.985   1.00 135.10 ? 190 VAL A HG13  1 
ATOM   1714 H  HG21  . VAL A 1 190 ? 24.319  246.929 7.031   1.00 122.17 ? 190 VAL A HG21  1 
ATOM   1715 H  HG22  . VAL A 1 190 ? 23.793  246.505 8.469   1.00 122.17 ? 190 VAL A HG22  1 
ATOM   1716 H  HG23  . VAL A 1 190 ? 23.397  247.919 7.863   1.00 122.17 ? 190 VAL A HG23  1 
ATOM   1717 N  N     . LEU A 1 191 ? 28.301  247.933 9.248   1.00 106.27 ? 191 LEU A N     1 
ATOM   1718 C  CA    . LEU A 1 191 ? 29.521  248.472 9.845   1.00 107.13 ? 191 LEU A CA    1 
ATOM   1719 C  C     . LEU A 1 191 ? 30.582  248.632 8.757   1.00 104.02 ? 191 LEU A C     1 
ATOM   1720 O  O     . LEU A 1 191 ? 31.372  249.575 8.773   1.00 99.49  ? 191 LEU A O     1 
ATOM   1721 C  CB    . LEU A 1 191 ? 30.035  247.559 10.965  1.00 104.20 ? 191 LEU A CB    1 
ATOM   1722 C  CG    . LEU A 1 191 ? 29.042  247.212 12.080  1.00 104.54 ? 191 LEU A CG    1 
ATOM   1723 C  CD1   . LEU A 1 191 ? 29.516  246.003 12.884  1.00 98.37  ? 191 LEU A CD1   1 
ATOM   1724 C  CD2   . LEU A 1 191 ? 28.823  248.417 12.985  1.00 108.82 ? 191 LEU A CD2   1 
ATOM   1725 N  N     . ALA A 1 192 ? 30.577  247.692 7.817   1.00 101.41 ? 192 ALA A N     1 
ATOM   1726 C  CA    . ALA A 1 192 ? 31.472  247.712 6.674   1.00 99.98  ? 192 ALA A CA    1 
ATOM   1727 C  C     . ALA A 1 192 ? 31.309  249.009 5.916   1.00 103.96 ? 192 ALA A C     1 
ATOM   1728 O  O     . ALA A 1 192 ? 32.213  249.843 5.907   1.00 102.44 ? 192 ALA A O     1 
ATOM   1729 C  CB    . ALA A 1 192 ? 31.197  246.528 5.761   1.00 98.60  ? 192 ALA A CB    1 
ATOM   1730 N  N     . ARG A 1 193 ? 30.140  249.168 5.300   1.00 112.46 ? 193 ARG A N     1 
ATOM   1731 C  CA    . ARG A 1 193 ? 29.804  250.352 4.515   1.00 126.52 ? 193 ARG A CA    1 
ATOM   1732 C  C     . ARG A 1 193 ? 30.153  251.672 5.211   1.00 136.62 ? 193 ARG A C     1 
ATOM   1733 O  O     . ARG A 1 193 ? 30.942  252.462 4.684   1.00 144.63 ? 193 ARG A O     1 
ATOM   1734 C  CB    . ARG A 1 193 ? 28.314  250.341 4.169   1.00 129.04 ? 193 ARG A CB    1 
ATOM   1735 C  CG    . ARG A 1 193 ? 27.877  251.436 3.185   1.00 137.52 ? 193 ARG A CG    1 
ATOM   1736 C  CD    . ARG A 1 193 ? 26.365  251.609 3.232   1.00 142.51 ? 193 ARG A CD    1 
ATOM   1737 N  NE    . ARG A 1 193 ? 25.726  250.401 3.755   1.00 142.39 ? 193 ARG A NE    1 
ATOM   1738 C  CZ    . ARG A 1 193 ? 24.459  250.326 4.152   1.00 138.78 ? 193 ARG A CZ    1 
ATOM   1739 N  NH1   . ARG A 1 193 ? 23.676  251.395 4.089   1.00 143.92 1 193 ARG A NH1   1 
ATOM   1740 N  NH2   . ARG A 1 193 ? 23.978  249.178 4.612   1.00 128.63 ? 193 ARG A NH2   1 
ATOM   1741 N  N     . ARG A 1 194 ? 29.573  251.910 6.389   1.00 134.70 ? 194 ARG A N     1 
ATOM   1742 C  CA    . ARG A 1 194 ? 29.728  253.200 7.066   1.00 136.72 ? 194 ARG A CA    1 
ATOM   1743 C  C     . ARG A 1 194 ? 31.168  253.428 7.537   1.00 134.06 ? 194 ARG A C     1 
ATOM   1744 O  O     . ARG A 1 194 ? 31.559  254.555 7.849   1.00 137.87 ? 194 ARG A O     1 
ATOM   1745 C  CB    . ARG A 1 194 ? 28.750  253.318 8.243   1.00 136.68 ? 194 ARG A CB    1 
ATOM   1746 C  CG    . ARG A 1 194 ? 29.062  252.427 9.422   1.00 138.59 ? 194 ARG A CG    1 
ATOM   1747 C  CD    . ARG A 1 194 ? 28.308  252.873 10.673  1.00 144.96 ? 194 ARG A CD    1 
ATOM   1748 N  NE    . ARG A 1 194 ? 26.984  252.262 10.786  1.00 148.28 ? 194 ARG A NE    1 
ATOM   1749 C  CZ    . ARG A 1 194 ? 26.223  252.323 11.877  1.00 146.66 ? 194 ARG A CZ    1 
ATOM   1750 N  NH1   . ARG A 1 194 ? 26.653  252.972 12.952  1.00 146.51 1 194 ARG A NH1   1 
ATOM   1751 N  NH2   . ARG A 1 194 ? 25.032  251.733 11.896  1.00 143.52 ? 194 ARG A NH2   1 
ATOM   1752 N  N     . LEU A 1 195 ? 31.951  252.354 7.583   1.00 128.18 ? 195 LEU A N     1 
ATOM   1753 C  CA    . LEU A 1 195 ? 33.396  252.458 7.755   1.00 126.41 ? 195 LEU A CA    1 
ATOM   1754 C  C     . LEU A 1 195 ? 34.065  252.509 6.384   1.00 131.41 ? 195 LEU A C     1 
ATOM   1755 O  O     . LEU A 1 195 ? 35.002  253.277 6.173   1.00 130.21 ? 195 LEU A O     1 
ATOM   1756 C  CB    . LEU A 1 195 ? 33.945  251.280 8.565   1.00 117.62 ? 195 LEU A CB    1 
ATOM   1757 C  CG    . LEU A 1 195 ? 33.755  251.293 10.086  1.00 113.21 ? 195 LEU A CG    1 
ATOM   1758 C  CD1   . LEU A 1 195 ? 33.664  249.883 10.631  1.00 100.23 ? 195 LEU A CD1   1 
ATOM   1759 C  CD2   . LEU A 1 195 ? 34.895  252.042 10.758  1.00 117.61 ? 195 LEU A CD2   1 
ATOM   1760 N  N     . ASN A 1 196 ? 33.549  251.692 5.463   1.00 134.06 ? 196 ASN A N     1 
ATOM   1761 C  CA    . ASN A 1 196 ? 34.122  251.485 4.129   1.00 137.57 ? 196 ASN A CA    1 
ATOM   1762 C  C     . ASN A 1 196 ? 34.494  252.767 3.405   1.00 149.19 ? 196 ASN A C     1 
ATOM   1763 O  O     . ASN A 1 196 ? 35.669  253.026 3.142   1.00 156.30 ? 196 ASN A O     1 
ATOM   1764 C  CB    . ASN A 1 196 ? 33.144  250.686 3.257   1.00 137.06 ? 196 ASN A CB    1 
ATOM   1765 C  CG    . ASN A 1 196 ? 33.703  249.335 2.834   1.00 138.88 ? 196 ASN A CG    1 
ATOM   1766 O  OD1   . ASN A 1 196 ? 34.852  249.239 2.400   1.00 145.87 ? 196 ASN A OD1   1 
ATOM   1767 N  ND2   . ASN A 1 196 ? 32.890  248.282 2.962   1.00 131.37 ? 196 ASN A ND2   1 
ATOM   1768 N  N     . GLU A 1 197 ? 33.488  253.565 3.068   1.00 149.33 ? 197 GLU A N     1 
ATOM   1769 C  CA    . GLU A 1 197 ? 33.741  254.822 2.388   1.00 152.19 ? 197 GLU A CA    1 
ATOM   1770 C  C     . GLU A 1 197 ? 34.480  255.772 3.321   1.00 150.19 ? 197 GLU A C     1 
ATOM   1771 O  O     . GLU A 1 197 ? 35.475  256.385 2.937   1.00 158.09 ? 197 GLU A O     1 
ATOM   1772 C  CB    . GLU A 1 197 ? 32.433  255.461 1.903   1.00 155.66 ? 197 GLU A CB    1 
ATOM   1773 C  CG    . GLU A 1 197 ? 31.604  254.592 0.962   1.00 154.43 ? 197 GLU A CG    1 
ATOM   1774 C  CD    . GLU A 1 197 ? 30.465  253.874 1.673   1.00 149.24 ? 197 GLU A CD    1 
ATOM   1775 O  OE1   . GLU A 1 197 ? 30.103  252.757 1.244   1.00 145.00 ? 197 GLU A OE1   1 
ATOM   1776 O  OE2   . GLU A 1 197 ? 29.928  254.432 2.655   1.00 148.49 1 197 GLU A OE2   1 
ATOM   1777 N  N     . LEU A 1 198 ? 34.004  255.862 4.558   1.00 138.87 ? 198 LEU A N     1 
ATOM   1778 C  CA    . LEU A 1 198 ? 34.413  256.930 5.466   1.00 135.47 ? 198 LEU A CA    1 
ATOM   1779 C  C     . LEU A 1 198 ? 35.830  256.773 6.020   1.00 126.83 ? 198 LEU A C     1 
ATOM   1780 O  O     . LEU A 1 198 ? 36.045  256.847 7.230   1.00 126.11 ? 198 LEU A O     1 
ATOM   1781 C  CB    . LEU A 1 198 ? 33.413  257.037 6.619   1.00 136.89 ? 198 LEU A CB    1 
ATOM   1782 C  CG    . LEU A 1 198 ? 32.000  257.519 6.269   1.00 140.53 ? 198 LEU A CG    1 
ATOM   1783 C  CD1   . LEU A 1 198 ? 31.300  256.581 5.283   1.00 138.26 ? 198 LEU A CD1   1 
ATOM   1784 C  CD2   . LEU A 1 198 ? 31.171  257.676 7.539   1.00 140.74 ? 198 LEU A CD2   1 
ATOM   1785 N  N     . GLY A 1 199 ? 36.797  256.574 5.130   1.00 123.81 ? 199 GLY A N     1 
ATOM   1786 C  CA    . GLY A 1 199 ? 38.194  256.556 5.518   1.00 124.82 ? 199 GLY A CA    1 
ATOM   1787 C  C     . GLY A 1 199 ? 38.821  255.177 5.483   1.00 127.52 ? 199 GLY A C     1 
ATOM   1788 O  O     . GLY A 1 199 ? 39.786  254.947 4.752   1.00 127.47 ? 199 GLY A O     1 
ATOM   1789 N  N     . ILE A 1 200 ? 38.261  254.256 6.269   1.00 128.66 ? 200 ILE A N     1 
ATOM   1790 C  CA    . ILE A 1 200 ? 38.840  252.926 6.458   1.00 122.01 ? 200 ILE A CA    1 
ATOM   1791 C  C     . ILE A 1 200 ? 38.269  251.875 5.501   1.00 118.18 ? 200 ILE A C     1 
ATOM   1792 O  O     . ILE A 1 200 ? 37.055  251.714 5.384   1.00 110.46 ? 200 ILE A O     1 
ATOM   1793 C  CB    . ILE A 1 200 ? 38.641  252.450 7.912   1.00 116.75 ? 200 ILE A CB    1 
ATOM   1794 C  CG1   . ILE A 1 200 ? 39.407  253.362 8.866   1.00 119.75 ? 200 ILE A CG1   1 
ATOM   1795 C  CG2   . ILE A 1 200 ? 39.141  251.026 8.092   1.00 112.12 ? 200 ILE A CG2   1 
ATOM   1796 C  CD1   . ILE A 1 200 ? 39.072  253.141 10.316  1.00 118.50 ? 200 ILE A CD1   1 
ATOM   1797 H  HG12  . ILE A 1 200 ? 40.357  253.205 8.753   1.00 143.70 ? 200 ILE A HG12  1 
ATOM   1798 H  HG13  . ILE A 1 200 ? 39.198  254.285 8.650   1.00 143.70 ? 200 ILE A HG13  1 
ATOM   1799 H  HG21  . ILE A 1 200 ? 39.003  250.758 9.013   1.00 134.54 ? 200 ILE A HG21  1 
ATOM   1800 H  HG22  . ILE A 1 200 ? 38.645  250.441 7.498   1.00 134.54 ? 200 ILE A HG22  1 
ATOM   1801 H  HG23  . ILE A 1 200 ? 40.086  250.994 7.876   1.00 134.54 ? 200 ILE A HG23  1 
ATOM   1802 N  N     . GLN A 1 201 ? 39.165  251.165 4.819   1.00 122.36 ? 201 GLN A N     1 
ATOM   1803 C  CA    . GLN A 1 201 ? 38.785  250.058 3.948   1.00 125.21 ? 201 GLN A CA    1 
ATOM   1804 C  C     . GLN A 1 201 ? 39.785  248.902 4.062   1.00 123.92 ? 201 GLN A C     1 
ATOM   1805 O  O     . GLN A 1 201 ? 39.565  247.826 3.505   1.00 119.96 ? 201 GLN A O     1 
ATOM   1806 C  CB    . GLN A 1 201 ? 38.669  250.525 2.492   1.00 133.34 ? 201 GLN A CB    1 
ATOM   1807 C  CG    . GLN A 1 201 ? 39.864  251.324 1.971   1.00 141.49 ? 201 GLN A CG    1 
ATOM   1808 C  CD    . GLN A 1 201 ? 39.733  252.823 2.215   1.00 146.35 ? 201 GLN A CD    1 
ATOM   1809 O  OE1   . GLN A 1 201 ? 38.628  253.343 2.388   1.00 145.83 ? 201 GLN A OE1   1 
ATOM   1810 N  NE2   . GLN A 1 201 ? 40.867  253.523 2.227   1.00 148.80 ? 201 GLN A NE2   1 
ATOM   1811 N  N     . LYS A 1 202 ? 40.882  249.138 4.782   1.00 126.14 ? 202 LYS A N     1 
ATOM   1812 C  CA    . LYS A 1 202 ? 41.868  248.098 5.087   1.00 122.93 ? 202 LYS A CA    1 
ATOM   1813 C  C     . LYS A 1 202 ? 42.092  248.018 6.592   1.00 115.92 ? 202 LYS A C     1 
ATOM   1814 O  O     . LYS A 1 202 ? 41.612  248.865 7.341   1.00 115.67 ? 202 LYS A O     1 
ATOM   1815 C  CB    . LYS A 1 202 ? 43.190  248.365 4.366   1.00 130.46 ? 202 LYS A CB    1 
ATOM   1816 C  CG    . LYS A 1 202 ? 43.183  248.010 2.878   1.00 135.57 ? 202 LYS A CG    1 
ATOM   1817 C  CD    . LYS A 1 202 ? 43.197  246.503 2.664   1.00 135.38 ? 202 LYS A CD    1 
ATOM   1818 C  CE    . LYS A 1 202 ? 43.377  246.148 1.195   1.00 137.88 ? 202 LYS A CE    1 
ATOM   1819 N  NZ    . LYS A 1 202 ? 43.481  244.673 0.998   1.00 136.89 1 202 LYS A NZ    1 
ATOM   1820 N  N     . LEU A 1 203 ? 42.829  247.007 7.036   1.00 111.68 ? 203 LEU A N     1 
ATOM   1821 C  CA    . LEU A 1 203 ? 42.916  246.721 8.463   1.00 110.49 ? 203 LEU A CA    1 
ATOM   1822 C  C     . LEU A 1 203 ? 43.977  247.559 9.162   1.00 115.53 ? 203 LEU A C     1 
ATOM   1823 O  O     . LEU A 1 203 ? 43.859  247.861 10.343  1.00 115.56 ? 203 LEU A O     1 
ATOM   1824 C  CB    . LEU A 1 203 ? 43.194  245.232 8.685   1.00 105.92 ? 203 LEU A CB    1 
ATOM   1825 C  CG    . LEU A 1 203 ? 42.963  244.668 10.090  1.00 97.75  ? 203 LEU A CG    1 
ATOM   1826 C  CD1   . LEU A 1 203 ? 44.191  244.850 10.952  1.00 98.12  ? 203 LEU A CD1   1 
ATOM   1827 C  CD2   . LEU A 1 203 ? 41.756  245.330 10.729  1.00 94.50  ? 203 LEU A CD2   1 
ATOM   1828 N  N     . ARG A 1 204 ? 45.018  247.931 8.431   1.00 120.33 ? 204 ARG A N     1 
ATOM   1829 C  CA    . ARG A 1 204 ? 46.077  248.755 8.999   1.00 123.40 ? 204 ARG A CA    1 
ATOM   1830 C  C     . ARG A 1 204 ? 45.629  250.206 9.074   1.00 121.60 ? 204 ARG A C     1 
ATOM   1831 O  O     . ARG A 1 204 ? 46.360  251.071 9.550   1.00 123.04 ? 204 ARG A O     1 
ATOM   1832 C  CB    . ARG A 1 204 ? 47.351  248.635 8.161   1.00 131.98 ? 204 ARG A CB    1 
ATOM   1833 C  CG    . ARG A 1 204 ? 47.145  248.977 6.691   1.00 139.44 ? 204 ARG A CG    1 
ATOM   1834 C  CD    . ARG A 1 204 ? 48.157  248.272 5.795   1.00 144.42 ? 204 ARG A CD    1 
ATOM   1835 N  NE    . ARG A 1 204 ? 49.494  248.853 5.886   1.00 151.86 ? 204 ARG A NE    1 
ATOM   1836 C  CZ    . ARG A 1 204 ? 50.568  248.347 5.287   1.00 154.54 ? 204 ARG A CZ    1 
ATOM   1837 N  NH1   . ARG A 1 204 ? 50.461  247.241 4.560   1.00 152.93 1 204 ARG A NH1   1 
ATOM   1838 N  NH2   . ARG A 1 204 ? 51.749  248.941 5.418   1.00 156.90 ? 204 ARG A NH2   1 
ATOM   1839 N  N     . ASP A 1 205 ? 44.416  250.463 8.601   1.00 120.36 ? 205 ASP A N     1 
ATOM   1840 C  CA    . ASP A 1 205 ? 43.924  251.825 8.460   1.00 123.06 ? 205 ASP A CA    1 
ATOM   1841 C  C     . ASP A 1 205 ? 43.401  252.383 9.776   1.00 118.64 ? 205 ASP A C     1 
ATOM   1842 O  O     . ASP A 1 205 ? 43.558  253.573 10.053  1.00 123.61 ? 205 ASP A O     1 
ATOM   1843 C  CB    . ASP A 1 205 ? 42.835  251.885 7.386   1.00 126.43 ? 205 ASP A CB    1 
ATOM   1844 C  CG    . ASP A 1 205 ? 43.387  251.670 5.985   1.00 128.65 ? 205 ASP A CG    1 
ATOM   1845 O  OD1   . ASP A 1 205 ? 44.429  250.996 5.850   1.00 131.76 ? 205 ASP A OD1   1 
ATOM   1846 O  OD2   . ASP A 1 205 ? 42.778  252.176 5.019   1.00 126.64 1 205 ASP A OD2   1 
ATOM   1847 N  N     . ILE A 1 206 ? 42.775  251.531 10.580  1.00 111.03 ? 206 ILE A N     1 
ATOM   1848 C  CA    . ILE A 1 206 ? 42.349  251.930 11.918  1.00 109.72 ? 206 ILE A CA    1 
ATOM   1849 C  C     . ILE A 1 206 ? 43.550  252.421 12.725  1.00 112.76 ? 206 ILE A C     1 
ATOM   1850 O  O     . ILE A 1 206 ? 43.437  253.356 13.521  1.00 112.11 ? 206 ILE A O     1 
ATOM   1851 C  CB    . ILE A 1 206 ? 41.665  250.775 12.670  1.00 101.76 ? 206 ILE A CB    1 
ATOM   1852 C  CG1   . ILE A 1 206 ? 42.567  249.542 12.645  1.00 97.18  ? 206 ILE A CG1   1 
ATOM   1853 C  CG2   . ILE A 1 206 ? 40.273  250.503 12.096  1.00 96.44  ? 206 ILE A CG2   1 
ATOM   1854 C  CD1   . ILE A 1 206 ? 41.873  248.270 12.974  1.00 94.99  ? 206 ILE A CD1   1 
ATOM   1855 H  HG12  . ILE A 1 206 ? 42.945  249.450 11.756  1.00 116.62 ? 206 ILE A HG12  1 
ATOM   1856 H  HG13  . ILE A 1 206 ? 43.280  249.664 13.292  1.00 116.62 ? 206 ILE A HG13  1 
ATOM   1857 H  HG21  . ILE A 1 206 ? 39.733  251.304 12.186  1.00 115.72 ? 206 ILE A HG21  1 
ATOM   1858 H  HG22  . ILE A 1 206 ? 40.358  250.266 11.159  1.00 115.72 ? 206 ILE A HG22  1 
ATOM   1859 H  HG23  . ILE A 1 206 ? 39.866  249.773 12.587  1.00 115.72 ? 206 ILE A HG23  1 
ATOM   1860 N  N     . LEU A 1 207 ? 44.697  251.787 12.500  1.00 114.00 ? 207 LEU A N     1 
ATOM   1861 C  CA    . LEU A 1 207 ? 45.962  252.202 13.103  1.00 119.68 ? 207 LEU A CA    1 
ATOM   1862 C  C     . LEU A 1 207 ? 46.235  253.709 12.958  1.00 134.87 ? 207 LEU A C     1 
ATOM   1863 O  O     . LEU A 1 207 ? 46.541  254.387 13.943  1.00 140.62 ? 207 LEU A O     1 
ATOM   1864 C  CB    . LEU A 1 207 ? 47.122  251.415 12.483  1.00 116.27 ? 207 LEU A CB    1 
ATOM   1865 C  CG    . LEU A 1 207 ? 47.236  249.904 12.685  1.00 108.59 ? 207 LEU A CG    1 
ATOM   1866 C  CD1   . LEU A 1 207 ? 48.140  249.304 11.611  1.00 108.73 ? 207 LEU A CD1   1 
ATOM   1867 C  CD2   . LEU A 1 207 ? 47.779  249.600 14.067  1.00 104.71 ? 207 LEU A CD2   1 
ATOM   1868 N  N     . SER A 1 208 ? 46.128  254.227 11.732  1.00 137.64 ? 208 SER A N     1 
ATOM   1869 C  CA    . SER A 1 208 ? 46.469  255.624 11.438  1.00 135.98 ? 208 SER A CA    1 
ATOM   1870 C  C     . SER A 1 208 ? 45.391  256.600 11.915  1.00 136.18 ? 208 SER A C     1 
ATOM   1871 O  O     . SER A 1 208 ? 45.702  257.710 12.347  1.00 139.54 ? 208 SER A O     1 
ATOM   1872 C  CB    . SER A 1 208 ? 46.723  255.803 9.938   1.00 133.27 ? 208 SER A CB    1 
ATOM   1873 O  OG    . SER A 1 208 ? 45.758  255.114 9.163   1.00 127.69 ? 208 SER A OG    1 
ATOM   1874 N  N     . LYS A 1 209 ? 44.129  256.180 11.832  1.00 134.57 ? 209 LYS A N     1 
ATOM   1875 C  CA    . LYS A 1 209 ? 43.011  256.922 12.415  1.00 136.64 ? 209 LYS A CA    1 
ATOM   1876 C  C     . LYS A 1 209 ? 43.078  256.871 13.940  1.00 144.18 ? 209 LYS A C     1 
ATOM   1877 O  O     . LYS A 1 209 ? 43.907  256.155 14.502  1.00 145.21 ? 209 LYS A O     1 
ATOM   1878 C  CB    . LYS A 1 209 ? 41.674  256.354 11.933  1.00 127.74 ? 209 LYS A CB    1 
ATOM   1879 C  CG    . LYS A 1 209 ? 41.406  256.545 10.452  1.00 127.92 ? 209 LYS A CG    1 
ATOM   1880 C  CD    . LYS A 1 209 ? 40.872  257.944 10.153  1.00 128.69 ? 209 LYS A CD    1 
ATOM   1881 C  CE    . LYS A 1 209 ? 40.602  258.142 8.663   1.00 126.81 ? 209 LYS A CE    1 
ATOM   1882 N  NZ    . LYS A 1 209 ? 41.812  258.599 7.916   1.00 128.82 1 209 LYS A NZ    1 
ATOM   1883 N  N     . ASN A 1 210 ? 42.202  257.616 14.612  1.00 148.47 ? 210 ASN A N     1 
ATOM   1884 C  CA    . ASN A 1 210 ? 42.214  257.645 16.074  1.00 149.33 ? 210 ASN A CA    1 
ATOM   1885 C  C     . ASN A 1 210 ? 40.890  257.262 16.730  1.00 150.12 ? 210 ASN A C     1 
ATOM   1886 O  O     . ASN A 1 210 ? 39.811  257.554 16.209  1.00 147.34 ? 210 ASN A O     1 
ATOM   1887 C  CB    . ASN A 1 210 ? 42.650  259.021 16.567  1.00 153.44 ? 210 ASN A CB    1 
ATOM   1888 C  CG    . ASN A 1 210 ? 44.158  259.169 16.599  1.00 154.74 ? 210 ASN A CG    1 
ATOM   1889 O  OD1   . ASN A 1 210 ? 44.846  258.421 17.299  1.00 154.07 ? 210 ASN A OD1   1 
ATOM   1890 N  ND2   . ASN A 1 210 ? 44.681  260.135 15.846  1.00 153.35 ? 210 ASN A ND2   1 
ATOM   1891 N  N     . TYR A 1 211 ? 41.013  256.629 17.898  1.00 154.28 ? 211 TYR A N     1 
ATOM   1892 C  CA    . TYR A 1 211 ? 39.925  255.938 18.604  1.00 155.33 ? 211 TYR A CA    1 
ATOM   1893 C  C     . TYR A 1 211 ? 38.618  256.723 18.696  1.00 158.97 ? 211 TYR A C     1 
ATOM   1894 O  O     . TYR A 1 211 ? 37.536  256.134 18.725  1.00 157.68 ? 211 TYR A O     1 
ATOM   1895 C  CB    . TYR A 1 211 ? 40.395  255.567 20.019  1.00 154.15 ? 211 TYR A CB    1 
ATOM   1896 C  CG    . TYR A 1 211 ? 39.637  254.427 20.671  1.00 148.48 ? 211 TYR A CG    1 
ATOM   1897 C  CD1   . TYR A 1 211 ? 39.837  253.111 20.265  1.00 144.36 ? 211 TYR A CD1   1 
ATOM   1898 C  CD2   . TYR A 1 211 ? 38.740  254.663 21.708  1.00 146.89 ? 211 TYR A CD2   1 
ATOM   1899 C  CE1   . TYR A 1 211 ? 39.154  252.065 20.861  1.00 138.90 ? 211 TYR A CE1   1 
ATOM   1900 C  CE2   . TYR A 1 211 ? 38.053  253.621 22.312  1.00 141.43 ? 211 TYR A CE2   1 
ATOM   1901 C  CZ    . TYR A 1 211 ? 38.265  252.326 21.884  1.00 137.17 ? 211 TYR A CZ    1 
ATOM   1902 O  OH    . TYR A 1 211 ? 37.587  251.287 22.478  1.00 131.21 ? 211 TYR A OH    1 
ATOM   1903 N  N     . ASN A 1 212 ? 38.720  258.047 18.748  1.00 162.05 ? 212 ASN A N     1 
ATOM   1904 C  CA    . ASN A 1 212 ? 37.542  258.901 18.835  1.00 160.91 ? 212 ASN A CA    1 
ATOM   1905 C  C     . ASN A 1 212 ? 36.612  258.715 17.652  1.00 156.82 ? 212 ASN A C     1 
ATOM   1906 O  O     . ASN A 1 212 ? 35.444  258.353 17.809  1.00 153.30 ? 212 ASN A O     1 
ATOM   1907 C  CB    . ASN A 1 212 ? 37.958  260.365 18.936  1.00 166.35 ? 212 ASN A CB    1 
ATOM   1908 C  CG    . ASN A 1 212 ? 38.689  260.665 20.218  1.00 167.69 ? 212 ASN A CG    1 
ATOM   1909 O  OD1   . ASN A 1 212 ? 38.559  259.931 21.199  1.00 164.63 ? 212 ASN A OD1   1 
ATOM   1910 N  ND2   . ASN A 1 212 ? 39.462  261.747 20.226  1.00 172.06 ? 212 ASN A ND2   1 
ATOM   1911 N  N     . GLU A 1 213 ? 37.147  258.953 16.462  1.00 157.46 ? 213 GLU A N     1 
ATOM   1912 C  CA    . GLU A 1 213 ? 36.358  258.869 15.245  1.00 156.91 ? 213 GLU A CA    1 
ATOM   1913 C  C     . GLU A 1 213 ? 36.009  257.431 14.880  1.00 149.70 ? 213 GLU A C     1 
ATOM   1914 O  O     . GLU A 1 213 ? 35.553  257.162 13.772  1.00 151.57 ? 213 GLU A O     1 
ATOM   1915 C  CB    . GLU A 1 213 ? 37.107  259.531 14.093  1.00 160.72 ? 213 GLU A CB    1 
ATOM   1916 C  CG    . GLU A 1 213 ? 36.330  259.555 12.798  1.00 168.25 ? 213 GLU A CG    1 
ATOM   1917 C  CD    . GLU A 1 213 ? 37.087  260.261 11.700  1.00 175.97 ? 213 GLU A CD    1 
ATOM   1918 O  OE1   . GLU A 1 213 ? 38.232  260.691 11.956  1.00 178.06 ? 213 GLU A OE1   1 
ATOM   1919 O  OE2   . GLU A 1 213 ? 36.542  260.378 10.584  1.00 178.90 1 213 GLU A OE2   1 
ATOM   1920 N  N     . LEU A 1 214 ? 36.226  256.510 15.811  1.00 140.64 ? 214 LEU A N     1 
ATOM   1921 C  CA    . LEU A 1 214 ? 35.953  255.106 15.554  1.00 134.33 ? 214 LEU A CA    1 
ATOM   1922 C  C     . LEU A 1 214 ? 35.047  254.537 16.640  1.00 138.92 ? 214 LEU A C     1 
ATOM   1923 O  O     . LEU A 1 214 ? 34.206  253.682 16.379  1.00 136.67 ? 214 LEU A O     1 
ATOM   1924 C  CB    . LEU A 1 214 ? 37.262  254.319 15.463  1.00 126.38 ? 214 LEU A CB    1 
ATOM   1925 C  CG    . LEU A 1 214 ? 37.170  252.827 15.129  1.00 117.64 ? 214 LEU A CG    1 
ATOM   1926 C  CD1   . LEU A 1 214 ? 36.134  252.571 14.043  1.00 118.20 ? 214 LEU A CD1   1 
ATOM   1927 C  CD2   . LEU A 1 214 ? 38.529  252.305 14.695  1.00 109.91 ? 214 LEU A CD2   1 
ATOM   1928 N  N     . GLU A 1 215 ? 35.204  255.035 17.860  1.00 145.17 ? 215 GLU A N     1 
ATOM   1929 C  CA    . GLU A 1 215 ? 34.365  254.603 18.973  1.00 144.30 ? 215 GLU A CA    1 
ATOM   1930 C  C     . GLU A 1 215 ? 32.906  255.015 18.748  1.00 147.21 ? 215 GLU A C     1 
ATOM   1931 O  O     . GLU A 1 215 ? 32.026  254.661 19.532  1.00 147.77 ? 215 GLU A O     1 
ATOM   1932 C  CB    . GLU A 1 215 ? 34.893  255.186 20.288  1.00 144.58 ? 215 GLU A CB    1 
ATOM   1933 C  CG    . GLU A 1 215 ? 34.409  254.475 21.541  1.00 139.11 ? 215 GLU A CG    1 
ATOM   1934 C  CD    . GLU A 1 215 ? 35.131  254.949 22.790  1.00 138.52 ? 215 GLU A CD    1 
ATOM   1935 O  OE1   . GLU A 1 215 ? 35.742  256.041 22.753  1.00 141.07 ? 215 GLU A OE1   1 
ATOM   1936 O  OE2   . GLU A 1 215 ? 35.096  254.224 23.806  1.00 135.07 1 215 GLU A OE2   1 
ATOM   1937 N  N     . LYS A 1 216 ? 32.660  255.762 17.670  1.00 146.74 ? 216 LYS A N     1 
ATOM   1938 C  CA    . LYS A 1 216 ? 31.315  256.219 17.325  1.00 141.34 ? 216 LYS A CA    1 
ATOM   1939 C  C     . LYS A 1 216 ? 30.827  255.681 15.973  1.00 137.38 ? 216 LYS A C     1 
ATOM   1940 O  O     . LYS A 1 216 ? 29.710  255.978 15.546  1.00 135.31 ? 216 LYS A O     1 
ATOM   1941 C  CB    . LYS A 1 216 ? 31.259  257.748 17.307  1.00 142.15 ? 216 LYS A CB    1 
ATOM   1942 C  CG    . LYS A 1 216 ? 31.464  258.422 18.656  1.00 138.06 ? 216 LYS A CG    1 
ATOM   1943 C  CD    . LYS A 1 216 ? 30.884  259.838 18.632  1.00 135.33 ? 216 LYS A CD    1 
ATOM   1944 C  CE    . LYS A 1 216 ? 31.510  260.726 19.690  1.00 131.10 ? 216 LYS A CE    1 
ATOM   1945 N  NZ    . LYS A 1 216 ? 32.939  261.020 19.381  1.00 128.53 1 216 LYS A NZ    1 
ATOM   1946 N  N     . ILE A 1 217 ? 31.666  254.899 15.300  1.00 136.21 ? 217 ILE A N     1 
ATOM   1947 C  CA    . ILE A 1 217 ? 31.303  254.291 14.019  1.00 134.06 ? 217 ILE A CA    1 
ATOM   1948 C  C     . ILE A 1 217 ? 30.991  252.810 14.191  1.00 128.90 ? 217 ILE A C     1 
ATOM   1949 O  O     . ILE A 1 217 ? 30.453  252.160 13.288  1.00 125.08 ? 217 ILE A O     1 
ATOM   1950 C  CB    . ILE A 1 217 ? 32.436  254.432 12.981  1.00 134.85 ? 217 ILE A CB    1 
ATOM   1951 C  CG1   . ILE A 1 217 ? 33.103  255.801 13.095  1.00 137.45 ? 217 ILE A CG1   1 
ATOM   1952 C  CG2   . ILE A 1 217 ? 31.918  254.184 11.564  1.00 136.25 ? 217 ILE A CG2   1 
ATOM   1953 C  CD1   . ILE A 1 217 ? 32.163  256.962 12.859  1.00 140.84 ? 217 ILE A CD1   1 
ATOM   1954 H  HG12  . ILE A 1 217 ? 33.472  255.895 13.987  1.00 164.94 ? 217 ILE A HG12  1 
ATOM   1955 H  HG13  . ILE A 1 217 ? 33.814  255.857 12.437  1.00 164.94 ? 217 ILE A HG13  1 
ATOM   1956 H  HG21  . ILE A 1 217 ? 32.654  254.280 10.938  1.00 163.50 ? 217 ILE A HG21  1 
ATOM   1957 H  HG22  . ILE A 1 217 ? 31.556  253.286 11.513  1.00 163.50 ? 217 ILE A HG22  1 
ATOM   1958 H  HG23  . ILE A 1 217 ? 31.226  254.832 11.363  1.00 163.50 ? 217 ILE A HG23  1 
ATOM   1959 N  N     . THR A 1 218 ? 31.333  252.282 15.362  1.00 125.94 ? 218 THR A N     1 
ATOM   1960 C  CA    . THR A 1 218 ? 31.281  250.848 15.569  1.00 120.51 ? 218 THR A CA    1 
ATOM   1961 C  C     . THR A 1 218 ? 31.168  250.464 17.046  1.00 117.44 ? 218 THR A C     1 
ATOM   1962 O  O     . THR A 1 218 ? 30.910  249.307 17.377  1.00 113.06 ? 218 THR A O     1 
ATOM   1963 C  CB    . THR A 1 218 ? 32.520  250.180 14.954  1.00 120.66 ? 218 THR A CB    1 
ATOM   1964 O  OG1   . THR A 1 218 ? 32.465  248.773 15.192  1.00 126.45 ? 218 THR A OG1   1 
ATOM   1965 C  CG2   . THR A 1 218 ? 33.798  250.750 15.549  1.00 115.68 ? 218 THR A CG2   1 
ATOM   1966 H  HG21  . THR A 1 218 ? 33.813  250.601 16.507  1.00 138.81 ? 218 THR A HG21  1 
ATOM   1967 H  HG22  . THR A 1 218 ? 34.570  250.319 15.151  1.00 138.81 ? 218 THR A HG22  1 
ATOM   1968 H  HG23  . THR A 1 218 ? 33.847  251.704 15.378  1.00 138.81 ? 218 THR A HG23  1 
ATOM   1969 N  N     . GLY A 1 219 ? 31.349  251.440 17.927  1.00 120.72 ? 219 GLY A N     1 
ATOM   1970 C  CA    . GLY A 1 219 ? 31.260  251.198 19.355  1.00 117.81 ? 219 GLY A CA    1 
ATOM   1971 C  C     . GLY A 1 219 ? 32.629  250.925 19.936  1.00 118.20 ? 219 GLY A C     1 
ATOM   1972 O  O     . GLY A 1 219 ? 33.574  250.650 19.198  1.00 118.86 ? 219 GLY A O     1 
ATOM   1973 N  N     . LYS A 1 220 ? 32.739  250.995 21.258  1.00 117.86 ? 220 LYS A N     1 
ATOM   1974 C  CA    . LYS A 1 220 ? 34.024  250.812 21.925  1.00 117.04 ? 220 LYS A CA    1 
ATOM   1975 C  C     . LYS A 1 220 ? 34.550  249.388 21.754  1.00 111.57 ? 220 LYS A C     1 
ATOM   1976 O  O     . LYS A 1 220 ? 35.749  249.177 21.556  1.00 109.44 ? 220 LYS A O     1 
ATOM   1977 C  CB    . LYS A 1 220 ? 33.903  251.161 23.410  1.00 118.53 ? 220 LYS A CB    1 
ATOM   1978 C  CG    . LYS A 1 220 ? 35.214  251.087 24.176  1.00 122.30 ? 220 LYS A CG    1 
ATOM   1979 C  CD    . LYS A 1 220 ? 35.057  251.580 25.609  1.00 126.54 ? 220 LYS A CD    1 
ATOM   1980 C  CE    . LYS A 1 220 ? 36.357  251.441 26.396  1.00 128.28 ? 220 LYS A CE    1 
ATOM   1981 N  NZ    . LYS A 1 220 ? 36.333  252.209 27.679  1.00 130.37 1 220 LYS A NZ    1 
ATOM   1982 N  N     . ALA A 1 221 ? 33.643  248.417 21.818  1.00 110.65 ? 221 ALA A N     1 
ATOM   1983 C  CA    . ALA A 1 221 ? 34.004  247.001 21.752  1.00 106.48 ? 221 ALA A CA    1 
ATOM   1984 C  C     . ALA A 1 221 ? 34.665  246.633 20.430  1.00 103.29 ? 221 ALA A C     1 
ATOM   1985 O  O     . ALA A 1 221 ? 35.784  246.114 20.411  1.00 101.98 ? 221 ALA A O     1 
ATOM   1986 C  CB    . ALA A 1 221 ? 32.778  246.134 21.976  1.00 103.56 ? 221 ALA A CB    1 
ATOM   1987 N  N     . LYS A 1 222 ? 33.966  246.887 19.329  1.00 100.30 ? 222 LYS A N     1 
ATOM   1988 C  CA    . LYS A 1 222 ? 34.525  246.605 18.017  1.00 100.87 ? 222 LYS A CA    1 
ATOM   1989 C  C     . LYS A 1 222 ? 35.748  247.480 17.742  1.00 107.47 ? 222 LYS A C     1 
ATOM   1990 O  O     . LYS A 1 222 ? 36.716  247.020 17.141  1.00 111.72 ? 222 LYS A O     1 
ATOM   1991 C  CB    . LYS A 1 222 ? 33.479  246.810 16.926  1.00 98.98  ? 222 LYS A CB    1 
ATOM   1992 C  CG    . LYS A 1 222 ? 32.208  246.024 17.113  1.00 96.21  ? 222 LYS A CG    1 
ATOM   1993 C  CD    . LYS A 1 222 ? 31.888  245.226 15.861  1.00 101.04 ? 222 LYS A CD    1 
ATOM   1994 C  CE    . LYS A 1 222 ? 30.474  244.660 15.917  1.00 104.07 ? 222 LYS A CE    1 
ATOM   1995 N  NZ    . LYS A 1 222 ? 30.182  244.013 17.230  1.00 103.21 1 222 LYS A NZ    1 
ATOM   1996 N  N     . ALA A 1 223 ? 35.703  248.736 18.186  1.00 109.12 ? 223 ALA A N     1 
ATOM   1997 C  CA    . ALA A 1 223 ? 36.822  249.659 17.993  1.00 109.66 ? 223 ALA A CA    1 
ATOM   1998 C  C     . ALA A 1 223 ? 38.104  249.112 18.613  1.00 103.82 ? 223 ALA A C     1 
ATOM   1999 O  O     . ALA A 1 223 ? 39.147  249.073 17.961  1.00 102.21 ? 223 ALA A O     1 
ATOM   2000 C  CB    . ALA A 1 223 ? 36.494  251.030 18.578  1.00 114.13 ? 223 ALA A CB    1 
ATOM   2001 N  N     . LEU A 1 224 ? 38.021  248.684 19.869  1.00 100.92 ? 224 LEU A N     1 
ATOM   2002 C  CA    . LEU A 1 224 ? 39.180  248.141 20.559  1.00 102.17 ? 224 LEU A CA    1 
ATOM   2003 C  C     . LEU A 1 224 ? 39.588  246.804 19.956  1.00 103.08 ? 224 LEU A C     1 
ATOM   2004 O  O     . LEU A 1 224 ? 40.765  246.445 19.932  1.00 108.80 ? 224 LEU A O     1 
ATOM   2005 C  CB    . LEU A 1 224 ? 38.894  247.976 22.048  1.00 103.46 ? 224 LEU A CB    1 
ATOM   2006 C  CG    . LEU A 1 224 ? 40.039  247.298 22.803  1.00 105.51 ? 224 LEU A CG    1 
ATOM   2007 C  CD1   . LEU A 1 224 ? 41.320  248.115 22.674  1.00 107.59 ? 224 LEU A CD1   1 
ATOM   2008 C  CD2   . LEU A 1 224 ? 39.682  247.061 24.263  1.00 105.43 ? 224 LEU A CD2   1 
ATOM   2009 N  N     . TYR A 1 225 ? 38.602  246.064 19.474  1.00 98.49  ? 225 TYR A N     1 
ATOM   2010 C  CA    . TYR A 1 225 ? 38.844  244.764 18.868  1.00 96.61  ? 225 TYR A CA    1 
ATOM   2011 C  C     . TYR A 1 225 ? 39.664  244.911 17.582  1.00 97.86  ? 225 TYR A C     1 
ATOM   2012 O  O     . TYR A 1 225 ? 40.671  244.223 17.396  1.00 97.79  ? 225 TYR A O     1 
ATOM   2013 C  CB    . TYR A 1 225 ? 37.498  244.070 18.633  1.00 93.45  ? 225 TYR A CB    1 
ATOM   2014 C  CG    . TYR A 1 225 ? 37.427  243.028 17.542  1.00 92.63  ? 225 TYR A CG    1 
ATOM   2015 C  CD1   . TYR A 1 225 ? 38.163  241.856 17.611  1.00 90.83  ? 225 TYR A CD1   1 
ATOM   2016 C  CD2   . TYR A 1 225 ? 36.566  243.199 16.461  1.00 98.53  ? 225 TYR A CD2   1 
ATOM   2017 C  CE1   . TYR A 1 225 ? 38.069  240.895 16.605  1.00 93.50  ? 225 TYR A CE1   1 
ATOM   2018 C  CE2   . TYR A 1 225 ? 36.464  242.253 15.461  1.00 99.07  ? 225 TYR A CE2   1 
ATOM   2019 C  CZ    . TYR A 1 225 ? 37.213  241.103 15.536  1.00 96.15  ? 225 TYR A CZ    1 
ATOM   2020 O  OH    . TYR A 1 225 ? 37.094  240.171 14.530  1.00 94.56  ? 225 TYR A OH    1 
ATOM   2021 N  N     . LEU A 1 226 ? 39.251  245.833 16.717  1.00 99.06  ? 226 LEU A N     1 
ATOM   2022 C  CA    . LEU A 1 226 ? 39.981  246.116 15.481  1.00 98.55  ? 226 LEU A CA    1 
ATOM   2023 C  C     . LEU A 1 226 ? 41.372  246.653 15.787  1.00 103.83 ? 226 LEU A C     1 
ATOM   2024 O  O     . LEU A 1 226 ? 42.357  246.258 15.163  1.00 109.22 ? 226 LEU A O     1 
ATOM   2025 C  CB    . LEU A 1 226 ? 39.217  247.122 14.622  1.00 95.57  ? 226 LEU A CB    1 
ATOM   2026 C  CG    . LEU A 1 226 ? 37.741  246.833 14.358  1.00 91.71  ? 226 LEU A CG    1 
ATOM   2027 C  CD1   . LEU A 1 226 ? 37.034  248.098 13.900  1.00 93.12  ? 226 LEU A CD1   1 
ATOM   2028 C  CD2   . LEU A 1 226 ? 37.571  245.711 13.342  1.00 89.93  ? 226 LEU A CD2   1 
ATOM   2029 N  N     . LEU A 1 227 ? 41.432  247.565 16.750  1.00 102.79 ? 227 LEU A N     1 
ATOM   2030 C  CA    . LEU A 1 227 ? 42.684  248.150 17.206  1.00 107.74 ? 227 LEU A CA    1 
ATOM   2031 C  C     . LEU A 1 227 ? 43.688  247.064 17.595  1.00 106.97 ? 227 LEU A C     1 
ATOM   2032 O  O     . LEU A 1 227 ? 44.847  247.099 17.183  1.00 110.49 ? 227 LEU A O     1 
ATOM   2033 C  CB    . LEU A 1 227 ? 42.407  249.097 18.382  1.00 114.86 ? 227 LEU A CB    1 
ATOM   2034 C  CG    . LEU A 1 227 ? 43.507  249.744 19.228  1.00 122.85 ? 227 LEU A CG    1 
ATOM   2035 C  CD1   . LEU A 1 227 ? 42.889  250.849 20.073  1.00 126.82 ? 227 LEU A CD1   1 
ATOM   2036 C  CD2   . LEU A 1 227 ? 44.209  248.729 20.128  1.00 122.67 ? 227 LEU A CD2   1 
ATOM   2037 N  N     . LYS A 1 228 ? 43.232  246.092 18.379  1.00 104.57 ? 228 LYS A N     1 
ATOM   2038 C  CA    . LYS A 1 228 ? 44.100  245.012 18.835  1.00 105.85 ? 228 LYS A CA    1 
ATOM   2039 C  C     . LYS A 1 228 ? 44.537  244.117 17.681  1.00 110.35 ? 228 LYS A C     1 
ATOM   2040 O  O     . LYS A 1 228 ? 45.710  243.756 17.579  1.00 115.63 ? 228 LYS A O     1 
ATOM   2041 C  CB    . LYS A 1 228 ? 43.405  244.179 19.912  1.00 99.51  ? 228 LYS A CB    1 
ATOM   2042 C  CG    . LYS A 1 228 ? 43.421  244.832 21.280  1.00 101.41 ? 228 LYS A CG    1 
ATOM   2043 C  CD    . LYS A 1 228 ? 43.102  243.836 22.373  1.00 99.29  ? 228 LYS A CD    1 
ATOM   2044 C  CE    . LYS A 1 228 ? 43.223  244.480 23.745  1.00 103.08 ? 228 LYS A CE    1 
ATOM   2045 N  NZ    . LYS A 1 228 ? 42.945  243.507 24.836  1.00 99.16  1 228 LYS A NZ    1 
ATOM   2046 N  N     . LEU A 1 229 ? 43.592  243.757 16.819  1.00 105.57 ? 229 LEU A N     1 
ATOM   2047 C  CA    . LEU A 1 229 ? 43.908  242.980 15.629  1.00 100.72 ? 229 LEU A CA    1 
ATOM   2048 C  C     . LEU A 1 229 ? 45.003  243.643 14.817  1.00 102.39 ? 229 LEU A C     1 
ATOM   2049 O  O     . LEU A 1 229 ? 46.016  243.018 14.497  1.00 101.16 ? 229 LEU A O     1 
ATOM   2050 C  CB    . LEU A 1 229 ? 42.675  242.813 14.753  1.00 101.73 ? 229 LEU A CB    1 
ATOM   2051 C  CG    . LEU A 1 229 ? 41.499  242.040 15.322  1.00 104.34 ? 229 LEU A CG    1 
ATOM   2052 C  CD1   . LEU A 1 229 ? 40.367  242.064 14.317  1.00 105.48 ? 229 LEU A CD1   1 
ATOM   2053 C  CD2   . LEU A 1 229 ? 41.914  240.615 15.630  1.00 105.51 ? 229 LEU A CD2   1 
ATOM   2054 N  N     . ALA A 1 230 ? 44.781  244.918 14.496  1.00 106.18 ? 230 ALA A N     1 
ATOM   2055 C  CA    . ALA A 1 230 ? 45.637  245.677 13.586  1.00 111.89 ? 230 ALA A CA    1 
ATOM   2056 C  C     . ALA A 1 230 ? 47.089  245.665 14.027  1.00 116.97 ? 230 ALA A C     1 
ATOM   2057 O  O     . ALA A 1 230 ? 48.000  245.669 13.197  1.00 119.21 ? 230 ALA A O     1 
ATOM   2058 C  CB    . ALA A 1 230 ? 45.136  247.110 13.467  1.00 113.35 ? 230 ALA A CB    1 
ATOM   2059 N  N     . GLN A 1 231 ? 47.294  245.646 15.341  1.00 117.68 ? 231 GLN A N     1 
ATOM   2060 C  CA    . GLN A 1 231 ? 48.631  245.611 15.908  1.00 116.70 ? 231 GLN A CA    1 
ATOM   2061 C  C     . GLN A 1 231 ? 48.964  244.221 16.441  1.00 110.31 ? 231 GLN A C     1 
ATOM   2062 O  O     . GLN A 1 231 ? 49.772  244.080 17.353  1.00 109.78 ? 231 GLN A O     1 
ATOM   2063 C  CB    . GLN A 1 231 ? 48.770  246.648 17.021  1.00 121.76 ? 231 GLN A CB    1 
ATOM   2064 C  CG    . GLN A 1 231 ? 50.219  246.933 17.399  1.00 134.05 ? 231 GLN A CG    1 
ATOM   2065 C  CD    . GLN A 1 231 ? 50.356  247.967 18.503  1.00 141.47 ? 231 GLN A CD    1 
ATOM   2066 O  OE1   . GLN A 1 231 ? 49.360  248.486 19.009  1.00 145.16 ? 231 GLN A OE1   1 
ATOM   2067 N  NE2   . GLN A 1 231 ? 51.597  248.269 18.885  1.00 141.51 ? 231 GLN A NE2   1 
ATOM   2068 N  N     . ASN A 1 232 ? 48.323  243.201 15.877  1.00 106.52 ? 232 ASN A N     1 
ATOM   2069 C  CA    . ASN A 1 232 ? 48.641  241.810 16.195  1.00 105.40 ? 232 ASN A CA    1 
ATOM   2070 C  C     . ASN A 1 232 ? 48.676  241.511 17.699  1.00 104.64 ? 232 ASN A C     1 
ATOM   2071 O  O     . ASN A 1 232 ? 49.397  240.620 18.146  1.00 103.96 ? 232 ASN A O     1 
ATOM   2072 C  CB    . ASN A 1 232 ? 49.986  241.437 15.558  1.00 108.67 ? 232 ASN A CB    1 
ATOM   2073 C  CG    . ASN A 1 232 ? 50.200  239.936 15.457  1.00 107.52 ? 232 ASN A CG    1 
ATOM   2074 O  OD1   . ASN A 1 232 ? 49.327  239.141 15.804  1.00 102.03 ? 232 ASN A OD1   1 
ATOM   2075 N  ND2   . ASN A 1 232 ? 51.369  239.543 14.965  1.00 113.86 ? 232 ASN A ND2   1 
ATOM   2076 N  N     . LYS A 1 233 ? 47.904  242.254 18.484  1.00 106.59 ? 233 LYS A N     1 
ATOM   2077 C  CA    . LYS A 1 233 ? 47.867  242.001 19.920  1.00 109.96 ? 233 LYS A CA    1 
ATOM   2078 C  C     . LYS A 1 233 ? 46.476  241.558 20.373  1.00 105.96 ? 233 LYS A C     1 
ATOM   2079 O  O     . LYS A 1 233 ? 46.025  241.890 21.472  1.00 107.13 ? 233 LYS A O     1 
ATOM   2080 C  CB    . LYS A 1 233 ? 48.343  243.236 20.708  1.00 117.25 ? 233 LYS A CB    1 
ATOM   2081 C  CG    . LYS A 1 233 ? 47.360  244.392 20.847  1.00 121.23 ? 233 LYS A CG    1 
ATOM   2082 C  CD    . LYS A 1 233 ? 47.936  245.447 21.796  1.00 126.41 ? 233 LYS A CD    1 
ATOM   2083 C  CE    . LYS A 1 233 ? 46.870  246.389 22.345  1.00 125.48 ? 233 LYS A CE    1 
ATOM   2084 N  NZ    . LYS A 1 233 ? 47.439  247.304 23.380  1.00 125.98 1 233 LYS A NZ    1 
ATOM   2085 N  N     . TYR A 1 234 ? 45.805  240.799 19.513  1.00 101.58 ? 234 TYR A N     1 
ATOM   2086 C  CA    . TYR A 1 234 ? 44.589  240.086 19.893  1.00 95.24  ? 234 TYR A CA    1 
ATOM   2087 C  C     . TYR A 1 234 ? 44.954  238.634 20.198  1.00 91.04  ? 234 TYR A C     1 
ATOM   2088 O  O     . TYR A 1 234 ? 45.715  238.019 19.448  1.00 92.21  ? 234 TYR A O     1 
ATOM   2089 C  CB    . TYR A 1 234 ? 43.530  240.161 18.778  1.00 96.81  ? 234 TYR A CB    1 
ATOM   2090 C  CG    . TYR A 1 234 ? 42.445  239.095 18.863  1.00 94.51  ? 234 TYR A CG    1 
ATOM   2091 C  CD1   . TYR A 1 234 ? 41.190  239.384 19.395  1.00 91.00  ? 234 TYR A CD1   1 
ATOM   2092 C  CD2   . TYR A 1 234 ? 42.678  237.795 18.405  1.00 92.64  ? 234 TYR A CD2   1 
ATOM   2093 C  CE1   . TYR A 1 234 ? 40.198  238.401 19.473  1.00 87.48  ? 234 TYR A CE1   1 
ATOM   2094 C  CE2   . TYR A 1 234 ? 41.702  236.810 18.488  1.00 88.81  ? 234 TYR A CE2   1 
ATOM   2095 C  CZ    . TYR A 1 234 ? 40.464  237.116 19.019  1.00 86.84  ? 234 TYR A CZ    1 
ATOM   2096 O  OH    . TYR A 1 234 ? 39.503  236.127 19.097  1.00 83.08  ? 234 TYR A OH    1 
ATOM   2097 N  N     . SER A 1 235 ? 44.424  238.091 21.294  1.00 88.92  ? 235 SER A N     1 
ATOM   2098 C  CA    . SER A 1 235 ? 44.589  236.667 21.592  1.00 85.32  ? 235 SER A CA    1 
ATOM   2099 C  C     . SER A 1 235 ? 43.574  236.149 22.601  1.00 80.07  ? 235 SER A C     1 
ATOM   2100 O  O     . SER A 1 235 ? 43.897  235.924 23.758  1.00 77.66  ? 235 SER A O     1 
ATOM   2101 C  CB    . SER A 1 235 ? 46.001  236.380 22.095  1.00 91.33  ? 235 SER A CB    1 
ATOM   2102 O  OG    . SER A 1 235 ? 46.793  235.799 21.070  1.00 96.04  ? 235 SER A OG    1 
ATOM   2103 N  N     . GLU A 1 236 ? 42.345  235.939 22.143  1.00 79.92  ? 236 GLU A N     1 
ATOM   2104 C  CA    . GLU A 1 236 ? 41.311  235.330 22.974  1.00 79.79  ? 236 GLU A CA    1 
ATOM   2105 C  C     . GLU A 1 236 ? 41.499  233.829 23.061  1.00 78.52  ? 236 GLU A C     1 
ATOM   2106 O  O     . GLU A 1 236 ? 41.794  233.171 22.059  1.00 86.68  ? 236 GLU A O     1 
ATOM   2107 C  CB    . GLU A 1 236 ? 39.907  235.640 22.439  1.00 83.04  ? 236 GLU A CB    1 
ATOM   2108 C  CG    . GLU A 1 236 ? 39.496  237.097 22.586  1.00 92.73  ? 236 GLU A CG    1 
ATOM   2109 C  CD    . GLU A 1 236 ? 40.023  237.713 23.867  1.00 103.21 ? 236 GLU A CD    1 
ATOM   2110 O  OE1   . GLU A 1 236 ? 39.652  237.227 24.959  1.00 105.16 ? 236 GLU A OE1   1 
ATOM   2111 O  OE2   . GLU A 1 236 ? 40.825  238.671 23.782  1.00 109.42 1 236 GLU A OE2   1 
ATOM   2112 N  N     . PRO A 1 237 ? 41.317  233.285 24.269  1.00 72.05  ? 237 PRO A N     1 
ATOM   2113 C  CA    . PRO A 1 237 ? 41.445  231.863 24.586  1.00 67.05  ? 237 PRO A CA    1 
ATOM   2114 C  C     . PRO A 1 237 ? 40.332  231.036 23.979  1.00 68.38  ? 237 PRO A C     1 
ATOM   2115 O  O     . PRO A 1 237 ? 39.215  231.534 23.799  1.00 66.48  ? 237 PRO A O     1 
ATOM   2116 C  CB    . PRO A 1 237 ? 41.352  231.842 26.113  1.00 61.17  ? 237 PRO A CB    1 
ATOM   2117 C  CG    . PRO A 1 237 ? 40.523  233.023 26.433  1.00 63.17  ? 237 PRO A CG    1 
ATOM   2118 C  CD    . PRO A 1 237 ? 40.964  234.073 25.461  1.00 69.64  ? 237 PRO A CD    1 
ATOM   2119 N  N     . VAL A 1 238 ? 40.636  229.780 23.674  1.00 66.42  ? 238 VAL A N     1 
ATOM   2120 C  CA    . VAL A 1 238 ? 39.612  228.842 23.257  1.00 60.81  ? 238 VAL A CA    1 
ATOM   2121 C  C     . VAL A 1 238 ? 38.853  228.384 24.497  1.00 60.19  ? 238 VAL A C     1 
ATOM   2122 O  O     . VAL A 1 238 ? 39.427  227.759 25.386  1.00 58.06  ? 238 VAL A O     1 
ATOM   2123 C  CB    . VAL A 1 238 ? 40.219  227.641 22.503  1.00 58.34  ? 238 VAL A CB    1 
ATOM   2124 C  CG1   . VAL A 1 238 ? 39.147  226.577 22.191  1.00 52.52  ? 238 VAL A CG1   1 
ATOM   2125 C  CG2   . VAL A 1 238 ? 40.933  228.127 21.230  1.00 58.99  ? 238 VAL A CG2   1 
ATOM   2126 H  HG11  . VAL A 1 238 ? 38.293  226.880 22.536  1.00 63.02  ? 238 VAL A HG11  1 
ATOM   2127 H  HG12  . VAL A 1 238 ? 39.092  226.457 21.230  1.00 63.02  ? 238 VAL A HG12  1 
ATOM   2128 H  HG13  . VAL A 1 238 ? 39.399  225.742 22.616  1.00 63.02  ? 238 VAL A HG13  1 
ATOM   2129 H  HG21  . VAL A 1 238 ? 40.849  229.092 21.170  1.00 70.79  ? 238 VAL A HG21  1 
ATOM   2130 H  HG22  . VAL A 1 238 ? 41.869  227.878 21.278  1.00 70.79  ? 238 VAL A HG22  1 
ATOM   2131 H  HG23  . VAL A 1 238 ? 40.519  227.711 20.457  1.00 70.79  ? 238 VAL A HG23  1 
ATOM   2132 N  N     . GLU A 1 239 ? 37.565  228.719 24.549  1.00 61.29  ? 239 GLU A N     1 
ATOM   2133 C  CA    . GLU A 1 239 ? 36.702  228.407 25.687  1.00 62.01  ? 239 GLU A CA    1 
ATOM   2134 C  C     . GLU A 1 239 ? 35.334  227.920 25.226  1.00 59.71  ? 239 GLU A C     1 
ATOM   2135 O  O     . GLU A 1 239 ? 34.578  228.701 24.665  1.00 55.67  ? 239 GLU A O     1 
ATOM   2136 C  CB    . GLU A 1 239 ? 36.509  229.647 26.574  1.00 71.58  ? 239 GLU A CB    1 
ATOM   2137 C  CG    . GLU A 1 239 ? 37.331  229.648 27.847  1.00 93.61  ? 239 GLU A CG    1 
ATOM   2138 C  CD    . GLU A 1 239 ? 37.084  228.412 28.696  1.00 104.20 ? 239 GLU A CD    1 
ATOM   2139 O  OE1   . GLU A 1 239 ? 35.935  228.228 29.160  1.00 109.52 ? 239 GLU A OE1   1 
ATOM   2140 O  OE2   . GLU A 1 239 ? 38.038  227.621 28.892  1.00 102.23 1 239 GLU A OE2   1 
ATOM   2141 N  N     . ASN A 1 240 ? 34.986  226.662 25.478  1.00 63.99  ? 240 ASN A N     1 
ATOM   2142 C  CA    . ASN A 1 240 ? 33.649  226.206 25.122  1.00 63.88  ? 240 ASN A CA    1 
ATOM   2143 C  C     . ASN A 1 240 ? 32.601  226.869 25.989  1.00 62.80  ? 240 ASN A C     1 
ATOM   2144 O  O     . ASN A 1 240 ? 32.710  226.852 27.200  1.00 69.12  ? 240 ASN A O     1 
ATOM   2145 C  CB    . ASN A 1 240 ? 33.519  224.692 25.248  1.00 69.12  ? 240 ASN A CB    1 
ATOM   2146 C  CG    . ASN A 1 240 ? 32.388  224.141 24.389  1.00 78.92  ? 240 ASN A CG    1 
ATOM   2147 O  OD1   . ASN A 1 240 ? 31.462  224.867 24.026  1.00 85.17  ? 240 ASN A OD1   1 
ATOM   2148 N  ND2   . ASN A 1 240 ? 32.470  222.860 24.045  1.00 76.60  ? 240 ASN A ND2   1 
ATOM   2149 N  N     . LYS A 1 241 ? 31.584  227.457 25.375  1.00 60.50  ? 241 LYS A N     1 
ATOM   2150 C  CA    . LYS A 1 241 ? 30.522  228.084 26.149  1.00 61.02  ? 241 LYS A CA    1 
ATOM   2151 C  C     . LYS A 1 241 ? 29.248  227.272 26.046  1.00 61.66  ? 241 LYS A C     1 
ATOM   2152 O  O     . LYS A 1 241 ? 28.908  226.769 24.974  1.00 60.77  ? 241 LYS A O     1 
ATOM   2153 C  CB    . LYS A 1 241 ? 30.265  229.517 25.680  1.00 61.56  ? 241 LYS A CB    1 
ATOM   2154 C  CG    . LYS A 1 241 ? 31.521  230.364 25.494  1.00 70.60  ? 241 LYS A CG    1 
ATOM   2155 C  CD    . LYS A 1 241 ? 31.407  231.227 24.235  1.00 78.73  ? 241 LYS A CD    1 
ATOM   2156 C  CE    . LYS A 1 241 ? 32.749  231.824 23.838  1.00 82.88  ? 241 LYS A CE    1 
ATOM   2157 N  NZ    . LYS A 1 241 ? 32.630  232.688 22.625  1.00 86.00  1 241 LYS A NZ    1 
ATOM   2158 N  N     . SER A 1 242 ? 28.545  227.142 27.164  1.00 58.51  ? 242 SER A N     1 
ATOM   2159 C  CA    . SER A 1 242 ? 27.247  226.475 27.177  1.00 56.88  ? 242 SER A CA    1 
ATOM   2160 C  C     . SER A 1 242 ? 26.203  227.337 26.476  1.00 53.33  ? 242 SER A C     1 
ATOM   2161 O  O     . SER A 1 242 ? 26.310  228.563 26.452  1.00 53.82  ? 242 SER A O     1 
ATOM   2162 C  CB    . SER A 1 242 ? 26.798  226.188 28.610  1.00 58.03  ? 242 SER A CB    1 
ATOM   2163 O  OG    . SER A 1 242 ? 26.561  227.400 29.317  1.00 64.56  ? 242 SER A OG    1 
ATOM   2164 N  N     . ARG A 1 243 ? 25.186  226.694 25.920  1.00 53.83  ? 243 ARG A N     1 
ATOM   2165 C  CA    . ARG A 1 243 ? 24.083  227.411 25.290  1.00 57.87  ? 243 ARG A CA    1 
ATOM   2166 C  C     . ARG A 1 243 ? 23.300  228.209 26.335  1.00 53.97  ? 243 ARG A C     1 
ATOM   2167 O  O     . ARG A 1 243 ? 23.087  227.710 27.431  1.00 52.77  ? 243 ARG A O     1 
ATOM   2168 C  CB    . ARG A 1 243 ? 23.162  226.434 24.558  1.00 65.11  ? 243 ARG A CB    1 
ATOM   2169 C  CG    . ARG A 1 243 ? 22.904  226.827 23.117  1.00 75.20  ? 243 ARG A CG    1 
ATOM   2170 C  CD    . ARG A 1 243 ? 21.426  226.765 22.790  1.00 80.73  ? 243 ARG A CD    1 
ATOM   2171 N  NE    . ARG A 1 243 ? 21.082  225.670 21.883  1.00 81.40  ? 243 ARG A NE    1 
ATOM   2172 C  CZ    . ARG A 1 243 ? 21.882  225.179 20.938  1.00 76.08  ? 243 ARG A CZ    1 
ATOM   2173 N  NH1   . ARG A 1 243 ? 23.094  225.689 20.745  1.00 76.46  1 243 ARG A NH1   1 
ATOM   2174 N  NH2   . ARG A 1 243 ? 21.460  224.179 20.175  1.00 67.98  ? 243 ARG A NH2   1 
ATOM   2175 N  N     . LYS A 1 244 ? 22.885  229.435 26.001  1.00 49.36  ? 244 LYS A N     1 
ATOM   2176 C  CA    . LYS A 1 244 ? 22.176  230.281 26.963  1.00 50.82  ? 244 LYS A CA    1 
ATOM   2177 C  C     . LYS A 1 244 ? 20.685  230.371 26.692  1.00 44.19  ? 244 LYS A C     1 
ATOM   2178 O  O     . LYS A 1 244 ? 19.933  230.855 27.525  1.00 53.19  ? 244 LYS A O     1 
ATOM   2179 C  CB    . LYS A 1 244 ? 22.718  231.723 26.981  1.00 51.75  ? 244 LYS A CB    1 
ATOM   2180 C  CG    . LYS A 1 244 ? 24.216  231.920 26.978  1.00 53.78  ? 244 LYS A CG    1 
ATOM   2181 C  CD    . LYS A 1 244 ? 24.913  231.208 28.103  1.00 51.70  ? 244 LYS A CD    1 
ATOM   2182 C  CE    . LYS A 1 244 ? 26.408  231.534 28.067  1.00 56.74  ? 244 LYS A CE    1 
ATOM   2183 N  NZ    . LYS A 1 244 ? 27.246  230.364 28.446  1.00 53.87  1 244 LYS A NZ    1 
ATOM   2184 N  N     . SER A 1 245 ? 20.246  229.976 25.511  1.00 43.33  ? 245 SER A N     1 
ATOM   2185 C  CA    . SER A 1 245 ? 18.843  230.179 25.173  1.00 43.23  ? 245 SER A CA    1 
ATOM   2186 C  C     . SER A 1 245 ? 18.324  229.030 24.351  1.00 47.71  ? 245 SER A C     1 
ATOM   2187 O  O     . SER A 1 245 ? 19.095  228.270 23.789  1.00 41.52  ? 245 SER A O     1 
ATOM   2188 C  CB    . SER A 1 245 ? 18.649  231.484 24.419  1.00 45.40  ? 245 SER A CB    1 
ATOM   2189 O  OG    . SER A 1 245 ? 19.235  231.409 23.145  1.00 62.22  ? 245 SER A OG    1 
ATOM   2190 N  N     . HIS A 1 246 ? 17.007  228.894 24.302  1.00 39.36  ? 246 HIS A N     1 
ATOM   2191 C  CA    . HIS A 1 246 ? 16.388  227.801 23.597  1.00 40.01  ? 246 HIS A CA    1 
ATOM   2192 C  C     . HIS A 1 246 ? 15.078  228.324 23.076  1.00 41.90  ? 246 HIS A C     1 
ATOM   2193 O  O     . HIS A 1 246 ? 14.248  228.819 23.850  1.00 35.82  ? 246 HIS A O     1 
ATOM   2194 C  CB    . HIS A 1 246 ? 16.210  226.592 24.510  1.00 37.16  ? 246 HIS A CB    1 
ATOM   2195 C  CG    . HIS A 1 246 ? 17.499  226.069 25.052  1.00 53.04  ? 246 HIS A CG    1 
ATOM   2196 N  ND1   . HIS A 1 246 ? 17.985  226.409 26.300  1.00 62.85  ? 246 HIS A ND1   1 
ATOM   2197 C  CD2   . HIS A 1 246 ? 18.437  225.255 24.501  1.00 57.40  ? 246 HIS A CD2   1 
ATOM   2198 C  CE1   . HIS A 1 246 ? 19.137  225.817 26.503  1.00 68.44  ? 246 HIS A CE1   1 
ATOM   2199 N  NE2   . HIS A 1 246 ? 19.445  225.103 25.425  1.00 63.59  ? 246 HIS A NE2   1 
ATOM   2200 N  N     . GLY A 1 247 ? 14.917  228.256 21.751  1.00 38.84  ? 247 GLY A N     1 
ATOM   2201 C  CA    . GLY A 1 247 ? 13.782  228.873 21.104  1.00 29.33  ? 247 GLY A CA    1 
ATOM   2202 C  C     . GLY A 1 247 ? 13.065  227.885 20.243  1.00 40.81  ? 247 GLY A C     1 
ATOM   2203 O  O     . GLY A 1 247 ? 13.581  226.812 19.917  1.00 41.15  ? 247 GLY A O     1 
ATOM   2204 N  N     . ARG A 1 248 ? 11.858  228.258 19.869  1.00 41.93  ? 248 ARG A N     1 
ATOM   2205 C  CA    . ARG A 1 248 ? 11.114  227.506 18.885  1.00 43.09  ? 248 ARG A CA    1 
ATOM   2206 C  C     . ARG A 1 248 ? 10.337  228.488 18.017  1.00 40.84  ? 248 ARG A C     1 
ATOM   2207 O  O     . ARG A 1 248 ? 9.726   229.426 18.533  1.00 39.56  ? 248 ARG A O     1 
ATOM   2208 C  CB    . ARG A 1 248 ? 10.182  226.517 19.566  1.00 40.54  ? 248 ARG A CB    1 
ATOM   2209 C  CG    . ARG A 1 248 ? 9.535   225.555 18.599  1.00 43.23  ? 248 ARG A CG    1 
ATOM   2210 C  CD    . ARG A 1 248 ? 10.564  224.579 18.084  1.00 39.85  ? 248 ARG A CD    1 
ATOM   2211 N  NE    . ARG A 1 248 ? 9.979   223.572 17.225  1.00 36.74  ? 248 ARG A NE    1 
ATOM   2212 C  CZ    . ARG A 1 248 ? 9.688   223.780 15.937  1.00 55.11  ? 248 ARG A CZ    1 
ATOM   2213 N  NH1   . ARG A 1 248 ? 9.918   224.967 15.370  1.00 55.43  1 248 ARG A NH1   1 
ATOM   2214 N  NH2   . ARG A 1 248 ? 9.154   222.807 15.214  1.00 53.14  ? 248 ARG A NH2   1 
ATOM   2215 N  N     . TYR A 1 249 ? 10.374  228.303 16.704  1.00 47.27  ? 249 TYR A N     1 
ATOM   2216 C  CA    . TYR A 1 249 ? 9.615   229.178 15.803  1.00 50.89  ? 249 TYR A CA    1 
ATOM   2217 C  C     . TYR A 1 249 ? 8.739   228.384 14.846  1.00 50.94  ? 249 TYR A C     1 
ATOM   2218 O  O     . TYR A 1 249 ? 9.166   227.370 14.289  1.00 55.76  ? 249 TYR A O     1 
ATOM   2219 C  CB    . TYR A 1 249 ? 10.541  230.082 14.989  1.00 51.48  ? 249 TYR A CB    1 
ATOM   2220 C  CG    . TYR A 1 249 ? 11.403  231.053 15.772  1.00 54.68  ? 249 TYR A CG    1 
ATOM   2221 C  CD1   . TYR A 1 249 ? 12.496  230.606 16.513  1.00 54.72  ? 249 TYR A CD1   1 
ATOM   2222 C  CD2   . TYR A 1 249 ? 11.164  232.424 15.721  1.00 61.08  ? 249 TYR A CD2   1 
ATOM   2223 C  CE1   . TYR A 1 249 ? 13.312  231.499 17.215  1.00 53.52  ? 249 TYR A CE1   1 
ATOM   2224 C  CE2   . TYR A 1 249 ? 11.970  233.321 16.422  1.00 62.45  ? 249 TYR A CE2   1 
ATOM   2225 C  CZ    . TYR A 1 249 ? 13.044  232.852 17.166  1.00 55.85  ? 249 TYR A CZ    1 
ATOM   2226 O  OH    . TYR A 1 249 ? 13.862  233.735 17.855  1.00 57.94  ? 249 TYR A OH    1 
ATOM   2227 N  N     . LEU A 1 250 ? 7.513   228.859 14.661  1.00 49.35  ? 250 LEU A N     1 
ATOM   2228 C  CA    . LEU A 1 250 ? 6.553   228.224 13.768  1.00 46.81  ? 250 LEU A CA    1 
ATOM   2229 C  C     . LEU A 1 250 ? 5.982   229.262 12.827  1.00 50.15  ? 250 LEU A C     1 
ATOM   2230 O  O     . LEU A 1 250 ? 5.781   230.405 13.221  1.00 51.16  ? 250 LEU A O     1 
ATOM   2231 C  CB    . LEU A 1 250 ? 5.413   227.581 14.547  1.00 48.34  ? 250 LEU A CB    1 
ATOM   2232 C  CG    . LEU A 1 250 ? 5.768   226.674 15.722  1.00 53.06  ? 250 LEU A CG    1 
ATOM   2233 C  CD1   . LEU A 1 250 ? 4.516   226.270 16.441  1.00 55.33  ? 250 LEU A CD1   1 
ATOM   2234 C  CD2   . LEU A 1 250 ? 6.521   225.435 15.254  1.00 57.55  ? 250 LEU A CD2   1 
ATOM   2235 N  N     . THR A 1 251 ? 5.709   228.862 11.589  1.00 43.09  ? 251 THR A N     1 
ATOM   2236 C  CA    . THR A 1 251 ? 4.955   229.705 10.677  1.00 42.32  ? 251 THR A CA    1 
ATOM   2237 C  C     . THR A 1 251 ? 3.464   229.423 10.880  1.00 38.61  ? 251 THR A C     1 
ATOM   2238 O  O     . THR A 1 251 ? 3.042   228.266 10.969  1.00 40.36  ? 251 THR A O     1 
ATOM   2239 C  CB    . THR A 1 251 ? 5.391   229.463 9.212   1.00 49.77  ? 251 THR A CB    1 
ATOM   2240 O  OG1   . THR A 1 251 ? 6.765   229.841 9.077   1.00 54.78  ? 251 THR A OG1   1 
ATOM   2241 C  CG2   . THR A 1 251 ? 4.557   230.272 8.217   1.00 46.53  ? 251 THR A CG2   1 
ATOM   2242 H  HG21  . THR A 1 251 ? 4.858   230.096 7.312   1.00 55.84  ? 251 THR A HG21  1 
ATOM   2243 H  HG22  . THR A 1 251 ? 3.622   230.027 8.292   1.00 55.84  ? 251 THR A HG22  1 
ATOM   2244 H  HG23  . THR A 1 251 ? 4.650   231.220 8.401   1.00 55.84  ? 251 THR A HG23  1 
ATOM   2245 N  N     . LEU A 1 252 ? 2.676   230.488 11.005  1.00 39.53  ? 252 LEU A N     1 
ATOM   2246 C  CA    . LEU A 1 252 ? 1.226   230.364 11.126  1.00 42.83  ? 252 LEU A CA    1 
ATOM   2247 C  C     . LEU A 1 252 ? 0.647   229.798 9.823   1.00 50.35  ? 252 LEU A C     1 
ATOM   2248 O  O     . LEU A 1 252 ? 1.172   230.054 8.746   1.00 47.75  ? 252 LEU A O     1 
ATOM   2249 C  CB    . LEU A 1 252 ? 0.608   231.722 11.457  1.00 37.66  ? 252 LEU A CB    1 
ATOM   2250 C  CG    . LEU A 1 252 ? 1.211   232.307 12.751  1.00 46.34  ? 252 LEU A CG    1 
ATOM   2251 C  CD1   . LEU A 1 252 ? 0.669   233.689 13.096  1.00 42.97  ? 252 LEU A CD1   1 
ATOM   2252 C  CD2   . LEU A 1 252 ? 1.018   231.334 13.921  1.00 33.97  ? 252 LEU A CD2   1 
ATOM   2253 N  N     . PRO A 1 253 ? -0.428  229.007 9.920   1.00 55.24  ? 253 PRO A N     1 
ATOM   2254 C  CA    . PRO A 1 253 ? -1.057  228.460 8.721   1.00 48.57  ? 253 PRO A CA    1 
ATOM   2255 C  C     . PRO A 1 253 ? -1.462  229.564 7.757   1.00 55.51  ? 253 PRO A C     1 
ATOM   2256 O  O     . PRO A 1 253 ? -1.521  229.341 6.539   1.00 60.75  ? 253 PRO A O     1 
ATOM   2257 C  CB    . PRO A 1 253 ? -2.290  227.732 9.272   1.00 47.24  ? 253 PRO A CB    1 
ATOM   2258 C  CG    . PRO A 1 253 ? -2.517  228.304 10.615  1.00 51.08  ? 253 PRO A CG    1 
ATOM   2259 C  CD    . PRO A 1 253 ? -1.156  228.626 11.141  1.00 53.76  ? 253 PRO A CD    1 
ATOM   2260 N  N     . TYR A 1 254 ? -1.733  230.741 8.318   1.00 52.68  ? 254 TYR A N     1 
ATOM   2261 C  CA    . TYR A 1 254 ? -2.093  231.938 7.562   1.00 48.09  ? 254 TYR A CA    1 
ATOM   2262 C  C     . TYR A 1 254 ? -1.862  233.157 8.447   1.00 52.50  ? 254 TYR A C     1 
ATOM   2263 O  O     . TYR A 1 254 ? -1.855  233.054 9.678   1.00 51.19  ? 254 TYR A O     1 
ATOM   2264 C  CB    . TYR A 1 254 ? -3.554  231.888 7.089   1.00 49.93  ? 254 TYR A CB    1 
ATOM   2265 C  CG    . TYR A 1 254 ? -4.578  231.818 8.198   1.00 55.52  ? 254 TYR A CG    1 
ATOM   2266 C  CD1   . TYR A 1 254 ? -5.064  232.978 8.799   1.00 51.31  ? 254 TYR A CD1   1 
ATOM   2267 C  CD2   . TYR A 1 254 ? -5.068  230.593 8.645   1.00 57.57  ? 254 TYR A CD2   1 
ATOM   2268 C  CE1   . TYR A 1 254 ? -6.002  232.923 9.810   1.00 58.79  ? 254 TYR A CE1   1 
ATOM   2269 C  CE2   . TYR A 1 254 ? -6.021  230.523 9.665   1.00 56.07  ? 254 TYR A CE2   1 
ATOM   2270 C  CZ    . TYR A 1 254 ? -6.477  231.693 10.252  1.00 60.05  ? 254 TYR A CZ    1 
ATOM   2271 O  OH    . TYR A 1 254 ? -7.421  231.650 11.268  1.00 52.53  ? 254 TYR A OH    1 
ATOM   2272 N  N     . ASN A 1 255 ? -1.700  234.312 7.818   1.00 58.06  ? 255 ASN A N     1 
ATOM   2273 C  CA    . ASN A 1 255 ? -1.388  235.526 8.543   1.00 56.16  ? 255 ASN A CA    1 
ATOM   2274 C  C     . ASN A 1 255 ? -2.553  236.022 9.383   1.00 53.21  ? 255 ASN A C     1 
ATOM   2275 O  O     . ASN A 1 255 ? -3.681  236.062 8.930   1.00 60.72  ? 255 ASN A O     1 
ATOM   2276 C  CB    . ASN A 1 255 ? -0.931  236.593 7.557   1.00 53.08  ? 255 ASN A CB    1 
ATOM   2277 C  CG    . ASN A 1 255 ? 0.436   236.291 6.994   1.00 55.47  ? 255 ASN A CG    1 
ATOM   2278 O  OD1   . ASN A 1 255 ? 1.150   235.412 7.507   1.00 50.65  ? 255 ASN A OD1   1 
ATOM   2279 N  ND2   . ASN A 1 255 ? 0.825   237.021 5.948   1.00 58.66  ? 255 ASN A ND2   1 
ATOM   2280 N  N     . THR A 1 256 ? -2.286  236.398 10.623  1.00 54.18  ? 256 THR A N     1 
ATOM   2281 C  CA    . THR A 1 256 ? -3.377  236.801 11.505  1.00 56.36  ? 256 THR A CA    1 
ATOM   2282 C  C     . THR A 1 256 ? -2.935  237.721 12.631  1.00 52.14  ? 256 THR A C     1 
ATOM   2283 O  O     . THR A 1 256 ? -1.768  237.695 13.039  1.00 51.75  ? 256 THR A O     1 
ATOM   2284 C  CB    . THR A 1 256 ? -4.066  235.572 12.118  1.00 60.37  ? 256 THR A CB    1 
ATOM   2285 O  OG1   . THR A 1 256 ? -5.323  235.971 12.684  1.00 64.00  ? 256 THR A OG1   1 
ATOM   2286 C  CG2   . THR A 1 256 ? -3.177  234.924 13.189  1.00 65.95  ? 256 THR A CG2   1 
ATOM   2287 H  HG21  . THR A 1 256 ? -3.624  234.151 13.567  1.00 79.14  ? 256 THR A HG21  1 
ATOM   2288 H  HG22  . THR A 1 256 ? -2.337  234.642 12.796  1.00 79.14  ? 256 THR A HG22  1 
ATOM   2289 H  HG23  . THR A 1 256 ? -2.995  235.561 13.898  1.00 79.14  ? 256 THR A HG23  1 
ATOM   2290 N  N     . ARG A 1 257 ? -3.871  238.538 13.113  1.00 51.30  ? 257 ARG A N     1 
ATOM   2291 C  CA    . ARG A 1 257 ? -3.679  239.333 14.328  1.00 57.23  ? 257 ARG A CA    1 
ATOM   2292 C  C     . ARG A 1 257 ? -4.479  238.753 15.487  1.00 57.27  ? 257 ARG A C     1 
ATOM   2293 O  O     . ARG A 1 257 ? -4.599  239.383 16.529  1.00 61.93  ? 257 ARG A O     1 
ATOM   2294 C  CB    . ARG A 1 257 ? -4.140  240.774 14.132  1.00 68.91  ? 257 ARG A CB    1 
ATOM   2295 C  CG    . ARG A 1 257 ? -3.239  241.675 13.334  1.00 75.25  ? 257 ARG A CG    1 
ATOM   2296 C  CD    . ARG A 1 257 ? -3.785  243.097 13.343  1.00 72.35  ? 257 ARG A CD    1 
ATOM   2297 N  NE    . ARG A 1 257 ? -3.769  243.678 14.684  1.00 72.49  ? 257 ARG A NE    1 
ATOM   2298 C  CZ    . ARG A 1 257 ? -2.671  244.095 15.319  1.00 74.35  ? 257 ARG A CZ    1 
ATOM   2299 N  NH1   . ARG A 1 257 ? -1.469  243.992 14.751  1.00 65.81  1 257 ARG A NH1   1 
ATOM   2300 N  NH2   . ARG A 1 257 ? -2.774  244.613 16.536  1.00 79.12  ? 257 ARG A NH2   1 
ATOM   2301 N  N     . ASP A 1 258 ? -5.080  237.586 15.281  1.00 50.54  ? 258 ASP A N     1 
ATOM   2302 C  CA    . ASP A 1 258 ? -6.029  237.029 16.244  1.00 44.93  ? 258 ASP A CA    1 
ATOM   2303 C  C     . ASP A 1 258 ? -5.291  236.137 17.231  1.00 48.91  ? 258 ASP A C     1 
ATOM   2304 O  O     . ASP A 1 258 ? -4.836  235.036 16.867  1.00 46.97  ? 258 ASP A O     1 
ATOM   2305 C  CB    . ASP A 1 258 ? -7.118  236.234 15.529  1.00 50.26  ? 258 ASP A CB    1 
ATOM   2306 C  CG    . ASP A 1 258 ? -8.315  235.932 16.410  1.00 63.63  ? 258 ASP A CG    1 
ATOM   2307 O  OD1   . ASP A 1 258 ? -9.369  235.577 15.836  1.00 69.23  ? 258 ASP A OD1   1 
ATOM   2308 O  OD2   . ASP A 1 258 ? -8.214  236.045 17.658  1.00 62.91  1 258 ASP A OD2   1 
ATOM   2309 N  N     . VAL A 1 259 ? -5.147  236.618 18.469  1.00 48.46  ? 259 VAL A N     1 
ATOM   2310 C  CA    . VAL A 1 259 ? -4.451  235.857 19.512  1.00 45.25  ? 259 VAL A CA    1 
ATOM   2311 C  C     . VAL A 1 259 ? -5.069  234.472 19.722  1.00 42.18  ? 259 VAL A C     1 
ATOM   2312 O  O     . VAL A 1 259 ? -4.344  233.507 19.931  1.00 52.63  ? 259 VAL A O     1 
ATOM   2313 C  CB    . VAL A 1 259 ? -4.427  236.634 20.859  1.00 60.01  ? 259 VAL A CB    1 
ATOM   2314 C  CG1   . VAL A 1 259 ? -3.765  235.817 21.957  1.00 38.01  ? 259 VAL A CG1   1 
ATOM   2315 C  CG2   . VAL A 1 259 ? -3.663  237.916 20.688  1.00 60.02  ? 259 VAL A CG2   1 
ATOM   2316 H  HG11  . VAL A 1 259 ? -3.769  236.332 22.779  1.00 45.61  ? 259 VAL A HG11  1 
ATOM   2317 H  HG12  . VAL A 1 259 ? -4.262  234.993 22.080  1.00 45.61  ? 259 VAL A HG12  1 
ATOM   2318 H  HG13  . VAL A 1 259 ? -2.853  235.617 21.695  1.00 45.61  ? 259 VAL A HG13  1 
ATOM   2319 H  HG21  . VAL A 1 259 ? -3.654  238.393 21.533  1.00 72.03  ? 259 VAL A HG21  1 
ATOM   2320 H  HG22  . VAL A 1 259 ? -2.756  237.709 20.414  1.00 72.03  ? 259 VAL A HG22  1 
ATOM   2321 H  HG23  . VAL A 1 259 ? -4.099  238.454 20.009  1.00 72.03  ? 259 VAL A HG23  1 
ATOM   2322 N  N     . LYS A 1 260 ? -6.394  234.372 19.642  1.00 42.42  ? 260 LYS A N     1 
ATOM   2323 C  CA    . LYS A 1 260 ? -7.075  233.091 19.814  1.00 44.78  ? 260 LYS A CA    1 
ATOM   2324 C  C     . LYS A 1 260 ? -6.633  232.108 18.744  1.00 50.82  ? 260 LYS A C     1 
ATOM   2325 O  O     . LYS A 1 260 ? -6.613  230.900 18.966  1.00 60.16  ? 260 LYS A O     1 
ATOM   2326 C  CB    . LYS A 1 260 ? -8.598  233.277 19.783  1.00 46.52  ? 260 LYS A CB    1 
ATOM   2327 C  CG    . LYS A 1 260 ? -9.109  234.257 20.836  1.00 50.39  ? 260 LYS A CG    1 
ATOM   2328 C  CD    . LYS A 1 260 ? -10.629 234.352 20.854  1.00 59.17  ? 260 LYS A CD    1 
ATOM   2329 C  CE    . LYS A 1 260 ? -11.173 234.938 19.556  1.00 60.86  ? 260 LYS A CE    1 
ATOM   2330 N  NZ    . LYS A 1 260 ? -10.597 236.280 19.251  1.00 57.78  1 260 LYS A NZ    1 
ATOM   2331 N  N     . VAL A 1 261 ? -6.257  232.635 17.586  1.00 45.35  ? 261 VAL A N     1 
ATOM   2332 C  CA    . VAL A 1 261 ? -5.777  231.809 16.494  1.00 44.37  ? 261 VAL A CA    1 
ATOM   2333 C  C     . VAL A 1 261 ? -4.320  231.452 16.748  1.00 44.32  ? 261 VAL A C     1 
ATOM   2334 O  O     . VAL A 1 261 ? -3.900  230.301 16.582  1.00 46.93  ? 261 VAL A O     1 
ATOM   2335 C  CB    . VAL A 1 261 ? -5.932  232.531 15.089  1.00 50.51  ? 261 VAL A CB    1 
ATOM   2336 C  CG1   . VAL A 1 261 ? -5.250  231.744 13.988  1.00 41.89  ? 261 VAL A CG1   1 
ATOM   2337 C  CG2   . VAL A 1 261 ? -7.398  232.740 14.732  1.00 45.46  ? 261 VAL A CG2   1 
ATOM   2338 H  HG11  . VAL A 1 261 ? -5.366  232.214 13.147  1.00 50.26  ? 261 VAL A HG11  1 
ATOM   2339 H  HG12  . VAL A 1 261 ? -4.306  231.665 14.196  1.00 50.26  ? 261 VAL A HG12  1 
ATOM   2340 H  HG13  . VAL A 1 261 ? -5.653  230.864 13.933  1.00 50.26  ? 261 VAL A HG13  1 
ATOM   2341 H  HG21  . VAL A 1 261 ? -7.452  233.182 13.870  1.00 54.55  ? 261 VAL A HG21  1 
ATOM   2342 H  HG22  . VAL A 1 261 ? -7.838  231.877 14.691  1.00 54.55  ? 261 VAL A HG22  1 
ATOM   2343 H  HG23  . VAL A 1 261 ? -7.813  233.291 15.414  1.00 54.55  ? 261 VAL A HG23  1 
ATOM   2344 N  N     . ILE A 1 262 ? -3.539  232.453 17.117  1.00 36.47  ? 262 ILE A N     1 
ATOM   2345 C  CA    . ILE A 1 262 ? -2.108  232.252 17.331  1.00 44.52  ? 262 ILE A CA    1 
ATOM   2346 C  C     . ILE A 1 262 ? -1.774  231.353 18.548  1.00 44.16  ? 262 ILE A C     1 
ATOM   2347 O  O     . ILE A 1 262 ? -0.794  230.604 18.522  1.00 40.21  ? 262 ILE A O     1 
ATOM   2348 C  CB    . ILE A 1 262 ? -1.403  233.617 17.507  1.00 43.44  ? 262 ILE A CB    1 
ATOM   2349 C  CG1   . ILE A 1 262 ? -1.616  234.503 16.256  1.00 36.47  ? 262 ILE A CG1   1 
ATOM   2350 C  CG2   . ILE A 1 262 ? 0.082   233.423 17.837  1.00 40.95  ? 262 ILE A CG2   1 
ATOM   2351 C  CD1   . ILE A 1 262 ? -1.262  235.979 16.432  1.00 36.56  ? 262 ILE A CD1   1 
ATOM   2352 H  HG12  . ILE A 1 262 ? -1.066  234.156 15.537  1.00 43.77  ? 262 ILE A HG12  1 
ATOM   2353 H  HG13  . ILE A 1 262 ? -2.551  234.456 16.002  1.00 43.77  ? 262 ILE A HG13  1 
ATOM   2354 H  HG21  . ILE A 1 262 ? 0.498   234.293 17.941  1.00 49.14  ? 262 ILE A HG21  1 
ATOM   2355 H  HG22  . ILE A 1 262 ? 0.159   232.918 18.661  1.00 49.14  ? 262 ILE A HG22  1 
ATOM   2356 H  HG23  . ILE A 1 262 ? 0.506   232.939 17.111  1.00 49.14  ? 262 ILE A HG23  1 
ATOM   2357 N  N     . LEU A 1 263 ? -2.603  231.421 19.594  1.00 40.16  ? 263 LEU A N     1 
ATOM   2358 C  CA    . LEU A 1 263 ? -2.245  230.876 20.908  1.00 47.62  ? 263 LEU A CA    1 
ATOM   2359 C  C     . LEU A 1 263 ? -1.794  229.404 20.851  1.00 44.54  ? 263 LEU A C     1 
ATOM   2360 O  O     . LEU A 1 263 ? -0.705  229.083 21.328  1.00 48.14  ? 263 LEU A O     1 
ATOM   2361 C  CB    . LEU A 1 263 ? -3.408  231.057 21.901  1.00 50.17  ? 263 LEU A CB    1 
ATOM   2362 C  CG    . LEU A 1 263 ? -3.055  230.810 23.377  1.00 57.60  ? 263 LEU A CG    1 
ATOM   2363 C  CD1   . LEU A 1 263 ? -1.651  231.337 23.691  1.00 59.01  ? 263 LEU A CD1   1 
ATOM   2364 C  CD2   . LEU A 1 263 ? -4.100  231.410 24.332  1.00 53.07  ? 263 LEU A CD2   1 
ATOM   2365 N  N     . PRO A 1 264 ? -2.596  228.521 20.237  1.00 38.07  ? 264 PRO A N     1 
ATOM   2366 C  CA    . PRO A 1 264 ? -2.235  227.095 20.144  1.00 41.06  ? 264 PRO A CA    1 
ATOM   2367 C  C     . PRO A 1 264 ? -0.852  226.854 19.570  1.00 40.73  ? 264 PRO A C     1 
ATOM   2368 O  O     . PRO A 1 264 ? -0.212  225.868 19.913  1.00 48.85  ? 264 PRO A O     1 
ATOM   2369 C  CB    . PRO A 1 264 ? -3.284  226.523 19.208  1.00 35.49  ? 264 PRO A CB    1 
ATOM   2370 C  CG    . PRO A 1 264 ? -4.441  227.429 19.330  1.00 45.18  ? 264 PRO A CG    1 
ATOM   2371 C  CD    . PRO A 1 264 ? -3.899  228.804 19.618  1.00 41.37  ? 264 PRO A CD    1 
ATOM   2372 N  N     . TYR A 1 265 ? -0.396  227.754 18.713  1.00 35.42  ? 265 TYR A N     1 
ATOM   2373 C  CA    . TYR A 1 265 ? 0.900   227.588 18.072  1.00 41.49  ? 265 TYR A CA    1 
ATOM   2374 C  C     . TYR A 1 265 ? 1.991   228.061 18.993  1.00 41.03  ? 265 TYR A C     1 
ATOM   2375 O  O     . TYR A 1 265 ? 3.049   227.432 19.095  1.00 40.55  ? 265 TYR A O     1 
ATOM   2376 C  CB    . TYR A 1 265 ? 0.965   228.358 16.746  1.00 40.41  ? 265 TYR A CB    1 
ATOM   2377 C  CG    . TYR A 1 265 ? -0.001  227.820 15.722  1.00 42.26  ? 265 TYR A CG    1 
ATOM   2378 C  CD1   . TYR A 1 265 ? 0.390   226.865 14.795  1.00 43.17  ? 265 TYR A CD1   1 
ATOM   2379 C  CD2   . TYR A 1 265 ? -1.312  228.250 15.706  1.00 47.79  ? 265 TYR A CD2   1 
ATOM   2380 C  CE1   . TYR A 1 265 ? -0.521  226.353 13.877  1.00 42.46  ? 265 TYR A CE1   1 
ATOM   2381 C  CE2   . TYR A 1 265 ? -2.211  227.763 14.804  1.00 50.89  ? 265 TYR A CE2   1 
ATOM   2382 C  CZ    . TYR A 1 265 ? -1.822  226.823 13.889  1.00 55.46  ? 265 TYR A CZ    1 
ATOM   2383 O  OH    . TYR A 1 265 ? -2.762  226.356 12.992  1.00 73.61  ? 265 TYR A OH    1 
ATOM   2384 N  N     . LEU A 1 266 ? 1.730   229.203 19.624  1.00 33.72  ? 266 LEU A N     1 
ATOM   2385 C  CA    . LEU A 1 266 ? 2.591   229.750 20.652  1.00 37.20  ? 266 LEU A CA    1 
ATOM   2386 C  C     . LEU A 1 266 ? 2.769   228.724 21.777  1.00 43.05  ? 266 LEU A C     1 
ATOM   2387 O  O     . LEU A 1 266 ? 3.884   228.523 22.263  1.00 51.89  ? 266 LEU A O     1 
ATOM   2388 C  CB    . LEU A 1 266 ? 2.015   231.062 21.193  1.00 37.49  ? 266 LEU A CB    1 
ATOM   2389 C  CG    . LEU A 1 266 ? 2.785   231.725 22.331  1.00 40.69  ? 266 LEU A CG    1 
ATOM   2390 C  CD1   . LEU A 1 266 ? 4.243   232.031 21.941  1.00 41.94  ? 266 LEU A CD1   1 
ATOM   2391 C  CD2   . LEU A 1 266 ? 2.055   232.970 22.786  1.00 40.51  ? 266 LEU A CD2   1 
ATOM   2392 N  N     . LYS A 1 267 ? 1.685   228.056 22.168  1.00 35.99  ? 267 LYS A N     1 
ATOM   2393 C  CA    . LYS A 1 267 ? 1.789   227.032 23.205  1.00 43.88  ? 267 LYS A CA    1 
ATOM   2394 C  C     . LYS A 1 267 ? 2.662   225.909 22.707  1.00 47.32  ? 267 LYS A C     1 
ATOM   2395 O  O     . LYS A 1 267 ? 3.518   225.420 23.448  1.00 52.70  ? 267 LYS A O     1 
ATOM   2396 C  CB    . LYS A 1 267 ? 0.426   226.479 23.624  1.00 45.53  ? 267 LYS A CB    1 
ATOM   2397 C  CG    . LYS A 1 267 ? -0.428  227.444 24.432  1.00 55.31  ? 267 LYS A CG    1 
ATOM   2398 C  CD    . LYS A 1 267 ? -1.506  226.689 25.209  1.00 68.85  ? 267 LYS A CD    1 
ATOM   2399 C  CE    . LYS A 1 267 ? -2.558  227.631 25.818  1.00 76.90  ? 267 LYS A CE    1 
ATOM   2400 N  NZ    . LYS A 1 267 ? -2.029  228.583 26.847  1.00 77.07  1 267 LYS A NZ    1 
ATOM   2401 N  N     . LYS A 1 268 ? 2.448   225.503 21.448  1.00 38.90  ? 268 LYS A N     1 
ATOM   2402 C  CA    . LYS A 1 268 ? 3.226   224.414 20.866  1.00 33.26  ? 268 LYS A CA    1 
ATOM   2403 C  C     . LYS A 1 268 ? 4.721   224.792 20.838  1.00 31.05  ? 268 LYS A C     1 
ATOM   2404 O  O     . LYS A 1 268 ? 5.586   223.984 21.150  1.00 39.86  ? 268 LYS A O     1 
ATOM   2405 C  CB    . LYS A 1 268 ? 2.692   224.076 19.476  1.00 41.52  ? 268 LYS A CB    1 
ATOM   2406 C  CG    . LYS A 1 268 ? 3.652   223.344 18.547  1.00 53.36  ? 268 LYS A CG    1 
ATOM   2407 C  CD    . LYS A 1 268 ? 2.883   222.638 17.415  1.00 61.49  ? 268 LYS A CD    1 
ATOM   2408 C  CE    . LYS A 1 268 ? 3.792   222.221 16.255  1.00 68.37  ? 268 LYS A CE    1 
ATOM   2409 N  NZ    . LYS A 1 268 ? 4.903   221.363 16.726  1.00 76.68  1 268 LYS A NZ    1 
ATOM   2410 N  N     . ALA A 1 269 ? 5.026   226.033 20.491  1.00 32.98  ? 269 ALA A N     1 
ATOM   2411 C  CA    . ALA A 1 269 ? 6.401   226.500 20.488  1.00 35.92  ? 269 ALA A CA    1 
ATOM   2412 C  C     . ALA A 1 269 ? 6.985   226.491 21.925  1.00 53.30  ? 269 ALA A C     1 
ATOM   2413 O  O     . ALA A 1 269 ? 8.171   226.188 22.148  1.00 41.13  ? 269 ALA A O     1 
ATOM   2414 C  CB    . ALA A 1 269 ? 6.462   227.910 19.881  1.00 32.75  ? 269 ALA A CB    1 
ATOM   2415 N  N     . ILE A 1 270 ? 6.152   226.836 22.901  1.00 47.97  ? 270 ILE A N     1 
ATOM   2416 C  CA    . ILE A 1 270 ? 6.623   226.909 24.280  1.00 42.78  ? 270 ILE A CA    1 
ATOM   2417 C  C     . ILE A 1 270 ? 6.973   225.519 24.750  1.00 40.34  ? 270 ILE A C     1 
ATOM   2418 O  O     . ILE A 1 270 ? 8.047   225.291 25.334  1.00 30.44  ? 270 ILE A O     1 
ATOM   2419 C  CB    . ILE A 1 270 ? 5.584   227.535 25.210  1.00 39.83  ? 270 ILE A CB    1 
ATOM   2420 C  CG1   . ILE A 1 270 ? 5.553   229.042 24.989  1.00 26.00  ? 270 ILE A CG1   1 
ATOM   2421 C  CG2   . ILE A 1 270 ? 5.930   227.250 26.683  1.00 40.10  ? 270 ILE A CG2   1 
ATOM   2422 C  CD1   . ILE A 1 270 ? 4.254   229.673 25.365  1.00 34.88  ? 270 ILE A CD1   1 
ATOM   2423 H  HG12  . ILE A 1 270 ? 6.249   229.452 25.525  1.00 31.20  ? 270 ILE A HG12  1 
ATOM   2424 H  HG13  . ILE A 1 270 ? 5.711   229.224 24.049  1.00 31.20  ? 270 ILE A HG13  1 
ATOM   2425 H  HG21  . ILE A 1 270 ? 5.256   227.658 27.249  1.00 48.12  ? 270 ILE A HG21  1 
ATOM   2426 H  HG22  . ILE A 1 270 ? 5.944   226.290 26.823  1.00 48.12  ? 270 ILE A HG22  1 
ATOM   2427 H  HG23  . ILE A 1 270 ? 6.801   227.627 26.881  1.00 48.12  ? 270 ILE A HG23  1 
ATOM   2428 N  N     . ASN A 1 271 ? 6.061   224.595 24.478  1.00 37.82  ? 271 ASN A N     1 
ATOM   2429 C  CA    . ASN A 1 271 ? 6.267   223.191 24.795  1.00 43.25  ? 271 ASN A CA    1 
ATOM   2430 C  C     . ASN A 1 271 ? 7.553   222.646 24.201  1.00 52.53  ? 271 ASN A C     1 
ATOM   2431 O  O     . ASN A 1 271 ? 8.255   221.862 24.835  1.00 63.00  ? 271 ASN A O     1 
ATOM   2432 C  CB    . ASN A 1 271 ? 5.096   222.341 24.294  1.00 35.33  ? 271 ASN A CB    1 
ATOM   2433 C  CG    . ASN A 1 271 ? 3.876   222.480 25.155  1.00 45.76  ? 271 ASN A CG    1 
ATOM   2434 O  OD1   . ASN A 1 271 ? 3.931   223.117 26.204  1.00 55.21  ? 271 ASN A OD1   1 
ATOM   2435 N  ND2   . ASN A 1 271 ? 2.761   221.881 24.734  1.00 43.75  ? 271 ASN A ND2   1 
ATOM   2436 N  N     . GLU A 1 272 ? 7.870   223.045 22.979  1.00 43.48  ? 272 GLU A N     1 
ATOM   2437 C  CA    . GLU A 1 272 ? 9.019   222.443 22.335  1.00 40.17  ? 272 GLU A CA    1 
ATOM   2438 C  C     . GLU A 1 272 ? 10.297  223.167 22.735  1.00 41.83  ? 272 GLU A C     1 
ATOM   2439 O  O     . GLU A 1 272 ? 11.358  222.543 22.823  1.00 38.09  ? 272 GLU A O     1 
ATOM   2440 C  CB    . GLU A 1 272 ? 8.837   222.425 20.824  1.00 38.01  ? 272 GLU A CB    1 
ATOM   2441 C  CG    . GLU A 1 272 ? 7.620   221.621 20.411  1.00 47.90  ? 272 GLU A CG    1 
ATOM   2442 C  CD    . GLU A 1 272 ? 7.546   221.373 18.909  1.00 57.03  ? 272 GLU A CD    1 
ATOM   2443 O  OE1   . GLU A 1 272 ? 8.524   221.685 18.198  1.00 58.16  ? 272 GLU A OE1   1 
ATOM   2444 O  OE2   . GLU A 1 272 ? 6.502   220.870 18.445  1.00 58.07  1 272 GLU A OE2   1 
ATOM   2445 N  N     . ALA A 1 273 ? 10.197  224.478 22.966  1.00 38.16  ? 273 ALA A N     1 
ATOM   2446 C  CA    . ALA A 1 273 ? 11.315  225.201 23.548  1.00 43.65  ? 273 ALA A CA    1 
ATOM   2447 C  C     . ALA A 1 273 ? 11.663  224.544 24.892  1.00 37.71  ? 273 ALA A C     1 
ATOM   2448 O  O     . ALA A 1 273 ? 12.805  224.143 25.118  1.00 32.09  ? 273 ALA A O     1 
ATOM   2449 C  CB    . ALA A 1 273 ? 10.985  226.673 23.726  1.00 44.58  ? 273 ALA A CB    1 
ATOM   2450 N  N     . TYR A 1 274 ? 10.659  224.378 25.749  1.00 34.96  ? 274 TYR A N     1 
ATOM   2451 C  CA    . TYR A 1 274 ? 10.908  223.876 27.097  1.00 39.67  ? 274 TYR A CA    1 
ATOM   2452 C  C     . TYR A 1 274 ? 11.614  222.546 27.077  1.00 48.79  ? 274 TYR A C     1 
ATOM   2453 O  O     . TYR A 1 274 ? 12.457  222.280 27.936  1.00 55.13  ? 274 TYR A O     1 
ATOM   2454 C  CB    . TYR A 1 274 ? 9.614   223.755 27.898  1.00 37.49  ? 274 TYR A CB    1 
ATOM   2455 C  CG    . TYR A 1 274 ? 9.505   224.868 28.898  1.00 49.81  ? 274 TYR A CG    1 
ATOM   2456 C  CD1   . TYR A 1 274 ? 9.098   226.122 28.497  1.00 56.16  ? 274 TYR A CD1   1 
ATOM   2457 C  CD2   . TYR A 1 274 ? 9.850   224.680 30.241  1.00 47.34  ? 274 TYR A CD2   1 
ATOM   2458 C  CE1   . TYR A 1 274 ? 9.014   227.161 29.394  1.00 62.34  ? 274 TYR A CE1   1 
ATOM   2459 C  CE2   . TYR A 1 274 ? 9.765   225.726 31.146  1.00 53.71  ? 274 TYR A CE2   1 
ATOM   2460 C  CZ    . TYR A 1 274 ? 9.347   226.961 30.704  1.00 58.56  ? 274 TYR A CZ    1 
ATOM   2461 O  OH    . TYR A 1 274 ? 9.255   228.025 31.552  1.00 73.47  ? 274 TYR A OH    1 
ATOM   2462 N  N     . ASN A 1 275 ? 11.293  221.714 26.089  1.00 47.49  ? 275 ASN A N     1 
ATOM   2463 C  CA    . ASN A 1 275 ? 11.800  220.354 26.114  1.00 47.16  ? 275 ASN A CA    1 
ATOM   2464 C  C     . ASN A 1 275 ? 13.262  220.332 25.744  1.00 49.13  ? 275 ASN A C     1 
ATOM   2465 O  O     . ASN A 1 275 ? 13.911  219.286 25.811  1.00 51.69  ? 275 ASN A O     1 
ATOM   2466 C  CB    . ASN A 1 275 ? 10.979  219.454 25.204  1.00 52.71  ? 275 ASN A CB    1 
ATOM   2467 C  CG    . ASN A 1 275 ? 9.746   218.927 25.894  1.00 69.54  ? 275 ASN A CG    1 
ATOM   2468 O  OD1   . ASN A 1 275 ? 9.595   217.717 26.074  1.00 85.07  ? 275 ASN A OD1   1 
ATOM   2469 N  ND2   . ASN A 1 275 ? 8.878   219.839 26.342  1.00 68.15  ? 275 ASN A ND2   1 
ATOM   2470 N  N     . LYS A 1 276 ? 13.775  221.507 25.381  1.00 50.98  ? 276 LYS A N     1 
ATOM   2471 C  CA    . LYS A 1 276 ? 15.186  221.659 25.037  1.00 53.44  ? 276 LYS A CA    1 
ATOM   2472 C  C     . LYS A 1 276 ? 15.990  222.256 26.186  1.00 48.60  ? 276 LYS A C     1 
ATOM   2473 O  O     . LYS A 1 276 ? 17.211  222.172 26.182  1.00 50.99  ? 276 LYS A O     1 
ATOM   2474 C  CB    . LYS A 1 276 ? 15.352  222.536 23.791  1.00 50.50  ? 276 LYS A CB    1 
ATOM   2475 C  CG    . LYS A 1 276 ? 14.576  222.065 22.570  1.00 60.22  ? 276 LYS A CG    1 
ATOM   2476 C  CD    . LYS A 1 276 ? 15.078  222.696 21.259  1.00 70.07  ? 276 LYS A CD    1 
ATOM   2477 C  CE    . LYS A 1 276 ? 15.171  224.223 21.318  1.00 73.37  ? 276 LYS A CE    1 
ATOM   2478 N  NZ    . LYS A 1 276 ? 15.387  224.813 19.948  1.00 75.69  1 276 LYS A NZ    1 
ATOM   2479 N  N     . VAL A 1 277 ? 15.308  222.882 27.149  1.00 42.51  ? 277 VAL A N     1 
ATOM   2480 C  CA    . VAL A 1 277 ? 15.986  223.514 28.272  1.00 48.66  ? 277 VAL A CA    1 
ATOM   2481 C  C     . VAL A 1 277 ? 16.435  222.486 29.324  1.00 55.33  ? 277 VAL A C     1 
ATOM   2482 O  O     . VAL A 1 277 ? 15.612  221.773 29.896  1.00 61.85  ? 277 VAL A O     1 
ATOM   2483 C  CB    . VAL A 1 277 ? 15.088  224.561 28.955  1.00 47.61  ? 277 VAL A CB    1 
ATOM   2484 C  CG1   . VAL A 1 277 ? 15.837  225.232 30.096  1.00 56.00  ? 277 VAL A CG1   1 
ATOM   2485 C  CG2   . VAL A 1 277 ? 14.690  225.602 27.986  1.00 40.14  ? 277 VAL A CG2   1 
ATOM   2486 H  HG11  . VAL A 1 277 ? 16.729  224.856 30.152  1.00 67.20  ? 277 VAL A HG11  1 
ATOM   2487 H  HG12  . VAL A 1 277 ? 15.890  226.185 29.921  1.00 67.20  ? 277 VAL A HG12  1 
ATOM   2488 H  HG13  . VAL A 1 277 ? 15.357  225.074 30.924  1.00 67.20  ? 277 VAL A HG13  1 
ATOM   2489 H  HG21  . VAL A 1 277 ? 14.126  226.252 28.434  1.00 48.17  ? 277 VAL A HG21  1 
ATOM   2490 H  HG22  . VAL A 1 277 ? 15.487  226.036 27.644  1.00 48.17  ? 277 VAL A HG22  1 
ATOM   2491 H  HG23  . VAL A 1 277 ? 14.202  225.186 27.258  1.00 48.17  ? 277 VAL A HG23  1 
ATOM   2492 N  N     . ASN A 1 278 ? 17.739  222.412 29.577  1.00 56.20  ? 278 ASN A N     1 
ATOM   2493 C  CA    . ASN A 1 278 ? 18.228  221.637 30.712  1.00 72.23  ? 278 ASN A CA    1 
ATOM   2494 C  C     . ASN A 1 278 ? 18.063  222.430 32.017  1.00 71.17  ? 278 ASN A C     1 
ATOM   2495 O  O     . ASN A 1 278 ? 19.017  222.614 32.781  1.00 72.47  ? 278 ASN A O     1 
ATOM   2496 C  CB    . ASN A 1 278 ? 19.694  221.232 30.509  1.00 88.97  ? 278 ASN A CB    1 
ATOM   2497 C  CG    . ASN A 1 278 ? 20.639  222.429 30.459  1.00 96.58  ? 278 ASN A CG    1 
ATOM   2498 O  OD1   . ASN A 1 278 ? 20.303  223.490 29.912  1.00 96.73  ? 278 ASN A OD1   1 
ATOM   2499 N  ND2   . ASN A 1 278 ? 21.831  222.261 31.038  1.00 96.25  ? 278 ASN A ND2   1 
ATOM   2500 N  N     . GLY A 1 279 ? 16.847  222.907 32.268  1.00 63.74  ? 279 GLY A N     1 
ATOM   2501 C  CA    . GLY A 1 279 ? 16.596  223.694 33.453  1.00 59.67  ? 279 GLY A CA    1 
ATOM   2502 C  C     . GLY A 1 279 ? 15.283  224.451 33.455  1.00 58.08  ? 279 GLY A C     1 
ATOM   2503 O  O     . GLY A 1 279 ? 14.292  224.021 32.855  1.00 52.96  ? 279 GLY A O     1 
ATOM   2504 N  N     . ILE A 1 280 ? 15.296  225.582 34.156  1.00 55.62  ? 280 ILE A N     1 
ATOM   2505 C  CA    . ILE A 1 280 ? 14.138  226.437 34.355  1.00 54.95  ? 280 ILE A CA    1 
ATOM   2506 C  C     . ILE A 1 280 ? 14.525  227.827 33.852  1.00 53.33  ? 280 ILE A C     1 
ATOM   2507 O  O     . ILE A 1 280 ? 15.479  228.424 34.338  1.00 57.04  ? 280 ILE A O     1 
ATOM   2508 C  CB    . ILE A 1 280 ? 13.716  226.471 35.868  1.00 50.66  ? 280 ILE A CB    1 
ATOM   2509 C  CG1   . ILE A 1 280 ? 13.471  225.054 36.389  1.00 55.78  ? 280 ILE A CG1   1 
ATOM   2510 C  CG2   . ILE A 1 280 ? 12.487  227.322 36.098  1.00 44.67  ? 280 ILE A CG2   1 
ATOM   2511 C  CD1   . ILE A 1 280 ? 14.703  224.391 36.978  1.00 65.08  ? 280 ILE A CD1   1 
ATOM   2512 H  HG12  . ILE A 1 280 ? 12.794  225.090 37.082  1.00 66.93  ? 280 ILE A HG12  1 
ATOM   2513 H  HG13  . ILE A 1 280 ? 13.160  224.501 35.655  1.00 66.93  ? 280 ILE A HG13  1 
ATOM   2514 H  HG21  . ILE A 1 280 ? 12.269  227.311 37.043  1.00 53.60  ? 280 ILE A HG21  1 
ATOM   2515 H  HG22  . ILE A 1 280 ? 12.674  228.230 35.813  1.00 53.60  ? 280 ILE A HG22  1 
ATOM   2516 H  HG23  . ILE A 1 280 ? 11.750  226.958 35.583  1.00 53.60  ? 280 ILE A HG23  1 
ATOM   2517 N  N     . PRO A 1 281 ? 13.827  228.337 32.837  1.00 44.78  ? 281 PRO A N     1 
ATOM   2518 C  CA    . PRO A 1 281 ? 14.272  229.658 32.405  1.00 41.28  ? 281 PRO A CA    1 
ATOM   2519 C  C     . PRO A 1 281 ? 13.744  230.732 33.340  1.00 41.48  ? 281 PRO A C     1 
ATOM   2520 O  O     . PRO A 1 281 ? 12.657  230.565 33.885  1.00 43.67  ? 281 PRO A O     1 
ATOM   2521 C  CB    . PRO A 1 281 ? 13.655  229.791 31.024  1.00 32.92  ? 281 PRO A CB    1 
ATOM   2522 C  CG    . PRO A 1 281 ? 12.417  229.029 31.135  1.00 39.97  ? 281 PRO A CG    1 
ATOM   2523 C  CD    . PRO A 1 281 ? 12.726  227.835 32.012  1.00 34.67  ? 281 PRO A CD    1 
ATOM   2524 N  N     . MET A 1 282 ? 14.480  231.816 33.522  1.00 34.44  ? 282 MET A N     1 
ATOM   2525 C  CA    . MET A 1 282 ? 13.944  232.944 34.287  1.00 46.21  ? 282 MET A CA    1 
ATOM   2526 C  C     . MET A 1 282 ? 13.399  234.019 33.370  1.00 44.92  ? 282 MET A C     1 
ATOM   2527 O  O     . MET A 1 282 ? 12.752  234.967 33.827  1.00 43.44  ? 282 MET A O     1 
ATOM   2528 C  CB    . MET A 1 282 ? 15.004  233.547 35.203  1.00 41.92  ? 282 MET A CB    1 
ATOM   2529 C  CG    . MET A 1 282 ? 15.433  232.593 36.305  1.00 46.13  ? 282 MET A CG    1 
ATOM   2530 S  SD    . MET A 1 282 ? 16.755  233.283 37.314  1.00 52.56  ? 282 MET A SD    1 
ATOM   2531 C  CE    . MET A 1 282 ? 15.861  234.571 38.190  1.00 43.84  ? 282 MET A CE    1 
ATOM   2532 N  N     . ARG A 1 283 ? 13.674  233.884 32.076  1.00 45.31  ? 283 ARG A N     1 
ATOM   2533 C  CA    . ARG A 1 283 ? 13.158  234.838 31.110  1.00 44.13  ? 283 ARG A CA    1 
ATOM   2534 C  C     . ARG A 1 283 ? 12.526  234.174 29.913  1.00 39.55  ? 283 ARG A C     1 
ATOM   2535 O  O     . ARG A 1 283 ? 13.102  233.295 29.269  1.00 33.42  ? 283 ARG A O     1 
ATOM   2536 C  CB    . ARG A 1 283 ? 14.234  235.794 30.610  1.00 45.15  ? 283 ARG A CB    1 
ATOM   2537 C  CG    . ARG A 1 283 ? 13.697  236.655 29.458  1.00 47.84  ? 283 ARG A CG    1 
ATOM   2538 C  CD    . ARG A 1 283 ? 14.557  237.873 29.173  1.00 43.45  ? 283 ARG A CD    1 
ATOM   2539 N  NE    . ARG A 1 283 ? 15.847  237.501 28.608  1.00 48.03  ? 283 ARG A NE    1 
ATOM   2540 C  CZ    . ARG A 1 283 ? 16.675  238.361 28.015  1.00 61.26  ? 283 ARG A CZ    1 
ATOM   2541 N  NH1   . ARG A 1 283 ? 16.337  239.638 27.905  1.00 61.55  1 283 ARG A NH1   1 
ATOM   2542 N  NH2   . ARG A 1 283 ? 17.841  237.950 27.528  1.00 64.17  ? 283 ARG A NH2   1 
ATOM   2543 N  N     . ILE A 1 284 ? 11.318  234.620 29.622  1.00 41.52  ? 284 ILE A N     1 
ATOM   2544 C  CA    . ILE A 1 284 ? 10.645  234.206 28.424  1.00 40.56  ? 284 ILE A CA    1 
ATOM   2545 C  C     . ILE A 1 284 ? 10.406  235.412 27.507  1.00 42.18  ? 284 ILE A C     1 
ATOM   2546 O  O     . ILE A 1 284 ? 9.933   236.480 27.947  1.00 41.62  ? 284 ILE A O     1 
ATOM   2547 C  CB    . ILE A 1 284 ? 9.343   233.495 28.764  1.00 42.36  ? 284 ILE A CB    1 
ATOM   2548 C  CG1   . ILE A 1 284 ? 8.693   232.959 27.490  1.00 45.61  ? 284 ILE A CG1   1 
ATOM   2549 C  CG2   . ILE A 1 284 ? 8.431   234.400 29.549  1.00 38.63  ? 284 ILE A CG2   1 
ATOM   2550 C  CD1   . ILE A 1 284 ? 7.648   231.925 27.749  1.00 47.10  ? 284 ILE A CD1   1 
ATOM   2551 H  HG12  . ILE A 1 284 ? 8.272   233.695 27.018  1.00 54.73  ? 284 ILE A HG12  1 
ATOM   2552 H  HG13  . ILE A 1 284 ? 9.378   232.558 26.933  1.00 54.73  ? 284 ILE A HG13  1 
ATOM   2553 H  HG21  . ILE A 1 284 ? 8.875   234.660 30.372  1.00 46.35  ? 284 ILE A HG21  1 
ATOM   2554 H  HG22  . ILE A 1 284 ? 8.233   235.187 29.017  1.00 46.35  ? 284 ILE A HG22  1 
ATOM   2555 H  HG23  . ILE A 1 284 ? 7.611   233.923 29.752  1.00 46.35  ? 284 ILE A HG23  1 
ATOM   2556 N  N     . THR A 1 285 ? 10.790  235.255 26.241  1.00 38.86  ? 285 THR A N     1 
ATOM   2557 C  CA    . THR A 1 285 ? 10.568  236.300 25.237  1.00 39.89  ? 285 THR A CA    1 
ATOM   2558 C  C     . THR A 1 285 ? 9.625   235.791 24.157  1.00 39.37  ? 285 THR A C     1 
ATOM   2559 O  O     . THR A 1 285 ? 9.734   234.642 23.721  1.00 46.46  ? 285 THR A O     1 
ATOM   2560 C  CB    . THR A 1 285 ? 11.889  236.764 24.582  1.00 40.83  ? 285 THR A CB    1 
ATOM   2561 O  OG1   . THR A 1 285 ? 12.784  237.263 25.584  1.00 44.50  ? 285 THR A OG1   1 
ATOM   2562 C  CG2   . THR A 1 285 ? 11.626  237.872 23.577  1.00 43.73  ? 285 THR A CG2   1 
ATOM   2563 H  HG21  . THR A 1 285 ? 12.460  238.157 23.171  1.00 52.47  ? 285 THR A HG21  1 
ATOM   2564 H  HG22  . THR A 1 285 ? 11.030  237.553 22.881  1.00 52.47  ? 285 THR A HG22  1 
ATOM   2565 H  HG23  . THR A 1 285 ? 11.215  238.631 24.020  1.00 52.47  ? 285 THR A HG23  1 
ATOM   2566 N  N     . VAL A 1 286 ? 8.691   236.623 23.714  1.00 45.58  ? 286 VAL A N     1 
ATOM   2567 C  CA    . VAL A 1 286 ? 7.869   236.243 22.560  1.00 37.95  ? 286 VAL A CA    1 
ATOM   2568 C  C     . VAL A 1 286 ? 8.302   237.059 21.353  1.00 39.93  ? 286 VAL A C     1 
ATOM   2569 O  O     . VAL A 1 286 ? 8.583   238.249 21.449  1.00 45.04  ? 286 VAL A O     1 
ATOM   2570 C  CB    . VAL A 1 286 ? 6.351   236.427 22.809  1.00 35.82  ? 286 VAL A CB    1 
ATOM   2571 C  CG1   . VAL A 1 286 ? 5.555   236.252 21.507  1.00 30.19  ? 286 VAL A CG1   1 
ATOM   2572 C  CG2   . VAL A 1 286 ? 5.860   235.404 23.817  1.00 33.37  ? 286 VAL A CG2   1 
ATOM   2573 H  HG11  . VAL A 1 286 ? 4.611   236.373 21.696  1.00 36.23  ? 286 VAL A HG11  1 
ATOM   2574 H  HG12  . VAL A 1 286 ? 5.852   236.915 20.865  1.00 36.23  ? 286 VAL A HG12  1 
ATOM   2575 H  HG13  . VAL A 1 286 ? 5.711   235.360 21.159  1.00 36.23  ? 286 VAL A HG13  1 
ATOM   2576 H  HG21  . VAL A 1 286 ? 4.910   235.534 23.961  1.00 40.04  ? 286 VAL A HG21  1 
ATOM   2577 H  HG22  . VAL A 1 286 ? 6.024   234.514 23.469  1.00 40.04  ? 286 VAL A HG22  1 
ATOM   2578 H  HG23  . VAL A 1 286 ? 6.341   235.528 24.651  1.00 40.04  ? 286 VAL A HG23  1 
ATOM   2579 N  N     . ILE A 1 287 ? 8.352   236.387 20.213  1.00 41.51  ? 287 ILE A N     1 
ATOM   2580 C  CA    . ILE A 1 287 ? 8.885   236.940 18.980  1.00 40.71  ? 287 ILE A CA    1 
ATOM   2581 C  C     . ILE A 1 287 ? 7.854   236.792 17.863  1.00 41.57  ? 287 ILE A C     1 
ATOM   2582 O  O     . ILE A 1 287 ? 7.442   235.688 17.538  1.00 40.59  ? 287 ILE A O     1 
ATOM   2583 C  CB    . ILE A 1 287 ? 10.182  236.224 18.599  1.00 41.36  ? 287 ILE A CB    1 
ATOM   2584 C  CG1   . ILE A 1 287 ? 11.110  236.215 19.818  1.00 48.46  ? 287 ILE A CG1   1 
ATOM   2585 C  CG2   . ILE A 1 287 ? 10.807  236.848 17.353  1.00 51.74  ? 287 ILE A CG2   1 
ATOM   2586 C  CD1   . ILE A 1 287 ? 12.564  235.946 19.514  1.00 50.78  ? 287 ILE A CD1   1 
ATOM   2587 H  HG12  . ILE A 1 287 ? 11.058  237.081 20.252  1.00 58.15  ? 287 ILE A HG12  1 
ATOM   2588 H  HG13  . ILE A 1 287 ? 10.808  235.526 20.430  1.00 58.15  ? 287 ILE A HG13  1 
ATOM   2589 H  HG21  . ILE A 1 287 ? 11.625  236.373 17.139  1.00 62.09  ? 287 ILE A HG21  1 
ATOM   2590 H  HG22  . ILE A 1 287 ? 10.180  236.777 16.617  1.00 62.09  ? 287 ILE A HG22  1 
ATOM   2591 H  HG23  . ILE A 1 287 ? 11.003  237.781 17.532  1.00 62.09  ? 287 ILE A HG23  1 
ATOM   2592 N  N     . ALA A 1 288 ? 7.413   237.911 17.310  1.00 39.86  ? 288 ALA A N     1 
ATOM   2593 C  CA    . ALA A 1 288 ? 6.428   237.891 16.248  1.00 46.04  ? 288 ALA A CA    1 
ATOM   2594 C  C     . ALA A 1 288 ? 7.068   238.369 14.955  1.00 51.61  ? 288 ALA A C     1 
ATOM   2595 O  O     . ALA A 1 288 ? 7.636   239.466 14.901  1.00 53.03  ? 288 ALA A O     1 
ATOM   2596 C  CB    . ALA A 1 288 ? 5.232   238.757 16.605  1.00 35.47  ? 288 ALA A CB    1 
ATOM   2597 N  N     . ILE A 1 289 ? 6.993   237.538 13.919  1.00 55.61  ? 289 ILE A N     1 
ATOM   2598 C  CA    . ILE A 1 289 ? 7.453   237.936 12.592  1.00 50.75  ? 289 ILE A CA    1 
ATOM   2599 C  C     . ILE A 1 289 ? 6.227   238.390 11.797  1.00 52.84  ? 289 ILE A C     1 
ATOM   2600 O  O     . ILE A 1 289 ? 5.349   237.592 11.456  1.00 53.79  ? 289 ILE A O     1 
ATOM   2601 C  CB    . ILE A 1 289 ? 8.211   236.796 11.887  1.00 50.67  ? 289 ILE A CB    1 
ATOM   2602 C  CG1   . ILE A 1 289 ? 9.509   236.502 12.643  1.00 58.18  ? 289 ILE A CG1   1 
ATOM   2603 C  CG2   . ILE A 1 289 ? 8.535   237.134 10.437  1.00 51.00  ? 289 ILE A CG2   1 
ATOM   2604 C  CD1   . ILE A 1 289 ? 9.330   235.538 13.791  1.00 61.86  ? 289 ILE A CD1   1 
ATOM   2605 H  HG12  . ILE A 1 289 ? 10.150  236.115 12.027  1.00 69.81  ? 289 ILE A HG12  1 
ATOM   2606 H  HG13  . ILE A 1 289 ? 9.857   237.333 13.003  1.00 69.81  ? 289 ILE A HG13  1 
ATOM   2607 H  HG21  . ILE A 1 289 ? 9.010   236.389 10.038  1.00 61.20  ? 289 ILE A HG21  1 
ATOM   2608 H  HG22  . ILE A 1 289 ? 7.707   237.294 9.958   1.00 61.20  ? 289 ILE A HG22  1 
ATOM   2609 H  HG23  . ILE A 1 289 ? 9.089   237.930 10.416  1.00 61.20  ? 289 ILE A HG23  1 
ATOM   2610 N  N     . MET A 1 290 ? 6.160   239.693 11.549  1.00 51.55  ? 290 MET A N     1 
ATOM   2611 C  CA    . MET A 1 290 ? 4.986   240.298 10.926  1.00 59.89  ? 290 MET A CA    1 
ATOM   2612 C  C     . MET A 1 290 ? 4.905   240.010 9.425   1.00 62.02  ? 290 MET A C     1 
ATOM   2613 O  O     . MET A 1 290 ? 5.808   239.394 8.849   1.00 64.84  ? 290 MET A O     1 
ATOM   2614 C  CB    . MET A 1 290 ? 4.990   241.801 11.191  1.00 47.98  ? 290 MET A CB    1 
ATOM   2615 C  CG    . MET A 1 290 ? 5.291   242.093 12.668  1.00 50.76  ? 290 MET A CG    1 
ATOM   2616 S  SD    . MET A 1 290 ? 4.171   241.201 13.797  1.00 58.52  ? 290 MET A SD    1 
ATOM   2617 C  CE    . MET A 1 290 ? 2.614   242.036 13.446  1.00 54.61  ? 290 MET A CE    1 
ATOM   2618 N  N     . GLU A 1 291 ? 3.803   240.436 8.815   1.00 58.88  ? 291 GLU A N     1 
ATOM   2619 C  CA    . GLU A 1 291 ? 3.553   240.236 7.380   1.00 70.14  ? 291 GLU A CA    1 
ATOM   2620 C  C     . GLU A 1 291 ? 4.743   240.504 6.473   1.00 65.71  ? 291 GLU A C     1 
ATOM   2621 O  O     . GLU A 1 291 ? 4.995   239.738 5.547   1.00 59.98  ? 291 GLU A O     1 
ATOM   2622 C  CB    . GLU A 1 291 ? 2.405   241.126 6.925   1.00 73.67  ? 291 GLU A CB    1 
ATOM   2623 C  CG    . GLU A 1 291 ? 1.166   240.360 6.580   1.00 81.19  ? 291 GLU A CG    1 
ATOM   2624 C  CD    . GLU A 1 291 ? -0.069  241.171 6.846   1.00 89.49  ? 291 GLU A CD    1 
ATOM   2625 O  OE1   . GLU A 1 291 ? 0.081   242.318 7.337   1.00 83.47  ? 291 GLU A OE1   1 
ATOM   2626 O  OE2   . GLU A 1 291 ? -1.179  240.658 6.573   1.00 98.42  1 291 GLU A OE2   1 
ATOM   2627 N  N     . ASP A 1 292 ? 5.443   241.606 6.747   1.00 63.17  ? 292 ASP A N     1 
ATOM   2628 C  CA    . ASP A 1 292 ? 6.583   242.066 5.959   1.00 63.11  ? 292 ASP A CA    1 
ATOM   2629 C  C     . ASP A 1 292 ? 7.927   241.517 6.448   1.00 65.54  ? 292 ASP A C     1 
ATOM   2630 O  O     . ASP A 1 292 ? 8.988   242.045 6.107   1.00 65.07  ? 292 ASP A O     1 
ATOM   2631 C  CB    . ASP A 1 292 ? 6.629   243.589 5.983   1.00 65.26  ? 292 ASP A CB    1 
ATOM   2632 C  CG    . ASP A 1 292 ? 6.667   244.135 7.389   1.00 63.94  ? 292 ASP A CG    1 
ATOM   2633 O  OD1   . ASP A 1 292 ? 6.931   243.343 8.302   1.00 60.12  ? 292 ASP A OD1   1 
ATOM   2634 O  OD2   . ASP A 1 292 ? 6.440   245.341 7.586   1.00 73.22  1 292 ASP A OD2   1 
ATOM   2635 N  N     . LEU A 1 293 ? 7.871   240.486 7.280   1.00 67.43  ? 293 LEU A N     1 
ATOM   2636 C  CA    . LEU A 1 293 ? 9.070   239.860 7.832   1.00 64.05  ? 293 LEU A CA    1 
ATOM   2637 C  C     . LEU A 1 293 ? 9.802   240.763 8.835   1.00 65.57  ? 293 LEU A C     1 
ATOM   2638 O  O     . LEU A 1 293 ? 10.951  240.487 9.204   1.00 65.09  ? 293 LEU A O     1 
ATOM   2639 C  CB    . LEU A 1 293 ? 10.015  239.434 6.708   1.00 55.55  ? 293 LEU A CB    1 
ATOM   2640 C  CG    . LEU A 1 293 ? 9.321   238.486 5.716   1.00 62.49  ? 293 LEU A CG    1 
ATOM   2641 C  CD1   . LEU A 1 293 ? 10.254  237.988 4.587   1.00 64.99  ? 293 LEU A CD1   1 
ATOM   2642 C  CD2   . LEU A 1 293 ? 8.656   237.316 6.462   1.00 53.62  ? 293 LEU A CD2   1 
ATOM   2643 N  N     . ASP A 1 294 ? 9.134   241.823 9.295   1.00 63.10  ? 294 ASP A N     1 
ATOM   2644 C  CA    . ASP A 1 294 ? 9.688   242.632 10.379  1.00 68.94  ? 294 ASP A CA    1 
ATOM   2645 C  C     . ASP A 1 294 ? 9.545   241.870 11.706  1.00 64.39  ? 294 ASP A C     1 
ATOM   2646 O  O     . ASP A 1 294 ? 8.608   241.084 11.889  1.00 56.35  ? 294 ASP A O     1 
ATOM   2647 C  CB    . ASP A 1 294 ? 9.007   244.000 10.448  1.00 88.46  ? 294 ASP A CB    1 
ATOM   2648 C  CG    . ASP A 1 294 ? 9.820   245.022 11.231  1.00 108.30 ? 294 ASP A CG    1 
ATOM   2649 O  OD1   . ASP A 1 294 ? 10.839  244.631 11.842  1.00 111.51 ? 294 ASP A OD1   1 
ATOM   2650 O  OD2   . ASP A 1 294 ? 9.436   246.216 11.242  1.00 116.39 1 294 ASP A OD2   1 
ATOM   2651 N  N     . ILE A 1 295 ? 10.481  242.104 12.622  1.00 66.45  ? 295 ILE A N     1 
ATOM   2652 C  CA    . ILE A 1 295 ? 10.594  241.313 13.844  1.00 59.72  ? 295 ILE A CA    1 
ATOM   2653 C  C     . ILE A 1 295 ? 10.314  242.099 15.125  1.00 60.61  ? 295 ILE A C     1 
ATOM   2654 O  O     . ILE A 1 295 ? 11.021  243.053 15.449  1.00 63.61  ? 295 ILE A O     1 
ATOM   2655 C  CB    . ILE A 1 295 ? 11.988  240.692 13.952  1.00 58.91  ? 295 ILE A CB    1 
ATOM   2656 C  CG1   . ILE A 1 295 ? 12.364  240.071 12.613  1.00 53.25  ? 295 ILE A CG1   1 
ATOM   2657 C  CG2   . ILE A 1 295 ? 12.017  239.656 15.064  1.00 66.41  ? 295 ILE A CG2   1 
ATOM   2658 C  CD1   . ILE A 1 295 ? 13.531  239.112 12.644  1.00 46.99  ? 295 ILE A CD1   1 
ATOM   2659 H  HG12  . ILE A 1 295 ? 11.596  239.583 12.275  1.00 63.90  ? 295 ILE A HG12  1 
ATOM   2660 H  HG13  . ILE A 1 295 ? 12.590  240.784 11.996  1.00 63.90  ? 295 ILE A HG13  1 
ATOM   2661 H  HG21  . ILE A 1 295 ? 12.908  239.275 15.116  1.00 79.69  ? 295 ILE A HG21  1 
ATOM   2662 H  HG22  . ILE A 1 295 ? 11.792  240.088 15.903  1.00 79.69  ? 295 ILE A HG22  1 
ATOM   2663 H  HG23  . ILE A 1 295 ? 11.371  238.961 14.864  1.00 79.69  ? 295 ILE A HG23  1 
ATOM   2664 N  N     . LEU A 1 296 ? 9.284   241.681 15.857  1.00 54.96  ? 296 LEU A N     1 
ATOM   2665 C  CA    . LEU A 1 296 ? 8.954   242.296 17.135  1.00 51.94  ? 296 LEU A CA    1 
ATOM   2666 C  C     . LEU A 1 296 ? 9.152   241.289 18.256  1.00 55.49  ? 296 LEU A C     1 
ATOM   2667 O  O     . LEU A 1 296 ? 8.819   240.107 18.101  1.00 55.77  ? 296 LEU A O     1 
ATOM   2668 C  CB    . LEU A 1 296 ? 7.515   242.800 17.134  1.00 49.45  ? 296 LEU A CB    1 
ATOM   2669 C  CG    . LEU A 1 296 ? 7.135   243.753 15.997  1.00 53.39  ? 296 LEU A CG    1 
ATOM   2670 C  CD1   . LEU A 1 296 ? 5.638   244.093 15.988  1.00 51.47  ? 296 LEU A CD1   1 
ATOM   2671 C  CD2   . LEU A 1 296 ? 7.971   245.014 16.071  1.00 52.38  ? 296 LEU A CD2   1 
ATOM   2672 N  N     . SER A 1 297 ? 9.707   241.738 19.378  1.00 48.87  ? 297 SER A N     1 
ATOM   2673 C  CA    . SER A 1 297 ? 9.755   240.875 20.552  1.00 47.10  ? 297 SER A CA    1 
ATOM   2674 C  C     . SER A 1 297 ? 9.332   241.611 21.810  1.00 50.03  ? 297 SER A C     1 
ATOM   2675 O  O     . SER A 1 297 ? 9.553   242.820 21.956  1.00 47.78  ? 297 SER A O     1 
ATOM   2676 C  CB    . SER A 1 297 ? 11.153  240.273 20.748  1.00 46.56  ? 297 SER A CB    1 
ATOM   2677 O  OG    . SER A 1 297 ? 12.139  241.267 20.913  1.00 52.45  ? 297 SER A OG    1 
ATOM   2678 N  N     . LYS A 1 298 ? 8.695   240.879 22.709  1.00 41.46  ? 298 LYS A N     1 
ATOM   2679 C  CA    . LYS A 1 298 ? 8.536   241.369 24.058  1.00 52.62  ? 298 LYS A CA    1 
ATOM   2680 C  C     . LYS A 1 298 ? 8.927   240.253 24.996  1.00 47.04  ? 298 LYS A C     1 
ATOM   2681 O  O     . LYS A 1 298 ? 8.530   239.103 24.811  1.00 43.23  ? 298 LYS A O     1 
ATOM   2682 C  CB    . LYS A 1 298 ? 7.112   241.846 24.348  1.00 60.12  ? 298 LYS A CB    1 
ATOM   2683 C  CG    . LYS A 1 298 ? 7.056   242.661 25.639  1.00 65.02  ? 298 LYS A CG    1 
ATOM   2684 C  CD    . LYS A 1 298 ? 5.678   243.216 25.955  1.00 67.51  ? 298 LYS A CD    1 
ATOM   2685 C  CE    . LYS A 1 298 ? 5.714   244.073 27.213  1.00 66.06  ? 298 LYS A CE    1 
ATOM   2686 N  NZ    . LYS A 1 298 ? 6.603   245.238 27.029  1.00 74.60  1 298 LYS A NZ    1 
ATOM   2687 N  N     . GLY A 1 299 ? 9.727   240.593 25.995  1.00 41.52  ? 299 GLY A N     1 
ATOM   2688 C  CA    . GLY A 1 299 ? 10.191  239.599 26.940  1.00 46.95  ? 299 GLY A CA    1 
ATOM   2689 C  C     . GLY A 1 299 ? 9.952   240.011 28.377  1.00 50.46  ? 299 GLY A C     1 
ATOM   2690 O  O     . GLY A 1 299 ? 9.723   241.189 28.683  1.00 51.44  ? 299 GLY A O     1 
ATOM   2691 N  N     . LYS A 1 300 ? 10.003  239.039 29.276  1.00 49.44  ? 300 LYS A N     1 
ATOM   2692 C  CA    . LYS A 1 300 ? 9.912   239.351 30.698  1.00 51.82  ? 300 LYS A CA    1 
ATOM   2693 C  C     . LYS A 1 300 ? 10.795  238.407 31.483  1.00 42.43  ? 300 LYS A C     1 
ATOM   2694 O  O     . LYS A 1 300 ? 10.730  237.180 31.314  1.00 37.50  ? 300 LYS A O     1 
ATOM   2695 C  CB    . LYS A 1 300 ? 8.463   239.273 31.191  1.00 54.04  ? 300 LYS A CB    1 
ATOM   2696 C  CG    . LYS A 1 300 ? 8.310   239.343 32.708  1.00 60.01  ? 300 LYS A CG    1 
ATOM   2697 C  CD    . LYS A 1 300 ? 7.508   240.554 33.135  1.00 68.46  ? 300 LYS A CD    1 
ATOM   2698 C  CE    . LYS A 1 300 ? 7.084   240.471 34.602  1.00 73.85  ? 300 LYS A CE    1 
ATOM   2699 N  NZ    . LYS A 1 300 ? 5.759   239.792 34.727  1.00 78.38  1 300 LYS A NZ    1 
ATOM   2700 N  N     . LYS A 1 301 ? 11.641  238.985 32.323  1.00 46.49  ? 301 LYS A N     1 
ATOM   2701 C  CA    . LYS A 1 301 ? 12.510  238.194 33.187  1.00 47.45  ? 301 LYS A CA    1 
ATOM   2702 C  C     . LYS A 1 301 ? 12.044  238.290 34.633  1.00 48.19  ? 301 LYS A C     1 
ATOM   2703 O  O     . LYS A 1 301 ? 11.798  239.379 35.138  1.00 50.57  ? 301 LYS A O     1 
ATOM   2704 C  CB    . LYS A 1 301 ? 13.960  238.655 33.066  1.00 46.07  ? 301 LYS A CB    1 
ATOM   2705 C  CG    . LYS A 1 301 ? 14.731  238.463 34.321  1.00 46.97  ? 301 LYS A CG    1 
ATOM   2706 C  CD    . LYS A 1 301 ? 16.131  237.959 34.093  1.00 48.48  ? 301 LYS A CD    1 
ATOM   2707 C  CE    . LYS A 1 301 ? 16.904  238.019 35.424  1.00 60.57  ? 301 LYS A CE    1 
ATOM   2708 N  NZ    . LYS A 1 301 ? 18.349  237.723 35.240  1.00 66.35  1 301 LYS A NZ    1 
ATOM   2709 N  N     . PHE A 1 302 ? 11.916  237.147 35.297  1.00 55.05  ? 302 PHE A N     1 
ATOM   2710 C  CA    . PHE A 1 302 ? 11.479  237.145 36.685  1.00 42.16  ? 302 PHE A CA    1 
ATOM   2711 C  C     . PHE A 1 302 ? 12.634  236.976 37.635  1.00 45.75  ? 302 PHE A C     1 
ATOM   2712 O  O     . PHE A 1 302 ? 13.771  236.756 37.204  1.00 46.45  ? 302 PHE A O     1 
ATOM   2713 C  CB    . PHE A 1 302 ? 10.452  236.061 36.911  1.00 51.82  ? 302 PHE A CB    1 
ATOM   2714 C  CG    . PHE A 1 302 ? 9.248   236.219 36.060  1.00 50.71  ? 302 PHE A CG    1 
ATOM   2715 C  CD1   . PHE A 1 302 ? 9.260   235.780 34.743  1.00 44.70  ? 302 PHE A CD1   1 
ATOM   2716 C  CD2   . PHE A 1 302 ? 8.107   236.821 36.556  1.00 47.68  ? 302 PHE A CD2   1 
ATOM   2717 C  CE1   . PHE A 1 302 ? 8.151   235.929 33.942  1.00 44.34  ? 302 PHE A CE1   1 
ATOM   2718 C  CE2   . PHE A 1 302 ? 6.995   236.972 35.753  1.00 50.30  ? 302 PHE A CE2   1 
ATOM   2719 C  CZ    . PHE A 1 302 ? 7.024   236.525 34.443  1.00 49.36  ? 302 PHE A CZ    1 
ATOM   2720 N  N     . LYS A 1 303 ? 12.334  237.121 38.929  1.00 46.20  ? 303 LYS A N     1 
ATOM   2721 C  CA    . LYS A 1 303 ? 13.298  236.891 39.988  1.00 52.56  ? 303 LYS A CA    1 
ATOM   2722 C  C     . LYS A 1 303 ? 13.409  235.406 40.326  1.00 55.74  ? 303 LYS A C     1 
ATOM   2723 O  O     . LYS A 1 303 ? 14.237  235.001 41.133  1.00 64.52  ? 303 LYS A O     1 
ATOM   2724 C  CB    . LYS A 1 303 ? 12.900  237.686 41.227  1.00 53.68  ? 303 LYS A CB    1 
ATOM   2725 C  CG    . LYS A 1 303 ? 12.834  239.184 40.994  1.00 52.01  ? 303 LYS A CG    1 
ATOM   2726 C  CD    . LYS A 1 303 ? 14.227  239.776 40.885  1.00 62.13  ? 303 LYS A CD    1 
ATOM   2727 C  CE    . LYS A 1 303 ? 14.201  241.262 40.538  1.00 72.82  ? 303 LYS A CE    1 
ATOM   2728 N  NZ    . LYS A 1 303 ? 15.582  241.816 40.387  1.00 78.32  1 303 LYS A NZ    1 
ATOM   2729 N  N     . HIS A 1 304 ? 12.558  234.602 39.701  1.00 49.66  ? 304 HIS A N     1 
ATOM   2730 C  CA    . HIS A 1 304 ? 12.534  233.159 39.906  1.00 45.36  ? 304 HIS A CA    1 
ATOM   2731 C  C     . HIS A 1 304 ? 12.286  232.438 38.574  1.00 48.23  ? 304 HIS A C     1 
ATOM   2732 O  O     . HIS A 1 304 ? 11.919  233.064 37.574  1.00 49.81  ? 304 HIS A O     1 
ATOM   2733 C  CB    . HIS A 1 304 ? 11.440  232.792 40.891  1.00 43.66  ? 304 HIS A CB    1 
ATOM   2734 C  CG    . HIS A 1 304 ? 10.085  233.215 40.433  1.00 48.11  ? 304 HIS A CG    1 
ATOM   2735 N  ND1   . HIS A 1 304 ? 9.404   232.575 39.409  1.00 42.67  ? 304 HIS A ND1   1 
ATOM   2736 C  CD2   . HIS A 1 304 ? 9.301   234.255 40.814  1.00 43.24  ? 304 HIS A CD2   1 
ATOM   2737 C  CE1   . HIS A 1 304 ? 8.252   233.187 39.205  1.00 49.11  ? 304 HIS A CE1   1 
ATOM   2738 N  NE2   . HIS A 1 304 ? 8.163   234.209 40.041  1.00 59.10  ? 304 HIS A NE2   1 
ATOM   2739 N  N     . GLY A 1 305 ? 12.461  231.120 38.569  1.00 46.22  ? 305 GLY A N     1 
ATOM   2740 C  CA    . GLY A 1 305 ? 12.255  230.337 37.371  1.00 37.81  ? 305 GLY A CA    1 
ATOM   2741 C  C     . GLY A 1 305 ? 10.779  230.264 37.020  1.00 40.26  ? 305 GLY A C     1 
ATOM   2742 O  O     . GLY A 1 305 ? 9.907   230.465 37.892  1.00 41.32  ? 305 GLY A O     1 
ATOM   2743 N  N     . ILE A 1 306 ? 10.517  229.950 35.751  1.00 34.57  ? 306 ILE A N     1 
ATOM   2744 C  CA    . ILE A 1 306 ? 9.179   229.961 35.160  1.00 37.70  ? 306 ILE A CA    1 
ATOM   2745 C  C     . ILE A 1 306 ? 8.764   228.543 34.803  1.00 38.46  ? 306 ILE A C     1 
ATOM   2746 O  O     . ILE A 1 306 ? 9.419   227.914 33.988  1.00 40.87  ? 306 ILE A O     1 
ATOM   2747 C  CB    . ILE A 1 306 ? 9.141   230.817 33.867  1.00 35.98  ? 306 ILE A CB    1 
ATOM   2748 C  CG1   . ILE A 1 306 ? 9.524   232.261 34.152  1.00 44.60  ? 306 ILE A CG1   1 
ATOM   2749 C  CG2   . ILE A 1 306 ? 7.760   230.789 33.240  1.00 43.08  ? 306 ILE A CG2   1 
ATOM   2750 C  CD1   . ILE A 1 306 ? 10.201  232.955 32.966  1.00 53.60  ? 306 ILE A CD1   1 
ATOM   2751 H  HG12  . ILE A 1 306 ? 8.722   232.761 34.371  1.00 53.51  ? 306 ILE A HG12  1 
ATOM   2752 H  HG13  . ILE A 1 306 ? 10.140  232.280 34.900  1.00 53.51  ? 306 ILE A HG13  1 
ATOM   2753 H  HG21  . ILE A 1 306 ? 7.533   229.872 33.019  1.00 51.69  ? 306 ILE A HG21  1 
ATOM   2754 H  HG22  . ILE A 1 306 ? 7.118   231.145 33.874  1.00 51.69  ? 306 ILE A HG22  1 
ATOM   2755 H  HG23  . ILE A 1 306 ? 7.767   231.332 32.436  1.00 51.69  ? 306 ILE A HG23  1 
ATOM   2756 N  N     . SER A 1 307 ? 7.697   228.019 35.400  1.00 45.68  ? 307 SER A N     1 
ATOM   2757 C  CA    . SER A 1 307 ? 7.246   226.679 35.019  1.00 41.24  ? 307 SER A CA    1 
ATOM   2758 C  C     . SER A 1 307 ? 6.562   226.740 33.657  1.00 39.63  ? 307 SER A C     1 
ATOM   2759 O  O     . SER A 1 307 ? 6.065   227.788 33.268  1.00 35.73  ? 307 SER A O     1 
ATOM   2760 C  CB    . SER A 1 307 ? 6.281   226.105 36.032  1.00 41.13  ? 307 SER A CB    1 
ATOM   2761 O  OG    . SER A 1 307 ? 5.118   226.902 36.088  1.00 45.02  ? 307 SER A OG    1 
ATOM   2762 N  N     . ILE A 1 308 ? 6.499   225.607 32.967  1.00 39.10  ? 308 ILE A N     1 
ATOM   2763 C  CA    . ILE A 1 308 ? 5.933   225.584 31.638  1.00 42.43  ? 308 ILE A CA    1 
ATOM   2764 C  C     . ILE A 1 308 ? 4.493   226.113 31.663  1.00 48.45  ? 308 ILE A C     1 
ATOM   2765 O  O     . ILE A 1 308 ? 4.137   226.991 30.869  1.00 47.67  ? 308 ILE A O     1 
ATOM   2766 C  CB    . ILE A 1 308 ? 5.997   224.168 31.018  1.00 43.94  ? 308 ILE A CB    1 
ATOM   2767 C  CG1   . ILE A 1 308 ? 5.523   224.208 29.551  1.00 42.20  ? 308 ILE A CG1   1 
ATOM   2768 C  CG2   . ILE A 1 308 ? 5.236   223.132 31.868  1.00 34.95  ? 308 ILE A CG2   1 
ATOM   2769 C  CD1   . ILE A 1 308 ? 5.714   222.894 28.843  1.00 43.35  ? 308 ILE A CD1   1 
ATOM   2770 H  HG12  . ILE A 1 308 ? 4.578   224.425 29.530  1.00 50.64  ? 308 ILE A HG12  1 
ATOM   2771 H  HG13  . ILE A 1 308 ? 6.031   224.883 29.074  1.00 50.64  ? 308 ILE A HG13  1 
ATOM   2772 H  HG21  . ILE A 1 308 ? 4.306   223.398 31.932  1.00 41.94  ? 308 ILE A HG21  1 
ATOM   2773 H  HG22  . ILE A 1 308 ? 5.304   222.263 31.442  1.00 41.94  ? 308 ILE A HG22  1 
ATOM   2774 H  HG23  . ILE A 1 308 ? 5.633   223.098 32.753  1.00 41.94  ? 308 ILE A HG23  1 
ATOM   2775 N  N     . ASP A 1 309 ? 3.690   225.633 32.608  1.00 46.28  ? 309 ASP A N     1 
ATOM   2776 C  CA    . ASP A 1 309 ? 2.301   226.082 32.718  1.00 51.82  ? 309 ASP A CA    1 
ATOM   2777 C  C     . ASP A 1 309 ? 2.242   227.588 32.898  1.00 53.29  ? 309 ASP A C     1 
ATOM   2778 O  O     . ASP A 1 309 ? 1.322   228.268 32.425  1.00 51.66  ? 309 ASP A O     1 
ATOM   2779 C  CB    . ASP A 1 309 ? 1.605   225.395 33.883  1.00 60.58  ? 309 ASP A CB    1 
ATOM   2780 C  CG    . ASP A 1 309 ? 1.662   223.891 33.784  1.00 67.90  ? 309 ASP A CG    1 
ATOM   2781 O  OD1   . ASP A 1 309 ? 0.910   223.327 32.963  1.00 66.93  ? 309 ASP A OD1   1 
ATOM   2782 O  OD2   . ASP A 1 309 ? 2.458   223.283 34.529  1.00 72.46  1 309 ASP A OD2   1 
ATOM   2783 N  N     . ASN A 1 310 ? 3.251   228.104 33.580  1.00 49.41  ? 310 ASN A N     1 
ATOM   2784 C  CA    . ASN A 1 310 ? 3.314   229.517 33.846  1.00 49.71  ? 310 ASN A CA    1 
ATOM   2785 C  C     . ASN A 1 310 ? 3.695   230.277 32.588  1.00 47.91  ? 310 ASN A C     1 
ATOM   2786 O  O     . ASN A 1 310 ? 3.121   231.328 32.275  1.00 44.03  ? 310 ASN A O     1 
ATOM   2787 C  CB    . ASN A 1 310 ? 4.306   229.795 34.963  1.00 47.63  ? 310 ASN A CB    1 
ATOM   2788 C  CG    . ASN A 1 310 ? 3.921   230.985 35.764  1.00 56.25  ? 310 ASN A CG    1 
ATOM   2789 O  OD1   . ASN A 1 310 ? 2.782   231.446 35.671  1.00 57.66  ? 310 ASN A OD1   1 
ATOM   2790 N  ND2   . ASN A 1 310 ? 4.855   231.500 36.577  1.00 59.78  ? 310 ASN A ND2   1 
ATOM   2791 N  N     . ALA A 1 311 ? 4.673   229.724 31.877  1.00 44.42  ? 311 ALA A N     1 
ATOM   2792 C  CA    . ALA A 1 311 ? 5.116   230.245 30.593  1.00 41.62  ? 311 ALA A CA    1 
ATOM   2793 C  C     . ALA A 1 311 ? 3.956   230.492 29.622  1.00 36.17  ? 311 ALA A C     1 
ATOM   2794 O  O     . ALA A 1 311 ? 3.938   231.517 28.948  1.00 37.62  ? 311 ALA A O     1 
ATOM   2795 C  CB    . ALA A 1 311 ? 6.120   229.306 29.985  1.00 41.67  ? 311 ALA A CB    1 
ATOM   2796 N  N     . TYR A 1 312 ? 2.984   229.580 29.573  1.00 38.46  ? 312 TYR A N     1 
ATOM   2797 C  CA    . TYR A 1 312 ? 1.823   229.761 28.695  1.00 42.42  ? 312 TYR A CA    1 
ATOM   2798 C  C     . TYR A 1 312 ? 1.112   231.061 28.971  1.00 47.18  ? 312 TYR A C     1 
ATOM   2799 O  O     . TYR A 1 312 ? 0.753   231.789 28.043  1.00 55.08  ? 312 TYR A O     1 
ATOM   2800 C  CB    . TYR A 1 312 ? 0.796   228.648 28.852  1.00 45.94  ? 312 TYR A CB    1 
ATOM   2801 C  CG    . TYR A 1 312 ? 1.267   227.240 28.571  1.00 44.27  ? 312 TYR A CG    1 
ATOM   2802 C  CD1   . TYR A 1 312 ? 0.756   226.185 29.308  1.00 43.98  ? 312 TYR A CD1   1 
ATOM   2803 C  CD2   . TYR A 1 312 ? 2.201   226.959 27.576  1.00 30.70  ? 312 TYR A CD2   1 
ATOM   2804 C  CE1   . TYR A 1 312 ? 1.155   224.892 29.087  1.00 45.29  ? 312 TYR A CE1   1 
ATOM   2805 C  CE2   . TYR A 1 312 ? 2.601   225.646 27.336  1.00 32.39  ? 312 TYR A CE2   1 
ATOM   2806 C  CZ    . TYR A 1 312 ? 2.071   224.621 28.111  1.00 44.31  ? 312 TYR A CZ    1 
ATOM   2807 O  OH    . TYR A 1 312 ? 2.438   223.300 27.930  1.00 55.06  ? 312 TYR A OH    1 
ATOM   2808 N  N     . LYS A 1 313 ? 0.877   231.332 30.253  1.00 46.33  ? 313 LYS A N     1 
ATOM   2809 C  CA    . LYS A 1 313 ? 0.133   232.520 30.658  1.00 39.95  ? 313 LYS A CA    1 
ATOM   2810 C  C     . LYS A 1 313 ? 0.936   233.773 30.401  1.00 45.14  ? 313 LYS A C     1 
ATOM   2811 O  O     . LYS A 1 313 ? 0.428   234.732 29.805  1.00 49.45  ? 313 LYS A O     1 
ATOM   2812 C  CB    . LYS A 1 313 ? -0.273  232.428 32.119  1.00 39.92  ? 313 LYS A CB    1 
ATOM   2813 C  CG    . LYS A 1 313 ? -1.351  231.393 32.369  1.00 54.93  ? 313 LYS A CG    1 
ATOM   2814 C  CD    . LYS A 1 313 ? -1.701  231.306 33.841  1.00 70.20  ? 313 LYS A CD    1 
ATOM   2815 C  CE    . LYS A 1 313 ? -2.456  230.028 34.163  1.00 84.36  ? 313 LYS A CE    1 
ATOM   2816 N  NZ    . LYS A 1 313 ? -2.517  229.809 35.639  1.00 98.03  1 313 LYS A NZ    1 
ATOM   2817 N  N     . VAL A 1 314 ? 2.198   233.760 30.821  1.00 42.00  ? 314 VAL A N     1 
ATOM   2818 C  CA    . VAL A 1 314 ? 3.087   234.891 30.558  1.00 39.91  ? 314 VAL A CA    1 
ATOM   2819 C  C     . VAL A 1 314 ? 3.206   235.170 29.044  1.00 42.19  ? 314 VAL A C     1 
ATOM   2820 O  O     . VAL A 1 314 ? 3.106   236.309 28.592  1.00 49.10  ? 314 VAL A O     1 
ATOM   2821 C  CB    . VAL A 1 314 ? 4.474   234.634 31.153  1.00 37.83  ? 314 VAL A CB    1 
ATOM   2822 C  CG1   . VAL A 1 314 ? 5.409   235.776 30.860  1.00 41.39  ? 314 VAL A CG1   1 
ATOM   2823 C  CG2   . VAL A 1 314 ? 4.354   234.466 32.662  1.00 48.53  ? 314 VAL A CG2   1 
ATOM   2824 H  HG11  . VAL A 1 314 ? 6.276   235.582 31.250  1.00 49.67  ? 314 VAL A HG11  1 
ATOM   2825 H  HG12  . VAL A 1 314 ? 5.493   235.876 29.898  1.00 49.67  ? 314 VAL A HG12  1 
ATOM   2826 H  HG13  . VAL A 1 314 ? 5.046   236.588 31.246  1.00 49.67  ? 314 VAL A HG13  1 
ATOM   2827 H  HG21  . VAL A 1 314 ? 5.235   234.304 33.032  1.00 58.24  ? 314 VAL A HG21  1 
ATOM   2828 H  HG22  . VAL A 1 314 ? 3.980   235.277 33.040  1.00 58.24  ? 314 VAL A HG22  1 
ATOM   2829 H  HG23  . VAL A 1 314 ? 3.771   233.714 32.850  1.00 58.24  ? 314 VAL A HG23  1 
ATOM   2830 N  N     . ALA A 1 315 ? 3.405   234.119 28.264  1.00 44.89  ? 315 ALA A N     1 
ATOM   2831 C  CA    . ALA A 1 315 ? 3.599   234.254 26.826  1.00 37.74  ? 315 ALA A CA    1 
ATOM   2832 C  C     . ALA A 1 315 ? 2.369   234.854 26.149  1.00 44.49  ? 315 ALA A C     1 
ATOM   2833 O  O     . ALA A 1 315 ? 2.494   235.789 25.351  1.00 41.83  ? 315 ALA A O     1 
ATOM   2834 C  CB    . ALA A 1 315 ? 3.929   232.934 26.243  1.00 31.53  ? 315 ALA A CB    1 
ATOM   2835 N  N     . GLU A 1 316 ? 1.186   234.332 26.481  1.00 41.20  ? 316 GLU A N     1 
ATOM   2836 C  CA    . GLU A 1 316 ? -0.060  234.909 25.979  1.00 37.17  ? 316 GLU A CA    1 
ATOM   2837 C  C     . GLU A 1 316 ? -0.179  236.374 26.374  1.00 47.54  ? 316 GLU A C     1 
ATOM   2838 O  O     . GLU A 1 316 ? -0.643  237.202 25.592  1.00 52.79  ? 316 GLU A O     1 
ATOM   2839 C  CB    . GLU A 1 316 ? -1.275  234.131 26.488  1.00 32.14  ? 316 GLU A CB    1 
ATOM   2840 C  CG    . GLU A 1 316 ? -2.609  234.815 26.176  1.00 41.32  ? 316 GLU A CG    1 
ATOM   2841 C  CD    . GLU A 1 316 ? -3.818  233.986 26.585  1.00 50.76  ? 316 GLU A CD    1 
ATOM   2842 O  OE1   . GLU A 1 316 ? -3.645  232.885 27.175  1.00 49.58  ? 316 GLU A OE1   1 
ATOM   2843 O  OE2   . GLU A 1 316 ? -4.950  234.459 26.341  1.00 56.36  1 316 GLU A OE2   1 
ATOM   2844 N  N     . ASP A 1 317 ? 0.243   236.702 27.591  1.00 52.12  ? 317 ASP A N     1 
ATOM   2845 C  CA    . ASP A 1 317 ? 0.256   238.101 28.013  1.00 51.22  ? 317 ASP A CA    1 
ATOM   2846 C  C     . ASP A 1 317 ? 1.189   238.934 27.129  1.00 51.57  ? 317 ASP A C     1 
ATOM   2847 O  O     . ASP A 1 317 ? 0.808   239.999 26.659  1.00 55.34  ? 317 ASP A O     1 
ATOM   2848 C  CB    . ASP A 1 317 ? 0.668   238.230 29.478  1.00 49.38  ? 317 ASP A CB    1 
ATOM   2849 C  CG    . ASP A 1 317 ? -0.506  238.074 30.425  1.00 66.08  ? 317 ASP A CG    1 
ATOM   2850 O  OD1   . ASP A 1 317 ? -1.650  237.981 29.914  1.00 68.59  ? 317 ASP A OD1   1 
ATOM   2851 O  OD2   . ASP A 1 317 ? -0.292  238.054 31.667  1.00 67.99  1 317 ASP A OD2   1 
ATOM   2852 N  N     . LEU A 1 318 ? 2.406   238.445 26.897  1.00 43.65  ? 318 LEU A N     1 
ATOM   2853 C  CA    . LEU A 1 318 ? 3.381   239.190 26.105  1.00 47.72  ? 318 LEU A CA    1 
ATOM   2854 C  C     . LEU A 1 318 ? 2.936   239.376 24.637  1.00 49.20  ? 318 LEU A C     1 
ATOM   2855 O  O     . LEU A 1 318 ? 3.063   240.467 24.068  1.00 51.29  ? 318 LEU A O     1 
ATOM   2856 C  CB    . LEU A 1 318 ? 4.737   238.488 26.156  1.00 47.01  ? 318 LEU A CB    1 
ATOM   2857 C  CG    . LEU A 1 318 ? 5.417   238.394 27.529  1.00 42.40  ? 318 LEU A CG    1 
ATOM   2858 C  CD1   . LEU A 1 318 ? 6.533   237.355 27.546  1.00 35.96  ? 318 LEU A CD1   1 
ATOM   2859 C  CD2   . LEU A 1 318 ? 5.965   239.733 27.927  1.00 42.31  ? 318 LEU A CD2   1 
ATOM   2860 N  N     . LEU A 1 319 ? 2.411   238.317 24.032  1.00 40.86  ? 319 LEU A N     1 
ATOM   2861 C  CA    . LEU A 1 319 ? 1.929   238.395 22.663  1.00 45.59  ? 319 LEU A CA    1 
ATOM   2862 C  C     . LEU A 1 319 ? 0.814   239.424 22.533  1.00 56.96  ? 319 LEU A C     1 
ATOM   2863 O  O     . LEU A 1 319 ? 0.798   240.243 21.605  1.00 56.60  ? 319 LEU A O     1 
ATOM   2864 C  CB    . LEU A 1 319 ? 1.434   237.027 22.197  1.00 43.36  ? 319 LEU A CB    1 
ATOM   2865 C  CG    . LEU A 1 319 ? 0.517   237.009 20.970  1.00 47.42  ? 319 LEU A CG    1 
ATOM   2866 C  CD1   . LEU A 1 319 ? 1.263   237.535 19.752  1.00 36.50  ? 319 LEU A CD1   1 
ATOM   2867 C  CD2   . LEU A 1 319 ? -0.003  235.598 20.714  1.00 43.60  ? 319 LEU A CD2   1 
ATOM   2868 N  N     . ARG A 1 320 ? -0.112  239.371 23.484  1.00 55.86  ? 320 ARG A N     1 
ATOM   2869 C  CA    . ARG A 1 320 ? -1.275  240.246 23.507  1.00 52.19  ? 320 ARG A CA    1 
ATOM   2870 C  C     . ARG A 1 320 ? -0.820  241.706 23.594  1.00 58.31  ? 320 ARG A C     1 
ATOM   2871 O  O     . ARG A 1 320 ? -1.431  242.610 23.018  1.00 62.09  ? 320 ARG A O     1 
ATOM   2872 C  CB    . ARG A 1 320 ? -2.173  239.857 24.692  1.00 52.53  ? 320 ARG A CB    1 
ATOM   2873 C  CG    . ARG A 1 320 ? -3.649  240.136 24.526  1.00 60.43  ? 320 ARG A CG    1 
ATOM   2874 C  CD    . ARG A 1 320 ? -4.481  239.437 25.597  1.00 54.20  ? 320 ARG A CD    1 
ATOM   2875 N  NE    . ARG A 1 320 ? -4.852  238.079 25.207  1.00 57.07  ? 320 ARG A NE    1 
ATOM   2876 C  CZ    . ARG A 1 320 ? -5.814  237.799 24.334  1.00 63.66  ? 320 ARG A CZ    1 
ATOM   2877 N  NH1   . ARG A 1 320 ? -6.105  236.540 24.023  1.00 67.49  1 320 ARG A NH1   1 
ATOM   2878 N  NH2   . ARG A 1 320 ? -6.484  238.787 23.759  1.00 69.52  ? 320 ARG A NH2   1 
ATOM   2879 N  N     . GLU A 1 321 ? 0.278   241.922 24.310  1.00 62.22  ? 321 GLU A N     1 
ATOM   2880 C  CA    . GLU A 1 321 ? 0.859   243.253 24.456  1.00 60.62  ? 321 GLU A CA    1 
ATOM   2881 C  C     . GLU A 1 321 ? 1.595   243.674 23.184  1.00 54.94  ? 321 GLU A C     1 
ATOM   2882 O  O     . GLU A 1 321 ? 1.544   244.842 22.804  1.00 59.29  ? 321 GLU A O     1 
ATOM   2883 C  CB    . GLU A 1 321 ? 1.805   243.299 25.665  1.00 61.60  ? 321 GLU A CB    1 
ATOM   2884 C  CG    . GLU A 1 321 ? 1.122   243.003 27.007  1.00 72.98  ? 321 GLU A CG    1 
ATOM   2885 C  CD    . GLU A 1 321 ? 2.114   242.913 28.165  1.00 81.42  ? 321 GLU A CD    1 
ATOM   2886 O  OE1   . GLU A 1 321 ? 3.137   243.630 28.117  1.00 79.81  ? 321 GLU A OE1   1 
ATOM   2887 O  OE2   . GLU A 1 321 ? 1.876   242.126 29.115  1.00 84.28  1 321 GLU A OE2   1 
ATOM   2888 N  N     . LEU A 1 322 ? 2.272   242.722 22.534  1.00 54.94  ? 322 LEU A N     1 
ATOM   2889 C  CA    . LEU A 1 322 ? 2.918   242.973 21.241  1.00 58.88  ? 322 LEU A CA    1 
ATOM   2890 C  C     . LEU A 1 322 ? 1.915   243.554 20.267  1.00 67.42  ? 322 LEU A C     1 
ATOM   2891 O  O     . LEU A 1 322 ? 2.161   244.584 19.646  1.00 78.17  ? 322 LEU A O     1 
ATOM   2892 C  CB    . LEU A 1 322 ? 3.519   241.697 20.640  1.00 55.54  ? 322 LEU A CB    1 
ATOM   2893 C  CG    . LEU A 1 322 ? 5.016   241.438 20.845  1.00 58.31  ? 322 LEU A CG    1 
ATOM   2894 C  CD1   . LEU A 1 322 ? 5.500   240.240 20.034  1.00 40.63  ? 322 LEU A CD1   1 
ATOM   2895 C  CD2   . LEU A 1 322 ? 5.840   242.666 20.518  1.00 66.71  ? 322 LEU A CD2   1 
ATOM   2896 N  N     . LEU A 1 323 ? 0.777   242.883 20.145  1.00 63.84  ? 323 LEU A N     1 
ATOM   2897 C  CA    . LEU A 1 323 ? -0.255  243.286 19.205  1.00 61.35  ? 323 LEU A CA    1 
ATOM   2898 C  C     . LEU A 1 323 ? -0.859  244.632 19.567  1.00 67.41  ? 323 LEU A C     1 
ATOM   2899 O  O     . LEU A 1 323 ? -1.392  245.329 18.702  1.00 74.23  ? 323 LEU A O     1 
ATOM   2900 C  CB    . LEU A 1 323 ? -1.328  242.211 19.126  1.00 56.70  ? 323 LEU A CB    1 
ATOM   2901 C  CG    . LEU A 1 323 ? -0.727  240.981 18.450  1.00 53.12  ? 323 LEU A CG    1 
ATOM   2902 C  CD1   . LEU A 1 323 ? -1.622  239.762 18.579  1.00 49.12  ? 323 LEU A CD1   1 
ATOM   2903 C  CD2   . LEU A 1 323 ? -0.429  241.303 16.982  1.00 59.54  ? 323 LEU A CD2   1 
ATOM   2904 N  N     . VAL A 1 324 ? -0.767  245.010 20.837  1.00 65.88  ? 324 VAL A N     1 
ATOM   2905 C  CA    . VAL A 1 324 ? -1.125  246.368 21.221  1.00 70.51  ? 324 VAL A CA    1 
ATOM   2906 C  C     . VAL A 1 324 ? -0.106  247.326 20.601  1.00 73.13  ? 324 VAL A C     1 
ATOM   2907 O  O     . VAL A 1 324 ? -0.482  248.331 19.998  1.00 79.40  ? 324 VAL A O     1 
ATOM   2908 C  CB    . VAL A 1 324 ? -1.194  246.520 22.757  1.00 76.51  ? 324 VAL A CB    1 
ATOM   2909 C  CG1   . VAL A 1 324 ? -1.074  247.995 23.212  1.00 81.49  ? 324 VAL A CG1   1 
ATOM   2910 C  CG2   . VAL A 1 324 ? -2.478  245.877 23.274  1.00 79.69  ? 324 VAL A CG2   1 
ATOM   2911 H  HG11  . VAL A 1 324 ? -0.975  248.560 22.429  1.00 97.78  ? 324 VAL A HG11  1 
ATOM   2912 H  HG12  . VAL A 1 324 ? -1.876  248.241 23.699  1.00 97.78  ? 324 VAL A HG12  1 
ATOM   2913 H  HG13  . VAL A 1 324 ? -0.297  248.086 23.786  1.00 97.78  ? 324 VAL A HG13  1 
ATOM   2914 H  HG21  . VAL A 1 324 ? -2.973  245.512 22.523  1.00 95.63  ? 324 VAL A HG21  1 
ATOM   2915 H  HG22  . VAL A 1 324 ? -2.248  245.169 23.895  1.00 95.63  ? 324 VAL A HG22  1 
ATOM   2916 H  HG23  . VAL A 1 324 ? -3.010  246.552 23.724  1.00 95.63  ? 324 VAL A HG23  1 
ATOM   2917 N  N     . ARG A 1 325 ? 1.179   246.999 20.723  1.00 68.65  ? 325 ARG A N     1 
ATOM   2918 C  CA    . ARG A 1 325 ? 2.234   247.817 20.122  1.00 69.47  ? 325 ARG A CA    1 
ATOM   2919 C  C     . ARG A 1 325 ? 2.050   248.001 18.603  1.00 73.53  ? 325 ARG A C     1 
ATOM   2920 O  O     . ARG A 1 325 ? 2.119   249.124 18.113  1.00 83.08  ? 325 ARG A O     1 
ATOM   2921 C  CB    . ARG A 1 325 ? 3.613   247.208 20.420  1.00 67.64  ? 325 ARG A CB    1 
ATOM   2922 C  CG    . ARG A 1 325 ? 4.798   248.151 20.191  1.00 71.36  ? 325 ARG A CG    1 
ATOM   2923 C  CD    . ARG A 1 325 ? 5.940   247.907 21.191  1.00 76.42  ? 325 ARG A CD    1 
ATOM   2924 N  NE    . ARG A 1 325 ? 6.790   246.769 20.831  1.00 85.51  ? 325 ARG A NE    1 
ATOM   2925 C  CZ    . ARG A 1 325 ? 7.398   245.969 21.708  1.00 91.77  ? 325 ARG A CZ    1 
ATOM   2926 N  NH1   . ARG A 1 325 ? 7.252   246.160 23.015  1.00 90.45  1 325 ARG A NH1   1 
ATOM   2927 N  NH2   . ARG A 1 325 ? 8.151   244.966 21.276  1.00 95.07  ? 325 ARG A NH2   1 
ATOM   2928 N  N     . ASP A 1 326 ? 1.798   246.923 17.857  1.00 69.74  ? 326 ASP A N     1 
ATOM   2929 C  CA    . ASP A 1 326 ? 1.736   247.050 16.405  1.00 71.43  ? 326 ASP A CA    1 
ATOM   2930 C  C     . ASP A 1 326 ? 0.410   247.582 15.876  1.00 86.16  ? 326 ASP A C     1 
ATOM   2931 O  O     . ASP A 1 326 ? 0.390   248.570 15.136  1.00 98.13  ? 326 ASP A O     1 
ATOM   2932 C  CB    . ASP A 1 326 ? 2.018   245.735 15.717  1.00 69.22  ? 326 ASP A CB    1 
ATOM   2933 C  CG    . ASP A 1 326 ? 2.315   245.931 14.245  1.00 80.47  ? 326 ASP A CG    1 
ATOM   2934 O  OD1   . ASP A 1 326 ? 1.360   246.132 13.454  1.00 84.40  ? 326 ASP A OD1   1 
ATOM   2935 O  OD2   . ASP A 1 326 ? 3.509   245.929 13.883  1.00 81.70  1 326 ASP A OD2   1 
ATOM   2936 N  N     . LYS A 1 327 ? -0.684  246.902 16.203  1.00 80.42  ? 327 LYS A N     1 
ATOM   2937 C  CA    . LYS A 1 327 ? -2.025  247.432 15.928  1.00 77.76  ? 327 LYS A CA    1 
ATOM   2938 C  C     . LYS A 1 327 ? -2.544  247.230 14.508  1.00 82.27  ? 327 LYS A C     1 
ATOM   2939 O  O     . LYS A 1 327 ? -3.756  247.271 14.296  1.00 87.36  ? 327 LYS A O     1 
ATOM   2940 C  CB    . LYS A 1 327 ? -2.085  248.930 16.221  1.00 77.41  ? 327 LYS A CB    1 
ATOM   2941 C  CG    . LYS A 1 327 ? -1.663  249.339 17.608  1.00 82.09  ? 327 LYS A CG    1 
ATOM   2942 C  CD    . LYS A 1 327 ? -1.559  250.849 17.667  1.00 96.48  ? 327 LYS A CD    1 
ATOM   2943 C  CE    . LYS A 1 327 ? -1.515  251.372 19.088  1.00 101.33 ? 327 LYS A CE    1 
ATOM   2944 N  NZ    . LYS A 1 327 ? -1.728  252.853 19.079  1.00 112.76 1 327 LYS A NZ    1 
ATOM   2945 N  N     . ARG A 1 328 ? -1.670  247.043 13.525  1.00 78.88  ? 328 ARG A N     1 
ATOM   2946 C  CA    . ARG A 1 328 ? -2.189  246.907 12.167  1.00 84.06  ? 328 ARG A CA    1 
ATOM   2947 C  C     . ARG A 1 328 ? -1.657  245.720 11.365  1.00 85.66  ? 328 ARG A C     1 
ATOM   2948 O  O     . ARG A 1 328 ? -2.371  245.181 10.521  1.00 91.75  ? 328 ARG A O     1 
ATOM   2949 C  CB    . ARG A 1 328 ? -1.952  248.204 11.390  1.00 90.96  ? 328 ARG A CB    1 
ATOM   2950 C  CG    . ARG A 1 328 ? -2.960  249.293 11.770  1.00 98.91  ? 328 ARG A CG    1 
ATOM   2951 C  CD    . ARG A 1 328 ? -2.868  250.530 10.892  1.00 105.86 ? 328 ARG A CD    1 
ATOM   2952 N  NE    . ARG A 1 328 ? -3.625  251.644 11.458  1.00 116.97 ? 328 ARG A NE    1 
ATOM   2953 C  CZ    . ARG A 1 328 ? -3.747  252.838 10.881  1.00 135.66 ? 328 ARG A CZ    1 
ATOM   2954 N  NH1   . ARG A 1 328 ? -3.166  253.079 9.712   1.00 140.36 1 328 ARG A NH1   1 
ATOM   2955 N  NH2   . ARG A 1 328 ? -4.455  253.796 11.469  1.00 143.91 ? 328 ARG A NH2   1 
ATOM   2956 N  N     . ARG A 1 329 ? -0.427  245.291 11.617  1.00 78.30  ? 329 ARG A N     1 
ATOM   2957 C  CA    . ARG A 1 329 ? 0.112   244.199 10.821  1.00 73.61  ? 329 ARG A CA    1 
ATOM   2958 C  C     . ARG A 1 329 ? -0.323  242.862 11.374  1.00 72.46  ? 329 ARG A C     1 
ATOM   2959 O  O     . ARG A 1 329 ? -0.366  242.671 12.581  1.00 77.01  ? 329 ARG A O     1 
ATOM   2960 C  CB    . ARG A 1 329 ? 1.633   244.260 10.762  1.00 72.44  ? 329 ARG A CB    1 
ATOM   2961 C  CG    . ARG A 1 329 ? 2.173   245.550 10.187  1.00 75.36  ? 329 ARG A CG    1 
ATOM   2962 C  CD    . ARG A 1 329 ? 3.289   246.070 11.070  1.00 76.76  ? 329 ARG A CD    1 
ATOM   2963 N  NE    . ARG A 1 329 ? 4.590   245.941 10.428  1.00 75.46  ? 329 ARG A NE    1 
ATOM   2964 C  CZ    . ARG A 1 329 ? 5.748   246.129 11.049  1.00 73.36  ? 329 ARG A CZ    1 
ATOM   2965 N  NH1   . ARG A 1 329 ? 5.767   246.444 12.338  1.00 67.38  1 329 ARG A NH1   1 
ATOM   2966 N  NH2   . ARG A 1 329 ? 6.885   246.006 10.378  1.00 73.76  ? 329 ARG A NH2   1 
ATOM   2967 N  N     . ASN A 1 330 ? -0.654  241.942 10.476  1.00 76.17  ? 330 ASN A N     1 
ATOM   2968 C  CA    . ASN A 1 330 ? -0.883  240.551 10.842  1.00 73.33  ? 330 ASN A CA    1 
ATOM   2969 C  C     . ASN A 1 330 ? 0.440   239.892 11.216  1.00 73.68  ? 330 ASN A C     1 
ATOM   2970 O  O     . ASN A 1 330 ? 1.514   240.370 10.852  1.00 71.92  ? 330 ASN A O     1 
ATOM   2971 C  CB    . ASN A 1 330 ? -1.540  239.763 9.695   1.00 74.10  ? 330 ASN A CB    1 
ATOM   2972 C  CG    . ASN A 1 330 ? -3.027  240.064 9.529   1.00 74.70  ? 330 ASN A CG    1 
ATOM   2973 O  OD1   . ASN A 1 330 ? -3.746  240.270 10.501  1.00 72.12  ? 330 ASN A OD1   1 
ATOM   2974 N  ND2   . ASN A 1 330 ? -3.494  240.071 8.278   1.00 77.82  ? 330 ASN A ND2   1 
ATOM   2975 N  N     . VAL A 1 331 ? 0.363   238.784 11.935  1.00 43.88  ? 331 VAL A N     1 
ATOM   2976 C  CA    . VAL A 1 331 ? 1.550   238.021 12.223  1.00 41.44  ? 331 VAL A CA    1 
ATOM   2977 C  C     . VAL A 1 331 ? 1.730   236.925 11.177  1.00 47.81  ? 331 VAL A C     1 
ATOM   2978 O  O     . VAL A 1 331 ? 0.740   236.383 10.675  1.00 49.41  ? 331 VAL A O     1 
ATOM   2979 C  CB    . VAL A 1 331 ? 1.473   237.389 13.636  1.00 41.02  ? 331 VAL A CB    1 
ATOM   2980 C  CG1   . VAL A 1 331 ? 2.773   236.703 13.974  1.00 38.11  ? 331 VAL A CG1   1 
ATOM   2981 C  CG2   . VAL A 1 331 ? 1.141   238.452 14.669  1.00 39.12  ? 331 VAL A CG2   1 
ATOM   2982 H  HG11  . VAL A 1 331 ? 2.704   236.315 14.860  1.00 45.73  ? 331 VAL A HG11  1 
ATOM   2983 H  HG12  . VAL A 1 331 ? 2.941   236.006 13.320  1.00 45.73  ? 331 VAL A HG12  1 
ATOM   2984 H  HG13  . VAL A 1 331 ? 3.490   237.356 13.953  1.00 45.73  ? 331 VAL A HG13  1 
ATOM   2985 H  HG21  . VAL A 1 331 ? 1.097   238.037 15.545  1.00 46.95  ? 331 VAL A HG21  1 
ATOM   2986 H  HG22  . VAL A 1 331 ? 1.835   239.130 14.657  1.00 46.95  ? 331 VAL A HG22  1 
ATOM   2987 H  HG23  . VAL A 1 331 ? 0.285   238.850 14.447  1.00 46.95  ? 331 VAL A HG23  1 
ATOM   2988 N  N     . ARG A 1 332 ? 2.984   236.602 10.855  1.00 51.64  ? 332 ARG A N     1 
ATOM   2989 C  CA    . ARG A 1 332 ? 3.301   235.517 9.918   1.00 47.94  ? 332 ARG A CA    1 
ATOM   2990 C  C     . ARG A 1 332 ? 3.935   234.302 10.619  1.00 51.06  ? 332 ARG A C     1 
ATOM   2991 O  O     . ARG A 1 332 ? 3.443   233.180 10.533  1.00 51.45  ? 332 ARG A O     1 
ATOM   2992 C  CB    . ARG A 1 332 ? 4.239   236.020 8.827   1.00 49.41  ? 332 ARG A CB    1 
ATOM   2993 C  CG    . ARG A 1 332 ? 4.390   235.037 7.673   1.00 52.33  ? 332 ARG A CG    1 
ATOM   2994 C  CD    . ARG A 1 332 ? 5.526   235.385 6.701   1.00 49.82  ? 332 ARG A CD    1 
ATOM   2995 N  NE    . ARG A 1 332 ? 5.774   234.239 5.835   1.00 50.37  ? 332 ARG A NE    1 
ATOM   2996 C  CZ    . ARG A 1 332 ? 5.103   233.997 4.709   1.00 56.93  ? 332 ARG A CZ    1 
ATOM   2997 N  NH1   . ARG A 1 332 ? 4.171   234.850 4.287   1.00 59.24  1 332 ARG A NH1   1 
ATOM   2998 N  NH2   . ARG A 1 332 ? 5.370   232.909 3.996   1.00 58.52  ? 332 ARG A NH2   1 
ATOM   2999 N  N     . ARG A 1 333 ? 5.043   234.530 11.310  1.00 54.06  ? 333 ARG A N     1 
ATOM   3000 C  CA    . ARG A 1 333 ? 5.667   233.478 12.086  1.00 55.91  ? 333 ARG A CA    1 
ATOM   3001 C  C     . ARG A 1 333 ? 5.687   233.837 13.578  1.00 53.13  ? 333 ARG A C     1 
ATOM   3002 O  O     . ARG A 1 333 ? 5.795   235.003 13.982  1.00 49.92  ? 333 ARG A O     1 
ATOM   3003 C  CB    . ARG A 1 333 ? 7.078   233.210 11.570  1.00 59.49  ? 333 ARG A CB    1 
ATOM   3004 C  CG    . ARG A 1 333 ? 7.162   233.226 10.072  1.00 67.61  ? 333 ARG A CG    1 
ATOM   3005 C  CD    . ARG A 1 333 ? 8.288   232.363 9.543   1.00 70.82  ? 333 ARG A CD    1 
ATOM   3006 N  NE    . ARG A 1 333 ? 9.592   232.861 9.940   1.00 72.79  ? 333 ARG A NE    1 
ATOM   3007 C  CZ    . ARG A 1 333 ? 10.422  233.507 9.131   1.00 76.19  ? 333 ARG A CZ    1 
ATOM   3008 N  NH1   . ARG A 1 333 ? 10.091  233.740 7.865   1.00 76.93  1 333 ARG A NH1   1 
ATOM   3009 N  NH2   . ARG A 1 333 ? 11.591  233.917 9.597   1.00 82.71  ? 333 ARG A NH2   1 
ATOM   3010 N  N     . ILE A 1 334 ? 5.558   232.838 14.421  1.00 50.11  ? 334 ILE A N     1 
ATOM   3011 C  CA    . ILE A 1 334 ? 5.626   233.152 15.822  1.00 49.41  ? 334 ILE A CA    1 
ATOM   3012 C  C     . ILE A 1 334 ? 6.705   232.350 16.493  1.00 49.82  ? 334 ILE A C     1 
ATOM   3013 O  O     . ILE A 1 334 ? 6.975   231.218 16.105  1.00 51.86  ? 334 ILE A O     1 
ATOM   3014 C  CB    . ILE A 1 334 ? 4.304   232.923 16.521  1.00 46.62  ? 334 ILE A CB    1 
ATOM   3015 C  CG1   . ILE A 1 334 ? 4.376   233.599 17.888  1.00 53.57  ? 334 ILE A CG1   1 
ATOM   3016 C  CG2   . ILE A 1 334 ? 3.985   231.440 16.613  1.00 37.32  ? 334 ILE A CG2   1 
ATOM   3017 C  CD1   . ILE A 1 334 ? 3.079   234.221 18.327  1.00 59.82  ? 334 ILE A CD1   1 
ATOM   3018 H  HG12  . ILE A 1 334 ? 4.626   232.936 18.551  1.00 64.29  ? 334 ILE A HG12  1 
ATOM   3019 H  HG13  . ILE A 1 334 ? 5.045   234.300 17.856  1.00 64.29  ? 334 ILE A HG13  1 
ATOM   3020 H  HG21  . ILE A 1 334 ? 3.935   231.073 15.716  1.00 44.78  ? 334 ILE A HG21  1 
ATOM   3021 H  HG22  . ILE A 1 334 ? 4.687   230.997 17.114  1.00 44.78  ? 334 ILE A HG22  1 
ATOM   3022 H  HG23  . ILE A 1 334 ? 3.134   231.328 17.065  1.00 44.78  ? 334 ILE A HG23  1 
ATOM   3023 N  N     . GLY A 1 335 ? 7.331   232.954 17.498  1.00 48.35  ? 335 GLY A N     1 
ATOM   3024 C  CA    . GLY A 1 335 ? 8.436   232.315 18.181  1.00 48.03  ? 335 GLY A CA    1 
ATOM   3025 C  C     . GLY A 1 335 ? 8.523   232.631 19.660  1.00 45.84  ? 335 GLY A C     1 
ATOM   3026 O  O     . GLY A 1 335 ? 7.980   233.616 20.137  1.00 50.17  ? 335 GLY A O     1 
ATOM   3027 N  N     . VAL A 1 336 ? 9.231   231.785 20.391  1.00 49.94  ? 336 VAL A N     1 
ATOM   3028 C  CA    . VAL A 1 336 ? 9.449   232.011 21.808  1.00 45.38  ? 336 VAL A CA    1 
ATOM   3029 C  C     . VAL A 1 336 ? 10.919  231.722 22.097  1.00 43.86  ? 336 VAL A C     1 
ATOM   3030 O  O     . VAL A 1 336 ? 11.535  230.857 21.448  1.00 41.79  ? 336 VAL A O     1 
ATOM   3031 C  CB    . VAL A 1 336 ? 8.507   231.142 22.659  1.00 39.31  ? 336 VAL A CB    1 
ATOM   3032 C  CG1   . VAL A 1 336 ? 9.011   229.712 22.786  1.00 39.84  ? 336 VAL A CG1   1 
ATOM   3033 C  CG2   . VAL A 1 336 ? 8.330   231.732 24.028  1.00 51.22  ? 336 VAL A CG2   1 
ATOM   3034 H  HG11  . VAL A 1 336 ? 9.843   229.626 22.296  1.00 47.81  ? 336 VAL A HG11  1 
ATOM   3035 H  HG12  . VAL A 1 336 ? 9.156   229.510 23.723  1.00 47.81  ? 336 VAL A HG12  1 
ATOM   3036 H  HG13  . VAL A 1 336 ? 8.346   229.109 22.417  1.00 47.81  ? 336 VAL A HG13  1 
ATOM   3037 H  HG21  . VAL A 1 336 ? 7.733   231.164 24.541  1.00 61.47  ? 336 VAL A HG21  1 
ATOM   3038 H  HG22  . VAL A 1 336 ? 9.195   231.782 24.464  1.00 61.47  ? 336 VAL A HG22  1 
ATOM   3039 H  HG23  . VAL A 1 336 ? 7.950   232.620 23.942  1.00 61.47  ? 336 VAL A HG23  1 
ATOM   3040 N  N     . LYS A 1 337 ? 11.492  232.490 23.018  1.00 34.75  ? 337 LYS A N     1 
ATOM   3041 C  CA    . LYS A 1 337 ? 12.872  232.271 23.445  1.00 34.26  ? 337 LYS A CA    1 
ATOM   3042 C  C     . LYS A 1 337 ? 12.940  232.134 24.986  1.00 36.27  ? 337 LYS A C     1 
ATOM   3043 O  O     . LYS A 1 337 ? 12.385  232.936 25.720  1.00 39.23  ? 337 LYS A O     1 
ATOM   3044 C  CB    . LYS A 1 337 ? 13.768  233.400 22.953  1.00 29.51  ? 337 LYS A CB    1 
ATOM   3045 C  CG    . LYS A 1 337 ? 15.233  233.118 23.129  1.00 30.87  ? 337 LYS A CG    1 
ATOM   3046 C  CD    . LYS A 1 337 ? 16.139  234.227 22.598  1.00 32.72  ? 337 LYS A CD    1 
ATOM   3047 C  CE    . LYS A 1 337 ? 16.136  235.469 23.474  1.00 45.77  ? 337 LYS A CE    1 
ATOM   3048 N  NZ    . LYS A 1 337 ? 17.550  235.955 23.725  1.00 56.09  1 337 LYS A NZ    1 
ATOM   3049 N  N     . LEU A 1 338 ? 13.594  231.082 25.454  1.00 39.57  ? 338 LEU A N     1 
ATOM   3050 C  CA    . LEU A 1 338 ? 13.705  230.794 26.880  1.00 32.85  ? 338 LEU A CA    1 
ATOM   3051 C  C     . LEU A 1 338 ? 15.163  230.942 27.257  1.00 40.59  ? 338 LEU A C     1 
ATOM   3052 O  O     . LEU A 1 338 ? 16.000  230.235 26.698  1.00 39.26  ? 338 LEU A O     1 
ATOM   3053 C  CB    . LEU A 1 338 ? 13.236  229.382 27.208  1.00 28.78  ? 338 LEU A CB    1 
ATOM   3054 C  CG    . LEU A 1 338 ? 11.839  228.873 26.821  1.00 34.00  ? 338 LEU A CG    1 
ATOM   3055 C  CD1   . LEU A 1 338 ? 11.709  227.396 27.179  1.00 35.19  ? 338 LEU A CD1   1 
ATOM   3056 C  CD2   . LEU A 1 338 ? 10.741  229.657 27.487  1.00 28.99  ? 338 LEU A CD2   1 
ATOM   3057 N  N     . ASP A 1 339 ? 15.489  231.853 28.177  1.00 38.28  ? 339 ASP A N     1 
ATOM   3058 C  CA    . ASP A 1 339 ? 16.887  231.951 28.626  1.00 48.55  ? 339 ASP A CA    1 
ATOM   3059 C  C     . ASP A 1 339 ? 17.012  232.399 30.081  1.00 40.10  ? 339 ASP A C     1 
ATOM   3060 O  O     . ASP A 1 339 ? 16.027  232.410 30.804  1.00 38.81  ? 339 ASP A O     1 
ATOM   3061 C  CB    . ASP A 1 339 ? 17.682  232.891 27.725  1.00 46.56  ? 339 ASP A CB    1 
ATOM   3062 C  CG    . ASP A 1 339 ? 17.054  234.256 27.614  1.00 54.26  ? 339 ASP A CG    1 
ATOM   3063 O  OD1   . ASP A 1 339 ? 16.090  234.539 28.363  1.00 55.40  ? 339 ASP A OD1   1 
ATOM   3064 O  OD2   . ASP A 1 339 ? 17.529  235.051 26.773  1.00 58.25  1 339 ASP A OD2   1 
ATOM   3065 N  N     . ASN A 1 340 ? 18.216  232.804 30.477  1.00 39.50  ? 340 ASN A N     1 
ATOM   3066 C  CA    . ASN A 1 340 ? 18.501  233.066 31.893  1.00 42.96  ? 340 ASN A CA    1 
ATOM   3067 C  C     . ASN A 1 340 ? 18.086  231.825 32.665  1.00 48.11  ? 340 ASN A C     1 
ATOM   3068 O  O     . ASN A 1 340 ? 17.219  231.877 33.531  1.00 43.59  ? 340 ASN A O     1 
ATOM   3069 C  CB    . ASN A 1 340 ? 17.748  234.290 32.419  1.00 48.97  ? 340 ASN A CB    1 
ATOM   3070 C  CG    . ASN A 1 340 ? 18.296  235.591 31.889  1.00 61.88  ? 340 ASN A CG    1 
ATOM   3071 O  OD1   . ASN A 1 340 ? 17.603  236.323 31.181  1.00 76.70  ? 340 ASN A OD1   1 
ATOM   3072 N  ND2   . ASN A 1 340 ? 19.541  235.895 32.235  1.00 65.03  ? 340 ASN A ND2   1 
ATOM   3073 N  N     . ILE A 1 341 ? 18.690  230.710 32.286  1.00 45.42  ? 341 ILE A N     1 
ATOM   3074 C  CA    . ILE A 1 341 ? 18.280  229.398 32.723  1.00 49.71  ? 341 ILE A CA    1 
ATOM   3075 C  C     . ILE A 1 341 ? 18.918  229.080 34.040  1.00 54.26  ? 341 ILE A C     1 
ATOM   3076 O  O     . ILE A 1 341 ? 20.121  229.284 34.199  1.00 54.08  ? 341 ILE A O     1 
ATOM   3077 C  CB    . ILE A 1 341 ? 18.694  228.334 31.708  1.00 52.15  ? 341 ILE A CB    1 
ATOM   3078 C  CG1   . ILE A 1 341 ? 17.930  228.530 30.399  1.00 45.49  ? 341 ILE A CG1   1 
ATOM   3079 C  CG2   . ILE A 1 341 ? 18.500  226.932 32.267  1.00 54.41  ? 341 ILE A CG2   1 
ATOM   3080 C  CD1   . ILE A 1 341 ? 18.824  228.448 29.235  1.00 52.51  ? 341 ILE A CD1   1 
ATOM   3081 H  HG12  . ILE A 1 341 ? 17.257  227.837 30.315  1.00 54.58  ? 341 ILE A HG12  1 
ATOM   3082 H  HG13  . ILE A 1 341 ? 17.513  229.406 30.401  1.00 54.58  ? 341 ILE A HG13  1 
ATOM   3083 H  HG21  . ILE A 1 341 ? 18.772  226.285 31.597  1.00 65.29  ? 341 ILE A HG21  1 
ATOM   3084 H  HG22  . ILE A 1 341 ? 19.044  226.832 33.063  1.00 65.29  ? 341 ILE A HG22  1 
ATOM   3085 H  HG23  . ILE A 1 341 ? 17.564  226.807 32.487  1.00 65.29  ? 341 ILE A HG23  1 
ATOM   3086 N  N     . ILE A 1 342 ? 18.101  228.602 34.977  1.00 63.06  ? 342 ILE A N     1 
ATOM   3087 C  CA    . ILE A 1 342 ? 18.589  227.985 36.210  1.00 62.88  ? 342 ILE A CA    1 
ATOM   3088 C  C     . ILE A 1 342 ? 18.953  226.556 35.844  1.00 58.65  ? 342 ILE A C     1 
ATOM   3089 O  O     . ILE A 1 342 ? 18.083  225.705 35.649  1.00 57.16  ? 342 ILE A O     1 
ATOM   3090 C  CB    . ILE A 1 342 ? 17.543  228.007 37.353  1.00 51.97  ? 342 ILE A CB    1 
ATOM   3091 C  CG1   . ILE A 1 342 ? 17.033  229.420 37.602  1.00 47.85  ? 342 ILE A CG1   1 
ATOM   3092 C  CG2   . ILE A 1 342 ? 18.145  227.480 38.620  1.00 61.72  ? 342 ILE A CG2   1 
ATOM   3093 C  CD1   . ILE A 1 342 ? 15.702  229.452 38.323  1.00 48.06  ? 342 ILE A CD1   1 
ATOM   3094 H  HG12  . ILE A 1 342 ? 17.679  229.897 38.145  1.00 57.42  ? 342 ILE A HG12  1 
ATOM   3095 H  HG13  . ILE A 1 342 ? 16.921  229.869 36.749  1.00 57.42  ? 342 ILE A HG13  1 
ATOM   3096 H  HG21  . ILE A 1 342 ? 17.474  227.502 39.321  1.00 74.06  ? 342 ILE A HG21  1 
ATOM   3097 H  HG22  . ILE A 1 342 ? 18.441  226.568 38.474  1.00 74.06  ? 342 ILE A HG22  1 
ATOM   3098 H  HG23  . ILE A 1 342 ? 18.900  228.037 38.867  1.00 74.06  ? 342 ILE A HG23  1 
ATOM   3099 N  N     . ILE A 1 343 ? 20.246  226.313 35.712  1.00 67.62  ? 343 ILE A N     1 
ATOM   3100 C  CA    . ILE A 1 343 ? 20.722  225.033 35.224  1.00 81.39  ? 343 ILE A CA    1 
ATOM   3101 C  C     . ILE A 1 343 ? 20.544  223.952 36.292  1.00 80.23  ? 343 ILE A C     1 
ATOM   3102 O  O     . ILE A 1 343 ? 20.747  224.197 37.478  1.00 76.87  ? 343 ILE A O     1 
ATOM   3103 C  CB    . ILE A 1 343 ? 22.202  225.134 34.796  1.00 88.63  ? 343 ILE A CB    1 
ATOM   3104 C  CG1   . ILE A 1 343 ? 22.351  226.132 33.644  1.00 82.27  ? 343 ILE A CG1   1 
ATOM   3105 C  CG2   . ILE A 1 343 ? 22.754  223.775 34.391  1.00 95.94  ? 343 ILE A CG2   1 
ATOM   3106 C  CD1   . ILE A 1 343 ? 23.786  226.518 33.353  1.00 81.06  ? 343 ILE A CD1   1 
ATOM   3107 H  HG12  . ILE A 1 343 ? 21.980  225.738 32.839  1.00 98.72  ? 343 ILE A HG12  1 
ATOM   3108 H  HG13  . ILE A 1 343 ? 21.865  226.942 33.868  1.00 98.72  ? 343 ILE A HG13  1 
ATOM   3109 H  HG21  . ILE A 1 343 ? 23.682  223.876 34.129  1.00 115.13 ? 343 ILE A HG21  1 
ATOM   3110 H  HG22  . ILE A 1 343 ? 22.687  223.170 35.146  1.00 115.13 ? 343 ILE A HG22  1 
ATOM   3111 H  HG23  . ILE A 1 343 ? 22.235  223.433 33.646  1.00 115.13 ? 343 ILE A HG23  1 
ATOM   3112 N  N     . ASN A 1 344 ? 20.156  222.757 35.861  1.00 83.28  ? 344 ASN A N     1 
ATOM   3113 C  CA    . ASN A 1 344 ? 20.000  221.632 36.773  1.00 86.52  ? 344 ASN A CA    1 
ATOM   3114 C  C     . ASN A 1 344 ? 21.319  221.206 37.400  1.00 89.94  ? 344 ASN A C     1 
ATOM   3115 O  O     . ASN A 1 344 ? 21.910  220.213 36.990  1.00 89.29  ? 344 ASN A O     1 
ATOM   3116 C  CB    . ASN A 1 344 ? 19.373  220.449 36.045  1.00 88.03  ? 344 ASN A CB    1 
ATOM   3117 C  CG    . ASN A 1 344 ? 18.011  220.783 35.472  1.00 92.39  ? 344 ASN A CG    1 
ATOM   3118 O  OD1   . ASN A 1 344 ? 17.268  221.592 36.041  1.00 97.37  ? 344 ASN A OD1   1 
ATOM   3119 N  ND2   . ASN A 1 344 ? 17.673  220.165 34.340  1.00 85.70  ? 344 ASN A ND2   1 
ATOM   3120 O  "O5'" . DG  B 2 1   ? 28.631  263.882 35.321  1.00 89.50  ? 1   DG  P "O5'" 1 
ATOM   3121 C  "C5'" . DG  B 2 1   ? 27.491  263.374 35.998  1.00 78.44  ? 1   DG  P "C5'" 1 
ATOM   3122 C  "C4'" . DG  B 2 1   ? 27.920  262.431 37.103  1.00 73.41  ? 1   DG  P "C4'" 1 
ATOM   3123 O  "O4'" . DG  B 2 1   ? 26.891  262.346 38.130  1.00 72.36  ? 1   DG  P "O4'" 1 
ATOM   3124 C  "C3'" . DG  B 2 1   ? 28.197  261.014 36.654  1.00 72.79  ? 1   DG  P "C3'" 1 
ATOM   3125 O  "O3'" . DG  B 2 1   ? 29.392  260.561 37.256  1.00 80.00  ? 1   DG  P "O3'" 1 
ATOM   3126 C  "C2'" . DG  B 2 1   ? 26.967  260.240 37.142  1.00 69.45  ? 1   DG  P "C2'" 1 
ATOM   3127 C  "C1'" . DG  B 2 1   ? 26.588  261.001 38.393  1.00 69.80  ? 1   DG  P "C1'" 1 
ATOM   3128 N  N9    . DG  B 2 1   ? 25.170  260.908 38.733  1.00 68.16  ? 1   DG  P N9    1 
ATOM   3129 C  C8    . DG  B 2 1   ? 24.117  261.491 38.067  1.00 67.89  ? 1   DG  P C8    1 
ATOM   3130 N  N7    . DG  B 2 1   ? 22.957  261.244 38.610  1.00 67.43  ? 1   DG  P N7    1 
ATOM   3131 C  C5    . DG  B 2 1   ? 23.259  260.446 39.713  1.00 65.98  ? 1   DG  P C5    1 
ATOM   3132 C  C6    . DG  B 2 1   ? 22.405  259.870 40.693  1.00 66.88  ? 1   DG  P C6    1 
ATOM   3133 O  O6    . DG  B 2 1   ? 21.174  259.949 40.786  1.00 68.66  ? 1   DG  P O6    1 
ATOM   3134 N  N1    . DG  B 2 1   ? 23.118  259.142 41.637  1.00 65.66  ? 1   DG  P N1    1 
ATOM   3135 C  C2    . DG  B 2 1   ? 24.481  258.999 41.647  1.00 71.57  ? 1   DG  P C2    1 
ATOM   3136 N  N2    . DG  B 2 1   ? 24.986  258.260 42.639  1.00 73.69  ? 1   DG  P N2    1 
ATOM   3137 N  N3    . DG  B 2 1   ? 25.294  259.535 40.743  1.00 73.21  ? 1   DG  P N3    1 
ATOM   3138 C  C4    . DG  B 2 1   ? 24.615  260.238 39.805  1.00 68.96  ? 1   DG  P C4    1 
ATOM   3139 P  P     . DG  B 2 2   ? 30.301  259.431 36.558  1.00 90.67  ? 2   DG  P P     1 
ATOM   3140 O  OP1   . DG  B 2 2   ? 31.664  259.661 37.080  1.00 98.16  ? 2   DG  P OP1   1 
ATOM   3141 O  OP2   . DG  B 2 2   ? 30.071  259.354 35.101  1.00 89.09  1 2   DG  P OP2   1 
ATOM   3142 O  "O5'" . DG  B 2 2   ? 29.711  258.070 37.128  1.00 77.72  ? 2   DG  P "O5'" 1 
ATOM   3143 C  "C5'" . DG  B 2 2   ? 29.649  257.867 38.513  1.00 76.50  ? 2   DG  P "C5'" 1 
ATOM   3144 C  "C4'" . DG  B 2 2   ? 28.866  256.616 38.818  1.00 75.44  ? 2   DG  P "C4'" 1 
ATOM   3145 O  "O4'" . DG  B 2 2   ? 27.465  256.952 38.997  1.00 74.32  ? 2   DG  P "O4'" 1 
ATOM   3146 C  "C3'" . DG  B 2 2   ? 28.891  255.550 37.716  1.00 79.97  ? 2   DG  P "C3'" 1 
ATOM   3147 O  "O3'" . DG  B 2 2   ? 28.830  254.279 38.330  1.00 85.63  ? 2   DG  P "O3'" 1 
ATOM   3148 C  "C2'" . DG  B 2 2   ? 27.593  255.846 36.980  1.00 77.42  ? 2   DG  P "C2'" 1 
ATOM   3149 C  "C1'" . DG  B 2 2   ? 26.715  256.090 38.186  1.00 79.52  ? 2   DG  P "C1'" 1 
ATOM   3150 N  N9    . DG  B 2 2   ? 25.429  256.690 37.903  1.00 81.51  ? 2   DG  P N9    1 
ATOM   3151 C  C8    . DG  B 2 2   ? 25.069  257.427 36.804  1.00 83.84  ? 2   DG  P C8    1 
ATOM   3152 N  N7    . DG  B 2 2   ? 23.828  257.825 36.841  1.00 82.89  ? 2   DG  P N7    1 
ATOM   3153 C  C5    . DG  B 2 2   ? 23.344  257.309 38.037  1.00 78.29  ? 2   DG  P C5    1 
ATOM   3154 C  C6    . DG  B 2 2   ? 22.063  257.406 38.617  1.00 73.70  ? 2   DG  P C6    1 
ATOM   3155 O  O6    . DG  B 2 2   ? 21.067  257.994 38.174  1.00 73.86  ? 2   DG  P O6    1 
ATOM   3156 N  N1    . DG  B 2 2   ? 21.997  256.734 39.840  1.00 72.62  ? 2   DG  P N1    1 
ATOM   3157 C  C2    . DG  B 2 2   ? 23.048  256.056 40.423  1.00 72.38  ? 2   DG  P C2    1 
ATOM   3158 N  N2    . DG  B 2 2   ? 22.805  255.467 41.613  1.00 64.54  ? 2   DG  P N2    1 
ATOM   3159 N  N3    . DG  B 2 2   ? 24.252  255.965 39.883  1.00 75.79  ? 2   DG  P N3    1 
ATOM   3160 C  C4    . DG  B 2 2   ? 24.323  256.613 38.697  1.00 77.31  ? 2   DG  P C4    1 
ATOM   3161 P  P     . DC  B 2 3   ? 29.413  252.961 37.620  1.00 98.74  ? 3   DC  P P     1 
ATOM   3162 O  OP1   . DC  B 2 3   ? 30.874  253.182 37.528  1.00 100.48 ? 3   DC  P OP1   1 
ATOM   3163 O  OP2   . DC  B 2 3   ? 28.619  252.619 36.404  1.00 85.85  1 3   DC  P OP2   1 
ATOM   3164 O  "O5'" . DC  B 2 3   ? 29.093  251.828 38.706  1.00 84.92  ? 3   DC  P "O5'" 1 
ATOM   3165 C  "C5'" . DC  B 2 3   ? 28.863  252.196 40.085  1.00 79.59  ? 3   DC  P "C5'" 1 
ATOM   3166 C  "C4'" . DC  B 2 3   ? 27.666  251.441 40.665  1.00 77.50  ? 3   DC  P "C4'" 1 
ATOM   3167 O  "O4'" . DC  B 2 3   ? 26.444  252.224 40.492  1.00 79.54  ? 3   DC  P "O4'" 1 
ATOM   3168 C  "C3'" . DC  B 2 3   ? 27.396  250.081 40.023  1.00 78.19  ? 3   DC  P "C3'" 1 
ATOM   3169 O  "O3'" . DC  B 2 3   ? 27.084  249.091 41.015  1.00 78.94  ? 3   DC  P "O3'" 1 
ATOM   3170 C  "C2'" . DC  B 2 3   ? 26.207  250.353 39.104  1.00 78.76  ? 3   DC  P "C2'" 1 
ATOM   3171 C  "C1'" . DC  B 2 3   ? 25.455  251.433 39.863  1.00 78.85  ? 3   DC  P "C1'" 1 
ATOM   3172 N  N1    . DC  B 2 3   ? 24.620  252.303 38.966  1.00 80.68  ? 3   DC  P N1    1 
ATOM   3173 C  C2    . DC  B 2 3   ? 23.276  252.537 39.282  1.00 79.14  ? 3   DC  P C2    1 
ATOM   3174 O  O2    . DC  B 2 3   ? 22.801  252.035 40.306  1.00 74.01  ? 3   DC  P O2    1 
ATOM   3175 N  N3    . DC  B 2 3   ? 22.533  253.316 38.455  1.00 76.70  ? 3   DC  P N3    1 
ATOM   3176 C  C4    . DC  B 2 3   ? 23.078  253.835 37.352  1.00 69.06  ? 3   DC  P C4    1 
ATOM   3177 N  N4    . DC  B 2 3   ? 22.305  254.602 36.574  1.00 59.34  ? 3   DC  P N4    1 
ATOM   3178 C  C5    . DC  B 2 3   ? 24.444  253.604 37.010  1.00 67.84  ? 3   DC  P C5    1 
ATOM   3179 C  C6    . DC  B 2 3   ? 25.168  252.837 37.832  1.00 74.64  ? 3   DC  P C6    1 
ATOM   3180 P  P     . DA  B 2 4   ? 27.048  247.530 40.601  1.00 103.48 ? 4   DA  P P     1 
ATOM   3181 O  OP1   . DA  B 2 4   ? 28.214  246.913 41.270  1.00 108.31 ? 4   DA  P OP1   1 
ATOM   3182 O  OP2   . DA  B 2 4   ? 26.882  247.406 39.124  1.00 88.62  1 4   DA  P OP2   1 
ATOM   3183 O  "O5'" . DA  B 2 4   ? 25.696  246.981 41.270  1.00 89.96  ? 4   DA  P "O5'" 1 
ATOM   3184 C  "C5'" . DA  B 2 4   ? 24.640  247.879 41.572  1.00 87.28  ? 4   DA  P "C5'" 1 
ATOM   3185 C  "C4'" . DA  B 2 4   ? 23.279  247.273 41.262  1.00 85.84  ? 4   DA  P "C4'" 1 
ATOM   3186 O  "O4'" . DA  B 2 4   ? 22.502  248.237 40.498  1.00 87.14  ? 4   DA  P "O4'" 1 
ATOM   3187 C  "C3'" . DA  B 2 4   ? 23.284  245.985 40.425  1.00 84.34  ? 4   DA  P "C3'" 1 
ATOM   3188 O  "O3'" . DA  B 2 4   ? 22.171  245.133 40.823  1.00 84.19  ? 4   DA  P "O3'" 1 
ATOM   3189 C  "C2'" . DA  B 2 4   ? 23.100  246.524 39.012  1.00 81.12  ? 4   DA  P "C2'" 1 
ATOM   3190 C  "C1'" . DA  B 2 4   ? 22.124  247.670 39.262  1.00 77.60  ? 4   DA  P "C1'" 1 
ATOM   3191 N  N9    . DA  B 2 4   ? 22.157  248.709 38.236  1.00 70.13  ? 4   DA  P N9    1 
ATOM   3192 C  C8    . DA  B 2 4   ? 23.236  249.107 37.496  1.00 73.22  ? 4   DA  P C8    1 
ATOM   3193 N  N7    . DA  B 2 4   ? 22.968  250.067 36.636  1.00 74.32  ? 4   DA  P N7    1 
ATOM   3194 C  C5    . DA  B 2 4   ? 21.620  250.316 36.830  1.00 70.21  ? 4   DA  P C5    1 
ATOM   3195 C  C6    . DA  B 2 4   ? 20.724  251.221 36.222  1.00 67.73  ? 4   DA  P C6    1 
ATOM   3196 N  N6    . DA  B 2 4   ? 21.082  252.077 35.249  1.00 68.11  ? 4   DA  P N6    1 
ATOM   3197 N  N1    . DA  B 2 4   ? 19.437  251.208 36.649  1.00 61.15  ? 4   DA  P N1    1 
ATOM   3198 C  C2    . DA  B 2 4   ? 19.081  250.341 37.614  1.00 58.63  ? 4   DA  P C2    1 
ATOM   3199 N  N3    . DA  B 2 4   ? 19.831  249.440 38.251  1.00 64.68  ? 4   DA  P N3    1 
ATOM   3200 C  C4    . DA  B 2 4   ? 21.102  249.480 37.810  1.00 70.42  ? 4   DA  P C4    1 
ATOM   3201 P  P     . DC  B 2 5   ? 22.071  243.575 40.390  1.00 88.64  ? 5   DC  P P     1 
ATOM   3202 O  OP1   . DC  B 2 5   ? 21.641  242.863 41.606  1.00 93.86  ? 5   DC  P OP1   1 
ATOM   3203 O  OP2   . DC  B 2 5   ? 23.269  243.109 39.648  1.00 84.29  1 5   DC  P OP2   1 
ATOM   3204 O  "O5'" . DC  B 2 5   ? 20.838  243.546 39.379  1.00 91.51  ? 5   DC  P "O5'" 1 
ATOM   3205 C  "C5'" . DC  B 2 5   ? 19.568  243.988 39.821  1.00 79.47  ? 5   DC  P "C5'" 1 
ATOM   3206 C  "C4'" . DC  B 2 5   ? 18.735  244.502 38.662  1.00 71.88  ? 5   DC  P "C4'" 1 
ATOM   3207 O  "O4'" . DC  B 2 5   ? 19.358  245.643 38.064  1.00 64.47  ? 5   DC  P "O4'" 1 
ATOM   3208 C  "C3'" . DC  B 2 5   ? 18.547  243.537 37.494  1.00 66.71  ? 5   DC  P "C3'" 1 
ATOM   3209 O  "O3'" . DC  B 2 5   ? 17.348  242.791 37.691  1.00 71.99  ? 5   DC  P "O3'" 1 
ATOM   3210 C  "C2'" . DC  B 2 5   ? 18.449  244.471 36.268  1.00 57.69  ? 5   DC  P "C2'" 1 
ATOM   3211 C  "C1'" . DC  B 2 5   ? 18.698  245.869 36.860  1.00 56.67  ? 5   DC  P "C1'" 1 
ATOM   3212 N  N1    . DC  B 2 5   ? 19.544  246.752 35.990  1.00 61.43  ? 5   DC  P N1    1 
ATOM   3213 C  C2    . DC  B 2 5   ? 18.946  247.821 35.306  1.00 59.36  ? 5   DC  P C2    1 
ATOM   3214 O  O2    . DC  B 2 5   ? 17.732  248.025 35.453  1.00 57.36  ? 5   DC  P O2    1 
ATOM   3215 N  N3    . DC  B 2 5   ? 19.716  248.607 34.503  1.00 58.77  ? 5   DC  P N3    1 
ATOM   3216 C  C4    . DC  B 2 5   ? 21.017  248.351 34.372  1.00 62.28  ? 5   DC  P C4    1 
ATOM   3217 N  N4    . DC  B 2 5   ? 21.730  249.146 33.572  1.00 66.25  ? 5   DC  P N4    1 
ATOM   3218 C  C5    . DC  B 2 5   ? 21.647  247.270 35.061  1.00 60.90  ? 5   DC  P C5    1 
ATOM   3219 C  C6    . DC  B 2 5   ? 20.880  246.498 35.848  1.00 63.77  ? 5   DC  P C6    1 
ATOM   3220 P  P     . DT  B 2 6   ? 16.772  241.823 36.549  1.00 71.01  ? 6   DT  P P     1 
ATOM   3221 O  OP1   . DT  B 2 6   ? 15.701  241.006 37.167  1.00 70.33  ? 6   DT  P OP1   1 
ATOM   3222 O  OP2   . DT  B 2 6   ? 17.902  241.204 35.814  1.00 71.88  1 6   DT  P OP2   1 
ATOM   3223 O  "O5'" . DT  B 2 6   ? 16.051  242.829 35.560  1.00 69.44  ? 6   DT  P "O5'" 1 
ATOM   3224 C  "C5'" . DT  B 2 6   ? 14.945  243.567 36.011  1.00 59.39  ? 6   DT  P "C5'" 1 
ATOM   3225 C  "C4'" . DT  B 2 6   ? 14.296  244.290 34.854  1.00 59.76  ? 6   DT  P "C4'" 1 
ATOM   3226 O  "O4'" . DT  B 2 6   ? 15.208  245.287 34.317  1.00 58.60  ? 6   DT  P "O4'" 1 
ATOM   3227 C  "C3'" . DT  B 2 6   ? 13.890  243.402 33.674  1.00 60.85  ? 6   DT  P "C3'" 1 
ATOM   3228 O  "O3'" . DT  B 2 6   ? 12.613  243.817 33.232  1.00 59.11  ? 6   DT  P "O3'" 1 
ATOM   3229 C  "C2'" . DT  B 2 6   ? 14.985  243.669 32.627  1.00 49.56  ? 6   DT  P "C2'" 1 
ATOM   3230 C  "C1'" . DT  B 2 6   ? 15.313  245.126 32.913  1.00 62.80  ? 6   DT  P "C1'" 1 
ATOM   3231 N  N1    . DT  B 2 6   ? 16.679  245.546 32.498  1.00 60.06  ? 6   DT  P N1    1 
ATOM   3232 C  C2    . DT  B 2 6   ? 16.818  246.699 31.768  1.00 57.87  ? 6   DT  P C2    1 
ATOM   3233 O  O2    . DT  B 2 6   ? 15.869  247.391 31.422  1.00 55.48  ? 6   DT  P O2    1 
ATOM   3234 N  N3    . DT  B 2 6   ? 18.111  247.018 31.443  1.00 55.56  ? 6   DT  P N3    1 
ATOM   3235 C  C4    . DT  B 2 6   ? 19.252  246.323 31.778  1.00 55.71  ? 6   DT  P C4    1 
ATOM   3236 O  O4    . DT  B 2 6   ? 20.369  246.697 31.436  1.00 61.99  ? 6   DT  P O4    1 
ATOM   3237 C  C5    . DT  B 2 6   ? 19.040  245.132 32.565  1.00 55.65  ? 6   DT  P C5    1 
ATOM   3238 C  C7    . DT  B 2 6   ? 20.209  244.300 32.997  1.00 52.38  ? 6   DT  P C7    1 
ATOM   3239 C  C6    . DT  B 2 6   ? 17.776  244.804 32.888  1.00 57.29  ? 6   DT  P C6    1 
ATOM   3240 P  P     . DG  B 2 7   ? 11.822  243.005 32.106  1.00 63.28  ? 7   DG  P P     1 
ATOM   3241 O  OP1   . DG  B 2 7   ? 10.385  243.191 32.383  1.00 56.76  ? 7   DG  P OP1   1 
ATOM   3242 O  OP2   . DG  B 2 7   ? 12.394  241.650 31.937  1.00 71.17  1 7   DG  P OP2   1 
ATOM   3243 O  "O5'" . DG  B 2 7   ? 12.171  243.804 30.783  1.00 69.29  ? 7   DG  P "O5'" 1 
ATOM   3244 C  "C5'" . DG  B 2 7   ? 11.665  245.081 30.605  1.00 63.10  ? 7   DG  P "C5'" 1 
ATOM   3245 C  "C4'" . DG  B 2 7   ? 12.038  245.569 29.239  1.00 61.63  ? 7   DG  P "C4'" 1 
ATOM   3246 O  "O4'" . DG  B 2 7   ? 13.441  245.903 29.233  1.00 64.42  ? 7   DG  P "O4'" 1 
ATOM   3247 C  "C3'" . DG  B 2 7   ? 11.840  244.541 28.121  1.00 58.71  ? 7   DG  P "C3'" 1 
ATOM   3248 O  "O3'" . DG  B 2 7   ? 11.192  245.162 27.049  1.00 51.00  ? 7   DG  P "O3'" 1 
ATOM   3249 C  "C2'" . DG  B 2 7   ? 13.268  244.115 27.760  1.00 53.73  ? 7   DG  P "C2'" 1 
ATOM   3250 C  "C1'" . DG  B 2 7   ? 14.018  245.390 28.069  1.00 62.51  ? 7   DG  P "C1'" 1 
ATOM   3251 N  N9    . DG  B 2 7   ? 15.440  245.240 28.304  1.00 63.56  ? 7   DG  P N9    1 
ATOM   3252 C  C8    . DG  B 2 7   ? 16.086  244.345 29.125  1.00 58.81  ? 7   DG  P C8    1 
ATOM   3253 N  N7    . DG  B 2 7   ? 17.388  244.497 29.124  1.00 52.27  ? 7   DG  P N7    1 
ATOM   3254 C  C5    . DG  B 2 7   ? 17.594  245.569 28.262  1.00 54.93  ? 7   DG  P C5    1 
ATOM   3255 C  C6    . DG  B 2 7   ? 18.785  246.203 27.853  1.00 53.36  ? 7   DG  P C6    1 
ATOM   3256 O  O6    . DG  B 2 7   ? 19.943  245.941 28.179  1.00 57.02  ? 7   DG  P O6    1 
ATOM   3257 N  N1    . DG  B 2 7   ? 18.531  247.252 26.965  1.00 59.23  ? 7   DG  P N1    1 
ATOM   3258 C  C2    . DG  B 2 7   ? 17.282  247.635 26.525  1.00 57.84  ? 7   DG  P C2    1 
ATOM   3259 N  N2    . DG  B 2 7   ? 17.230  248.662 25.667  1.00 55.62  ? 7   DG  P N2    1 
ATOM   3260 N  N3    . DG  B 2 7   ? 16.168  247.049 26.897  1.00 64.12  ? 7   DG  P N3    1 
ATOM   3261 C  C4    . DG  B 2 7   ? 16.400  246.030 27.765  1.00 62.72  ? 7   DG  P C4    1 
ATOM   3262 P  P     . DA  B 2 8   ? 10.710  244.312 25.787  1.00 56.74  ? 8   DA  P P     1 
ATOM   3263 O  OP1   . DA  B 2 8   ? 9.284   244.632 25.579  1.00 65.18  ? 8   DA  P OP1   1 
ATOM   3264 O  OP2   . DA  B 2 8   ? 11.139  242.906 25.930  1.00 65.25  1 8   DA  P OP2   1 
ATOM   3265 O  "O5'" . DA  B 2 8   ? 11.542  244.951 24.599  1.00 52.53  ? 8   DA  P "O5'" 1 
ATOM   3266 C  "C5'" . DA  B 2 8   ? 11.466  246.329 24.399  1.00 55.42  ? 8   DA  P "C5'" 1 
ATOM   3267 C  "C4'" . DA  B 2 8   ? 12.135  246.721 23.104  1.00 57.07  ? 8   DA  P "C4'" 1 
ATOM   3268 O  "O4'" . DA  B 2 8   ? 13.556  246.838 23.325  1.00 59.65  ? 8   DA  P "O4'" 1 
ATOM   3269 C  "C3'" . DA  B 2 8   ? 11.961  245.730 21.962  1.00 56.71  ? 8   DA  P "C3'" 1 
ATOM   3270 O  "O3'" . DA  B 2 8   ? 11.895  246.431 20.738  1.00 57.53  ? 8   DA  P "O3'" 1 
ATOM   3271 C  "C2'" . DA  B 2 8   ? 13.219  244.875 22.054  1.00 54.54  ? 8   DA  P "C2'" 1 
ATOM   3272 C  "C1'" . DA  B 2 8   ? 14.252  245.878 22.572  1.00 60.54  ? 8   DA  P "C1'" 1 
ATOM   3273 N  N9    . DA  B 2 8   ? 15.257  245.284 23.444  1.00 62.43  ? 8   DA  P N9    1 
ATOM   3274 C  C8    . DA  B 2 8   ? 15.054  244.349 24.417  1.00 54.10  ? 8   DA  P C8    1 
ATOM   3275 N  N7    . DA  B 2 8   ? 16.150  243.994 25.041  1.00 54.60  ? 8   DA  P N7    1 
ATOM   3276 C  C5    . DA  B 2 8   ? 17.141  244.750 24.440  1.00 57.84  ? 8   DA  P C5    1 
ATOM   3277 C  C6    . DA  B 2 8   ? 18.535  244.837 24.649  1.00 53.19  ? 8   DA  P C6    1 
ATOM   3278 N  N6    . DA  B 2 8   ? 19.193  244.128 25.573  1.00 52.00  ? 8   DA  P N6    1 
ATOM   3279 N  N1    . DA  B 2 8   ? 19.227  245.696 23.878  1.00 62.54  ? 8   DA  P N1    1 
ATOM   3280 C  C2    . DA  B 2 8   ? 18.568  246.410 22.953  1.00 67.65  ? 8   DA  P C2    1 
ATOM   3281 N  N3    . DA  B 2 8   ? 17.265  246.410 22.660  1.00 64.70  ? 8   DA  P N3    1 
ATOM   3282 C  C4    . DA  B 2 8   ? 16.603  245.557 23.454  1.00 64.07  ? 8   DA  P C4    1 
ATOM   3283 P  P     . DT  B 2 9   ? 11.646  245.640 19.365  1.00 78.98  ? 9   DT  P P     1 
ATOM   3284 O  OP1   . DT  B 2 9   ? 10.323  246.081 18.871  1.00 80.99  ? 9   DT  P OP1   1 
ATOM   3285 O  OP2   . DT  B 2 9   ? 11.909  244.189 19.520  1.00 82.83  1 9   DT  P OP2   1 
ATOM   3286 O  "O5'" . DT  B 2 9   ? 12.837  246.163 18.450  1.00 63.02  ? 9   DT  P "O5'" 1 
ATOM   3287 C  "C5'" . DT  B 2 9   ? 13.585  247.298 18.849  1.00 62.56  ? 9   DT  P "C5'" 1 
ATOM   3288 C  "C4'" . DT  B 2 9   ? 14.995  247.229 18.285  1.00 68.67  ? 9   DT  P "C4'" 1 
ATOM   3289 O  "O4'" . DT  B 2 9   ? 15.862  246.598 19.253  1.00 65.91  ? 9   DT  P "O4'" 1 
ATOM   3290 C  "C3'" . DT  B 2 9   ? 15.157  246.420 16.982  1.00 74.63  ? 9   DT  P "C3'" 1 
ATOM   3291 O  "O3'" . DT  B 2 9   ? 15.907  247.191 16.033  1.00 85.25  ? 9   DT  P "O3'" 1 
ATOM   3292 C  "C2'" . DT  B 2 9   ? 15.929  245.173 17.429  1.00 67.55  ? 9   DT  P "C2'" 1 
ATOM   3293 C  "C1'" . DT  B 2 9   ? 16.736  245.737 18.585  1.00 58.90  ? 9   DT  P "C1'" 1 
ATOM   3294 N  N1    . DT  B 2 9   ? 17.212  244.750 19.561  1.00 50.28  ? 9   DT  P N1    1 
ATOM   3295 C  C2    . DT  B 2 9   ? 18.528  244.798 19.940  1.00 56.34  ? 9   DT  P C2    1 
ATOM   3296 O  O2    . DT  B 2 9   ? 19.314  245.595 19.473  1.00 56.67  ? 9   DT  P O2    1 
ATOM   3297 N  N3    . DT  B 2 9   ? 18.901  243.870 20.880  1.00 57.21  ? 9   DT  P N3    1 
ATOM   3298 C  C4    . DT  B 2 9   ? 18.096  242.925 21.477  1.00 60.11  ? 9   DT  P C4    1 
ATOM   3299 O  O4    . DT  B 2 9   ? 18.529  242.140 22.312  1.00 63.67  ? 9   DT  P O4    1 
ATOM   3300 C  C5    . DT  B 2 9   ? 16.706  242.927 21.042  1.00 53.67  ? 9   DT  P C5    1 
ATOM   3301 C  C7    . DT  B 2 9   ? 15.733  241.938 21.618  1.00 48.06  ? 9   DT  P C7    1 
ATOM   3302 C  C6    . DT  B 2 9   ? 16.334  243.839 20.117  1.00 52.64  ? 9   DT  P C6    1 
ATOM   3303 P  P     . DC  B 2 10  ? 15.895  246.834 14.464  1.00 79.38  ? 10  DC  P P     1 
ATOM   3304 O  OP1   . DC  B 2 10  ? 15.769  248.131 13.781  1.00 82.61  ? 10  DC  P OP1   1 
ATOM   3305 O  OP2   . DC  B 2 10  ? 14.934  245.743 14.186  1.00 79.65  1 10  DC  P OP2   1 
ATOM   3306 O  "O5'" . DC  B 2 10  ? 17.335  246.191 14.210  1.00 85.37  ? 10  DC  P "O5'" 1 
ATOM   3307 C  "C5'" . DC  B 2 10  ? 18.512  246.898 14.588  1.00 92.90  ? 10  DC  P "C5'" 1 
ATOM   3308 C  "C4'" . DC  B 2 10  ? 19.708  245.964 14.604  1.00 99.06  ? 10  DC  P "C4'" 1 
ATOM   3309 O  "O4'" . DC  B 2 10  ? 19.670  245.150 15.801  1.00 96.29  ? 10  DC  P "O4'" 1 
ATOM   3310 C  "C3'" . DC  B 2 10  ? 19.792  244.977 13.422  1.00 105.89 ? 10  DC  P "C3'" 1 
ATOM   3311 O  "O3'" . DC  B 2 10  ? 21.120  245.010 12.852  1.00 115.77 ? 10  DC  P "O3'" 1 
ATOM   3312 C  "C2'" . DC  B 2 10  ? 19.475  243.622 14.070  1.00 96.09  ? 10  DC  P "C2'" 1 
ATOM   3313 C  "C1'" . DC  B 2 10  ? 20.034  243.839 15.461  1.00 91.44  ? 10  DC  P "C1'" 1 
ATOM   3314 N  N1    . DC  B 2 10  ? 19.501  242.925 16.488  1.00 78.17  ? 10  DC  P N1    1 
ATOM   3315 C  C2    . DC  B 2 10  ? 20.329  242.542 17.538  1.00 76.54  ? 10  DC  P C2    1 
ATOM   3316 O  O2    . DC  B 2 10  ? 21.483  242.984 17.578  1.00 77.23  ? 10  DC  P O2    1 
ATOM   3317 N  N3    . DC  B 2 10  ? 19.848  241.700 18.488  1.00 76.71  ? 10  DC  P N3    1 
ATOM   3318 C  C4    . DC  B 2 10  ? 18.592  241.253 18.410  1.00 75.56  ? 10  DC  P C4    1 
ATOM   3319 N  N4    . DC  B 2 10  ? 18.161  240.428 19.375  1.00 71.50  ? 10  DC  P N4    1 
ATOM   3320 C  C5    . DC  B 2 10  ? 17.726  241.636 17.338  1.00 77.61  ? 10  DC  P C5    1 
ATOM   3321 C  C6    . DC  B 2 10  ? 18.220  242.470 16.408  1.00 76.76  ? 10  DC  P C6    1 
ATOM   3322 P  P     . DG  B 2 11  ? 21.496  244.151 11.540  1.00 103.60 ? 11  DG  P P     1 
ATOM   3323 O  OP1   . DG  B 2 11  ? 22.381  245.028 10.743  1.00 110.50 ? 11  DG  P OP1   1 
ATOM   3324 O  OP2   . DG  B 2 11  ? 20.276  243.524 10.969  1.00 90.19  1 11  DG  P OP2   1 
ATOM   3325 O  "O5'" . DG  B 2 11  ? 22.403  242.962 12.106  1.00 107.52 ? 11  DG  P "O5'" 1 
ATOM   3326 C  "C5'" . DG  B 2 11  ? 23.497  243.253 12.974  1.00 103.71 ? 11  DG  P "C5'" 1 
ATOM   3327 C  "C4'" . DG  B 2 11  ? 24.441  242.068 13.058  1.00 98.20  ? 11  DG  P "C4'" 1 
ATOM   3328 O  "O4'" . DG  B 2 11  ? 23.777  240.961 13.720  1.00 92.16  ? 11  DG  P "O4'" 1 
ATOM   3329 C  "C3'" . DG  B 2 11  ? 24.877  241.503 11.718  1.00 96.14  ? 11  DG  P "C3'" 1 
ATOM   3330 O  "O3'" . DG  B 2 11  ? 26.102  240.797 11.885  1.00 92.89  ? 11  DG  P "O3'" 1 
ATOM   3331 C  "C2'" . DG  B 2 11  ? 23.730  240.551 11.410  1.00 92.26  ? 11  DG  P "C2'" 1 
ATOM   3332 C  "C1'" . DG  B 2 11  ? 23.546  239.927 12.781  1.00 82.88  ? 11  DG  P "C1'" 1 
ATOM   3333 N  N9    . DG  B 2 11  ? 22.229  239.390 13.034  1.00 71.12  ? 11  DG  P N9    1 
ATOM   3334 C  C8    . DG  B 2 11  ? 21.008  239.881 12.616  1.00 74.83  ? 11  DG  P C8    1 
ATOM   3335 N  N7    . DG  B 2 11  ? 19.993  239.171 13.052  1.00 74.20  ? 11  DG  P N7    1 
ATOM   3336 C  C5    . DG  B 2 11  ? 20.594  238.161 13.813  1.00 68.57  ? 11  DG  P C5    1 
ATOM   3337 C  C6    . DG  B 2 11  ? 20.024  237.085 14.542  1.00 65.92  ? 11  DG  P C6    1 
ATOM   3338 O  O6    . DG  B 2 11  ? 18.825  236.785 14.673  1.00 67.28  ? 11  DG  P O6    1 
ATOM   3339 N  N1    . DG  B 2 11  ? 21.007  236.305 15.156  1.00 60.09  ? 11  DG  P N1    1 
ATOM   3340 C  C2    . DG  B 2 11  ? 22.363  236.537 15.081  1.00 56.40  ? 11  DG  P C2    1 
ATOM   3341 N  N2    . DG  B 2 11  ? 23.163  235.683 15.743  1.00 57.08  ? 11  DG  P N2    1 
ATOM   3342 N  N3    . DG  B 2 11  ? 22.899  237.533 14.415  1.00 57.15  ? 11  DG  P N3    1 
ATOM   3343 C  C4    . DG  B 2 11  ? 21.963  238.296 13.803  1.00 65.56  ? 11  DG  P C4    1 
ATOM   3344 P  P     . DG  B 2 12  ? 26.702  239.911 10.685  1.00 110.21 ? 12  DG  P P     1 
ATOM   3345 O  OP1   . DG  B 2 12  ? 28.156  240.201 10.652  1.00 112.23 ? 12  DG  P OP1   1 
ATOM   3346 O  OP2   . DG  B 2 12  ? 25.851  240.131 9.484   1.00 103.24 1 12  DG  P OP2   1 
ATOM   3347 O  "O5'" . DG  B 2 12  ? 26.547  238.397 11.203  1.00 94.10  ? 12  DG  P "O5'" 1 
ATOM   3348 C  "C5'" . DG  B 2 12  ? 27.273  237.978 12.371  1.00 89.48  ? 12  DG  P "C5'" 1 
ATOM   3349 C  "C4'" . DG  B 2 12  ? 27.333  236.461 12.497  1.00 79.34  ? 12  DG  P "C4'" 1 
ATOM   3350 O  "O4'" . DG  B 2 12  ? 26.025  235.936 12.842  1.00 71.15  ? 12  DG  P "O4'" 1 
ATOM   3351 C  "C3'" . DG  B 2 12  ? 27.764  235.702 11.247  1.00 78.49  ? 12  DG  P "C3'" 1 
ATOM   3352 O  "O3'" . DG  B 2 12  ? 28.461  234.517 11.635  1.00 69.96  ? 12  DG  P "O3'" 1 
ATOM   3353 C  "C2'" . DG  B 2 12  ? 26.424  235.373 10.591  1.00 73.08  ? 12  DG  P "C2'" 1 
ATOM   3354 C  "C1'" . DG  B 2 12  ? 25.551  235.092 11.809  1.00 63.92  ? 12  DG  P "C1'" 1 
ATOM   3355 N  N9    . DG  B 2 12  ? 24.135  235.387 11.606  1.00 58.40  ? 12  DG  P N9    1 
ATOM   3356 C  C8    . DG  B 2 12  ? 23.585  236.474 10.934  1.00 54.91  ? 12  DG  P C8    1 
ATOM   3357 N  N7    . DG  B 2 12  ? 22.269  236.475 10.934  1.00 57.36  ? 12  DG  P N7    1 
ATOM   3358 C  C5    . DG  B 2 12  ? 21.924  235.318 11.666  1.00 50.38  ? 12  DG  P C5    1 
ATOM   3359 C  C6    . DG  B 2 12  ? 20.643  234.789 12.017  1.00 47.85  ? 12  DG  P C6    1 
ATOM   3360 O  O6    . DG  B 2 12  ? 19.523  235.242 11.742  1.00 53.87  ? 12  DG  P O6    1 
ATOM   3361 N  N1    . DG  B 2 12  ? 20.749  233.610 12.768  1.00 42.86  ? 12  DG  P N1    1 
ATOM   3362 C  C2    . DG  B 2 12  ? 21.948  233.020 13.135  1.00 46.43  ? 12  DG  P C2    1 
ATOM   3363 N  N2    . DG  B 2 12  ? 21.859  231.886 13.843  1.00 42.18  ? 12  DG  P N2    1 
ATOM   3364 N  N3    . DG  B 2 12  ? 23.158  233.511 12.820  1.00 44.98  ? 12  DG  P N3    1 
ATOM   3365 C  C4    . DG  B 2 12  ? 23.066  234.646 12.083  1.00 49.83  ? 12  DG  P C4    1 
ATOM   3366 P  P     . DG  B 2 13  ? 29.340  233.694 10.582  1.00 107.67 ? 13  DG  P P     1 
ATOM   3367 O  OP1   . DG  B 2 13  ? 30.699  233.553 11.149  1.00 109.52 ? 13  DG  P OP1   1 
ATOM   3368 O  OP2   . DG  B 2 13  ? 29.130  234.303 9.246   1.00 115.50 1 13  DG  P OP2   1 
ATOM   3369 O  "O5'" . DG  B 2 13  ? 28.647  232.258 10.562  1.00 87.50  ? 13  DG  P "O5'" 1 
ATOM   3370 C  "C5'" . DG  B 2 13  ? 28.326  231.595 11.763  1.00 76.98  ? 13  DG  P "C5'" 1 
ATOM   3371 C  "C4'" . DG  B 2 13  ? 27.367  230.472 11.467  1.00 68.75  ? 13  DG  P "C4'" 1 
ATOM   3372 O  "O4'" . DG  B 2 13  ? 26.022  230.998 11.417  1.00 66.30  ? 13  DG  P "O4'" 1 
ATOM   3373 C  "C3'" . DG  B 2 13  ? 27.610  229.812 10.117  1.00 69.69  ? 13  DG  P "C3'" 1 
ATOM   3374 O  "O3'" . DG  B 2 13  ? 28.183  228.502 10.314  1.00 61.00  ? 13  DG  P "O3'" 1 
ATOM   3375 C  "C2'" . DG  B 2 13  ? 26.212  229.786 9.424   1.00 76.07  ? 13  DG  P "C2'" 1 
ATOM   3376 C  "C1'" . DG  B 2 13  ? 25.246  230.240 10.528  1.00 66.84  ? 13  DG  P "C1'" 1 
ATOM   3377 N  N9    . DG  B 2 13  ? 24.118  231.095 10.086  1.00 61.57  ? 13  DG  P N9    1 
ATOM   3378 C  C8    . DG  B 2 13  ? 24.200  232.315 9.419   1.00 53.78  ? 13  DG  P C8    1 
ATOM   3379 N  N7    . DG  B 2 13  ? 23.027  232.861 9.174   1.00 48.08  ? 13  DG  P N7    1 
ATOM   3380 C  C5    . DG  B 2 13  ? 22.100  231.966 9.744   1.00 50.95  ? 13  DG  P C5    1 
ATOM   3381 C  C6    . DG  B 2 13  ? 20.675  232.029 9.807   1.00 46.64  ? 13  DG  P C6    1 
ATOM   3382 O  O6    . DG  B 2 13  ? 19.922  232.906 9.370   1.00 50.22  ? 13  DG  P O6    1 
ATOM   3383 N  N1    . DG  B 2 13  ? 20.129  230.920 10.451  1.00 44.42  ? 13  DG  P N1    1 
ATOM   3384 C  C2    . DG  B 2 13  ? 20.852  229.880 10.975  1.00 56.12  ? 13  DG  P C2    1 
ATOM   3385 N  N2    . DG  B 2 13  ? 20.134  228.889 11.534  1.00 37.26  ? 13  DG  P N2    1 
ATOM   3386 N  N3    . DG  B 2 13  ? 22.190  229.802 10.933  1.00 60.27  ? 13  DG  P N3    1 
ATOM   3387 C  C4    . DG  B 2 13  ? 22.748  230.878 10.305  1.00 54.56  ? 13  DG  P C4    1 
ATOM   3388 P  P     . DT  C 3 2   ? 12.425  240.885 -8.215  1.00 149.64 ? 2   DT  T P     1 
ATOM   3389 O  OP1   . DT  C 3 2   ? 12.771  239.444 -8.305  1.00 143.44 ? 2   DT  T OP1   1 
ATOM   3390 O  OP2   . DT  C 3 2   ? 11.438  241.497 -9.143  1.00 152.12 1 2   DT  T OP2   1 
ATOM   3391 O  "O5'" . DT  C 3 2   ? 11.977  241.169 -6.702  1.00 105.17 ? 2   DT  T "O5'" 1 
ATOM   3392 C  "C5'" . DT  C 3 2   ? 11.023  242.185 -6.404  1.00 104.67 ? 2   DT  T "C5'" 1 
ATOM   3393 C  "C4'" . DT  C 3 2   ? 9.895   241.645 -5.522  1.00 103.24 ? 2   DT  T "C4'" 1 
ATOM   3394 O  "O4'" . DT  C 3 2   ? 8.885   241.008 -6.346  1.00 105.70 ? 2   DT  T "O4'" 1 
ATOM   3395 C  "C3'" . DT  C 3 2   ? 10.291  240.605 -4.466  1.00 96.40  ? 2   DT  T "C3'" 1 
ATOM   3396 O  "O3'" . DT  C 3 2   ? 9.552   240.854 -3.275  1.00 91.53  ? 2   DT  T "O3'" 1 
ATOM   3397 C  "C2'" . DT  C 3 2   ? 9.865   239.292 -5.120  1.00 96.50  ? 2   DT  T "C2'" 1 
ATOM   3398 C  "C1'" . DT  C 3 2   ? 8.601   239.728 -5.839  1.00 101.61 ? 2   DT  T "C1'" 1 
ATOM   3399 N  N1    . DT  C 3 2   ? 8.213   238.859 -6.987  1.00 109.65 ? 2   DT  T N1    1 
ATOM   3400 C  C2    . DT  C 3 2   ? 6.951   238.306 -7.015  1.00 119.06 ? 2   DT  T C2    1 
ATOM   3401 O  O2    . DT  C 3 2   ? 6.125   238.473 -6.132  1.00 127.14 ? 2   DT  T O2    1 
ATOM   3402 N  N3    . DT  C 3 2   ? 6.687   237.539 -8.121  1.00 117.40 ? 2   DT  T N3    1 
ATOM   3403 C  C4    . DT  C 3 2   ? 7.536   237.279 -9.184  1.00 111.62 ? 2   DT  T C4    1 
ATOM   3404 O  O4    . DT  C 3 2   ? 7.205   236.570 -10.127 1.00 114.82 ? 2   DT  T O4    1 
ATOM   3405 C  C5    . DT  C 3 2   ? 8.841   237.896 -9.099  1.00 104.55 ? 2   DT  T C5    1 
ATOM   3406 C  C7    . DT  C 3 2   ? 9.852   237.684 -10.189 1.00 90.62  ? 2   DT  T C7    1 
ATOM   3407 C  C6    . DT  C 3 2   ? 9.112   238.650 -8.017  1.00 109.03 ? 2   DT  T C6    1 
ATOM   3408 P  P     . DA  C 3 3   ? 9.851   240.057 -1.911  1.00 90.47  ? 3   DA  T P     1 
ATOM   3409 O  OP1   . DA  C 3 3   ? 9.003   240.719 -0.893  1.00 104.22 1 3   DA  T OP1   1 
ATOM   3410 O  OP2   . DA  C 3 3   ? 11.316  239.913 -1.713  1.00 80.87  ? 3   DA  T OP2   1 
ATOM   3411 O  "O5'" . DA  C 3 3   ? 9.239   238.607 -2.158  1.00 86.80  ? 3   DA  T "O5'" 1 
ATOM   3412 C  "C5'" . DA  C 3 3   ? 7.839   238.436 -2.312  1.00 84.21  ? 3   DA  T "C5'" 1 
ATOM   3413 C  "C4'" . DA  C 3 3   ? 7.539   237.022 -2.784  1.00 83.97  ? 3   DA  T "C4'" 1 
ATOM   3414 O  "O4'" . DA  C 3 3   ? 8.104   236.823 -4.114  1.00 80.63  ? 3   DA  T "O4'" 1 
ATOM   3415 C  "C3'" . DA  C 3 3   ? 8.133   235.903 -1.909  1.00 78.07  ? 3   DA  T "C3'" 1 
ATOM   3416 O  "O3'" . DA  C 3 3   ? 7.219   234.814 -1.841  1.00 78.00  ? 3   DA  T "O3'" 1 
ATOM   3417 C  "C2'" . DA  C 3 3   ? 9.387   235.514 -2.682  1.00 74.57  ? 3   DA  T "C2'" 1 
ATOM   3418 C  "C1'" . DA  C 3 3   ? 8.855   235.635 -4.105  1.00 74.21  ? 3   DA  T "C1'" 1 
ATOM   3419 N  N9    . DA  C 3 3   ? 9.886   235.683 -5.140  1.00 76.43  ? 3   DA  T N9    1 
ATOM   3420 C  C8    . DA  C 3 3   ? 11.156  236.178 -5.026  1.00 83.62  ? 3   DA  T C8    1 
ATOM   3421 N  N7    . DA  C 3 3   ? 11.875  236.063 -6.127  1.00 87.41  ? 3   DA  T N7    1 
ATOM   3422 C  C5    . DA  C 3 3   ? 11.021  235.434 -7.022  1.00 85.80  ? 3   DA  T C5    1 
ATOM   3423 C  C6    . DA  C 3 3   ? 11.180  235.015 -8.373  1.00 87.93  ? 3   DA  T C6    1 
ATOM   3424 N  N6    . DA  C 3 3   ? 12.309  235.181 -9.080  1.00 88.55  ? 3   DA  T N6    1 
ATOM   3425 N  N1    . DA  C 3 3   ? 10.122  234.418 -8.966  1.00 87.14  ? 3   DA  T N1    1 
ATOM   3426 C  C2    . DA  C 3 3   ? 8.992   234.252 -8.257  1.00 82.31  ? 3   DA  T C2    1 
ATOM   3427 N  N3    . DA  C 3 3   ? 8.725   234.600 -6.993  1.00 75.26  ? 3   DA  T N3    1 
ATOM   3428 C  C4    . DA  C 3 3   ? 9.788   235.192 -6.428  1.00 80.81  ? 3   DA  T C4    1 
ATOM   3429 P  P     . DC  C 3 4   ? 6.614   234.345 -0.424  1.00 75.35  ? 4   DC  T P     1 
ATOM   3430 O  OP1   . DC  C 3 4   ? 5.908   233.064 -0.650  1.00 78.52  1 4   DC  T OP1   1 
ATOM   3431 O  OP2   . DC  C 3 4   ? 5.885   235.471 0.184   1.00 68.46  ? 4   DC  T OP2   1 
ATOM   3432 O  "O5'" . DC  C 3 4   ? 7.913   234.021 0.454   1.00 57.46  ? 4   DC  T "O5'" 1 
ATOM   3433 C  "C5'" . DC  C 3 4   ? 8.587   232.827 0.265   1.00 54.02  ? 4   DC  T "C5'" 1 
ATOM   3434 C  "C4'" . DC  C 3 4   ? 9.525   232.604 1.399   1.00 66.35  ? 4   DC  T "C4'" 1 
ATOM   3435 O  "O4'" . DC  C 3 4   ? 10.626  233.518 1.255   1.00 69.69  ? 4   DC  T "O4'" 1 
ATOM   3436 C  "C3'" . DC  C 3 4   ? 8.913   232.871 2.778   1.00 68.83  ? 4   DC  T "C3'" 1 
ATOM   3437 O  "O3'" . DC  C 3 4   ? 9.323   231.863 3.679   1.00 56.29  ? 4   DC  T "O3'" 1 
ATOM   3438 C  "C2'" . DC  C 3 4   ? 9.460   234.250 3.169   1.00 72.11  ? 4   DC  T "C2'" 1 
ATOM   3439 C  "C1'" . DC  C 3 4   ? 10.795  234.278 2.434   1.00 76.50  ? 4   DC  T "C1'" 1 
ATOM   3440 N  N1    . DC  C 3 4   ? 11.221  235.624 2.004   1.00 82.77  ? 4   DC  T N1    1 
ATOM   3441 C  C2    . DC  C 3 4   ? 12.564  236.000 2.146   1.00 87.73  ? 4   DC  T C2    1 
ATOM   3442 O  O2    . DC  C 3 4   ? 13.366  235.205 2.670   1.00 85.67  ? 4   DC  T O2    1 
ATOM   3443 N  N3    . DC  C 3 4   ? 12.946  237.226 1.708   1.00 88.76  ? 4   DC  T N3    1 
ATOM   3444 C  C4    . DC  C 3 4   ? 12.047  238.045 1.150   1.00 86.90  ? 4   DC  T C4    1 
ATOM   3445 N  N4    . DC  C 3 4   ? 12.465  239.245 0.743   1.00 90.59  ? 4   DC  T N4    1 
ATOM   3446 C  C5    . DC  C 3 4   ? 10.680  237.671 0.992   1.00 81.94  ? 4   DC  T C5    1 
ATOM   3447 C  C6    . DC  C 3 4   ? 10.318  236.461 1.415   1.00 79.95  ? 4   DC  T C6    1 
ATOM   3448 P  P     . DG  C 3 5   ? 8.372   231.406 4.893   1.00 55.01  ? 5   DG  T P     1 
ATOM   3449 O  OP1   . DG  C 3 5   ? 7.094   230.838 4.386   1.00 53.48  ? 5   DG  T OP1   1 
ATOM   3450 O  OP2   . DG  C 3 5   ? 8.342   232.501 5.908   1.00 63.70  1 5   DG  T OP2   1 
ATOM   3451 O  "O5'" . DG  C 3 5   ? 9.213   230.243 5.546   1.00 59.62  ? 5   DG  T "O5'" 1 
ATOM   3452 C  "C5'" . DG  C 3 5   ? 10.584  230.446 5.864   1.00 51.48  ? 5   DG  T "C5'" 1 
ATOM   3453 C  "C4'" . DG  C 3 5   ? 11.012  229.334 6.761   1.00 44.81  ? 5   DG  T "C4'" 1 
ATOM   3454 O  "O4'" . DG  C 3 5   ? 12.444  229.170 6.766   1.00 43.61  ? 5   DG  T "O4'" 1 
ATOM   3455 C  "C3'" . DG  C 3 5   ? 10.604  229.516 8.193   1.00 46.23  ? 5   DG  T "C3'" 1 
ATOM   3456 O  "O3'" . DG  C 3 5   ? 10.324  228.244 8.688   1.00 47.41  ? 5   DG  T "O3'" 1 
ATOM   3457 C  "C2'" . DG  C 3 5   ? 11.850  230.180 8.815   1.00 41.65  ? 5   DG  T "C2'" 1 
ATOM   3458 C  "C1'" . DG  C 3 5   ? 12.984  229.520 8.038   1.00 41.79  ? 5   DG  T "C1'" 1 
ATOM   3459 N  N9    . DG  C 3 5   ? 14.127  230.365 7.737   1.00 43.83  ? 5   DG  T N9    1 
ATOM   3460 C  C8    . DG  C 3 5   ? 14.097  231.632 7.226   1.00 42.76  ? 5   DG  T C8    1 
ATOM   3461 N  N7    . DG  C 3 5   ? 15.276  232.102 6.936   1.00 43.74  ? 5   DG  T N7    1 
ATOM   3462 C  C5    . DG  C 3 5   ? 16.141  231.070 7.241   1.00 41.29  ? 5   DG  T C5    1 
ATOM   3463 C  C6    . DG  C 3 5   ? 17.539  231.011 7.132   1.00 44.17  ? 5   DG  T C6    1 
ATOM   3464 O  O6    . DG  C 3 5   ? 18.316  231.897 6.737   1.00 47.96  ? 5   DG  T O6    1 
ATOM   3465 N  N1    . DG  C 3 5   ? 18.030  229.781 7.536   1.00 39.46  ? 5   DG  T N1    1 
ATOM   3466 C  C2    . DG  C 3 5   ? 17.261  228.744 7.999   1.00 43.94  ? 5   DG  T C2    1 
ATOM   3467 N  N2    . DG  C 3 5   ? 17.911  227.635 8.356   1.00 37.04  ? 5   DG  T N2    1 
ATOM   3468 N  N3    . DG  C 3 5   ? 15.944  228.786 8.106   1.00 45.72  ? 5   DG  T N3    1 
ATOM   3469 C  C4    . DG  C 3 5   ? 15.455  229.985 7.718   1.00 42.95  ? 5   DG  T C4    1 
ATOM   3470 P  P     . DC  C 3 6   ? 9.801   228.029 10.182  1.00 50.95  ? 6   DC  T P     1 
ATOM   3471 O  OP1   . DC  C 3 6   ? 9.284   226.638 10.139  1.00 47.21  1 6   DC  T OP1   1 
ATOM   3472 O  OP2   . DC  C 3 6   ? 8.904   229.123 10.625  1.00 47.45  ? 6   DC  T OP2   1 
ATOM   3473 O  "O5'" . DC  C 3 6   ? 11.154  227.952 10.993  1.00 46.16  ? 6   DC  T "O5'" 1 
ATOM   3474 C  "C5'" . DC  C 3 6   ? 11.909  226.770 10.889  1.00 46.29  ? 6   DC  T "C5'" 1 
ATOM   3475 C  "C4'" . DC  C 3 6   ? 13.186  226.877 11.675  1.00 47.40  ? 6   DC  T "C4'" 1 
ATOM   3476 O  "O4'" . DC  C 3 6   ? 14.055  227.860 11.062  1.00 43.80  ? 6   DC  T "O4'" 1 
ATOM   3477 C  "C3'" . DC  C 3 6   ? 13.034  227.309 13.150  1.00 45.64  ? 6   DC  T "C3'" 1 
ATOM   3478 O  "O3'" . DC  C 3 6   ? 13.820  226.449 13.925  1.00 48.76  ? 6   DC  T "O3'" 1 
ATOM   3479 C  "C2'" . DC  C 3 6   ? 13.619  228.723 13.155  1.00 40.86  ? 6   DC  T "C2'" 1 
ATOM   3480 C  "C1'" . DC  C 3 6   ? 14.699  228.552 12.106  1.00 39.13  ? 6   DC  T "C1'" 1 
ATOM   3481 N  N1    . DC  C 3 6   ? 15.293  229.791 11.544  1.00 38.91  ? 6   DC  T N1    1 
ATOM   3482 C  C2    . DC  C 3 6   ? 16.664  229.795 11.287  1.00 38.22  ? 6   DC  T C2    1 
ATOM   3483 O  O2    . DC  C 3 6   ? 17.313  228.791 11.561  1.00 42.43  ? 6   DC  T O2    1 
ATOM   3484 N  N3    . DC  C 3 6   ? 17.240  230.887 10.736  1.00 46.10  ? 6   DC  T N3    1 
ATOM   3485 C  C4    . DC  C 3 6   ? 16.498  231.940 10.436  1.00 48.59  ? 6   DC  T C4    1 
ATOM   3486 N  N4    . DC  C 3 6   ? 17.122  232.988 9.892   1.00 53.01  ? 6   DC  T N4    1 
ATOM   3487 C  C5    . DC  C 3 6   ? 15.080  231.971 10.689  1.00 41.92  ? 6   DC  T C5    1 
ATOM   3488 C  C6    . DC  C 3 6   ? 14.519  230.876 11.230  1.00 39.85  ? 6   DC  T C6    1 
ATOM   3489 P  P     . DC  C 3 7   ? 13.439  226.076 15.439  1.00 52.72  ? 7   DC  T P     1 
ATOM   3490 O  OP1   . DC  C 3 7   ? 13.608  224.618 15.546  1.00 56.21  1 7   DC  T OP1   1 
ATOM   3491 O  OP2   . DC  C 3 7   ? 12.148  226.667 15.840  1.00 57.99  ? 7   DC  T OP2   1 
ATOM   3492 O  "O5'" . DC  C 3 7   ? 14.678  226.674 16.216  1.00 57.26  ? 7   DC  T "O5'" 1 
ATOM   3493 C  "C5'" . DC  C 3 7   ? 15.947  226.220 15.810  1.00 52.69  ? 7   DC  T "C5'" 1 
ATOM   3494 C  "C4'" . DC  C 3 7   ? 17.001  227.289 15.952  1.00 42.90  ? 7   DC  T "C4'" 1 
ATOM   3495 O  "O4'" . DC  C 3 7   ? 16.782  228.387 15.042  1.00 44.83  ? 7   DC  T "O4'" 1 
ATOM   3496 C  "C3'" . DC  C 3 7   ? 17.075  227.942 17.321  1.00 46.39  ? 7   DC  T "C3'" 1 
ATOM   3497 O  "O3'" . DC  C 3 7   ? 18.083  227.314 18.055  1.00 53.69  ? 7   DC  T "O3'" 1 
ATOM   3498 C  "C2'" . DC  C 3 7   ? 17.456  229.400 16.998  1.00 45.42  ? 7   DC  T "C2'" 1 
ATOM   3499 C  "C1'" . DC  C 3 7   ? 17.663  229.356 15.475  1.00 42.49  ? 7   DC  T "C1'" 1 
ATOM   3500 N  N1    . DC  C 3 7   ? 17.412  230.652 14.808  1.00 41.93  ? 7   DC  T N1    1 
ATOM   3501 C  C2    . DC  C 3 7   ? 18.507  231.379 14.362  1.00 45.38  ? 7   DC  T C2    1 
ATOM   3502 O  O2    . DC  C 3 7   ? 19.630  230.870 14.461  1.00 55.46  ? 7   DC  T O2    1 
ATOM   3503 N  N3    . DC  C 3 7   ? 18.309  232.595 13.801  1.00 44.23  ? 7   DC  T N3    1 
ATOM   3504 C  C4    . DC  C 3 7   ? 17.071  233.098 13.726  1.00 47.43  ? 7   DC  T C4    1 
ATOM   3505 N  N4    . DC  C 3 7   ? 16.920  234.301 13.153  1.00 54.86  ? 7   DC  T N4    1 
ATOM   3506 C  C5    . DC  C 3 7   ? 15.940  232.388 14.225  1.00 39.87  ? 7   DC  T C5    1 
ATOM   3507 C  C6    . DC  C 3 7   ? 16.157  231.180 14.763  1.00 40.75  ? 7   DC  T C6    1 
ATOM   3508 P  P     . DC  C 3 8   ? 18.118  227.426 19.642  1.00 50.68  ? 8   DC  T P     1 
ATOM   3509 O  OP1   . DC  C 3 8   ? 18.395  226.059 20.123  1.00 62.03  ? 8   DC  T OP1   1 
ATOM   3510 O  OP2   . DC  C 3 8   ? 16.912  228.127 20.149  1.00 64.82  1 8   DC  T OP2   1 
ATOM   3511 O  "O5'" . DC  C 3 8   ? 19.301  228.464 19.925  1.00 63.25  ? 8   DC  T "O5'" 1 
ATOM   3512 C  "C5'" . DC  C 3 8   ? 20.637  228.049 19.871  1.00 57.09  ? 8   DC  T "C5'" 1 
ATOM   3513 C  "C4'" . DC  C 3 8   ? 21.530  229.197 19.459  1.00 54.98  ? 8   DC  T "C4'" 1 
ATOM   3514 O  "O4'" . DC  C 3 8   ? 20.940  229.891 18.336  1.00 58.49  ? 8   DC  T "O4'" 1 
ATOM   3515 C  "C3'" . DC  C 3 8   ? 21.719  230.280 20.510  1.00 51.39  ? 8   DC  T "C3'" 1 
ATOM   3516 O  "O3'" . DC  C 3 8   ? 22.805  229.947 21.334  1.00 58.67  ? 8   DC  T "O3'" 1 
ATOM   3517 C  "C2'" . DC  C 3 8   ? 22.027  231.529 19.670  1.00 54.75  ? 8   DC  T "C2'" 1 
ATOM   3518 C  "C1'" . DC  C 3 8   ? 21.549  231.155 18.245  1.00 57.38  ? 8   DC  T "C1'" 1 
ATOM   3519 N  N1    . DC  C 3 8   ? 20.581  232.133 17.679  1.00 52.34  ? 8   DC  T N1    1 
ATOM   3520 C  C2    . DC  C 3 8   ? 21.068  233.264 17.027  1.00 54.99  ? 8   DC  T C2    1 
ATOM   3521 O  O2    . DC  C 3 8   ? 22.291  233.399 16.893  1.00 60.29  ? 8   DC  T O2    1 
ATOM   3522 N  N3    . DC  C 3 8   ? 20.191  234.167 16.538  1.00 54.46  ? 8   DC  T N3    1 
ATOM   3523 C  C4    . DC  C 3 8   ? 18.875  233.982 16.702  1.00 54.23  ? 8   DC  T C4    1 
ATOM   3524 N  N4    . DC  C 3 8   ? 18.044  234.907 16.192  1.00 54.62  ? 8   DC  T N4    1 
ATOM   3525 C  C5    . DC  C 3 8   ? 18.355  232.847 17.400  1.00 47.75  ? 8   DC  T C5    1 
ATOM   3526 C  C6    . DC  C 3 8   ? 19.240  231.956 17.868  1.00 48.03  ? 8   DC  T C6    1 
ATOM   3527 P  P     . DT  C 3 9   ? 23.207  230.886 22.566  1.00 54.77  ? 9   DT  T P     1 
ATOM   3528 O  OP1   . DT  C 3 9   ? 24.190  230.133 23.377  1.00 66.33  ? 9   DT  T OP1   1 
ATOM   3529 O  OP2   . DT  C 3 9   ? 21.952  231.377 23.172  1.00 60.31  1 9   DT  T OP2   1 
ATOM   3530 O  "O5'" . DT  C 3 9   ? 23.896  232.167 21.902  1.00 62.87  ? 9   DT  T "O5'" 1 
ATOM   3531 C  "C5'" . DT  C 3 9   ? 25.230  232.102 21.402  1.00 63.05  ? 9   DT  T "C5'" 1 
ATOM   3532 C  "C4'" . DT  C 3 9   ? 25.787  233.502 21.146  1.00 68.05  ? 9   DT  T "C4'" 1 
ATOM   3533 O  "O4'" . DT  C 3 9   ? 25.313  234.011 19.857  1.00 64.46  ? 9   DT  T "O4'" 1 
ATOM   3534 C  "C3'" . DT  C 3 9   ? 25.326  234.585 22.100  1.00 72.69  ? 9   DT  T "C3'" 1 
ATOM   3535 O  "O3'" . DT  C 3 9   ? 25.880  234.450 23.459  1.00 93.29  ? 9   DT  T "O3'" 1 
ATOM   3536 C  "C2'" . DT  C 3 9   ? 25.741  235.831 21.333  1.00 60.56  ? 9   DT  T "C2'" 1 
ATOM   3537 C  "C1'" . DT  C 3 9   ? 25.213  235.443 19.940  1.00 64.35  ? 9   DT  T "C1'" 1 
ATOM   3538 N  N1    . DT  C 3 9   ? 23.775  235.830 19.694  1.00 60.57  ? 9   DT  T N1    1 
ATOM   3539 C  C2    . DT  C 3 9   ? 23.478  236.963 18.940  1.00 60.76  ? 9   DT  T C2    1 
ATOM   3540 O  O2    . DT  C 3 9   ? 24.328  237.698 18.449  1.00 65.77  ? 9   DT  T O2    1 
ATOM   3541 N  N3    . DT  C 3 9   ? 22.136  237.209 18.783  1.00 55.77  ? 9   DT  T N3    1 
ATOM   3542 C  C4    . DT  C 3 9   ? 21.080  236.462 19.283  1.00 61.60  ? 9   DT  T C4    1 
ATOM   3543 O  O4    . DT  C 3 9   ? 19.902  236.764 19.066  1.00 63.47  ? 9   DT  T O4    1 
ATOM   3544 C  C5    . DT  C 3 9   ? 21.459  235.300 20.079  1.00 64.74  ? 9   DT  T C5    1 
ATOM   3545 C  C7    . DT  C 3 9   ? 20.403  234.407 20.690  1.00 40.91  ? 9   DT  T C7    1 
ATOM   3546 C  C6    . DT  C 3 9   ? 22.772  235.048 20.234  1.00 59.40  ? 9   DT  T C6    1 
ATOM   3547 P  P     . DG  C 3 10  ? 27.362  234.904 23.902  1.00 75.51  ? 10  DG  T P     1 
ATOM   3548 O  OP1   . DG  C 3 10  ? 28.367  234.151 23.110  1.00 86.55  1 10  DG  T OP1   1 
ATOM   3549 O  OP2   . DG  C 3 10  ? 27.335  234.768 25.367  1.00 75.67  ? 10  DG  T OP2   1 
ATOM   3550 O  "O5'" . DG  C 3 10  ? 27.454  236.459 23.570  1.00 60.76  ? 10  DG  T "O5'" 1 
ATOM   3551 C  "C5'" . DG  C 3 10  ? 28.620  236.965 22.961  1.00 65.54  ? 10  DG  T "C5'" 1 
ATOM   3552 C  "C4'" . DG  C 3 10  ? 28.439  238.413 22.577  1.00 73.16  ? 10  DG  T "C4'" 1 
ATOM   3553 O  "O4'" . DG  C 3 10  ? 27.172  238.593 21.892  1.00 75.89  ? 10  DG  T "O4'" 1 
ATOM   3554 C  "C3'" . DG  C 3 10  ? 28.411  239.377 23.748  1.00 80.20  ? 10  DG  T "C3'" 1 
ATOM   3555 O  "O3'" . DG  C 3 10  ? 29.083  240.525 23.375  1.00 84.04  ? 10  DG  T "O3'" 1 
ATOM   3556 C  "C2'" . DG  C 3 10  ? 26.918  239.644 23.940  1.00 75.29  ? 10  DG  T "C2'" 1 
ATOM   3557 C  "C1'" . DG  C 3 10  ? 26.453  239.635 22.502  1.00 72.64  ? 10  DG  T "C1'" 1 
ATOM   3558 N  N9    . DG  C 3 10  ? 25.033  239.360 22.335  1.00 68.72  ? 10  DG  T N9    1 
ATOM   3559 C  C8    . DG  C 3 10  ? 24.293  238.381 22.960  1.00 68.31  ? 10  DG  T C8    1 
ATOM   3560 N  N7    . DG  C 3 10  ? 23.034  238.363 22.591  1.00 66.08  ? 10  DG  T N7    1 
ATOM   3561 C  C5    . DG  C 3 10  ? 22.940  239.397 21.661  1.00 65.59  ? 10  DG  T C5    1 
ATOM   3562 C  C6    . DG  C 3 10  ? 21.826  239.850 20.915  1.00 64.07  ? 10  DG  T C6    1 
ATOM   3563 O  O6    . DG  C 3 10  ? 20.657  239.419 20.941  1.00 64.63  ? 10  DG  T O6    1 
ATOM   3564 N  N1    . DG  C 3 10  ? 22.168  240.910 20.071  1.00 57.65  ? 10  DG  T N1    1 
ATOM   3565 C  C2    . DG  C 3 10  ? 23.427  241.463 19.970  1.00 62.81  ? 10  DG  T C2    1 
ATOM   3566 N  N2    . DG  C 3 10  ? 23.564  242.490 19.110  1.00 60.32  ? 10  DG  T N2    1 
ATOM   3567 N  N3    . DG  C 3 10  ? 24.480  241.043 20.664  1.00 64.44  ? 10  DG  T N3    1 
ATOM   3568 C  C4    . DG  C 3 10  ? 24.163  240.012 21.485  1.00 65.95  ? 10  DG  T C4    1 
ATOM   3569 P  P     . DA  C 3 11  ? 29.596  241.553 24.485  1.00 97.86  ? 11  DA  T P     1 
ATOM   3570 O  OP1   . DA  C 3 11  ? 30.878  241.011 24.987  1.00 106.55 ? 11  DA  T OP1   1 
ATOM   3571 O  OP2   . DA  C 3 11  ? 28.491  241.841 25.430  1.00 85.80  1 11  DA  T OP2   1 
ATOM   3572 O  "O5'" . DA  C 3 11  ? 29.863  242.881 23.632  1.00 96.28  ? 11  DA  T "O5'" 1 
ATOM   3573 C  "C5'" . DA  C 3 11  ? 29.786  242.844 22.202  1.00 86.90  ? 11  DA  T "C5'" 1 
ATOM   3574 C  "C4'" . DA  C 3 11  ? 28.998  244.029 21.682  1.00 80.40  ? 11  DA  T "C4'" 1 
ATOM   3575 O  "O4'" . DA  C 3 11  ? 27.608  243.655 21.522  1.00 76.81  ? 11  DA  T "O4'" 1 
ATOM   3576 C  "C3'" . DA  C 3 11  ? 29.003  245.253 22.595  1.00 85.75  ? 11  DA  T "C3'" 1 
ATOM   3577 O  "O3'" . DA  C 3 11  ? 29.191  246.418 21.819  1.00 99.47  ? 11  DA  T "O3'" 1 
ATOM   3578 C  "C2'" . DA  C 3 11  ? 27.619  245.225 23.248  1.00 77.76  ? 11  DA  T "C2'" 1 
ATOM   3579 C  "C1'" . DA  C 3 11  ? 26.780  244.626 22.136  1.00 77.97  ? 11  DA  T "C1'" 1 
ATOM   3580 N  N9    . DA  C 3 11  ? 25.563  243.957 22.599  1.00 79.26  ? 11  DA  T N9    1 
ATOM   3581 C  C8    . DA  C 3 11  ? 25.464  243.011 23.580  1.00 78.21  ? 11  DA  T C8    1 
ATOM   3582 N  N7    . DA  C 3 11  ? 24.243  242.568 23.768  1.00 72.29  ? 11  DA  T N7    1 
ATOM   3583 C  C5    . DA  C 3 11  ? 23.493  243.265 22.848  1.00 69.98  ? 11  DA  T C5    1 
ATOM   3584 C  C6    . DA  C 3 11  ? 22.123  243.251 22.543  1.00 66.20  ? 11  DA  T C6    1 
ATOM   3585 N  N6    . DA  C 3 11  ? 21.237  242.469 23.164  1.00 59.76  ? 11  DA  T N6    1 
ATOM   3586 N  N1    . DA  C 3 11  ? 21.695  244.071 21.562  1.00 71.42  ? 11  DA  T N1    1 
ATOM   3587 C  C2    . DA  C 3 11  ? 22.584  244.848 20.941  1.00 76.74  ? 11  DA  T C2    1 
ATOM   3588 N  N3    . DA  C 3 11  ? 23.895  244.947 21.141  1.00 80.54  ? 11  DA  T N3    1 
ATOM   3589 C  C4    . DA  C 3 11  ? 24.289  244.123 22.115  1.00 76.05  ? 11  DA  T C4    1 
ATOM   3590 P  P     . DT  C 3 12  ? 29.493  247.831 22.525  1.00 112.95 ? 12  DT  T P     1 
ATOM   3591 O  OP1   . DT  C 3 12  ? 30.754  248.341 21.941  1.00 114.94 ? 12  DT  T OP1   1 
ATOM   3592 O  OP2   . DT  C 3 12  ? 29.351  247.703 23.998  1.00 106.38 1 12  DT  T OP2   1 
ATOM   3593 O  "O5'" . DT  C 3 12  ? 28.302  248.747 22.001  1.00 91.20  ? 12  DT  T "O5'" 1 
ATOM   3594 C  "C5'" . DT  C 3 12  ? 27.399  248.252 21.027  1.00 84.22  ? 12  DT  T "C5'" 1 
ATOM   3595 C  "C4'" . DT  C 3 12  ? 26.124  249.031 21.128  1.00 81.46  ? 12  DT  T "C4'" 1 
ATOM   3596 O  "O4'" . DT  C 3 12  ? 25.054  248.159 21.584  1.00 79.02  ? 12  DT  T "O4'" 1 
ATOM   3597 C  "C3'" . DT  C 3 12  ? 26.203  250.162 22.152  1.00 83.22  ? 12  DT  T "C3'" 1 
ATOM   3598 O  "O3'" . DT  C 3 12  ? 25.520  251.286 21.660  1.00 92.12  ? 12  DT  T "O3'" 1 
ATOM   3599 C  "C2'" . DT  C 3 12  ? 25.505  249.567 23.373  1.00 80.48  ? 12  DT  T "C2'" 1 
ATOM   3600 C  "C1'" . DT  C 3 12  ? 24.419  248.764 22.691  1.00 82.51  ? 12  DT  T "C1'" 1 
ATOM   3601 N  N1    . DT  C 3 12  ? 23.798  247.703 23.536  1.00 83.12  ? 12  DT  T N1    1 
ATOM   3602 C  C2    . DT  C 3 12  ? 22.482  247.373 23.313  1.00 78.77  ? 12  DT  T C2    1 
ATOM   3603 O  O2    . DT  C 3 12  ? 21.801  247.912 22.469  1.00 79.60  ? 12  DT  T O2    1 
ATOM   3604 N  N3    . DT  C 3 12  ? 21.988  246.386 24.115  1.00 72.03  ? 12  DT  T N3    1 
ATOM   3605 C  C4    . DT  C 3 12  ? 22.659  245.703 25.105  1.00 67.51  ? 12  DT  T C4    1 
ATOM   3606 O  O4    . DT  C 3 12  ? 22.112  244.831 25.776  1.00 59.82  ? 12  DT  T O4    1 
ATOM   3607 C  C5    . DT  C 3 12  ? 24.046  246.094 25.300  1.00 74.76  ? 12  DT  T C5    1 
ATOM   3608 C  C7    . DT  C 3 12  ? 24.885  245.422 26.353  1.00 72.31  ? 12  DT  T C7    1 
ATOM   3609 C  C6    . DT  C 3 12  ? 24.544  247.068 24.512  1.00 81.67  ? 12  DT  T C6    1 
ATOM   3610 P  P     . DC  C 3 13  ? 25.703  252.729 22.348  1.00 104.24 ? 13  DC  T P     1 
ATOM   3611 O  OP1   . DC  C 3 13  ? 26.853  253.393 21.696  1.00 97.63  ? 13  DC  T OP1   1 
ATOM   3612 O  OP2   . DC  C 3 13  ? 25.705  252.561 23.823  1.00 106.26 1 13  DC  T OP2   1 
ATOM   3613 O  "O5'" . DC  C 3 13  ? 24.348  253.482 21.948  1.00 96.54  ? 13  DC  T "O5'" 1 
ATOM   3614 C  "C5'" . DC  C 3 13  ? 23.340  252.780 21.214  1.00 95.63  ? 13  DC  T "C5'" 1 
ATOM   3615 C  "C4'" . DC  C 3 13  ? 22.046  252.702 22.005  1.00 93.78  ? 13  DC  T "C4'" 1 
ATOM   3616 O  "O4'" . DC  C 3 13  ? 21.982  251.457 22.744  1.00 95.18  ? 13  DC  T "O4'" 1 
ATOM   3617 C  "C3'" . DC  C 3 13  ? 21.849  253.819 23.039  1.00 91.02  ? 13  DC  T "C3'" 1 
ATOM   3618 O  "O3'" . DC  C 3 13  ? 20.633  254.479 22.801  1.00 91.60  ? 13  DC  T "O3'" 1 
ATOM   3619 C  "C2'" . DC  C 3 13  ? 21.821  253.088 24.381  1.00 88.48  ? 13  DC  T "C2'" 1 
ATOM   3620 C  "C1'" . DC  C 3 13  ? 21.327  251.718 23.960  1.00 93.15  ? 13  DC  T "C1'" 1 
ATOM   3621 N  N1    . DC  C 3 13  ? 21.643  250.644 24.937  1.00 89.92  ? 13  DC  T N1    1 
ATOM   3622 C  C2    . DC  C 3 13  ? 20.665  249.702 25.262  1.00 87.05  ? 13  DC  T C2    1 
ATOM   3623 O  O2    . DC  C 3 13  ? 19.559  249.767 24.711  1.00 89.32  ? 13  DC  T O2    1 
ATOM   3624 N  N3    . DC  C 3 13  ? 20.957  248.740 26.165  1.00 82.28  ? 13  DC  T N3    1 
ATOM   3625 C  C4    . DC  C 3 13  ? 22.157  248.703 26.734  1.00 79.80  ? 13  DC  T C4    1 
ATOM   3626 N  N4    . DC  C 3 13  ? 22.394  247.731 27.615  1.00 78.53  ? 13  DC  T N4    1 
ATOM   3627 C  C5    . DC  C 3 13  ? 23.167  249.659 26.426  1.00 83.73  ? 13  DC  T C5    1 
ATOM   3628 C  C6    . DC  C 3 13  ? 22.868  250.606 25.532  1.00 87.95  ? 13  DC  T C6    1 
ATOM   3629 P  P     . DA  C 3 14  ? 20.374  255.928 23.441  1.00 129.23 ? 14  DA  T P     1 
ATOM   3630 O  OP1   . DA  C 3 14  ? 20.428  256.918 22.340  1.00 131.14 ? 14  DA  T OP1   1 
ATOM   3631 O  OP2   . DA  C 3 14  ? 21.248  256.063 24.631  1.00 127.29 1 14  DA  T OP2   1 
ATOM   3632 O  "O5'" . DA  C 3 14  ? 18.878  255.836 23.973  1.00 96.54  ? 14  DA  T "O5'" 1 
ATOM   3633 C  "C5'" . DA  C 3 14  ? 17.964  254.952 23.353  1.00 92.86  ? 14  DA  T "C5'" 1 
ATOM   3634 C  "C4'" . DA  C 3 14  ? 17.061  254.344 24.396  1.00 86.52  ? 14  DA  T "C4'" 1 
ATOM   3635 O  "O4'" . DA  C 3 14  ? 17.733  253.224 25.007  1.00 84.27  ? 14  DA  T "O4'" 1 
ATOM   3636 C  "C3'" . DA  C 3 14  ? 16.701  255.299 25.540  1.00 81.35  ? 14  DA  T "C3'" 1 
ATOM   3637 O  "O3'" . DA  C 3 14  ? 15.307  255.601 25.502  1.00 81.46  ? 14  DA  T "O3'" 1 
ATOM   3638 C  "C2'" . DA  C 3 14  ? 17.098  254.548 26.823  1.00 78.46  ? 14  DA  T "C2'" 1 
ATOM   3639 C  "C1'" . DA  C 3 14  ? 17.298  253.115 26.334  1.00 81.55  ? 14  DA  T "C1'" 1 
ATOM   3640 N  N9    . DA  C 3 14  ? 18.298  252.370 27.094  1.00 80.70  ? 14  DA  T N9    1 
ATOM   3641 C  C8    . DA  C 3 14  ? 19.648  252.598 27.130  1.00 86.52  ? 14  DA  T C8    1 
ATOM   3642 N  N7    . DA  C 3 14  ? 20.306  251.768 27.910  1.00 86.93  ? 14  DA  T N7    1 
ATOM   3643 C  C5    . DA  C 3 14  ? 19.323  250.937 28.418  1.00 76.76  ? 14  DA  T C5    1 
ATOM   3644 C  C6    . DA  C 3 14  ? 19.370  249.846 29.308  1.00 68.61  ? 14  DA  T C6    1 
ATOM   3645 N  N6    . DA  C 3 14  ? 20.503  249.396 29.862  1.00 70.73  ? 14  DA  T N6    1 
ATOM   3646 N  N1    . DA  C 3 14  ? 18.202  249.237 29.613  1.00 59.44  ? 14  DA  T N1    1 
ATOM   3647 C  C2    . DA  C 3 14  ? 17.066  249.698 29.061  1.00 60.10  ? 14  DA  T C2    1 
ATOM   3648 N  N3    . DA  C 3 14  ? 16.895  250.714 28.212  1.00 67.47  ? 14  DA  T N3    1 
ATOM   3649 C  C4    . DA  C 3 14  ? 18.075  251.295 27.925  1.00 75.41  ? 14  DA  T C4    1 
ATOM   3650 P  P     . DG  C 3 15  ? 14.669  256.672 26.522  1.00 106.21 ? 15  DG  T P     1 
ATOM   3651 O  OP1   . DG  C 3 15  ? 13.371  257.116 25.959  1.00 100.46 ? 15  DG  T OP1   1 
ATOM   3652 O  OP2   . DG  C 3 15  ? 15.697  257.678 26.870  1.00 109.36 1 15  DG  T OP2   1 
ATOM   3653 O  "O5'" . DG  C 3 15  ? 14.379  255.802 27.827  1.00 96.26  ? 15  DG  T "O5'" 1 
ATOM   3654 C  "C5'" . DG  C 3 15  ? 13.426  254.750 27.772  1.00 90.47  ? 15  DG  T "C5'" 1 
ATOM   3655 C  "C4'" . DG  C 3 15  ? 13.328  254.069 29.110  1.00 83.09  ? 15  DG  T "C4'" 1 
ATOM   3656 O  "O4'" . DG  C 3 15  ? 14.529  253.326 29.331  1.00 84.77  ? 15  DG  T "O4'" 1 
ATOM   3657 C  "C3'" . DG  C 3 15  ? 13.212  255.025 30.289  1.00 83.26  ? 15  DG  T "C3'" 1 
ATOM   3658 O  "O3'" . DG  C 3 15  ? 11.891  254.997 30.804  1.00 84.69  ? 15  DG  T "O3'" 1 
ATOM   3659 C  "C2'" . DG  C 3 15  ? 14.237  254.515 31.316  1.00 84.53  ? 15  DG  T "C2'" 1 
ATOM   3660 C  "C1'" . DG  C 3 15  ? 14.750  253.223 30.703  1.00 81.07  ? 15  DG  T "C1'" 1 
ATOM   3661 N  N9    . DG  C 3 15  ? 16.177  253.002 30.902  1.00 77.14  ? 15  DG  T N9    1 
ATOM   3662 C  C8    . DG  C 3 15  ? 17.216  253.680 30.303  1.00 74.02  ? 15  DG  T C8    1 
ATOM   3663 N  N7    . DG  C 3 15  ? 18.394  253.245 30.663  1.00 78.01  ? 15  DG  T N7    1 
ATOM   3664 C  C5    . DG  C 3 15  ? 18.116  252.209 31.556  1.00 70.84  ? 15  DG  T C5    1 
ATOM   3665 C  C6    . DG  C 3 15  ? 18.994  251.361 32.277  1.00 67.13  ? 15  DG  T C6    1 
ATOM   3666 O  O6    . DG  C 3 15  ? 20.230  251.352 32.265  1.00 69.91  ? 15  DG  T O6    1 
ATOM   3667 N  N1    . DG  C 3 15  ? 18.300  250.444 33.069  1.00 66.19  ? 15  DG  T N1    1 
ATOM   3668 C  C2    . DG  C 3 15  ? 16.925  250.360 33.155  1.00 64.62  ? 15  DG  T C2    1 
ATOM   3669 N  N2    . DG  C 3 15  ? 16.431  249.414 33.984  1.00 55.20  ? 15  DG  T N2    1 
ATOM   3670 N  N3    . DG  C 3 15  ? 16.089  251.155 32.479  1.00 64.95  ? 15  DG  T N3    1 
ATOM   3671 C  C4    . DG  C 3 15  ? 16.755  252.048 31.707  1.00 69.98  ? 15  DG  T C4    1 
ATOM   3672 P  P     . DT  C 3 16  ? 11.492  255.914 32.061  1.00 120.39 ? 16  DT  T P     1 
ATOM   3673 O  OP1   . DT  C 3 16  ? 10.212  256.582 31.739  1.00 120.68 ? 16  DT  T OP1   1 
ATOM   3674 O  OP2   . DT  C 3 16  ? 12.686  256.712 32.433  1.00 119.82 1 16  DT  T OP2   1 
ATOM   3675 O  "O5'" . DT  C 3 16  ? 11.223  254.854 33.226  1.00 72.88  ? 16  DT  T "O5'" 1 
ATOM   3676 C  "C5'" . DT  C 3 16  ? 11.960  253.662 33.255  1.00 72.01  ? 16  DT  T "C5'" 1 
ATOM   3677 C  "C4'" . DT  C 3 16  ? 11.953  253.069 34.633  1.00 74.56  ? 16  DT  T "C4'" 1 
ATOM   3678 O  "O4'" . DT  C 3 16  ? 13.237  252.439 34.861  1.00 76.86  ? 16  DT  T "O4'" 1 
ATOM   3679 C  "C3'" . DT  C 3 16  ? 11.780  254.086 35.759  1.00 81.52  ? 16  DT  T "C3'" 1 
ATOM   3680 O  "O3'" . DT  C 3 16  ? 11.128  253.485 36.888  1.00 80.54  ? 16  DT  T "O3'" 1 
ATOM   3681 C  "C2'" . DT  C 3 16  ? 13.216  254.468 36.078  1.00 84.60  ? 16  DT  T "C2'" 1 
ATOM   3682 C  "C1'" . DT  C 3 16  ? 13.943  253.141 35.865  1.00 78.02  ? 16  DT  T "C1'" 1 
ATOM   3683 N  N1    . DT  C 3 16  ? 15.353  253.312 35.429  1.00 71.34  ? 16  DT  T N1    1 
ATOM   3684 C  C2    . DT  C 3 16  ? 16.303  252.447 35.903  1.00 66.39  ? 16  DT  T C2    1 
ATOM   3685 O  O2    . DT  C 3 16  ? 16.042  251.526 36.652  1.00 68.69  ? 16  DT  T O2    1 
ATOM   3686 N  N3    . DT  C 3 16  ? 17.576  252.693 35.465  1.00 62.63  ? 16  DT  T N3    1 
ATOM   3687 C  C4    . DT  C 3 16  ? 17.985  253.707 34.615  1.00 64.69  ? 16  DT  T C4    1 
ATOM   3688 O  O4    . DT  C 3 16  ? 19.158  253.843 34.276  1.00 66.11  ? 16  DT  T O4    1 
ATOM   3689 C  C5    . DT  C 3 16  ? 16.932  254.592 34.154  1.00 57.38  ? 16  DT  T C5    1 
ATOM   3690 C  C7    . DT  C 3 16  ? 17.251  255.739 33.231  1.00 58.60  ? 16  DT  T C7    1 
ATOM   3691 C  C6    . DT  C 3 16  ? 15.682  254.354 34.579  1.00 57.19  ? 16  DT  T C6    1 
ATOM   3692 P  P     . DG  C 3 17  ? 10.514  254.408 38.063  1.00 114.74 ? 17  DG  T P     1 
ATOM   3693 O  OP1   . DG  C 3 17  ? 9.103   253.993 38.259  1.00 111.79 ? 17  DG  T OP1   1 
ATOM   3694 O  OP2   . DG  C 3 17  ? 10.845  255.829 37.799  1.00 106.95 1 17  DG  T OP2   1 
ATOM   3695 O  "O5'" . DG  C 3 17  ? 11.359  253.992 39.361  1.00 91.54  ? 17  DG  T "O5'" 1 
ATOM   3696 C  "C5'" . DG  C 3 17  ? 11.495  252.619 39.717  1.00 81.24  ? 17  DG  T "C5'" 1 
ATOM   3697 C  "C4'" . DG  C 3 17  ? 12.647  252.417 40.690  1.00 73.23  ? 17  DG  T "C4'" 1 
ATOM   3698 O  "O4'" . DG  C 3 17  ? 13.907  252.481 39.979  1.00 70.84  ? 17  DG  T "O4'" 1 
ATOM   3699 C  "C3'" . DG  C 3 17  ? 12.731  253.441 41.828  1.00 72.00  ? 17  DG  T "C3'" 1 
ATOM   3700 O  "O3'" . DG  C 3 17  ? 12.751  252.752 43.096  1.00 70.48  ? 17  DG  T "O3'" 1 
ATOM   3701 C  "C2'" . DG  C 3 17  ? 14.037  254.210 41.549  1.00 62.54  ? 17  DG  T "C2'" 1 
ATOM   3702 C  "C1'" . DG  C 3 17  ? 14.848  253.201 40.740  1.00 66.87  ? 17  DG  T "C1'" 1 
ATOM   3703 N  N9    . DG  C 3 17  ? 15.806  253.817 39.814  1.00 68.20  ? 17  DG  T N9    1 
ATOM   3704 C  C8    . DG  C 3 17  ? 15.531  254.764 38.849  1.00 65.67  ? 17  DG  T C8    1 
ATOM   3705 N  N7    . DG  C 3 17  ? 16.579  255.131 38.156  1.00 65.27  ? 17  DG  T N7    1 
ATOM   3706 C  C5    . DG  C 3 17  ? 17.623  254.378 38.686  1.00 64.14  ? 17  DG  T C5    1 
ATOM   3707 C  C6    . DG  C 3 17  ? 19.001  254.354 38.338  1.00 61.51  ? 17  DG  T C6    1 
ATOM   3708 O  O6    . DG  C 3 17  ? 19.587  255.010 37.459  1.00 64.13  ? 17  DG  T O6    1 
ATOM   3709 N  N1    . DG  C 3 17  ? 19.716  253.458 39.133  1.00 59.86  ? 17  DG  T N1    1 
ATOM   3710 C  C2    . DG  C 3 17  ? 19.169  252.674 40.131  1.00 63.68  ? 17  DG  T C2    1 
ATOM   3711 N  N2    . DG  C 3 17  ? 20.018  251.863 40.781  1.00 64.72  ? 17  DG  T N2    1 
ATOM   3712 N  N3    . DG  C 3 17  ? 17.878  252.684 40.467  1.00 57.58  ? 17  DG  T N3    1 
ATOM   3713 C  C4    . DG  C 3 17  ? 17.166  253.557 39.707  1.00 67.22  ? 17  DG  T C4    1 
ATOM   3714 P  P     . DC  C 3 18  ? 12.700  253.558 44.486  1.00 79.50  ? 18  DC  T P     1 
ATOM   3715 O  OP1   . DC  C 3 18  ? 12.007  252.698 45.474  1.00 91.09  ? 18  DC  T OP1   1 
ATOM   3716 O  OP2   . DC  C 3 18  ? 12.190  254.934 44.261  1.00 76.11  1 18  DC  T OP2   1 
ATOM   3717 O  "O5'" . DC  C 3 18  ? 14.240  253.618 44.896  1.00 93.78  ? 18  DC  T "O5'" 1 
ATOM   3718 C  "C5'" . DC  C 3 18  ? 15.049  252.439 44.762  1.00 85.02  ? 18  DC  T "C5'" 1 
ATOM   3719 C  "C4'" . DC  C 3 18  ? 16.524  252.778 44.889  1.00 75.81  ? 18  DC  T "C4'" 1 
ATOM   3720 O  "O4'" . DC  C 3 18  ? 16.990  253.333 43.650  1.00 66.61  ? 18  DC  T "O4'" 1 
ATOM   3721 C  "C3'" . DC  C 3 18  ? 16.858  253.824 45.959  1.00 71.79  ? 18  DC  T "C3'" 1 
ATOM   3722 O  "O3'" . DC  C 3 18  ? 17.381  253.180 47.111  1.00 71.13  ? 18  DC  T "O3'" 1 
ATOM   3723 C  "C2'" . DC  C 3 18  ? 17.910  254.731 45.294  1.00 68.76  ? 18  DC  T "C2'" 1 
ATOM   3724 C  "C1'" . DC  C 3 18  ? 18.120  254.111 43.906  1.00 65.27  ? 18  DC  T "C1'" 1 
ATOM   3725 N  N1    . DC  C 3 18  ? 18.229  255.124 42.822  1.00 70.41  ? 18  DC  T N1    1 
ATOM   3726 C  C2    . DC  C 3 18  ? 19.475  255.390 42.236  1.00 74.10  ? 18  DC  T C2    1 
ATOM   3727 O  O2    . DC  C 3 18  ? 20.475  254.761 42.626  1.00 75.92  ? 18  DC  T O2    1 
ATOM   3728 N  N3    . DC  C 3 18  ? 19.549  256.332 41.253  1.00 70.77  ? 18  DC  T N3    1 
ATOM   3729 C  C4    . DC  C 3 18  ? 18.446  256.986 40.865  1.00 66.49  ? 18  DC  T C4    1 
ATOM   3730 N  N4    . DC  C 3 18  ? 18.561  257.901 39.893  1.00 61.95  ? 18  DC  T N4    1 
ATOM   3731 C  C5    . DC  C 3 18  ? 17.175  256.735 41.460  1.00 67.42  ? 18  DC  T C5    1 
ATOM   3732 C  C6    . DC  C 3 18  ? 17.112  255.803 42.422  1.00 68.16  ? 18  DC  T C6    1 
ATOM   3733 P  P     . DC  C 3 19  ? 17.320  253.887 48.555  1.00 80.56  ? 19  DC  T P     1 
ATOM   3734 O  OP1   . DC  C 3 19  ? 17.288  252.784 49.540  1.00 87.31  ? 19  DC  T OP1   1 
ATOM   3735 O  OP2   . DC  C 3 19  ? 16.255  254.919 48.562  1.00 71.86  1 19  DC  T OP2   1 
ATOM   3736 O  "O5'" . DC  C 3 19  ? 18.740  254.598 48.696  1.00 75.44  ? 19  DC  T "O5'" 1 
ATOM   3737 C  "C5'" . DC  C 3 19  ? 19.927  253.841 48.544  1.00 75.09  ? 19  DC  T "C5'" 1 
ATOM   3738 C  "C4'" . DC  C 3 19  ? 21.126  254.760 48.418  1.00 74.53  ? 19  DC  T "C4'" 1 
ATOM   3739 O  "O4'" . DC  C 3 19  ? 21.323  255.106 47.032  1.00 72.64  ? 19  DC  T "O4'" 1 
ATOM   3740 C  "C3'" . DC  C 3 19  ? 20.979  256.086 49.127  1.00 72.09  ? 19  DC  T "C3'" 1 
ATOM   3741 O  "O3'" . DC  C 3 19  ? 21.355  255.943 50.489  1.00 79.97  ? 19  DC  T "O3'" 1 
ATOM   3742 C  "C2'" . DC  C 3 19  ? 21.952  256.981 48.360  1.00 70.26  ? 19  DC  T "C2'" 1 
ATOM   3743 C  "C1'" . DC  C 3 19  ? 21.920  256.388 46.948  1.00 79.38  ? 19  DC  T "C1'" 1 
ATOM   3744 N  N1    . DC  C 3 19  ? 21.158  257.207 45.954  1.00 74.97  ? 19  DC  T N1    1 
ATOM   3745 C  C2    . DC  C 3 19  ? 21.817  257.694 44.831  1.00 69.91  ? 19  DC  T C2    1 
ATOM   3746 O  O2    . DC  C 3 19  ? 23.012  257.438 44.688  1.00 69.20  ? 19  DC  T O2    1 
ATOM   3747 N  N3    . DC  C 3 19  ? 21.127  258.427 43.928  1.00 72.99  ? 19  DC  T N3    1 
ATOM   3748 C  C4    . DC  C 3 19  ? 19.832  258.677 44.121  1.00 75.09  ? 19  DC  T C4    1 
ATOM   3749 N  N4    . DC  C 3 19  ? 19.187  259.415 43.199  1.00 68.23  ? 19  DC  T N4    1 
ATOM   3750 C  C5    . DC  C 3 19  ? 19.138  258.183 45.268  1.00 77.92  ? 19  DC  T C5    1 
ATOM   3751 C  C6    . DC  C 3 19  ? 19.834  257.463 46.150  1.00 75.46  ? 19  DC  T C6    1 
HETATM 3752 CA CA    . CA  D 4 .   ? 30.502  227.635 9.378   1.00 51.38  ? 401 CA  A CA    1 
HETATM 3753 CA CA    . CA  E 4 .   ? 30.597  225.200 6.670   1.00 42.02  ? 402 CA  A CA    1 
HETATM 3754 N  N1    . DCP F 5 .   ? 22.568  227.654 7.889   1.00 49.09  ? 403 DCP A N1    1 
HETATM 3755 C  C2    . DCP F 5 .   ? 21.257  227.926 7.868   1.00 37.76  ? 403 DCP A C2    1 
HETATM 3756 N  N3    . DCP F 5 .   ? 20.747  229.066 7.399   1.00 39.01  ? 403 DCP A N3    1 
HETATM 3757 C  C4    . DCP F 5 .   ? 21.565  230.003 6.914   1.00 44.73  ? 403 DCP A C4    1 
HETATM 3758 C  C5    . DCP F 5 .   ? 22.934  229.781 6.890   1.00 40.80  ? 403 DCP A C5    1 
HETATM 3759 C  C6    . DCP F 5 .   ? 23.440  228.557 7.390   1.00 39.45  ? 403 DCP A C6    1 
HETATM 3760 O  O2    . DCP F 5 .   ? 20.400  227.017 8.347   1.00 38.72  ? 403 DCP A O2    1 
HETATM 3761 N  N4    . DCP F 5 .   ? 20.980  231.217 6.442   1.00 46.59  ? 403 DCP A N4    1 
HETATM 3762 C  "C1'" . DCP F 5 .   ? 23.016  226.334 8.406   1.00 40.61  ? 403 DCP A "C1'" 1 
HETATM 3763 C  "C2'" . DCP F 5 .   ? 23.127  225.433 7.258   1.00 41.42  ? 403 DCP A "C2'" 1 
HETATM 3764 C  "C3'" . DCP F 5 .   ? 24.572  225.462 6.921   1.00 38.04  ? 403 DCP A "C3'" 1 
HETATM 3765 C  "C4'" . DCP F 5 .   ? 25.173  225.488 8.214   1.00 40.03  ? 403 DCP A "C4'" 1 
HETATM 3766 O  "O4'" . DCP F 5 .   ? 24.283  226.344 8.999   1.00 43.07  ? 403 DCP A "O4'" 1 
HETATM 3767 O  "O3'" . DCP F 5 .   ? 24.914  224.319 6.209   1.00 37.50  ? 403 DCP A "O3'" 1 
HETATM 3768 C  "C5'" . DCP F 5 .   ? 26.538  225.994 8.160   1.00 38.60  ? 403 DCP A "C5'" 1 
HETATM 3769 O  "O5'" . DCP F 5 .   ? 26.687  227.297 7.671   1.00 46.45  ? 403 DCP A "O5'" 1 
HETATM 3770 P  PA    . DCP F 5 .   ? 27.911  227.661 6.752   1.00 45.21  ? 403 DCP A PA    1 
HETATM 3771 O  O1A   . DCP F 5 .   ? 28.111  229.128 6.704   1.00 43.97  1 403 DCP A O1A   1 
HETATM 3772 O  O2A   . DCP F 5 .   ? 29.225  227.099 7.232   1.00 50.29  ? 403 DCP A O2A   1 
HETATM 3773 O  O3A   . DCP F 5 .   ? 27.632  227.223 5.280   1.00 64.57  ? 403 DCP A O3A   1 
HETATM 3774 P  PB    . DCP F 5 .   ? 27.922  225.816 4.662   1.00 41.11  ? 403 DCP A PB    1 
HETATM 3775 O  O1B   . DCP F 5 .   ? 26.599  225.166 4.366   1.00 44.74  ? 403 DCP A O1B   1 
HETATM 3776 O  O2B   . DCP F 5 .   ? 28.467  224.781 5.589   1.00 49.54  1 403 DCP A O2B   1 
HETATM 3777 O  O3B   . DCP F 5 .   ? 28.815  226.018 3.393   1.00 42.97  ? 403 DCP A O3B   1 
HETATM 3778 P  PG    . DCP F 5 .   ? 30.334  226.404 3.453   1.00 45.48  ? 403 DCP A PG    1 
HETATM 3779 O  O1G   . DCP F 5 .   ? 31.079  225.348 2.685   1.00 45.27  ? 403 DCP A O1G   1 
HETATM 3780 O  O2G   . DCP F 5 .   ? 30.620  227.683 2.720   1.00 52.44  1 403 DCP A O2G   1 
HETATM 3781 O  O3G   . DCP F 5 .   ? 30.842  226.556 4.923   1.00 69.49  ? 403 DCP A O3G   1 
HETATM 3782 O  O     . HOH G 6 .   ? 13.919  234.954 26.654  1.00 39.28  ? 501 HOH A O     1 
HETATM 3783 O  O     . HOH G 6 .   ? 18.939  223.655 -13.081 1.00 37.22  ? 502 HOH A O     1 
HETATM 3784 O  O     . HOH G 6 .   ? 14.702  219.389 10.873  1.00 42.42  ? 503 HOH A O     1 
HETATM 3785 O  O     . HOH G 6 .   ? 7.065   229.606 37.735  1.00 46.61  ? 504 HOH A O     1 
HETATM 3786 O  O     . HOH G 6 .   ? 9.534   238.220 39.605  1.00 51.20  ? 505 HOH A O     1 
HETATM 3787 O  O     . HOH G 6 .   ? 29.528  209.058 7.978   1.00 46.56  ? 506 HOH A O     1 
HETATM 3788 O  O     . HOH G 6 .   ? 25.249  230.465 0.110   1.00 41.06  ? 507 HOH A O     1 
HETATM 3789 O  O     . HOH G 6 .   ? 30.915  229.758 8.400   1.00 44.90  ? 508 HOH A O     1 
HETATM 3790 O  O     . HOH G 6 .   ? 3.536   237.532 4.665   1.00 50.46  ? 509 HOH A O     1 
HETATM 3791 O  O     . HOH G 6 .   ? 13.400  217.545 -6.048  1.00 54.27  ? 510 HOH A O     1 
HETATM 3792 O  O     . HOH G 6 .   ? 28.308  217.365 -4.658  1.00 41.59  ? 511 HOH A O     1 
HETATM 3793 O  O     . HOH G 6 .   ? 9.596   230.026 -1.651  1.00 34.31  ? 512 HOH A O     1 
HETATM 3794 O  O     . HOH G 6 .   ? 20.064  225.797 10.968  1.00 47.17  ? 513 HOH A O     1 
HETATM 3795 O  O     . HOH G 6 .   ? -3.788  224.447 22.405  1.00 50.57  ? 514 HOH A O     1 
HETATM 3796 O  O     . HOH G 6 .   ? 27.520  207.744 1.830   1.00 48.50  ? 515 HOH A O     1 
HETATM 3797 O  O     . HOH G 6 .   ? 22.912  219.410 39.608  1.00 57.39  ? 516 HOH A O     1 
HETATM 3798 O  O     . HOH G 6 .   ? -6.661  238.907 12.254  1.00 38.85  ? 517 HOH A O     1 
HETATM 3799 O  O     . HOH G 6 .   ? -5.504  227.921 15.681  1.00 58.42  ? 518 HOH A O     1 
HETATM 3800 O  O     . HOH G 6 .   ? 4.575   223.378 35.321  1.00 48.60  ? 519 HOH A O     1 
HETATM 3801 O  O     . HOH G 6 .   ? -4.943  225.607 16.437  1.00 48.87  ? 520 HOH A O     1 
HETATM 3802 O  O     . HOH G 6 .   ? 31.195  228.134 22.298  1.00 52.72  ? 521 HOH A O     1 
HETATM 3803 O  O     . HOH G 6 .   ? -2.858  231.871 37.013  1.00 50.40  ? 522 HOH A O     1 
HETATM 3804 O  O     . HOH G 6 .   ? 13.554  212.634 8.288   1.00 59.36  ? 523 HOH A O     1 
HETATM 3805 O  O     . HOH G 6 .   ? -1.183  224.023 21.255  1.00 56.22  ? 524 HOH A O     1 
HETATM 3806 O  O     . HOH G 6 .   ? 25.933  231.280 -4.840  1.00 63.63  ? 525 HOH A O     1 
HETATM 3807 O  O     . HOH G 6 .   ? 15.529  219.595 33.692  1.00 60.90  ? 526 HOH A O     1 
HETATM 3808 O  O     . HOH G 6 .   ? 30.337  207.222 12.460  1.00 52.14  ? 527 HOH A O     1 
HETATM 3809 O  O     . HOH G 6 .   ? 6.942   222.025 7.415   1.00 54.23  ? 528 HOH A O     1 
HETATM 3810 O  O     . HOH G 6 .   ? 51.493  216.598 14.204  1.00 65.93  ? 529 HOH A O     1 
HETATM 3811 O  O     . HOH G 6 .   ? 14.399  214.518 10.392  1.00 63.00  ? 530 HOH A O     1 
HETATM 3812 O  O     . HOH G 6 .   ? 9.967   246.206 8.669   1.00 74.46  ? 531 HOH A O     1 
HETATM 3813 O  O     . HOH G 6 .   ? 6.484   225.030 2.520   1.00 62.71  ? 532 HOH A O     1 
HETATM 3814 O  O     . HOH G 6 .   ? 12.593  238.903 9.212   1.00 59.41  ? 533 HOH A O     1 
HETATM 3815 O  O     . HOH G 6 .   ? 42.798  221.411 -2.516  1.00 72.26  ? 534 HOH A O     1 
HETATM 3816 O  O     . HOH G 6 .   ? 41.185  223.677 -2.281  1.00 67.42  ? 535 HOH A O     1 
HETATM 3817 O  O     . HOH H 6 .   ? 29.814  238.595 10.063  1.00 60.13  ? 101 HOH P O     1 
HETATM 3818 O  O     . HOH H 6 .   ? 27.255  234.228 7.980   1.00 68.94  ? 102 HOH P O     1 
HETATM 3819 O  O     . HOH I 6 .   ? 9.133   225.206 12.486  1.00 36.77  ? 101 HOH T O     1 
HETATM 3820 O  O     . HOH I 6 .   ? 9.829   224.509 9.227   1.00 39.12  ? 102 HOH T O     1 
HETATM 3821 O  O     . HOH I 6 .   ? 21.578  253.527 44.299  1.00 57.23  ? 103 HOH T O     1 
HETATM 3822 O  O     . HOH I 6 .   ? 9.213   242.062 -10.261 1.00 75.09  ? 104 HOH T O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . MET A 1   ? 0.5983 1.5425 0.8613 -0.1490 -0.2557 -0.1815 1   MET A N     
2    C CA    . MET A 1   ? 0.5721 1.4660 0.7949 -0.1168 -0.2492 -0.1676 1   MET A CA    
3    C C     . MET A 1   ? 0.6145 1.5211 0.8557 -0.1091 -0.2255 -0.1533 1   MET A C     
4    O O     . MET A 1   ? 0.6150 1.5522 0.8918 -0.1380 -0.2110 -0.1535 1   MET A O     
5    C CB    . MET A 1   ? 0.5787 1.3948 0.7598 -0.1355 -0.2504 -0.1690 1   MET A CB    
6    C CG    . MET A 1   ? 0.7036 1.4691 0.8350 -0.0992 -0.2506 -0.1578 1   MET A CG    
7    S SD    . MET A 1   ? 0.9827 1.6594 1.0623 -0.1165 -0.2490 -0.1604 1   MET A SD    
8    C CE    . MET A 1   ? 0.6983 1.3546 0.7993 -0.1530 -0.2249 -0.1533 1   MET A CE    
9    N N     . ILE A 2   ? 0.5624 1.4441 0.7773 -0.0702 -0.2214 -0.1406 2   ILE A N     
10   C CA    . ILE A 2   ? 0.5480 1.4348 0.7745 -0.0584 -0.2007 -0.1279 2   ILE A CA    
11   C C     . ILE A 2   ? 0.5409 1.3608 0.7250 -0.0415 -0.1952 -0.1147 2   ILE A C     
12   O O     . ILE A 2   ? 0.5204 1.3091 0.6679 -0.0097 -0.2065 -0.1099 2   ILE A O     
13   C CB    . ILE A 2   ? 0.5684 1.5095 0.8158 -0.0186 -0.2012 -0.1265 2   ILE A CB    
14   C CG1   . ILE A 2   ? 0.5160 1.5314 0.8084 -0.0355 -0.2047 -0.1397 2   ILE A CG1   
15   C CG2   . ILE A 2   ? 0.5153 1.4542 0.7693 -0.0034 -0.1801 -0.1148 2   ILE A CG2   
16   C CD1   . ILE A 2   ? 0.5102 1.5800 0.8199 0.0060  -0.2092 -0.1420 2   ILE A CD1   
22   N N     . VAL A 3   ? 0.5119 1.3090 0.6992 -0.0633 -0.1770 -0.1076 3   VAL A N     
23   C CA    . VAL A 3   ? 0.4422 1.1622 0.5871 -0.0510 -0.1676 -0.0944 3   VAL A CA    
24   C C     . VAL A 3   ? 0.4443 1.1546 0.5966 -0.0361 -0.1457 -0.0809 3   VAL A C     
25   O O     . VAL A 3   ? 0.5381 1.2883 0.7247 -0.0551 -0.1329 -0.0820 3   VAL A O     
26   C CB    . VAL A 3   ? 0.4329 1.0886 0.5555 -0.0878 -0.1618 -0.0962 3   VAL A CB    
27   C CG1   . VAL A 3   ? 0.5325 1.1028 0.6105 -0.0714 -0.1488 -0.0819 3   VAL A CG1   
28   C CG2   . VAL A 3   ? 0.5227 1.1863 0.6353 -0.1013 -0.1849 -0.1129 3   VAL A CG2   
35   N N     . ILE A 4   ? 0.4770 1.1362 0.5957 -0.0022 -0.1420 -0.0686 4   ILE A N     
36   C CA    . ILE A 4   ? 0.5240 1.1552 0.6394 0.0116  -0.1223 -0.0567 4   ILE A CA    
37   C C     . ILE A 4   ? 0.5782 1.1221 0.6549 0.0042  -0.1103 -0.0459 4   ILE A C     
38   O O     . ILE A 4   ? 0.6451 1.1432 0.6866 0.0227  -0.1159 -0.0396 4   ILE A O     
39   C CB    . ILE A 4   ? 0.5289 1.1727 0.6398 0.0586  -0.1283 -0.0521 4   ILE A CB    
40   C CG1   . ILE A 4   ? 0.4952 1.2342 0.6500 0.0698  -0.1383 -0.0641 4   ILE A CG1   
41   C CG2   . ILE A 4   ? 0.5613 1.1615 0.6612 0.0718  -0.1092 -0.0412 4   ILE A CG2   
42   C CD1   . ILE A 4   ? 0.6056 1.3576 0.7547 0.1203  -0.1483 -0.0617 4   ILE A CD1   
48   N N     . PHE A 5   ? 0.6095 1.1331 0.6927 -0.0231 -0.0936 -0.0432 5   PHE A N     
49   C CA    . PHE A 5   ? 0.4959 0.9437 0.5472 -0.0296 -0.0821 -0.0342 5   PHE A CA    
50   C C     . PHE A 5   ? 0.4833 0.9096 0.5299 -0.0092 -0.0675 -0.0239 5   PHE A C     
51   O O     . PHE A 5   ? 0.4715 0.9393 0.5429 -0.0033 -0.0611 -0.0250 5   PHE A O     
52   C CB    . PHE A 5   ? 0.4484 0.8801 0.5045 -0.0690 -0.0754 -0.0374 5   PHE A CB    
53   C CG    . PHE A 5   ? 0.4021 0.7629 0.4302 -0.0741 -0.0631 -0.0291 5   PHE A CG    
54   C CD1   . PHE A 5   ? 0.4150 0.7271 0.4112 -0.0679 -0.0680 -0.0293 5   PHE A CD1   
55   C CD2   . PHE A 5   ? 0.4171 0.7649 0.4509 -0.0845 -0.0467 -0.0217 5   PHE A CD2   
56   C CE1   . PHE A 5   ? 0.4606 0.7152 0.4349 -0.0710 -0.0571 -0.0232 5   PHE A CE1   
57   C CE2   . PHE A 5   ? 0.3953 0.6825 0.4048 -0.0875 -0.0376 -0.0150 5   PHE A CE2   
58   C CZ    . PHE A 5   ? 0.4157 0.6579 0.3976 -0.0804 -0.0429 -0.0162 5   PHE A CZ    
59   N N     . VAL A 6   ? 0.4331 0.7979 0.4483 0.0017  -0.0626 -0.0153 6   VAL A N     
60   C CA    . VAL A 6   ? 0.3930 0.7337 0.4011 0.0215  -0.0522 -0.0072 6   VAL A CA    
61   C C     . VAL A 6   ? 0.4478 0.7290 0.4342 0.0102  -0.0409 -0.0007 6   VAL A C     
62   O O     . VAL A 6   ? 0.4124 0.6582 0.3762 0.0068  -0.0439 0.0012  6   VAL A O     
63   C CB    . VAL A 6   ? 0.4580 0.7908 0.4508 0.0556  -0.0617 -0.0028 6   VAL A CB    
64   C CG1   . VAL A 6   ? 0.3881 0.6837 0.3696 0.0735  -0.0518 0.0045  6   VAL A CG1   
65   C CG2   . VAL A 6   ? 0.5418 0.9398 0.5588 0.0720  -0.0743 -0.0105 6   VAL A CG2   
72   N N     . ASP A 7   ? 0.4289 0.7041 0.4227 0.0049  -0.0279 0.0018  7   ASP A N     
73   C CA    . ASP A 7   ? 0.4406 0.6670 0.4178 -0.0056 -0.0181 0.0068  7   ASP A CA    
74   C C     . ASP A 7   ? 0.4931 0.7062 0.4678 0.0114  -0.0099 0.0106  7   ASP A C     
75   O O     . ASP A 7   ? 0.4929 0.7383 0.4841 0.0153  -0.0050 0.0080  7   ASP A O     
76   C CB    . ASP A 7   ? 0.4475 0.6773 0.4329 -0.0345 -0.0125 0.0051  7   ASP A CB    
77   C CG    . ASP A 7   ? 0.6303 0.8068 0.5948 -0.0442 -0.0073 0.0087  7   ASP A CG    
78   O OD1   . ASP A 7   ? 0.6926 0.8374 0.6416 -0.0302 -0.0050 0.0123  7   ASP A OD1   
79   O OD2   . ASP A 7   ? 0.6621 0.8288 0.6259 -0.0661 -0.0060 0.0077  7   ASP A OD2   
80   N N     . PHE A 8   ? 0.4727 0.6420 0.4274 0.0215  -0.0086 0.0157  8   PHE A N     
81   C CA    . PHE A 8   ? 0.4977 0.6497 0.4484 0.0371  -0.0034 0.0174  8   PHE A CA    
82   C C     . PHE A 8   ? 0.4814 0.6280 0.4355 0.0244  0.0072  0.0165  8   PHE A C     
83   O O     . PHE A 8   ? 0.4249 0.5570 0.3744 0.0064  0.0100  0.0182  8   PHE A O     
84   C CB    . PHE A 8   ? 0.4752 0.5818 0.4047 0.0460  -0.0049 0.0236  8   PHE A CB    
85   C CG    . PHE A 8   ? 0.5662 0.6705 0.4840 0.0552  -0.0145 0.0277  8   PHE A CG    
86   C CD1   . PHE A 8   ? 0.6323 0.7000 0.5287 0.0541  -0.0138 0.0352  8   PHE A CD1   
87   C CD2   . PHE A 8   ? 0.5805 0.7225 0.5078 0.0655  -0.0241 0.0244  8   PHE A CD2   
88   C CE1   . PHE A 8   ? 0.5525 0.6170 0.4325 0.0629  -0.0219 0.0409  8   PHE A CE1   
89   C CE2   . PHE A 8   ? 0.5427 0.6819 0.4552 0.0761  -0.0345 0.0287  8   PHE A CE2   
90   C CZ    . PHE A 8   ? 0.4960 0.5939 0.3822 0.0746  -0.0331 0.0378  8   PHE A CZ    
91   N N     . ASP A 9   ? 0.4441 0.6013 0.4033 0.0355  0.0121  0.0134  9   ASP A N     
92   C CA    . ASP A 9   ? 0.4625 0.6188 0.4213 0.0246  0.0217  0.0131  9   ASP A CA    
93   C C     . ASP A 9   ? 0.4568 0.5676 0.3993 0.0238  0.0234  0.0153  9   ASP A C     
94   O O     . ASP A 9   ? 0.4468 0.5330 0.3816 0.0363  0.0197  0.0148  9   ASP A O     
95   C CB    . ASP A 9   ? 0.3135 0.5022 0.2813 0.0381  0.0270  0.0073  9   ASP A CB    
96   C CG    . ASP A 9   ? 0.4846 0.7311 0.4741 0.0354  0.0279  0.0044  9   ASP A CG    
97   O OD1   . ASP A 9   ? 0.4643 0.7422 0.4638 0.0563  0.0275  -0.0025 9   ASP A OD1   
98   O OD2   . ASP A 9   ? 0.4950 0.7567 0.4925 0.0127  0.0283  0.0078  9   ASP A OD2   
99   N N     . TYR A 10  ? 0.4952 0.5952 0.4324 0.0087  0.0281  0.0178  10  TYR A N     
100  C CA    . TYR A 10  ? 0.5186 0.5834 0.4436 0.0074  0.0284  0.0187  10  TYR A CA    
101  C C     . TYR A 10  ? 0.4962 0.5367 0.4167 0.0164  0.0238  0.0184  10  TYR A C     
102  O O     . TYR A 10  ? 0.5088 0.5319 0.4249 0.0241  0.0235  0.0155  10  TYR A O     
103  C CB    . TYR A 10  ? 0.5459 0.6116 0.4656 0.0117  0.0331  0.0158  10  TYR A CB    
104  C CG    . TYR A 10  ? 0.4923 0.5678 0.4137 0.0297  0.0332  0.0086  10  TYR A CG    
105  C CD1   . TYR A 10  ? 0.5046 0.5547 0.4178 0.0390  0.0304  0.0030  10  TYR A CD1   
106  C CD2   . TYR A 10  ? 0.4220 0.5332 0.3539 0.0378  0.0353  0.0058  10  TYR A CD2   
107  C CE1   . TYR A 10  ? 0.4622 0.5139 0.3738 0.0571  0.0290  -0.0058 10  TYR A CE1   
108  C CE2   . TYR A 10  ? 0.3729 0.4915 0.3049 0.0593  0.0345  -0.0031 10  TYR A CE2   
109  C CZ    . TYR A 10  ? 0.4569 0.5412 0.3766 0.0690  0.0310  -0.0089 10  TYR A CZ    
110  O OH    . TYR A 10  ? 0.5423 0.6268 0.4588 0.0911  0.0288  -0.0196 10  TYR A OH    
111  N N     . PHE A 11  ? 0.4963 0.5354 0.4163 0.0139  0.0202  0.0215  11  PHE A N     
112  C CA    . PHE A 11  ? 0.5072 0.5309 0.4212 0.0234  0.0163  0.0241  11  PHE A CA    
113  C C     . PHE A 11  ? 0.4866 0.4801 0.3934 0.0234  0.0180  0.0250  11  PHE A C     
114  O O     . PHE A 11  ? 0.5622 0.5411 0.4656 0.0332  0.0161  0.0244  11  PHE A O     
115  C CB    . PHE A 11  ? 0.4962 0.5228 0.4056 0.0185  0.0128  0.0276  11  PHE A CB    
116  C CG    . PHE A 11  ? 0.4419 0.4521 0.3397 0.0278  0.0094  0.0334  11  PHE A CG    
117  C CD1   . PHE A 11  ? 0.4237 0.4313 0.3196 0.0438  0.0049  0.0348  11  PHE A CD1   
118  C CD2   . PHE A 11  ? 0.4689 0.4655 0.3551 0.0216  0.0107  0.0378  11  PHE A CD2   
119  C CE1   . PHE A 11  ? 0.4856 0.4702 0.3652 0.0525  0.0010  0.0431  11  PHE A CE1   
120  C CE2   . PHE A 11  ? 0.5937 0.5736 0.4646 0.0283  0.0088  0.0462  11  PHE A CE2   
121  C CZ    . PHE A 11  ? 0.5308 0.5016 0.3972 0.0431  0.0035  0.0500  11  PHE A CZ    
122  N N     . PHE A 12  ? 0.4072 0.3913 0.3122 0.0128  0.0208  0.0258  12  PHE A N     
123  C CA    . PHE A 12  ? 0.4292 0.3928 0.3321 0.0101  0.0225  0.0259  12  PHE A CA    
124  C C     . PHE A 12  ? 0.4810 0.4379 0.3865 0.0147  0.0215  0.0197  12  PHE A C     
125  O O     . PHE A 12  ? 0.4988 0.4357 0.4016 0.0161  0.0200  0.0191  12  PHE A O     
126  C CB    . PHE A 12  ? 0.3887 0.3530 0.2934 0.0008  0.0257  0.0249  12  PHE A CB    
127  C CG    . PHE A 12  ? 0.5557 0.5241 0.4545 -0.0022 0.0269  0.0285  12  PHE A CG    
128  C CD1   . PHE A 12  ? 0.6255 0.5982 0.5177 0.0018  0.0241  0.0325  12  PHE A CD1   
129  C CD2   . PHE A 12  ? 0.5661 0.5367 0.4653 -0.0070 0.0302  0.0261  12  PHE A CD2   
130  C CE1   . PHE A 12  ? 0.6318 0.6087 0.5152 -0.0002 0.0242  0.0341  12  PHE A CE1   
131  C CE2   . PHE A 12  ? 0.5856 0.5603 0.4764 -0.0077 0.0315  0.0270  12  PHE A CE2   
132  C CZ    . PHE A 12  ? 0.5529 0.5297 0.4345 -0.0051 0.0284  0.0311  12  PHE A CZ    
133  N N     . ALA A 13  ? 0.4526 0.4240 0.3608 0.0162  0.0220  0.0150  13  ALA A N     
134  C CA    . ALA A 13  ? 0.4189 0.3863 0.3258 0.0222  0.0207  0.0074  13  ALA A CA    
135  C C     . ALA A 13  ? 0.4448 0.4094 0.3492 0.0360  0.0185  0.0045  13  ALA A C     
136  O O     . ALA A 13  ? 0.5872 0.5323 0.4872 0.0418  0.0153  -0.0019 13  ALA A O     
137  C CB    . ALA A 13  ? 0.3481 0.3328 0.2533 0.0210  0.0230  0.0051  13  ALA A CB    
138  N N     . GLN A 14  ? 0.4720 0.4557 0.3792 0.0422  0.0189  0.0077  14  GLN A N     
139  C CA    . GLN A 14  ? 0.5098 0.4940 0.4153 0.0604  0.0154  0.0037  14  GLN A CA    
140  C C     . GLN A 14  ? 0.5798 0.5264 0.4759 0.0655  0.0100  0.0069  14  GLN A C     
141  O O     . GLN A 14  ? 0.6279 0.5556 0.5173 0.0805  0.0056  0.0009  14  GLN A O     
142  C CB    . GLN A 14  ? 0.4066 0.4251 0.3204 0.0667  0.0154  0.0059  14  GLN A CB    
143  C CG    . GLN A 14  ? 0.4145 0.4396 0.3281 0.0907  0.0110  -0.0003 14  GLN A CG    
144  C CD    . GLN A 14  ? 0.5143 0.5852 0.4414 0.0975  0.0103  -0.0001 14  GLN A CD    
145  O OE1   . GLN A 14  ? 0.4736 0.5655 0.4055 0.1185  0.0081  -0.0073 14  GLN A OE1   
146  N NE2   . GLN A 14  ? 0.5273 0.6150 0.4610 0.0806  0.0112  0.0066  14  GLN A NE2   
147  N N     . VAL A 15  ? 0.5230 0.4563 0.4162 0.0533  0.0107  0.0164  15  VAL A N     
148  C CA    . VAL A 15  ? 0.5709 0.4661 0.4523 0.0535  0.0075  0.0226  15  VAL A CA    
149  C C     . VAL A 15  ? 0.5764 0.4430 0.4559 0.0465  0.0068  0.0163  15  VAL A C     
150  O O     . VAL A 15  ? 0.5571 0.3880 0.4258 0.0533  0.0017  0.0154  15  VAL A O     
151  C CB    . VAL A 15  ? 0.6088 0.5018 0.4860 0.0404  0.0107  0.0345  15  VAL A CB    
152  C CG1   . VAL A 15  ? 0.5327 0.3853 0.3953 0.0364  0.0097  0.0437  15  VAL A CG1   
153  C CG2   . VAL A 15  ? 0.6123 0.5296 0.4883 0.0485  0.0083  0.0390  15  VAL A CG2   
160  N N     . GLU A 16  ? 0.5054 0.3854 0.3943 0.0333  0.0105  0.0113  16  GLU A N     
161  C CA    . GLU A 16  ? 0.4639 0.3241 0.3536 0.0258  0.0080  0.0028  16  GLU A CA    
162  C C     . GLU A 16  ? 0.5621 0.4111 0.4449 0.0428  0.0022  -0.0098 16  GLU A C     
163  O O     . GLU A 16  ? 0.6727 0.4878 0.5488 0.0420  -0.0033 -0.0164 16  GLU A O     
164  C CB    . GLU A 16  ? 0.5102 0.3940 0.4112 0.0137  0.0109  -0.0015 16  GLU A CB    
165  C CG    . GLU A 16  ? 0.4590 0.3521 0.3672 -0.0015 0.0163  0.0075  16  GLU A CG    
166  C CD    . GLU A 16  ? 0.6267 0.4992 0.5373 -0.0168 0.0171  0.0101  16  GLU A CD    
167  O OE1   . GLU A 16  ? 0.7436 0.6287 0.6609 -0.0289 0.0230  0.0161  16  GLU A OE1   
168  O OE2   . GLU A 16  ? 0.7201 0.5641 0.6258 -0.0178 0.0120  0.0054  16  GLU A OE2   
169  N N     . GLU A 17  ? 0.5757 0.4523 0.4592 0.0582  0.0036  -0.0136 17  GLU A N     
170  C CA    . GLU A 17  ? 0.6021 0.4737 0.4781 0.0785  -0.0006 -0.0267 17  GLU A CA    
171  C C     . GLU A 17  ? 0.6668 0.5038 0.5314 0.0949  -0.0073 -0.0261 17  GLU A C     
172  O O     . GLU A 17  ? 0.7339 0.5420 0.5879 0.1071  -0.0136 -0.0383 17  GLU A O     
173  C CB    . GLU A 17  ? 0.5531 0.4703 0.4344 0.0898  0.0047  -0.0298 17  GLU A CB    
174  C CG    . GLU A 17  ? 0.6021 0.5456 0.4875 0.0774  0.0102  -0.0307 17  GLU A CG    
175  C CD    . GLU A 17  ? 0.6708 0.6577 0.5599 0.0839  0.0172  -0.0306 17  GLU A CD    
176  O OE1   . GLU A 17  ? 0.7259 0.7299 0.6188 0.0986  0.0178  -0.0320 17  GLU A OE1   
177  O OE2   . GLU A 17  ? 0.7177 0.7224 0.6057 0.0741  0.0219  -0.0287 17  GLU A OE2   
178  N N     . VAL A 18  ? 0.7340 0.5720 0.5981 0.0974  -0.0072 -0.0128 18  VAL A N     
179  C CA    . VAL A 18  ? 0.6432 0.4446 0.4926 0.1151  -0.0151 -0.0097 18  VAL A CA    
180  C C     . VAL A 18  ? 0.6944 0.4382 0.5313 0.1003  -0.0190 -0.0071 18  VAL A C     
181  O O     . VAL A 18  ? 0.7975 0.4965 0.6192 0.1131  -0.0272 -0.0136 18  VAL A O     
182  C CB    . VAL A 18  ? 0.7346 0.5513 0.5837 0.1201  -0.0155 0.0052  18  VAL A CB    
183  C CG1   . VAL A 18  ? 0.6862 0.4583 0.5147 0.1401  -0.0255 0.0115  18  VAL A CG1   
184  C CG2   . VAL A 18  ? 0.5919 0.4679 0.4567 0.1316  -0.0126 0.0000  18  VAL A CG2   
191  N N     . LEU A 19  ? 0.6524 0.3984 0.4966 0.0728  -0.0131 0.0005  19  LEU A N     
192  C CA    . LEU A 19  ? 0.7152 0.4144 0.5521 0.0532  -0.0151 0.0038  19  LEU A CA    
193  C C     . LEU A 19  ? 0.7554 0.4398 0.5947 0.0481  -0.0200 -0.0149 19  LEU A C     
194  O O     . LEU A 19  ? 0.8078 0.4434 0.6374 0.0379  -0.0257 -0.0169 19  LEU A O     
195  C CB    . LEU A 19  ? 0.7421 0.4575 0.5884 0.0264  -0.0062 0.0172  19  LEU A CB    
196  C CG    . LEU A 19  ? 0.7477 0.4662 0.5849 0.0277  -0.0023 0.0363  19  LEU A CG    
197  C CD1   . LEU A 19  ? 0.7084 0.4216 0.5463 0.0005  0.0059  0.0495  19  LEU A CD1   
198  C CD2   . LEU A 19  ? 0.6997 0.3789 0.5144 0.0488  -0.0107 0.0427  19  LEU A CD2   
199  N N     . ASN A 20  ? 0.7527 0.4774 0.6029 0.0538  -0.0183 -0.0281 20  ASN A N     
200  C CA    . ASN A 20  ? 0.7136 0.4298 0.5626 0.0538  -0.0244 -0.0480 20  ASN A CA    
201  C C     . ASN A 20  ? 0.6871 0.4338 0.5331 0.0787  -0.0243 -0.0617 20  ASN A C     
202  O O     . ASN A 20  ? 0.6664 0.4566 0.5215 0.0759  -0.0188 -0.0634 20  ASN A O     
203  C CB    . ASN A 20  ? 0.6413 0.3810 0.5060 0.0295  -0.0219 -0.0504 20  ASN A CB    
204  C CG    . ASN A 20  ? 0.7491 0.4803 0.6229 0.0038  -0.0175 -0.0355 20  ASN A CG    
205  O OD1   . ASN A 20  ? 0.8231 0.5232 0.6974 -0.0147 -0.0217 -0.0383 20  ASN A OD1   
206  N ND2   . ASN A 20  ? 0.6432 0.4040 0.5242 0.0009  -0.0086 -0.0206 20  ASN A ND2   
207  N N     . PRO A 21  ? 0.6911 0.4157 0.5230 0.1038  -0.0301 -0.0710 21  PRO A N     
208  C CA    . PRO A 21  ? 0.8890 0.6480 0.7180 0.1294  -0.0282 -0.0848 21  PRO A CA    
209  C C     . PRO A 21  ? 0.8334 0.6139 0.6608 0.1262  -0.0280 -0.1013 21  PRO A C     
210  O O     . PRO A 21  ? 0.7730 0.5963 0.6003 0.1405  -0.0218 -0.1069 21  PRO A O     
211  C CB    . PRO A 21  ? 0.9791 0.6958 0.7905 0.1565  -0.0375 -0.0956 21  PRO A CB    
212  C CG    . PRO A 21  ? 0.9203 0.5927 0.7270 0.1479  -0.0413 -0.0771 21  PRO A CG    
213  C CD    . PRO A 21  ? 0.8162 0.4819 0.6325 0.1110  -0.0381 -0.0671 21  PRO A CD    
214  N N     . GLN A 22  ? 0.8230 0.5779 0.6491 0.1075  -0.0346 -0.1085 22  GLN A N     
215  C CA    . GLN A 22  ? 0.7646 0.5423 0.5877 0.1046  -0.0363 -0.1233 22  GLN A CA    
216  C C     . GLN A 22  ? 0.8337 0.6648 0.6678 0.0970  -0.0261 -0.1110 22  GLN A C     
217  O O     . GLN A 22  ? 0.9025 0.7630 0.7287 0.1043  -0.0240 -0.1190 22  GLN A O     
218  C CB    . GLN A 22  ? 0.7454 0.4926 0.5709 0.0819  -0.0463 -0.1312 22  GLN A CB    
219  C CG    . GLN A 22  ? 1.0574 0.7579 0.8870 0.0666  -0.0492 -0.1201 22  GLN A CG    
220  C CD    . GLN A 22  ? 1.1306 0.8407 0.9795 0.0350  -0.0469 -0.1083 22  GLN A CD    
221  O OE1   . GLN A 22  ? 1.2267 0.9698 1.0856 0.0252  -0.0476 -0.1137 22  GLN A OE1   
222  N NE2   . GLN A 22  ? 1.0339 0.7170 0.8870 0.0204  -0.0441 -0.0921 22  GLN A NE2   
223  N N     . TYR A 23  ? 0.6396 0.4796 0.4885 0.0824  -0.0200 -0.0912 23  TYR A N     
224  C CA    . TYR A 23  ? 0.5963 0.4776 0.4537 0.0748  -0.0117 -0.0795 23  TYR A CA    
225  C C     . TYR A 23  ? 0.6925 0.6084 0.5460 0.0909  -0.0031 -0.0769 23  TYR A C     
226  O O     . TYR A 23  ? 0.7503 0.6979 0.6039 0.0865  0.0032  -0.0710 23  TYR A O     
227  C CB    . TYR A 23  ? 0.5259 0.4070 0.3978 0.0579  -0.0077 -0.0617 23  TYR A CB    
228  C CG    . TYR A 23  ? 0.5894 0.4508 0.4697 0.0381  -0.0127 -0.0617 23  TYR A CG    
229  C CD1   . TYR A 23  ? 0.7221 0.5783 0.6129 0.0240  -0.0086 -0.0474 23  TYR A CD1   
230  C CD2   . TYR A 23  ? 0.6335 0.4867 0.5120 0.0329  -0.0211 -0.0767 23  TYR A CD2   
231  C CE1   . TYR A 23  ? 0.7311 0.5776 0.6324 0.0040  -0.0108 -0.0470 23  TYR A CE1   
232  C CE2   . TYR A 23  ? 0.7536 0.5969 0.6449 0.0120  -0.0254 -0.0774 23  TYR A CE2   
233  C CZ    . TYR A 23  ? 0.8421 0.6839 0.7458 -0.0027 -0.0191 -0.0619 23  TYR A CZ    
234  O OH    . TYR A 23  ? 1.0219 0.8618 0.9405 -0.0247 -0.0210 -0.0623 23  TYR A OH    
235  N N     . LYS A 24  ? 0.6127 0.5236 0.4630 0.1092  -0.0029 -0.0810 24  LYS A N     
236  C CA    . LYS A 24  ? 0.6027 0.5562 0.4554 0.1223  0.0063  -0.0781 24  LYS A CA    
237  C C     . LYS A 24  ? 0.7096 0.6910 0.5497 0.1313  0.0108  -0.0896 24  LYS A C     
238  O O     . LYS A 24  ? 0.8508 0.8137 0.6762 0.1421  0.0043  -0.1071 24  LYS A O     
239  C CB    . LYS A 24  ? 0.6257 0.5737 0.4793 0.1442  0.0042  -0.0818 24  LYS A CB    
240  C CG    . LYS A 24  ? 0.7739 0.7742 0.6398 0.1512  0.0137  -0.0746 24  LYS A CG    
241  C CD    . LYS A 24  ? 0.8507 0.8611 0.7168 0.1813  0.0116  -0.0846 24  LYS A CD    
242  C CE    . LYS A 24  ? 0.8392 0.8955 0.7245 0.1820  0.0171  -0.0735 24  LYS A CE    
243  N NZ    . LYS A 24  ? 0.8930 0.9258 0.7844 0.1641  0.0125  -0.0567 24  LYS A NZ    
244  N N     . GLY A 25  ? 0.5754 0.5994 0.4188 0.1258  0.0217  -0.0797 25  GLY A N     
245  C CA    . GLY A 25  ? 0.6594 0.7141 0.4876 0.1340  0.0286  -0.0873 25  GLY A CA    
246  C C     . GLY A 25  ? 0.7145 0.7686 0.5313 0.1181  0.0283  -0.0810 25  GLY A C     
247  O O     . GLY A 25  ? 0.8120 0.8942 0.6143 0.1192  0.0363  -0.0792 25  GLY A O     
248  N N     . LYS A 26  ? 0.7178 0.7412 0.5406 0.1039  0.0193  -0.0768 26  LYS A N     
249  C CA    . LYS A 26  ? 0.5777 0.5969 0.3919 0.0921  0.0150  -0.0727 26  LYS A CA    
250  C C     . LYS A 26  ? 0.6708 0.6867 0.4988 0.0741  0.0163  -0.0546 26  LYS A C     
251  O O     . LYS A 26  ? 0.6228 0.6293 0.4678 0.0683  0.0167  -0.0485 26  LYS A O     
252  C CB    . LYS A 26  ? 0.6755 0.6662 0.4857 0.0935  0.0012  -0.0892 26  LYS A CB    
253  C CG    . LYS A 26  ? 0.9273 0.9108 0.7234 0.1126  -0.0024 -0.1104 26  LYS A CG    
254  C CD    . LYS A 26  ? 1.1784 1.1257 0.9738 0.1097  -0.0176 -0.1273 26  LYS A CD    
255  C CE    . LYS A 26  ? 1.4648 1.4080 1.2367 0.1285  -0.0234 -0.1515 26  LYS A CE    
256  N NZ    . LYS A 26  ? 1.6135 1.5328 1.3802 0.1210  -0.0398 -0.1686 26  LYS A NZ    
257  N N     . PRO A 27  ? 0.6020 0.6240 0.4194 0.0673  0.0162  -0.0465 27  PRO A N     
258  C CA    . PRO A 27  ? 0.4028 0.4175 0.2293 0.0537  0.0153  -0.0324 27  PRO A CA    
259  C C     . PRO A 27  ? 0.5293 0.5251 0.3758 0.0475  0.0086  -0.0355 27  PRO A C     
260  O O     . PRO A 27  ? 0.4666 0.4518 0.3146 0.0487  -0.0004 -0.0473 27  PRO A O     
261  C CB    . PRO A 27  ? 0.5447 0.5587 0.3528 0.0548  0.0092  -0.0315 27  PRO A CB    
262  C CG    . PRO A 27  ? 0.4423 0.4727 0.2258 0.0658  0.0134  -0.0372 27  PRO A CG    
263  C CD    . PRO A 27  ? 0.5469 0.5805 0.3385 0.0751  0.0157  -0.0515 27  PRO A CD    
264  N N     . LEU A 28  ? 0.4776 0.4708 0.3385 0.0398  0.0129  -0.0256 28  LEU A N     
265  C CA    . LEU A 28  ? 0.5094 0.4874 0.3860 0.0328  0.0087  -0.0263 28  LEU A CA    
266  C C     . LEU A 28  ? 0.4409 0.4205 0.3246 0.0240  0.0114  -0.0147 28  LEU A C     
267  O O     . LEU A 28  ? 0.4438 0.4304 0.3255 0.0219  0.0173  -0.0059 28  LEU A O     
268  C CB    . LEU A 28  ? 0.5226 0.4900 0.4057 0.0361  0.0099  -0.0290 28  LEU A CB    
269  C CG    . LEU A 28  ? 0.6139 0.5653 0.5096 0.0263  0.0083  -0.0253 28  LEU A CG    
270  C CD1   . LEU A 28  ? 0.5994 0.5372 0.4992 0.0204  0.0009  -0.0354 28  LEU A CD1   
271  C CD2   . LEU A 28  ? 0.4272 0.3684 0.3244 0.0306  0.0106  -0.0211 28  LEU A CD2   
272  N N     . VAL A 29  ? 0.4857 0.4610 0.3780 0.0190  0.0068  -0.0163 29  VAL A N     
273  C CA    . VAL A 29  ? 0.5186 0.4950 0.4151 0.0145  0.0083  -0.0086 29  VAL A CA    
274  C C     . VAL A 29  ? 0.6044 0.5789 0.5166 0.0078  0.0092  -0.0095 29  VAL A C     
275  O O     . VAL A 29  ? 0.6518 0.6282 0.5736 0.0045  0.0053  -0.0167 29  VAL A O     
276  C CB    . VAL A 29  ? 0.5455 0.5249 0.4349 0.0189  0.0022  -0.0095 29  VAL A CB    
277  C CG1   . VAL A 29  ? 0.5409 0.5166 0.4315 0.0179  0.0031  -0.0029 29  VAL A CG1   
278  C CG2   . VAL A 29  ? 0.5442 0.5242 0.4131 0.0245  0.0020  -0.0068 29  VAL A CG2   
285  N N     . VAL A 30  ? 0.5593 0.5319 0.4734 0.0044  0.0144  -0.0022 30  VAL A N     
286  C CA    . VAL A 30  ? 0.4438 0.4165 0.3680 -0.0020 0.0173  -0.0008 30  VAL A CA    
287  C C     . VAL A 30  ? 0.4153 0.3972 0.3432 -0.0011 0.0173  -0.0014 30  VAL A C     
288  O O     . VAL A 30  ? 0.3966 0.3750 0.3160 0.0021  0.0177  0.0022  30  VAL A O     
289  C CB    . VAL A 30  ? 0.5035 0.4701 0.4241 -0.0036 0.0219  0.0064  30  VAL A CB    
290  C CG1   . VAL A 30  ? 0.5896 0.5573 0.5151 -0.0100 0.0261  0.0097  30  VAL A CG1   
291  C CG2   . VAL A 30  ? 0.4693 0.4259 0.3866 -0.0001 0.0208  0.0059  30  VAL A CG2   
298  N N     . CYS A 31  ? 0.4201 0.4145 0.3613 -0.0038 0.0165  -0.0068 31  CYS A N     
299  C CA    . CYS A 31  ? 0.4876 0.4951 0.4330 0.0028  0.0145  -0.0105 31  CYS A CA    
300  C C     . CYS A 31  ? 0.5774 0.6005 0.5341 -0.0014 0.0213  -0.0112 31  CYS A C     
301  O O     . CYS A 31  ? 0.5480 0.5770 0.5145 -0.0129 0.0265  -0.0099 31  CYS A O     
302  C CB    . CYS A 31  ? 0.5965 0.6171 0.5494 0.0078  0.0059  -0.0190 31  CYS A CB    
303  S SG    . CYS A 31  ? 0.5695 0.5758 0.5049 0.0133  -0.0014 -0.0189 31  CYS A SG    
304  N N     . VAL A 32  ? 0.4803 0.5085 0.4337 0.0080  0.0215  -0.0134 32  VAL A N     
305  C CA    . VAL A 32  ? 0.4793 0.5291 0.4428 0.0068  0.0290  -0.0163 32  VAL A CA    
306  C C     . VAL A 32  ? 0.4659 0.5462 0.4482 0.0144  0.0254  -0.0266 32  VAL A C     
307  O O     . VAL A 32  ? 0.4634 0.5450 0.4414 0.0312  0.0190  -0.0325 32  VAL A O     
308  C CB    . VAL A 32  ? 0.3932 0.4326 0.3411 0.0145  0.0316  -0.0156 32  VAL A CB    
309  C CG1   . VAL A 32  ? 0.4190 0.4825 0.3736 0.0128  0.0415  -0.0182 32  VAL A CG1   
310  C CG2   . VAL A 32  ? 0.3501 0.3646 0.2817 0.0082  0.0321  -0.0070 32  VAL A CG2   
317  N N     . TYR A 33  ? 0.4668 0.5714 0.4701 0.0020  0.0282  -0.0294 33  TYR A N     
318  C CA    . TYR A 33  ? 0.4688 0.6122 0.4954 0.0078  0.0240  -0.0407 33  TYR A CA    
319  C C     . TYR A 33  ? 0.5201 0.6984 0.5591 0.0125  0.0335  -0.0457 33  TYR A C     
320  O O     . TYR A 33  ? 0.5746 0.7695 0.6221 -0.0033 0.0464  -0.0416 33  TYR A O     
321  C CB    . TYR A 33  ? 0.4609 0.6206 0.5080 -0.0103 0.0223  -0.0439 33  TYR A CB    
322  C CG    . TYR A 33  ? 0.5858 0.7185 0.6219 -0.0110 0.0113  -0.0440 33  TYR A CG    
323  C CD1   . TYR A 33  ? 0.6090 0.7111 0.6343 -0.0246 0.0142  -0.0368 33  TYR A CD1   
324  C CD2   . TYR A 33  ? 0.5197 0.6582 0.5539 0.0042  -0.0025 -0.0518 33  TYR A CD2   
325  C CE1   . TYR A 33  ? 0.6071 0.6882 0.6216 -0.0229 0.0050  -0.0392 33  TYR A CE1   
326  C CE2   . TYR A 33  ? 0.5211 0.6385 0.5425 0.0040  -0.0113 -0.0525 33  TYR A CE2   
327  C CZ    . TYR A 33  ? 0.5103 0.6004 0.5226 -0.0096 -0.0069 -0.0471 33  TYR A CZ    
328  O OH    . TYR A 33  ? 0.5651 0.6365 0.5635 -0.0076 -0.0147 -0.0499 33  TYR A OH    
329  N N     . SER A 34  ? 0.3894 0.5779 0.4271 0.0359  0.0269  -0.0546 34  SER A N     
330  C CA    . SER A 34  ? 0.3831 0.6064 0.4308 0.0479  0.0341  -0.0631 34  SER A CA    
331  C C     . SER A 34  ? 0.4966 0.7818 0.5808 0.0377  0.0415  -0.0706 34  SER A C     
332  O O     . SER A 34  ? 0.6167 0.9380 0.7109 0.0398  0.0541  -0.0751 34  SER A O     
333  C CB    . SER A 34  ? 0.4914 0.7065 0.5290 0.0784  0.0215  -0.0722 34  SER A CB    
334  O OG    . SER A 34  ? 0.5605 0.8190 0.6244 0.0885  0.0136  -0.0833 34  SER A OG    
335  N N     . GLY A 35  ? 0.4399 0.7406 0.5442 0.0262  0.0339  -0.0733 35  GLY A N     
336  C CA    . GLY A 35  ? 0.3079 0.6697 0.4509 0.0115  0.0392  -0.0813 35  GLY A CA    
337  C C     . GLY A 35  ? 0.4968 0.9073 0.6640 0.0347  0.0271  -0.0982 35  GLY A C     
338  O O     . GLY A 35  ? 0.4585 0.9182 0.6602 0.0230  0.0237  -0.1072 35  GLY A O     
339  N N     . ARG A 36  ? 0.4604 0.8562 0.6091 0.0680  0.0193  -0.1031 36  ARG A N     
340  C CA    . ARG A 36  ? 0.5481 0.9834 0.7135 0.0977  0.0058  -0.1187 36  ARG A CA    
341  C C     . ARG A 36  ? 0.5996 1.0487 0.7799 0.0955  -0.0122 -0.1241 36  ARG A C     
342  O O     . ARG A 36  ? 0.6777 1.1920 0.8950 0.0980  -0.0169 -0.1378 36  ARG A O     
343  C CB    . ARG A 36  ? 0.6116 1.0023 0.7426 0.1323  -0.0032 -0.1193 36  ARG A CB    
344  C CG    . ARG A 36  ? 0.7177 1.1387 0.8590 0.1684  -0.0194 -0.1342 36  ARG A CG    
345  C CD    . ARG A 36  ? 0.7266 1.1190 0.8418 0.2006  -0.0205 -0.1386 36  ARG A CD    
346  N NE    . ARG A 36  ? 0.6393 1.0649 0.7657 0.1968  -0.0007 -0.1443 36  ARG A NE    
347  C CZ    . ARG A 36  ? 0.7463 1.1696 0.8600 0.2274  0.0001  -0.1553 36  ARG A CZ    
348  N NH1   . ARG A 36  ? 0.8149 1.1985 0.9044 0.2626  -0.0188 -0.1604 36  ARG A NH1   
349  N NH2   . ARG A 36  ? 0.6679 1.1249 0.7892 0.2238  0.0193  -0.1612 36  ARG A NH2   
350  N N     . THR A 37  ? 0.5673 0.9600 0.7194 0.0910  -0.0221 -0.1146 37  THR A N     
351  C CA    . THR A 37  ? 0.6293 1.0314 0.7914 0.0829  -0.0370 -0.1193 37  THR A CA    
352  C C     . THR A 37  ? 0.7091 1.0642 0.8538 0.0547  -0.0324 -0.1076 37  THR A C     
353  O O     . THR A 37  ? 0.7391 1.0619 0.8688 0.0415  -0.0178 -0.0958 37  THR A O     
354  C CB    . THR A 37  ? 0.7448 1.1298 0.8856 0.1154  -0.0589 -0.1226 37  THR A CB    
355  O OG1   . THR A 37  ? 0.9959 1.3893 1.1424 0.1058  -0.0730 -0.1275 37  THR A OG1   
356  C CG2   . THR A 37  ? 0.6271 0.9381 0.7199 0.1271  -0.0593 -0.1078 37  THR A CG2   
360  N N     . LYS A 38  ? 0.7075 1.0594 0.8526 0.0477  -0.0458 -0.1119 38  LYS A N     
361  C CA    . LYS A 38  ? 0.7225 1.0313 0.8514 0.0244  -0.0425 -0.1039 38  LYS A CA    
362  C C     . LYS A 38  ? 0.6946 0.9415 0.7798 0.0364  -0.0432 -0.0907 38  LYS A C     
363  O O     . LYS A 38  ? 0.7339 0.9456 0.8040 0.0213  -0.0384 -0.0835 38  LYS A O     
364  C CB    . LYS A 38  ? 0.7900 1.1163 0.9328 0.0128  -0.0569 -0.1160 38  LYS A CB    
365  C CG    . LYS A 38  ? 0.8668 1.2512 1.0556 -0.0105 -0.0546 -0.1281 38  LYS A CG    
366  C CD    . LYS A 38  ? 0.9444 1.3347 1.1434 -0.0280 -0.0694 -0.1408 38  LYS A CD    
367  C CE    . LYS A 38  ? 0.9871 1.3199 1.1654 -0.0516 -0.0632 -0.1331 38  LYS A CE    
368  N NZ    . LYS A 38  ? 0.9776 1.2511 1.1109 -0.0338 -0.0622 -0.1208 38  LYS A NZ    
369  N N     . THR A 39  ? 0.6820 0.9161 0.7473 0.0632  -0.0489 -0.0877 39  THR A N     
370  C CA    . THR A 39  ? 0.6952 0.8740 0.7207 0.0716  -0.0488 -0.0744 39  THR A CA    
371  C C     . THR A 39  ? 0.5481 0.7054 0.5585 0.0846  -0.0416 -0.0672 39  THR A C     
372  O O     . THR A 39  ? 0.5242 0.6370 0.5050 0.0863  -0.0394 -0.0559 39  THR A O     
373  C CB    . THR A 39  ? 0.7275 0.8937 0.7301 0.0903  -0.0660 -0.0749 39  THR A CB    
374  O OG1   . THR A 39  ? 0.7602 0.9436 0.7644 0.1169  -0.0764 -0.0801 39  THR A OG1   
375  C CG2   . THR A 39  ? 0.7052 0.8940 0.7200 0.0806  -0.0760 -0.0855 39  THR A CG2   
379  N N     . SER A 40  ? 0.5007 0.6913 0.5315 0.0939  -0.0383 -0.0753 40  SER A N     
380  C CA    . SER A 40  ? 0.5474 0.7176 0.5636 0.1056  -0.0315 -0.0718 40  SER A CA    
381  C C     . SER A 40  ? 0.5160 0.6584 0.5215 0.0840  -0.0169 -0.0611 40  SER A C     
382  O O     . SER A 40  ? 0.4425 0.6035 0.4656 0.0627  -0.0065 -0.0602 40  SER A O     
383  C CB    . SER A 40  ? 0.5864 0.8056 0.6291 0.1178  -0.0275 -0.0846 40  SER A CB    
384  O OG    . SER A 40  ? 0.6132 0.8772 0.6886 0.0940  -0.0163 -0.0883 40  SER A OG    
385  N N     . GLY A 41  ? 0.4922 0.5886 0.4680 0.0887  -0.0171 -0.0523 41  GLY A N     
386  C CA    . GLY A 41  ? 0.5386 0.6127 0.5047 0.0708  -0.0057 -0.0433 41  GLY A CA    
387  C C     . GLY A 41  ? 0.5665 0.5937 0.5026 0.0714  -0.0093 -0.0333 41  GLY A C     
388  O O     . GLY A 41  ? 0.5619 0.5683 0.4810 0.0844  -0.0196 -0.0314 41  GLY A O     
389  N N     . ALA A 42  ? 0.5497 0.5615 0.4790 0.0564  -0.0008 -0.0261 42  ALA A N     
390  C CA    . ALA A 42  ? 0.4754 0.4503 0.3811 0.0524  -0.0024 -0.0170 42  ALA A CA    
391  C C     . ALA A 42  ? 0.4550 0.4298 0.3627 0.0359  0.0032  -0.0100 42  ALA A C     
392  O O     . ALA A 42  ? 0.4892 0.4823 0.4120 0.0271  0.0093  -0.0113 42  ALA A O     
393  C CB    . ALA A 42  ? 0.5109 0.4674 0.4046 0.0544  -0.0002 -0.0181 42  ALA A CB    
394  N N     . VAL A 43  ? 0.4604 0.4139 0.3518 0.0320  0.0012  -0.0023 43  VAL A N     
395  C CA    . VAL A 43  ? 0.4622 0.4181 0.3549 0.0204  0.0061  0.0028  43  VAL A CA    
396  C C     . VAL A 43  ? 0.5054 0.4582 0.3984 0.0123  0.0119  0.0053  43  VAL A C     
397  O O     . VAL A 43  ? 0.4903 0.4283 0.3731 0.0125  0.0106  0.0061  43  VAL A O     
398  C CB    . VAL A 43  ? 0.4737 0.4160 0.3495 0.0191  0.0039  0.0100  43  VAL A CB    
399  C CG1   . VAL A 43  ? 0.4569 0.4055 0.3347 0.0093  0.0102  0.0139  43  VAL A CG1   
400  C CG2   . VAL A 43  ? 0.4777 0.4259 0.3503 0.0282  -0.0028 0.0070  43  VAL A CG2   
407  N N     . ALA A 44  ? 0.4254 0.3893 0.3277 0.0060  0.0169  0.0062  44  ALA A N     
408  C CA    . ALA A 44  ? 0.5101 0.4727 0.4100 0.0003  0.0204  0.0092  44  ALA A CA    
409  C C     . ALA A 44  ? 0.4828 0.4436 0.3783 -0.0048 0.0205  0.0144  44  ALA A C     
410  O O     . ALA A 44  ? 0.5523 0.5091 0.4420 -0.0100 0.0199  0.0165  44  ALA A O     
411  C CB    . ALA A 44  ? 0.4476 0.4208 0.3560 -0.0023 0.0253  0.0094  44  ALA A CB    
412  N N     . THR A 45  ? 0.4270 0.3936 0.3261 -0.0034 0.0211  0.0148  45  THR A N     
413  C CA    . THR A 45  ? 0.4154 0.3881 0.3120 -0.0056 0.0226  0.0181  45  THR A CA    
414  C C     . THR A 45  ? 0.5880 0.5643 0.4830 -0.0004 0.0223  0.0156  45  THR A C     
415  O O     . THR A 45  ? 0.6169 0.5913 0.5162 0.0035  0.0201  0.0104  45  THR A O     
416  C CB    . THR A 45  ? 0.5001 0.4820 0.4024 -0.0060 0.0242  0.0193  45  THR A CB    
417  O OG1   . THR A 45  ? 0.6386 0.6350 0.5423 -0.0062 0.0258  0.0208  45  THR A OG1   
418  C CG2   . THR A 45  ? 0.5183 0.4967 0.4253 -0.0014 0.0244  0.0175  45  THR A CG2   
422  N N     . ALA A 46  ? 0.4470 0.4303 0.3352 -0.0018 0.0246  0.0187  46  ALA A N     
423  C CA    . ALA A 46  ? 0.4690 0.4592 0.3520 0.0044  0.0252  0.0154  46  ALA A CA    
424  C C     . ALA A 46  ? 0.5382 0.5477 0.4247 0.0061  0.0304  0.0153  46  ALA A C     
425  O O     . ALA A 46  ? 0.3609 0.3820 0.2519 -0.0011 0.0336  0.0205  46  ALA A O     
426  C CB    . ALA A 46  ? 0.4871 0.4716 0.3535 0.0035  0.0244  0.0200  46  ALA A CB    
427  N N     . ASN A 47  ? 0.4717 0.4872 0.3564 0.0163  0.0304  0.0079  47  ASN A N     
428  C CA    . ASN A 47  ? 0.4264 0.4646 0.3146 0.0223  0.0354  0.0059  47  ASN A CA    
429  C C     . ASN A 47  ? 0.4265 0.4827 0.3046 0.0170  0.0422  0.0111  47  ASN A C     
430  O O     . ASN A 47  ? 0.4774 0.5204 0.3429 0.0100  0.0413  0.0170  47  ASN A O     
431  C CB    . ASN A 47  ? 0.3433 0.3775 0.2312 0.0376  0.0324  -0.0056 47  ASN A CB    
432  C CG    . ASN A 47  ? 0.5794 0.6067 0.4537 0.0433  0.0300  -0.0137 47  ASN A CG    
433  O OD1   . ASN A 47  ? 0.5433 0.5718 0.4069 0.0378  0.0308  -0.0095 47  ASN A OD1   
434  N ND2   . ASN A 47  ? 0.4703 0.4877 0.3424 0.0559  0.0258  -0.0261 47  ASN A ND2   
435  N N     . TYR A 48  ? 0.4624 0.5497 0.3451 0.0202  0.0492  0.0099  48  TYR A N     
436  C CA    . TYR A 48  ? 0.5082 0.6179 0.3829 0.0097  0.0586  0.0180  48  TYR A CA    
437  C C     . TYR A 48  ? 0.5675 0.6736 0.4191 0.0155  0.0608  0.0169  48  TYR A C     
438  O O     . TYR A 48  ? 0.5447 0.6518 0.3804 0.0041  0.0663  0.0281  48  TYR A O     
439  C CB    . TYR A 48  ? 0.5699 0.7244 0.4603 0.0115  0.0666  0.0159  48  TYR A CB    
440  C CG    . TYR A 48  ? 0.7323 0.8951 0.6407 -0.0024 0.0649  0.0215  48  TYR A CG    
441  C CD1   . TYR A 48  ? 0.9415 1.1129 0.8500 -0.0258 0.0703  0.0328  48  TYR A CD1   
442  C CD2   . TYR A 48  ? 0.7670 0.9246 0.6891 0.0067  0.0568  0.0160  48  TYR A CD2   
443  C CE1   . TYR A 48  ? 1.0709 1.2483 0.9948 -0.0397 0.0667  0.0354  48  TYR A CE1   
444  C CE2   . TYR A 48  ? 0.9223 1.0883 0.8579 -0.0050 0.0536  0.0197  48  TYR A CE2   
445  C CZ    . TYR A 48  ? 1.0503 1.2272 0.9878 -0.0282 0.0581  0.0280  48  TYR A CZ    
446  O OH    . TYR A 48  ? 1.0467 1.2315 0.9971 -0.0408 0.0531  0.0291  48  TYR A OH    
447  N N     . GLU A 49  ? 0.5013 0.5999 0.3484 0.0327  0.0555  0.0036  49  GLU A N     
448  C CA    . GLU A 49  ? 0.4792 0.5727 0.3027 0.0397  0.0544  -0.0003 49  GLU A CA    
449  C C     . GLU A 49  ? 0.5449 0.6099 0.3566 0.0307  0.0474  0.0088  49  GLU A C     
450  O O     . GLU A 49  ? 0.6731 0.7376 0.4616 0.0284  0.0497  0.0165  49  GLU A O     
451  C CB    . GLU A 49  ? 0.4081 0.4926 0.2301 0.0579  0.0467  -0.0190 49  GLU A CB    
452  C CG    . GLU A 49  ? 0.5081 0.6189 0.3340 0.0734  0.0528  -0.0304 49  GLU A CG    
453  C CD    . GLU A 49  ? 0.8812 0.9972 0.7315 0.0759  0.0525  -0.0307 49  GLU A CD    
454  O OE1   . GLU A 49  ? 0.6777 0.7758 0.5406 0.0643  0.0481  -0.0222 49  GLU A OE1   
455  O OE2   . GLU A 49  ? 0.8978 1.0376 0.7529 0.0919  0.0564  -0.0403 49  GLU A OE2   
456  N N     . ALA A 50  ? 0.5041 0.5467 0.3298 0.0269  0.0393  0.0086  50  ALA A N     
457  C CA    . ALA A 50  ? 0.5244 0.5433 0.3417 0.0224  0.0319  0.0150  50  ALA A CA    
458  C C     . ALA A 50  ? 0.6023 0.6147 0.4103 0.0089  0.0369  0.0313  50  ALA A C     
459  O O     . ALA A 50  ? 0.6352 0.6293 0.4235 0.0082  0.0328  0.0393  50  ALA A O     
460  C CB    . ALA A 50  ? 0.4271 0.4305 0.2629 0.0223  0.0241  0.0094  50  ALA A CB    
461  N N     . ARG A 51  ? 0.5857 0.6115 0.4068 -0.0017 0.0444  0.0361  51  ARG A N     
462  C CA    . ARG A 51  ? 0.6495 0.6664 0.4619 -0.0185 0.0487  0.0507  51  ARG A CA    
463  C C     . ARG A 51  ? 0.6808 0.7054 0.4675 -0.0231 0.0567  0.0613  51  ARG A C     
464  O O     . ARG A 51  ? 0.6809 0.6818 0.4483 -0.0343 0.0567  0.0754  51  ARG A O     
465  C CB    . ARG A 51  ? 0.5929 0.6277 0.4266 -0.0310 0.0538  0.0518  51  ARG A CB    
466  C CG    . ARG A 51  ? 0.6039 0.6283 0.4562 -0.0271 0.0461  0.0440  51  ARG A CG    
467  C CD    . ARG A 51  ? 0.5053 0.5480 0.3760 -0.0379 0.0485  0.0443  51  ARG A CD    
468  N NE    . ARG A 51  ? 0.5707 0.6073 0.4548 -0.0299 0.0418  0.0365  51  ARG A NE    
469  C CZ    . ARG A 51  ? 0.6366 0.6861 0.5349 -0.0348 0.0404  0.0349  51  ARG A CZ    
470  N NH1   . ARG A 51  ? 0.5365 0.6089 0.4419 -0.0490 0.0444  0.0387  51  ARG A NH1   
471  N NH2   . ARG A 51  ? 0.7013 0.7428 0.6061 -0.0265 0.0349  0.0297  51  ARG A NH2   
472  N N     . LYS A 52  ? 0.6251 0.6793 0.4083 -0.0134 0.0631  0.0547  52  LYS A N     
473  C CA    . LYS A 52  ? 0.5844 0.6518 0.3404 -0.0171 0.0728  0.0646  52  LYS A CA    
474  C C     . LYS A 52  ? 0.6855 0.7191 0.4092 -0.0114 0.0642  0.0722  52  LYS A C     
475  O O     . LYS A 52  ? 0.7363 0.7645 0.4304 -0.0193 0.0704  0.0879  52  LYS A O     
476  C CB    . LYS A 52  ? 0.6672 0.7730 0.4231 -0.0022 0.0800  0.0517  52  LYS A CB    
477  C CG    . LYS A 52  ? 0.7358 0.8829 0.5193 -0.0034 0.0897  0.0449  52  LYS A CG    
478  C CD    . LYS A 52  ? 0.8275 1.0190 0.5997 0.0026  0.1041  0.0424  52  LYS A CD    
479  C CE    . LYS A 52  ? 0.8668 1.0980 0.6647 0.0183  0.1080  0.0249  52  LYS A CE    
480  N NZ    . LYS A 52  ? 0.9254 1.1422 0.7184 0.0451  0.0974  0.0042  52  LYS A NZ    
481  N N     . LEU A 53  ? 0.6408 0.6536 0.3701 0.0023  0.0496  0.0614  53  LEU A N     
482  C CA    . LEU A 53  ? 0.6019 0.5876 0.3061 0.0121  0.0378  0.0649  53  LEU A CA    
483  C C     . LEU A 53  ? 0.6944 0.6424 0.3957 0.0064  0.0298  0.0754  53  LEU A C     
484  O O     . LEU A 53  ? 0.7523 0.6776 0.4353 0.0179  0.0179  0.0776  53  LEU A O     
485  C CB    . LEU A 53  ? 0.5056 0.4967 0.2205 0.0299  0.0257  0.0449  53  LEU A CB    
486  C CG    . LEU A 53  ? 0.6285 0.6494 0.3463 0.0381  0.0311  0.0303  53  LEU A CG    
487  C CD1   . LEU A 53  ? 0.6104 0.6302 0.3428 0.0507  0.0182  0.0093  53  LEU A CD1   
488  C CD2   . LEU A 53  ? 0.6386 0.6725 0.3204 0.0419  0.0379  0.0370  53  LEU A CD2   
489  N N     . GLY A 54  ? 0.7318 0.6740 0.4510 -0.0088 0.0347  0.0798  54  GLY A N     
490  C CA    . GLY A 54  ? 0.6945 0.5985 0.4092 -0.0131 0.0271  0.0871  54  GLY A CA    
491  C C     . GLY A 54  ? 0.6780 0.5785 0.4209 -0.0064 0.0191  0.0734  54  GLY A C     
492  O O     . GLY A 54  ? 0.6571 0.5285 0.3978 -0.0083 0.0133  0.0765  54  GLY A O     
493  N N     . VAL A 55  ? 0.6122 0.5394 0.3790 0.0014  0.0188  0.0585  55  VAL A N     
494  C CA    . VAL A 55  ? 0.6947 0.6202 0.4859 0.0053  0.0133  0.0478  55  VAL A CA    
495  C C     . VAL A 55  ? 0.6781 0.5994 0.4815 -0.0087 0.0183  0.0509  55  VAL A C     
496  O O     . VAL A 55  ? 0.6459 0.5846 0.4552 -0.0200 0.0269  0.0540  55  VAL A O     
497  C CB    . VAL A 55  ? 0.6938 0.6432 0.5051 0.0127  0.0127  0.0337  55  VAL A CB    
498  C CG1   . VAL A 55  ? 0.6789 0.6266 0.5118 0.0151  0.0083  0.0254  55  VAL A CG1   
499  C CG2   . VAL A 55  ? 0.5269 0.4816 0.3254 0.0246  0.0064  0.0285  55  VAL A CG2   
506  N N     . LYS A 56  ? 0.6505 0.5516 0.4570 -0.0067 0.0123  0.0485  56  LYS A N     
507  C CA    . LYS A 56  ? 0.6670 0.5581 0.4792 -0.0191 0.0141  0.0500  56  LYS A CA    
508  C C     . LYS A 56  ? 0.7151 0.6087 0.5441 -0.0119 0.0104  0.0388  56  LYS A C     
509  O O     . LYS A 56  ? 0.7755 0.6662 0.6064 0.0019  0.0049  0.0326  56  LYS A O     
510  C CB    . LYS A 56  ? 0.7615 0.6139 0.5494 -0.0256 0.0103  0.0601  56  LYS A CB    
511  C CG    . LYS A 56  ? 0.9097 0.7603 0.6899 -0.0479 0.0177  0.0716  56  LYS A CG    
512  C CD    . LYS A 56  ? 0.9580 0.7604 0.7091 -0.0557 0.0130  0.0836  56  LYS A CD    
513  C CE    . LYS A 56  ? 1.0748 0.8782 0.8163 -0.0823 0.0224  0.0982  56  LYS A CE    
514  N NZ    . LYS A 56  ? 1.0833 0.8311 0.7895 -0.0926 0.0184  0.1140  56  LYS A NZ    
515  N N     . ALA A 57  ? 0.6371 0.5398 0.4783 -0.0209 0.0135  0.0361  57  ALA A N     
516  C CA    . ALA A 57  ? 0.6037 0.5082 0.4553 -0.0142 0.0112  0.0270  57  ALA A CA    
517  C C     . ALA A 57  ? 0.6298 0.5051 0.4680 -0.0072 0.0045  0.0243  57  ALA A C     
518  O O     . ALA A 57  ? 0.6892 0.5358 0.5101 -0.0136 0.0012  0.0298  57  ALA A O     
519  C CB    . ALA A 57  ? 0.4608 0.3784 0.3222 -0.0235 0.0140  0.0250  57  ALA A CB    
520  N N     . GLY A 58  ? 0.6252 0.5076 0.4711 0.0061  0.0025  0.0156  58  GLY A N     
521  C CA    . GLY A 58  ? 0.5362 0.3963 0.3715 0.0183  -0.0040 0.0098  58  GLY A CA    
522  C C     . GLY A 58  ? 0.6336 0.4843 0.4604 0.0334  -0.0108 0.0108  58  GLY A C     
523  O O     . GLY A 58  ? 0.6103 0.4491 0.4317 0.0499  -0.0172 0.0037  58  GLY A O     
524  N N     . MET A 59  ? 0.6104 0.4678 0.4346 0.0306  -0.0103 0.0183  59  MET A N     
525  C CA    . MET A 59  ? 0.6126 0.4581 0.4229 0.0457  -0.0190 0.0206  59  MET A CA    
526  C C     . MET A 59  ? 0.6064 0.4856 0.4376 0.0602  -0.0219 0.0092  59  MET A C     
527  O O     . MET A 59  ? 0.6122 0.5221 0.4659 0.0532  -0.0154 0.0037  59  MET A O     
528  C CB    . MET A 59  ? 0.6802 0.5191 0.4740 0.0373  -0.0175 0.0332  59  MET A CB    
529  C CG    . MET A 59  ? 0.7864 0.6530 0.5866 0.0435  -0.0186 0.0307  59  MET A CG    
530  S SD    . MET A 59  ? 0.8174 0.6783 0.5930 0.0338  -0.0142 0.0450  59  MET A SD    
531  C CE    . MET A 59  ? 0.8681 0.6784 0.6051 0.0361  -0.0207 0.0607  59  MET A CE    
532  N N     . PRO A 60  ? 0.6201 0.4932 0.4443 0.0804  -0.0324 0.0053  60  PRO A N     
533  C CA    . PRO A 60  ? 0.5833 0.4959 0.4313 0.0931  -0.0361 -0.0068 60  PRO A CA    
534  C C     . PRO A 60  ? 0.6484 0.5850 0.5052 0.0851  -0.0355 -0.0062 60  PRO A C     
535  O O     . PRO A 60  ? 0.6226 0.5420 0.4587 0.0813  -0.0370 0.0033  60  PRO A O     
536  C CB    . PRO A 60  ? 0.6327 0.5300 0.4657 0.1185  -0.0499 -0.0091 60  PRO A CB    
537  C CG    . PRO A 60  ? 0.6278 0.4738 0.4334 0.1193  -0.0511 -0.0022 60  PRO A CG    
538  C CD    . PRO A 60  ? 0.6565 0.4859 0.4516 0.0933  -0.0420 0.0108  60  PRO A CD    
539  N N     . ILE A 61  ? 0.5269 0.5017 0.4126 0.0815  -0.0328 -0.0165 61  ILE A N     
540  C CA    . ILE A 61  ? 0.4919 0.4850 0.3865 0.0717  -0.0324 -0.0187 61  ILE A CA    
541  C C     . ILE A 61  ? 0.5841 0.5784 0.4645 0.0841  -0.0451 -0.0194 61  ILE A C     
542  O O     . ILE A 61  ? 0.5491 0.5382 0.4172 0.0777  -0.0446 -0.0159 61  ILE A O     
543  C CB    . ILE A 61  ? 0.5112 0.5405 0.4389 0.0632  -0.0282 -0.0295 61  ILE A CB    
544  C CG1   . ILE A 61  ? 0.6163 0.6408 0.5508 0.0497  -0.0151 -0.0257 61  ILE A CG1   
545  C CG2   . ILE A 61  ? 0.4016 0.4434 0.3368 0.0535  -0.0307 -0.0342 61  ILE A CG2   
546  C CD1   . ILE A 61  ? 0.5802 0.6349 0.5423 0.0387  -0.0086 -0.0324 61  ILE A CD1   
552  N N     . ILE A 62  ? 0.6301 0.6320 0.5099 0.1040  -0.0568 -0.0244 62  ILE A N     
553  C CA    . ILE A 62  ? 0.8628 0.8661 0.7256 0.1185  -0.0711 -0.0246 62  ILE A CA    
554  C C     . ILE A 62  ? 0.7615 0.7218 0.5827 0.1204  -0.0717 -0.0079 62  ILE A C     
555  O O     . ILE A 62  ? 0.7526 0.7115 0.5534 0.1254  -0.0789 -0.0048 62  ILE A O     
556  C CB    . ILE A 62  ? 1.0613 1.0819 0.9305 0.1438  -0.0856 -0.0331 62  ILE A CB    
557  C CG1   . ILE A 62  ? 1.0997 1.0959 0.9622 0.1550  -0.0832 -0.0298 62  ILE A CG1   
558  C CG2   . ILE A 62  ? 1.3098 1.3871 1.2200 0.1417  -0.0891 -0.0510 62  ILE A CG2   
559  C CD1   . ILE A 62  ? 1.2361 1.2506 1.1056 0.1844  -0.0974 -0.0399 62  ILE A CD1   
565  N N     . LYS A 63  ? 0.5684 0.4944 0.3757 0.1153  -0.0643 0.0027  63  LYS A N     
566  C CA    . LYS A 63  ? 0.7062 0.5925 0.4759 0.1105  -0.0623 0.0202  63  LYS A CA    
567  C C     . LYS A 63  ? 0.7819 0.6813 0.5524 0.0920  -0.0516 0.0230  63  LYS A C     
568  O O     . LYS A 63  ? 0.8245 0.7167 0.5690 0.0921  -0.0527 0.0314  63  LYS A O     
569  C CB    . LYS A 63  ? 0.7050 0.5529 0.4630 0.1042  -0.0568 0.0290  63  LYS A CB    
570  C CG    . LYS A 63  ? 0.9118 0.7115 0.6277 0.1027  -0.0591 0.0479  63  LYS A CG    
571  C CD    . LYS A 63  ? 1.0933 0.8485 0.7933 0.1141  -0.0665 0.0504  63  LYS A CD    
572  C CE    . LYS A 63  ? 1.1771 0.9005 0.8708 0.0912  -0.0564 0.0580  63  LYS A CE    
573  N NZ    . LYS A 63  ? 1.1922 0.8848 0.8547 0.0718  -0.0507 0.0786  63  LYS A NZ    
574  N N     . ALA A 64  ? 0.7144 0.6335 0.5131 0.0780  -0.0415 0.0155  64  ALA A N     
575  C CA    . ALA A 64  ? 0.7114 0.6410 0.5119 0.0636  -0.0318 0.0167  64  ALA A CA    
576  C C     . ALA A 64  ? 0.6387 0.5887 0.4365 0.0705  -0.0389 0.0082  64  ALA A C     
577  O O     . ALA A 64  ? 0.7025 0.6538 0.4845 0.0666  -0.0345 0.0114  64  ALA A O     
578  C CB    . ALA A 64  ? 0.4095 0.3531 0.2385 0.0512  -0.0224 0.0102  64  ALA A CB    
579  N N     . MET A 65  ? 0.5827 0.5519 0.3964 0.0809  -0.0501 -0.0041 65  MET A N     
580  C CA    . MET A 65  ? 0.5819 0.5727 0.3960 0.0858  -0.0593 -0.0157 65  MET A CA    
581  C C     . MET A 65  ? 0.5821 0.5633 0.3595 0.1006  -0.0697 -0.0090 65  MET A C     
582  O O     . MET A 65  ? 0.7241 0.7177 0.4910 0.1030  -0.0746 -0.0161 65  MET A O     
583  C CB    . MET A 65  ? 0.5984 0.6194 0.4463 0.0882  -0.0679 -0.0321 65  MET A CB    
584  C CG    . MET A 65  ? 0.5681 0.5975 0.4478 0.0716  -0.0564 -0.0365 65  MET A CG    
585  S SD    . MET A 65  ? 0.6946 0.7644 0.6156 0.0672  -0.0629 -0.0544 65  MET A SD    
586  C CE    . MET A 65  ? 0.5666 0.6496 0.4897 0.0891  -0.0728 -0.0546 65  MET A CE    
587  N N     . GLN A 66  ? 0.6036 0.5589 0.3576 0.1109  -0.0733 0.0050  66  GLN A N     
588  C CA    . GLN A 66  ? 0.6745 0.6127 0.3855 0.1233  -0.0812 0.0165  66  GLN A CA    
589  C C     . GLN A 66  ? 0.7283 0.6535 0.4129 0.1095  -0.0668 0.0296  66  GLN A C     
590  O O     . GLN A 66  ? 0.8850 0.8116 0.5387 0.1159  -0.0703 0.0336  66  GLN A O     
591  C CB    . GLN A 66  ? 0.6631 0.5675 0.3508 0.1384  -0.0897 0.0300  66  GLN A CB    
592  C CG    . GLN A 66  ? 0.8752 0.7918 0.5912 0.1533  -0.1004 0.0179  66  GLN A CG    
593  C CD    . GLN A 66  ? 0.9625 0.9270 0.7058 0.1638  -0.1137 -0.0028 66  GLN A CD    
594  O OE1   . GLN A 66  ? 0.8851 0.8807 0.6594 0.1490  -0.1079 -0.0165 66  GLN A OE1   
595  N NE2   . GLN A 66  ? 1.1536 1.1234 0.8856 0.1894  -0.1327 -0.0053 66  GLN A NE2   
596  N N     . ILE A 67  ? 0.6727 0.5902 0.3692 0.0914  -0.0508 0.0356  67  ILE A N     
597  C CA    . ILE A 67  ? 0.6687 0.5811 0.3423 0.0789  -0.0368 0.0482  67  ILE A CA    
598  C C     . ILE A 67  ? 0.7303 0.6729 0.4219 0.0719  -0.0281 0.0348  67  ILE A C     
599  O O     . ILE A 67  ? 0.8352 0.7858 0.5072 0.0678  -0.0185 0.0399  67  ILE A O     
600  C CB    . ILE A 67  ? 0.6769 0.5646 0.3483 0.0625  -0.0248 0.0641  67  ILE A CB    
601  C CG1   . ILE A 67  ? 0.6267 0.5208 0.3373 0.0549  -0.0214 0.0540  67  ILE A CG1   
602  C CG2   . ILE A 67  ? 0.7118 0.5583 0.3517 0.0685  -0.0324 0.0808  67  ILE A CG2   
603  C CD1   . ILE A 67  ? 0.6233 0.4951 0.3322 0.0389  -0.0123 0.0664  67  ILE A CD1   
609  N N     . ALA A 68  ? 0.6783 0.6368 0.4054 0.0713  -0.0313 0.0178  68  ALA A N     
610  C CA    . ALA A 68  ? 0.6229 0.6010 0.3671 0.0660  -0.0250 0.0044  68  ALA A CA    
611  C C     . ALA A 68  ? 0.5876 0.5798 0.3546 0.0708  -0.0371 -0.0155 68  ALA A C     
612  O O     . ALA A 68  ? 0.6606 0.6570 0.4565 0.0629  -0.0343 -0.0237 68  ALA A O     
613  C CB    . ALA A 68  ? 0.6126 0.5892 0.3786 0.0525  -0.0120 0.0084  68  ALA A CB    
614  N N     . PRO A 69  ? 0.6624 0.6622 0.4150 0.0827  -0.0509 -0.0229 69  PRO A N     
615  C CA    . PRO A 69  ? 0.5785 0.5957 0.3521 0.0861  -0.0655 -0.0423 69  PRO A CA    
616  C C     . PRO A 69  ? 0.5833 0.6073 0.3705 0.0786  -0.0638 -0.0593 69  PRO A C     
617  O O     . PRO A 69  ? 0.6489 0.6839 0.4600 0.0742  -0.0733 -0.0750 69  PRO A O     
618  C CB    . PRO A 69  ? 0.6311 0.6546 0.3748 0.1023  -0.0804 -0.0441 69  PRO A CB    
619  C CG    . PRO A 69  ? 0.5947 0.5987 0.2998 0.1069  -0.0725 -0.0223 69  PRO A CG    
620  C CD    . PRO A 69  ? 0.7229 0.7179 0.4336 0.0924  -0.0527 -0.0131 69  PRO A CD    
621  N N     . SER A 70  ? 0.5438 0.5616 0.3161 0.0773  -0.0523 -0.0570 70  SER A N     
622  C CA    . SER A 70  ? 0.5694 0.5876 0.3505 0.0745  -0.0526 -0.0747 70  SER A CA    
623  C C     . SER A 70  ? 0.5847 0.5924 0.3866 0.0647  -0.0400 -0.0710 70  SER A C     
624  O O     . SER A 70  ? 0.6252 0.6258 0.4334 0.0635  -0.0402 -0.0841 70  SER A O     
625  C CB    . SER A 70  ? 0.7111 0.7341 0.4586 0.0860  -0.0518 -0.0813 70  SER A CB    
626  O OG    . SER A 70  ? 0.8409 0.8735 0.5699 0.0956  -0.0676 -0.0898 70  SER A OG    
627  N N     . ALA A 71  ? 0.4803 0.4845 0.2907 0.0588  -0.0307 -0.0539 71  ALA A N     
628  C CA    . ALA A 71  ? 0.6167 0.6132 0.4469 0.0502  -0.0211 -0.0499 71  ALA A CA    
629  C C     . ALA A 71  ? 0.5701 0.5614 0.4254 0.0418  -0.0278 -0.0607 71  ALA A C     
630  O O     . ALA A 71  ? 0.6021 0.6014 0.4653 0.0403  -0.0385 -0.0684 71  ALA A O     
631  C CB    . ALA A 71  ? 0.5017 0.4958 0.3358 0.0446  -0.0128 -0.0319 71  ALA A CB    
632  N N     . ILE A 72  ? 0.5708 0.5501 0.4378 0.0362  -0.0218 -0.0608 72  ILE A N     
633  C CA    . ILE A 72  ? 0.5440 0.5143 0.4335 0.0239  -0.0242 -0.0646 72  ILE A CA    
634  C C     . ILE A 72  ? 0.5629 0.5390 0.4668 0.0166  -0.0178 -0.0511 72  ILE A C     
635  O O     . ILE A 72  ? 0.5210 0.4946 0.4209 0.0182  -0.0092 -0.0395 72  ILE A O     
636  C CB    . ILE A 72  ? 0.6156 0.5636 0.5048 0.0234  -0.0214 -0.0686 72  ILE A CB    
637  C CG1   . ILE A 72  ? 0.8220 0.7613 0.6955 0.0328  -0.0290 -0.0861 72  ILE A CG1   
638  C CG2   . ILE A 72  ? 0.5425 0.4762 0.4505 0.0079  -0.0219 -0.0677 72  ILE A CG2   
639  C CD1   . ILE A 72  ? 0.9959 0.9278 0.8551 0.0472  -0.0227 -0.0869 72  ILE A CD1   
645  N N     . TYR A 73  ? 0.5538 0.5415 0.4746 0.0093  -0.0224 -0.0542 73  TYR A N     
646  C CA    . TYR A 73  ? 0.5644 0.5596 0.4982 0.0042  -0.0159 -0.0443 73  TYR A CA    
647  C C     . TYR A 73  ? 0.6028 0.5934 0.5543 -0.0107 -0.0113 -0.0438 73  TYR A C     
648  O O     . TYR A 73  ? 0.7117 0.7093 0.6781 -0.0211 -0.0162 -0.0527 73  TYR A O     
649  C CB    . TYR A 73  ? 0.3974 0.4141 0.3371 0.0099  -0.0224 -0.0466 73  TYR A CB    
650  C CG    . TYR A 73  ? 0.5333 0.5462 0.4493 0.0240  -0.0254 -0.0414 73  TYR A CG    
651  C CD1   . TYR A 73  ? 0.3721 0.3868 0.2724 0.0317  -0.0340 -0.0485 73  TYR A CD1   
652  C CD2   . TYR A 73  ? 0.3499 0.3547 0.2562 0.0282  -0.0196 -0.0292 73  TYR A CD2   
653  C CE1   . TYR A 73  ? 0.5440 0.5535 0.4183 0.0428  -0.0353 -0.0407 73  TYR A CE1   
654  C CE2   . TYR A 73  ? 0.5539 0.5497 0.4360 0.0372  -0.0216 -0.0220 73  TYR A CE2   
655  C CZ    . TYR A 73  ? 0.5541 0.5528 0.4196 0.0444  -0.0287 -0.0264 73  TYR A CZ    
656  O OH    . TYR A 73  ? 0.6228 0.6115 0.4600 0.0520  -0.0293 -0.0165 73  TYR A OH    
657  N N     . VAL A 74  ? 0.5633 0.5423 0.5121 -0.0130 -0.0021 -0.0328 74  VAL A N     
658  C CA    . VAL A 74  ? 0.4562 0.4277 0.4157 -0.0271 0.0034  -0.0288 74  VAL A CA    
659  C C     . VAL A 74  ? 0.5443 0.5294 0.5094 -0.0292 0.0117  -0.0195 74  VAL A C     
660  O O     . VAL A 74  ? 0.5264 0.5123 0.4815 -0.0196 0.0143  -0.0138 74  VAL A O     
661  C CB    . VAL A 74  ? 0.3877 0.3288 0.3348 -0.0266 0.0054  -0.0243 74  VAL A CB    
662  C CG1   . VAL A 74  ? 0.4676 0.3920 0.4084 -0.0238 -0.0031 -0.0365 74  VAL A CG1   
663  C CG2   . VAL A 74  ? 0.3961 0.3354 0.3302 -0.0144 0.0096  -0.0160 74  VAL A CG2   
670  N N     . PRO A 75  ? 0.5892 0.5860 0.5696 -0.0428 0.0163  -0.0188 75  PRO A N     
671  C CA    . PRO A 75  ? 0.5787 0.5908 0.5631 -0.0452 0.0258  -0.0115 75  PRO A CA    
672  C C     . PRO A 75  ? 0.6150 0.6050 0.5819 -0.0437 0.0320  0.0007  75  PRO A C     
673  O O     . PRO A 75  ? 0.5033 0.4667 0.4603 -0.0462 0.0309  0.0051  75  PRO A O     
674  C CB    . PRO A 75  ? 0.5374 0.5665 0.5415 -0.0640 0.0303  -0.0132 75  PRO A CB    
675  C CG    . PRO A 75  ? 0.5870 0.5876 0.5885 -0.0749 0.0248  -0.0154 75  PRO A CG    
676  C CD    . PRO A 75  ? 0.5766 0.5685 0.5688 -0.0595 0.0138  -0.0244 75  PRO A CD    
677  N N     . MET A 76  ? 0.6408 0.6413 0.6025 -0.0375 0.0371  0.0048  76  MET A N     
678  C CA    . MET A 76  ? 0.6451 0.6301 0.5904 -0.0353 0.0409  0.0147  76  MET A CA    
679  C C     . MET A 76  ? 0.6153 0.5914 0.5575 -0.0483 0.0482  0.0242  76  MET A C     
680  O O     . MET A 76  ? 0.5336 0.5270 0.4873 -0.0603 0.0550  0.0244  76  MET A O     
681  C CB    . MET A 76  ? 0.7383 0.7352 0.6774 -0.0268 0.0431  0.0144  76  MET A CB    
682  C CG    . MET A 76  ? 0.8341 0.8178 0.7562 -0.0233 0.0437  0.0220  76  MET A CG    
683  S SD    . MET A 76  ? 0.6855 0.6777 0.5995 -0.0147 0.0429  0.0177  76  MET A SD    
684  C CE    . MET A 76  ? 0.6259 0.6408 0.5446 -0.0168 0.0521  0.0147  76  MET A CE    
685  N N     . ARG A 77  ? 0.5989 0.5488 0.5250 -0.0458 0.0467  0.0327  77  ARG A N     
686  C CA    . ARG A 77  ? 0.6312 0.5641 0.5462 -0.0561 0.0526  0.0454  77  ARG A CA    
687  C C     . ARG A 77  ? 0.5885 0.5170 0.4832 -0.0460 0.0535  0.0543  77  ARG A C     
688  O O     . ARG A 77  ? 0.6103 0.5145 0.4901 -0.0387 0.0484  0.0611  77  ARG A O     
689  C CB    . ARG A 77  ? 0.5524 0.4504 0.4635 -0.0610 0.0472  0.0472  77  ARG A CB    
690  C CG    . ARG A 77  ? 0.5392 0.4438 0.4700 -0.0725 0.0447  0.0362  77  ARG A CG    
691  C CD    . ARG A 77  ? 0.5435 0.4083 0.4684 -0.0815 0.0397  0.0372  77  ARG A CD    
692  N NE    . ARG A 77  ? 0.6297 0.4706 0.5432 -0.0630 0.0296  0.0313  77  ARG A NE    
693  C CZ    . ARG A 77  ? 0.6374 0.4356 0.5386 -0.0627 0.0234  0.0316  77  ARG A CZ    
694  N NH1   . ARG A 77  ? 0.6169 0.3872 0.5145 -0.0830 0.0260  0.0395  77  ARG A NH1   
695  N NH2   . ARG A 77  ? 0.6619 0.4445 0.5533 -0.0422 0.0150  0.0243  77  ARG A NH2   
696  N N     . LYS A 78  ? 0.5344 0.4877 0.4284 -0.0433 0.0583  0.0522  78  LYS A N     
697  C CA    . LYS A 78  ? 0.6441 0.5976 0.5196 -0.0336 0.0568  0.0568  78  LYS A CA    
698  C C     . LYS A 78  ? 0.5978 0.5303 0.4506 -0.0349 0.0585  0.0723  78  LYS A C     
699  O O     . LYS A 78  ? 0.6515 0.5767 0.4903 -0.0234 0.0514  0.0755  78  LYS A O     
700  C CB    . LYS A 78  ? 0.6541 0.6336 0.5290 -0.0316 0.0623  0.0507  78  LYS A CB    
701  C CG    . LYS A 78  ? 0.7152 0.6961 0.5756 -0.0207 0.0562  0.0483  78  LYS A CG    
702  C CD    . LYS A 78  ? 0.8185 0.8169 0.6825 -0.0158 0.0567  0.0357  78  LYS A CD    
703  C CE    . LYS A 78  ? 0.9196 0.9165 0.7683 -0.0086 0.0496  0.0319  78  LYS A CE    
704  N NZ    . LYS A 78  ? 1.0217 1.0312 0.8627 -0.0041 0.0530  0.0219  78  LYS A NZ    
705  N N     . PRO A 79  ? 0.5546 0.4778 0.4030 -0.0493 0.0672  0.0827  79  PRO A N     
706  C CA    . PRO A 79  ? 0.6321 0.5283 0.4523 -0.0490 0.0676  0.1003  79  PRO A CA    
707  C C     . PRO A 79  ? 0.7368 0.5987 0.5489 -0.0372 0.0552  0.1033  79  PRO A C     
708  O O     . PRO A 79  ? 0.7213 0.5700 0.5107 -0.0250 0.0495  0.1126  79  PRO A O     
709  C CB    . PRO A 79  ? 0.5715 0.4603 0.3906 -0.0713 0.0800  0.1115  79  PRO A CB    
710  C CG    . PRO A 79  ? 0.5569 0.4881 0.4018 -0.0799 0.0888  0.0988  79  PRO A CG    
711  C CD    . PRO A 79  ? 0.5942 0.5365 0.4594 -0.0662 0.0780  0.0805  79  PRO A CD    
712  N N     . ILE A 80  ? 0.7234 0.5739 0.5528 -0.0381 0.0501  0.0942  80  ILE A N     
713  C CA    . ILE A 80  ? 0.6270 0.4476 0.4489 -0.0234 0.0386  0.0941  80  ILE A CA    
714  C C     . ILE A 80  ? 0.6139 0.4567 0.4382 -0.0034 0.0305  0.0864  80  ILE A C     
715  O O     . ILE A 80  ? 0.7091 0.5381 0.5206 0.0132  0.0218  0.0904  80  ILE A O     
716  C CB    . ILE A 80  ? 0.6908 0.4961 0.5286 -0.0276 0.0348  0.0830  80  ILE A CB    
717  C CG1   . ILE A 80  ? 0.6311 0.4254 0.4757 -0.0526 0.0425  0.0862  80  ILE A CG1   
718  C CG2   . ILE A 80  ? 0.8060 0.5747 0.6304 -0.0101 0.0237  0.0834  80  ILE A CG2   
719  C CD1   . ILE A 80  ? 0.6696 0.4357 0.5225 -0.0577 0.0357  0.0764  80  ILE A CD1   
725  N N     . TYR A 81  ? 0.5838 0.4612 0.4247 -0.0049 0.0327  0.0753  81  TYR A N     
726  C CA    . TYR A 81  ? 0.6570 0.5561 0.5025 0.0085  0.0257  0.0679  81  TYR A CA    
727  C C     . TYR A 81  ? 0.6243 0.5309 0.4522 0.0146  0.0232  0.0755  81  TYR A C     
728  O O     . TYR A 81  ? 0.6972 0.6130 0.5226 0.0280  0.0145  0.0742  81  TYR A O     
729  C CB    . TYR A 81  ? 0.5724 0.4979 0.4360 0.0035  0.0279  0.0557  81  TYR A CB    
730  C CG    . TYR A 81  ? 0.5345 0.4563 0.4125 -0.0041 0.0309  0.0489  81  TYR A CG    
731  C CD1   . TYR A 81  ? 0.6134 0.5523 0.5021 -0.0114 0.0350  0.0423  81  TYR A CD1   
732  C CD2   . TYR A 81  ? 0.6304 0.5313 0.5098 -0.0021 0.0278  0.0475  81  TYR A CD2   
733  C CE1   . TYR A 81  ? 0.5713 0.5109 0.4731 -0.0166 0.0356  0.0353  81  TYR A CE1   
734  C CE2   . TYR A 81  ? 0.5706 0.4703 0.4624 -0.0095 0.0286  0.0393  81  TYR A CE2   
735  C CZ    . TYR A 81  ? 0.5660 0.4874 0.4694 -0.0167 0.0322  0.0337  81  TYR A CZ    
736  O OH    . TYR A 81  ? 0.6469 0.5712 0.5620 -0.0220 0.0311  0.0254  81  TYR A OH    
737  N N     . GLU A 82  ? 0.6273 0.5337 0.4427 0.0051  0.0309  0.0827  82  GLU A N     
738  C CA    . GLU A 82  ? 0.7051 0.6174 0.4979 0.0108  0.0289  0.0902  82  GLU A CA    
739  C C     . GLU A 82  ? 0.7090 0.5954 0.4802 0.0233  0.0210  0.1035  82  GLU A C     
740  O O     . GLU A 82  ? 0.6492 0.5457 0.4085 0.0372  0.0113  0.1048  82  GLU A O     
741  C CB    . GLU A 82  ? 0.7510 0.6689 0.5325 -0.0016 0.0412  0.0955  82  GLU A CB    
742  C CG    . GLU A 82  ? 0.8602 0.8074 0.6405 0.0000  0.0417  0.0846  82  GLU A CG    
743  C CD    . GLU A 82  ? 0.8690 0.8317 0.6548 -0.0107 0.0549  0.0798  82  GLU A CD    
744  O OE1   . GLU A 82  ? 0.8989 0.8557 0.6827 -0.0218 0.0660  0.0895  82  GLU A OE1   
745  O OE2   . GLU A 82  ? 0.7707 0.7523 0.5634 -0.0080 0.0539  0.0658  82  GLU A OE2   
746  N N     . ALA A 83  ? 0.7012 0.5526 0.4670 0.0192  0.0234  0.1126  83  ALA A N     
747  C CA    . ALA A 83  ? 0.6719 0.4884 0.4141 0.0334  0.0147  0.1258  83  ALA A CA    
748  C C     . ALA A 83  ? 0.7440 0.5717 0.4971 0.0559  0.0009  0.1156  83  ALA A C     
749  O O     . ALA A 83  ? 0.7784 0.6120 0.5170 0.0741  -0.0097 0.1199  83  ALA A O     
750  C CB    . ALA A 83  ? 0.6333 0.4047 0.3693 0.0225  0.0190  0.1348  83  ALA A CB    
751  N N     . PHE A 84  ? 0.6838 0.5184 0.4624 0.0551  0.0011  0.1017  84  PHE A N     
752  C CA    . PHE A 84  ? 0.6430 0.4976 0.4364 0.0742  -0.0085 0.0901  84  PHE A CA    
753  C C     . PHE A 84  ? 0.6769 0.5741 0.4749 0.0820  -0.0147 0.0859  84  PHE A C     
754  O O     . PHE A 84  ? 0.7204 0.6305 0.5177 0.1026  -0.0258 0.0843  84  PHE A O     
755  C CB    . PHE A 84  ? 0.6821 0.5514 0.5019 0.0667  -0.0036 0.0752  84  PHE A CB    
756  C CG    . PHE A 84  ? 0.6725 0.5099 0.4919 0.0745  -0.0063 0.0713  84  PHE A CG    
757  C CD1   . PHE A 84  ? 0.6862 0.4830 0.4968 0.0607  -0.0019 0.0767  84  PHE A CD1   
758  C CD2   . PHE A 84  ? 0.6208 0.4710 0.4492 0.0951  -0.0132 0.0606  84  PHE A CD2   
759  C CE1   . PHE A 84  ? 0.7094 0.4722 0.5178 0.0671  -0.0063 0.0706  84  PHE A CE1   
760  C CE2   . PHE A 84  ? 0.6637 0.4824 0.4888 0.1047  -0.0164 0.0542  84  PHE A CE2   
761  C CZ    . PHE A 84  ? 0.6734 0.4451 0.4873 0.0906  -0.0139 0.0587  84  PHE A CZ    
762  N N     . SER A 85  ? 0.6001 0.5204 0.4037 0.0661  -0.0084 0.0824  85  SER A N     
763  C CA    . SER A 85  ? 0.5953 0.5531 0.4032 0.0691  -0.0149 0.0761  85  SER A CA    
764  C C     . SER A 85  ? 0.6892 0.6425 0.4695 0.0817  -0.0237 0.0870  85  SER A C     
765  O O     . SER A 85  ? 0.6661 0.6456 0.4491 0.0965  -0.0362 0.0830  85  SER A O     
766  C CB    . SER A 85  ? 0.5522 0.5259 0.3679 0.0504  -0.0071 0.0688  85  SER A CB    
767  O OG    . SER A 85  ? 0.5842 0.5851 0.3968 0.0518  -0.0148 0.0635  85  SER A OG    
768  N N     . ASN A 86  ? 0.6614 0.5850 0.4150 0.0759  -0.0175 0.1010  86  ASN A N     
769  C CA    . ASN A 86  ? 0.6655 0.5803 0.3861 0.0887  -0.0256 0.1141  86  ASN A CA    
770  C C     . ASN A 86  ? 0.7428 0.6480 0.4594 0.1139  -0.0399 0.1178  86  ASN A C     
771  O O     . ASN A 86  ? 0.8171 0.7465 0.5277 0.1310  -0.0538 0.1162  86  ASN A O     
772  C CB    . ASN A 86  ? 0.6901 0.5685 0.3796 0.0781  -0.0148 0.1326  86  ASN A CB    
773  C CG    . ASN A 86  ? 0.8337 0.7301 0.5250 0.0577  -0.0008 0.1279  86  ASN A CG    
774  O OD1   . ASN A 86  ? 0.8363 0.7666 0.5449 0.0544  -0.0023 0.1117  86  ASN A OD1   
775  N ND2   . ASN A 86  ? 0.7964 0.6698 0.4698 0.0438  0.0129  0.1418  86  ASN A ND2   
776  N N     . ARG A 87  ? 0.7129 0.5852 0.4341 0.1180  -0.0379 0.1204  87  ARG A N     
777  C CA    . ARG A 87  ? 0.7448 0.6033 0.4595 0.1463  -0.0520 0.1226  87  ARG A CA    
778  C C     . ARG A 87  ? 0.8015 0.7170 0.5452 0.1617  -0.0626 0.1053  87  ARG A C     
779  O O     . ARG A 87  ? 0.8475 0.7761 0.5833 0.1873  -0.0779 0.1067  87  ARG A O     
780  C CB    . ARG A 87  ? 0.7760 0.5900 0.4930 0.1477  -0.0485 0.1231  87  ARG A CB    
781  C CG    . ARG A 87  ? 0.7638 0.5138 0.4474 0.1379  -0.0431 0.1431  87  ARG A CG    
782  C CD    . ARG A 87  ? 0.7663 0.4662 0.4455 0.1500  -0.0481 0.1425  87  ARG A CD    
783  N NE    . ARG A 87  ? 0.9246 0.6443 0.6385 0.1438  -0.0429 0.1222  87  ARG A NE    
784  C CZ    . ARG A 87  ? 0.8541 0.5619 0.5797 0.1175  -0.0308 0.1185  87  ARG A CZ    
785  N NH1   . ARG A 87  ? 0.7442 0.4242 0.4537 0.0934  -0.0212 0.1333  87  ARG A NH1   
786  N NH2   . ARG A 87  ? 0.8269 0.5543 0.5801 0.1157  -0.0282 0.1000  87  ARG A NH2   
787  N N     . ILE A 88  ? 0.7842 0.7354 0.5612 0.1458  -0.0549 0.0897  88  ILE A N     
788  C CA    . ILE A 88  ? 0.7010 0.7080 0.5075 0.1554  -0.0624 0.0744  88  ILE A CA    
789  C C     . ILE A 88  ? 0.7175 0.7638 0.5216 0.1547  -0.0721 0.0723  88  ILE A C     
790  O O     . ILE A 88  ? 0.7889 0.8723 0.6020 0.1738  -0.0861 0.0667  88  ILE A O     
791  C CB    . ILE A 88  ? 0.6209 0.6503 0.4587 0.1368  -0.0509 0.0612  88  ILE A CB    
792  C CG1   . ILE A 88  ? 0.6395 0.6350 0.4785 0.1424  -0.0449 0.0604  88  ILE A CG1   
793  C CG2   . ILE A 88  ? 0.5708 0.6623 0.4391 0.1407  -0.0565 0.0473  88  ILE A CG2   
794  C CD1   . ILE A 88  ? 0.5393 0.5463 0.4004 0.1225  -0.0325 0.0505  88  ILE A CD1   
800  N N     . MET A 89  ? 0.5543 0.5947 0.3460 0.1342  -0.0659 0.0750  89  MET A N     
801  C CA    . MET A 89  ? 0.6221 0.6946 0.4065 0.1338  -0.0763 0.0712  89  MET A CA    
802  C C     . MET A 89  ? 0.7598 0.8265 0.5166 0.1613  -0.0923 0.0820  89  MET A C     
803  O O     . MET A 89  ? 0.7800 0.8887 0.5422 0.1721  -0.1076 0.0746  89  MET A O     
804  C CB    . MET A 89  ? 0.6264 0.6852 0.3939 0.1123  -0.0668 0.0727  89  MET A CB    
805  C CG    . MET A 89  ? 0.6687 0.7280 0.4597 0.0892  -0.0528 0.0631  89  MET A CG    
806  S SD    . MET A 89  ? 0.6109 0.7218 0.4424 0.0809  -0.0586 0.0442  89  MET A SD    
807  C CE    . MET A 89  ? 0.7056 0.7998 0.5505 0.0555  -0.0420 0.0384  89  MET A CE    
808  N N     . ASN A 90  ? 0.8333 0.8473 0.5602 0.1725  -0.0899 0.0997  90  ASN A N     
809  C CA    . ASN A 90  ? 0.9134 0.9118 0.6095 0.2020  -0.1060 0.1127  90  ASN A CA    
810  C C     . ASN A 90  ? 0.9059 0.9392 0.6263 0.2301  -0.1215 0.1021  90  ASN A C     
811  O O     . ASN A 90  ? 0.9862 1.0430 0.6958 0.2541  -0.1400 0.1031  90  ASN A O     
812  C CB    . ASN A 90  ? 1.0924 1.0189 0.7527 0.2058  -0.0994 0.1345  90  ASN A CB    
813  C CG    . ASN A 90  ? 1.2291 1.1280 0.8570 0.1843  -0.0870 0.1491  90  ASN A CG    
814  O OD1   . ASN A 90  ? 1.2411 1.1669 0.8555 0.1805  -0.0904 0.1477  90  ASN A OD1   
815  N ND2   . ASN A 90  ? 1.3021 1.1499 0.9175 0.1697  -0.0725 0.1619  90  ASN A ND2   
816  N N     . LEU A 91  ? 0.7803 0.8209 0.5328 0.2291  -0.1144 0.0912  91  LEU A N     
817  C CA    . LEU A 91  ? 0.7139 0.7926 0.4908 0.2577  -0.1268 0.0798  91  LEU A CA    
818  C C     . LEU A 91  ? 0.6743 0.8334 0.4845 0.2532  -0.1352 0.0631  91  LEU A C     
819  O O     . LEU A 91  ? 0.6226 0.8249 0.4440 0.2803  -0.1521 0.0567  91  LEU A O     
820  C CB    . LEU A 91  ? 0.7547 0.8250 0.5557 0.2570  -0.1155 0.0709  91  LEU A CB    
821  C CG    . LEU A 91  ? 0.8114 0.8038 0.5839 0.2640  -0.1104 0.0834  91  LEU A CG    
822  C CD1   . LEU A 91  ? 0.6909 0.6823 0.4886 0.2595  -0.0992 0.0705  91  LEU A CD1   
823  C CD2   . LEU A 91  ? 0.7540 0.7168 0.4977 0.3035  -0.1286 0.0932  91  LEU A CD2   
824  N N     . LEU A 92  ? 0.5667 0.7459 0.3938 0.2189  -0.1240 0.0554  92  LEU A N     
825  C CA    . LEU A 92  ? 0.7125 0.9619 0.5709 0.2074  -0.1312 0.0393  92  LEU A CA    
826  C C     . LEU A 92  ? 0.7353 1.0016 0.5711 0.2198  -0.1506 0.0419  92  LEU A C     
827  O O     . LEU A 92  ? 0.7295 1.0577 0.5874 0.2300  -0.1664 0.0300  92  LEU A O     
828  C CB    . LEU A 92  ? 0.6055 0.8576 0.4790 0.1683  -0.1160 0.0321  92  LEU A CB    
829  C CG    . LEU A 92  ? 0.5816 0.8233 0.4770 0.1559  -0.0984 0.0289  92  LEU A CG    
830  C CD1   . LEU A 92  ? 0.5617 0.8030 0.4677 0.1202  -0.0861 0.0231  92  LEU A CD1   
831  C CD2   . LEU A 92  ? 0.5059 0.8018 0.4365 0.1701  -0.1019 0.0178  92  LEU A CD2   
832  N N     . ASN A 93  ? 0.7935 1.0070 0.5848 0.2187  -0.1489 0.0574  93  ASN A N     
833  C CA    . ASN A 93  ? 0.8777 1.0950 0.6351 0.2321  -0.1657 0.0636  93  ASN A CA    
834  C C     . ASN A 93  ? 0.8883 1.1468 0.6562 0.2639  -0.1872 0.0585  93  ASN A C     
835  O O     . ASN A 93  ? 0.8833 1.1934 0.6676 0.2595  -0.1994 0.0447  93  ASN A O     
836  C CB    . ASN A 93  ? 1.0685 1.2132 0.7732 0.2372  -0.1587 0.0874  93  ASN A CB    
837  C CG    . ASN A 93  ? 1.2708 1.4112 0.9389 0.2295  -0.1627 0.0924  93  ASN A CG    
838  O OD1   . ASN A 93  ? 1.3382 1.5219 1.0185 0.2156  -0.1686 0.0763  93  ASN A OD1   
839  N ND2   . ASN A 93  ? 1.3863 1.4710 1.0125 0.2339  -0.1571 0.1132  93  ASN A ND2   
840  N N     . LYS A 94  ? 0.9091 1.1401 0.6739 0.2904  -0.1881 0.0663  94  LYS A N     
841  C CA    . LYS A 94  ? 0.8945 1.1483 0.6664 0.3196  -0.2037 0.0619  94  LYS A CA    
842  C C     . LYS A 94  ? 0.8675 1.2088 0.6938 0.3200  -0.2109 0.0382  94  LYS A C     
843  O O     . LYS A 94  ? 0.7829 1.1578 0.6204 0.3417  -0.2243 0.0310  94  LYS A O     
844  C CB    . LYS A 94  ? 0.9334 1.1334 0.6898 0.3473  -0.2020 0.0729  94  LYS A CB    
845  C CG    . LYS A 94  ? 1.0445 1.1616 0.7650 0.3375  -0.1875 0.0926  94  LYS A CG    
846  C CD    . LYS A 94  ? 1.2184 1.2961 0.8952 0.3207  -0.1846 0.1100  94  LYS A CD    
847  C CE    . LYS A 94  ? 1.3034 1.2991 0.9453 0.3114  -0.1699 0.1311  94  LYS A CE    
848  N NZ    . LYS A 94  ? 1.3698 1.3129 0.9896 0.3363  -0.1766 0.1430  94  LYS A NZ    
849  N N     . HIS A 95  ? 0.9083 1.2871 0.7682 0.2946  -0.2014 0.0266  95  HIS A N     
850  C CA    . HIS A 95  ? 0.8993 1.3619 0.8138 0.2876  -0.2041 0.0053  95  HIS A CA    
851  C C     . HIS A 95  ? 0.9292 1.4386 0.8595 0.2567  -0.2102 -0.0072 95  HIS A C     
852  O O     . HIS A 95  ? 1.0422 1.6208 1.0173 0.2434  -0.2124 -0.0244 95  HIS A O     
853  C CB    . HIS A 95  ? 0.7647 1.2418 0.7099 0.2788  -0.1885 0.0001  95  HIS A CB    
854  C CG    . HIS A 95  ? 0.7852 1.2216 0.7198 0.3096  -0.1834 0.0070  95  HIS A CG    
855  N ND1   . HIS A 95  ? 0.8139 1.2734 0.7618 0.3404  -0.1900 -0.0006 95  HIS A ND1   
856  C CD2   . HIS A 95  ? 0.8193 1.1895 0.7294 0.3137  -0.1727 0.0195  95  HIS A CD2   
857  C CE1   . HIS A 95  ? 0.8920 1.2993 0.8230 0.3624  -0.1841 0.0057  95  HIS A CE1   
858  N NE2   . HIS A 95  ? 0.8987 1.2510 0.8076 0.3460  -0.1739 0.0181  95  HIS A NE2   
859  N N     . ALA A 96  ? 0.8358 1.3048 0.7275 0.2442  -0.2122 0.0010  96  ALA A N     
860  C CA    . ALA A 96  ? 0.7688 1.2673 0.6694 0.2119  -0.2161 -0.0120 96  ALA A CA    
861  C C     . ALA A 96  ? 0.7959 1.2888 0.6667 0.2169  -0.2314 -0.0123 96  ALA A C     
862  O O     . ALA A 96  ? 0.7576 1.1964 0.5814 0.2332  -0.2320 0.0044  96  ALA A O     
863  C CB    . ALA A 96  ? 0.7254 1.1823 0.6104 0.1844  -0.2000 -0.0074 96  ALA A CB    
864  N N     . ASP A 97  ? 0.7766 1.3257 0.6752 0.2007  -0.2429 -0.0312 97  ASP A N     
865  C CA    . ASP A 97  ? 0.8386 1.3859 0.7110 0.1972  -0.2571 -0.0359 97  ASP A CA    
866  C C     . ASP A 97  ? 0.8504 1.3450 0.6827 0.1785  -0.2483 -0.0306 97  ASP A C     
867  O O     . ASP A 97  ? 0.8823 1.3371 0.6679 0.1899  -0.2507 -0.0194 97  ASP A O     
868  C CB    . ASP A 97  ? 0.8433 1.4577 0.7567 0.1755  -0.2694 -0.0595 97  ASP A CB    
869  C CG    . ASP A 97  ? 0.9106 1.5852 0.8661 0.1929  -0.2765 -0.0665 97  ASP A CG    
870  O OD1   . ASP A 97  ? 0.8883 1.5488 0.8297 0.2291  -0.2789 -0.0542 97  ASP A OD1   
871  O OD2   . ASP A 97  ? 0.9683 1.7022 0.9700 0.1695  -0.2790 -0.0843 97  ASP A OD2   
872  N N     . LYS A 98  ? 0.8063 1.3027 0.6571 0.1492  -0.2371 -0.0390 98  LYS A N     
873  C CA    . LYS A 98  ? 0.7772 1.2242 0.5937 0.1324  -0.2254 -0.0353 98  LYS A CA    
874  C C     . LYS A 98  ? 0.7646 1.1905 0.5991 0.1186  -0.2045 -0.0298 98  LYS A C     
875  O O     . LYS A 98  ? 0.6926 1.1532 0.5726 0.1067  -0.2004 -0.0376 98  LYS A O     
876  C CB    . LYS A 98  ? 0.7587 1.2180 0.5756 0.1039  -0.2330 -0.0562 98  LYS A CB    
877  C CG    . LYS A 98  ? 0.9020 1.3933 0.7193 0.1096  -0.2534 -0.0673 98  LYS A CG    
878  C CD    . LYS A 98  ? 1.0068 1.4801 0.7980 0.0900  -0.2586 -0.0819 98  LYS A CD    
879  C CE    . LYS A 98  ? 1.1191 1.5408 0.8508 0.1076  -0.2525 -0.0670 98  LYS A CE    
880  N NZ    . LYS A 98  ? 1.1902 1.6216 0.9002 0.1332  -0.2670 -0.0595 98  LYS A NZ    
881  N N     . ILE A 99  ? 0.6961 1.0594 0.4982 0.1170  -0.1867 -0.0158 99  ILE A N     
882  C CA    . ILE A 99  ? 0.6663 0.9971 0.4851 0.1001  -0.1634 -0.0111 99  ILE A CA    
883  C C     . ILE A 99  ? 0.7476 1.0390 0.5450 0.0783  -0.1515 -0.0148 99  ILE A C     
884  O O     . ILE A 99  ? 0.7653 1.0302 0.5215 0.0861  -0.1516 -0.0089 99  ILE A O     
885  C CB    . ILE A 99  ? 0.7059 0.9990 0.5125 0.1217  -0.1518 0.0098  99  ILE A CB    
886  C CG1   . ILE A 99  ? 0.6611 0.9247 0.4859 0.1035  -0.1294 0.0124  99  ILE A CG1   
887  C CG2   . ILE A 99  ? 0.6468 0.8956 0.4018 0.1368  -0.1508 0.0267  99  ILE A CG2   
888  C CD1   . ILE A 99  ? 0.7031 0.9270 0.5168 0.1207  -0.1187 0.0299  99  ILE A CD1   
894  N N     . GLU A 100 ? 0.7164 1.0052 0.5404 0.0521  -0.1413 -0.0247 100 GLU A N     
895  C CA    . GLU A 100 ? 0.6284 0.8779 0.4357 0.0343  -0.1296 -0.0293 100 GLU A CA    
896  C C     . GLU A 100 ? 0.6319 0.8476 0.4484 0.0303  -0.1085 -0.0178 100 GLU A C     
897  O O     . GLU A 100 ? 0.5976 0.8218 0.4454 0.0166  -0.1024 -0.0209 100 GLU A O     
898  C CB    . GLU A 100 ? 0.6340 0.8993 0.4590 0.0077  -0.1375 -0.0504 100 GLU A CB    
899  C CG    . GLU A 100 ? 0.6416 0.8641 0.4484 -0.0076 -0.1283 -0.0581 100 GLU A CG    
900  C CD    . GLU A 100 ? 0.7369 0.9676 0.5586 -0.0343 -0.1388 -0.0791 100 GLU A CD    
901  O OE1   . GLU A 100 ? 0.8115 1.0047 0.6275 -0.0488 -0.1307 -0.0853 100 GLU A OE1   
902  O OE2   . GLU A 100 ? 0.7262 1.0004 0.5653 -0.0410 -0.1561 -0.0897 100 GLU A OE2   
903  N N     . VAL A 101 ? 0.6702 0.8501 0.4591 0.0416  -0.0973 -0.0041 101 VAL A N     
904  C CA    . VAL A 101 ? 0.5746 0.7240 0.3715 0.0369  -0.0787 0.0050  101 VAL A CA    
905  C C     . VAL A 101 ? 0.5970 0.7282 0.3956 0.0175  -0.0709 -0.0062 101 VAL A C     
906  O O     . VAL A 101 ? 0.6210 0.7356 0.3938 0.0175  -0.0685 -0.0100 101 VAL A O     
907  C CB    . VAL A 101 ? 0.6186 0.7377 0.3881 0.0514  -0.0695 0.0229  101 VAL A CB    
908  C CG1   . VAL A 101 ? 0.6145 0.7051 0.3942 0.0437  -0.0516 0.0293  101 VAL A CG1   
909  C CG2   . VAL A 101 ? 0.5933 0.7217 0.3591 0.0728  -0.0791 0.0344  101 VAL A CG2   
916  N N     . ALA A 102 ? 0.6114 0.7459 0.4387 0.0026  -0.0670 -0.0113 102 ALA A N     
917  C CA    . ALA A 102 ? 0.5820 0.6972 0.4106 -0.0152 -0.0634 -0.0225 102 ALA A CA    
918  C C     . ALA A 102 ? 0.6360 0.7176 0.4582 -0.0137 -0.0474 -0.0159 102 ALA A C     
919  O O     . ALA A 102 ? 0.6380 0.6979 0.4498 -0.0198 -0.0446 -0.0244 102 ALA A O     
920  C CB    . ALA A 102 ? 0.4778 0.6100 0.3359 -0.0343 -0.0670 -0.0294 102 ALA A CB    
921  N N     . SER A 103 ? 0.6395 0.7171 0.4679 -0.0046 -0.0384 -0.0022 103 SER A N     
922  C CA    . SER A 103 ? 0.5899 0.6418 0.4173 -0.0046 -0.0244 0.0033  103 SER A CA    
923  C C     . SER A 103 ? 0.6033 0.6523 0.4350 0.0054  -0.0182 0.0172  103 SER A C     
924  O O     . SER A 103 ? 0.5982 0.6607 0.4298 0.0153  -0.0248 0.0228  103 SER A O     
925  C CB    . SER A 103 ? 0.6098 0.6521 0.4540 -0.0179 -0.0212 -0.0025 103 SER A CB    
926  O OG    . SER A 103 ? 0.6504 0.7051 0.5158 -0.0197 -0.0193 0.0033  103 SER A OG    
927  N N     . ILE A 104 ? 0.5879 0.6185 0.4234 0.0040  -0.0071 0.0217  104 ILE A N     
928  C CA    . ILE A 104 ? 0.5793 0.6003 0.4142 0.0120  -0.0020 0.0336  104 ILE A CA    
929  C C     . ILE A 104 ? 0.5847 0.6176 0.4373 0.0168  -0.0067 0.0346  104 ILE A C     
930  O O     . ILE A 104 ? 0.6068 0.6328 0.4562 0.0279  -0.0076 0.0427  104 ILE A O     
931  C CB    . ILE A 104 ? 0.5708 0.5738 0.4083 0.0073  0.0097  0.0361  104 ILE A CB    
932  C CG1   . ILE A 104 ? 0.4918 0.4793 0.3241 0.0121  0.0143  0.0484  104 ILE A CG1   
933  C CG2   . ILE A 104 ? 0.5619 0.5644 0.4184 0.0005  0.0116  0.0293  104 ILE A CG2   
934  C CD1   . ILE A 104 ? 0.4745 0.4504 0.3115 0.0046  0.0250  0.0496  104 ILE A CD1   
940  N N     . ASP A 105 ? 0.5150 0.5660 0.3847 0.0091  -0.0099 0.0264  105 ASP A N     
941  C CA    . ASP A 105 ? 0.4885 0.5571 0.3764 0.0139  -0.0112 0.0266  105 ASP A CA    
942  C C     . ASP A 105 ? 0.4886 0.5942 0.3911 0.0099  -0.0199 0.0197  105 ASP A C     
943  O O     . ASP A 105 ? 0.5507 0.6799 0.4721 0.0101  -0.0189 0.0177  105 ASP A O     
944  C CB    . ASP A 105 ? 0.4748 0.5320 0.3728 0.0069  -0.0021 0.0258  105 ASP A CB    
945  C CG    . ASP A 105 ? 0.4895 0.5646 0.4019 -0.0067 -0.0018 0.0201  105 ASP A CG    
946  O OD1   . ASP A 105 ? 0.4692 0.5480 0.3802 -0.0188 -0.0058 0.0153  105 ASP A OD1   
947  O OD2   . ASP A 105 ? 0.5242 0.6081 0.4473 -0.0058 0.0028  0.0206  105 ASP A OD2   
948  N N     . GLU A 106 ? 0.5605 0.6755 0.4548 0.0063  -0.0284 0.0152  106 GLU A N     
949  C CA    . GLU A 106 ? 0.5527 0.7076 0.4636 0.0007  -0.0383 0.0075  106 GLU A CA    
950  C C     . GLU A 106 ? 0.5950 0.7649 0.4931 0.0068  -0.0521 0.0036  106 GLU A C     
951  O O     . GLU A 106 ? 0.6427 0.7895 0.5162 0.0081  -0.0530 0.0040  106 GLU A O     
952  C CB    . GLU A 106 ? 0.6614 0.8177 0.5843 -0.0237 -0.0354 0.0004  106 GLU A CB    
953  C CG    . GLU A 106 ? 0.7558 0.8773 0.6594 -0.0339 -0.0346 -0.0039 106 GLU A CG    
954  C CD    . GLU A 106 ? 0.9520 1.0615 0.8630 -0.0555 -0.0312 -0.0081 106 GLU A CD    
955  O OE1   . GLU A 106 ? 0.9985 1.1337 0.9298 -0.0675 -0.0307 -0.0081 106 GLU A OE1   
956  O OE2   . GLU A 106 ? 1.0755 1.1497 0.9709 -0.0598 -0.0288 -0.0107 106 GLU A OE2   
957  N N     . ALA A 107 ? 0.4740 0.6878 0.3894 0.0112  -0.0631 -0.0013 107 ALA A N     
958  C CA    . ALA A 107 ? 0.4555 0.6907 0.3607 0.0186  -0.0789 -0.0062 107 ALA A CA    
959  C C     . ALA A 107 ? 0.5100 0.8019 0.4454 0.0093  -0.0903 -0.0178 107 ALA A C     
960  O O     . ALA A 107 ? 0.5164 0.8366 0.4806 0.0049  -0.0849 -0.0186 107 ALA A O     
961  C CB    . ALA A 107 ? 0.5924 0.8200 0.4783 0.0475  -0.0835 0.0052  107 ALA A CB    
962  N N     . TYR A 108 ? 0.6149 0.9263 0.5434 0.0054  -0.1058 -0.0276 108 TYR A N     
963  C CA    . TYR A 108 ? 0.5896 0.9629 0.5469 -0.0013 -0.1206 -0.0397 108 TYR A CA    
964  C C     . TYR A 108 ? 0.6329 1.0331 0.5796 0.0284  -0.1372 -0.0380 108 TYR A C     
965  O O     . TYR A 108 ? 0.6669 1.0366 0.5765 0.0434  -0.1421 -0.0324 108 TYR A O     
966  C CB    . TYR A 108 ? 0.5443 0.9226 0.5036 -0.0309 -0.1295 -0.0554 108 TYR A CB    
967  C CG    . TYR A 108 ? 0.6681 1.0066 0.6281 -0.0587 -0.1157 -0.0564 108 TYR A CG    
968  C CD1   . TYR A 108 ? 0.7377 1.0163 0.6670 -0.0546 -0.1052 -0.0504 108 TYR A CD1   
969  C CD2   . TYR A 108 ? 0.6728 1.0343 0.6632 -0.0887 -0.1135 -0.0627 108 TYR A CD2   
970  C CE1   . TYR A 108 ? 0.7121 0.9532 0.6399 -0.0751 -0.0947 -0.0512 108 TYR A CE1   
971  C CE2   . TYR A 108 ? 0.7063 1.0236 0.6913 -0.1121 -0.1022 -0.0614 108 TYR A CE2   
972  C CZ    . TYR A 108 ? 0.6773 0.9338 0.6304 -0.1028 -0.0939 -0.0561 108 TYR A CZ    
973  O OH    . TYR A 108 ? 0.7303 0.9415 0.6757 -0.1205 -0.0845 -0.0548 108 TYR A OH    
974  N N     . LEU A 109 ? 0.6453 1.1052 0.6240 0.0377  -0.1457 -0.0427 109 LEU A N     
975  C CA    . LEU A 109 ? 0.5723 1.0653 0.5451 0.0691  -0.1643 -0.0423 109 LEU A CA    
976  C C     . LEU A 109 ? 0.6055 1.1711 0.6112 0.0554  -0.1818 -0.0604 109 LEU A C     
977  O O     . LEU A 109 ? 0.5451 1.1544 0.5927 0.0346  -0.1758 -0.0683 109 LEU A O     
978  C CB    . LEU A 109 ? 0.5772 1.0788 0.5598 0.1003  -0.1600 -0.0325 109 LEU A CB    
979  C CG    . LEU A 109 ? 0.5819 1.0150 0.5347 0.1167  -0.1453 -0.0150 109 LEU A CG    
980  C CD1   . LEU A 109 ? 0.5056 0.8984 0.4596 0.0889  -0.1240 -0.0126 109 LEU A CD1   
981  C CD2   . LEU A 109 ? 0.5598 1.0076 0.5245 0.1490  -0.1460 -0.0104 109 LEU A CD2   
982  N N     . ASP A 110 ? 0.6142 1.1942 0.6004 0.0647  -0.2030 -0.0671 110 ASP A N     
983  C CA    . ASP A 110 ? 0.5342 1.1822 0.5518 0.0567  -0.2210 -0.0841 110 ASP A CA    
984  C C     . ASP A 110 ? 0.5912 1.2690 0.6200 0.0951  -0.2263 -0.0781 110 ASP A C     
985  O O     . ASP A 110 ? 0.7959 1.4403 0.7877 0.1272  -0.2328 -0.0664 110 ASP A O     
986  C CB    . ASP A 110 ? 0.5616 1.1917 0.5498 0.0484  -0.2360 -0.0937 110 ASP A CB    
987  C CG    . ASP A 110 ? 0.6658 1.3494 0.6891 0.0269  -0.2494 -0.1130 110 ASP A CG    
988  O OD1   . ASP A 110 ? 0.6271 1.3667 0.6871 0.0371  -0.2531 -0.1159 110 ASP A OD1   
989  O OD2   . ASP A 110 ? 0.7619 1.4296 0.7745 0.0001  -0.2563 -0.1261 110 ASP A OD2   
990  N N     . VAL A 111 ? 0.5402 1.2764 0.6172 0.0920  -0.2220 -0.0851 111 VAL A N     
991  C CA    . VAL A 111 ? 0.5565 1.3211 0.6445 0.1306  -0.2262 -0.0819 111 VAL A CA    
992  C C     . VAL A 111 ? 0.6407 1.4740 0.7632 0.1273  -0.2389 -0.0976 111 VAL A C     
993  O O     . VAL A 111 ? 0.7538 1.6244 0.8943 0.1554  -0.2417 -0.0993 111 VAL A O     
994  C CB    . VAL A 111 ? 0.6665 1.4422 0.7779 0.1408  -0.2085 -0.0766 111 VAL A CB    
995  C CG1   . VAL A 111 ? 0.5802 1.2861 0.6548 0.1509  -0.1985 -0.0601 111 VAL A CG1   
996  C CG2   . VAL A 111 ? 0.5430 1.3722 0.7035 0.1022  -0.1951 -0.0878 111 VAL A CG2   
1003 N N     . THR A 112 ? 0.5921 1.4400 0.7227 0.0930  -0.2468 -0.1100 112 THR A N     
1004 C CA    . THR A 112 ? 0.7011 1.6118 0.8631 0.0840  -0.2606 -0.1260 112 THR A CA    
1005 C C     . THR A 112 ? 0.7254 1.6584 0.8792 0.1279  -0.2765 -0.1250 112 THR A C     
1006 O O     . THR A 112 ? 0.6874 1.6843 0.8785 0.1371  -0.2791 -0.1337 112 THR A O     
1007 C CB    . THR A 112 ? 0.8166 1.7122 0.9660 0.0512  -0.2728 -0.1371 112 THR A CB    
1008 O OG1   . THR A 112 ? 0.9690 1.7936 1.0633 0.0622  -0.2753 -0.1273 112 THR A OG1   
1009 C CG2   . THR A 112 ? 0.7078 1.6076 0.8842 0.0020  -0.2605 -0.1447 112 THR A CG2   
1013 N N     . ASN A 113 ? 0.7768 1.6562 0.8801 0.1548  -0.2863 -0.1138 113 ASN A N     
1014 C CA    . ASN A 113 ? 0.7771 1.6671 0.8649 0.1960  -0.3025 -0.1108 113 ASN A CA    
1015 C C     . ASN A 113 ? 0.7500 1.6331 0.8384 0.2342  -0.2940 -0.0999 113 ASN A C     
1016 O O     . ASN A 113 ? 0.7061 1.6298 0.8096 0.2625  -0.3033 -0.1047 113 ASN A O     
1017 C CB    . ASN A 113 ? 0.7848 1.6162 0.8139 0.2090  -0.3145 -0.1007 113 ASN A CB    
1018 C CG    . ASN A 113 ? 0.8725 1.7213 0.8990 0.1826  -0.3298 -0.1158 113 ASN A CG    
1019 O OD1   . ASN A 113 ? 0.9290 1.8419 0.9955 0.1680  -0.3398 -0.1334 113 ASN A OD1   
1020 N ND2   . ASN A 113 ? 0.8678 1.6592 0.8461 0.1765  -0.3315 -0.1095 113 ASN A ND2   
1021 N N     . LYS A 114 ? 0.7289 1.5595 0.8001 0.2354  -0.2772 -0.0864 114 LYS A N     
1022 C CA    . LYS A 114 ? 0.7883 1.6011 0.8565 0.2696  -0.2682 -0.0767 114 LYS A CA    
1023 C C     . LYS A 114 ? 0.7762 1.6633 0.8965 0.2751  -0.2631 -0.0908 114 LYS A C     
1024 O O     . LYS A 114 ? 0.7899 1.6882 0.9098 0.3131  -0.2685 -0.0910 114 LYS A O     
1025 C CB    . LYS A 114 ? 0.8759 1.6293 0.9256 0.2604  -0.2499 -0.0634 114 LYS A CB    
1026 C CG    . LYS A 114 ? 0.9908 1.6690 0.9935 0.2959  -0.2488 -0.0437 114 LYS A CG    
1027 C CD    . LYS A 114 ? 1.0608 1.6876 1.0115 0.3039  -0.2613 -0.0312 114 LYS A CD    
1028 C CE    . LYS A 114 ? 1.0543 1.5978 0.9563 0.3299  -0.2567 -0.0087 114 LYS A CE    
1029 N NZ    . LYS A 114 ? 1.0257 1.5170 0.8745 0.3320  -0.2643 0.0062  114 LYS A NZ    
1030 N N     . VAL A 115 ? 0.7698 1.7059 0.9325 0.2366  -0.2521 -0.1025 115 VAL A N     
1031 C CA    . VAL A 115 ? 0.7376 1.7461 0.9495 0.2352  -0.2426 -0.1149 115 VAL A CA    
1032 C C     . VAL A 115 ? 0.7061 1.7898 0.9494 0.2325  -0.2577 -0.1311 115 VAL A C     
1033 O O     . VAL A 115 ? 0.6626 1.8164 0.9516 0.2170  -0.2497 -0.1434 115 VAL A O     
1034 C CB    . VAL A 115 ? 0.6221 1.6468 0.8635 0.1917  -0.2213 -0.1175 115 VAL A CB    
1035 C CG1   . VAL A 115 ? 0.6554 1.6071 0.8653 0.1898  -0.2093 -0.1026 115 VAL A CG1   
1036 C CG2   . VAL A 115 ? 0.6245 1.6762 0.8858 0.1434  -0.2257 -0.1272 115 VAL A CG2   
1043 N N     . GLU A 116 ? 0.8053 1.8746 1.0225 0.2471  -0.2791 -0.1305 116 GLU A N     
1044 C CA    . GLU A 116 ? 0.9208 2.0577 1.1635 0.2450  -0.2969 -0.1460 116 GLU A CA    
1045 C C     . GLU A 116 ? 0.8097 2.0027 1.0982 0.1928  -0.2909 -0.1603 116 GLU A C     
1046 O O     . GLU A 116 ? 0.8073 2.0762 1.1355 0.1866  -0.2972 -0.1750 116 GLU A O     
1047 C CB    . GLU A 116 ? 1.0349 2.2213 1.2955 0.2866  -0.3018 -0.1522 116 GLU A CB    
1048 C CG    . GLU A 116 ? 1.1680 2.2992 1.3811 0.3387  -0.3137 -0.1395 116 GLU A CG    
1049 C CD    . GLU A 116 ? 1.3134 2.4920 1.5433 0.3810  -0.3195 -0.1477 116 GLU A CD    
1050 O OE1   . GLU A 116 ? 1.3222 2.5750 1.6004 0.3708  -0.3101 -0.1622 116 GLU A OE1   
1051 O OE2   . GLU A 116 ? 1.3989 2.5397 1.5921 0.4240  -0.3333 -0.1395 116 GLU A OE2   
1052 N N     . GLY A 117 ? 0.6797 1.8328 0.9615 0.1548  -0.2786 -0.1555 117 GLY A N     
1053 C CA    . GLY A 117 ? 0.6566 1.8433 0.9720 0.1019  -0.2744 -0.1668 117 GLY A CA    
1054 C C     . GLY A 117 ? 0.7275 1.9572 1.0853 0.0783  -0.2514 -0.1691 117 GLY A C     
1055 O O     . GLY A 117 ? 0.7696 2.0067 1.1479 0.0304  -0.2424 -0.1731 117 GLY A O     
1056 N N     . ASN A 118 ? 0.7706 2.0241 1.1381 0.1117  -0.2413 -0.1663 118 ASN A N     
1057 C CA    . ASN A 118 ? 0.7250 2.0270 1.1312 0.0926  -0.2190 -0.1693 118 ASN A CA    
1058 C C     . ASN A 118 ? 0.6638 1.9154 1.0576 0.0734  -0.1961 -0.1568 118 ASN A C     
1059 O O     . ASN A 118 ? 0.5798 1.7743 0.9402 0.1019  -0.1928 -0.1455 118 ASN A O     
1060 C CB    . ASN A 118 ? 0.7495 2.0993 1.1698 0.1368  -0.2170 -0.1738 118 ASN A CB    
1061 C CG    . ASN A 118 ? 0.8290 2.2216 1.2808 0.1214  -0.1921 -0.1755 118 ASN A CG    
1062 O OD1   . ASN A 118 ? 0.8747 2.2459 1.3136 0.1474  -0.1787 -0.1692 118 ASN A OD1   
1063 N ND2   . ASN A 118 ? 0.8818 2.3309 1.3724 0.0768  -0.1852 -0.1834 118 ASN A ND2   
1064 N N     . PHE A 119 ? 0.6565 1.9289 1.0768 0.0251  -0.1805 -0.1584 119 PHE A N     
1065 C CA    . PHE A 119 ? 0.6118 1.8344 1.0189 0.0010  -0.1602 -0.1464 119 PHE A CA    
1066 C C     . PHE A 119 ? 0.6394 1.8592 1.0418 0.0326  -0.1429 -0.1392 119 PHE A C     
1067 O O     . PHE A 119 ? 0.6384 1.7975 1.0117 0.0422  -0.1358 -0.1279 119 PHE A O     
1068 C CB    . PHE A 119 ? 0.5595 1.8031 0.9939 -0.0573 -0.1467 -0.1481 119 PHE A CB    
1069 C CG    . PHE A 119 ? 0.6434 1.8191 1.0554 -0.0881 -0.1333 -0.1362 119 PHE A CG    
1070 C CD1   . PHE A 119 ? 0.6920 1.8086 1.0772 -0.1057 -0.1463 -0.1356 119 PHE A CD1   
1071 C CD2   . PHE A 119 ? 0.7038 1.8734 1.1183 -0.0973 -0.1084 -0.1261 119 PHE A CD2   
1072 C CE1   . PHE A 119 ? 0.7073 1.7604 1.0704 -0.1319 -0.1349 -0.1256 119 PHE A CE1   
1073 C CE2   . PHE A 119 ? 0.7104 1.8162 1.1026 -0.1242 -0.0969 -0.1147 119 PHE A CE2   
1074 C CZ    . PHE A 119 ? 0.7062 1.7540 1.0735 -0.1414 -0.1103 -0.1146 119 PHE A CZ    
1075 N N     . GLU A 120 ? 0.6659 1.9515 1.0958 0.0497  -0.1369 -0.1470 120 GLU A N     
1076 C CA    . GLU A 120 ? 0.6569 1.9425 1.0816 0.0809  -0.1211 -0.1434 120 GLU A CA    
1077 C C     . GLU A 120 ? 0.6506 1.8827 1.0384 0.1345  -0.1331 -0.1387 120 GLU A C     
1078 O O     . GLU A 120 ? 0.6392 1.8294 1.0065 0.1531  -0.1215 -0.1309 120 GLU A O     
1079 C CB    . GLU A 120 ? 0.6771 2.0484 1.1377 0.0897  -0.1142 -0.1552 120 GLU A CB    
1080 C CG    . GLU A 120 ? 0.6993 2.1214 1.1946 0.0365  -0.0979 -0.1571 120 GLU A CG    
1081 C CD    . GLU A 120 ? 0.7310 2.1233 1.2173 0.0132  -0.0721 -0.1452 120 GLU A CD    
1082 O OE1   . GLU A 120 ? 0.7228 2.0970 1.2127 -0.0367 -0.0633 -0.1382 120 GLU A OE1   
1083 O OE2   . GLU A 120 ? 0.7689 2.1530 1.2426 0.0454  -0.0612 -0.1433 120 GLU A OE2   
1084 N N     . ASN A 121 ? 0.6014 1.8321 0.9788 0.1583  -0.1564 -0.1428 121 ASN A N     
1085 C CA    . ASN A 121 ? 0.6393 1.8075 0.9752 0.2040  -0.1697 -0.1352 121 ASN A CA    
1086 C C     . ASN A 121 ? 0.6583 1.7449 0.9600 0.1939  -0.1637 -0.1202 121 ASN A C     
1087 O O     . ASN A 121 ? 0.7084 1.7439 0.9830 0.2237  -0.1595 -0.1118 121 ASN A O     
1088 C CB    . ASN A 121 ? 0.7311 1.9029 1.0564 0.2192  -0.1956 -0.1390 121 ASN A CB    
1089 C CG    . ASN A 121 ? 0.7671 1.9974 1.1093 0.2555  -0.2061 -0.1508 121 ASN A CG    
1090 O OD1   . ASN A 121 ? 0.7741 2.0133 1.1176 0.2868  -0.1980 -0.1530 121 ASN A OD1   
1091 N ND2   . ASN A 121 ? 0.6957 1.9658 1.0498 0.2526  -0.2251 -0.1596 121 ASN A ND2   
1092 N N     . GLY A 122 ? 0.5955 1.6691 0.8982 0.1511  -0.1641 -0.1179 122 GLY A N     
1093 C CA    . GLY A 122 ? 0.5702 1.5741 0.8436 0.1367  -0.1585 -0.1054 122 GLY A CA    
1094 C C     . GLY A 122 ? 0.5046 1.4954 0.7822 0.1303  -0.1353 -0.0992 122 GLY A C     
1095 O O     . GLY A 122 ? 0.4142 1.3440 0.6621 0.1430  -0.1318 -0.0881 122 GLY A O     
1096 N N     . ILE A 123 ? 0.5501 1.5972 0.8625 0.1097  -0.1192 -0.1058 123 ILE A N     
1097 C CA    . ILE A 123 ? 0.5579 1.5963 0.8725 0.1038  -0.0961 -0.1003 123 ILE A CA    
1098 C C     . ILE A 123 ? 0.4917 1.5030 0.7855 0.1554  -0.0959 -0.0986 123 ILE A C     
1099 O O     . ILE A 123 ? 0.4393 1.3968 0.7103 0.1633  -0.0883 -0.0895 123 ILE A O     
1100 C CB    . ILE A 123 ? 0.6018 1.7068 0.9526 0.0751  -0.0788 -0.1067 123 ILE A CB    
1101 C CG1   . ILE A 123 ? 0.5859 1.6932 0.9493 0.0175  -0.0749 -0.1043 123 ILE A CG1   
1102 C CG2   . ILE A 123 ? 0.5929 1.6916 0.9401 0.0815  -0.0562 -0.1022 123 ILE A CG2   
1103 C CD1   . ILE A 123 ? 0.5609 1.7280 0.9568 -0.0155 -0.0586 -0.1081 123 ILE A CD1   
1109 N N     . GLU A 124 ? 0.4393 1.4842 0.7395 0.1905  -0.1057 -0.1079 124 GLU A N     
1110 C CA    . GLU A 124 ? 0.5335 1.5435 0.8089 0.2420  -0.1097 -0.1076 124 GLU A CA    
1111 C C     . GLU A 124 ? 0.5081 1.4307 0.7406 0.2598  -0.1209 -0.0942 124 GLU A C     
1112 O O     . GLU A 124 ? 0.5747 1.4438 0.7828 0.2826  -0.1154 -0.0885 124 GLU A O     
1113 C CB    . GLU A 124 ? 0.6091 1.6649 0.8949 0.2753  -0.1236 -0.1194 124 GLU A CB    
1114 C CG    . GLU A 124 ? 0.8224 1.8274 1.0746 0.3295  -0.1342 -0.1180 124 GLU A CG    
1115 C CD    . GLU A 124 ? 1.0451 2.0066 1.2801 0.3445  -0.1192 -0.1155 124 GLU A CD    
1116 O OE1   . GLU A 124 ? 1.0410 2.0430 1.2982 0.3271  -0.1002 -0.1214 124 GLU A OE1   
1117 O OE2   . GLU A 124 ? 1.1865 2.0701 1.3833 0.3719  -0.1263 -0.1070 124 GLU A OE2   
1118 N N     . LEU A 125 ? 0.4834 1.3898 0.7047 0.2478  -0.1364 -0.0895 125 LEU A N     
1119 C CA    . LEU A 125 ? 0.5575 1.3830 0.7351 0.2600  -0.1464 -0.0752 125 LEU A CA    
1120 C C     . LEU A 125 ? 0.6092 1.3909 0.7759 0.2387  -0.1320 -0.0653 125 LEU A C     
1121 O O     . LEU A 125 ? 0.6627 1.3786 0.7971 0.2603  -0.1314 -0.0551 125 LEU A O     
1122 C CB    . LEU A 125 ? 0.6203 1.4441 0.7876 0.2462  -0.1641 -0.0736 125 LEU A CB    
1123 C CG    . LEU A 125 ? 0.6559 1.4001 0.7757 0.2494  -0.1723 -0.0580 125 LEU A CG    
1124 C CD1   . LEU A 125 ? 0.6804 1.3626 0.7620 0.2936  -0.1779 -0.0474 125 LEU A CD1   
1125 C CD2   . LEU A 125 ? 0.7075 1.4603 0.8189 0.2339  -0.1884 -0.0602 125 LEU A CD2   
1126 N N     . ALA A 126 ? 0.5660 1.3815 0.7585 0.1950  -0.1208 -0.0681 126 ALA A N     
1127 C CA    . ALA A 126 ? 0.5504 1.3218 0.7327 0.1703  -0.1024 -0.0598 126 ALA A CA    
1128 C C     . ALA A 126 ? 0.5167 1.2686 0.6932 0.1967  -0.0887 -0.0592 126 ALA A C     
1129 O O     . ALA A 126 ? 0.4806 1.1534 0.6238 0.1960  -0.0798 -0.0494 126 ALA A O     
1130 C CB    . ALA A 126 ? 0.5495 1.3630 0.7620 0.1202  -0.0893 -0.0640 126 ALA A CB    
1131 N N     . ARG A 127 ? 0.5268 1.3407 0.7299 0.2177  -0.0857 -0.0708 127 ARG A N     
1132 C CA    . ARG A 127 ? 0.5294 1.3255 0.7242 0.2448  -0.0738 -0.0737 127 ARG A CA    
1133 C C     . ARG A 127 ? 0.5849 1.3056 0.7400 0.2869  -0.0866 -0.0679 127 ARG A C     
1134 O O     . ARG A 127 ? 0.5488 1.2094 0.6804 0.2945  -0.0788 -0.0625 127 ARG A O     
1135 C CB    . ARG A 127 ? 0.5663 1.4285 0.7859 0.2557  -0.0673 -0.0880 127 ARG A CB    
1136 C CG    . ARG A 127 ? 0.6123 1.5152 0.8534 0.2266  -0.0437 -0.0910 127 ARG A CG    
1137 C CD    . ARG A 127 ? 0.7369 1.7001 0.9961 0.2431  -0.0379 -0.1046 127 ARG A CD    
1138 N NE    . ARG A 127 ? 0.8567 1.8873 1.1452 0.2305  -0.0459 -0.1114 127 ARG A NE    
1139 C CZ    . ARG A 127 ? 0.8518 1.9389 1.1697 0.1880  -0.0347 -0.1121 127 ARG A CZ    
1140 N NH1   . ARG A 127 ? 0.7739 1.8552 1.0929 0.1544  -0.0145 -0.1048 127 ARG A NH1   
1141 N NH2   . ARG A 127 ? 0.8579 2.0038 1.2022 0.1787  -0.0439 -0.1196 127 ARG A NH2   
1142 N N     . LYS A 128 ? 0.6697 1.3849 0.8131 0.3098  -0.1054 -0.0682 128 LYS A N     
1143 C CA    . LYS A 128 ? 0.7449 1.3839 0.8468 0.3472  -0.1182 -0.0606 128 LYS A CA    
1144 C C     . LYS A 128 ? 0.7474 1.3096 0.8163 0.3364  -0.1193 -0.0434 128 LYS A C     
1145 O O     . LYS A 128 ? 0.8744 1.3630 0.9105 0.3564  -0.1196 -0.0362 128 LYS A O     
1146 C CB    . LYS A 128 ? 0.8622 1.5138 0.9575 0.3667  -0.1377 -0.0618 128 LYS A CB    
1147 C CG    . LYS A 128 ? 1.0725 1.6597 1.1300 0.4098  -0.1496 -0.0577 128 LYS A CG    
1148 C CD    . LYS A 128 ? 1.1781 1.6719 1.1892 0.4100  -0.1564 -0.0375 128 LYS A CD    
1149 C CE    . LYS A 128 ? 1.2899 1.7277 1.2635 0.4459  -0.1721 -0.0308 128 LYS A CE    
1150 N NZ    . LYS A 128 ? 1.3326 1.6853 1.2602 0.4396  -0.1776 -0.0088 128 LYS A NZ    
1151 N N     . ILE A 129 ? 0.5695 1.1374 0.6422 0.2966  -0.1167 -0.0378 129 ILE A N     
1152 C CA    . ILE A 129 ? 0.5963 1.0815 0.6333 0.2706  -0.1100 -0.0230 129 ILE A CA    
1153 C C     . ILE A 129 ? 0.5971 1.0377 0.6270 0.2550  -0.0897 -0.0212 129 ILE A C     
1154 O O     . ILE A 129 ? 0.6405 1.0032 0.6364 0.2567  -0.0872 -0.0106 129 ILE A O     
1155 C CB    . ILE A 129 ? 0.6404 1.1461 0.6853 0.2304  -0.1105 -0.0218 129 ILE A CB    
1156 C CG1   . ILE A 129 ? 0.6700 1.1885 0.7026 0.2460  -0.1329 -0.0195 129 ILE A CG1   
1157 C CG2   . ILE A 129 ? 0.4952 0.9319 0.5150 0.1977  -0.0966 -0.0113 129 ILE A CG2   
1158 C CD1   . ILE A 129 ? 0.7354 1.2761 0.7742 0.2102  -0.1366 -0.0222 129 ILE A CD1   
1164 N N     . LYS A 130 ? 0.5621 1.0536 0.6233 0.2379  -0.0752 -0.0309 130 LYS A N     
1165 C CA    . LYS A 130 ? 0.5108 0.9658 0.5640 0.2241  -0.0572 -0.0299 130 LYS A CA    
1166 C C     . LYS A 130 ? 0.5156 0.9299 0.5495 0.2623  -0.0599 -0.0327 130 LYS A C     
1167 O O     . LYS A 130 ? 0.5678 0.9135 0.5757 0.2579  -0.0539 -0.0271 130 LYS A O     
1168 C CB    . LYS A 130 ? 0.5873 1.1081 0.6741 0.2021  -0.0414 -0.0386 130 LYS A CB    
1169 C CG    . LYS A 130 ? 0.6122 1.1402 0.7072 0.1552  -0.0338 -0.0331 130 LYS A CG    
1170 C CD    . LYS A 130 ? 0.5609 1.1593 0.6891 0.1334  -0.0192 -0.0397 130 LYS A CD    
1171 C CE    . LYS A 130 ? 0.4769 1.0597 0.5970 0.1355  -0.0018 -0.0405 130 LYS A CE    
1172 N NZ    . LYS A 130 ? 0.4299 0.9414 0.5225 0.1107  0.0056  -0.0298 130 LYS A NZ    
1173 N N     . GLN A 131 ? 0.4823 0.9379 0.5286 0.3006  -0.0705 -0.0425 131 GLN A N     
1174 C CA    . GLN A 131 ? 0.6232 1.0371 0.6493 0.3414  -0.0755 -0.0475 131 GLN A CA    
1175 C C     . GLN A 131 ? 0.6938 1.0132 0.6763 0.3514  -0.0874 -0.0327 131 GLN A C     
1176 O O     . GLN A 131 ? 0.7782 1.0294 0.7350 0.3593  -0.0846 -0.0313 131 GLN A O     
1177 C CB    . GLN A 131 ? 0.6446 1.1219 0.6915 0.3821  -0.0856 -0.0620 131 GLN A CB    
1178 C CG    . GLN A 131 ? 0.8137 1.3813 0.9000 0.3690  -0.0707 -0.0767 131 GLN A CG    
1179 C CD    . GLN A 131 ? 1.0452 1.6633 1.1442 0.3932  -0.0786 -0.0894 131 GLN A CD    
1180 O OE1   . GLN A 131 ? 1.2218 1.8264 1.3092 0.4124  -0.0962 -0.0864 131 GLN A OE1   
1181 N NE2   . GLN A 131 ? 1.0277 1.7049 1.1488 0.3926  -0.0655 -0.1033 131 GLN A NE2   
1182 N N     . GLU A 132 ? 0.5500 0.8657 0.5228 0.3490  -0.1004 -0.0215 132 GLU A N     
1183 C CA    . GLU A 132 ? 0.6433 0.8739 0.5725 0.3574  -0.1105 -0.0049 132 GLU A CA    
1184 C C     . GLU A 132 ? 0.6192 0.7842 0.5282 0.3219  -0.0962 0.0054  132 GLU A C     
1185 O O     . GLU A 132 ? 0.7539 0.8432 0.6319 0.3290  -0.0974 0.0133  132 GLU A O     
1186 C CB    . GLU A 132 ? 0.7514 0.9981 0.6723 0.3588  -0.1257 0.0051  132 GLU A CB    
1187 C CG    . GLU A 132 ? 0.9074 1.0730 0.7799 0.3771  -0.1384 0.0234  132 GLU A CG    
1188 C CD    . GLU A 132 ? 1.0642 1.2436 0.9227 0.3750  -0.1518 0.0343  132 GLU A CD    
1189 O OE1   . GLU A 132 ? 1.1480 1.2591 0.9640 0.3760  -0.1565 0.0523  132 GLU A OE1   
1190 O OE2   . GLU A 132 ? 1.0818 1.3394 0.9717 0.3674  -0.1559 0.0238  132 GLU A OE2   
1191 N N     . ILE A 133 ? 0.5307 0.7248 0.4580 0.2837  -0.0835 0.0048  133 ILE A N     
1192 C CA    . ILE A 133 ? 0.5735 0.7142 0.4847 0.2516  -0.0712 0.0136  133 ILE A CA    
1193 C C     . ILE A 133 ? 0.7466 0.8583 0.6565 0.2541  -0.0612 0.0058  133 ILE A C     
1194 O O     . ILE A 133 ? 0.7723 0.8199 0.6595 0.2440  -0.0575 0.0129  133 ILE A O     
1195 C CB    . ILE A 133 ? 0.6123 0.7907 0.5424 0.2141  -0.0619 0.0133  133 ILE A CB    
1196 C CG1   . ILE A 133 ? 0.7055 0.9069 0.6325 0.2120  -0.0737 0.0188  133 ILE A CG1   
1197 C CG2   . ILE A 133 ? 0.5644 0.6944 0.4809 0.1845  -0.0494 0.0202  133 ILE A CG2   
1198 C CD1   . ILE A 133 ? 0.6371 0.8671 0.5782 0.1765  -0.0674 0.0171  133 ILE A CD1   
1204 N N     . LEU A 134 ? 0.7202 0.8822 0.6540 0.2674  -0.0571 -0.0096 134 LEU A N     
1205 C CA    . LEU A 134 ? 0.7450 0.8854 0.6754 0.2735  -0.0488 -0.0198 134 LEU A CA    
1206 C C     . LEU A 134 ? 0.7926 0.8694 0.6952 0.3064  -0.0602 -0.0208 134 LEU A C     
1207 O O     . LEU A 134 ? 0.7670 0.7843 0.6505 0.3007  -0.0571 -0.0212 134 LEU A O     
1208 C CB    . LEU A 134 ? 0.6591 0.8755 0.6198 0.2819  -0.0405 -0.0361 134 LEU A CB    
1209 C CG    . LEU A 134 ? 0.6038 0.8090 0.5602 0.2901  -0.0311 -0.0493 134 LEU A CG    
1210 C CD1   . LEU A 134 ? 0.5043 0.6958 0.4587 0.2526  -0.0174 -0.0449 134 LEU A CD1   
1211 C CD2   . LEU A 134 ? 0.5572 0.8382 0.5382 0.3138  -0.0264 -0.0663 134 LEU A CD2   
1212 N N     . GLU A 135 ? 0.8479 0.9359 0.7477 0.3407  -0.0747 -0.0215 135 GLU A N     
1213 C CA    . GLU A 135 ? 0.8813 0.9043 0.7513 0.3762  -0.0882 -0.0215 135 GLU A CA    
1214 C C     . GLU A 135 ? 0.8746 0.8091 0.7080 0.3601  -0.0923 -0.0015 135 GLU A C     
1215 O O     . GLU A 135 ? 0.9768 0.8401 0.7862 0.3626  -0.0935 -0.0016 135 GLU A O     
1216 C CB    . GLU A 135 ? 0.9527 1.0123 0.8277 0.4182  -0.1046 -0.0251 135 GLU A CB    
1217 C CG    . GLU A 135 ? 1.1757 1.1697 1.0197 0.4484  -0.1166 -0.0278 135 GLU A CG    
1218 C CD    . GLU A 135 ? 1.4232 1.4421 1.2789 0.4693  -0.1126 -0.0517 135 GLU A CD    
1219 O OE1   . GLU A 135 ? 1.4157 1.5001 1.3017 0.4604  -0.0992 -0.0646 135 GLU A OE1   
1220 O OE2   . GLU A 135 ? 1.6258 1.5993 1.4586 0.4938  -0.1226 -0.0571 135 GLU A OE2   
1221 N N     . LYS A 136 ? 0.8197 0.7609 0.6486 0.3425  -0.0945 0.0150  136 LYS A N     
1222 C CA    . LYS A 136 ? 0.8026 0.6691 0.5957 0.3284  -0.0974 0.0360  136 LYS A CA    
1223 C C     . LYS A 136 ? 0.8592 0.6926 0.6499 0.2870  -0.0821 0.0406  136 LYS A C     
1224 O O     . LYS A 136 ? 0.9814 0.7424 0.7457 0.2793  -0.0823 0.0498  136 LYS A O     
1225 C CB    . LYS A 136 ? 0.7608 0.6525 0.5482 0.3250  -0.1043 0.0504  136 LYS A CB    
1226 C CG    . LYS A 136 ? 0.9456 0.8496 0.7234 0.3690  -0.1242 0.0510  136 LYS A CG    
1227 C CD    . LYS A 136 ? 0.9995 0.8813 0.7468 0.3680  -0.1339 0.0724  136 LYS A CD    
1228 C CE    . LYS A 136 ? 1.0257 0.9282 0.7702 0.3999  -0.1499 0.0691  136 LYS A CE    
1229 N NZ    . LYS A 136 ? 1.1272 1.0157 0.8444 0.3919  -0.1566 0.0880  136 LYS A NZ    
1230 N N     . GLU A 137 ? 0.6989 0.5855 0.5175 0.2606  -0.0696 0.0340  137 GLU A N     
1231 C CA    . GLU A 137 ? 0.7073 0.5735 0.5261 0.2233  -0.0565 0.0386  137 GLU A CA    
1232 C C     . GLU A 137 ? 0.7098 0.5944 0.5484 0.2134  -0.0463 0.0224  137 GLU A C     
1233 O O     . GLU A 137 ? 0.7624 0.6346 0.6034 0.1851  -0.0367 0.0239  137 GLU A O     
1234 C CB    . GLU A 137 ? 0.6740 0.5770 0.5015 0.1992  -0.0513 0.0469  137 GLU A CB    
1235 C CG    . GLU A 137 ? 0.7502 0.6258 0.5508 0.2012  -0.0585 0.0650  137 GLU A CG    
1236 C CD    . GLU A 137 ? 0.9065 0.7128 0.6801 0.1862  -0.0541 0.0786  137 GLU A CD    
1237 O OE1   . GLU A 137 ? 0.8396 0.6268 0.6206 0.1699  -0.0455 0.0724  137 GLU A OE1   
1238 O OE2   . GLU A 137 ? 1.1008 0.8735 0.8453 0.1898  -0.0594 0.0959  137 GLU A OE2   
1239 N N     . LYS A 138 ? 0.6581 0.5766 0.5105 0.2375  -0.0483 0.0067  138 LYS A N     
1240 C CA    . LYS A 138 ? 0.8021 0.7427 0.6693 0.2301  -0.0384 -0.0082 138 LYS A CA    
1241 C C     . LYS A 138 ? 0.8070 0.7885 0.6930 0.1970  -0.0262 -0.0054 138 LYS A C     
1242 O O     . LYS A 138 ? 0.8068 0.7876 0.6965 0.1821  -0.0178 -0.0115 138 LYS A O     
1243 C CB    . LYS A 138 ? 0.7599 0.6352 0.6079 0.2267  -0.0389 -0.0125 138 LYS A CB    
1244 C CG    . LYS A 138 ? 0.8466 0.6888 0.6797 0.2620  -0.0488 -0.0253 138 LYS A CG    
1245 C CD    . LYS A 138 ? 1.0438 0.8607 0.8607 0.2897  -0.0625 -0.0165 138 LYS A CD    
1246 C CE    . LYS A 138 ? 1.1859 0.9778 0.9902 0.3315  -0.0732 -0.0327 138 LYS A CE    
1247 N NZ    . LYS A 138 ? 1.1956 1.0660 1.0252 0.3571  -0.0701 -0.0510 138 LYS A NZ    
1248 N N     . ILE A 139 ? 0.7727 0.7862 0.6678 0.1870  -0.0268 0.0033  139 ILE A N     
1249 C CA    . ILE A 139 ? 0.6208 0.6683 0.5313 0.1579  -0.0174 0.0054  139 ILE A CA    
1250 C C     . ILE A 139 ? 0.6321 0.7490 0.5675 0.1611  -0.0152 -0.0019 139 ILE A C     
1251 O O     . ILE A 139 ? 0.6889 0.8353 0.6315 0.1789  -0.0236 -0.0031 139 ILE A O     
1252 C CB    . ILE A 139 ? 0.5505 0.5828 0.4522 0.1398  -0.0191 0.0187  139 ILE A CB    
1253 C CG1   . ILE A 139 ? 0.6134 0.5859 0.4944 0.1297  -0.0176 0.0269  139 ILE A CG1   
1254 C CG2   . ILE A 139 ? 0.5651 0.6314 0.4818 0.1142  -0.0118 0.0184  139 ILE A CG2   
1255 C CD1   . ILE A 139 ? 0.5994 0.5631 0.4855 0.1100  -0.0081 0.0223  139 ILE A CD1   
1261 N N     . THR A 140 ? 0.5827 0.7277 0.5311 0.1431  -0.0042 -0.0063 140 THR A N     
1262 C CA    . THR A 140 ? 0.5318 0.7440 0.5048 0.1390  -0.0002 -0.0111 140 THR A CA    
1263 C C     . THR A 140 ? 0.5186 0.7421 0.4980 0.1098  0.0010  -0.0035 140 THR A C     
1264 O O     . THR A 140 ? 0.5492 0.7356 0.5161 0.0908  0.0040  0.0029  140 THR A O     
1265 C CB    . THR A 140 ? 0.4945 0.7363 0.4762 0.1360  0.0121  -0.0191 140 THR A CB    
1266 O OG1   . THR A 140 ? 0.5295 0.7527 0.5048 0.1075  0.0203  -0.0129 140 THR A OG1   
1267 C CG2   . THR A 140 ? 0.4912 0.7089 0.4601 0.1621  0.0114  -0.0288 140 THR A CG2   
1271 N N     . VAL A 141 ? 0.4483 0.7256 0.4482 0.1070  -0.0021 -0.0060 141 VAL A N     
1272 C CA    . VAL A 141 ? 0.3925 0.6796 0.3978 0.0806  -0.0038 -0.0015 141 VAL A CA    
1273 C C     . VAL A 141 ? 0.4199 0.7712 0.4527 0.0643  0.0011  -0.0063 141 VAL A C     
1274 O O     . VAL A 141 ? 0.4116 0.8111 0.4625 0.0780  0.0047  -0.0133 141 VAL A O     
1275 C CB    . VAL A 141 ? 0.4315 0.7105 0.4289 0.0902  -0.0179 0.0015  141 VAL A CB    
1276 C CG1   . VAL A 141 ? 0.5002 0.7142 0.4686 0.0993  -0.0206 0.0094  141 VAL A CG1   
1277 C CG2   . VAL A 141 ? 0.4471 0.7744 0.4604 0.1170  -0.0277 -0.0052 141 VAL A CG2   
1284 N N     . THR A 142 ? 0.4178 0.7690 0.4532 0.0346  0.0014  -0.0030 142 THR A N     
1285 C CA    . THR A 142 ? 0.4157 0.8225 0.4766 0.0121  0.0044  -0.0062 142 THR A CA    
1286 C C     . THR A 142 ? 0.4770 0.9053 0.5469 0.0076  -0.0106 -0.0100 142 THR A C     
1287 O O     . THR A 142 ? 0.5321 0.9175 0.5814 0.0073  -0.0190 -0.0071 142 THR A O     
1288 C CB    . THR A 142 ? 0.4757 0.8600 0.5299 -0.0208 0.0150  0.0000  142 THR A CB    
1289 O OG1   . THR A 142 ? 0.5759 0.9417 0.6187 -0.0144 0.0272  0.0033  142 THR A OG1   
1290 C CG2   . THR A 142 ? 0.4671 0.9058 0.5469 -0.0488 0.0187  -0.0018 142 THR A CG2   
1294 N N     . VAL A 143 ? 0.4686 0.9674 0.5692 0.0048  -0.0140 -0.0174 143 VAL A N     
1295 C CA    . VAL A 143 ? 0.4707 0.9993 0.5827 -0.0001 -0.0302 -0.0234 143 VAL A CA    
1296 C C     . VAL A 143 ? 0.5452 1.1248 0.6858 -0.0369 -0.0281 -0.0283 143 VAL A C     
1297 O O     . VAL A 143 ? 0.5116 1.1265 0.6713 -0.0521 -0.0138 -0.0274 143 VAL A O     
1298 C CB    . VAL A 143 ? 0.4933 1.0665 0.6178 0.0366  -0.0429 -0.0301 143 VAL A CB    
1299 C CG1   . VAL A 143 ? 0.4777 0.9937 0.5712 0.0709  -0.0462 -0.0240 143 VAL A CG1   
1300 C CG2   . VAL A 143 ? 0.5859 1.2371 0.7466 0.0432  -0.0352 -0.0378 143 VAL A CG2   
1307 N N     . GLY A 144 ? 0.5589 1.1432 0.7012 -0.0521 -0.0427 -0.0337 144 GLY A N     
1308 C CA    . GLY A 144 ? 0.4773 1.1117 0.6486 -0.0884 -0.0448 -0.0405 144 GLY A CA    
1309 C C     . GLY A 144 ? 0.5100 1.1993 0.7003 -0.0778 -0.0655 -0.0527 144 GLY A C     
1310 O O     . GLY A 144 ? 0.5563 1.2170 0.7232 -0.0533 -0.0799 -0.0536 144 GLY A O     
1311 N N     . VAL A 145 ? 0.4359 1.2070 0.6680 -0.0962 -0.0672 -0.0616 145 VAL A N     
1312 C CA    . VAL A 145 ? 0.4502 1.2865 0.7058 -0.0853 -0.0885 -0.0750 145 VAL A CA    
1313 C C     . VAL A 145 ? 0.6213 1.4941 0.9033 -0.1310 -0.0920 -0.0840 145 VAL A C     
1314 O O     . VAL A 145 ? 0.7603 1.6747 1.0694 -0.1491 -0.0780 -0.0841 145 VAL A O     
1315 C CB    . VAL A 145 ? 0.4412 1.3444 0.7218 -0.0465 -0.0882 -0.0792 145 VAL A CB    
1316 C CG1   . VAL A 145 ? 0.3682 1.2996 0.6521 -0.0234 -0.1099 -0.0895 145 VAL A CG1   
1317 C CG2   . VAL A 145 ? 0.4883 1.3430 0.7408 -0.0063 -0.0805 -0.0695 145 VAL A CG2   
1324 N N     . ALA A 146 ? 0.5299 1.3707 0.7951 -0.1473 -0.1090 -0.0906 146 ALA A N     
1325 C CA    . ALA A 146 ? 0.5740 1.4194 0.8524 -0.1904 -0.1126 -0.0986 146 ALA A CA    
1326 C C     . ALA A 146 ? 0.5907 1.4324 0.8578 -0.1837 -0.1386 -0.1122 146 ALA A C     
1327 O O     . ALA A 146 ? 0.5109 1.3345 0.7523 -0.1487 -0.1514 -0.1124 146 ALA A O     
1328 C CB    . ALA A 146 ? 0.4452 1.2276 0.7057 -0.2310 -0.1011 -0.0910 146 ALA A CB    
1329 N N     . PRO A 147 ? 0.5866 1.4430 0.8704 -0.2170 -0.1462 -0.1229 147 PRO A N     
1330 C CA    . PRO A 147 ? 0.6395 1.4968 0.9145 -0.2128 -0.1713 -0.1377 147 PRO A CA    
1331 C C     . PRO A 147 ? 0.6906 1.4730 0.9186 -0.2114 -0.1828 -0.1404 147 PRO A C     
1332 O O     . PRO A 147 ? 0.6464 1.4269 0.8563 -0.1920 -0.2027 -0.1497 147 PRO A O     
1333 C CB    . PRO A 147 ? 0.6273 1.5091 0.9321 -0.2568 -0.1726 -0.1468 147 PRO A CB    
1334 C CG    . PRO A 147 ? 0.5250 1.4494 0.8623 -0.2694 -0.1488 -0.1367 147 PRO A CG    
1335 C CD    . PRO A 147 ? 0.5557 1.4349 0.8690 -0.2582 -0.1316 -0.1213 147 PRO A CD    
1336 N N     . ASN A 148 ? 0.7186 1.4402 0.9244 -0.2300 -0.1703 -0.1325 148 ASN A N     
1337 C CA    . ASN A 148 ? 0.7033 1.3550 0.8618 -0.2248 -0.1794 -0.1358 148 ASN A CA    
1338 C C     . ASN A 148 ? 0.7577 1.3500 0.8876 -0.2083 -0.1605 -0.1185 148 ASN A C     
1339 O O     . ASN A 148 ? 0.7825 1.3897 0.9290 -0.2016 -0.1422 -0.1048 148 ASN A O     
1340 C CB    . ASN A 148 ? 0.6816 1.2843 0.8284 -0.2642 -0.1860 -0.1474 148 ASN A CB    
1341 C CG    . ASN A 148 ? 0.7592 1.3332 0.9171 -0.3028 -0.1672 -0.1381 148 ASN A CG    
1342 O OD1   . ASN A 148 ? 0.7877 1.3420 0.9388 -0.3000 -0.1499 -0.1232 148 ASN A OD1   
1343 N ND2   . ASN A 148 ? 0.7876 1.3568 0.9609 -0.3389 -0.1710 -0.1457 148 ASN A ND2   
1344 N N     . LYS A 149 ? 0.7699 1.2885 0.8549 -0.1987 -0.1628 -0.1189 149 LYS A N     
1345 C CA    . LYS A 149 ? 0.7091 1.1645 0.7634 -0.1764 -0.1451 -0.1025 149 LYS A CA    
1346 C C     . LYS A 149 ? 0.7255 1.1392 0.7815 -0.2020 -0.1265 -0.0931 149 LYS A C     
1347 O O     . LYS A 149 ? 0.6907 1.0925 0.7469 -0.1887 -0.1088 -0.0777 149 LYS A O     
1348 C CB    . LYS A 149 ? 0.7505 1.1490 0.7586 -0.1596 -0.1528 -0.1073 149 LYS A CB    
1349 C CG    . LYS A 149 ? 0.7893 1.1992 0.7786 -0.1183 -0.1575 -0.1010 149 LYS A CG    
1350 C CD    . LYS A 149 ? 0.8465 1.2257 0.7951 -0.1077 -0.1707 -0.1110 149 LYS A CD    
1351 C CE    . LYS A 149 ? 0.8300 1.1357 0.7465 -0.1123 -0.1587 -0.1096 149 LYS A CE    
1352 N NZ    . LYS A 149 ? 0.8503 1.1347 0.7303 -0.1071 -0.1727 -0.1248 149 LYS A NZ    
1353 N N     . ILE A 150 ? 0.7715 1.1584 0.8252 -0.2381 -0.1317 -0.1025 150 ILE A N     
1354 C CA    . ILE A 150 ? 0.8055 1.1403 0.8521 -0.2614 -0.1162 -0.0924 150 ILE A CA    
1355 C C     . ILE A 150 ? 0.7482 1.1312 0.8299 -0.2751 -0.1001 -0.0794 150 ILE A C     
1356 O O     . ILE A 150 ? 0.6688 1.0219 0.7419 -0.2710 -0.0822 -0.0639 150 ILE A O     
1357 C CB    . ILE A 150 ? 0.9086 1.2011 0.9442 -0.2987 -0.1272 -0.1054 150 ILE A CB    
1358 C CG1   . ILE A 150 ? 1.0349 1.2624 1.0553 -0.3182 -0.1122 -0.0925 150 ILE A CG1   
1359 C CG2   . ILE A 150 ? 1.0083 1.3648 1.0816 -0.3334 -0.1393 -0.1176 150 ILE A CG2   
1360 C CD1   . ILE A 150 ? 1.1853 1.3591 1.1908 -0.3544 -0.1235 -0.1042 150 ILE A CD1   
1366 N N     . LEU A 151 ? 0.6610 1.1237 0.7823 -0.2894 -0.1068 -0.0869 151 LEU A N     
1367 C CA    . LEU A 151 ? 0.6136 1.1349 0.7713 -0.3030 -0.0910 -0.0770 151 LEU A CA    
1368 C C     . LEU A 151 ? 0.6635 1.2048 0.8226 -0.2619 -0.0776 -0.0653 151 LEU A C     
1369 O O     . LEU A 151 ? 0.7100 1.2511 0.8737 -0.2659 -0.0582 -0.0519 151 LEU A O     
1370 C CB    . LEU A 151 ? 0.5465 1.1539 0.7480 -0.3221 -0.1015 -0.0897 151 LEU A CB    
1371 C CG    . LEU A 151 ? 0.6561 1.2380 0.8616 -0.3647 -0.1049 -0.0951 151 LEU A CG    
1372 C CD1   . LEU A 151 ? 0.7008 1.3533 0.9422 -0.3687 -0.1171 -0.1086 151 LEU A CD1   
1373 C CD2   . LEU A 151 ? 0.6413 1.1986 0.8484 -0.3948 -0.0824 -0.0778 151 LEU A CD2   
1374 N N     . ALA A 152 ? 0.6764 1.2318 0.8284 -0.2228 -0.0886 -0.0701 152 ALA A N     
1375 C CA    . ALA A 152 ? 0.5875 1.1513 0.7363 -0.1826 -0.0787 -0.0602 152 ALA A CA    
1376 C C     . ALA A 152 ? 0.6285 1.1177 0.7456 -0.1764 -0.0623 -0.0463 152 ALA A C     
1377 O O     . ALA A 152 ? 0.6651 1.1609 0.7856 -0.1607 -0.0479 -0.0368 152 ALA A O     
1378 C CB    . ALA A 152 ? 0.4827 1.0542 0.6188 -0.1443 -0.0948 -0.0656 152 ALA A CB    
1379 N N     . LYS A 153 ? 0.6465 1.0668 0.7325 -0.1870 -0.0658 -0.0468 153 LYS A N     
1380 C CA    . LYS A 153 ? 0.6389 0.9913 0.6960 -0.1807 -0.0527 -0.0353 153 LYS A CA    
1381 C C     . LYS A 153 ? 0.6479 0.9941 0.7127 -0.2081 -0.0372 -0.0255 153 LYS A C     
1382 O O     . LYS A 153 ? 0.6094 0.9311 0.6626 -0.1968 -0.0234 -0.0141 153 LYS A O     
1383 C CB    . LYS A 153 ? 0.6549 0.9413 0.6781 -0.1824 -0.0612 -0.0407 153 LYS A CB    
1384 C CG    . LYS A 153 ? 0.6349 0.8545 0.6330 -0.1855 -0.0496 -0.0313 153 LYS A CG    
1385 C CD    . LYS A 153 ? 0.6497 0.8288 0.6200 -0.1554 -0.0494 -0.0300 153 LYS A CD    
1386 C CE    . LYS A 153 ? 0.7023 0.8252 0.6524 -0.1551 -0.0386 -0.0214 153 LYS A CE    
1387 N NZ    . LYS A 153 ? 0.7256 0.8302 0.6604 -0.1248 -0.0335 -0.0168 153 LYS A NZ    
1388 N N     . ILE A 154 ? 0.6506 1.0189 0.7335 -0.2455 -0.0399 -0.0295 154 ILE A N     
1389 C CA    . ILE A 154 ? 0.6442 1.0012 0.7294 -0.2762 -0.0250 -0.0177 154 ILE A CA    
1390 C C     . ILE A 154 ? 0.5903 1.0094 0.7002 -0.2680 -0.0087 -0.0094 154 ILE A C     
1391 O O     . ILE A 154 ? 0.6421 1.0369 0.7379 -0.2656 0.0069  0.0039  154 ILE A O     
1392 C CB    . ILE A 154 ? 0.6616 1.0240 0.7596 -0.3236 -0.0320 -0.0235 154 ILE A CB    
1393 C CG1   . ILE A 154 ? 0.6530 0.9357 0.7175 -0.3318 -0.0460 -0.0312 154 ILE A CG1   
1394 C CG2   . ILE A 154 ? 0.6944 1.0580 0.7980 -0.3575 -0.0142 -0.0079 154 ILE A CG2   
1395 C CD1   . ILE A 154 ? 0.7023 0.9740 0.7732 -0.3793 -0.0552 -0.0384 154 ILE A CD1   
1401 N N     . ILE A 155 ? 0.5256 1.0259 0.6708 -0.2606 -0.0129 -0.0183 155 ILE A N     
1402 C CA    . ILE A 155 ? 0.5786 1.1444 0.7490 -0.2505 0.0024  -0.0135 155 ILE A CA    
1403 C C     . ILE A 155 ? 0.6374 1.1831 0.7897 -0.2055 0.0080  -0.0094 155 ILE A C     
1404 O O     . ILE A 155 ? 0.6907 1.2603 0.8479 -0.1963 0.0237  -0.0031 155 ILE A O     
1405 C CB    . ILE A 155 ? 0.5863 1.2504 0.8019 -0.2506 -0.0050 -0.0262 155 ILE A CB    
1406 C CG1   . ILE A 155 ? 0.5748 1.3127 0.8206 -0.2579 0.0147  -0.0213 155 ILE A CG1   
1407 C CG2   . ILE A 155 ? 0.5609 1.2408 0.7765 -0.2049 -0.0204 -0.0362 155 ILE A CG2   
1408 C CD1   . ILE A 155 ? 0.5797 1.2906 0.8169 -0.2999 0.0292  -0.0094 155 ILE A CD1   
1414 N N     . ALA A 156 ? 0.6439 1.1461 0.7741 -0.1787 -0.0046 -0.0134 156 ALA A N     
1415 C CA    . ALA A 156 ? 0.5950 1.0676 0.7054 -0.1415 0.0004  -0.0087 156 ALA A CA    
1416 C C     . ALA A 156 ? 0.5558 0.9716 0.6405 -0.1502 0.0141  0.0032  156 ALA A C     
1417 O O     . ALA A 156 ? 0.5671 0.9881 0.6487 -0.1346 0.0260  0.0083  156 ALA A O     
1418 C CB    . ALA A 156 ? 0.5383 0.9738 0.6284 -0.1169 -0.0143 -0.0130 156 ALA A CB    
1419 N N     . ASP A 157 ? 0.5237 0.8852 0.5887 -0.1734 0.0109  0.0064  157 ASP A N     
1420 C CA    . ASP A 157 ? 0.6260 0.9304 0.6645 -0.1812 0.0208  0.0176  157 ASP A CA    
1421 C C     . ASP A 157 ? 0.6492 0.9830 0.6960 -0.1983 0.0377  0.0277  157 ASP A C     
1422 O O     . ASP A 157 ? 0.6753 0.9867 0.7044 -0.1868 0.0479  0.0359  157 ASP A O     
1423 C CB    . ASP A 157 ? 0.7690 1.0150 0.7872 -0.2038 0.0125  0.0174  157 ASP A CB    
1424 C CG    . ASP A 157 ? 0.8506 1.0519 0.8481 -0.1816 0.0010  0.0105  157 ASP A CG    
1425 O OD1   . ASP A 157 ? 0.9384 1.1588 0.9402 -0.1542 -0.0028 0.0059  157 ASP A OD1   
1426 O OD2   . ASP A 157 ? 0.9111 1.0571 0.8863 -0.1913 -0.0041 0.0098  157 ASP A OD2   
1427 N N     . LYS A 158 ? 0.6332 1.0210 0.7068 -0.2259 0.0408  0.0265  158 LYS A N     
1428 C CA    . LYS A 158 ? 0.5930 1.0205 0.6768 -0.2445 0.0591  0.0365  158 LYS A CA    
1429 C C     . LYS A 158 ? 0.6020 1.0870 0.7009 -0.2135 0.0689  0.0330  158 LYS A C     
1430 O O     . LYS A 158 ? 0.6479 1.1689 0.7517 -0.2221 0.0860  0.0402  158 LYS A O     
1431 C CB    . LYS A 158 ? 0.5751 1.0543 0.6887 -0.2853 0.0602  0.0352  158 LYS A CB    
1432 C CG    . LYS A 158 ? 0.6932 1.1153 0.7907 -0.3255 0.0541  0.0407  158 LYS A CG    
1433 C CD    . LYS A 158 ? 0.8190 1.2937 0.9463 -0.3625 0.0568  0.0393  158 LYS A CD    
1434 C CE    . LYS A 158 ? 0.9917 1.3977 1.0978 -0.3990 0.0511  0.0452  158 LYS A CE    
1435 N NZ    . LYS A 158 ? 1.0973 1.5350 1.2198 -0.4273 0.0605  0.0508  158 LYS A NZ    
1436 N N     . SER A 159 ? 0.5248 1.0168 0.6284 -0.1771 0.0583  0.0219  159 SER A N     
1437 C CA    . SER A 159 ? 0.5009 1.0455 0.6194 -0.1450 0.0645  0.0156  159 SER A CA    
1438 C C     . SER A 159 ? 0.4414 0.9372 0.5326 -0.1098 0.0643  0.0158  159 SER A C     
1439 O O     . SER A 159 ? 0.5471 1.0735 0.6435 -0.0831 0.0702  0.0105  159 SER A O     
1440 C CB    . SER A 159 ? 0.5892 1.1929 0.7392 -0.1295 0.0518  0.0020  159 SER A CB    
1441 O OG    . SER A 159 ? 0.6768 1.3403 0.8583 -0.1627 0.0530  -0.0003 159 SER A OG    
1442 N N     . LYS A 160 ? 0.4576 0.8797 0.5207 -0.1097 0.0570  0.0203  160 LYS A N     
1443 C CA    . LYS A 160 ? 0.5215 0.8964 0.5597 -0.0834 0.0574  0.0212  160 LYS A CA    
1444 C C     . LYS A 160 ? 0.5753 0.9606 0.6041 -0.0811 0.0729  0.0259  160 LYS A C     
1445 O O     . LYS A 160 ? 0.6089 1.0128 0.6389 -0.1071 0.0841  0.0342  160 LYS A O     
1446 C CB    . LYS A 160 ? 0.5674 0.8701 0.5795 -0.0905 0.0504  0.0264  160 LYS A CB    
1447 C CG    . LYS A 160 ? 0.5854 0.8724 0.5998 -0.0926 0.0360  0.0215  160 LYS A CG    
1448 C CD    . LYS A 160 ? 0.6359 0.8554 0.6235 -0.0938 0.0312  0.0248  160 LYS A CD    
1449 C CE    . LYS A 160 ? 0.5540 0.7577 0.5392 -0.0936 0.0179  0.0188  160 LYS A CE    
1450 N NZ    . LYS A 160 ? 0.6006 0.7472 0.5615 -0.0865 0.0149  0.0200  160 LYS A NZ    
1451 N N     . PRO A 161 ? 0.4973 0.8706 0.5150 -0.0511 0.0736  0.0207  161 PRO A N     
1452 C CA    . PRO A 161 ? 0.3993 0.7538 0.4160 -0.0216 0.0618  0.0121  161 PRO A CA    
1453 C C     . PRO A 161 ? 0.4718 0.8834 0.5110 0.0019  0.0609  0.0013  161 PRO A C     
1454 O O     . PRO A 161 ? 0.4851 0.9557 0.5416 -0.0030 0.0716  -0.0009 161 PRO A O     
1455 C CB    . PRO A 161 ? 0.5349 0.8447 0.5264 -0.0071 0.0640  0.0122  161 PRO A CB    
1456 C CG    . PRO A 161 ? 0.4754 0.8159 0.4634 -0.0129 0.0787  0.0144  161 PRO A CG    
1457 C CD    . PRO A 161 ? 0.4859 0.8556 0.4858 -0.0460 0.0857  0.0237  161 PRO A CD    
1458 N N     . ASN A 162 ? 0.5590 0.9535 0.5968 0.0274  0.0485  -0.0047 162 ASN A N     
1459 C CA    . ASN A 162 ? 0.5160 0.9552 0.5718 0.0558  0.0432  -0.0151 162 ASN A CA    
1460 C C     . ASN A 162 ? 0.4617 0.9783 0.5507 0.0445  0.0450  -0.0185 162 ASN A C     
1461 O O     . ASN A 162 ? 0.4880 1.0621 0.5965 0.0657  0.0471  -0.0283 162 ASN A O     
1462 C CB    . ASN A 162 ? 0.5727 1.0170 0.6210 0.0832  0.0499  -0.0236 162 ASN A CB    
1463 C CG    . ASN A 162 ? 0.6934 1.1445 0.7456 0.1223  0.0387  -0.0342 162 ASN A CG    
1464 O OD1   . ASN A 162 ? 0.8049 1.2603 0.8652 0.1291  0.0260  -0.0335 162 ASN A OD1   
1465 N ND2   . ASN A 162 ? 0.6470 1.0949 0.6900 0.1495  0.0422  -0.0443 162 ASN A ND2   
1466 N N     . GLY A 163 ? 0.3589 0.8785 0.4554 0.0117  0.0431  -0.0122 163 GLY A N     
1467 C CA    . GLY A 163 ? 0.3208 0.9144 0.4507 -0.0062 0.0447  -0.0158 163 GLY A CA    
1468 C C     . GLY A 163 ? 0.5014 1.1312 0.6520 0.0078  0.0276  -0.0241 163 GLY A C     
1469 O O     . GLY A 163 ? 0.4872 1.0752 0.6213 0.0275  0.0130  -0.0244 163 GLY A O     
1470 N N     . LEU A 164 ? 0.4767 1.1890 0.6636 -0.0032 0.0298  -0.0305 164 LEU A N     
1471 C CA    . LEU A 164 ? 0.4408 1.2020 0.6530 0.0020  0.0130  -0.0391 164 LEU A CA    
1472 C C     . LEU A 164 ? 0.4733 1.2891 0.7153 -0.0431 0.0178  -0.0394 164 LEU A C     
1473 O O     . LEU A 164 ? 0.5181 1.4187 0.7957 -0.0476 0.0255  -0.0459 164 LEU A O     
1474 C CB    . LEU A 164 ? 0.3628 1.1843 0.5954 0.0454  0.0081  -0.0511 164 LEU A CB    
1475 C CG    . LEU A 164 ? 0.4241 1.3169 0.6894 0.0545  -0.0094 -0.0619 164 LEU A CG    
1476 C CD1   . LEU A 164 ? 0.3892 1.2290 0.6302 0.0717  -0.0312 -0.0600 164 LEU A CD1   
1477 C CD2   . LEU A 164 ? 0.5509 1.4919 0.8289 0.0912  -0.0088 -0.0732 164 LEU A CD2   
1478 N N     . GLY A 165 ? 0.4540 1.2192 0.6805 -0.0771 0.0136  -0.0327 165 GLY A N     
1479 C CA    . GLY A 165 ? 0.4574 1.2574 0.7066 -0.1244 0.0161  -0.0324 165 GLY A CA    
1480 C C     . GLY A 165 ? 0.4769 1.3311 0.7551 -0.1300 -0.0035 -0.0450 165 GLY A C     
1481 O O     . GLY A 165 ? 0.4503 1.2870 0.7176 -0.1021 -0.0222 -0.0509 165 GLY A O     
1482 N N     . VAL A 166 ? 0.4483 1.3449 0.7502 -0.1631 0.0005  -0.0478 166 VAL A N     
1483 C CA    . VAL A 166 ? 0.4869 1.4288 0.8118 -0.1644 -0.0166 -0.0609 166 VAL A CA    
1484 C C     . VAL A 166 ? 0.5655 1.5120 0.9026 -0.2156 -0.0144 -0.0608 166 VAL A C     
1485 O O     . VAL A 166 ? 0.6507 1.6068 0.9934 -0.2409 0.0042  -0.0529 166 VAL A O     
1486 C CB    . VAL A 166 ? 0.3687 1.3818 0.7173 -0.1282 -0.0159 -0.0702 166 VAL A CB    
1487 C CG1   . VAL A 166 ? 0.3959 1.4556 0.7670 -0.1264 -0.0353 -0.0839 166 VAL A CG1   
1488 C CG2   . VAL A 166 ? 0.3473 1.3472 0.6805 -0.0753 -0.0185 -0.0705 166 VAL A CG2   
1495 N N     . ILE A 167 ? 0.4902 1.4274 0.8290 -0.2294 -0.0344 -0.0699 167 ILE A N     
1496 C CA    . ILE A 167 ? 0.5089 1.4523 0.8617 -0.2740 -0.0369 -0.0735 167 ILE A CA    
1497 C C     . ILE A 167 ? 0.6176 1.6165 0.9951 -0.2625 -0.0573 -0.0903 167 ILE A C     
1498 O O     . ILE A 167 ? 0.5878 1.5660 0.9521 -0.2469 -0.0782 -0.0985 167 ILE A O     
1499 C CB    . ILE A 167 ? 0.5068 1.3684 0.8311 -0.3079 -0.0432 -0.0698 167 ILE A CB    
1500 C CG1   . ILE A 167 ? 0.5002 1.3000 0.7959 -0.3179 -0.0249 -0.0525 167 ILE A CG1   
1501 C CG2   . ILE A 167 ? 0.5507 1.4150 0.8895 -0.3526 -0.0476 -0.0747 167 ILE A CG2   
1502 C CD1   . ILE A 167 ? 0.5478 1.2599 0.8083 -0.3360 -0.0345 -0.0509 167 ILE A CD1   
1508 N N     . ARG A 168 ? 0.6273 1.6972 1.0389 -0.2691 -0.0515 -0.0953 168 ARG A N     
1509 C CA    . ARG A 168 ? 0.5852 1.7127 1.0232 -0.2610 -0.0706 -0.1114 168 ARG A CA    
1510 C C     . ARG A 168 ? 0.6344 1.7450 1.0789 -0.3079 -0.0812 -0.1174 168 ARG A C     
1511 O O     . ARG A 168 ? 0.6564 1.7347 1.0971 -0.3496 -0.0679 -0.1082 168 ARG A O     
1512 C CB    . ARG A 168 ? 0.5825 1.7973 1.0557 -0.2481 -0.0607 -0.1160 168 ARG A CB    
1513 C CG    . ARG A 168 ? 0.4975 1.7299 0.9645 -0.2000 -0.0507 -0.1127 168 ARG A CG    
1514 C CD    . ARG A 168 ? 0.4982 1.8184 0.9998 -0.1900 -0.0415 -0.1197 168 ARG A CD    
1515 N NE    . ARG A 168 ? 0.5177 1.8534 1.0119 -0.1401 -0.0345 -0.1199 168 ARG A NE    
1516 C CZ    . ARG A 168 ? 0.5687 1.8774 1.0451 -0.1349 -0.0145 -0.1089 168 ARG A CZ    
1517 N NH1   . ARG A 168 ? 0.5551 1.8202 1.0184 -0.1759 0.0006  -0.0954 168 ARG A NH1   
1518 N NH2   . ARG A 168 ? 0.6147 1.9352 1.0835 -0.0877 -0.0108 -0.1117 168 ARG A NH2   
1519 N N     . PRO A 169 ? 0.6483 1.7768 1.1001 -0.2998 -0.1061 -0.1326 169 PRO A N     
1520 C CA    . PRO A 169 ? 0.6654 1.7857 1.1266 -0.3402 -0.1206 -0.1427 169 PRO A CA    
1521 C C     . PRO A 169 ? 0.6928 1.8366 1.1805 -0.3878 -0.1041 -0.1378 169 PRO A C     
1522 O O     . PRO A 169 ? 0.7136 1.7996 1.1883 -0.4291 -0.1026 -0.1338 169 PRO A O     
1523 C CB    . PRO A 169 ? 0.6006 1.7831 1.0824 -0.3137 -0.1436 -0.1597 169 PRO A CB    
1524 C CG    . PRO A 169 ? 0.5869 1.7573 1.0439 -0.2585 -0.1490 -0.1569 169 PRO A CG    
1525 C CD    . PRO A 169 ? 0.5723 1.7253 1.0193 -0.2481 -0.1233 -0.1408 169 PRO A CD    
1526 N N     . THR A 170 ? 0.6903 1.9152 1.2121 -0.3801 -0.0919 -0.1380 170 THR A N     
1527 C CA    . THR A 170 ? 0.7628 2.0203 1.3099 -0.4211 -0.0727 -0.1313 170 THR A CA    
1528 C C     . THR A 170 ? 0.8482 2.0257 1.3663 -0.4562 -0.0551 -0.1131 170 THR A C     
1529 O O     . THR A 170 ? 0.8889 2.0379 1.4096 -0.5030 -0.0550 -0.1109 170 THR A O     
1530 C CB    . THR A 170 ? 0.7234 2.0605 1.2946 -0.3952 -0.0548 -0.1289 170 THR A CB    
1531 O OG1   . THR A 170 ? 0.6663 2.0684 1.2575 -0.3534 -0.0718 -0.1447 170 THR A OG1   
1532 C CG2   . THR A 170 ? 0.7802 2.1674 1.3827 -0.4374 -0.0372 -0.1245 170 THR A CG2   
1536 N N     . GLU A 171 ? 1.1017 1.6338 1.3986 -0.4811 0.2277  0.0376  171 GLU A N     
1537 C CA    . GLU A 171 ? 1.1333 1.5954 1.3581 -0.4966 0.2376  0.0634  171 GLU A CA    
1538 C C     . GLU A 171 ? 1.0837 1.4794 1.2626 -0.4815 0.2027  0.0719  171 GLU A C     
1539 O O     . GLU A 171 ? 1.1451 1.4820 1.2616 -0.4863 0.2055  0.0947  171 GLU A O     
1540 C CB    . GLU A 171 ? 1.1709 1.6317 1.3471 -0.4851 0.2635  0.0731  171 GLU A CB    
1541 C CG    . GLU A 171 ? 1.1889 1.6869 1.3754 -0.4449 0.2551  0.0558  171 GLU A CG    
1542 C CD    . GLU A 171 ? 1.2678 1.7619 1.4044 -0.4353 0.2814  0.0625  171 GLU A CD    
1543 O OE1   . GLU A 171 ? 1.2288 1.7739 1.3978 -0.4344 0.3102  0.0510  171 GLU A OE1   
1544 O OE2   . GLU A 171 ? 1.3452 1.7861 1.4111 -0.4282 0.2732  0.0786  171 GLU A OE2   
1545 N N     . VAL A 172 ? 0.9937 1.3987 1.2022 -0.4629 0.1704  0.0542  172 VAL A N     
1546 C CA    . VAL A 172 ? 1.0149 1.3579 1.1835 -0.4478 0.1398  0.0599  172 VAL A CA    
1547 C C     . VAL A 172 ? 1.1261 1.4136 1.2818 -0.4800 0.1398  0.0742  172 VAL A C     
1548 O O     . VAL A 172 ? 1.1592 1.3820 1.2598 -0.4761 0.1337  0.0943  172 VAL A O     
1549 C CB    . VAL A 172 ? 0.9682 1.3313 1.1688 -0.4230 0.1066  0.0363  172 VAL A CB    
1550 C CG1   . VAL A 172 ? 0.9901 1.2857 1.1521 -0.4123 0.0794  0.0414  172 VAL A CG1   
1551 C CG2   . VAL A 172 ? 0.9022 1.3056 1.1048 -0.3866 0.1035  0.0254  172 VAL A CG2   
1558 N N     . GLN A 173 ? 1.1585 1.4710 1.3668 -0.5115 0.1459  0.0640  173 GLN A N     
1559 C CA    . GLN A 173 ? 1.2628 1.5203 1.4620 -0.5444 0.1467  0.0752  173 GLN A CA    
1560 C C     . GLN A 173 ? 1.3594 1.5749 1.5092 -0.5646 0.1750  0.1056  173 GLN A C     
1561 O O     . GLN A 173 ? 1.4058 1.5499 1.5143 -0.5744 0.1708  0.1250  173 GLN A O     
1562 C CB    . GLN A 173 ? 1.3108 1.6099 1.5795 -0.5782 0.1498  0.0569  173 GLN A CB    
1563 C CG    . GLN A 173 ? 1.3599 1.6664 1.6609 -0.5685 0.1144  0.0319  173 GLN A CG    
1564 C CD    . GLN A 173 ? 1.4434 1.6644 1.7012 -0.5683 0.0943  0.0384  173 GLN A CD    
1565 O OE1   . GLN A 173 ? 1.4737 1.6307 1.6747 -0.5648 0.1019  0.0631  173 GLN A OE1   
1566 N NE2   . GLN A 173 ? 1.4573 1.6768 1.7418 -0.5718 0.0683  0.0162  173 GLN A NE2   
1567 N N     . ASP A 174 ? 1.3921 1.6495 1.5432 -0.5695 0.2041  0.1100  174 ASP A N     
1568 C CA    . ASP A 174 ? 1.5043 1.7251 1.6022 -0.5886 0.2323  0.1386  174 ASP A CA    
1569 C C     . ASP A 174 ? 1.4746 1.6387 1.4980 -0.5612 0.2175  0.1594  174 ASP A C     
1570 O O     . ASP A 174 ? 1.5161 1.6141 1.4918 -0.5726 0.2171  0.1852  174 ASP A O     
1571 C CB    . ASP A 174 ? 1.5812 1.8618 1.6951 -0.5972 0.2678  0.1351  174 ASP A CB    
1572 C CG    . ASP A 174 ? 1.6554 1.9962 1.8472 -0.6269 0.2863  0.1175  174 ASP A CG    
1573 O OD1   . ASP A 174 ? 1.7229 2.0422 1.9375 -0.6575 0.2838  0.1187  174 ASP A OD1   
1574 O OD2   . ASP A 174 ? 1.6444 2.0545 1.8764 -0.6197 0.3039  0.1021  174 ASP A OD2   
1575 N N     . PHE A 175 ? 1.4072 1.5991 1.4232 -0.5249 0.2052  0.1484  175 PHE A N     
1576 C CA    . PHE A 175 ? 1.3524 1.5041 1.3050 -0.4971 0.1906  0.1647  175 PHE A CA    
1577 C C     . PHE A 175 ? 1.3627 1.4489 1.2926 -0.4878 0.1620  0.1759  175 PHE A C     
1578 O O     . PHE A 175 ? 1.3620 1.3958 1.2360 -0.4835 0.1579  0.2022  175 PHE A O     
1579 C CB    . PHE A 175 ? 1.1856 1.3821 1.1481 -0.4609 0.1800  0.1447  175 PHE A CB    
1580 C CG    . PHE A 175 ? 1.1320 1.2972 1.0349 -0.4339 0.1666  0.1584  175 PHE A CG    
1581 C CD1   . PHE A 175 ? 1.0824 1.2535 0.9418 -0.4348 0.1862  0.1697  175 PHE A CD1   
1582 C CD2   . PHE A 175 ? 1.1363 1.2682 1.0277 -0.4082 0.1348  0.1583  175 PHE A CD2   
1583 C CE1   . PHE A 175 ? 1.0608 1.2073 0.8674 -0.4120 0.1719  0.1813  175 PHE A CE1   
1584 C CE2   . PHE A 175 ? 1.0980 1.2070 0.9407 -0.3841 0.1223  0.1705  175 PHE A CE2   
1585 C CZ    . PHE A 175 ? 1.0470 1.1645 0.8479 -0.3868 0.1397  0.1821  175 PHE A CZ    
1586 N N     . LEU A 176 ? 1.3373 1.4275 1.3109 -0.4844 0.1426  0.1557  176 LEU A N     
1587 C CA    . LEU A 176 ? 1.3359 1.3636 1.2939 -0.4768 0.1185  0.1619  176 LEU A CA    
1588 C C     . LEU A 176 ? 1.4881 1.4537 1.4176 -0.5069 0.1311  0.1894  176 LEU A C     
1589 O O     . LEU A 176 ? 1.5899 1.4930 1.4792 -0.4955 0.1182  0.2096  176 LEU A O     
1590 C CB    . LEU A 176 ? 1.2148 1.2601 1.2250 -0.4756 0.0998  0.1325  176 LEU A CB    
1591 C CG    . LEU A 176 ? 1.1248 1.1939 1.1412 -0.4358 0.0752  0.1126  176 LEU A CG    
1592 C CD1   . LEU A 176 ? 1.0866 1.1817 1.1539 -0.4383 0.0582  0.0828  176 LEU A CD1   
1593 C CD2   . LEU A 176 ? 1.1090 1.1181 1.0771 -0.4092 0.0574  0.1280  176 LEU A CD2   
1594 N N     . ASN A 177 ? 1.5339 1.5166 1.4854 -0.5448 0.1571  0.1910  177 ASN A N     
1595 C CA    . ASN A 177 ? 1.6651 1.5883 1.5861 -0.5762 0.1733  0.2190  177 ASN A CA    
1596 C C     . ASN A 177 ? 1.7374 1.6302 1.5902 -0.5692 0.1825  0.2522  177 ASN A C     
1597 O O     . ASN A 177 ? 1.7888 1.6156 1.5970 -0.5604 0.1703  0.2775  177 ASN A O     
1598 C CB    . ASN A 177 ? 1.7345 1.6890 1.6960 -0.6204 0.2026  0.2125  177 ASN A CB    
1599 C CG    . ASN A 177 ? 1.7568 1.7269 1.7808 -0.6358 0.1914  0.1849  177 ASN A CG    
1600 O OD1   . ASN A 177 ? 1.7946 1.7302 1.8199 -0.6197 0.1642  0.1757  177 ASN A OD1   
1601 N ND2   . ASN A 177 ? 1.7356 1.7588 1.8120 -0.6683 0.2128  0.1710  177 ASN A ND2   
1602 N N     . GLU A 178 ? 1.7446 1.6864 1.5898 -0.5723 0.2036  0.2515  178 GLU A N     
1603 C CA    . GLU A 178 ? 1.7895 1.7097 1.5674 -0.5705 0.2147  0.2804  178 GLU A CA    
1604 C C     . GLU A 178 ? 1.7056 1.6006 1.4437 -0.5309 0.1848  0.2901  178 GLU A C     
1605 O O     . GLU A 178 ? 1.6855 1.5533 1.3636 -0.5268 0.1854  0.3171  178 GLU A O     
1606 C CB    . GLU A 178 ? 1.8466 1.8294 1.6289 -0.5787 0.2432  0.2699  178 GLU A CB    
1607 C CG    . GLU A 178 ? 1.9436 1.9531 1.7625 -0.6201 0.2782  0.2644  178 GLU A CG    
1608 C CD    . GLU A 178 ? 1.9232 2.0167 1.7966 -0.6173 0.2955  0.2337  178 GLU A CD    
1609 O OE1   . GLU A 178 ? 1.9070 2.0379 1.8460 -0.6376 0.3059  0.2151  178 GLU A OE1   
1610 O OE2   . GLU A 178 ? 1.9037 2.0256 1.7556 -0.5949 0.2985  0.2283  178 GLU A OE2   
1611 N N     . LEU A 179 ? 1.6491 1.5548 1.4209 -0.5030 0.1585  0.2679  179 LEU A N     
1612 C CA    . LEU A 179 ? 1.5614 1.4481 1.3062 -0.4648 0.1303  0.2732  179 LEU A CA    
1613 C C     . LEU A 179 ? 1.7303 1.5417 1.4347 -0.4613 0.1165  0.3052  179 LEU A C     
1614 O O     . LEU A 179 ? 1.8121 1.5817 1.5343 -0.4694 0.1106  0.3060  179 LEU A O     
1615 C CB    . LEU A 179 ? 1.3121 1.2241 1.1035 -0.4393 0.1086  0.2413  179 LEU A CB    
1616 C CG    . LEU A 179 ? 1.2015 1.1095 0.9703 -0.3995 0.0843  0.2419  179 LEU A CG    
1617 C CD1   . LEU A 179 ? 1.1218 1.0740 0.8681 -0.3911 0.0943  0.2406  179 LEU A CD1   
1618 C CD2   . LEU A 179 ? 1.0952 1.0153 0.9033 -0.3755 0.0630  0.2134  179 LEU A CD2   
1619 N N     . ASP A 180 ? 1.7743 1.5684 1.4248 -0.4489 0.1108  0.3313  180 ASP A N     
1620 C CA    . ASP A 180 ? 1.8347 1.5629 1.4478 -0.4377 0.0935  0.3638  180 ASP A CA    
1621 C C     . ASP A 180 ? 1.7729 1.4872 1.4136 -0.4039 0.0658  0.3494  180 ASP A C     
1622 O O     . ASP A 180 ? 1.7260 1.4818 1.4067 -0.3909 0.0603  0.3162  180 ASP A O     
1623 C CB    . ASP A 180 ? 1.8785 1.6040 1.4311 -0.4297 0.0896  0.3920  180 ASP A CB    
1624 C CG    . ASP A 180 ? 1.9526 1.6099 1.4629 -0.4248 0.0758  0.4329  180 ASP A CG    
1625 O OD1   . ASP A 180 ? 1.9414 1.5808 1.3985 -0.4410 0.0847  0.4634  180 ASP A OD1   
1626 O OD2   . ASP A 180 ? 2.0140 1.6349 1.5429 -0.4038 0.0563  0.4348  180 ASP A OD2   
1627 N N     . ILE A 181 ? 1.7799 1.4355 1.3994 -0.3888 0.0493  0.3744  181 ILE A N     
1628 C CA    . ILE A 181 ? 1.7366 1.3747 1.3824 -0.3576 0.0269  0.3605  181 ILE A CA    
1629 C C     . ILE A 181 ? 1.6966 1.3615 1.3304 -0.3213 0.0069  0.3607  181 ILE A C     
1630 O O     . ILE A 181 ? 1.5897 1.2781 1.2531 -0.2981 -0.0049 0.3340  181 ILE A O     
1631 C CB    . ILE A 181 ? 1.6922 1.2507 1.3291 -0.3560 0.0204  0.3840  181 ILE A CB    
1632 C CG1   . ILE A 181 ? 1.6050 1.1457 1.2761 -0.3295 0.0038  0.3610  181 ILE A CG1   
1633 C CG2   . ILE A 181 ? 1.7748 1.2972 1.3622 -0.3444 0.0111  0.4280  181 ILE A CG2   
1634 C CD1   . ILE A 181 ? 1.6277 1.0872 1.2923 -0.3242 -0.0012 0.3809  181 ILE A CD1   
1640 N N     . ASP A 182 ? 1.7717 1.4339 1.3608 -0.3184 0.0032  0.3907  182 ASP A N     
1641 C CA    . ASP A 182 ? 1.7560 1.4419 1.3315 -0.2873 -0.0167 0.3947  182 ASP A CA    
1642 C C     . ASP A 182 ? 1.6254 1.3783 1.2131 -0.2829 -0.0122 0.3642  182 ASP A C     
1643 O O     . ASP A 182 ? 1.6007 1.3777 1.1895 -0.2566 -0.0278 0.3572  182 ASP A O     
1644 C CB    . ASP A 182 ? 1.8795 1.5460 1.4011 -0.2898 -0.0231 0.4356  182 ASP A CB    
1645 C CG    . ASP A 182 ? 2.0206 1.6208 1.5317 -0.2795 -0.0359 0.4687  182 ASP A CG    
1646 O OD1   . ASP A 182 ? 2.1271 1.7011 1.6732 -0.2609 -0.0441 0.4574  182 ASP A OD1   
1647 O OD2   . ASP A 182 ? 2.0258 1.5982 1.4920 -0.2894 -0.0374 0.5060  182 ASP A OD2   
1648 N N     . GLU A 183 ? 1.5359 1.3180 1.1346 -0.3088 0.0103  0.3466  183 GLU A N     
1649 C CA    . GLU A 183 ? 1.4568 1.2997 1.0704 -0.3056 0.0182  0.3173  183 GLU A CA    
1650 C C     . GLU A 183 ? 1.3649 1.2267 1.0267 -0.2849 0.0083  0.2840  183 GLU A C     
1651 O O     . GLU A 183 ? 1.2997 1.2090 0.9792 -0.2782 0.0128  0.2584  183 GLU A O     
1652 C CB    . GLU A 183 ? 1.5484 1.4166 1.1632 -0.3388 0.0472  0.3104  183 GLU A CB    
1653 C CG    . GLU A 183 ? 1.7595 1.6014 1.3235 -0.3642 0.0607  0.3436  183 GLU A CG    
1654 C CD    . GLU A 183 ? 1.9057 1.7790 1.4692 -0.3956 0.0931  0.3348  183 GLU A CD    
1655 O OE1   . GLU A 183 ? 1.9164 1.8287 1.4625 -0.3944 0.1029  0.3252  183 GLU A OE1   
1656 O OE2   . GLU A 183 ? 1.9859 1.8442 1.5669 -0.4220 0.1101  0.3368  183 GLU A OE2   
1657 N N     . ILE A 184 ? 1.3382 1.1598 1.0183 -0.2744 -0.0046 0.2850  184 ILE A N     
1658 C CA    . ILE A 184 ? 1.2945 1.1267 1.0147 -0.2573 -0.0139 0.2541  184 ILE A CA    
1659 C C     . ILE A 184 ? 1.2971 1.1324 1.0135 -0.2214 -0.0334 0.2515  184 ILE A C     
1660 O O     . ILE A 184 ? 1.3381 1.1454 1.0318 -0.2081 -0.0446 0.2765  184 ILE A O     
1661 C CB    . ILE A 184 ? 1.3272 1.1121 1.0685 -0.2670 -0.0153 0.2518  184 ILE A CB    
1662 C CG1   . ILE A 184 ? 1.3514 1.1353 1.1000 -0.3060 0.0055  0.2538  184 ILE A CG1   
1663 C CG2   . ILE A 184 ? 1.1991 0.9928 0.9754 -0.2499 -0.0262 0.2188  184 ILE A CG2   
1664 C CD1   . ILE A 184 ? 1.4009 1.1234 1.1545 -0.3218 0.0066  0.2637  184 ILE A CD1   
1670 N N     . PRO A 185 ? 1.2987 1.1705 1.0382 -0.2057 -0.0371 0.2220  185 PRO A N     
1671 C CA    . PRO A 185 ? 1.2371 1.1143 0.9776 -0.1729 -0.0530 0.2149  185 PRO A CA    
1672 C C     . PRO A 185 ? 1.2294 1.0635 0.9862 -0.1567 -0.0647 0.2110  185 PRO A C     
1673 O O     . PRO A 185 ? 1.3423 1.1588 1.1191 -0.1687 -0.0613 0.1969  185 PRO A O     
1674 C CB    . PRO A 185 ? 1.1810 1.1080 0.9399 -0.1670 -0.0489 0.1840  185 PRO A CB    
1675 C CG    . PRO A 185 ? 1.1979 1.1519 0.9615 -0.1950 -0.0305 0.1798  185 PRO A CG    
1676 C CD    . PRO A 185 ? 1.2765 1.1923 1.0409 -0.2187 -0.0248 0.1953  185 PRO A CD    
1677 N N     . GLY A 186 ? 1.1484 0.9663 0.8976 -0.1307 -0.0776 0.2224  186 GLY A N     
1678 C CA    . GLY A 186 ? 1.1872 0.9654 0.9523 -0.1116 -0.0861 0.2160  186 GLY A CA    
1679 C C     . GLY A 186 ? 1.3221 1.0418 1.0802 -0.1164 -0.0871 0.2419  186 GLY A C     
1680 O O     . GLY A 186 ? 1.3758 1.0533 1.1474 -0.1084 -0.0891 0.2342  186 GLY A O     
1681 N N     . ILE A 187 ? 1.3504 1.0642 1.0842 -0.1296 -0.0851 0.2729  187 ILE A N     
1682 C CA    . ILE A 187 ? 1.4701 1.1258 1.1926 -0.1344 -0.0858 0.3024  187 ILE A CA    
1683 C C     . ILE A 187 ? 1.5387 1.1946 1.2348 -0.1230 -0.0965 0.3390  187 ILE A C     
1684 O O     . ILE A 187 ? 1.4979 1.1760 1.1667 -0.1413 -0.0926 0.3549  187 ILE A O     
1685 C CB    . ILE A 187 ? 1.5334 1.1710 1.2495 -0.1716 -0.0702 0.3065  187 ILE A CB    
1686 C CG1   . ILE A 187 ? 1.5727 1.2667 1.2798 -0.1929 -0.0595 0.2985  187 ILE A CG1   
1687 C CG2   . ILE A 187 ? 1.4500 1.0632 1.1936 -0.1817 -0.0643 0.2787  187 ILE A CG2   
1688 C CD1   . ILE A 187 ? 1.6730 1.3530 1.3613 -0.2274 -0.0440 0.3172  187 ILE A CD1   
1694 N N     . GLY A 188 ? 1.5878 1.2199 1.2924 -0.0928 -0.1098 0.3516  188 GLY A N     
1695 C CA    . GLY A 188 ? 1.5911 1.2296 1.2778 -0.0773 -0.1246 0.3849  188 GLY A CA    
1696 C C     . GLY A 188 ? 1.6530 1.2617 1.3057 -0.0974 -0.1236 0.4226  188 GLY A C     
1697 O O     . GLY A 188 ? 1.6671 1.2351 1.3150 -0.1189 -0.1109 0.4260  188 GLY A O     
1698 N N     . SER A 189 ? 1.6890 1.3174 1.3163 -0.0921 -0.1371 0.4512  189 SER A N     
1699 C CA    . SER A 189 ? 1.7170 1.3163 1.3047 -0.1097 -0.1385 0.4909  189 SER A CA    
1700 C C     . SER A 189 ? 1.7509 1.2825 1.3445 -0.0939 -0.1449 0.5199  189 SER A C     
1701 O O     . SER A 189 ? 1.8429 1.3351 1.4051 -0.1090 -0.1434 0.5532  189 SER A O     
1702 C CB    . SER A 189 ? 1.6729 1.3128 1.2287 -0.1079 -0.1543 0.5129  189 SER A CB    
1703 O OG    . SER A 189 ? 1.6347 1.2964 1.2137 -0.0739 -0.1750 0.5157  189 SER A OG    
1704 N N     . VAL A 190 ? 1.6906 1.2066 1.3230 -0.0632 -0.1506 0.5071  190 VAL A N     
1705 C CA    . VAL A 190 ? 1.6794 1.1256 1.3243 -0.0468 -0.1515 0.5259  190 VAL A CA    
1706 C C     . VAL A 190 ? 1.7034 1.1037 1.3546 -0.0705 -0.1300 0.5047  190 VAL A C     
1707 O O     . VAL A 190 ? 1.7624 1.1030 1.3970 -0.0839 -0.1231 0.5281  190 VAL A O     
1708 C CB    . VAL A 190 ? 1.6343 1.0810 1.3193 -0.0046 -0.1625 0.5176  190 VAL A CB    
1709 C CG1   . VAL A 190 ? 1.7363 1.1045 1.4369 0.0123  -0.1581 0.5302  190 VAL A CG1   
1710 C CG2   . VAL A 190 ? 1.5640 1.0564 1.2478 0.0182  -0.1853 0.5414  190 VAL A CG2   
1717 N N     . LEU A 191 ? 1.6450 1.0725 1.3202 -0.0759 -0.1204 0.4608  191 LEU A N     
1718 C CA    . LEU A 191 ? 1.6637 1.0603 1.3466 -0.1024 -0.1021 0.4365  191 LEU A CA    
1719 C C     . LEU A 191 ? 1.6362 1.0280 1.2882 -0.1422 -0.0899 0.4532  191 LEU A C     
1720 O O     . LEU A 191 ? 1.5962 0.9384 1.2455 -0.1653 -0.0764 0.4551  191 LEU A O     
1721 C CB    . LEU A 191 ? 1.6027 1.0455 1.3109 -0.1043 -0.0972 0.3890  191 LEU A CB    
1722 C CG    . LEU A 191 ? 1.5941 1.0489 1.3292 -0.0675 -0.1064 0.3688  191 LEU A CG    
1723 C CD1   . LEU A 191 ? 1.4916 1.0051 1.2407 -0.0709 -0.1038 0.3288  191 LEU A CD1   
1724 C CD2   . LEU A 191 ? 1.6655 1.0520 1.4173 -0.0542 -0.1021 0.3621  191 LEU A CD2   
1725 N N     . ALA A 192 ? 1.5941 1.0371 1.2221 -0.1511 -0.0934 0.4643  192 ALA A N     
1726 C CA    . ALA A 192 ? 1.5870 1.0312 1.1807 -0.1873 -0.0806 0.4817  192 ALA A CA    
1727 C C     . ALA A 192 ? 1.6697 1.0432 1.2371 -0.1931 -0.0800 0.5234  192 ALA A C     
1728 O O     . ALA A 192 ? 1.6659 0.9956 1.2309 -0.2196 -0.0631 0.5238  192 ALA A O     
1729 C CB    . ALA A 192 ? 1.5587 1.0624 1.1252 -0.1894 -0.0871 0.4901  192 ALA A CB    
1730 N N     . ARG A 193 ? 1.7869 1.1500 1.3360 -0.1679 -0.0993 0.5587  193 ARG A N     
1731 C CA    . ARG A 193 ? 1.9967 1.2928 1.5179 -0.1670 -0.1030 0.6044  193 ARG A CA    
1732 C C     . ARG A 193 ? 2.1439 1.3631 1.6839 -0.1690 -0.0909 0.6018  193 ARG A C     
1733 O O     . ARG A 193 ? 2.2692 1.4403 1.7860 -0.1987 -0.0751 0.6180  193 ARG A O     
1734 C CB    . ARG A 193 ? 2.0230 1.3330 1.5469 -0.1243 -0.1257 0.6261  193 ARG A CB    
1735 C CG    . ARG A 193 ? 2.1524 1.4189 1.6537 -0.1125 -0.1246 0.6607  193 ARG A CG    
1736 C CD    . ARG A 193 ? 2.2071 1.4808 1.7269 -0.0647 -0.1460 0.6746  193 ARG A CD    
1737 N NE    . ARG A 193 ? 2.1752 1.5163 1.7187 -0.0484 -0.1619 0.6533  193 ARG A NE    
1738 C CZ    . ARG A 193 ? 2.1135 1.4726 1.6867 -0.0085 -0.1792 0.6545  193 ARG A CZ    
1739 N NH1   . ARG A 193 ? 2.1904 1.5049 1.7730 0.0213  -0.1836 0.6761  193 ARG A NH1   
1740 N NH2   . ARG A 193 ? 1.9572 1.3790 1.5511 0.0016  -0.1905 0.6333  193 ARG A NH2   
1741 N N     . ARG A 194 ? 2.1109 1.3163 1.6908 -0.1390 -0.0965 0.5806  194 ARG A N     
1742 C CA    . ARG A 194 ? 2.1579 1.2835 1.7531 -0.1367 -0.0862 0.5786  194 ARG A CA    
1743 C C     . ARG A 194 ? 2.1262 1.2392 1.7284 -0.1776 -0.0632 0.5468  194 ARG A C     
1744 O O     . ARG A 194 ? 2.1973 1.2392 1.8021 -0.1890 -0.0510 0.5479  194 ARG A O     
1745 C CB    . ARG A 194 ? 2.1471 1.2643 1.7817 -0.0948 -0.0957 0.5600  194 ARG A CB    
1746 C CG    . ARG A 194 ? 2.1435 1.3130 1.8094 -0.0940 -0.0922 0.5081  194 ARG A CG    
1747 C CD    . ARG A 194 ? 2.2234 1.3615 1.9229 -0.0596 -0.0940 0.4882  194 ARG A CD    
1748 N NE    . ARG A 194 ? 2.2466 1.4245 1.9628 -0.0185 -0.1115 0.4954  194 ARG A NE    
1749 C CZ    . ARG A 194 ? 2.2178 1.3891 1.9654 0.0141  -0.1129 0.4747  194 ARG A CZ    
1750 N NH1   . ARG A 194 ? 2.2276 1.3507 1.9885 0.0104  -0.0986 0.4449  194 ARG A NH1   
1751 N NH2   . ARG A 194 ? 2.1584 1.3714 1.9233 0.0488  -0.1277 0.4829  194 ARG A NH2   
1752 N N     . LEU A 195 ? 2.0270 1.2094 1.6339 -0.1995 -0.0573 0.5185  195 LEU A N     
1753 C CA    . LEU A 195 ? 2.0021 1.1862 1.6146 -0.2423 -0.0364 0.4943  195 LEU A CA    
1754 C C     . LEU A 195 ? 2.0784 1.2625 1.6520 -0.2766 -0.0242 0.5239  195 LEU A C     
1755 O O     . LEU A 195 ? 2.0788 1.2226 1.6460 -0.3109 -0.0055 0.5272  195 LEU A O     
1756 C CB    . LEU A 195 ? 1.8560 1.1155 1.4977 -0.2466 -0.0355 0.4481  195 LEU A CB    
1757 C CG    . LEU A 195 ? 1.7885 1.0454 1.4676 -0.2269 -0.0406 0.4092  195 LEU A CG    
1758 C CD1   . LEU A 195 ? 1.5914 0.9286 1.2884 -0.2130 -0.0488 0.3789  195 LEU A CD1   
1759 C CD2   . LEU A 195 ? 1.8499 1.0728 1.5458 -0.2588 -0.0255 0.3840  195 LEU A CD2   
1760 N N     . ASN A 196 ? 2.1063 1.3345 1.6527 -0.2678 -0.0344 0.5450  196 ASN A N     
1761 C CA    . ASN A 196 ? 2.1611 1.4013 1.6646 -0.2988 -0.0231 0.5701  196 ASN A CA    
1762 C C     . ASN A 196 ? 2.3433 1.5078 1.8176 -0.3213 -0.0094 0.6042  196 ASN A C     
1763 O O     . ASN A 196 ? 2.4364 1.5948 1.9076 -0.3604 0.0146  0.5966  196 ASN A O     
1764 C CB    . ASN A 196 ? 2.1524 1.4312 1.6241 -0.2781 -0.0421 0.5952  196 ASN A CB    
1765 C CG    . ASN A 196 ? 2.1529 1.5091 1.6150 -0.2959 -0.0344 0.5753  196 ASN A CG    
1766 O OD1   . ASN A 196 ? 2.2415 1.6078 1.6932 -0.3327 -0.0112 0.5682  196 ASN A OD1   
1767 N ND2   . ASN A 196 ? 2.0379 1.4485 1.5051 -0.2699 -0.0523 0.5657  196 ASN A ND2   
1768 N N     . GLU A 197 ? 2.3618 1.4848 1.8274 -0.2885 -0.0204 0.6324  197 GLU A N     
1769 C CA    . GLU A 197 ? 2.4245 1.4857 1.8725 -0.2977 -0.0044 0.6575  197 GLU A CA    
1770 C C     . GLU A 197 ? 2.4112 1.4106 1.8847 -0.3189 0.0108  0.6406  197 GLU A C     
1771 O O     . GLU A 197 ? 2.5221 1.4958 1.9889 -0.3538 0.0344  0.6419  197 GLU A O     
1772 C CB    . GLU A 197 ? 2.4823 1.5135 1.9187 -0.2542 -0.0204 0.6914  197 GLU A CB    
1773 C CG    . GLU A 197 ? 2.4554 1.5459 1.8663 -0.2325 -0.0379 0.7067  197 GLU A CG    
1774 C CD    . GLU A 197 ? 2.3684 1.4969 1.8051 -0.1941 -0.0646 0.6962  197 GLU A CD    
1775 O OE1   . GLU A 197 ? 2.2961 1.4914 1.7219 -0.1884 -0.0770 0.6911  197 GLU A OE1   
1776 O OE2   . GLU A 197 ? 2.3609 1.4516 1.8294 -0.1697 -0.0718 0.6918  197 GLU A OE2   
1777 N N     . LEU A 198 ? 2.2650 1.2427 1.7687 -0.2987 -0.0021 0.6218  198 LEU A N     
1778 C CA    . LEU A 198 ? 2.2386 1.1449 1.7639 -0.3095 0.0093  0.6066  198 LEU A CA    
1779 C C     . LEU A 198 ? 2.1181 1.0392 1.6617 -0.3568 0.0280  0.5695  198 LEU A C     
1780 O O     . LEU A 198 ? 2.0965 1.0178 1.6774 -0.3538 0.0282  0.5300  198 LEU A O     
1781 C CB    . LEU A 198 ? 2.2550 1.1386 1.8077 -0.2687 -0.0086 0.5928  198 LEU A CB    
1782 C CG    . LEU A 198 ? 2.3103 1.1693 1.8597 -0.2183 -0.0231 0.6258  198 LEU A CG    
1783 C CD1   . LEU A 198 ? 2.2647 1.1939 1.7947 -0.1989 -0.0393 0.6482  198 LEU A CD1   
1784 C CD2   . LEU A 198 ? 2.3113 1.1435 1.8927 -0.1826 -0.0353 0.6068  198 LEU A CD2   
1785 N N     . GLY A 199 ? 2.0772 1.0242 1.6028 -0.3952 0.0459  0.5765  199 GLY A N     
1786 C CA    . GLY A 199 ? 2.0768 1.0406 1.6251 -0.4415 0.0665  0.5445  199 GLY A CA    
1787 C C     . GLY A 199 ? 2.0711 1.1373 1.6368 -0.4525 0.0687  0.5164  199 GLY A C     
1788 O O     . GLY A 199 ? 2.0648 1.1580 1.6207 -0.4896 0.0885  0.5195  199 GLY A O     
1789 N N     . ILE A 200 ? 2.0588 1.1799 1.6499 -0.4195 0.0500  0.4896  200 ILE A N     
1790 C CA    . ILE A 200 ? 1.9356 1.1507 1.5494 -0.4256 0.0512  0.4579  200 ILE A CA    
1791 C C     . ILE A 200 ? 1.8804 1.1466 1.4633 -0.4098 0.0437  0.4779  200 ILE A C     
1792 O O     . ILE A 200 ? 1.7905 1.0495 1.3569 -0.3735 0.0237  0.4963  200 ILE A O     
1793 C CB    . ILE A 200 ? 1.8442 1.0907 1.5012 -0.4015 0.0365  0.4148  200 ILE A CB    
1794 C CG1   . ILE A 200 ? 1.8857 1.0919 1.5723 -0.4245 0.0449  0.3886  200 ILE A CG1   
1795 C CG2   . ILE A 200 ? 1.7469 1.0879 1.4251 -0.4025 0.0359  0.3856  200 ILE A CG2   
1796 C CD1   . ILE A 200 ? 1.8554 1.0725 1.5744 -0.3994 0.0295  0.3507  200 ILE A CD1   
1802 N N     . GLN A 201 ? 1.9180 1.2367 1.4945 -0.4383 0.0607  0.4729  201 GLN A N     
1803 C CA    . GLN A 201 ? 1.9462 1.3181 1.4932 -0.4286 0.0568  0.4847  201 GLN A CA    
1804 C C     . GLN A 201 ? 1.8943 1.3470 1.4672 -0.4460 0.0710  0.4505  201 GLN A C     
1805 O O     . GLN A 201 ? 1.8335 1.3366 1.3878 -0.4380 0.0697  0.4511  201 GLN A O     
1806 C CB    . GLN A 201 ? 2.0813 1.4154 1.5695 -0.4458 0.0661  0.5312  201 GLN A CB    
1807 C CG    . GLN A 201 ? 2.1961 1.5006 1.6794 -0.4903 0.0959  0.5378  201 GLN A CG    
1808 C CD    . GLN A 201 ? 2.2845 1.5052 1.7711 -0.4905 0.0969  0.5532  201 GLN A CD    
1809 O OE1   . GLN A 201 ? 2.2964 1.4720 1.7724 -0.4571 0.0766  0.5725  201 GLN A OE1   
1810 N NE2   . GLN A 201 ? 2.3157 1.5174 1.8205 -0.5272 0.1217  0.5438  201 GLN A NE2   
1811 N N     . LYS A 202 ? 1.9042 1.3683 1.5205 -0.4698 0.0844  0.4209  202 LYS A N     
1812 C CA    . LYS A 202 ? 1.8253 1.3675 1.4778 -0.4826 0.0959  0.3858  202 LYS A CA    
1813 C C     . LYS A 202 ? 1.7123 1.2733 1.4187 -0.4706 0.0832  0.3462  202 LYS A C     
1814 O O     . LYS A 202 ? 1.7241 1.2331 1.4377 -0.4589 0.0702  0.3450  202 LYS A O     
1815 C CB    . LYS A 202 ? 1.9165 1.4683 1.5723 -0.5293 0.1274  0.3885  202 LYS A CB    
1816 C CG    . LYS A 202 ? 1.9966 1.5545 1.5998 -0.5431 0.1445  0.4185  202 LYS A CG    
1817 C CD    . LYS A 202 ? 1.9686 1.6026 1.5727 -0.5293 0.1458  0.4011  202 LYS A CD    
1818 C CE    . LYS A 202 ? 2.0154 1.6567 1.5668 -0.5493 0.1675  0.4258  202 LYS A CE    
1819 N NZ    . LYS A 202 ? 1.9785 1.6911 1.5316 -0.5384 0.1725  0.4054  202 LYS A NZ    
1820 N N     . LEU A 203 ? 1.6226 1.2559 1.3650 -0.4733 0.0874  0.3140  203 LEU A N     
1821 C CA    . LEU A 203 ? 1.5845 1.2426 1.3712 -0.4566 0.0711  0.2773  203 LEU A CA    
1822 C C     . LEU A 203 ? 1.6392 1.2850 1.4655 -0.4875 0.0781  0.2570  203 LEU A C     
1823 O O     . LEU A 203 ? 1.6362 1.2684 1.4861 -0.4768 0.0624  0.2342  203 LEU A O     
1824 C CB    . LEU A 203 ? 1.4925 1.2322 1.2999 -0.4424 0.0699  0.2530  203 LEU A CB    
1825 C CG    . LEU A 203 ? 1.3690 1.1362 1.2088 -0.4147 0.0489  0.2200  203 LEU A CG    
1826 C CD1   . LEU A 203 ? 1.3475 1.1428 1.2380 -0.4373 0.0519  0.1892  203 LEU A CD1   
1827 C CD2   . LEU A 203 ? 1.3531 1.0613 1.1763 -0.3874 0.0284  0.2268  203 LEU A CD2   
1828 N N     . ARG A 204 ? 1.6962 1.3471 1.5286 -0.5275 0.1025  0.2644  204 ARG A N     
1829 C CA    . ARG A 204 ? 1.7251 1.3666 1.5967 -0.5625 0.1105  0.2461  204 ARG A CA    
1830 C C     . ARG A 204 ? 1.7414 1.2887 1.5902 -0.5713 0.1085  0.2643  204 ARG A C     
1831 O O     . ARG A 204 ? 1.7595 1.2819 1.6336 -0.6013 0.1142  0.2512  204 ARG A O     
1832 C CB    . ARG A 204 ? 1.8142 1.4967 1.7038 -0.6036 0.1401  0.2480  204 ARG A CB    
1833 C CG    . ARG A 204 ? 1.9383 1.5840 1.7759 -0.6188 0.1615  0.2883  204 ARG A CG    
1834 C CD    . ARG A 204 ? 1.9768 1.6852 1.8253 -0.6447 0.1905  0.2876  204 ARG A CD    
1835 N NE    . ARG A 204 ? 2.0510 1.7745 1.9445 -0.6898 0.2117  0.2743  204 ARG A NE    
1836 C CZ    . ARG A 204 ? 2.0564 1.8399 1.9755 -0.7163 0.2395  0.2679  204 ARG A CZ    
1837 N NH1   . ARG A 204 ? 2.0271 1.8565 1.9270 -0.7016 0.2501  0.2726  204 ARG A NH1   
1838 N NH2   . ARG A 204 ? 2.0663 1.8641 2.0312 -0.7582 0.2577  0.2558  204 ARG A NH2   
1839 N N     . ASP A 205 ? 1.7588 1.2538 1.5606 -0.5446 0.1000  0.2946  205 ASP A N     
1840 C CA    . ASP A 205 ? 1.8335 1.2342 1.6081 -0.5499 0.1007  0.3192  205 ASP A CA    
1841 C C     . ASP A 205 ? 1.7858 1.1452 1.5768 -0.5295 0.0813  0.2978  205 ASP A C     
1842 O O     . ASP A 205 ? 1.8718 1.1625 1.6625 -0.5478 0.0863  0.2999  205 ASP A O     
1843 C CB    . ASP A 205 ? 1.9069 1.2706 1.6262 -0.5281 0.0981  0.3629  205 ASP A CB    
1844 C CG    . ASP A 205 ? 1.9388 1.3198 1.6295 -0.5561 0.1213  0.3889  205 ASP A CG    
1845 O OD1   . ASP A 205 ? 1.9477 1.3939 1.6648 -0.5798 0.1371  0.3692  205 ASP A OD1   
1846 O OD2   . ASP A 205 ? 1.9470 1.2765 1.5884 -0.5538 0.1240  0.4293  205 ASP A OD2   
1847 N N     . ILE A 206 ? 1.6726 1.0705 1.4755 -0.4926 0.0609  0.2770  206 ILE A N     
1848 C CA    . ILE A 206 ? 1.6611 1.0279 1.4799 -0.4738 0.0442  0.2515  206 ILE A CA    
1849 C C     . ILE A 206 ? 1.6857 1.0566 1.5419 -0.5106 0.0493  0.2186  206 ILE A C     
1850 O O     . ILE A 206 ? 1.6966 1.0077 1.5555 -0.5144 0.0447  0.2060  206 ILE A O     
1851 C CB    . ILE A 206 ? 1.5395 0.9593 1.3676 -0.4330 0.0244  0.2310  206 ILE A CB    
1852 C CG1   . ILE A 206 ? 1.4413 0.9546 1.2967 -0.4434 0.0274  0.2101  206 ILE A CG1   
1853 C CG2   . ILE A 206 ? 1.4893 0.8920 1.2828 -0.3941 0.0153  0.2612  206 ILE A CG2   
1854 C CD1   . ILE A 206 ? 1.3962 0.9622 1.2509 -0.4053 0.0128  0.2003  206 ILE A CD1   
1860 N N     . LEU A 207 ? 1.6679 1.1099 1.5535 -0.5380 0.0591  0.2046  207 LEU A N     
1861 C CA    . LEU A 207 ? 1.7208 1.1792 1.6473 -0.5782 0.0646  0.1758  207 LEU A CA    
1862 C C     . LEU A 207 ? 1.9450 1.3178 1.8615 -0.6125 0.0778  0.1866  207 LEU A C     
1863 O O     . LEU A 207 ? 2.0220 1.3647 1.9563 -0.6270 0.0708  0.1606  207 LEU A O     
1864 C CB    . LEU A 207 ? 1.6394 1.1817 1.5965 -0.6048 0.0800  0.1711  207 LEU A CB    
1865 C CG    . LEU A 207 ? 1.5042 1.1391 1.4826 -0.5804 0.0710  0.1541  207 LEU A CG    
1866 C CD1   . LEU A 207 ? 1.4811 1.1764 1.4736 -0.6042 0.0949  0.1640  207 LEU A CD1   
1867 C CD2   . LEU A 207 ? 1.4266 1.1035 1.4484 -0.5794 0.0521  0.1127  207 LEU A CD2   
1868 N N     . SER A 208 ? 2.0044 1.3358 1.8896 -0.6265 0.0970  0.2248  208 SER A N     
1869 C CA    . SER A 208 ? 2.0147 1.2638 1.8881 -0.6625 0.1137  0.2393  208 SER A CA    
1870 C C     . SER A 208 ? 2.0602 1.2105 1.9035 -0.6380 0.1035  0.2488  208 SER A C     
1871 O O     . SER A 208 ? 2.1239 1.2078 1.9703 -0.6634 0.1097  0.2404  208 SER A O     
1872 C CB    . SER A 208 ? 1.9936 1.2312 1.8389 -0.6851 0.1387  0.2791  208 SER A CB    
1873 O OG    . SER A 208 ? 1.9317 1.1807 1.7394 -0.6483 0.1331  0.3082  208 SER A OG    
1874 N N     . LYS A 209 ? 2.0520 1.1933 1.8680 -0.5890 0.0890  0.2657  209 LYS A N     
1875 C CA    . LYS A 209 ? 2.1119 1.1726 1.9071 -0.5569 0.0776  0.2708  209 LYS A CA    
1876 C C     . LYS A 209 ? 2.1956 1.2641 2.0185 -0.5489 0.0623  0.2246  209 LYS A C     
1877 O O     . LYS A 209 ? 2.1728 1.3150 2.0295 -0.5639 0.0568  0.1918  209 LYS A O     
1878 C CB    . LYS A 209 ? 2.0074 1.0723 1.7739 -0.5067 0.0652  0.2992  209 LYS A CB    
1879 C CG    . LYS A 209 ? 2.0298 1.0720 1.7587 -0.5104 0.0767  0.3485  209 LYS A CG    
1880 C CD    . LYS A 209 ? 2.0864 1.0178 1.7857 -0.5094 0.0836  0.3796  209 LYS A CD    
1881 C CE    . LYS A 209 ? 2.0848 0.9919 1.7413 -0.5130 0.0931  0.4315  209 LYS A CE    
1882 N NZ    . LYS A 209 ? 2.1155 1.0127 1.7665 -0.5673 0.1189  0.4409  209 LYS A NZ    
1883 N N     . ASN A 210 ? 2.2801 1.2730 2.0881 -0.5244 0.0556  0.2221  210 ASN A N     
1884 C CA    . ASN A 210 ? 2.2857 1.2763 2.1118 -0.5175 0.0425  0.1781  210 ASN A CA    
1885 C C     . ASN A 210 ? 2.3025 1.2846 2.1169 -0.4625 0.0267  0.1744  210 ASN A C     
1886 O O     . ASN A 210 ? 2.2904 1.2271 2.0808 -0.4305 0.0275  0.2068  210 ASN A O     
1887 C CB    . ASN A 210 ? 2.3677 1.2706 2.1916 -0.5501 0.0529  0.1649  210 ASN A CB    
1888 C CG    . ASN A 210 ? 2.3632 1.2999 2.2162 -0.6077 0.0615  0.1435  210 ASN A CG    
1889 O OD1   . ASN A 210 ? 2.3189 1.3320 2.2030 -0.6179 0.0497  0.1091  210 ASN A OD1   
1890 N ND2   . ASN A 210 ? 2.3672 1.2479 2.2114 -0.6457 0.0821  0.1645  210 ASN A ND2   
1891 N N     . TYR A 211 ? 2.3341 1.3609 2.1668 -0.4532 0.0123  0.1344  211 TYR A N     
1892 C CA    . TYR A 211 ? 2.3433 1.3879 2.1707 -0.4040 -0.0026 0.1245  211 TYR A CA    
1893 C C     . TYR A 211 ? 2.4254 1.3854 2.2294 -0.3677 -0.0002 0.1427  211 TYR A C     
1894 O O     . TYR A 211 ? 2.4051 1.3829 2.2032 -0.3241 -0.0086 0.1530  211 TYR A O     
1895 C CB    . TYR A 211 ? 2.3123 1.3882 2.1565 -0.4092 -0.0152 0.0755  211 TYR A CB    
1896 C CG    . TYR A 211 ? 2.2226 1.3518 2.0672 -0.3669 -0.0305 0.0622  211 TYR A CG    
1897 C CD1   . TYR A 211 ? 2.1357 1.3562 1.9932 -0.3586 -0.0375 0.0664  211 TYR A CD1   
1898 C CD2   . TYR A 211 ? 2.2213 1.3072 2.0527 -0.3363 -0.0358 0.0442  211 TYR A CD2   
1899 C CE1   . TYR A 211 ? 2.0518 1.3174 1.9085 -0.3219 -0.0501 0.0545  211 TYR A CE1   
1900 C CE2   . TYR A 211 ? 2.1364 1.2699 1.9674 -0.2997 -0.0476 0.0322  211 TYR A CE2   
1901 C CZ    . TYR A 211 ? 2.0486 1.2711 1.8920 -0.2932 -0.0552 0.0379  211 TYR A CZ    
1902 O OH    . TYR A 211 ? 1.9593 1.2254 1.8009 -0.2585 -0.0657 0.0266  211 TYR A OH    
1903 N N     . ASN A 212 ? 2.4986 1.3671 2.2915 -0.3858 0.0121  0.1464  212 ASN A N     
1904 C CA    . ASN A 212 ? 2.5197 1.3009 2.2934 -0.3517 0.0169  0.1641  212 ASN A CA    
1905 C C     . ASN A 212 ? 2.4716 1.2546 2.2324 -0.3205 0.0164  0.2137  212 ASN A C     
1906 O O     . ASN A 212 ? 2.4256 1.2146 2.1846 -0.2744 0.0080  0.2227  212 ASN A O     
1907 C CB    . ASN A 212 ? 2.6260 1.3057 2.3888 -0.3819 0.0329  0.1626  212 ASN A CB    
1908 C CG    . ASN A 212 ? 2.6447 1.3108 2.4160 -0.4093 0.0316  0.1117  212 ASN A CG    
1909 O OD1   . ASN A 212 ? 2.5875 1.3006 2.3669 -0.3933 0.0184  0.0788  212 ASN A OD1   
1910 N ND2   . ASN A 212 ? 2.7234 1.3236 2.4904 -0.4520 0.0449  0.1048  212 ASN A ND2   
1911 N N     . GLU A 213 ? 2.4836 1.2639 2.2352 -0.3475 0.0252  0.2457  213 GLU A N     
1912 C CA    . GLU A 213 ? 2.4839 1.2609 2.2170 -0.3238 0.0240  0.2954  213 GLU A CA    
1913 C C     . GLU A 213 ? 2.3576 1.2338 2.0965 -0.3019 0.0098  0.3002  213 GLU A C     
1914 O O     . GLU A 213 ? 2.3816 1.2733 2.1041 -0.2904 0.0072  0.3388  213 GLU A O     
1915 C CB    . GLU A 213 ? 2.5491 1.2928 2.2649 -0.3629 0.0392  0.3269  213 GLU A CB    
1916 C CG    . GLU A 213 ? 2.6813 1.3221 2.3893 -0.3883 0.0552  0.3245  213 GLU A CG    
1917 C CD    . GLU A 213 ? 2.7965 1.4042 2.4855 -0.4278 0.0719  0.3579  213 GLU A CD    
1918 O OE1   . GLU A 213 ? 2.8027 1.4760 2.4869 -0.4404 0.0720  0.3760  213 GLU A OE1   
1919 O OE2   . GLU A 213 ? 2.8674 1.3841 2.5459 -0.4455 0.0866  0.3654  213 GLU A OE2   
1920 N N     . LEU A 214 ? 2.2145 1.1552 1.9739 -0.2970 0.0005  0.2612  214 LEU A N     
1921 C CA    . LEU A 214 ? 2.1021 1.1344 1.8674 -0.2781 -0.0114 0.2617  214 LEU A CA    
1922 C C     . LEU A 214 ? 2.1501 1.2018 1.9262 -0.2377 -0.0238 0.2375  214 LEU A C     
1923 O O     . LEU A 214 ? 2.1069 1.2037 1.8823 -0.2063 -0.0338 0.2497  214 LEU A O     
1924 C CB    . LEU A 214 ? 1.9718 1.0780 1.7522 -0.3151 -0.0088 0.2408  214 LEU A CB    
1925 C CG    . LEU A 214 ? 1.8279 1.0282 1.6136 -0.3011 -0.0178 0.2399  214 LEU A CG    
1926 C CD1   . LEU A 214 ? 1.8422 1.0440 1.6049 -0.2744 -0.0219 0.2815  214 LEU A CD1   
1927 C CD2   . LEU A 214 ? 1.7061 0.9649 1.5049 -0.3411 -0.0093 0.2302  214 LEU A CD2   
1928 N N     . GLU A 215 ? 2.2389 1.2539 2.0230 -0.2400 -0.0223 0.2029  215 GLU A N     
1929 C CA    . GLU A 215 ? 2.2227 1.2469 2.0133 -0.2036 -0.0308 0.1781  215 GLU A CA    
1930 C C     . GLU A 215 ? 2.2766 1.2563 2.0606 -0.1593 -0.0312 0.2062  215 GLU A C     
1931 O O     . GLU A 215 ? 2.2790 1.2663 2.0693 -0.1246 -0.0360 0.1917  215 GLU A O     
1932 C CB    . GLU A 215 ? 2.2384 1.2230 2.0322 -0.2196 -0.0275 0.1355  215 GLU A CB    
1933 C CG    . GLU A 215 ? 2.1578 1.1718 1.9561 -0.1930 -0.0363 0.1012  215 GLU A CG    
1934 C CD    . GLU A 215 ? 2.1609 1.1449 1.9574 -0.2164 -0.0353 0.0572  215 GLU A CD    
1935 O OE1   . GLU A 215 ? 2.2154 1.1374 2.0071 -0.2470 -0.0260 0.0542  215 GLU A OE1   
1936 O OE2   . GLU A 215 ? 2.1042 1.1259 1.9019 -0.2055 -0.0442 0.0258  215 GLU A OE2   
1937 N N     . LYS A 216 ? 2.2897 1.2241 2.0617 -0.1605 -0.0259 0.2472  216 LYS A N     
1938 C CA    . LYS A 216 ? 2.2360 1.1293 2.0050 -0.1186 -0.0279 0.2795  216 LYS A CA    
1939 C C     . LYS A 216 ? 2.1746 1.1101 1.9352 -0.1074 -0.0373 0.3237  216 LYS A C     
1940 O O     . LYS A 216 ? 2.1564 1.0687 1.9163 -0.0728 -0.0426 0.3552  216 LYS A O     
1941 C CB    . LYS A 216 ? 2.2852 1.0713 2.0444 -0.1228 -0.0145 0.2929  216 LYS A CB    
1942 C CG    . LYS A 216 ? 2.2511 0.9802 2.0145 -0.1271 -0.0046 0.2512  216 LYS A CG    
1943 C CD    . LYS A 216 ? 2.2555 0.8754 2.0110 -0.1117 0.0083  0.2701  216 LYS A CD    
1944 C CE    . LYS A 216 ? 2.2274 0.7762 1.9775 -0.1358 0.0222  0.2310  216 LYS A CE    
1945 N NZ    . LYS A 216 ? 2.1993 0.7434 1.9409 -0.1934 0.0278  0.2229  216 LYS A NZ    
1946 N N     . ILE A 217 ? 2.1412 1.1388 1.8953 -0.1366 -0.0394 0.3258  217 ILE A N     
1947 C CA    . ILE A 217 ? 2.1040 1.1455 1.8443 -0.1310 -0.0478 0.3635  217 ILE A CA    
1948 C C     . ILE A 217 ? 2.0047 1.1374 1.7553 -0.1154 -0.0598 0.3477  217 ILE A C     
1949 O O     . ILE A 217 ? 1.9459 1.1202 1.6862 -0.1038 -0.0694 0.3741  217 ILE A O     
1950 C CB    . ILE A 217 ? 2.1194 1.1640 1.8401 -0.1755 -0.0384 0.3802  217 ILE A CB    
1951 C CG1   . ILE A 217 ? 2.1830 1.1420 1.8975 -0.2026 -0.0228 0.3816  217 ILE A CG1   
1952 C CG2   . ILE A 217 ? 2.1399 1.2014 1.8356 -0.1684 -0.0456 0.4269  217 ILE A CG2   
1953 C CD1   . ILE A 217 ? 2.2584 1.1310 1.9621 -0.1767 -0.0221 0.4146  217 ILE A CD1   
1959 N N     . THR A 218 ? 1.9520 1.1132 1.7201 -0.1161 -0.0593 0.3045  218 THR A N     
1960 C CA    . THR A 218 ? 1.8523 1.0979 1.6286 -0.1080 -0.0679 0.2863  218 THR A CA    
1961 C C     . THR A 218 ? 1.8035 1.0613 1.5972 -0.0932 -0.0695 0.2439  218 THR A C     
1962 O O     . THR A 218 ? 1.7253 1.0448 1.5258 -0.0794 -0.0766 0.2288  218 THR A O     
1963 C CB    . THR A 218 ? 1.8388 1.1362 1.6095 -0.1458 -0.0634 0.2815  218 THR A CB    
1964 O OG1   . THR A 218 ? 1.8838 1.2585 1.6622 -0.1361 -0.0705 0.2631  218 THR A OG1   
1965 C CG2   . THR A 218 ? 1.7803 1.0552 1.5598 -0.1814 -0.0529 0.2544  218 THR A CG2   
1969 N N     . GLY A 219 ? 1.8646 1.0602 1.6619 -0.0968 -0.0623 0.2248  219 GLY A N     
1970 C CA    . GLY A 219 ? 1.8237 1.0217 1.6307 -0.0849 -0.0630 0.1844  219 GLY A CA    
1971 C C     . GLY A 219 ? 1.8191 1.0426 1.6293 -0.1208 -0.0620 0.1505  219 GLY A C     
1972 O O     . GLY A 219 ? 1.8162 1.0731 1.6267 -0.1509 -0.0609 0.1579  219 GLY A O     
1973 N N     . LYS A 220 ? 1.8186 1.0280 1.6314 -0.1176 -0.0624 0.1134  220 LYS A N     
1974 C CA    . LYS A 220 ? 1.7992 1.0314 1.6165 -0.1510 -0.0646 0.0798  220 LYS A CA    
1975 C C     . LYS A 220 ? 1.6963 1.0201 1.5227 -0.1558 -0.0732 0.0728  220 LYS A C     
1976 O O     . LYS A 220 ? 1.6549 1.0126 1.4907 -0.1886 -0.0737 0.0640  220 LYS A O     
1977 C CB    . LYS A 220 ? 1.8319 1.0278 1.6438 -0.1438 -0.0650 0.0421  220 LYS A CB    
1978 C CG    . LYS A 220 ? 1.8720 1.0874 1.6876 -0.1791 -0.0705 0.0067  220 LYS A CG    
1979 C CD    . LYS A 220 ? 1.9458 1.1142 1.7481 -0.1743 -0.0708 -0.0297 220 LYS A CD    
1980 C CE    . LYS A 220 ? 1.9579 1.1527 1.7635 -0.2097 -0.0806 -0.0650 220 LYS A CE    
1981 N NZ    . LYS A 220 ? 2.0112 1.1446 1.7975 -0.2144 -0.0797 -0.0997 220 LYS A NZ    
1982 N N     . ALA A 221 ? 1.6719 1.0348 1.4973 -0.1230 -0.0787 0.0770  221 ALA A N     
1983 C CA    . ALA A 221 ? 1.5899 1.0340 1.4217 -0.1225 -0.0857 0.0689  221 ALA A CA    
1984 C C     . ALA A 221 ? 1.5351 1.0187 1.3706 -0.1445 -0.0828 0.0924  221 ALA A C     
1985 O O     . ALA A 221 ? 1.4999 1.0285 1.3463 -0.1686 -0.0834 0.0788  221 ALA A O     
1986 C CB    . ALA A 221 ? 1.5458 1.0149 1.3741 -0.0838 -0.0899 0.0724  221 ALA A CB    
1987 N N     . LYS A 222 ? 1.5056 0.9735 1.3319 -0.1355 -0.0795 0.1279  222 LYS A N     
1988 C CA    . LYS A 222 ? 1.5038 1.0022 1.3264 -0.1569 -0.0748 0.1519  222 LYS A CA    
1989 C C     . LYS A 222 ? 1.5943 1.0675 1.4216 -0.1972 -0.0655 0.1507  222 LYS A C     
1990 O O     . LYS A 222 ? 1.6316 1.1479 1.4652 -0.2228 -0.0602 0.1514  222 LYS A O     
1991 C CB    . LYS A 222 ? 1.4913 0.9717 1.2980 -0.1396 -0.0754 0.1914  222 LYS A CB    
1992 C CG    . LYS A 222 ? 1.4481 0.9537 1.2538 -0.1018 -0.0845 0.1950  222 LYS A CG    
1993 C CD    . LYS A 222 ? 1.4990 1.0482 1.2918 -0.1005 -0.0873 0.2218  222 LYS A CD    
1994 C CE    . LYS A 222 ? 1.5317 1.0978 1.3246 -0.0642 -0.0972 0.2311  222 LYS A CE    
1995 N NZ    . LYS A 222 ? 1.5096 1.0954 1.3165 -0.0445 -0.0997 0.1981  222 LYS A NZ    
1996 N N     . ALA A 223 ? 1.6393 1.0421 1.4646 -0.2032 -0.0620 0.1480  223 ALA A N     
1997 C CA    . ALA A 223 ? 1.6548 1.0267 1.4849 -0.2436 -0.0524 0.1457  223 ALA A CA    
1998 C C     . ALA A 223 ? 1.5558 0.9808 1.4080 -0.2703 -0.0545 0.1121  223 ALA A C     
1999 O O     . ALA A 223 ? 1.5227 0.9751 1.3856 -0.3029 -0.0465 0.1163  223 ALA A O     
2000 C CB    . ALA A 223 ? 1.7431 1.0269 1.5666 -0.2431 -0.0486 0.1422  223 ALA A CB    
2001 N N     . LEU A 224 ? 1.5114 0.9522 1.3709 -0.2558 -0.0652 0.0797  224 LEU A N     
2002 C CA    . LEU A 224 ? 1.5025 0.9957 1.3837 -0.2771 -0.0712 0.0480  224 LEU A CA    
2003 C C     . LEU A 224 ? 1.4825 1.0587 1.3755 -0.2753 -0.0718 0.0529  224 LEU A C     
2004 O O     . LEU A 224 ? 1.5311 1.1556 1.4474 -0.3009 -0.0709 0.0399  224 LEU A O     
2005 C CB    . LEU A 224 ? 1.5219 1.0085 1.4005 -0.2593 -0.0837 0.0144  224 LEU A CB    
2006 C CG    . LEU A 224 ? 1.5207 1.0677 1.4206 -0.2771 -0.0942 -0.0168 224 LEU A CG    
2007 C CD1   . LEU A 224 ? 1.5427 1.0827 1.4625 -0.3231 -0.0902 -0.0252 224 LEU A CD1   
2008 C CD2   . LEU A 224 ? 1.5255 1.0655 1.4149 -0.2575 -0.1075 -0.0479 224 LEU A CD2   
2009 N N     . TYR A 225 ? 1.4237 1.0165 1.3021 -0.2448 -0.0727 0.0712  225 TYR A N     
2010 C CA    . TYR A 225 ? 1.3741 1.0383 1.2583 -0.2403 -0.0716 0.0762  225 TYR A CA    
2011 C C     . TYR A 225 ? 1.3831 1.0634 1.2717 -0.2711 -0.0572 0.0968  225 TYR A C     
2012 O O     . TYR A 225 ? 1.3564 1.0940 1.2653 -0.2880 -0.0529 0.0866  225 TYR A O     
2013 C CB    . TYR A 225 ? 1.3389 1.0081 1.2035 -0.2031 -0.0758 0.0914  225 TYR A CB    
2014 C CG    . TYR A 225 ? 1.3139 1.0336 1.1720 -0.1998 -0.0707 0.1095  225 TYR A CG    
2015 C CD1   . TYR A 225 ? 1.2647 1.0495 1.1369 -0.2035 -0.0698 0.0937  225 TYR A CD1   
2016 C CD2   . TYR A 225 ? 1.4025 1.1027 1.2384 -0.1913 -0.0674 0.1423  225 TYR A CD2   
2017 C CE1   . TYR A 225 ? 1.2880 1.1137 1.1507 -0.2007 -0.0630 0.1086  225 TYR A CE1   
2018 C CE2   . TYR A 225 ? 1.3989 1.1419 1.2234 -0.1900 -0.0631 0.1574  225 TYR A CE2   
2019 C CZ    . TYR A 225 ? 1.3375 1.1413 1.1744 -0.1952 -0.0597 0.1395  225 TYR A CZ    
2020 O OH    . TYR A 225 ? 1.3099 1.1509 1.1321 -0.1945 -0.0534 0.1529  225 TYR A OH    
2021 N N     . LEU A 226 ? 1.4220 1.0502 1.2916 -0.2783 -0.0490 0.1259  226 LEU A N     
2022 C CA    . LEU A 226 ? 1.4149 1.0477 1.2820 -0.3095 -0.0332 0.1478  226 LEU A CA    
2023 C C     . LEU A 226 ? 1.4703 1.1094 1.3655 -0.3486 -0.0259 0.1289  226 LEU A C     
2024 O O     . LEU A 226 ? 1.5179 1.2030 1.4289 -0.3733 -0.0141 0.1295  226 LEU A O     
2025 C CB    . LEU A 226 ? 1.4093 0.9750 1.2470 -0.3081 -0.0278 0.1836  226 LEU A CB    
2026 C CG    . LEU A 226 ? 1.3731 0.9251 1.1863 -0.2695 -0.0376 0.2046  226 LEU A CG    
2027 C CD1   . LEU A 226 ? 1.4239 0.8980 1.2161 -0.2658 -0.0359 0.2347  226 LEU A CD1   
2028 C CD2   . LEU A 226 ? 1.3372 0.9437 1.1361 -0.2642 -0.0353 0.2205  226 LEU A CD2   
2029 N N     . LEU A 227 ? 1.4704 1.0628 1.3724 -0.3546 -0.0323 0.1114  227 LEU A N     
2030 C CA    . LEU A 227 ? 1.5229 1.1180 1.4528 -0.3927 -0.0289 0.0898  227 LEU A CA    
2031 C C     . LEU A 227 ? 1.4726 1.1545 1.4372 -0.4003 -0.0336 0.0646  227 LEU A C     
2032 O O     . LEU A 227 ? 1.4966 1.2135 1.4882 -0.4338 -0.0229 0.0615  227 LEU A O     
2033 C CB    . LEU A 227 ? 1.6347 1.1683 1.5612 -0.3910 -0.0388 0.0693  227 LEU A CB    
2034 C CG    . LEU A 227 ? 1.7291 1.2577 1.6810 -0.4264 -0.0420 0.0388  227 LEU A CG    
2035 C CD1   . LEU A 227 ? 1.8143 1.2579 1.7465 -0.4210 -0.0466 0.0283  227 LEU A CD1   
2036 C CD2   . LEU A 227 ? 1.6915 1.2974 1.6722 -0.4246 -0.0571 0.0063  227 LEU A CD2   
2037 N N     . LYS A 228 ? 1.4306 1.1471 1.3957 -0.3684 -0.0486 0.0477  228 LYS A N     
2038 C CA    . LYS A 228 ? 1.4097 1.2056 1.4064 -0.3696 -0.0552 0.0249  228 LYS A CA    
2039 C C     . LYS A 228 ? 1.4447 1.2978 1.4503 -0.3741 -0.0401 0.0410  228 LYS A C     
2040 O O     . LYS A 228 ? 1.4810 1.3899 1.5224 -0.3959 -0.0345 0.0299  228 LYS A O     
2041 C CB    . LYS A 228 ? 1.3272 1.1385 1.3151 -0.3324 -0.0735 0.0064  228 LYS A CB    
2042 C CG    . LYS A 228 ? 1.3627 1.1398 1.3507 -0.3342 -0.0891 -0.0208 228 LYS A CG    
2043 C CD    . LYS A 228 ? 1.3260 1.1356 1.3108 -0.3040 -0.1062 -0.0424 228 LYS A CD    
2044 C CE    . LYS A 228 ? 1.3862 1.1633 1.3670 -0.3095 -0.1216 -0.0713 228 LYS A CE    
2045 N NZ    . LYS A 228 ? 1.3292 1.1363 1.3022 -0.2812 -0.1381 -0.0916 228 LYS A NZ    
2046 N N     . LEU A 229 ? 1.3989 1.2393 1.3727 -0.3536 -0.0334 0.0665  229 LEU A N     
2047 C CA    . LEU A 229 ? 1.3233 1.2077 1.2958 -0.3591 -0.0169 0.0830  229 LEU A CA    
2048 C C     . LEU A 229 ? 1.3377 1.2252 1.3273 -0.4012 0.0028  0.0919  229 LEU A C     
2049 O O     . LEU A 229 ? 1.2922 1.2399 1.3114 -0.4166 0.0142  0.0839  229 LEU A O     
2050 C CB    . LEU A 229 ? 1.3601 1.2157 1.2894 -0.3375 -0.0139 0.1120  229 LEU A CB    
2051 C CG    . LEU A 229 ? 1.3982 1.2562 1.3101 -0.2966 -0.0294 0.1075  229 LEU A CG    
2052 C CD1   . LEU A 229 ? 1.4350 1.2646 1.3081 -0.2823 -0.0265 0.1391  229 LEU A CD1   
2053 C CD2   . LEU A 229 ? 1.3838 1.3113 1.3136 -0.2837 -0.0311 0.0884  229 LEU A CD2   
2054 N N     . ALA A 230 ? 1.4141 1.2346 1.3856 -0.4188 0.0081  0.1087  230 ALA A N     
2055 C CA    . ALA A 230 ? 1.4884 1.2968 1.4659 -0.4596 0.0297  0.1235  230 ALA A CA    
2056 C C     . ALA A 230 ? 1.5182 1.3776 1.5485 -0.4912 0.0344  0.0980  230 ALA A C     
2057 O O     . ALA A 230 ? 1.5312 1.4197 1.5786 -0.5210 0.0560  0.1053  230 ALA A O     
2058 C CB    . ALA A 230 ? 1.5450 1.2651 1.4965 -0.4708 0.0310  0.1417  230 ALA A CB    
2059 N N     . GLN A 231 ? 1.5145 1.3862 1.5705 -0.4848 0.0142  0.0681  231 GLN A N     
2060 C CA    . GLN A 231 ? 1.4664 1.3916 1.5759 -0.5123 0.0125  0.0418  231 GLN A CA    
2061 C C     . GLN A 231 ? 1.3490 1.3552 1.4870 -0.4887 0.0014  0.0218  231 GLN A C     
2062 O O     . GLN A 231 ? 1.3148 1.3630 1.4935 -0.4973 -0.0122 -0.0047 231 GLN A O     
2063 C CB    . GLN A 231 ? 1.5422 1.4239 1.6604 -0.5277 -0.0037 0.0211  231 GLN A CB    
2064 C CG    . GLN A 231 ? 1.6641 1.5917 1.8373 -0.5680 -0.0031 -0.0014 231 GLN A CG    
2065 C CD    . GLN A 231 ? 1.7720 1.6538 1.9494 -0.5863 -0.0199 -0.0241 231 GLN A CD    
2066 O OE1   . GLN A 231 ? 1.8551 1.6672 1.9932 -0.5674 -0.0300 -0.0236 231 GLN A OE1   
2067 N NE2   . GLN A 231 ? 1.7430 1.6646 1.9691 -0.6240 -0.0225 -0.0450 231 GLN A NE2   
2068 N N     . ASN A 232 ? 1.3021 1.3282 1.4170 -0.4589 0.0064  0.0348  232 ASN A N     
2069 C CA    . ASN A 232 ? 1.2554 1.3551 1.3943 -0.4361 0.0009  0.0197  232 ASN A CA    
2070 C C     . ASN A 232 ? 1.2340 1.3512 1.3907 -0.4180 -0.0274 -0.0088 232 ASN A C     
2071 O O     . ASN A 232 ? 1.1911 1.3748 1.3841 -0.4109 -0.0338 -0.0258 232 ASN A O     
2072 C CB    . ASN A 232 ? 1.2587 1.4256 1.4444 -0.4624 0.0212  0.0167  232 ASN A CB    
2073 C CG    . ASN A 232 ? 1.2160 1.4515 1.4180 -0.4366 0.0246  0.0099  232 ASN A CG    
2074 O OD1   . ASN A 232 ? 1.1568 1.3882 1.3318 -0.4005 0.0125  0.0087  232 ASN A OD1   
2075 N ND2   . ASN A 232 ? 1.2603 1.5582 1.5078 -0.4554 0.0431  0.0055  232 ASN A ND2   
2076 N N     . LYS A 233 ? 1.2879 1.3443 1.4177 -0.4100 -0.0438 -0.0138 233 LYS A N     
2077 C CA    . LYS A 233 ? 1.3247 1.3912 1.4621 -0.3933 -0.0700 -0.0406 233 LYS A CA    
2078 C C     . LYS A 233 ? 1.3004 1.3320 1.3938 -0.3521 -0.0808 -0.0374 233 LYS A C     
2079 O O     . LYS A 233 ? 1.3308 1.3301 1.4097 -0.3410 -0.0985 -0.0533 233 LYS A O     
2080 C CB    . LYS A 233 ? 1.4247 1.4562 1.5740 -0.4229 -0.0811 -0.0578 233 LYS A CB    
2081 C CG    . LYS A 233 ? 1.5200 1.4589 1.6273 -0.4225 -0.0814 -0.0499 233 LYS A CG    
2082 C CD    . LYS A 233 ? 1.5909 1.5011 1.7112 -0.4515 -0.0940 -0.0737 233 LYS A CD    
2083 C CE    . LYS A 233 ? 1.6236 1.4434 1.7008 -0.4406 -0.0990 -0.0746 233 LYS A CE    
2084 N NZ    . LYS A 233 ? 1.6360 1.4286 1.7220 -0.4682 -0.1123 -0.1026 233 LYS A NZ    
2085 N N     . TYR A 234 ? 1.2495 1.2887 1.3214 -0.3310 -0.0689 -0.0177 234 TYR A N     
2086 C CA    . TYR A 234 ? 1.1849 1.2100 1.2237 -0.2916 -0.0779 -0.0158 234 TYR A CA    
2087 C C     . TYR A 234 ? 1.1038 1.1957 1.1597 -0.2714 -0.0823 -0.0279 234 TYR A C     
2088 O O     . TYR A 234 ? 1.0944 1.2357 1.1735 -0.2806 -0.0686 -0.0233 234 TYR A O     
2089 C CB    . TYR A 234 ? 1.2288 1.2184 1.2312 -0.2811 -0.0645 0.0136  234 TYR A CB    
2090 C CG    . TYR A 234 ? 1.2054 1.2031 1.1823 -0.2437 -0.0692 0.0174  234 TYR A CG    
2091 C CD1   . TYR A 234 ? 1.1863 1.1366 1.1347 -0.2196 -0.0791 0.0199  234 TYR A CD1   
2092 C CD2   . TYR A 234 ? 1.1617 1.2138 1.1444 -0.2330 -0.0619 0.0179  234 TYR A CD2   
2093 C CE1   . TYR A 234 ? 1.1452 1.1055 1.0733 -0.1878 -0.0824 0.0230  234 TYR A CE1   
2094 C CE2   . TYR A 234 ? 1.1192 1.1769 1.0784 -0.2016 -0.0653 0.0203  234 TYR A CE2   
2095 C CZ    . TYR A 234 ? 1.1178 1.1312 1.0506 -0.1801 -0.0759 0.0231  234 TYR A CZ    
2096 O OH    . TYR A 234 ? 1.0742 1.0960 0.9867 -0.1515 -0.0783 0.0251  234 TYR A OH    
2097 N N     . SER A 235 ? 1.0813 1.1723 1.1248 -0.2438 -0.0997 -0.0429 235 SER A N     
2098 C CA    . SER A 235 ? 1.0149 1.1595 1.0672 -0.2199 -0.1036 -0.0514 235 SER A CA    
2099 C C     . SER A 235 ? 0.9655 1.0895 0.9875 -0.1866 -0.1182 -0.0602 235 SER A C     
2100 O O     . SER A 235 ? 0.9283 1.0655 0.9571 -0.1790 -0.1356 -0.0801 235 SER A O     
2101 C CB    . SER A 235 ? 1.0560 1.2593 1.1550 -0.2338 -0.1116 -0.0696 235 SER A CB    
2102 O OG    . SER A 235 ? 1.0893 1.3427 1.2170 -0.2439 -0.0928 -0.0609 235 SER A OG    
2103 N N     . GLU A 236 ? 0.9850 1.0784 0.9732 -0.1674 -0.1110 -0.0447 236 GLU A N     
2104 C CA    . GLU A 236 ? 0.9978 1.0754 0.9584 -0.1355 -0.1203 -0.0511 236 GLU A CA    
2105 C C     . GLU A 236 ? 0.9639 1.0904 0.9291 -0.1156 -0.1194 -0.0557 236 GLU A C     
2106 O O     . GLU A 236 ? 1.0539 1.2116 1.0279 -0.1185 -0.1050 -0.0449 236 GLU A O     
2107 C CB    . GLU A 236 ? 1.0648 1.0969 0.9933 -0.1225 -0.1132 -0.0324 236 GLU A CB    
2108 C CG    . GLU A 236 ? 1.2102 1.1836 1.1296 -0.1336 -0.1154 -0.0286 236 GLU A CG    
2109 C CD    . GLU A 236 ? 1.3455 1.3037 1.2720 -0.1412 -0.1296 -0.0531 236 GLU A CD    
2110 O OE1   . GLU A 236 ? 1.3750 1.3322 1.2883 -0.1206 -0.1403 -0.0692 236 GLU A OE1   
2111 O OE2   . GLU A 236 ? 1.4225 1.3693 1.3658 -0.1695 -0.1298 -0.0565 236 GLU A OE2   
2112 N N     . PRO A 237 ? 0.8842 1.0134 0.8401 -0.0951 -0.1337 -0.0719 237 PRO A N     
2113 C CA    . PRO A 237 ? 0.8080 0.9755 0.7642 -0.0729 -0.1350 -0.0775 237 PRO A CA    
2114 C C     . PRO A 237 ? 0.8368 0.9952 0.7661 -0.0530 -0.1222 -0.0642 237 PRO A C     
2115 O O     . PRO A 237 ? 0.8342 0.9524 0.7392 -0.0483 -0.1194 -0.0548 237 PRO A O     
2116 C CB    . PRO A 237 ? 0.7421 0.8970 0.6852 -0.0592 -0.1548 -0.0965 237 PRO A CB    
2117 C CG    . PRO A 237 ? 0.7940 0.8917 0.7146 -0.0641 -0.1575 -0.0969 237 PRO A CG    
2118 C CD    . PRO A 237 ? 0.8722 0.9614 0.8123 -0.0928 -0.1489 -0.0863 237 PRO A CD    
2119 N N     . VAL A 238 ? 0.7976 0.9934 0.7328 -0.0414 -0.1147 -0.0636 238 VAL A N     
2120 C CA    . VAL A 238 ? 0.7379 0.9267 0.6461 -0.0226 -0.1042 -0.0548 238 VAL A CA    
2121 C C     . VAL A 238 ? 0.7445 0.9139 0.6286 0.0019  -0.1152 -0.0651 238 VAL A C     
2122 O O     . VAL A 238 ? 0.7092 0.8979 0.5989 0.0132  -0.1245 -0.0777 238 VAL A O     
2123 C CB    . VAL A 238 ? 0.6887 0.9189 0.6090 -0.0195 -0.0897 -0.0522 238 VAL A CB    
2124 C CG1   . VAL A 238 ? 0.6284 0.8492 0.5179 -0.0007 -0.0798 -0.0462 238 VAL A CG1   
2125 C CG2   . VAL A 238 ? 0.6845 0.9317 0.6250 -0.0453 -0.0753 -0.0418 238 VAL A CG2   
2132 N N     . GLU A 239 ? 0.7797 0.9114 0.6375 0.0101  -0.1138 -0.0589 239 GLU A N     
2133 C CA    . GLU A 239 ? 0.8050 0.9133 0.6377 0.0317  -0.1206 -0.0678 239 GLU A CA    
2134 C C     . GLU A 239 ? 0.7884 0.8813 0.5989 0.0446  -0.1099 -0.0566 239 GLU A C     
2135 O O     . GLU A 239 ? 0.7459 0.8163 0.5529 0.0389  -0.1067 -0.0450 239 GLU A O     
2136 C CB    . GLU A 239 ? 0.9402 1.0121 0.7674 0.0274  -0.1322 -0.0767 239 GLU A CB    
2137 C CG    . GLU A 239 ? 1.2167 1.2948 1.0453 0.0291  -0.1481 -0.0960 239 GLU A CG    
2138 C CD    . GLU A 239 ? 1.3548 1.4416 1.1628 0.0530  -0.1506 -0.1035 239 GLU A CD    
2139 O OE1   . GLU A 239 ? 1.4411 1.4991 1.2211 0.0690  -0.1460 -0.1037 239 GLU A OE1   
2140 O OE2   . GLU A 239 ? 1.3136 1.4360 1.1345 0.0561  -0.1563 -0.1083 239 GLU A OE2   
2141 N N     . ASN A 240 ? 0.8438 0.9477 0.6400 0.0617  -0.1048 -0.0595 240 ASN A N     
2142 C CA    . ASN A 240 ? 0.8533 0.9439 0.6300 0.0719  -0.0955 -0.0506 240 ASN A CA    
2143 C C     . ASN A 240 ? 0.8559 0.9114 0.6188 0.0825  -0.1001 -0.0540 240 ASN A C     
2144 O O     . ASN A 240 ? 0.9436 0.9867 0.6961 0.0926  -0.1069 -0.0678 240 ASN A O     
2145 C CB    . ASN A 240 ? 0.9189 1.0251 0.6821 0.0861  -0.0875 -0.0542 240 ASN A CB    
2146 C CG    . ASN A 240 ? 1.0482 1.1524 0.7982 0.0874  -0.0758 -0.0428 240 ASN A CG    
2147 O OD1   . ASN A 240 ? 1.1330 1.2216 0.8815 0.0841  -0.0765 -0.0332 240 ASN A OD1   
2148 N ND2   . ASN A 240 ? 1.0162 1.1365 0.7576 0.0920  -0.0655 -0.0438 240 ASN A ND2   
2149 N N     . LYS A 241 ? 0.8324 0.8717 0.5945 0.0809  -0.0961 -0.0411 241 LYS A N     
2150 C CA    . LYS A 241 ? 0.8527 0.8597 0.6060 0.0931  -0.0974 -0.0439 241 LYS A CA    
2151 C C     . LYS A 241 ? 0.8638 0.8732 0.6060 0.1068  -0.0884 -0.0384 241 LYS A C     
2152 O O     . LYS A 241 ? 0.8454 0.8736 0.5900 0.1014  -0.0832 -0.0255 241 LYS A O     
2153 C CB    . LYS A 241 ? 0.8634 0.8468 0.6289 0.0838  -0.1003 -0.0334 241 LYS A CB    
2154 C CG    . LYS A 241 ? 0.9736 0.9559 0.7529 0.0643  -0.1071 -0.0357 241 LYS A CG    
2155 C CD    . LYS A 241 ? 1.0749 1.0508 0.8657 0.0496  -0.1051 -0.0152 241 LYS A CD    
2156 C CE    . LYS A 241 ? 1.1201 1.1031 0.9258 0.0264  -0.1081 -0.0158 241 LYS A CE    
2157 N NZ    . LYS A 241 ? 1.1615 1.1331 0.9732 0.0114  -0.1048 0.0057  241 LYS A NZ    
2158 N N     . SER A 242 ? 0.8346 0.8250 0.5633 0.1228  -0.0861 -0.0488 242 SER A N     
2159 C CA    . SER A 242 ? 0.8159 0.8075 0.5376 0.1350  -0.0763 -0.0446 242 SER A CA    
2160 C C     . SER A 242 ? 0.7680 0.7522 0.5060 0.1348  -0.0755 -0.0290 242 SER A C     
2161 O O     . SER A 242 ? 0.7775 0.7414 0.5262 0.1316  -0.0809 -0.0257 242 SER A O     
2162 C CB    . SER A 242 ? 0.8438 0.8149 0.5460 0.1514  -0.0718 -0.0600 242 SER A CB    
2163 O OG    . SER A 242 ? 0.9365 0.8763 0.6401 0.1557  -0.0745 -0.0663 242 SER A OG    
2164 N N     . ARG A 243 ? 0.7682 0.7684 0.5086 0.1383  -0.0694 -0.0194 243 ARG A N     
2165 C CA    . ARG A 243 ? 0.8137 0.8125 0.5724 0.1409  -0.0705 -0.0032 243 ARG A CA    
2166 C C     . ARG A 243 ? 0.7719 0.7420 0.5367 0.1578  -0.0664 -0.0100 243 ARG A C     
2167 O O     . ARG A 243 ? 0.7644 0.7252 0.5153 0.1687  -0.0584 -0.0255 243 ARG A O     
2168 C CB    . ARG A 243 ? 0.8956 0.9224 0.6558 0.1398  -0.0660 0.0063  243 ARG A CB    
2169 C CG    . ARG A 243 ? 1.0139 1.0572 0.7860 0.1277  -0.0740 0.0281  243 ARG A CG    
2170 C CD    . ARG A 243 ? 1.0739 1.1315 0.8619 0.1351  -0.0741 0.0400  243 ARG A CD    
2171 N NE    . ARG A 243 ? 1.0747 1.1634 0.8548 0.1233  -0.0736 0.0458  243 ARG A NE    
2172 C CZ    . ARG A 243 ? 1.0085 1.1100 0.7721 0.1055  -0.0757 0.0493  243 ARG A CZ    
2173 N NH1   . ARG A 243 ? 1.0192 1.1092 0.7766 0.0974  -0.0783 0.0489  243 ARG A NH1   
2174 N NH2   . ARG A 243 ? 0.9012 1.0270 0.6549 0.0947  -0.0739 0.0524  243 ARG A NH2   
2175 N N     . LYS A 244 ? 0.7128 0.6664 0.4962 0.1603  -0.0705 0.0018  244 LYS A N     
2176 C CA    . LYS A 244 ? 0.7394 0.6617 0.5298 0.1772  -0.0643 -0.0055 244 LYS A CA    
2177 C C     . LYS A 244 ? 0.6438 0.5769 0.4582 0.1912  -0.0589 0.0074  244 LYS A C     
2178 O O     . LYS A 244 ? 0.7621 0.6744 0.5845 0.2080  -0.0494 0.0003  244 LYS A O     
2179 C CB    . LYS A 244 ? 0.7608 0.6481 0.5573 0.1736  -0.0701 -0.0038 244 LYS A CB    
2180 C CG    . LYS A 244 ? 0.7934 0.6738 0.5763 0.1555  -0.0782 -0.0119 244 LYS A CG    
2181 C CD    . LYS A 244 ? 0.7753 0.6545 0.5346 0.1560  -0.0765 -0.0355 244 LYS A CD    
2182 C CE    . LYS A 244 ? 0.8417 0.7185 0.5956 0.1376  -0.0866 -0.0425 244 LYS A CE    
2183 N NZ    . LYS A 244 ? 0.8023 0.7040 0.5406 0.1340  -0.0890 -0.0544 244 LYS A NZ    
2184 N N     . SER A 245 ? 0.6178 0.5834 0.4451 0.1844  -0.0652 0.0265  245 SER A N     
2185 C CA    . SER A 245 ? 0.6020 0.5825 0.4582 0.1971  -0.0639 0.0412  245 SER A CA    
2186 C C     . SER A 245 ? 0.6435 0.6677 0.5017 0.1882  -0.0666 0.0502  245 SER A C     
2187 O O     . SER A 245 ? 0.5671 0.6059 0.4046 0.1712  -0.0705 0.0492  245 SER A O     
2188 C CB    . SER A 245 ? 0.6268 0.5937 0.5047 0.1999  -0.0741 0.0625  245 SER A CB    
2189 O OG    . SER A 245 ? 0.8366 0.8201 0.7072 0.1810  -0.0872 0.0795  245 SER A OG    
2190 N N     . HIS A 246 ? 0.4856 0.5950 0.4150 0.0240  0.0173  -0.0218 246 HIS A N     
2191 C CA    . HIS A 246 ? 0.5062 0.5928 0.4213 0.0402  0.0228  -0.0261 246 HIS A CA    
2192 C C     . HIS A 246 ? 0.5427 0.6020 0.4474 0.0246  0.0316  -0.0227 246 HIS A C     
2193 O O     . HIS A 246 ? 0.4794 0.5083 0.3732 0.0129  0.0303  -0.0193 246 HIS A O     
2194 C CB    . HIS A 246 ? 0.4904 0.5382 0.3835 0.0587  0.0141  -0.0282 246 HIS A CB    
2195 C CG    . HIS A 246 ? 0.6791 0.7546 0.5816 0.0797  0.0022  -0.0301 246 HIS A CG    
2196 N ND1   . HIS A 246 ? 0.8016 0.8840 0.7024 0.0774  -0.0104 -0.0258 246 HIS A ND1   
2197 C CD2   . HIS A 246 ? 0.7204 0.8250 0.6355 0.1061  0.0001  -0.0376 246 HIS A CD2   
2198 C CE1   . HIS A 246 ? 0.8575 0.9728 0.7702 0.1013  -0.0212 -0.0287 246 HIS A CE1   
2199 N NE2   . HIS A 246 ? 0.7879 0.9174 0.7109 0.1207  -0.0146 -0.0361 246 HIS A NE2   
2200 N N     . GLY A 247 ? 0.4970 0.5733 0.4053 0.0261  0.0403  -0.0245 247 GLY A N     
2201 C CA    . GLY A 247 ? 0.3835 0.4458 0.2850 0.0133  0.0467  -0.0199 247 GLY A CA    
2202 C C     . GLY A 247 ? 0.5368 0.5884 0.4254 0.0231  0.0502  -0.0291 247 GLY A C     
2203 O O     . GLY A 247 ? 0.5404 0.5969 0.4260 0.0397  0.0497  -0.0398 247 GLY A O     
2204 N N     . ARG A 248 ? 0.5581 0.5955 0.4395 0.0137  0.0526  -0.0268 248 ARG A N     
2205 C CA    . ARG A 248 ? 0.5769 0.6127 0.4478 0.0183  0.0549  -0.0367 248 ARG A CA    
2206 C C     . ARG A 248 ? 0.5429 0.5945 0.4141 0.0092  0.0574  -0.0281 248 ARG A C     
2207 O O     . ARG A 248 ? 0.5294 0.5689 0.4046 0.0004  0.0560  -0.0183 248 ARG A O     
2208 C CB    . ARG A 248 ? 0.5620 0.5574 0.4208 0.0174  0.0519  -0.0456 248 ARG A CB    
2209 C CG    . ARG A 248 ? 0.6009 0.5921 0.4494 0.0198  0.0525  -0.0606 248 ARG A CG    
2210 C CD    . ARG A 248 ? 0.5585 0.5535 0.4019 0.0377  0.0525  -0.0734 248 ARG A CD    
2211 N NE    . ARG A 248 ? 0.5276 0.5106 0.3577 0.0399  0.0520  -0.0925 248 ARG A NE    
2212 C CZ    . ARG A 248 ? 0.7505 0.7661 0.5772 0.0390  0.0542  -0.1000 248 ARG A CZ    
2213 N NH1   . ARG A 248 ? 0.7379 0.7961 0.5720 0.0361  0.0578  -0.0858 248 ARG A NH1   
2214 N NH2   . ARG A 248 ? 0.7343 0.7376 0.5473 0.0397  0.0520  -0.1215 248 ARG A NH2   
2215 N N     . TYR A 249 ? 0.6175 0.6960 0.4825 0.0136  0.0604  -0.0319 249 TYR A N     
2216 C CA    . TYR A 249 ? 0.6597 0.7539 0.5201 0.0080  0.0606  -0.0214 249 TYR A CA    
2217 C C     . TYR A 249 ? 0.6616 0.7649 0.5088 0.0121  0.0580  -0.0361 249 TYR A C     
2218 O O     . TYR A 249 ? 0.7227 0.8348 0.5613 0.0202  0.0597  -0.0529 249 TYR A O     
2219 C CB    . TYR A 249 ? 0.6559 0.7829 0.5170 0.0052  0.0666  -0.0053 249 TYR A CB    
2220 C CG    . TYR A 249 ? 0.6932 0.8157 0.5688 -0.0049 0.0684  0.0096  249 TYR A CG    
2221 C CD1   . TYR A 249 ? 0.6875 0.8161 0.5755 -0.0027 0.0693  0.0025  249 TYR A CD1   
2222 C CD2   . TYR A 249 ? 0.7773 0.8897 0.6537 -0.0161 0.0681  0.0301  249 TYR A CD2   
2223 C CE1   . TYR A 249 ? 0.6667 0.7974 0.5695 -0.0149 0.0693  0.0134  249 TYR A CE1   
2224 C CE2   . TYR A 249 ? 0.7932 0.8975 0.6823 -0.0292 0.0690  0.0407  249 TYR A CE2   
2225 C CZ    . TYR A 249 ? 0.7006 0.8176 0.6039 -0.0302 0.0695  0.0314  249 TYR A CZ    
2226 O OH    . TYR A 249 ? 0.7230 0.8380 0.6403 -0.0461 0.0688  0.0392  249 TYR A OH    
2227 N N     . LEU A 250 ? 0.6419 0.7447 0.4883 0.0077  0.0529  -0.0318 250 LEU A N     
2228 C CA    . LEU A 250 ? 0.6080 0.7262 0.4443 0.0085  0.0477  -0.0463 250 LEU A CA    
2229 C C     . LEU A 250 ? 0.6429 0.7894 0.4733 0.0106  0.0434  -0.0304 250 LEU A C     
2230 O O     . LEU A 250 ? 0.6559 0.7938 0.4940 0.0101  0.0424  -0.0106 250 LEU A O     
2231 C CB    . LEU A 250 ? 0.6321 0.7283 0.4764 0.0005  0.0434  -0.0595 250 LEU A CB    
2232 C CG    . LEU A 250 ? 0.7039 0.7614 0.5508 -0.0032 0.0467  -0.0684 250 LEU A CG    
2233 C CD1   . LEU A 250 ? 0.7354 0.7775 0.5893 -0.0159 0.0448  -0.0757 250 LEU A CD1   
2234 C CD2   . LEU A 250 ? 0.7681 0.8164 0.6022 0.0035  0.0478  -0.0865 250 LEU A CD2   
2235 N N     . THR A 251 ? 0.5487 0.7259 0.3625 0.0143  0.0398  -0.0397 251 THR A N     
2236 C CA    . THR A 251 ? 0.5328 0.7380 0.3370 0.0185  0.0320  -0.0252 251 THR A CA    
2237 C C     . THR A 251 ? 0.4803 0.6908 0.2960 0.0162  0.0208  -0.0381 251 THR A C     
2238 O O     . THR A 251 ? 0.5021 0.7111 0.3203 0.0089  0.0186  -0.0643 251 THR A O     
2239 C CB    . THR A 251 ? 0.6235 0.8675 0.4001 0.0238  0.0328  -0.0283 251 THR A CB    
2240 O OG1   . THR A 251 ? 0.6877 0.9352 0.4583 0.0240  0.0456  -0.0140 251 THR A OG1   
2241 C CG2   . THR A 251 ? 0.5775 0.8522 0.3382 0.0299  0.0221  -0.0116 251 THR A CG2   
2245 N N     . LEU A 252 ? 0.4873 0.7028 0.3120 0.0221  0.0140  -0.0200 252 LEU A N     
2246 C CA    . LEU A 252 ? 0.5171 0.7526 0.3578 0.0224  0.0033  -0.0310 252 LEU A CA    
2247 C C     . LEU A 252 ? 0.6023 0.8832 0.4275 0.0235  -0.0083 -0.0454 252 LEU A C     
2248 O O     . LEU A 252 ? 0.5719 0.8716 0.3708 0.0308  -0.0099 -0.0355 252 LEU A O     
2249 C CB    . LEU A 252 ? 0.4484 0.6815 0.3012 0.0355  -0.0020 -0.0083 252 LEU A CB    
2250 C CG    . LEU A 252 ? 0.5697 0.7564 0.4345 0.0332  0.0087  0.0020  252 LEU A CG    
2251 C CD1   . LEU A 252 ? 0.5279 0.7026 0.4022 0.0484  0.0039  0.0214  252 LEU A CD1   
2252 C CD2   . LEU A 252 ? 0.4127 0.5838 0.2942 0.0195  0.0158  -0.0200 252 LEU A CD2   
2253 N N     . PRO A 253 ? 0.6524 0.9538 0.4927 0.0139  -0.0159 -0.0697 253 PRO A N     
2254 C CA    . PRO A 253 ? 0.5567 0.9049 0.3838 0.0125  -0.0295 -0.0876 253 PRO A CA    
2255 C C     . PRO A 253 ? 0.6358 1.0235 0.4498 0.0322  -0.0427 -0.0645 253 PRO A C     
2256 O O     . PRO A 253 ? 0.6984 1.1233 0.4864 0.0360  -0.0526 -0.0707 253 PRO A O     
2257 C CB    . PRO A 253 ? 0.5248 0.8890 0.3810 -0.0041 -0.0354 -0.1121 253 PRO A CB    
2258 C CG    . PRO A 253 ? 0.5726 0.9117 0.4563 -0.0035 -0.0266 -0.0986 253 PRO A CG    
2259 C CD    . PRO A 253 ? 0.6285 0.9156 0.4985 0.0015  -0.0124 -0.0815 253 PRO A CD    
2260 N N     . TYR A 254 ? 0.5987 0.9751 0.4277 0.0460  -0.0434 -0.0383 254 TYR A N     
2261 C CA    . TYR A 254 ? 0.5374 0.9363 0.3534 0.0687  -0.0561 -0.0098 254 TYR A CA    
2262 C C     . TYR A 254 ? 0.6040 0.9585 0.4322 0.0805  -0.0494 0.0180  254 TYR A C     
2263 O O     . TYR A 254 ? 0.5890 0.9134 0.4426 0.0727  -0.0392 0.0095  254 TYR A O     
2264 C CB    . TYR A 254 ? 0.5355 0.9948 0.3668 0.0775  -0.0770 -0.0213 254 TYR A CB    
2265 C CG    . TYR A 254 ? 0.5882 1.0561 0.4651 0.0744  -0.0773 -0.0355 254 TYR A CG    
2266 C CD1   . TYR A 254 ? 0.5312 0.9905 0.4278 0.0966  -0.0797 -0.0151 254 TYR A CD1   
2267 C CD2   . TYR A 254 ? 0.6016 1.0852 0.5006 0.0490  -0.0741 -0.0696 254 TYR A CD2   
2268 C CE1   . TYR A 254 ? 0.6067 1.0821 0.5448 0.0953  -0.0776 -0.0299 254 TYR A CE1   
2269 C CE2   . TYR A 254 ? 0.5640 1.0624 0.5042 0.0430  -0.0715 -0.0812 254 TYR A CE2   
2270 C CZ    . TYR A 254 ? 0.6076 1.1061 0.5679 0.0670  -0.0724 -0.0620 254 TYR A CZ    
2271 O OH    . TYR A 254 ? 0.4913 1.0122 0.4925 0.0630  -0.0676 -0.0751 254 TYR A OH    
2272 N N     . ASN A 255 ? 0.6838 1.0317 0.4907 0.0989  -0.0558 0.0510  255 ASN A N     
2273 C CA    . ASN A 255 ? 0.6749 0.9712 0.4876 0.1091  -0.0503 0.0774  255 ASN A CA    
2274 C C     . ASN A 255 ? 0.6251 0.9241 0.4724 0.1257  -0.0580 0.0719  255 ASN A C     
2275 O O     . ASN A 255 ? 0.7010 1.0477 0.5586 0.1420  -0.0744 0.0672  255 ASN A O     
2276 C CB    . ASN A 255 ? 0.6523 0.9355 0.4288 0.1221  -0.0555 0.1161  255 ASN A CB    
2277 C CG    . ASN A 255 ? 0.6955 0.9702 0.4419 0.1033  -0.0411 0.1241  255 ASN A CG    
2278 O OD1   . ASN A 255 ? 0.6331 0.9017 0.3895 0.0842  -0.0269 0.1018  255 ASN A OD1   
2279 N ND2   . ASN A 255 ? 0.7481 1.0237 0.4571 0.1096  -0.0440 0.1571  255 ASN A ND2   
2280 N N     . THR A 256 ? 0.6465 0.8998 0.5125 0.1224  -0.0461 0.0706  256 THR A N     
2281 C CA    . THR A 256 ? 0.6605 0.9210 0.5600 0.1385  -0.0501 0.0606  256 THR A CA    
2282 C C     . THR A 256 ? 0.6257 0.8237 0.5318 0.1431  -0.0399 0.0693  256 THR A C     
2283 O O     . THR A 256 ? 0.6396 0.7936 0.5331 0.1244  -0.0270 0.0739  256 THR A O     
2284 C CB    . THR A 256 ? 0.6879 0.9894 0.6166 0.1210  -0.0454 0.0256  256 THR A CB    
2285 O OG1   . THR A 256 ? 0.7124 1.0447 0.6747 0.1395  -0.0512 0.0162  256 THR A OG1   
2286 C CG2   . THR A 256 ? 0.7717 1.0319 0.7021 0.0953  -0.0261 0.0133  256 THR A CG2   
2290 N N     . ARG A 257 ? 0.6083 0.8063 0.5348 0.1693  -0.0465 0.0693  257 ARG A N     
2291 C CA    . ARG A 257 ? 0.6979 0.8422 0.6344 0.1755  -0.0372 0.0679  257 ARG A CA    
2292 C C     . ARG A 257 ? 0.6767 0.8521 0.6472 0.1720  -0.0284 0.0367  257 ARG A C     
2293 O O     . ARG A 257 ? 0.7421 0.8872 0.7235 0.1819  -0.0216 0.0298  257 ARG A O     
2294 C CB    . ARG A 257 ? 0.8576 0.9702 0.7903 0.2119  -0.0496 0.0888  257 ARG A CB    
2295 C CG    . ARG A 257 ? 0.9692 1.0249 0.8652 0.2135  -0.0544 0.1249  257 ARG A CG    
2296 C CD    . ARG A 257 ? 0.9482 0.9594 0.8415 0.2515  -0.0666 0.1434  257 ARG A CD    
2297 N NE    . ARG A 257 ? 0.9608 0.9231 0.8704 0.2565  -0.0572 0.1266  257 ARG A NE    
2298 C CZ    . ARG A 257 ? 1.0117 0.9057 0.9075 0.2341  -0.0457 0.1302  257 ARG A CZ    
2299 N NH1   . ARG A 257 ? 0.9205 0.7901 0.7899 0.2042  -0.0405 0.1510  257 ARG A NH1   
2300 N NH2   . ARG A 257 ? 1.0804 0.9360 0.9898 0.2413  -0.0391 0.1107  257 ARG A NH2   
2301 N N     . ASP A 258 ? 0.5658 0.8028 0.5518 0.1576  -0.0286 0.0175  258 ASP A N     
2302 C CA    . ASP A 258 ? 0.4698 0.7480 0.4894 0.1526  -0.0205 -0.0094 258 ASP A CA    
2303 C C     . ASP A 258 ? 0.5311 0.7820 0.5454 0.1195  -0.0021 -0.0224 258 ASP A C     
2304 O O     . ASP A 258 ? 0.5079 0.7652 0.5114 0.0936  0.0005  -0.0276 258 ASP A O     
2305 C CB    . ASP A 258 ? 0.5031 0.8626 0.5440 0.1499  -0.0309 -0.0234 258 ASP A CB    
2306 C CG    . ASP A 258 ? 0.6404 1.0552 0.7220 0.1496  -0.0239 -0.0477 258 ASP A CG    
2307 O OD1   . ASP A 258 ? 0.6781 1.1676 0.7846 0.1533  -0.0352 -0.0587 258 ASP A OD1   
2308 O OD2   . ASP A 258 ? 0.6373 1.0270 0.7260 0.1446  -0.0073 -0.0565 258 ASP A OD2   
2309 N N     . VAL A 259 ? 0.5350 0.7527 0.5536 0.1224  0.0097  -0.0280 259 VAL A N     
2310 C CA    . VAL A 259 ? 0.5062 0.6968 0.5163 0.0944  0.0256  -0.0380 259 VAL A CA    
2311 C C     . VAL A 259 ? 0.4475 0.6837 0.4716 0.0692  0.0326  -0.0559 259 VAL A C     
2312 O O     . VAL A 259 ? 0.5923 0.8066 0.6009 0.0438  0.0393  -0.0581 259 VAL A O     
2313 C CB    . VAL A 259 ? 0.7027 0.8620 0.7154 0.1040  0.0359  -0.0450 259 VAL A CB    
2314 C CG1   . VAL A 259 ? 0.4355 0.5727 0.4360 0.0766  0.0505  -0.0538 259 VAL A CG1   
2315 C CG2   . VAL A 259 ? 0.7280 0.8290 0.7235 0.1214  0.0293  -0.0284 259 VAL A CG2   
2322 N N     . LYS A 260 ? 0.4197 0.7186 0.4735 0.0761  0.0302  -0.0684 260 LYS A N     
2323 C CA    . LYS A 260 ? 0.4293 0.7733 0.4990 0.0472  0.0370  -0.0854 260 LYS A CA    
2324 C C     . LYS A 260 ? 0.5112 0.8541 0.5655 0.0273  0.0283  -0.0846 260 LYS A C     
2325 O O     . LYS A 260 ? 0.6307 0.9730 0.6823 -0.0034 0.0355  -0.0954 260 LYS A O     
2326 C CB    . LYS A 260 ? 0.4111 0.8351 0.5212 0.0589  0.0342  -0.0993 260 LYS A CB    
2327 C CG    . LYS A 260 ? 0.4521 0.8833 0.5791 0.0835  0.0440  -0.1046 260 LYS A CG    
2328 C CD    . LYS A 260 ? 0.5178 1.0403 0.6902 0.0956  0.0432  -0.1210 260 LYS A CD    
2329 C CE    . LYS A 260 ? 0.5207 1.0839 0.7077 0.1263  0.0190  -0.1147 260 LYS A CE    
2330 N NZ    . LYS A 260 ? 0.5078 1.0136 0.6740 0.1663  0.0077  -0.0955 260 LYS A NZ    
2331 N N     . VAL A 261 ? 0.4479 0.7865 0.4887 0.0451  0.0132  -0.0715 261 VAL A N     
2332 C CA    . VAL A 261 ? 0.4416 0.7809 0.4634 0.0307  0.0050  -0.0724 261 VAL A CA    
2333 C C     . VAL A 261 ? 0.4726 0.7473 0.4640 0.0185  0.0139  -0.0646 261 VAL A C     
2334 O O     . VAL A 261 ? 0.5135 0.7765 0.4930 -0.0034 0.0170  -0.0746 261 VAL A O     
2335 C CB    . VAL A 261 ? 0.5130 0.8791 0.5268 0.0554  -0.0144 -0.0593 261 VAL A CB    
2336 C CG1   . VAL A 261 ? 0.4141 0.7767 0.4007 0.0419  -0.0205 -0.0608 261 VAL A CG1   
2337 C CG2   . VAL A 261 ? 0.4134 0.8545 0.4593 0.0689  -0.0271 -0.0690 261 VAL A CG2   
2344 N N     . ILE A 262 ? 0.3909 0.6240 0.3707 0.0338  0.0169  -0.0477 262 ILE A N     
2345 C CA    . ILE A 262 ? 0.5181 0.6997 0.4735 0.0244  0.0238  -0.0396 262 ILE A CA    
2346 C C     . ILE A 262 ? 0.5230 0.6782 0.4767 0.0039  0.0370  -0.0505 262 ILE A C     
2347 O O     . ILE A 262 ? 0.4879 0.6158 0.4243 -0.0074 0.0401  -0.0509 262 ILE A O     
2348 C CB    . ILE A 262 ? 0.5197 0.6648 0.4661 0.0414  0.0234  -0.0200 262 ILE A CB    
2349 C CG1   . ILE A 262 ? 0.4284 0.5889 0.3685 0.0614  0.0102  -0.0029 262 ILE A CG1   
2350 C CG2   . ILE A 262 ? 0.5087 0.6111 0.4362 0.0295  0.0306  -0.0136 262 ILE A CG2   
2351 C CD1   . ILE A 262 ? 0.4446 0.5658 0.3786 0.0791  0.0082  0.0171  262 ILE A CD1   
2357 N N     . LEU A 263 ? 0.4631 0.6294 0.4336 0.0012  0.0445  -0.0588 263 LEU A N     
2358 C CA    . LEU A 263 ? 0.5700 0.7064 0.5328 -0.0143 0.0573  -0.0630 263 LEU A CA    
2359 C C     . LEU A 263 ? 0.5419 0.6601 0.4902 -0.0372 0.0602  -0.0691 263 LEU A C     
2360 O O     . LEU A 263 ? 0.6076 0.6848 0.5366 -0.0407 0.0635  -0.0636 263 LEU A O     
2361 C CB    . LEU A 263 ? 0.5862 0.7513 0.5688 -0.0159 0.0667  -0.0728 263 LEU A CB    
2362 C CG    . LEU A 263 ? 0.6948 0.8298 0.6640 -0.0273 0.0805  -0.0739 263 LEU A CG    
2363 C CD1   . LEU A 263 ? 0.7373 0.8215 0.6835 -0.0191 0.0779  -0.0631 263 LEU A CD1   
2364 C CD2   . LEU A 263 ? 0.6211 0.7877 0.6077 -0.0205 0.0909  -0.0830 263 LEU A CD2   
2365 N N     . PRO A 264 ? 0.4472 0.5945 0.4049 -0.0516 0.0574  -0.0812 264 PRO A N     
2366 C CA    . PRO A 264 ? 0.4990 0.6196 0.4414 -0.0731 0.0592  -0.0892 264 PRO A CA    
2367 C C     . PRO A 264 ? 0.5147 0.5993 0.4338 -0.0642 0.0544  -0.0840 264 PRO A C     
2368 O O     . PRO A 264 ? 0.6360 0.6817 0.5383 -0.0738 0.0578  -0.0866 264 PRO A O     
2369 C CB    . PRO A 264 ? 0.4088 0.5729 0.3667 -0.0858 0.0521  -0.1047 264 PRO A CB    
2370 C CG    . PRO A 264 ? 0.5034 0.7229 0.4904 -0.0769 0.0513  -0.1055 264 PRO A CG    
2371 C CD    . PRO A 264 ? 0.4605 0.6672 0.4443 -0.0484 0.0511  -0.0896 264 PRO A CD    
2372 N N     . TYR A 265 ? 0.4431 0.5416 0.3611 -0.0451 0.0471  -0.0758 265 TYR A N     
2373 C CA    . TYR A 265 ? 0.5331 0.6110 0.4322 -0.0371 0.0445  -0.0714 265 TYR A CA    
2374 C C     . TYR A 265 ? 0.5407 0.5858 0.4326 -0.0308 0.0500  -0.0588 265 TYR A C     
2375 O O     . TYR A 265 ? 0.5473 0.5675 0.4259 -0.0303 0.0514  -0.0593 265 TYR A O     
2376 C CB    . TYR A 265 ? 0.5096 0.6189 0.4069 -0.0228 0.0361  -0.0649 265 TYR A CB    
2377 C CG    . TYR A 265 ? 0.5194 0.6663 0.4201 -0.0281 0.0276  -0.0796 265 TYR A CG    
2378 C CD1   . TYR A 265 ? 0.5360 0.6838 0.4204 -0.0325 0.0241  -0.0939 265 TYR A CD1   
2379 C CD2   . TYR A 265 ? 0.5698 0.7549 0.4910 -0.0279 0.0224  -0.0822 265 TYR A CD2   
2380 C CE1   . TYR A 265 ? 0.5145 0.6982 0.4006 -0.0398 0.0145  -0.1111 265 TYR A CE1   
2381 C CE2   . TYR A 265 ? 0.5932 0.8203 0.5203 -0.0342 0.0124  -0.0972 265 TYR A CE2   
2382 C CZ    . TYR A 265 ? 0.6578 0.8833 0.5662 -0.0417 0.0080  -0.1119 265 TYR A CZ    
2383 O OH    . TYR A 265 ? 0.8710 1.1413 0.7846 -0.0500 -0.0039 -0.1301 265 TYR A OH    
2384 N N     . LEU A 266 ? 0.4440 0.4919 0.3454 -0.0242 0.0517  -0.0492 266 LEU A N     
2385 C CA    . LEU A 266 ? 0.4992 0.5190 0.3952 -0.0214 0.0557  -0.0406 266 LEU A CA    
2386 C C     . LEU A 266 ? 0.5853 0.5790 0.4712 -0.0328 0.0615  -0.0460 266 LEU A C     
2387 O O     . LEU A 266 ? 0.7089 0.6792 0.5833 -0.0308 0.0613  -0.0416 266 LEU A O     
2388 C CB    . LEU A 266 ? 0.4978 0.5219 0.4048 -0.0131 0.0564  -0.0355 266 LEU A CB    
2389 C CG    . LEU A 266 ? 0.5499 0.5454 0.4506 -0.0120 0.0595  -0.0310 266 LEU A CG    
2390 C CD1   . LEU A 266 ? 0.5730 0.5546 0.4660 -0.0110 0.0557  -0.0210 266 LEU A CD1   
2391 C CD2   . LEU A 266 ? 0.5440 0.5407 0.4545 -0.0017 0.0601  -0.0312 266 LEU A CD2   
2392 N N     . LYS A 267 ? 0.4925 0.4925 0.3823 -0.0453 0.0662  -0.0544 267 LYS A N     
2393 C CA    . LYS A 267 ? 0.6075 0.5775 0.4823 -0.0585 0.0723  -0.0554 267 LYS A CA    
2394 C C     . LYS A 267 ? 0.6652 0.6078 0.5248 -0.0587 0.0679  -0.0577 267 LYS A C     
2395 O O     . LYS A 267 ? 0.7500 0.6597 0.5927 -0.0564 0.0681  -0.0521 267 LYS A O     
2396 C CB    . LYS A 267 ? 0.6210 0.6056 0.5034 -0.0774 0.0801  -0.0627 267 LYS A CB    
2397 C CG    . LYS A 267 ? 0.7312 0.7433 0.6271 -0.0754 0.0876  -0.0627 267 LYS A CG    
2398 C CD    . LYS A 267 ? 0.8983 0.9214 0.7962 -0.0986 0.0997  -0.0673 267 LYS A CD    
2399 C CE    . LYS A 267 ? 0.9789 1.0461 0.8968 -0.0941 0.1085  -0.0724 267 LYS A CE    
2400 N NZ    . LYS A 267 ? 0.9903 1.0424 0.8957 -0.0789 0.1122  -0.0681 267 LYS A NZ    
2401 N N     . LYS A 268 ? 0.5521 0.5096 0.4164 -0.0590 0.0630  -0.0673 268 LYS A N     
2402 C CA    . LYS A 268 ? 0.4941 0.4260 0.3436 -0.0560 0.0592  -0.0746 268 LYS A CA    
2403 C C     . LYS A 268 ? 0.4703 0.3959 0.3138 -0.0365 0.0565  -0.0665 268 LYS A C     
2404 O O     . LYS A 268 ? 0.5964 0.4916 0.4266 -0.0298 0.0551  -0.0672 268 LYS A O     
2405 C CB    . LYS A 268 ? 0.5888 0.5456 0.4432 -0.0589 0.0541  -0.0896 268 LYS A CB    
2406 C CG    . LYS A 268 ? 0.7476 0.6917 0.5879 -0.0473 0.0497  -0.1000 268 LYS A CG    
2407 C CD    . LYS A 268 ? 0.8466 0.8047 0.6853 -0.0572 0.0447  -0.1210 268 LYS A CD    
2408 C CE    . LYS A 268 ? 0.9372 0.8988 0.7619 -0.0410 0.0409  -0.1340 268 LYS A CE    
2409 N NZ    . LYS A 268 ? 1.0628 0.9773 0.8732 -0.0291 0.0430  -0.1365 268 LYS A NZ    
2410 N N     . ALA A 269 ? 0.4813 0.4359 0.3357 -0.0278 0.0554  -0.0582 269 ALA A N     
2411 C CA    . ALA A 269 ? 0.5180 0.4751 0.3716 -0.0152 0.0539  -0.0501 269 ALA A CA    
2412 C C     . ALA A 269 ? 0.7486 0.6806 0.5962 -0.0148 0.0542  -0.0429 269 ALA A C     
2413 O O     . ALA A 269 ? 0.5978 0.5237 0.4412 -0.0048 0.0512  -0.0410 269 ALA A O     
2414 C CB    . ALA A 269 ? 0.4643 0.4510 0.3291 -0.0119 0.0534  -0.0401 269 ALA A CB    
2415 N N     . ILE A 270 ? 0.6840 0.6074 0.5310 -0.0244 0.0575  -0.0399 270 ILE A N     
2416 C CA    . ILE A 270 ? 0.6284 0.5323 0.4649 -0.0246 0.0573  -0.0336 270 ILE A CA    
2417 C C     . ILE A 270 ? 0.6148 0.4856 0.4322 -0.0233 0.0556  -0.0337 270 ILE A C     
2418 O O     . ILE A 270 ? 0.4963 0.3557 0.3045 -0.0128 0.0500  -0.0286 270 ILE A O     
2419 C CB    . ILE A 270 ? 0.5904 0.4957 0.4272 -0.0341 0.0633  -0.0328 270 ILE A CB    
2420 C CG1   . ILE A 270 ? 0.4034 0.3290 0.2555 -0.0294 0.0623  -0.0314 270 ILE A CG1   
2421 C CG2   . ILE A 270 ? 0.6082 0.4907 0.4246 -0.0364 0.0638  -0.0278 270 ILE A CG2   
2422 C CD1   . ILE A 270 ? 0.5096 0.4464 0.3693 -0.0330 0.0685  -0.0356 270 ILE A CD1   
2428 N N     . ASN A 271 ? 0.5902 0.4451 0.4017 -0.0340 0.0594  -0.0396 271 ASN A N     
2429 C CA    . ASN A 271 ? 0.6806 0.4917 0.4710 -0.0345 0.0578  -0.0394 271 ASN A CA    
2430 C C     . ASN A 271 ? 0.8019 0.6044 0.5894 -0.0128 0.0499  -0.0432 271 ASN A C     
2431 O O     . ASN A 271 ? 0.9518 0.7204 0.7217 -0.0019 0.0448  -0.0377 271 ASN A O     
2432 C CB    . ASN A 271 ? 0.5852 0.3829 0.3742 -0.0534 0.0625  -0.0489 271 ASN A CB    
2433 C CG    . ASN A 271 ? 0.7163 0.5176 0.5047 -0.0761 0.0720  -0.0441 271 ASN A CG    
2434 O OD1   . ASN A 271 ? 0.8359 0.6430 0.6190 -0.0755 0.0755  -0.0341 271 ASN A OD1   
2435 N ND2   . ASN A 271 ? 0.6888 0.4911 0.4826 -0.0974 0.0766  -0.0532 271 ASN A ND2   
2436 N N     . GLU A 272 ? 0.6709 0.5066 0.4746 -0.0046 0.0488  -0.0522 272 GLU A N     
2437 C CA    . GLU A 272 ? 0.6298 0.4645 0.4320 0.0167  0.0438  -0.0594 272 GLU A CA    
2438 C C     . GLU A 272 ? 0.6382 0.5005 0.4505 0.0315  0.0398  -0.0507 272 GLU A C     
2439 O O     . GLU A 272 ? 0.5938 0.4505 0.4030 0.0518  0.0342  -0.0526 272 GLU A O     
2440 C CB    . GLU A 272 ? 0.5907 0.4522 0.4012 0.0185  0.0457  -0.0742 272 GLU A CB    
2441 C CG    . GLU A 272 ? 0.7269 0.5644 0.5287 0.0021  0.0471  -0.0866 272 GLU A CG    
2442 C CD    . GLU A 272 ? 0.8343 0.6949 0.6376 0.0066  0.0464  -0.1054 272 GLU A CD    
2443 O OE1   . GLU A 272 ? 0.8368 0.7286 0.6446 0.0247  0.0466  -0.1081 272 GLU A OE1   
2444 O OE2   . GLU A 272 ? 0.8516 0.7038 0.6511 -0.0096 0.0459  -0.1182 272 GLU A OE2   
2445 N N     . ALA A 273 ? 0.5772 0.4697 0.4029 0.0217  0.0419  -0.0425 273 ALA A N     
2446 C CA    . ALA A 273 ? 0.6361 0.5513 0.4713 0.0285  0.0372  -0.0350 273 ALA A CA    
2447 C C     . ALA A 273 ? 0.5772 0.4613 0.3943 0.0352  0.0302  -0.0288 273 ALA A C     
2448 O O     . ALA A 273 ? 0.5031 0.3948 0.3216 0.0534  0.0223  -0.0282 273 ALA A O     
2449 C CB    . ALA A 273 ? 0.6369 0.5730 0.4840 0.0138  0.0400  -0.0286 273 ALA A CB    
2450 N N     . TYR A 274 ? 0.5587 0.4113 0.3582 0.0218  0.0332  -0.0238 274 TYR A N     
2451 C CA    . TYR A 274 ? 0.6358 0.4597 0.4118 0.0257  0.0272  -0.0141 274 TYR A CA    
2452 C C     . TYR A 274 ? 0.7663 0.5596 0.5278 0.0465  0.0194  -0.0130 274 TYR A C     
2453 O O     . TYR A 274 ? 0.8525 0.6400 0.6022 0.0616  0.0089  -0.0047 274 TYR A O     
2454 C CB    . TYR A 274 ? 0.6239 0.4202 0.3803 0.0058  0.0353  -0.0087 274 TYR A CB    
2455 C CG    . TYR A 274 ? 0.7742 0.5894 0.5289 -0.0025 0.0360  -0.0051 274 TYR A CG    
2456 C CD1   . TYR A 274 ? 0.8371 0.6829 0.6137 -0.0109 0.0411  -0.0120 274 TYR A CD1   
2457 C CD2   . TYR A 274 ? 0.7567 0.5571 0.4849 0.0001  0.0304  0.0044  274 TYR A CD2   
2458 C CE1   . TYR A 274 ? 0.9126 0.7697 0.6865 -0.0168 0.0413  -0.0127 274 TYR A CE1   
2459 C CE2   . TYR A 274 ? 0.8325 0.6514 0.5568 -0.0072 0.0307  0.0031  274 TYR A CE2   
2460 C CZ    . TYR A 274 ? 0.8771 0.7224 0.6254 -0.0155 0.0365  -0.0072 274 TYR A CZ    
2461 O OH    . TYR A 274 ? 1.0634 0.9208 0.8075 -0.0213 0.0366  -0.0125 274 TYR A OH    
2462 N N     . ASN A 275 ? 0.7565 0.5300 0.5180 0.0495  0.0230  -0.0226 275 ASN A N     
2463 C CA    . ASN A 275 ? 0.7734 0.5021 0.5163 0.0701  0.0159  -0.0231 275 ASN A CA    
2464 C C     . ASN A 275 ? 0.7816 0.5442 0.5411 0.1011  0.0068  -0.0288 275 ASN A C     
2465 O O     . ASN A 275 ? 0.8283 0.5601 0.5756 0.1272  -0.0015 -0.0300 275 ASN A O     
2466 C CB    . ASN A 275 ? 0.8581 0.5507 0.5941 0.0619  0.0219  -0.0358 275 ASN A CB    
2467 C CG    . ASN A 275 ? 1.0956 0.7385 0.8079 0.0353  0.0278  -0.0269 275 ASN A CG    
2468 O OD1   . ASN A 275 ? 1.3216 0.9016 1.0091 0.0367  0.0254  -0.0248 275 ASN A OD1   
2469 N ND2   . ASN A 275 ? 1.0669 0.7367 0.7859 0.0110  0.0360  -0.0210 275 ASN A ND2   
2470 N N     . LYS A 276 ? 0.7744 0.6004 0.5621 0.0981  0.0087  -0.0317 276 LYS A N     
2471 C CA    . LYS A 276 ? 0.7817 0.6569 0.5920 0.1221  0.0023  -0.0370 276 LYS A CA    
2472 C C     . LYS A 276 ? 0.7098 0.6119 0.5248 0.1254  -0.0087 -0.0260 276 LYS A C     
2473 O O     . LYS A 276 ? 0.7213 0.6626 0.5536 0.1478  -0.0174 -0.0290 276 LYS A O     
2474 C CB    . LYS A 276 ? 0.7161 0.6480 0.5548 0.1136  0.0121  -0.0466 276 LYS A CB    
2475 C CG    . LYS A 276 ? 0.8460 0.7627 0.6793 0.1098  0.0215  -0.0595 276 LYS A CG    
2476 C CD    . LYS A 276 ? 0.9429 0.9205 0.7988 0.1108  0.0297  -0.0682 276 LYS A CD    
2477 C CE    . LYS A 276 ? 0.9639 0.9852 0.8387 0.0890  0.0335  -0.0561 276 LYS A CE    
2478 N NZ    . LYS A 276 ? 0.9725 1.0424 0.8608 0.0844  0.0437  -0.0601 276 LYS A NZ    
2479 N N     . VAL A 277 ? 0.6422 0.5297 0.4434 0.1033  -0.0083 -0.0158 277 VAL A N     
2480 C CA    . VAL A 277 ? 0.7115 0.6242 0.5132 0.1031  -0.0196 -0.0086 277 VAL A CA    
2481 C C     . VAL A 277 ? 0.8163 0.6968 0.5894 0.1262  -0.0343 0.0022  277 VAL A C     
2482 O O     . VAL A 277 ? 0.9300 0.7518 0.6683 0.1221  -0.0324 0.0123  277 VAL A O     
2483 C CB    . VAL A 277 ? 0.7028 0.6103 0.4959 0.0739  -0.0136 -0.0049 277 VAL A CB    
2484 C CG1   . VAL A 277 ? 0.8005 0.7352 0.5920 0.0729  -0.0266 -0.0020 277 VAL A CG1   
2485 C CG2   . VAL A 277 ? 0.5910 0.5248 0.4094 0.0555  -0.0020 -0.0123 277 VAL A CG2   
2492 N N     . ASN A 278 ? 0.8088 0.7299 0.5966 0.1501  -0.0492 0.0014  278 ASN A N     
2493 C CA    . ASN A 278 ? 1.0290 0.9268 0.7884 0.1735  -0.0670 0.0144  278 ASN A CA    
2494 C C     . ASN A 278 ? 1.0189 0.9258 0.7595 0.1546  -0.0739 0.0229  278 ASN A C     
2495 O O     . ASN A 278 ? 1.0220 0.9666 0.7648 0.1679  -0.0920 0.0252  278 ASN A O     
2496 C CB    . ASN A 278 ? 1.2166 1.1626 1.0013 0.2108  -0.0827 0.0090  278 ASN A CB    
2497 C CG    . ASN A 278 ? 1.2691 1.3047 1.0959 0.2007  -0.0875 -0.0010 278 ASN A CG    
2498 O OD1   . ASN A 278 ? 1.2551 1.3167 1.1033 0.1697  -0.0739 -0.0086 278 ASN A OD1   
2499 N ND2   . ASN A 278 ? 1.2451 1.3277 1.0840 0.2265  -0.1078 -0.0002 278 ASN A ND2   
2500 N N     . GLY A 279 ? 0.9405 0.8179 0.6632 0.1244  -0.0598 0.0251  279 GLY A N     
2501 C CA    . GLY A 279 ? 0.8930 0.7785 0.5958 0.1066  -0.0635 0.0287  279 GLY A CA    
2502 C C     . GLY A 279 ? 0.8803 0.7492 0.5772 0.0749  -0.0448 0.0244  279 GLY A C     
2503 O O     . GLY A 279 ? 0.8284 0.6626 0.5213 0.0661  -0.0297 0.0257  279 GLY A O     
2504 N N     . ILE A 280 ? 0.8401 0.7361 0.5372 0.0590  -0.0471 0.0172  280 ILE A N     
2505 C CA    . ILE A 280 ? 0.8370 0.7228 0.5280 0.0339  -0.0316 0.0106  280 ILE A CA    
2506 C C     . ILE A 280 ? 0.7910 0.7162 0.5192 0.0211  -0.0317 -0.0056 280 ILE A C     
2507 O O     . ILE A 280 ? 0.8242 0.7826 0.5606 0.0208  -0.0458 -0.0123 280 ILE A O     
2508 C CB    . ILE A 280 ? 0.8026 0.6740 0.4482 0.0280  -0.0339 0.0162  280 ILE A CB    
2509 C CG1   . ILE A 280 ? 0.8956 0.7237 0.5000 0.0395  -0.0351 0.0378  280 ILE A CG1   
2510 C CG2   . ILE A 280 ? 0.7305 0.5958 0.3709 0.0063  -0.0164 0.0064  280 ILE A CG2   
2511 C CD1   . ILE A 280 ? 1.0166 0.8514 0.6047 0.0651  -0.0586 0.0492  280 ILE A CD1   
2517 N N     . PRO A 281 ? 0.6762 0.5979 0.4273 0.0098  -0.0170 -0.0113 281 PRO A N     
2518 C CA    . PRO A 281 ? 0.6120 0.5629 0.3935 -0.0029 -0.0182 -0.0226 281 PRO A CA    
2519 C C     . PRO A 281 ? 0.6219 0.5649 0.3890 -0.0179 -0.0169 -0.0332 281 PRO A C     
2520 O O     . PRO A 281 ? 0.6664 0.5844 0.4085 -0.0200 -0.0071 -0.0326 281 PRO A O     
2521 C CB    . PRO A 281 ? 0.5003 0.4462 0.3043 -0.0068 -0.0043 -0.0221 281 PRO A CB    
2522 C CG    . PRO A 281 ? 0.6082 0.5204 0.3900 -0.0055 0.0065  -0.0173 281 PRO A CG    
2523 C CD    . PRO A 281 ? 0.5565 0.4521 0.3086 0.0070  -0.0014 -0.0080 281 PRO A CD    
2524 N N     . MET A 282 ? 0.5203 0.4850 0.3032 -0.0291 -0.0257 -0.0443 282 MET A N     
2525 C CA    . MET A 282 ? 0.6782 0.6289 0.4485 -0.0426 -0.0238 -0.0590 282 MET A CA    
2526 C C     . MET A 282 ? 0.6586 0.5953 0.4528 -0.0536 -0.0130 -0.0643 282 MET A C     
2527 O O     . MET A 282 ? 0.6496 0.5659 0.4351 -0.0607 -0.0088 -0.0773 282 MET A O     
2528 C CB    . MET A 282 ? 0.6171 0.5915 0.3843 -0.0509 -0.0419 -0.0716 282 MET A CB    
2529 C CG    . MET A 282 ? 0.6769 0.6636 0.4120 -0.0375 -0.0551 -0.0661 282 MET A CG    
2530 S SD    . MET A 282 ? 0.7452 0.7721 0.4797 -0.0472 -0.0805 -0.0829 282 MET A SD    
2531 C CE    . MET A 282 ? 0.6532 0.6501 0.3622 -0.0646 -0.0742 -0.1074 282 MET A CE    
2532 N N     . ARG A 283 ? 0.6508 0.5980 0.4727 -0.0531 -0.0088 -0.0543 283 ARG A N     
2533 C CA    . ARG A 283 ? 0.6346 0.5672 0.4751 -0.0614 0.0005  -0.0540 283 ARG A CA    
2534 C C     . ARG A 283 ? 0.5739 0.5056 0.4231 -0.0519 0.0115  -0.0417 283 ARG A C     
2535 O O     . ARG A 283 ? 0.4864 0.4390 0.3446 -0.0448 0.0105  -0.0335 283 ARG A O     
2536 C CB    . ARG A 283 ? 0.6338 0.5821 0.4998 -0.0785 -0.0059 -0.0549 283 ARG A CB    
2537 C CG    . ARG A 283 ? 0.6698 0.5977 0.5502 -0.0851 0.0041  -0.0477 283 ARG A CG    
2538 C CD    . ARG A 283 ? 0.6083 0.5356 0.5070 -0.1085 -0.0006 -0.0485 283 ARG A CD    
2539 N NE    . ARG A 283 ? 0.6425 0.6179 0.5644 -0.1170 -0.0040 -0.0406 283 ARG A NE    
2540 C CZ    . ARG A 283 ? 0.7989 0.7862 0.7424 -0.1408 -0.0041 -0.0353 283 ARG A CZ    
2541 N NH1   . ARG A 283 ? 0.8181 0.7612 0.7593 -0.1580 -0.0024 -0.0356 283 ARG A NH1   
2542 N NH2   . ARG A 283 ? 0.8094 0.8522 0.7767 -0.1473 -0.0054 -0.0296 283 ARG A NH2   
2543 N N     . ILE A 284 ? 0.6071 0.5166 0.4538 -0.0503 0.0212  -0.0429 284 ILE A N     
2544 C CA    . ILE A 284 ? 0.5910 0.5026 0.4473 -0.0437 0.0298  -0.0336 284 ILE A CA    
2545 C C     . ILE A 284 ? 0.6098 0.5118 0.4810 -0.0488 0.0325  -0.0294 284 ILE A C     
2546 O O     . ILE A 284 ? 0.6117 0.4896 0.4800 -0.0512 0.0325  -0.0366 284 ILE A O     
2547 C CB    . ILE A 284 ? 0.6220 0.5236 0.4637 -0.0359 0.0380  -0.0360 284 ILE A CB    
2548 C CG1   . ILE A 284 ? 0.6571 0.5665 0.5095 -0.0309 0.0443  -0.0289 284 ILE A CG1   
2549 C CG2   . ILE A 284 ? 0.5827 0.4683 0.4167 -0.0361 0.0422  -0.0470 284 ILE A CG2   
2550 C CD1   . ILE A 284 ? 0.6806 0.5870 0.5219 -0.0284 0.0512  -0.0307 284 ILE A CD1   
2556 N N     . THR A 285 ? 0.5578 0.4766 0.4422 -0.0493 0.0344  -0.0177 285 THR A N     
2557 C CA    . THR A 285 ? 0.5711 0.4799 0.4645 -0.0535 0.0370  -0.0078 285 THR A CA    
2558 C C     . THR A 285 ? 0.5617 0.4793 0.4550 -0.0417 0.0426  -0.0007 285 THR A C     
2559 O O     . THR A 285 ? 0.6444 0.5841 0.5369 -0.0364 0.0446  -0.0007 285 THR A O     
2560 C CB    . THR A 285 ? 0.5727 0.4991 0.4795 -0.0689 0.0352  0.0023  285 THR A CB    
2561 O OG1   . THR A 285 ? 0.6189 0.5429 0.5291 -0.0831 0.0279  -0.0066 285 THR A OG1   
2562 C CG2   . THR A 285 ? 0.6146 0.5227 0.5241 -0.0750 0.0383  0.0171  285 THR A CG2   
2566 N N     . VAL A 286 ? 0.6460 0.5462 0.5395 -0.0361 0.0439  0.0038  286 VAL A N     
2567 C CA    . VAL A 286 ? 0.5438 0.4599 0.4381 -0.0256 0.0465  0.0113  286 VAL A CA    
2568 C C     . VAL A 286 ? 0.5686 0.4845 0.4640 -0.0299 0.0458  0.0301  286 VAL A C     
2569 O O     . VAL A 286 ? 0.6428 0.5303 0.5382 -0.0369 0.0437  0.0379  286 VAL A O     
2570 C CB    . VAL A 286 ? 0.5192 0.4281 0.4137 -0.0118 0.0473  0.0041  286 VAL A CB    
2571 C CG1   . VAL A 286 ? 0.4400 0.3701 0.3372 -0.0019 0.0464  0.0127  286 VAL A CG1   
2572 C CG2   . VAL A 286 ? 0.4864 0.4038 0.3776 -0.0113 0.0512  -0.0111 286 VAL A CG2   
2579 N N     . ILE A 287 ? 0.5794 0.5250 0.4728 -0.0268 0.0480  0.0371  287 ILE A N     
2580 C CA    . ILE A 287 ? 0.5673 0.5228 0.4567 -0.0324 0.0496  0.0568  287 ILE A CA    
2581 C C     . ILE A 287 ? 0.5761 0.5464 0.4571 -0.0183 0.0478  0.0637  287 ILE A C     
2582 O O     . ILE A 287 ? 0.5552 0.5523 0.4349 -0.0113 0.0482  0.0523  287 ILE A O     
2583 C CB    . ILE A 287 ? 0.5627 0.5531 0.4558 -0.0421 0.0547  0.0567  287 ILE A CB    
2584 C CG1   . ILE A 287 ? 0.6510 0.6355 0.5547 -0.0528 0.0533  0.0466  287 ILE A CG1   
2585 C CG2   . ILE A 287 ? 0.6906 0.6973 0.5781 -0.0516 0.0596  0.0784  287 ILE A CG2   
2586 C CD1   . ILE A 287 ? 0.6646 0.6861 0.5786 -0.0640 0.0572  0.0493  287 ILE A CD1   
2592 N N     . ALA A 288 ? 0.5636 0.5135 0.4376 -0.0138 0.0442  0.0818  288 ALA A N     
2593 C CA    . ALA A 288 ? 0.6392 0.6063 0.5039 0.0017  0.0394  0.0903  288 ALA A CA    
2594 C C     . ALA A 288 ? 0.7120 0.6893 0.5595 -0.0048 0.0415  0.1162  288 ALA A C     
2595 O O     . ALA A 288 ? 0.7426 0.6879 0.5844 -0.0155 0.0428  0.1365  288 ALA A O     
2596 C CB    . ALA A 288 ? 0.5134 0.4527 0.3815 0.0194  0.0316  0.0919  288 ALA A CB    
2597 N N     . ILE A 289 ? 0.7518 0.7726 0.5888 -0.0006 0.0425  0.1148  289 ILE A N     
2598 C CA    . ILE A 289 ? 0.6916 0.7302 0.5064 -0.0047 0.0452  0.1397  289 ILE A CA    
2599 C C     . ILE A 289 ? 0.7229 0.7625 0.5223 0.0152  0.0334  0.1531  289 ILE A C     
2600 O O     . ILE A 289 ? 0.7239 0.7964 0.5236 0.0285  0.0266  0.1369  289 ILE A O     
2601 C CB    . ILE A 289 ? 0.6756 0.7652 0.4843 -0.0103 0.0538  0.1283  289 ILE A CB    
2602 C CG1   . ILE A 289 ? 0.7642 0.8561 0.5901 -0.0265 0.0639  0.1189  289 ILE A CG1   
2603 C CG2   . ILE A 289 ? 0.6799 0.7974 0.4606 -0.0127 0.0578  0.1523  289 ILE A CG2   
2604 C CD1   . ILE A 289 ? 0.8067 0.8923 0.6515 -0.0214 0.0615  0.0897  289 ILE A CD1   
2610 N N     . MET A 290 ? 0.7235 0.7248 0.5102 0.0171  0.0295  0.1825  290 MET A N     
2611 C CA    . MET A 290 ? 0.8359 0.8308 0.6090 0.0413  0.0153  0.1983  290 MET A CA    
2612 C C     . MET A 290 ? 0.8578 0.8979 0.6008 0.0462  0.0124  0.2143  290 MET A C     
2613 O O     . MET A 290 ? 0.8859 0.9603 0.6176 0.0302  0.0237  0.2129  290 MET A O     
2614 C CB    . MET A 290 ? 0.7100 0.6372 0.4760 0.0439  0.0113  0.2254  290 MET A CB    
2615 C CG    . MET A 290 ? 0.7511 0.6349 0.5425 0.0345  0.0158  0.2066  290 MET A CG    
2616 S SD    . MET A 290 ? 0.8312 0.7386 0.6535 0.0529  0.0114  0.1649  290 MET A SD    
2617 C CE    . MET A 290 ? 0.7865 0.6820 0.6065 0.0912  -0.0056 0.1755  290 MET A CE    
2618 N N     . GLU A 291 ? 0.8208 0.8655 0.5510 0.0709  -0.0033 0.2272  291 GLU A N     
2619 C CA    . GLU A 291 ? 0.9593 1.0492 0.6564 0.0795  -0.0102 0.2428  291 GLU A CA    
2620 C C     . GLU A 291 ? 0.9129 1.0074 0.5763 0.0590  0.0030  0.2711  291 GLU A C     
2621 O O     . GLU A 291 ? 0.8289 0.9782 0.4720 0.0552  0.0069  0.2652  291 GLU A O     
2622 C CB    . GLU A 291 ? 1.0127 1.0896 0.6968 0.1097  -0.0304 0.2658  291 GLU A CB    
2623 C CG    . GLU A 291 ? 1.0849 1.2214 0.7786 0.1312  -0.0466 0.2422  291 GLU A CG    
2624 C CD    . GLU A 291 ? 1.1911 1.3112 0.8979 0.1642  -0.0655 0.2500  291 GLU A CD    
2625 O OE1   . GLU A 291 ? 1.1376 1.1904 0.8436 0.1714  -0.0652 0.2724  291 GLU A OE1   
2626 O OE2   . GLU A 291 ? 1.2815 1.4569 1.0009 0.1828  -0.0808 0.2317  291 GLU A OE2   
2627 N N     . ASP A 292 ? 0.9018 0.9393 0.5591 0.0448  0.0103  0.3005  292 ASP A N     
2628 C CA    . ASP A 292 ? 0.9112 0.9484 0.5383 0.0203  0.0249  0.3332  292 ASP A CA    
2629 C C     . ASP A 292 ? 0.9288 0.9849 0.5767 -0.0105 0.0459  0.3157  292 ASP A C     
2630 O O     . ASP A 292 ? 0.9290 0.9798 0.5637 -0.0366 0.0606  0.3410  292 ASP A O     
2631 C CB    . ASP A 292 ? 0.9698 0.9304 0.5794 0.0172  0.0211  0.3760  292 ASP A CB    
2632 C CG    . ASP A 292 ? 0.9630 0.8592 0.6071 0.0125  0.0204  0.3623  292 ASP A CG    
2633 O OD1   . ASP A 292 ? 0.8963 0.8131 0.5748 0.0048  0.0267  0.3248  292 ASP A OD1   
2634 O OD2   . ASP A 292 ? 1.1082 0.9313 0.7425 0.0172  0.0131  0.3883  292 ASP A OD2   
2635 N N     . LEU A 293 ? 0.9341 1.0122 0.6155 -0.0074 0.0469  0.2738  293 LEU A N     
2636 C CA    . LEU A 293 ? 0.8768 0.9760 0.5810 -0.0295 0.0633  0.2537  293 LEU A CA    
2637 C C     . LEU A 293 ? 0.9067 0.9535 0.6311 -0.0514 0.0688  0.2635  293 LEU A C     
2638 O O     . LEU A 293 ? 0.8881 0.9550 0.6302 -0.0731 0.0820  0.2545  293 LEU A O     
2639 C CB    . LEU A 293 ? 0.7569 0.9149 0.4388 -0.0424 0.0788  0.2621  293 LEU A CB    
2640 C CG    . LEU A 293 ? 0.8350 1.0455 0.4939 -0.0214 0.0724  0.2465  293 LEU A CG    
2641 C CD1   . LEU A 293 ? 0.8541 1.1211 0.4943 -0.0305 0.0877  0.2437  293 LEU A CD1   
2642 C CD2   . LEU A 293 ? 0.7107 0.9295 0.3973 -0.0060 0.0635  0.2019  293 LEU A CD2   
2643 N N     . ASP A 294 ? 0.8975 0.8794 0.6207 -0.0443 0.0576  0.2789  294 ASP A N     
2644 C CA    . ASP A 294 ? 0.9834 0.9097 0.7263 -0.0635 0.0601  0.2799  294 ASP A CA    
2645 C C     . ASP A 294 ? 0.9129 0.8433 0.6902 -0.0573 0.0573  0.2387  294 ASP A C     
2646 O O     . ASP A 294 ? 0.8021 0.7526 0.5862 -0.0336 0.0496  0.2161  294 ASP A O     
2647 C CB    . ASP A 294 ? 1.2615 1.1102 0.9892 -0.0545 0.0486  0.3064  294 ASP A CB    
2648 C CG    . ASP A 294 ? 1.5301 1.3168 1.2677 -0.0834 0.0533  0.3151  294 ASP A CG    
2649 O OD1   . ASP A 294 ? 1.5550 1.3660 1.3160 -0.1089 0.0635  0.2972  294 ASP A OD1   
2650 O OD2   . ASP A 294 ? 1.6625 1.3752 1.3845 -0.0797 0.0453  0.3386  294 ASP A OD2   
2651 N N     . ILE A 295 ? 0.9377 0.8516 0.7355 -0.0807 0.0635  0.2301  295 ILE A N     
2652 C CA    . ILE A 295 ? 0.8395 0.7647 0.6648 -0.0783 0.0624  0.1944  295 ILE A CA    
2653 C C     . ILE A 295 ? 0.8670 0.7314 0.7045 -0.0795 0.0549  0.1842  295 ILE A C     
2654 O O     . ILE A 295 ? 0.9169 0.7436 0.7563 -0.1029 0.0567  0.1951  295 ILE A O     
2655 C CB    . ILE A 295 ? 0.8081 0.7809 0.6494 -0.1006 0.0741  0.1853  295 ILE A CB    
2656 C CG1   . ILE A 295 ? 0.7216 0.7536 0.5479 -0.1000 0.0838  0.1957  295 ILE A CG1   
2657 C CG2   . ILE A 295 ? 0.8902 0.8797 0.7533 -0.0915 0.0711  0.1507  295 ILE A CG2   
2658 C CD1   . ILE A 295 ? 0.6160 0.7093 0.4601 -0.1090 0.0947  0.1785  295 ILE A CD1   
2664 N N     . LEU A 296 ? 0.7953 0.6524 0.6405 -0.0559 0.0473  0.1613  296 LEU A N     
2665 C CA    . LEU A 296 ? 0.7701 0.5780 0.6252 -0.0532 0.0416  0.1457  296 LEU A CA    
2666 C C     . LEU A 296 ? 0.8006 0.6351 0.6728 -0.0540 0.0432  0.1145  296 LEU A C     
2667 O O     . LEU A 296 ? 0.7888 0.6663 0.6640 -0.0427 0.0448  0.1024  296 LEU A O     
2668 C CB    . LEU A 296 ? 0.7511 0.5282 0.5998 -0.0230 0.0323  0.1463  296 LEU A CB    
2669 C CG    . LEU A 296 ? 0.8176 0.5657 0.6452 -0.0139 0.0273  0.1797  296 LEU A CG    
2670 C CD1   . LEU A 296 ? 0.7991 0.5312 0.6252 0.0233  0.0160  0.1771  296 LEU A CD1   
2671 C CD2   . LEU A 296 ? 0.8287 0.5143 0.6471 -0.0377 0.0286  0.1999  296 LEU A CD2   
2672 N N     . SER A 297 ? 0.7231 0.5301 0.6036 -0.0682 0.0419  0.1017  297 SER A N     
2673 C CA    . SER A 297 ? 0.6909 0.5168 0.5817 -0.0654 0.0414  0.0742  297 SER A CA    
2674 C C     . SER A 297 ? 0.7435 0.5235 0.6338 -0.0621 0.0362  0.0569  297 SER A C     
2675 O O     . SER A 297 ? 0.7325 0.4640 0.6191 -0.0723 0.0330  0.0625  297 SER A O     
2676 C CB    . SER A 297 ? 0.6681 0.5313 0.5695 -0.0862 0.0447  0.0700  297 SER A CB    
2677 O OG    . SER A 297 ? 0.7478 0.5907 0.6543 -0.1127 0.0441  0.0774  297 SER A OG    
2678 N N     . LYS A 298 ? 0.6301 0.4234 0.5219 -0.0483 0.0362  0.0354  298 LYS A N     
2679 C CA    . LYS A 298 ? 0.7824 0.5455 0.6716 -0.0480 0.0332  0.0143  298 LYS A CA    
2680 C C     . LYS A 298 ? 0.7002 0.4969 0.5901 -0.0520 0.0343  -0.0023 298 LYS A C     
2681 O O     . LYS A 298 ? 0.6406 0.4709 0.5309 -0.0425 0.0380  -0.0031 298 LYS A O     
2682 C CB    . LYS A 298 ? 0.8865 0.6256 0.7722 -0.0223 0.0329  0.0051  298 LYS A CB    
2683 C CG    . LYS A 298 ? 0.9639 0.6631 0.8434 -0.0224 0.0302  -0.0174 298 LYS A CG    
2684 C CD    . LYS A 298 ? 1.0028 0.6814 0.8808 0.0067  0.0311  -0.0297 298 LYS A CD    
2685 C CE    . LYS A 298 ? 1.0017 0.6382 0.8702 0.0071  0.0290  -0.0555 298 LYS A CE    
2686 N NZ    . LYS A 298 ? 1.1309 0.7093 0.9944 -0.0115 0.0216  -0.0490 298 LYS A NZ    
2687 N N     . GLY A 299 ? 0.6348 0.4201 0.5228 -0.0670 0.0297  -0.0152 299 GLY A N     
2688 C CA    . GLY A 299 ? 0.6948 0.5097 0.5792 -0.0696 0.0282  -0.0282 299 GLY A CA    
2689 C C     . GLY A 299 ? 0.7509 0.5442 0.6220 -0.0687 0.0247  -0.0510 299 GLY A C     
2690 O O     . GLY A 299 ? 0.7782 0.5309 0.6455 -0.0706 0.0222  -0.0601 299 GLY A O     
2691 N N     . LYS A 300 ? 0.7336 0.5510 0.5941 -0.0651 0.0244  -0.0605 300 LYS A N     
2692 C CA    . LYS A 300 ? 0.7740 0.5786 0.6164 -0.0658 0.0209  -0.0823 300 LYS A CA    
2693 C C     . LYS A 300 ? 0.6479 0.4834 0.4807 -0.0717 0.0141  -0.0848 300 LYS A C     
2694 O O     . LYS A 300 ? 0.5783 0.4382 0.4085 -0.0637 0.0172  -0.0742 300 LYS A O     
2695 C CB    . LYS A 300 ? 0.8088 0.6056 0.6388 -0.0468 0.0307  -0.0928 300 LYS A CB    
2696 C CG    . LYS A 300 ? 0.8936 0.6879 0.6988 -0.0458 0.0302  -0.1153 300 LYS A CG    
2697 C CD    . LYS A 300 ? 1.0135 0.7742 0.8133 -0.0356 0.0335  -0.1358 300 LYS A CD    
2698 C CE    . LYS A 300 ? 1.0889 0.8565 0.8604 -0.0302 0.0376  -0.1596 300 LYS A CE    
2699 N NZ    . LYS A 300 ? 1.1388 0.9317 0.9074 -0.0138 0.0536  -0.1586 300 LYS A NZ    
2700 N N     . LYS A 301 ? 0.7024 0.5348 0.5291 -0.0854 0.0032  -0.0989 301 LYS A N     
2701 C CA    . LYS A 301 ? 0.7078 0.5720 0.5233 -0.0885 -0.0070 -0.1023 301 LYS A CA    
2702 C C     . LYS A 301 ? 0.7310 0.5862 0.5138 -0.0839 -0.0088 -0.1223 301 LYS A C     
2703 O O     . LYS A 301 ? 0.7729 0.6008 0.5478 -0.0893 -0.0101 -0.1423 301 LYS A O     
2704 C CB    . LYS A 301 ? 0.6772 0.5612 0.5120 -0.1091 -0.0205 -0.1037 301 LYS A CB    
2705 C CG    . LYS A 301 ? 0.6862 0.5934 0.5051 -0.1142 -0.0356 -0.1183 301 LYS A CG    
2706 C CD    . LYS A 301 ? 0.6814 0.6385 0.5222 -0.1217 -0.0480 -0.1104 301 LYS A CD    
2707 C CE    . LYS A 301 ? 0.8318 0.8132 0.6565 -0.1284 -0.0671 -0.1284 301 LYS A CE    
2708 N NZ    . LYS A 301 ? 0.8763 0.9153 0.7294 -0.1369 -0.0817 -0.1245 301 LYS A NZ    
2709 N N     . PHE A 302 ? 0.8186 0.6939 0.5792 -0.0736 -0.0083 -0.1168 302 PHE A N     
2710 C CA    . PHE A 302 ? 0.6686 0.5411 0.3922 -0.0698 -0.0083 -0.1329 302 PHE A CA    
2711 C C     . PHE A 302 ? 0.7117 0.6079 0.4187 -0.0767 -0.0271 -0.1397 302 PHE A C     
2712 O O     . PHE A 302 ? 0.7055 0.6254 0.4340 -0.0830 -0.0399 -0.1311 302 PHE A O     
2713 C CB    . PHE A 302 ? 0.7964 0.6726 0.4997 -0.0566 0.0060  -0.1210 302 PHE A CB    
2714 C CG    . PHE A 302 ? 0.7810 0.6438 0.5019 -0.0498 0.0229  -0.1173 302 PHE A CG    
2715 C CD1   . PHE A 302 ? 0.6946 0.5602 0.4436 -0.0481 0.0258  -0.0991 302 PHE A CD1   
2716 C CD2   . PHE A 302 ? 0.7496 0.6023 0.4596 -0.0433 0.0354  -0.1337 302 PHE A CD2   
2717 C CE1   . PHE A 302 ? 0.6869 0.5460 0.4519 -0.0412 0.0386  -0.0961 302 PHE A CE1   
2718 C CE2   . PHE A 302 ? 0.7774 0.6260 0.5076 -0.0344 0.0488  -0.1307 302 PHE A CE2   
2719 C CZ    . PHE A 302 ? 0.7553 0.6074 0.5127 -0.0341 0.0493  -0.1112 302 PHE A CZ    
2720 N N     . LYS A 303 ? 0.7304 0.6257 0.3994 -0.0750 -0.0289 -0.1567 303 LYS A N     
2721 C CA    . LYS A 303 ? 0.8104 0.7320 0.4546 -0.0789 -0.0483 -0.1637 303 LYS A CA    
2722 C C     . LYS A 303 ? 0.8520 0.7932 0.4727 -0.0648 -0.0502 -0.1388 303 LYS A C     
2723 O O     . LYS A 303 ? 0.9620 0.9284 0.5609 -0.0626 -0.0682 -0.1377 303 LYS A O     
2724 C CB    . LYS A 303 ? 0.8401 0.7521 0.4474 -0.0822 -0.0493 -0.1937 303 LYS A CB    
2725 C CG    . LYS A 303 ? 0.8230 0.7044 0.4489 -0.0948 -0.0496 -0.2213 303 LYS A CG    
2726 C CD    . LYS A 303 ? 0.9390 0.8340 0.5878 -0.1163 -0.0722 -0.2308 303 LYS A CD    
2727 C CE    . LYS A 303 ? 1.0820 0.9348 0.7501 -0.1331 -0.0725 -0.2545 303 LYS A CE    
2728 N NZ    . LYS A 303 ? 1.1375 1.0068 0.8315 -0.1609 -0.0932 -0.2623 303 LYS A NZ    
2729 N N     . HIS A 304 ? 0.7783 0.7058 0.4026 -0.0552 -0.0328 -0.1187 304 HIS A N     
2730 C CA    . HIS A 304 ? 0.7302 0.6615 0.3317 -0.0432 -0.0323 -0.0932 304 HIS A CA    
2731 C C     . HIS A 304 ? 0.7595 0.6805 0.3927 -0.0378 -0.0223 -0.0736 304 HIS A C     
2732 O O     . HIS A 304 ? 0.7707 0.6842 0.4378 -0.0428 -0.0132 -0.0789 304 HIS A O     
2733 C CB    . HIS A 304 ? 0.7277 0.6481 0.2830 -0.0412 -0.0176 -0.0919 304 HIS A CB    
2734 C CG    . HIS A 304 ? 0.7849 0.6899 0.3532 -0.0441 0.0065  -0.0993 304 HIS A CG    
2735 N ND1   . HIS A 304 ? 0.7117 0.6061 0.3034 -0.0422 0.0204  -0.0828 304 HIS A ND1   
2736 C CD2   . HIS A 304 ? 0.7258 0.6272 0.2899 -0.0467 0.0176  -0.1238 304 HIS A CD2   
2737 C CE1   . HIS A 304 ? 0.7909 0.6816 0.3933 -0.0437 0.0382  -0.0952 304 HIS A CE1   
2738 N NE2   . HIS A 304 ? 0.9218 0.8154 0.5084 -0.0445 0.0374  -0.1199 304 HIS A NE2   
2739 N N     . GLY A 305 ? 0.7400 0.6574 0.3587 -0.0267 -0.0248 -0.0513 305 GLY A N     
2740 C CA    . GLY A 305 ? 0.6292 0.5347 0.2726 -0.0210 -0.0166 -0.0361 305 GLY A CA    
2741 C C     . GLY A 305 ? 0.6675 0.5523 0.3101 -0.0275 0.0062  -0.0352 305 GLY A C     
2742 O O     . GLY A 305 ? 0.6917 0.5718 0.3067 -0.0332 0.0170  -0.0406 305 GLY A O     
2743 N N     . ILE A 306 ? 0.5872 0.4662 0.2600 -0.0262 0.0133  -0.0294 306 ILE A N     
2744 C CA    . ILE A 306 ? 0.6267 0.4960 0.3099 -0.0325 0.0322  -0.0306 306 ILE A CA    
2745 C C     . ILE A 306 ? 0.6458 0.4960 0.3195 -0.0314 0.0384  -0.0139 306 ILE A C     
2746 O O     . ILE A 306 ? 0.6732 0.5188 0.3610 -0.0234 0.0311  -0.0069 306 ILE A O     
2747 C CB    . ILE A 306 ? 0.5881 0.4662 0.3129 -0.0334 0.0341  -0.0385 306 ILE A CB    
2748 C CG1   . ILE A 306 ? 0.6916 0.5770 0.4258 -0.0374 0.0282  -0.0544 306 ILE A CG1   
2749 C CG2   . ILE A 306 ? 0.6750 0.5502 0.4116 -0.0368 0.0503  -0.0396 306 ILE A CG2   
2750 C CD1   . ILE A 306 ? 0.7915 0.6842 0.5610 -0.0394 0.0226  -0.0547 306 ILE A CD1   
2756 N N     . SER A 307 ? 0.7490 0.5878 0.3987 -0.0405 0.0524  -0.0085 307 SER A N     
2757 C CA    . SER A 307 ? 0.7040 0.5178 0.3453 -0.0448 0.0587  0.0066  307 SER A CA    
2758 C C     . SER A 307 ? 0.6688 0.4896 0.3472 -0.0492 0.0667  -0.0005 307 SER A C     
2759 O O     . SER A 307 ? 0.6033 0.4479 0.3064 -0.0506 0.0719  -0.0139 307 SER A O     
2760 C CB    . SER A 307 ? 0.7183 0.5205 0.3239 -0.0592 0.0732  0.0162  307 SER A CB    
2761 O OG    . SER A 307 ? 0.7536 0.5831 0.3737 -0.0697 0.0899  0.0020  307 SER A OG    
2762 N N     . ILE A 308 ? 0.6695 0.4674 0.3488 -0.0506 0.0668  0.0078  308 ILE A N     
2763 C CA    . ILE A 308 ? 0.6980 0.5052 0.4090 -0.0543 0.0716  -0.0003 308 ILE A CA    
2764 C C     . ILE A 308 ? 0.7618 0.5934 0.4858 -0.0690 0.0871  -0.0087 308 ILE A C     
2765 O O     . ILE A 308 ? 0.7329 0.5914 0.4868 -0.0653 0.0880  -0.0197 308 ILE A O     
2766 C CB    . ILE A 308 ? 0.7309 0.5039 0.4347 -0.0557 0.0696  0.0065  308 ILE A CB    
2767 C CG1   . ILE A 308 ? 0.6930 0.4819 0.4285 -0.0581 0.0718  -0.0055 308 ILE A CG1   
2768 C CG2   . ILE A 308 ? 0.6389 0.3786 0.3105 -0.0737 0.0794  0.0193  308 ILE A CG2   
2769 C CD1   . ILE A 308 ? 0.7215 0.4755 0.4503 -0.0571 0.0681  -0.0048 308 ILE A CD1   
2775 N N     . ASP A 309 ? 0.7439 0.5697 0.4450 -0.0843 0.0994  -0.0027 309 ASP A N     
2776 C CA    . ASP A 309 ? 0.7979 0.6571 0.5140 -0.0975 0.1158  -0.0120 309 ASP A CA    
2777 C C     . ASP A 309 ? 0.8007 0.6912 0.5330 -0.0841 0.1157  -0.0266 309 ASP A C     
2778 O O     . ASP A 309 ? 0.7599 0.6824 0.5205 -0.0828 0.1226  -0.0386 309 ASP A O     
2779 C CB    . ASP A 309 ? 0.9215 0.7744 0.6060 -0.1171 0.1309  -0.0017 309 ASP A CB    
2780 C CG    . ASP A 309 ? 1.0359 0.8446 0.6992 -0.1325 0.1309  0.0152  309 ASP A CG    
2781 O OD1   . ASP A 309 ? 1.0161 0.8271 0.7000 -0.1481 0.1362  0.0113  309 ASP A OD1   
2782 O OD2   . ASP A 309 ? 1.1194 0.8893 0.7446 -0.1283 0.1241  0.0317  309 ASP A OD2   
2783 N N     . ASN A 310 ? 0.7613 0.6408 0.4754 -0.0730 0.1060  -0.0262 310 ASN A N     
2784 C CA    . ASN A 310 ? 0.7557 0.6529 0.4800 -0.0620 0.1042  -0.0414 310 ASN A CA    
2785 C C     . ASN A 310 ? 0.7203 0.6213 0.4786 -0.0513 0.0943  -0.0468 310 ASN A C     
2786 O O     . ASN A 310 ? 0.6591 0.5755 0.4382 -0.0442 0.0973  -0.0584 310 ASN A O     
2787 C CB    . ASN A 310 ? 0.7437 0.6290 0.4370 -0.0575 0.0952  -0.0413 310 ASN A CB    
2788 C CG    . ASN A 310 ? 0.8493 0.7503 0.5376 -0.0530 0.1006  -0.0598 310 ASN A CG    
2789 O OD1   . ASN A 310 ? 0.8550 0.7769 0.5590 -0.0523 0.1144  -0.0709 310 ASN A OD1   
2790 N ND2   . ASN A 310 ? 0.9035 0.7973 0.5704 -0.0488 0.0892  -0.0658 310 ASN A ND2   
2791 N N     . ALA A 311 ? 0.6799 0.5663 0.4416 -0.0487 0.0828  -0.0374 311 ALA A N     
2792 C CA    . ALA A 311 ? 0.6334 0.5253 0.4228 -0.0414 0.0750  -0.0385 311 ALA A CA    
2793 C C     . ALA A 311 ? 0.5498 0.4605 0.3641 -0.0413 0.0820  -0.0430 311 ALA A C     
2794 O O     . ALA A 311 ? 0.5592 0.4777 0.3924 -0.0331 0.0784  -0.0465 311 ALA A O     
2795 C CB    . ALA A 311 ? 0.6384 0.5190 0.4260 -0.0388 0.0660  -0.0291 311 ALA A CB    
2796 N N     . TYR A 312 ? 0.5764 0.4948 0.3901 -0.0512 0.0911  -0.0424 312 TYR A N     
2797 C CA    . TYR A 312 ? 0.6087 0.5550 0.4482 -0.0517 0.0960  -0.0484 312 TYR A CA    
2798 C C     . TYR A 312 ? 0.6573 0.6244 0.5110 -0.0406 0.1001  -0.0584 312 TYR A C     
2799 O O     . TYR A 312 ? 0.7450 0.7269 0.6209 -0.0293 0.0956  -0.0608 312 TYR A O     
2800 C CB    . TYR A 312 ? 0.6502 0.6070 0.4881 -0.0695 0.1066  -0.0489 312 TYR A CB    
2801 C CG    . TYR A 312 ? 0.6440 0.5715 0.4664 -0.0813 0.1035  -0.0409 312 TYR A CG    
2802 C CD1   . TYR A 312 ? 0.6511 0.5648 0.4550 -0.1012 0.1133  -0.0357 312 TYR A CD1   
2803 C CD2   . TYR A 312 ? 0.4766 0.3885 0.3012 -0.0724 0.0917  -0.0387 312 TYR A CD2   
2804 C CE1   . TYR A 312 ? 0.6861 0.5618 0.4730 -0.1107 0.1098  -0.0285 312 TYR A CE1   
2805 C CE2   . TYR A 312 ? 0.5134 0.3943 0.3230 -0.0792 0.0888  -0.0348 312 TYR A CE2   
2806 C CZ    . TYR A 312 ? 0.6785 0.5365 0.4686 -0.0978 0.0970  -0.0295 312 TYR A CZ    
2807 O OH    . TYR A 312 ? 0.8351 0.6502 0.6069 -0.1040 0.0936  -0.0251 312 TYR A OH    
2808 N N     . LYS A 313 ? 0.6516 0.6190 0.4898 -0.0420 0.1086  -0.0644 313 LYS A N     
2809 C CA    . LYS A 313 ? 0.5609 0.5468 0.4103 -0.0285 0.1142  -0.0783 313 LYS A CA    
2810 C C     . LYS A 313 ? 0.6337 0.5953 0.4862 -0.0134 0.1024  -0.0809 313 LYS A C     
2811 O O     . LYS A 313 ? 0.6793 0.6474 0.5522 0.0022  0.0999  -0.0860 313 LYS A O     
2812 C CB    . LYS A 313 ? 0.5650 0.5595 0.3923 -0.0343 0.1277  -0.0862 313 LYS A CB    
2813 C CG    . LYS A 313 ? 0.7443 0.7697 0.5733 -0.0518 0.1434  -0.0840 313 LYS A CG    
2814 C CD    . LYS A 313 ? 0.9430 0.9796 0.7446 -0.0592 0.1589  -0.0892 313 LYS A CD    
2815 C CE    . LYS A 313 ? 1.1190 1.1738 0.9125 -0.0857 0.1744  -0.0793 313 LYS A CE    
2816 N NZ    . LYS A 313 ? 1.3044 1.3613 1.0589 -0.0957 0.1887  -0.0776 313 LYS A NZ    
2817 N N     . VAL A 314 ? 0.6098 0.5433 0.4426 -0.0184 0.0942  -0.0763 314 VAL A N     
2818 C CA    . VAL A 314 ? 0.5901 0.4997 0.4266 -0.0113 0.0828  -0.0778 314 VAL A CA    
2819 C C     . VAL A 314 ? 0.6115 0.5211 0.4704 -0.0063 0.0757  -0.0667 314 VAL A C     
2820 O O     . VAL A 314 ? 0.6997 0.5967 0.5694 0.0041  0.0714  -0.0680 314 VAL A O     
2821 C CB    . VAL A 314 ? 0.5763 0.4683 0.3930 -0.0209 0.0740  -0.0740 314 VAL A CB    
2822 C CG1   . VAL A 314 ? 0.6257 0.4972 0.4496 -0.0202 0.0629  -0.0757 314 VAL A CG1   
2823 C CG2   . VAL A 314 ? 0.7209 0.6135 0.5095 -0.0243 0.0793  -0.0841 314 VAL A CG2   
2830 N N     . ALA A 315 ? 0.6409 0.5616 0.5032 -0.0131 0.0744  -0.0558 315 ALA A N     
2831 C CA    . ALA A 315 ? 0.5437 0.4693 0.4211 -0.0095 0.0682  -0.0454 315 ALA A CA    
2832 C C     . ALA A 315 ? 0.6175 0.5603 0.5126 0.0034  0.0696  -0.0474 315 ALA A C     
2833 O O     . ALA A 315 ? 0.5844 0.5180 0.4869 0.0128  0.0631  -0.0401 315 ALA A O     
2834 C CB    . ALA A 315 ? 0.4628 0.3980 0.3372 -0.0174 0.0676  -0.0391 315 ALA A CB    
2835 N N     . GLU A 316 ? 0.5647 0.5343 0.4664 0.0037  0.0777  -0.0561 316 GLU A N     
2836 C CA    . GLU A 316 ? 0.4976 0.4942 0.4203 0.0191  0.0783  -0.0608 316 GLU A CA    
2837 C C     . GLU A 316 ? 0.6352 0.6110 0.5601 0.0383  0.0762  -0.0664 316 GLU A C     
2838 O O     . GLU A 316 ? 0.6969 0.6742 0.6348 0.0566  0.0695  -0.0621 316 GLU A O     
2839 C CB    . GLU A 316 ? 0.4175 0.4539 0.3499 0.0127  0.0896  -0.0719 316 GLU A CB    
2840 C CG    . GLU A 316 ? 0.5117 0.5874 0.4708 0.0322  0.0904  -0.0804 316 GLU A CG    
2841 C CD    . GLU A 316 ? 0.6088 0.7364 0.5835 0.0209  0.1026  -0.0915 316 GLU A CD    
2842 O OE1   . GLU A 316 ? 0.5997 0.7242 0.5601 -0.0041 0.1116  -0.0908 316 GLU A OE1   
2843 O OE2   . GLU A 316 ? 0.6558 0.8282 0.6576 0.0373  0.1033  -0.1003 316 GLU A OE2   
2844 N N     . ASP A 317 ? 0.7060 0.6590 0.6155 0.0352  0.0808  -0.0763 317 ASP A N     
2845 C CA    . ASP A 317 ? 0.7052 0.6278 0.6130 0.0518  0.0779  -0.0854 317 ASP A CA    
2846 C C     . ASP A 317 ? 0.7236 0.6064 0.6296 0.0525  0.0654  -0.0703 317 ASP A C     
2847 O O     . ASP A 317 ? 0.7754 0.6384 0.6887 0.0712  0.0599  -0.0681 317 ASP A O     
2848 C CB    . ASP A 317 ? 0.6945 0.6004 0.5813 0.0448  0.0836  -0.1012 317 ASP A CB    
2849 C CG    . ASP A 317 ? 0.8941 0.8341 0.7825 0.0533  0.0979  -0.1197 317 ASP A CG    
2850 O OD1   . ASP A 317 ? 0.9056 0.8834 0.8173 0.0658  0.1025  -0.1212 317 ASP A OD1   
2851 O OD2   . ASP A 317 ? 0.9273 0.8619 0.7939 0.0474  0.1046  -0.1331 317 ASP A OD2   
2852 N N     . LEU A 318 ? 0.6301 0.5023 0.5263 0.0327  0.0613  -0.0588 318 LEU A N     
2853 C CA    . LEU A 318 ? 0.6923 0.5337 0.5871 0.0275  0.0523  -0.0435 318 LEU A CA    
2854 C C     . LEU A 318 ? 0.7044 0.5557 0.6093 0.0383  0.0476  -0.0255 318 LEU A C     
2855 O O     . LEU A 318 ? 0.7418 0.5611 0.6457 0.0456  0.0413  -0.0142 318 LEU A O     
2856 C CB    . LEU A 318 ? 0.6850 0.5292 0.5719 0.0055  0.0504  -0.0369 318 LEU A CB    
2857 C CG    . LEU A 318 ? 0.6345 0.4684 0.5081 -0.0056 0.0505  -0.0512 318 LEU A CG    
2858 C CD1   . LEU A 318 ? 0.5485 0.4003 0.4177 -0.0205 0.0482  -0.0445 318 LEU A CD1   
2859 C CD2   . LEU A 318 ? 0.6481 0.4416 0.5178 -0.0096 0.0446  -0.0575 318 LEU A CD2   
2860 N N     . LEU A 319 ? 0.5826 0.4756 0.4943 0.0384  0.0498  -0.0227 319 LEU A N     
2861 C CA    . LEU A 319 ? 0.6342 0.5453 0.5526 0.0489  0.0440  -0.0082 319 LEU A CA    
2862 C C     . LEU A 319 ? 0.7768 0.6826 0.7047 0.0755  0.0396  -0.0093 319 LEU A C     
2863 O O     . LEU A 319 ? 0.7791 0.6673 0.7040 0.0875  0.0311  0.0082  319 LEU A O     
2864 C CB    . LEU A 319 ? 0.5884 0.5463 0.5127 0.0430  0.0465  -0.0121 319 LEU A CB    
2865 C CG    . LEU A 319 ? 0.6257 0.6169 0.5592 0.0567  0.0396  -0.0051 319 LEU A CG    
2866 C CD1   . LEU A 319 ? 0.4962 0.4734 0.4173 0.0576  0.0322  0.0172  319 LEU A CD1   
2867 C CD2   . LEU A 319 ? 0.5609 0.5951 0.5007 0.0457  0.0423  -0.0155 319 LEU A CD2   
2868 N N     . ARG A 320 ? 0.7539 0.6761 0.6922 0.0859  0.0458  -0.0293 320 ARG A N     
2869 C CA    . ARG A 320 ? 0.7010 0.6286 0.6533 0.1163  0.0428  -0.0359 320 ARG A CA    
2870 C C     . ARG A 320 ? 0.8041 0.6660 0.7452 0.1294  0.0362  -0.0299 320 ARG A C     
2871 O O     . ARG A 320 ? 0.8552 0.7026 0.8012 0.1567  0.0275  -0.0218 320 ARG A O     
2872 C CB    . ARG A 320 ? 0.6901 0.6516 0.6541 0.1205  0.0548  -0.0613 320 ARG A CB    
2873 C CG    . ARG A 320 ? 0.7662 0.7737 0.7560 0.1493  0.0544  -0.0712 320 ARG A CG    
2874 C CD    . ARG A 320 ? 0.6663 0.7242 0.6690 0.1437  0.0702  -0.0942 320 ARG A CD    
2875 N NE    . ARG A 320 ? 0.6813 0.7928 0.6945 0.1209  0.0742  -0.0920 320 ARG A NE    
2876 C CZ    . ARG A 320 ? 0.7381 0.9046 0.7762 0.1297  0.0682  -0.0909 320 ARG A CZ    
2877 N NH1   . ARG A 320 ? 0.7698 0.9788 0.8156 0.1043  0.0716  -0.0919 320 ARG A NH1   
2878 N NH2   . ARG A 320 ? 0.8034 0.9804 0.8577 0.1645  0.0573  -0.0891 320 ARG A NH2   
2879 N N     . GLU A 321 ? 0.8727 0.6930 0.7982 0.1094  0.0390  -0.0335 321 GLU A N     
2880 C CA    . GLU A 321 ? 0.8795 0.6308 0.7930 0.1129  0.0329  -0.0298 321 GLU A CA    
2881 C C     . GLU A 321 ? 0.8197 0.5437 0.7241 0.1038  0.0244  0.0016  321 GLU A C     
2882 O O     . GLU A 321 ? 0.8946 0.5662 0.7919 0.1173  0.0167  0.0135  321 GLU A O     
2883 C CB    . GLU A 321 ? 0.9052 0.6295 0.8060 0.0905  0.0374  -0.0467 321 GLU A CB    
2884 C CG    . GLU A 321 ? 1.0412 0.7884 0.9432 0.0991  0.0470  -0.0769 321 GLU A CG    
2885 C CD    . GLU A 321 ? 1.1601 0.8886 1.0449 0.0757  0.0493  -0.0921 321 GLU A CD    
2886 O OE1   . GLU A 321 ? 1.1587 0.8398 1.0341 0.0605  0.0417  -0.0872 321 GLU A OE1   
2887 O OE2   . GLU A 321 ? 1.1866 0.9494 1.0664 0.0709  0.0582  -0.1079 321 GLU A OE2   
2888 N N     . LEU A 322 ? 0.8091 0.5667 0.7115 0.0816  0.0263  0.0150  322 LEU A N     
2889 C CA    . LEU A 322 ? 0.8658 0.6130 0.7585 0.0724  0.0211  0.0449  322 LEU A CA    
2890 C C     . LEU A 322 ? 0.9745 0.7205 0.8668 0.1018  0.0122  0.0613  322 LEU A C     
2891 O O     . LEU A 322 ? 1.1311 0.8291 1.0100 0.1061  0.0055  0.0841  322 LEU A O     
2892 C CB    . LEU A 322 ? 0.8065 0.6044 0.6992 0.0527  0.0256  0.0509  322 LEU A CB    
2893 C CG    . LEU A 322 ? 0.8454 0.6373 0.7329 0.0221  0.0301  0.0539  322 LEU A CG    
2894 C CD1   . LEU A 322 ? 0.6051 0.4467 0.4921 0.0114  0.0338  0.0601  322 LEU A CD1   
2895 C CD2   . LEU A 322 ? 0.9719 0.7131 0.8496 0.0090  0.0272  0.0731  322 LEU A CD2   
2896 N N     . LEU A 323 ? 0.9061 0.7062 0.8132 0.1211  0.0114  0.0505  323 LEU A N     
2897 C CA    . LEU A 323 ? 0.8683 0.6841 0.7786 0.1515  0.0005  0.0640  323 LEU A CA    
2898 C C     . LEU A 323 ? 0.9623 0.7259 0.8731 0.1830  -0.0064 0.0633  323 LEU A C     
2899 O O     . LEU A 323 ? 1.0548 0.8055 0.9599 0.2094  -0.0186 0.0838  323 LEU A O     
2900 C CB    . LEU A 323 ? 0.7767 0.6699 0.7080 0.1605  0.0014  0.0473  323 LEU A CB    
2901 C CG    . LEU A 323 ? 0.7202 0.6530 0.6450 0.1334  0.0048  0.0521  323 LEU A CG    
2902 C CD1   . LEU A 323 ? 0.6405 0.6407 0.5851 0.1313  0.0079  0.0311  323 LEU A CD1   
2903 C CD2   . LEU A 323 ? 0.8085 0.7396 0.7141 0.1367  -0.0051 0.0820  323 LEU A CD2   
2904 N N     . VAL A 324 ? 0.9523 0.6836 0.8672 0.1825  0.0003  0.0395  324 VAL A N     
2905 C CA    . VAL A 324 ? 1.0342 0.7000 0.9450 0.2104  -0.0059 0.0361  324 VAL A CA    
2906 C C     . VAL A 324 ? 1.1023 0.6890 0.9873 0.1954  -0.0125 0.0660  324 VAL A C     
2907 O O     . VAL A 324 ? 1.2013 0.7396 1.0758 0.2214  -0.0238 0.0857  324 VAL A O     
2908 C CB    . VAL A 324 ? 1.1131 0.7640 1.0300 0.2107  0.0037  -0.0003 324 VAL A CB    
2909 C CG1   . VAL A 324 ? 1.2111 0.7701 1.1148 0.2280  -0.0022 -0.0055 324 VAL A CG1   
2910 C CG2   . VAL A 324 ? 1.1201 0.8452 1.0626 0.2342  0.0101  -0.0258 324 VAL A CG2   
2917 N N     . ARG A 325 ? 1.0526 0.6282 0.9274 0.1533  -0.0056 0.0708  325 ARG A N     
2918 C CA    . ARG A 325 ? 1.0918 0.6030 0.9449 0.1302  -0.0089 0.0999  325 ARG A CA    
2919 C C     . ARG A 325 ? 1.1466 0.6622 0.9850 0.1402  -0.0170 0.1397  325 ARG A C     
2920 O O     . ARG A 325 ? 1.2973 0.7428 1.1165 0.1483  -0.0250 0.1650  325 ARG A O     
2921 C CB    . ARG A 325 ? 1.0639 0.5902 0.9158 0.0835  0.0006  0.0971  325 ARG A CB    
2922 C CG    . ARG A 325 ? 1.1389 0.5980 0.9744 0.0519  -0.0002 0.1179  325 ARG A CG    
2923 C CD    . ARG A 325 ? 1.2003 0.6608 1.0424 0.0147  0.0063  0.0965  325 ARG A CD    
2924 N NE    . ARG A 325 ? 1.2899 0.8198 1.1394 -0.0114 0.0140  0.1021  325 ARG A NE    
2925 C CZ    . ARG A 325 ? 1.3526 0.9207 1.2135 -0.0288 0.0188  0.0786  325 ARG A CZ    
2926 N NH1   . ARG A 325 ? 1.3417 0.8896 1.2055 -0.0258 0.0173  0.0481  325 ARG A NH1   
2927 N NH2   . ARG A 325 ? 1.3726 0.9997 1.2399 -0.0467 0.0246  0.0851  325 ARG A NH2   
2928 N N     . ASP A 326 ? 1.0708 0.6644 0.9146 0.1401  -0.0157 0.1454  326 ASP A N     
2929 C CA    . ASP A 326 ? 1.0955 0.6988 0.9199 0.1461  -0.0232 0.1824  326 ASP A CA    
2930 C C     . ASP A 326 ? 1.2823 0.8855 1.1060 0.1937  -0.0385 0.1923  326 ASP A C     
2931 O O     . ASP A 326 ? 1.4601 1.0086 1.2597 0.2071  -0.0485 0.2255  326 ASP A O     
2932 C CB    . ASP A 326 ? 1.0398 0.7240 0.8661 0.1283  -0.0174 0.1830  326 ASP A CB    
2933 C CG    . ASP A 326 ? 1.1900 0.8792 0.9881 0.1248  -0.0220 0.2221  326 ASP A CG    
2934 O OD1   . ASP A 326 ? 1.2372 0.9426 1.0271 0.1562  -0.0351 0.2368  326 ASP A OD1   
2935 O OD2   . ASP A 326 ? 1.2137 0.8933 0.9972 0.0911  -0.0127 0.2388  326 ASP A OD2   
2936 N N     . LYS A 327 ? 1.1793 0.8472 1.0291 0.2183  -0.0407 0.1659  327 LYS A N     
2937 C CA    . LYS A 327 ? 1.1396 0.8168 0.9981 0.2679  -0.0557 0.1678  327 LYS A CA    
2938 C C     . LYS A 327 ? 1.1854 0.9091 1.0315 0.2853  -0.0699 0.1956  327 LYS A C     
2939 O O     . LYS A 327 ? 1.2300 0.9963 1.0929 0.3245  -0.0827 0.1896  327 LYS A O     
2940 C CB    . LYS A 327 ? 1.1726 0.7510 1.0176 0.2925  -0.0636 0.1791  327 LYS A CB    
2941 C CG    . LYS A 327 ? 1.2473 0.7714 1.1003 0.2807  -0.0529 0.1496  327 LYS A CG    
2942 C CD    . LYS A 327 ? 1.4737 0.8865 1.3057 0.2995  -0.0621 0.1654  327 LYS A CD    
2943 C CE    . LYS A 327 ? 1.5488 0.9108 1.3905 0.3025  -0.0554 0.1278  327 LYS A CE    
2944 N NZ    . LYS A 327 ? 1.7361 0.9890 1.5592 0.3334  -0.0675 0.1392  327 LYS A NZ    
2945 N N     . ARG A 328 ? 1.1528 0.8744 0.9698 0.2583  -0.0684 0.2251  328 ARG A N     
2946 C CA    . ARG A 328 ? 1.2096 0.9756 1.0088 0.2768  -0.0832 0.2512  328 ARG A CA    
2947 C C     . ARG A 328 ? 1.2103 1.0450 0.9993 0.2458  -0.0766 0.2523  328 ARG A C     
2948 O O     . ARG A 328 ? 1.2655 1.1676 1.0530 0.2612  -0.0883 0.2538  328 ARG A O     
2949 C CB    . ARG A 328 ? 1.3362 1.0235 1.0963 0.2915  -0.0945 0.2979  328 ARG A CB    
2950 C CG    . ARG A 328 ? 1.4505 1.0887 1.2191 0.3424  -0.1102 0.2989  328 ARG A CG    
2951 C CD    . ARG A 328 ? 1.5797 1.1371 1.3054 0.3625  -0.1249 0.3492  328 ARG A CD    
2952 N NE    . ARG A 328 ? 1.7342 1.2333 1.4770 0.4003  -0.1365 0.3409  328 ARG A NE    
2953 C CZ    . ARG A 328 ? 1.9963 1.4336 1.7246 0.4108  -0.1500 0.3709  328 ARG A CZ    
2954 N NH1   . ARG A 328 ? 2.0726 1.4959 1.7644 0.3875  -0.1545 0.4143  328 ARG A NH1   
2955 N NH2   . ARG A 328 ? 2.1089 1.5001 1.8591 0.4449  -0.1584 0.3577  328 ARG A NH2   
2956 N N     . ARG A 329 ? 1.1233 0.9456 0.9061 0.2040  -0.0591 0.2490  329 ARG A N     
2957 C CA    . ARG A 329 ? 1.0471 0.9310 0.8186 0.1791  -0.0525 0.2486  329 ARG A CA    
2958 C C     . ARG A 329 ? 0.9998 0.9505 0.8030 0.1727  -0.0475 0.2071  329 ARG A C     
2959 O O     . ARG A 329 ? 1.0526 0.9914 0.8821 0.1672  -0.0393 0.1805  329 ARG A O     
2960 C CB    . ARG A 329 ? 1.0490 0.9012 0.8024 0.1395  -0.0360 0.2629  329 ARG A CB    
2961 C CG    . ARG A 329 ? 1.1202 0.9032 0.8398 0.1362  -0.0381 0.3070  329 ARG A CG    
2962 C CD    . ARG A 329 ? 1.1564 0.8780 0.8821 0.1045  -0.0242 0.3057  329 ARG A CD    
2963 N NE    . ARG A 329 ? 1.1436 0.8744 0.8492 0.0666  -0.0100 0.3265  329 ARG A NE    
2964 C CZ    . ARG A 329 ? 1.1233 0.8265 0.8376 0.0313  0.0037  0.3230  329 ARG A CZ    
2965 N NH1   . ARG A 329 ? 1.0537 0.7143 0.7923 0.0288  0.0039  0.2987  329 ARG A NH1   
2966 N NH2   . ARG A 329 ? 1.1265 0.8507 0.8255 -0.0015 0.0172  0.3424  329 ARG A NH2   
2967 N N     . ASN A 330 ? 1.0260 1.0449 0.8233 0.1723  -0.0527 0.2018  330 ASN A N     
2968 C CA    . ASN A 330 ? 0.9631 1.0390 0.7841 0.1580  -0.0466 0.1650  330 ASN A CA    
2969 C C     . ASN A 330 ? 0.9733 1.0357 0.7903 0.1236  -0.0281 0.1562  330 ASN A C     
2970 O O     . ASN A 330 ? 0.9690 1.0002 0.7634 0.1091  -0.0210 0.1792  330 ASN A O     
2971 C CB    . ASN A 330 ? 0.9518 1.0997 0.7640 0.1647  -0.0587 0.1599  330 ASN A CB    
2972 C CG    . ASN A 330 ? 0.9407 1.1265 0.7709 0.1981  -0.0782 0.1561  330 ASN A CG    
2973 O OD1   . ASN A 330 ? 0.8981 1.0809 0.7611 0.2111  -0.0782 0.1393  330 ASN A OD1   
2974 N ND2   . ASN A 330 ? 0.9731 1.2021 0.7816 0.2130  -0.0951 0.1704  330 ASN A ND2   
2975 N N     . VAL A 331 ? 0.5801 0.6680 0.4193 0.1104  -0.0205 0.1239  331 VAL A N     
2976 C CA    . VAL A 331 ? 0.5520 0.6347 0.3880 0.0835  -0.0059 0.1140  331 VAL A CA    
2977 C C     . VAL A 331 ? 0.6209 0.7534 0.4422 0.0755  -0.0061 0.1056  331 VAL A C     
2978 O O     . VAL A 331 ? 0.6257 0.8012 0.4505 0.0850  -0.0165 0.0928  331 VAL A O     
2979 C CB    . VAL A 331 ? 0.5407 0.6146 0.4031 0.0740  0.0025  0.0858  331 VAL A CB    
2980 C CG1   . VAL A 331 ? 0.5084 0.5729 0.3667 0.0510  0.0151  0.0788  331 VAL A CG1   
2981 C CG2   . VAL A 331 ? 0.5267 0.5576 0.4021 0.0850  0.0020  0.0884  331 VAL A CG2   
2988 N N     . ARG A 332 ? 0.6752 0.8056 0.4813 0.0583  0.0052  0.1100  332 ARG A N     
2989 C CA    . ARG A 332 ? 0.6189 0.7933 0.4093 0.0519  0.0074  0.0972  332 ARG A CA    
2990 C C     . ARG A 332 ? 0.6538 0.8284 0.4580 0.0377  0.0181  0.0687  332 ARG A C     
2991 O O     . ARG A 332 ? 0.6495 0.8473 0.4581 0.0365  0.0152  0.0425  332 ARG A O     
2992 C CB    . ARG A 332 ? 0.6453 0.8276 0.4045 0.0473  0.0130  0.1239  332 ARG A CB    
2993 C CG    . ARG A 332 ? 0.6726 0.9065 0.4093 0.0465  0.0135  0.1103  332 ARG A CG    
2994 C CD    . ARG A 332 ? 0.6459 0.8952 0.3520 0.0382  0.0250  0.1332  332 ARG A CD    
2995 N NE    . ARG A 332 ? 0.6424 0.9404 0.3311 0.0381  0.0284  0.1093  332 ARG A NE    
2996 C CZ    . ARG A 332 ? 0.7214 1.0593 0.3825 0.0482  0.0175  0.1067  332 ARG A CZ    
2997 N NH1   . ARG A 332 ? 0.7548 1.0929 0.4032 0.0609  0.0018  0.1305  332 ARG A NH1   
2998 N NH2   . ARG A 332 ? 0.7335 1.1116 0.3784 0.0476  0.0211  0.0791  332 ARG A NH2   
2999 N N     . ARG A 333 ? 0.6989 0.8460 0.5092 0.0266  0.0293  0.0741  333 ARG A N     
3000 C CA    . ARG A 333 ? 0.7195 0.8621 0.5426 0.0176  0.0373  0.0507  333 ARG A CA    
3001 C C     . ARG A 333 ? 0.6903 0.7942 0.5342 0.0133  0.0392  0.0484  333 ARG A C     
3002 O O     . ARG A 333 ? 0.6577 0.7343 0.5049 0.0127  0.0388  0.0660  333 ARG A O     
3003 C CB    . ARG A 333 ? 0.7629 0.9220 0.5756 0.0103  0.0483  0.0540  333 ARG A CB    
3004 C CG    . ARG A 333 ? 0.8618 1.0590 0.6481 0.0141  0.0486  0.0629  333 ARG A CG    
3005 C CD    . ARG A 333 ? 0.8949 1.1228 0.6731 0.0116  0.0599  0.0496  333 ARG A CD    
3006 N NE    . ARG A 333 ? 0.9174 1.1424 0.7058 0.0008  0.0718  0.0630  333 ARG A NE    
3007 C CZ    . ARG A 333 ? 0.9565 1.2069 0.7313 -0.0073 0.0818  0.0848  333 ARG A CZ    
3008 N NH1   . ARG A 333 ? 0.9668 1.2446 0.7117 -0.0036 0.0813  0.0977  333 ARG A NH1   
3009 N NH2   . ARG A 333 ? 1.0332 1.2855 0.8237 -0.0209 0.0922  0.0941  333 ARG A NH2   
3010 N N     . ILE A 334 ? 0.6504 0.7482 0.5054 0.0101  0.0410  0.0262  334 ILE A N     
3011 C CA    . ILE A 334 ? 0.6476 0.7133 0.5165 0.0060  0.0432  0.0241  334 ILE A CA    
3012 C C     . ILE A 334 ? 0.6546 0.7126 0.5258 -0.0011 0.0491  0.0139  334 ILE A C     
3013 O O     . ILE A 334 ? 0.6776 0.7494 0.5434 -0.0001 0.0507  0.0006  334 ILE A O     
3014 C CB    . ILE A 334 ? 0.6097 0.6718 0.4899 0.0096  0.0395  0.0114  334 ILE A CB    
3015 C CG1   . ILE A 334 ? 0.7052 0.7356 0.5946 0.0078  0.0423  0.0124  334 ILE A CG1   
3016 C CG2   . ILE A 334 ? 0.4883 0.5610 0.3687 0.0038  0.0407  -0.0099 334 ILE A CG2   
3017 C CD1   . ILE A 334 ? 0.7810 0.8106 0.6814 0.0175  0.0391  0.0098  334 ILE A CD1   
3023 N N     . GLY A 335 ? 0.6412 0.6763 0.5195 -0.0067 0.0511  0.0190  335 GLY A N     
3024 C CA    . GLY A 335 ? 0.6370 0.6694 0.5184 -0.0110 0.0541  0.0117  335 GLY A CA    
3025 C C     . GLY A 335 ? 0.6163 0.6217 0.5035 -0.0155 0.0528  0.0085  335 GLY A C     
3026 O O     . GLY A 335 ? 0.6766 0.6633 0.5664 -0.0169 0.0512  0.0131  335 GLY A O     
3027 N N     . VAL A 336 ? 0.6692 0.6723 0.5561 -0.0155 0.0527  -0.0002 336 VAL A N     
3028 C CA    . VAL A 336 ? 0.6181 0.6006 0.5056 -0.0196 0.0503  -0.0034 336 VAL A CA    
3029 C C     . VAL A 336 ? 0.5925 0.5892 0.4848 -0.0204 0.0480  -0.0036 336 VAL A C     
3030 O O     . VAL A 336 ? 0.5591 0.5763 0.4524 -0.0129 0.0492  -0.0066 336 VAL A O     
3031 C CB    . VAL A 336 ? 0.5502 0.5149 0.4285 -0.0172 0.0509  -0.0133 336 VAL A CB    
3032 C CG1   . VAL A 336 ? 0.5605 0.5228 0.4306 -0.0121 0.0499  -0.0195 336 VAL A CG1   
3033 C CG2   . VAL A 336 ? 0.7087 0.6544 0.5833 -0.0214 0.0499  -0.0156 336 VAL A CG2   
3040 N N     . LYS A 337 ? 0.4779 0.4678 0.3746 -0.0287 0.0441  -0.0024 337 LYS A N     
3041 C CA    . LYS A 337 ? 0.4618 0.4730 0.3669 -0.0299 0.0394  -0.0041 337 LYS A CA    
3042 C C     . LYS A 337 ? 0.4963 0.4899 0.3920 -0.0298 0.0319  -0.0112 337 LYS A C     
3043 O O     . LYS A 337 ? 0.5434 0.5143 0.4329 -0.0375 0.0309  -0.0137 337 LYS A O     
3044 C CB    . LYS A 337 ? 0.3892 0.4213 0.3106 -0.0452 0.0404  0.0043  337 LYS A CB    
3045 C CG    . LYS A 337 ? 0.3878 0.4598 0.3252 -0.0469 0.0366  0.0018  337 LYS A CG    
3046 C CD    . LYS A 337 ? 0.3962 0.4946 0.3525 -0.0685 0.0397  0.0110  337 LYS A CD    
3047 C CE    . LYS A 337 ? 0.5706 0.6405 0.5281 -0.0892 0.0336  0.0105  337 LYS A CE    
3048 N NZ    . LYS A 337 ? 0.6801 0.7898 0.6613 -0.1093 0.0293  0.0093  337 LYS A NZ    
3049 N N     . LEU A 338 ? 0.5363 0.5393 0.4278 -0.0185 0.0264  -0.0147 338 LEU A N     
3050 C CA    . LEU A 338 ? 0.4610 0.4499 0.3374 -0.0159 0.0181  -0.0185 338 LEU A CA    
3051 C C     . LEU A 338 ? 0.5427 0.5664 0.4333 -0.0158 0.0075  -0.0201 338 LEU A C     
3052 O O     . LEU A 338 ? 0.5122 0.5647 0.4149 -0.0032 0.0058  -0.0195 338 LEU A O     
3053 C CB    . LEU A 338 ? 0.4240 0.3903 0.2794 -0.0015 0.0180  -0.0181 338 LEU A CB    
3054 C CG    . LEU A 338 ? 0.5033 0.4419 0.3468 -0.0027 0.0278  -0.0182 338 LEU A CG    
3055 C CD1   . LEU A 338 ? 0.5336 0.4468 0.3567 0.0082  0.0261  -0.0167 338 LEU A CD1   
3056 C CD2   . LEU A 338 ? 0.4480 0.3703 0.2834 -0.0143 0.0329  -0.0199 338 LEU A CD2   
3057 N N     . ASP A 339 ? 0.5128 0.5383 0.4035 -0.0291 0.0001  -0.0245 339 ASP A N     
3058 C CA    . ASP A 339 ? 0.6238 0.6905 0.5303 -0.0307 -0.0126 -0.0281 339 ASP A CA    
3059 C C     . ASP A 339 ? 0.5247 0.5838 0.4152 -0.0380 -0.0250 -0.0362 339 ASP A C     
3060 O O     . ASP A 339 ? 0.5300 0.5515 0.3931 -0.0374 -0.0224 -0.0384 339 ASP A O     
3061 C CB    . ASP A 339 ? 0.5761 0.6783 0.5147 -0.0491 -0.0090 -0.0266 339 ASP A CB    
3062 C CG    . ASP A 339 ? 0.6843 0.7555 0.6219 -0.0723 -0.0033 -0.0264 339 ASP A CG    
3063 O OD1   . ASP A 339 ? 0.7200 0.7495 0.6352 -0.0722 -0.0035 -0.0315 339 ASP A OD1   
3064 O OD2   . ASP A 339 ? 0.7223 0.8103 0.6806 -0.0900 0.0020  -0.0206 339 ASP A OD2   
3065 N N     . ASN A 340 ? 0.4974 0.5977 0.4059 -0.0464 -0.0379 -0.0421 340 ASN A N     
3066 C CA    . ASN A 340 ? 0.5464 0.6486 0.4373 -0.0506 -0.0535 -0.0521 340 ASN A CA    
3067 C C     . ASN A 340 ? 0.6297 0.7122 0.4860 -0.0255 -0.0580 -0.0458 340 ASN A C     
3068 O O     . ASN A 340 ? 0.5954 0.6424 0.4183 -0.0267 -0.0562 -0.0480 340 ASN A O     
3069 C CB    . ASN A 340 ? 0.6396 0.7044 0.5167 -0.0719 -0.0501 -0.0629 340 ASN A CB    
3070 C CG    . ASN A 340 ? 0.7898 0.8653 0.6961 -0.1000 -0.0496 -0.0688 340 ASN A CG    
3071 O OD1   . ASN A 340 ? 0.9874 1.0296 0.8973 -0.1101 -0.0370 -0.0655 340 ASN A OD1   
3072 N ND2   . ASN A 340 ? 0.8073 0.9293 0.7342 -0.1136 -0.0641 -0.0767 340 ASN A ND2   
3073 N N     . ILE A 341 ? 0.5860 0.6899 0.4499 -0.0025 -0.0623 -0.0374 341 ILE A N     
3074 C CA    . ILE A 341 ? 0.6611 0.7349 0.4929 0.0222  -0.0644 -0.0270 341 ILE A CA    
3075 C C     . ILE A 341 ? 0.7213 0.8097 0.5307 0.0333  -0.0849 -0.0263 341 ILE A C     
3076 O O     . ILE A 341 ? 0.6932 0.8355 0.5262 0.0365  -0.1009 -0.0321 341 ILE A O     
3077 C CB    . ILE A 341 ? 0.6832 0.7670 0.5314 0.0455  -0.0614 -0.0206 341 ILE A CB    
3078 C CG1   . ILE A 341 ? 0.5997 0.6668 0.4618 0.0358  -0.0414 -0.0208 341 ILE A CG1   
3079 C CG2   . ILE A 341 ? 0.7352 0.7829 0.5491 0.0724  -0.0679 -0.0092 341 ILE A CG2   
3080 C CD1   . ILE A 341 ? 0.6614 0.7745 0.5594 0.0429  -0.0386 -0.0235 341 ILE A CD1   
3086 N N     . ILE A 342 ? 0.8622 0.9077 0.6261 0.0378  -0.0844 -0.0189 342 ILE A N     
3087 C CA    . ILE A 342 ? 0.8696 0.9197 0.5998 0.0546  -0.1037 -0.0116 342 ILE A CA    
3088 C C     . ILE A 342 ? 0.8219 0.8589 0.5476 0.0866  -0.1088 0.0044  342 ILE A C     
3089 O O     . ILE A 342 ? 0.8291 0.8122 0.5304 0.0927  -0.0966 0.0167  342 ILE A O     
3090 C CB    . ILE A 342 ? 0.7627 0.7716 0.4405 0.0456  -0.0985 -0.0075 342 ILE A CB    
3091 C CG1   . ILE A 342 ? 0.7074 0.7206 0.3899 0.0175  -0.0905 -0.0271 342 ILE A CG1   
3092 C CG2   . ILE A 342 ? 0.8953 0.9146 0.5351 0.0618  -0.1203 0.0013  342 ILE A CG2   
3093 C CD1   . ILE A 342 ? 0.7377 0.7102 0.3780 0.0086  -0.0753 -0.0256 342 ILE A CD1   
3099 N N     . ILE A 343 ? 0.9098 0.9976 0.6620 0.1068  -0.1266 0.0023  343 ILE A N     
3100 C CA    . ILE A 343 ? 1.0859 1.1654 0.8412 0.1422  -0.1319 0.0130  343 ILE A CA    
3101 C C     . ILE A 343 ? 1.1050 1.1376 0.8058 0.1658  -0.1448 0.0334  343 ILE A C     
3102 O O     . ILE A 343 ? 1.0678 1.1126 0.7402 0.1643  -0.1604 0.0374  343 ILE A O     
3103 C CB    . ILE A 343 ? 1.1347 1.2939 0.9387 0.1598  -0.1471 0.0030  343 ILE A CB    
3104 C CG1   . ILE A 343 ? 1.0237 1.2243 0.8779 0.1337  -0.1311 -0.0126 343 ILE A CG1   
3105 C CG2   . ILE A 343 ? 1.2295 1.3807 1.0350 0.2043  -0.1548 0.0115  343 ILE A CG2   
3106 C CD1   . ILE A 343 ? 0.9607 1.2531 0.8662 0.1386  -0.1435 -0.0241 343 ILE A CD1   
3112 N N     . ASN A 344 ? 1.1684 1.1443 0.8514 0.1862  -0.1385 0.0466  344 ASN A N     
3113 C CA    . ASN A 344 ? 1.2463 1.1661 0.8749 0.2088  -0.1499 0.0704  344 ASN A CA    
3114 C C     . ASN A 344 ? 1.2763 1.2366 0.9044 0.2468  -0.1804 0.0768  344 ASN A C     
3115 O O     . ASN A 344 ? 1.2701 1.2180 0.9044 0.2847  -0.1899 0.0829  344 ASN A O     
3116 C CB    . ASN A 344 ? 1.2947 1.1407 0.9092 0.2207  -0.1371 0.0803  344 ASN A CB    
3117 C CG    . ASN A 344 ? 1.3620 1.1724 0.9761 0.1839  -0.1093 0.0746  344 ASN A CG    
3118 O OD1   . ASN A 344 ? 1.4283 1.2427 1.0288 0.1534  -0.0998 0.0732  344 ASN A OD1   
3119 N ND2   . ASN A 344 ? 1.2827 1.0616 0.9119 0.1882  -0.0969 0.0690  344 ASN A ND2   
3120 O "O5'" . DG  B 1   ? 1.4739 0.5681 1.3584 -0.1703 -0.0045 -0.1882 1   DG  P "O5'" 
3121 C "C5'" . DG  B 1   ? 1.3488 0.4428 1.1888 -0.1445 -0.0254 -0.1772 1   DG  P "C5'" 
3122 C "C4'" . DG  B 1   ? 1.2610 0.3932 1.1350 -0.1332 -0.0521 -0.1997 1   DG  P "C4'" 
3123 O "O4'" . DG  B 1   ? 1.2613 0.3920 1.0962 -0.1066 -0.0723 -0.1913 1   DG  P "O4'" 
3124 C "C3'" . DG  B 1   ? 1.2393 0.4023 1.1241 -0.1390 -0.0536 -0.2057 1   DG  P "C3'" 
3125 O "O3'" . DG  B 1   ? 1.3012 0.4971 1.2414 -0.1428 -0.0636 -0.2361 1   DG  P "O3'" 
3126 C "C2'" . DG  B 1   ? 1.2132 0.3799 1.0458 -0.1164 -0.0691 -0.1908 1   DG  P "C2'" 
3127 C "C1'" . DG  B 1   ? 1.2240 0.3813 1.0469 -0.0973 -0.0847 -0.1928 1   DG  P "C1'" 
3128 N N9    . DG  B 1   ? 1.2268 0.3712 0.9919 -0.0785 -0.0908 -0.1748 1   DG  P N9    
3129 C C8    . DG  B 1   ? 1.2465 0.3655 0.9677 -0.0748 -0.0785 -0.1536 1   DG  P C8    
3130 N N7    . DG  B 1   ? 1.2525 0.3742 0.9353 -0.0564 -0.0865 -0.1461 1   DG  P N7    
3131 C C5    . DG  B 1   ? 1.2250 0.3639 0.9179 -0.0496 -0.1040 -0.1611 1   DG  P C5    
3132 C C6    . DG  B 1   ? 1.2451 0.3902 0.9057 -0.0336 -0.1147 -0.1617 1   DG  P C6    
3133 O O6    . DG  B 1   ? 1.2858 0.4188 0.9043 -0.0230 -0.1119 -0.1531 1   DG  P O6    
3134 N N1    . DG  B 1   ? 1.2164 0.3823 0.8960 -0.0302 -0.1281 -0.1758 1   DG  P N1    
3135 C C2    . DG  B 1   ? 1.2695 0.4524 0.9974 -0.0386 -0.1330 -0.1908 1   DG  P C2    
3136 N N2    . DG  B 1   ? 1.2894 0.4881 1.0223 -0.0299 -0.1475 -0.2034 1   DG  P N2    
3137 N N3    . DG  B 1   ? 1.2779 0.4599 1.0438 -0.0547 -0.1227 -0.1945 1   DG  P N3    
3138 C C4    . DG  B 1   ? 1.2394 0.3973 0.9835 -0.0606 -0.1076 -0.1777 1   DG  P C4    
3139 P P     . DG  B 2   ? 1.4158 0.6436 1.3855 -0.1586 -0.0598 -0.2507 2   DG  P P     
3140 O OP1   . DG  B 2   ? 1.4893 0.7394 1.5008 -0.1639 -0.0687 -0.2760 2   DG  P OP1   
3141 O OP2   . DG  B 2   ? 1.3986 0.6212 1.3654 -0.1770 -0.0334 -0.2344 2   DG  P OP2   
3142 O "O5'" . DG  B 2   ? 1.2513 0.5046 1.1972 -0.1369 -0.0815 -0.2480 2   DG  P "O5'" 
3143 C "C5'" . DG  B 2   ? 1.2368 0.4992 1.1708 -0.1145 -0.1039 -0.2554 2   DG  P "C5'" 
3144 C "C4'" . DG  B 2   ? 1.2327 0.5060 1.1278 -0.0986 -0.1174 -0.2457 2   DG  P "C4'" 
3145 O "O4'" . DG  B 2   ? 1.2449 0.4918 1.0873 -0.0875 -0.1164 -0.2221 2   DG  P "O4'" 
3146 C "C3'" . DG  B 2   ? 1.2841 0.5737 1.1809 -0.1101 -0.1102 -0.2424 2   DG  P "C3'" 
3147 O "O3'" . DG  B 2   ? 1.3555 0.6647 1.2334 -0.0957 -0.1270 -0.2467 2   DG  P "O3'" 
3148 C "C2'" . DG  B 2   ? 1.2779 0.5381 1.1258 -0.1123 -0.0969 -0.2137 2   DG  P "C2'" 
3149 C "C1'" . DG  B 2   ? 1.3213 0.5688 1.1313 -0.0909 -0.1097 -0.2069 2   DG  P "C1'" 
3150 N N9    . DG  B 2   ? 1.3724 0.5906 1.1341 -0.0869 -0.0994 -0.1842 2   DG  P N9    
3151 C C8    . DG  B 2   ? 1.4019 0.6214 1.1624 -0.0956 -0.0755 -0.1651 2   DG  P C8    
3152 N N7    . DG  B 2   ? 1.4062 0.6167 1.1264 -0.0833 -0.0707 -0.1477 2   DG  P N7    
3153 C C5    . DG  B 2   ? 1.3581 0.5630 1.0535 -0.0688 -0.0891 -0.1554 2   DG  P C5    
3154 C C6    . DG  B 2   ? 1.3165 0.5142 0.9698 -0.0535 -0.0909 -0.1473 2   DG  P C6    
3155 O O6    . DG  B 2   ? 1.3249 0.5238 0.9579 -0.0470 -0.0796 -0.1330 2   DG  P O6    
3156 N N1    . DG  B 2   ? 1.3136 0.4994 0.9463 -0.0445 -0.1080 -0.1604 2   DG  P N1    
3157 C C2    . DG  B 2   ? 1.2948 0.4996 0.9555 -0.0451 -0.1208 -0.1745 2   DG  P C2    
3158 N N2    . DG  B 2   ? 1.2021 0.4096 0.8403 -0.0329 -0.1315 -0.1795 2   DG  P N2    
3159 N N3    . DG  B 2   ? 1.3180 0.5376 1.0242 -0.0565 -0.1215 -0.1841 2   DG  P N3    
3160 C C4    . DG  B 2   ? 1.3371 0.5457 1.0546 -0.0702 -0.1062 -0.1759 2   DG  P C4    
3161 P P     . DC  B 3   ? 1.5062 0.8454 1.4001 -0.1030 -0.1286 -0.2556 3   DC  P P     
3162 O OP1   . DC  B 3   ? 1.5025 0.8639 1.4514 -0.1128 -0.1290 -0.2805 3   DC  P OP1   
3163 O OP2   . DC  B 3   ? 1.3532 0.6842 1.2243 -0.1145 -0.1143 -0.2360 3   DC  P OP2   
3164 O "O5'" . DC  B 3   ? 1.3421 0.6872 1.1971 -0.0813 -0.1488 -0.2556 3   DC  P "O5'" 
3165 C "C5'" . DC  B 3   ? 1.2874 0.6171 1.1194 -0.0632 -0.1618 -0.2559 3   DC  P "C5'" 
3166 C "C4'" . DC  B 3   ? 1.2866 0.6012 1.0568 -0.0504 -0.1659 -0.2391 3   DC  P "C4'" 
3167 O "O4'" . DC  B 3   ? 1.3303 0.6211 1.0706 -0.0525 -0.1532 -0.2204 3   DC  P "O4'" 
3168 C "C3'" . DC  B 3   ? 1.2978 0.6251 1.0479 -0.0541 -0.1641 -0.2334 3   DC  P "C3'" 
3169 O "O3'" . DC  B 3   ? 1.3243 0.6443 1.0308 -0.0392 -0.1758 -0.2310 3   DC  P "O3'" 
3170 C "C2'" . DC  B 3   ? 1.3182 0.6319 1.0425 -0.0648 -0.1457 -0.2132 3   DC  P "C2'" 
3171 C "C1'" . DC  B 3   ? 1.3352 0.6234 1.0374 -0.0569 -0.1435 -0.2053 3   DC  P "C1'" 
3172 N N1    . DC  B 3   ? 1.3676 0.6389 1.0591 -0.0664 -0.1259 -0.1899 3   DC  P N1    
3173 C C2    . DC  B 3   ? 1.3706 0.6219 1.0143 -0.0600 -0.1186 -0.1767 3   DC  P C2    
3174 O O2    . DC  B 3   ? 1.3174 0.5647 0.9300 -0.0492 -0.1248 -0.1778 3   DC  P O2    
3175 N N3    . DC  B 3   ? 1.3416 0.5918 0.9809 -0.0644 -0.1011 -0.1614 3   DC  P N3    
3176 C C4    . DC  B 3   ? 1.2270 0.4939 0.9032 -0.0754 -0.0889 -0.1552 3   DC  P C4    
3177 N N4    . DC  B 3   ? 1.1042 0.3767 0.7738 -0.0750 -0.0712 -0.1374 3   DC  P N4    
3178 C C5    . DC  B 3   ? 1.1944 0.4699 0.9135 -0.0866 -0.0943 -0.1696 3   DC  P C5    
3179 C C6    . DC  B 3   ? 1.2792 0.5526 1.0042 -0.0817 -0.1154 -0.1896 3   DC  P C6    
3180 P P     . DA  B 4   ? 1.6377 0.9707 1.3234 -0.0400 -0.1780 -0.2286 4   DA  P P     
3181 O OP1   . DA  B 4   ? 1.6904 1.0342 1.3907 -0.0279 -0.1978 -0.2453 4   DA  P OP1   
3182 O OP2   . DA  B 4   ? 1.4383 0.7867 1.1421 -0.0574 -0.1637 -0.2231 4   DA  P OP2   
3183 O "O5'" . DA  B 4   ? 1.4977 0.8050 1.1154 -0.0340 -0.1723 -0.2114 4   DA  P "O5'" 
3184 C "C5'" . DA  B 4   ? 1.4790 0.7650 1.0724 -0.0347 -0.1609 -0.2005 4   DA  P "C5'" 
3185 C "C4'" . DA  B 4   ? 1.4799 0.7564 1.0251 -0.0415 -0.1439 -0.1856 4   DA  P "C4'" 
3186 O "O4'" . DA  B 4   ? 1.4964 0.7690 1.0455 -0.0506 -0.1281 -0.1776 4   DA  P "O4'" 
3187 C "C3'" . DA  B 4   ? 1.4576 0.7508 0.9961 -0.0496 -0.1401 -0.1827 4   DA  P "C3'" 
3188 O "O3'" . DA  B 4   ? 1.4787 0.7576 0.9625 -0.0509 -0.1286 -0.1731 4   DA  P "O3'" 
3189 C "C2'" . DA  B 4   ? 1.4040 0.7100 0.9681 -0.0639 -0.1273 -0.1781 4   DA  P "C2'" 
3190 C "C1'" . DA  B 4   ? 1.3721 0.6574 0.9189 -0.0634 -0.1157 -0.1710 4   DA  P "C1'" 
3191 N N9    . DA  B 4   ? 1.2688 0.5536 0.8422 -0.0721 -0.1070 -0.1671 4   DA  P N9    
3192 C C8    . DA  B 4   ? 1.2867 0.5864 0.9090 -0.0788 -0.1101 -0.1716 4   DA  P C8    
3193 N N7    . DA  B 4   ? 1.2861 0.6044 0.9331 -0.0837 -0.0923 -0.1576 4   DA  P N7    
3194 C C5    . DA  B 4   ? 1.2461 0.5620 0.8597 -0.0775 -0.0809 -0.1453 4   DA  P C5    
3195 C C6    . DA  B 4   ? 1.2108 0.5378 0.8248 -0.0749 -0.0642 -0.1302 4   DA  P C6    
3196 N N6    . DA  B 4   ? 1.2037 0.5385 0.8456 -0.0795 -0.0544 -0.1215 4   DA  P N6    
3197 N N1    . DA  B 4   ? 1.1384 0.4650 0.7200 -0.0672 -0.0577 -0.1267 4   DA  P N1    
3198 C C2    . DA  B 4   ? 1.1225 0.4349 0.6704 -0.0656 -0.0631 -0.1358 4   DA  P C2    
3199 N N3    . DA  B 4   ? 1.2103 0.5026 0.7448 -0.0678 -0.0775 -0.1474 4   DA  P N3    
3200 C C4    . DA  B 4   ? 1.2695 0.5662 0.8400 -0.0722 -0.0881 -0.1522 4   DA  P C4    
3201 P P     . DC  B 5   ? 1.5388 0.8277 1.0013 -0.0562 -0.1257 -0.1692 5   DC  P P     
3202 O OP1   . DC  B 5   ? 1.6304 0.8928 1.0431 -0.0490 -0.1255 -0.1657 5   DC  P OP1   
3203 O OP2   . DC  B 5   ? 1.4618 0.7762 0.9647 -0.0562 -0.1395 -0.1772 5   DC  P OP2   
3204 O "O5'" . DC  B 5   ? 1.5774 0.8742 1.0255 -0.0718 -0.1016 -0.1601 5   DC  P "O5'" 
3205 C "C5'" . DC  B 5   ? 1.4407 0.7219 0.8568 -0.0747 -0.0837 -0.1561 5   DC  P "C5'" 
3206 C "C4'" . DC  B 5   ? 1.3378 0.6320 0.7615 -0.0859 -0.0659 -0.1534 5   DC  P "C4'" 
3207 O "O4'" . DC  B 5   ? 1.2281 0.5288 0.6926 -0.0838 -0.0726 -0.1528 5   DC  P "O4'" 
3208 C "C3'" . DC  B 5   ? 1.2632 0.5822 0.6894 -0.0974 -0.0571 -0.1497 5   DC  P "C3'" 
3209 O "O3'" . DC  B 5   ? 1.3414 0.6619 0.7321 -0.1047 -0.0377 -0.1495 5   DC  P "O3'" 
3210 C "C2'" . DC  B 5   ? 1.1139 0.4818 0.5960 -0.0966 -0.0475 -0.1370 5   DC  P "C2'" 
3211 C "C1'" . DC  B 5   ? 1.1037 0.4517 0.5978 -0.0881 -0.0541 -0.1391 5   DC  P "C1'" 
3212 N N1    . DC  B 5   ? 1.1411 0.5082 0.6846 -0.0875 -0.0575 -0.1331 5   DC  P N1    
3213 C C2    . DC  B 5   ? 1.1018 0.4885 0.6653 -0.0842 -0.0443 -0.1219 5   DC  P C2    
3214 O O2    . DC  B 5   ? 1.0799 0.4736 0.6257 -0.0796 -0.0330 -0.1195 5   DC  P O2    
3215 N N3    . DC  B 5   ? 1.0798 0.4743 0.6791 -0.0860 -0.0439 -0.1161 5   DC  P N3    
3216 C C4    . DC  B 5   ? 1.1170 0.5085 0.7408 -0.0925 -0.0543 -0.1234 5   DC  P C4    
3217 N N4    . DC  B 5   ? 1.1536 0.5516 0.8122 -0.0976 -0.0487 -0.1193 5   DC  P N4    
3218 C C5    . DC  B 5   ? 1.1080 0.4867 0.7191 -0.0937 -0.0709 -0.1377 5   DC  P C5    
3219 C C6    . DC  B 5   ? 1.1644 0.5274 0.7311 -0.0904 -0.0727 -0.1408 5   DC  P C6    
3220 P P     . DT  B 6   ? 1.3109 0.6746 0.7126 -0.1148 -0.0225 -0.1429 6   DT  P P     
3221 O OP1   . DT  B 6   ? 1.3220 0.6713 0.6789 -0.1240 -0.0042 -0.1490 6   DT  P OP1   
3222 O OP2   . DT  B 6   ? 1.3114 0.6861 0.7336 -0.1153 -0.0384 -0.1402 6   DT  P OP2   
3223 O "O5'" . DT  B 6   ? 1.2580 0.6732 0.7073 -0.1107 -0.0085 -0.1332 6   DT  P "O5'" 
3224 C "C5'" . DT  B 6   ? 1.1315 0.5500 0.5753 -0.1074 0.0055  -0.1373 6   DT  P "C5'" 
3225 C "C4'" . DT  B 6   ? 1.1058 0.5735 0.5911 -0.1005 0.0146  -0.1297 6   DT  P "C4'" 
3226 O "O4'" . DT  B 6   ? 1.0812 0.5487 0.5966 -0.0924 0.0023  -0.1197 6   DT  P "O4'" 
3227 C "C3'" . DT  B 6   ? 1.1000 0.6102 0.6017 -0.1051 0.0235  -0.1256 6   DT  P "C3'" 
3228 O "O3'" . DT  B 6   ? 1.0612 0.6067 0.5782 -0.0988 0.0372  -0.1304 6   DT  P "O3'" 
3229 C "C2'" . DT  B 6   ? 0.9431 0.4645 0.4754 -0.1012 0.0118  -0.1120 6   DT  P "C2'" 
3230 C "C1'" . DT  B 6   ? 1.1130 0.6162 0.6568 -0.0916 0.0054  -0.1092 6   DT  P "C1'" 
3231 N N1    . DT  B 6   ? 1.0746 0.5670 0.6402 -0.0921 -0.0063 -0.1019 6   DT  P N1    
3232 C C2    . DT  B 6   ? 1.0382 0.5351 0.6257 -0.0851 -0.0041 -0.0929 6   DT  P C2    
3233 O O2    . DT  B 6   ? 1.0045 0.5124 0.5914 -0.0751 0.0033  -0.0902 6   DT  P O2    
3234 N N3    . DT  B 6   ? 1.0055 0.4913 0.6140 -0.0900 -0.0108 -0.0895 6   DT  P N3    
3235 C C4    . DT  B 6   ? 1.0083 0.4847 0.6237 -0.0985 -0.0222 -0.0970 6   DT  P C4    
3236 O O4    . DT  B 6   ? 1.0805 0.5525 0.7223 -0.1033 -0.0262 -0.0979 6   DT  P O4    
3237 C C5    . DT  B 6   ? 1.0191 0.4883 0.6068 -0.1014 -0.0287 -0.1063 6   DT  P C5    
3238 C C7    . DT  B 6   ? 0.9833 0.4367 0.5700 -0.1062 -0.0459 -0.1176 6   DT  P C7    
3239 C C6    . DT  B 6   ? 1.0469 0.5214 0.6085 -0.0995 -0.0189 -0.1071 6   DT  P C6    
3240 P P     . DG  B 7   ? 1.0918 0.6856 0.6270 -0.1004 0.0480  -0.1319 7   DG  P P     
3241 O OP1   . DG  B 7   ? 1.0003 0.6177 0.5386 -0.0981 0.0635  -0.1493 7   DG  P OP1   
3242 O OP2   . DG  B 7   ? 1.1977 0.7871 0.7195 -0.1136 0.0466  -0.1287 7   DG  P OP2   
3243 O "O5'" . DG  B 7   ? 1.1503 0.7653 0.7169 -0.0856 0.0396  -0.1178 7   DG  P "O5'" 
3244 C "C5'" . DG  B 7   ? 1.0670 0.6859 0.6446 -0.0696 0.0382  -0.1186 7   DG  P "C5'" 
3245 C "C4'" . DG  B 7   ? 1.0390 0.6687 0.6339 -0.0578 0.0324  -0.1044 7   DG  P "C4'" 
3246 O "O4'" . DG  B 7   ? 1.0844 0.6837 0.6796 -0.0637 0.0243  -0.0908 7   DG  P "O4'" 
3247 C "C3'" . DG  B 7   ? 0.9872 0.6508 0.5929 -0.0590 0.0358  -0.1016 7   DG  P "C3'" 
3248 O "O3'" . DG  B 7   ? 0.8801 0.5621 0.4955 -0.0396 0.0343  -0.1004 7   DG  P "O3'" 
3249 C "C2'" . DG  B 7   ? 0.9290 0.5765 0.5362 -0.0697 0.0300  -0.0866 7   DG  P "C2'" 
3250 C "C1'" . DG  B 7   ? 1.0518 0.6650 0.6583 -0.0658 0.0241  -0.0796 7   DG  P "C1'" 
3251 N N9    . DG  B 7   ? 1.0713 0.6618 0.6819 -0.0779 0.0178  -0.0737 7   DG  P N9    
3252 C C8    . DG  B 7   ? 1.0171 0.5966 0.6206 -0.0907 0.0118  -0.0802 7   DG  P C8    
3253 N N7    . DG  B 7   ? 0.9360 0.4986 0.5515 -0.0968 0.0040  -0.0776 7   DG  P N7    
3254 C C5    . DG  B 7   ? 0.9655 0.5262 0.5955 -0.0909 0.0091  -0.0675 7   DG  P C5    
3255 C C6    . DG  B 7   ? 0.9444 0.4899 0.5932 -0.0965 0.0089  -0.0630 7   DG  P C6    
3256 O O6    . DG  B 7   ? 0.9883 0.5256 0.6525 -0.1066 0.0017  -0.0697 7   DG  P O6    
3257 N N1    . DG  B 7   ? 1.0217 0.5596 0.6694 -0.0887 0.0185  -0.0520 7   DG  P N1    
3258 C C2    . DG  B 7   ? 1.0073 0.5523 0.6380 -0.0732 0.0228  -0.0475 7   DG  P C2    
3259 N N2    . DG  B 7   ? 0.9884 0.5144 0.6105 -0.0645 0.0292  -0.0375 7   DG  P N2    
3260 N N3    . DG  B 7   ? 1.0826 0.6496 0.7042 -0.0666 0.0210  -0.0549 7   DG  P N3    
3261 C C4    . DG  B 7   ? 1.0626 0.6360 0.6847 -0.0780 0.0163  -0.0640 7   DG  P C4    
3262 P P     . DA  B 8   ? 0.9364 0.6559 0.5637 -0.0334 0.0360  -0.1008 8   DA  P P     
3263 O OP1   . DA  B 8   ? 1.0305 0.7791 0.6670 -0.0154 0.0367  -0.1198 8   DA  P OP1   
3264 O OP2   . DA  B 8   ? 1.0404 0.7706 0.6681 -0.0530 0.0402  -0.0999 8   DA  P OP2   
3265 O "O5'" . DA  B 8   ? 0.8908 0.5908 0.5143 -0.0231 0.0301  -0.0806 8   DA  P "O5'" 
3266 C "C5'" . DA  B 8   ? 0.9401 0.6132 0.5525 -0.0065 0.0256  -0.0764 8   DA  P "C5'" 
3267 C "C4'" . DA  B 8   ? 0.9714 0.6239 0.5731 0.0014  0.0247  -0.0585 8   DA  P "C4'" 
3268 O "O4'" . DA  B 8   ? 1.0132 0.6375 0.6158 -0.0177 0.0286  -0.0450 8   DA  P "O4'" 
3269 C "C3'" . DA  B 8   ? 0.9556 0.6365 0.5624 0.0053  0.0255  -0.0557 8   DA  P "C3'" 
3270 O "O3'" . DA  B 8   ? 0.9803 0.6393 0.5663 0.0257  0.0228  -0.0462 8   DA  P "O3'" 
3271 C "C2'" . DA  B 8   ? 0.9254 0.6052 0.5419 -0.0191 0.0305  -0.0450 8   DA  P "C2'" 
3272 C "C1'" . DA  B 8   ? 1.0172 0.6551 0.6281 -0.0282 0.0323  -0.0365 8   DA  P "C1'" 
3273 N N9    . DA  B 8   ? 1.0373 0.6731 0.6618 -0.0507 0.0322  -0.0380 8   DA  P N9    
3274 C C8    . DA  B 8   ? 0.9243 0.5772 0.5540 -0.0612 0.0292  -0.0492 8   DA  P C8    
3275 N N7    . DA  B 8   ? 0.9330 0.5728 0.5688 -0.0771 0.0257  -0.0498 8   DA  P N7    
3276 C C5    . DA  B 8   ? 0.9784 0.5978 0.6214 -0.0793 0.0285  -0.0399 8   DA  P C5    
3277 C C6    . DA  B 8   ? 0.9198 0.5230 0.5781 -0.0934 0.0269  -0.0402 8   DA  P C6    
3278 N N6    . DA  B 8   ? 0.9024 0.5051 0.5682 -0.1043 0.0172  -0.0510 8   DA  P N6    
3279 N N1    . DA  B 8   ? 1.0426 0.6271 0.7064 -0.0954 0.0358  -0.0317 8   DA  P N1    
3280 C C2    . DA  B 8   ? 1.1169 0.6913 0.7622 -0.0820 0.0439  -0.0210 8   DA  P C2    
3281 N N3    . DA  B 8   ? 1.0816 0.6678 0.7091 -0.0640 0.0417  -0.0201 8   DA  P N3    
3282 C C4    . DA  B 8   ? 1.0631 0.6760 0.6953 -0.0645 0.0344  -0.0311 8   DA  P C4    
3283 P P     . DT  B 9   ? 1.2458 0.9256 0.8294 0.0373  0.0213  -0.0426 9   DT  P P     
3284 O OP1   . DT  B 9   ? 1.2713 0.9605 0.8453 0.0687  0.0103  -0.0574 9   DT  P OP1   
3285 O OP2   . DT  B 9   ? 1.2738 0.9918 0.8816 0.0178  0.0252  -0.0446 9   DT  P OP2   
3286 O "O5'" . DT  B 9   ? 1.0670 0.7010 0.6266 0.0334  0.0287  -0.0199 9   DT  P "O5'" 
3287 C "C5'" . DT  B 9   ? 1.0816 0.6688 0.6266 0.0259  0.0342  -0.0111 9   DT  P "C5'" 
3288 C "C4'" . DT  B 9   ? 1.1680 0.7307 0.7106 0.0061  0.0477  0.0053  9   DT  P "C4'" 
3289 O "O4'" . DT  B 9   ? 1.1153 0.6978 0.6914 -0.0208 0.0505  0.0016  9   DT  P "O4'" 
3290 C "C3'" . DT  B 9   ? 1.2419 0.8158 0.7777 0.0100  0.0517  0.0137  9   DT  P "C3'" 
3291 O "O3'" . DT  B 9   ? 1.4047 0.9264 0.9080 0.0094  0.0649  0.0289  9   DT  P "O3'" 
3292 C "C2'" . DT  B 9   ? 1.1268 0.7397 0.7002 -0.0153 0.0543  0.0112  9   DT  P "C2'" 
3293 C "C1'" . DT  B 9   ? 1.0181 0.6135 0.6063 -0.0347 0.0575  0.0083  9   DT  P "C1'" 
3294 N N1    . DT  B 9   ? 0.8882 0.5145 0.5077 -0.0538 0.0526  -0.0010 9   DT  P N1    
3295 C C2    . DT  B 9   ? 0.9626 0.5775 0.6004 -0.0745 0.0573  -0.0015 9   DT  P C2    
3296 O O2    . DT  B 9   ? 0.9784 0.5627 0.6121 -0.0810 0.0688  0.0052  9   DT  P O2    
3297 N N3    . DT  B 9   ? 0.9589 0.5967 0.6183 -0.0873 0.0483  -0.0124 9   DT  P N3    
3298 C C4    . DT  B 9   ? 0.9868 0.6515 0.6457 -0.0843 0.0387  -0.0207 9   DT  P C4    
3299 O O4    . DT  B 9   ? 1.0260 0.6988 0.6943 -0.0958 0.0309  -0.0299 9   DT  P O4    
3300 C C5    . DT  B 9   ? 0.9051 0.5846 0.5494 -0.0662 0.0384  -0.0204 9   DT  P C5    
3301 C C7    . DT  B 9   ? 0.8236 0.5333 0.4692 -0.0653 0.0331  -0.0322 9   DT  P C7    
3302 C C6    . DT  B 9   ? 0.9035 0.5655 0.5313 -0.0503 0.0434  -0.0118 9   DT  P C6    
3303 P P     . DC  B 10  ? 1.3446 0.8534 0.8180 0.0228  0.0699  0.0397  10  DC  P P     
3304 O OP1   . DC  B 10  ? 1.4275 0.8670 0.8444 0.0400  0.0749  0.0488  10  DC  P OP1   
3305 O OP2   . DC  B 10  ? 1.3260 0.8860 0.8142 0.0388  0.0554  0.0305  10  DC  P OP2   
3306 O "O5'" . DC  B 10  ? 1.4104 0.9264 0.9071 -0.0078 0.0872  0.0474  10  DC  P "O5'" 
3307 C "C5'" . DC  B 10  ? 1.5139 0.9984 1.0173 -0.0325 0.1037  0.0506  10  DC  P "C5'" 
3308 C "C4'" . DC  B 10  ? 1.5680 1.0838 1.1120 -0.0597 0.1129  0.0481  10  DC  P "C4'" 
3309 O "O4'" . DC  B 10  ? 1.5023 1.0668 1.0894 -0.0686 0.0975  0.0347  10  DC  P "O4'" 
3310 C "C3'" . DC  B 10  ? 1.6499 1.1848 1.1887 -0.0556 0.1165  0.0544  10  DC  P "C3'" 
3311 O "O3'" . DC  B 10  ? 1.7778 1.2967 1.3244 -0.0790 0.1390  0.0578  10  DC  P "O3'" 
3312 C "C2'" . DC  B 10  ? 1.4913 1.0901 1.0696 -0.0574 0.0983  0.0436  10  DC  P "C2'" 
3313 C "C1'" . DC  B 10  ? 1.4194 1.0249 1.0298 -0.0760 0.0947  0.0324  10  DC  P "C1'" 
3314 N N1    . DC  B 10  ? 1.2297 0.8770 0.8635 -0.0757 0.0763  0.0207  10  DC  P N1    
3315 C C2    . DC  B 10  ? 1.1942 0.8547 0.8590 -0.0947 0.0711  0.0092  10  DC  P C2    
3316 O O2    . DC  B 10  ? 1.2032 0.8475 0.8836 -0.1109 0.0808  0.0067  10  DC  P O2    
3317 N N3    . DC  B 10  ? 1.1840 0.8715 0.8589 -0.0947 0.0559  -0.0010 10  DC  P N3    
3318 C C4    . DC  B 10  ? 1.1676 0.8740 0.8295 -0.0798 0.0492  -0.0013 10  DC  P C4    
3319 N N4    . DC  B 10  ? 1.1072 0.8341 0.7753 -0.0838 0.0387  -0.0123 10  DC  P N4    
3320 C C5    . DC  B 10  ? 1.2024 0.9042 0.8423 -0.0598 0.0531  0.0072  10  DC  P C5    
3321 C C6    . DC  B 10  ? 1.2081 0.8773 0.8311 -0.0568 0.0652  0.0187  10  DC  P C6    
3322 P P     . DG  B 11  ? 1.6229 1.1520 1.1616 -0.0793 0.1491  0.0650  11  DG  P P     
3323 O OP1   . DG  B 11  ? 1.7383 1.2112 1.2490 -0.0935 0.1791  0.0728  11  DG  P OP1   
3324 O OP2   . DG  B 11  ? 1.4545 1.0016 0.9707 -0.0500 0.1314  0.0695  11  DG  P OP2   
3325 O "O5'" . DG  B 11  ? 1.6330 1.2203 1.2320 -0.1015 0.1436  0.0516  11  DG  P "O5'" 
3326 C "C5'" . DG  B 11  ? 1.5705 1.1612 1.2088 -0.1271 0.1501  0.0385  11  DG  P "C5'" 
3327 C "C4'" . DG  B 11  ? 1.4693 1.1077 1.1542 -0.1433 0.1458  0.0254  11  DG  P "C4'" 
3328 O "O4'" . DG  B 11  ? 1.3738 1.0555 1.0725 -0.1325 0.1186  0.0200  11  DG  P "O4'" 
3329 C "C3'" . DG  B 11  ? 1.4442 1.0874 1.1211 -0.1456 0.1608  0.0319  11  DG  P "C3'" 
3330 O "O3'" . DG  B 11  ? 1.3751 1.0532 1.1013 -0.1667 0.1626  0.0145  11  DG  P "O3'" 
3331 C "C2'" . DG  B 11  ? 1.3920 1.0622 1.0512 -0.1215 0.1401  0.0401  11  DG  P "C2'" 
3332 C "C1'" . DG  B 11  ? 1.2502 0.9569 0.9422 -0.1238 0.1155  0.0261  11  DG  P "C1'" 
3333 N N9    . DG  B 11  ? 1.1002 0.8251 0.7769 -0.1036 0.0961  0.0295  11  DG  P N9    
3334 C C8    . DG  B 11  ? 1.1651 0.8721 0.8060 -0.0811 0.0943  0.0396  11  DG  P C8    
3335 N N7    . DG  B 11  ? 1.1462 0.8831 0.7899 -0.0691 0.0764  0.0347  11  DG  P N7    
3336 C C5    . DG  B 11  ? 1.0537 0.8226 0.7291 -0.0851 0.0666  0.0235  11  DG  P C5    
3337 C C6    . DG  B 11  ? 1.0061 0.8071 0.6916 -0.0845 0.0497  0.0143  11  DG  P C6    
3338 O O6    . DG  B 11  ? 1.0220 0.8367 0.6975 -0.0717 0.0420  0.0124  11  DG  P O6    
3339 N N1    . DG  B 11  ? 0.9198 0.7351 0.6282 -0.1013 0.0421  0.0039  11  DG  P N1    
3340 C C2    . DG  B 11  ? 0.8686 0.6769 0.5974 -0.1160 0.0488  -0.0006 11  DG  P C2    
3341 N N2    . DG  B 11  ? 0.8648 0.6893 0.6146 -0.1271 0.0354  -0.0151 11  DG  P N2    
3342 N N3    . DG  B 11  ? 0.8867 0.6711 0.6138 -0.1197 0.0675  0.0059  11  DG  P N3    
3343 C C4    . DG  B 11  ? 1.0110 0.7733 0.7069 -0.1041 0.0761  0.0196  11  DG  P C4    
3344 P P     . DG  B 12  ? 1.5854 1.2845 1.3177 -0.1716 0.1738  0.0153  12  DG  P P     
3345 O OP1   . DG  B 12  ? 1.5970 1.2981 1.3692 -0.1997 0.1953  -0.0030 12  DG  P OP1   
3346 O OP2   . DG  B 12  ? 1.5269 1.1937 1.2021 -0.1525 0.1840  0.0379  12  DG  P OP2   
3347 O "O5'" . DG  B 12  ? 1.3525 1.1092 1.1137 -0.1644 0.1423  0.0053  12  DG  P "O5'" 
3348 C "C5'" . DG  B 12  ? 1.2695 1.0543 1.0762 -0.1763 0.1251  -0.0176 12  DG  P "C5'" 
3349 C "C4'" . DG  B 12  ? 1.1204 0.9499 0.9440 -0.1708 0.1004  -0.0264 12  DG  P "C4'" 
3350 O "O4'" . DG  B 12  ? 1.0247 0.8592 0.8196 -0.1521 0.0807  -0.0150 12  DG  P "O4'" 
3351 C "C3'" . DG  B 12  ? 1.1019 0.9519 0.9286 -0.1718 0.1096  -0.0236 12  DG  P "C3'" 
3352 O "O3'" . DG  B 12  ? 0.9691 0.8592 0.8299 -0.1756 0.0882  -0.0436 12  DG  P "O3'" 
3353 C "C2'" . DG  B 12  ? 1.0496 0.8947 0.8323 -0.1497 0.1045  -0.0006 12  DG  P "C2'" 
3354 C "C1'" . DG  B 12  ? 0.9329 0.7847 0.7110 -0.1405 0.0793  -0.0034 12  DG  P "C1'" 
3355 N N9    . DG  B 12  ? 0.8804 0.7175 0.6211 -0.1215 0.0776  0.0132  12  DG  P N9    
3356 C C8    . DG  B 12  ? 0.8589 0.6598 0.5674 -0.1117 0.0946  0.0281  12  DG  P C8    
3357 N N7    . DG  B 12  ? 0.8989 0.6982 0.5822 -0.0918 0.0844  0.0357  12  DG  P N7    
3358 C C5    . DG  B 12  ? 0.7925 0.6288 0.4930 -0.0919 0.0632  0.0261  12  DG  P C5    
3359 C C6    . DG  B 12  ? 0.7581 0.6114 0.4485 -0.0781 0.0483  0.0250  12  DG  P C6    
3360 O O6    . DG  B 12  ? 0.8440 0.6891 0.5137 -0.0604 0.0481  0.0300  12  DG  P O6    
3361 N N1    . DG  B 12  ? 0.6804 0.5613 0.3867 -0.0866 0.0325  0.0139  12  DG  P N1    
3362 C C2    . DG  B 12  ? 0.7155 0.6056 0.4430 -0.1022 0.0269  0.0042  12  DG  P C2    
3363 N N2    . DG  B 12  ? 0.6552 0.5624 0.3851 -0.1061 0.0094  -0.0059 12  DG  P N2    
3364 N N3    . DG  B 12  ? 0.6944 0.5756 0.4389 -0.1133 0.0381  0.0019  12  DG  P N3    
3365 C C4    . DG  B 12  ? 0.7693 0.6243 0.4998 -0.1091 0.0580  0.0137  12  DG  P C4    
3366 P P     . DG  B 13  ? 1.4297 1.3495 1.3117 -0.1816 0.0953  -0.0516 13  DG  P P     
3367 O OP1   . DG  B 13  ? 1.4279 1.3703 1.3630 -0.1978 0.0901  -0.0838 13  DG  P OP1   
3368 O OP2   . DG  B 13  ? 1.5468 1.4419 1.3998 -0.1813 0.1267  -0.0314 13  DG  P OP2   
3369 O "O5'" . DG  B 13  ? 1.1701 1.1176 1.0368 -0.1646 0.0666  -0.0462 13  DG  P "O5'" 
3370 C "C5'" . DG  B 13  ? 1.0342 0.9898 0.9007 -0.1588 0.0362  -0.0559 13  DG  P "C5'" 
3371 C "C4'" . DG  B 13  ? 0.9345 0.9044 0.7732 -0.1435 0.0196  -0.0435 13  DG  P "C4'" 
3372 O "O4'" . DG  B 13  ? 0.9217 0.8713 0.7261 -0.1323 0.0260  -0.0230 13  DG  P "O4'" 
3373 C "C3'" . DG  B 13  ? 0.9389 0.9305 0.7786 -0.1398 0.0271  -0.0370 13  DG  P "C3'" 
3374 O "O3'" . DG  B 13  ? 0.8137 0.8346 0.6692 -0.1392 0.0027  -0.0535 13  DG  P "O3'" 
3375 C "C2'" . DG  B 13  ? 1.0356 1.0184 0.8361 -0.1229 0.0312  -0.0121 13  DG  P "C2'" 
3376 C "C1'" . DG  B 13  ? 0.9305 0.8945 0.7145 -0.1189 0.0229  -0.0095 13  DG  P "C1'" 
3377 N N9    . DG  B 13  ? 0.8808 0.8227 0.6360 -0.1064 0.0360  0.0085  13  DG  P N9    
3378 C C8    . DG  B 13  ? 0.7961 0.7083 0.5388 -0.1057 0.0598  0.0191  13  DG  P C8    
3379 N N7    . DG  B 13  ? 0.7401 0.6339 0.4528 -0.0893 0.0622  0.0317  13  DG  P N7    
3380 C C5    . DG  B 13  ? 0.7686 0.6866 0.4806 -0.0811 0.0412  0.0277  13  DG  P C5    
3381 C C6    . DG  B 13  ? 0.7203 0.6387 0.4132 -0.0640 0.0344  0.0317  13  DG  P C6    
3382 O O6    . DG  B 13  ? 0.7801 0.6770 0.4512 -0.0489 0.0415  0.0395  13  DG  P O6    
3383 N N1    . DG  B 13  ? 0.6806 0.6263 0.3808 -0.0652 0.0173  0.0227  13  DG  P N1    
3384 C C2    . DG  B 13  ? 0.8182 0.7810 0.5330 -0.0786 0.0056  0.0131  13  DG  P C2    
3385 N N2    . DG  B 13  ? 0.5757 0.5544 0.2859 -0.0786 -0.0081 0.0060  13  DG  P N2    
3386 N N3    . DG  B 13  ? 0.8651 0.8279 0.5970 -0.0909 0.0071  0.0082  13  DG  P N3    
3387 C C4    . DG  B 13  ? 0.7987 0.7422 0.5323 -0.0924 0.0264  0.0151  13  DG  P C4    
3388 P P     . DT  C 2   ? 2.5866 1.6928 1.4062 0.4319  -0.0007 0.0925  2   DT  T P     
3389 O OP1   . DT  C 2   ? 2.4580 1.6474 1.3445 0.4140  -0.0001 0.0966  2   DT  T OP1   
3390 O OP2   . DT  C 2   ? 2.6614 1.7024 1.4160 0.4832  -0.0247 0.0723  2   DT  T OP2   
3391 O "O5'" . DT  C 2   ? 1.9941 1.1470 0.8550 0.4243  -0.0132 0.0875  2   DT  T "O5'" 
3392 C "C5'" . DT  C 2   ? 2.0130 1.1264 0.8374 0.4574  -0.0356 0.0711  2   DT  T "C5'" 
3393 C "C4'" . DT  C 2   ? 1.9454 1.1446 0.8326 0.4770  -0.0710 0.0487  2   DT  T "C4'" 
3394 O "O4'" . DT  C 2   ? 1.9642 1.1895 0.8626 0.5180  -0.1017 0.0232  2   DT  T "O4'" 
3395 C "C3'" . DT  C 2   ? 1.7997 1.0956 0.7676 0.4399  -0.0643 0.0564  2   DT  T "C3'" 
3396 O "O3'" . DT  C 2   ? 1.7146 1.0514 0.7118 0.4465  -0.0837 0.0415  2   DT  T "O3'" 
3397 C "C2'" . DT  C 2   ? 1.7649 1.1243 0.7775 0.4535  -0.0812 0.0439  2   DT  T "C2'" 
3398 C "C1'" . DT  C 2   ? 1.8498 1.1795 0.8315 0.5080  -0.1137 0.0151  2   DT  T "C1'" 
3399 N N1    . DT  C 2   ? 1.9430 1.2896 0.9337 0.5308  -0.1268 0.0019  2   DT  T N1    
3400 C C2    . DT  C 2   ? 2.0282 1.4335 1.0619 0.5636  -0.1609 -0.0326 2   DT  T C2    
3401 O O2    . DT  C 2   ? 2.1045 1.5530 1.1731 0.5750  -0.1814 -0.0541 2   DT  T O2    
3402 N N3    . DT  C 2   ? 2.0034 1.4172 1.0402 0.5813  -0.1693 -0.0439 2   DT  T N3    
3403 C C4    . DT  C 2   ? 1.9569 1.3268 0.9573 0.5718  -0.1487 -0.0236 2   DT  T C4    
3404 O O4    . DT  C 2   ? 1.9919 1.3735 0.9973 0.5896  -0.1589 -0.0365 2   DT  T O4    
3405 C C5    . DT  C 2   ? 1.9010 1.2123 0.8591 0.5379  -0.1134 0.0111  2   DT  T C5    
3406 C C7    . DT  C 2   ? 1.7530 1.0171 0.6732 0.5238  -0.0875 0.0319  2   DT  T C7    
3407 C C6    . DT  C 2   ? 1.9613 1.2640 0.9174 0.5184  -0.1036 0.0214  2   DT  T C6    
3408 P P     . DA  C 3   ? 1.6369 1.0722 0.7285 0.4013  -0.0736 0.0400  3   DA  T P     
3409 O OP1   . DA  C 3   ? 1.7939 1.2511 0.9147 0.4089  -0.0888 0.0180  3   DA  T OP1   
3410 O OP2   . DA  C 3   ? 1.5168 0.9420 0.6141 0.3517  -0.0356 0.0676  3   DA  T OP2   
3411 O "O5'" . DA  C 3   ? 1.5404 1.0630 0.6945 0.4105  -0.0937 0.0221  3   DA  T "O5'" 
3412 C "C5'" . DA  C 3   ? 1.4898 1.0468 0.6628 0.4531  -0.1298 -0.0111 3   DA  T "C5'" 
3413 C "C4'" . DA  C 3   ? 1.4482 1.0736 0.6685 0.4575  -0.1420 -0.0219 3   DA  T "C4'" 
3414 O "O4'" . DA  C 3   ? 1.4380 1.0127 0.6130 0.4666  -0.1335 -0.0047 3   DA  T "O4'" 
3415 C "C3'" . DA  C 3   ? 1.3200 1.0260 0.6205 0.4054  -0.1227 -0.0161 3   DA  T "C3'" 
3416 O "O3'" . DA  C 3   ? 1.2712 1.0575 0.6351 0.4144  -0.1429 -0.0438 3   DA  T "O3'" 
3417 C "C2'" . DA  C 3   ? 1.2991 0.9703 0.5639 0.3874  -0.1009 0.0156  3   DA  T "C2'" 
3418 C "C1'" . DA  C 3   ? 1.3256 0.9513 0.5427 0.4331  -0.1185 0.0091  3   DA  T "C1'" 
3419 N N9    . DA  C 3   ? 1.3865 0.9551 0.5625 0.4221  -0.0948 0.0335  3   DA  T N9    
3420 C C8    . DA  C 3   ? 1.5032 1.0259 0.6481 0.3885  -0.0620 0.0610  3   DA  T C8    
3421 N N7    . DA  C 3   ? 1.5747 1.0566 0.6900 0.3846  -0.0453 0.0745  3   DA  T N7    
3422 C C5    . DA  C 3   ? 1.5450 1.0451 0.6697 0.4186  -0.0695 0.0563  3   DA  T C5    
3423 C C6    . DA  C 3   ? 1.5878 1.0624 0.6906 0.4327  -0.0678 0.0575  3   DA  T C6    
3424 N N6    . DA  C 3   ? 1.6248 1.0495 0.6901 0.4133  -0.0393 0.0787  3   DA  T N6    
3425 N N1    . DA  C 3   ? 1.5619 1.0653 0.6836 0.4670  -0.0956 0.0332  3   DA  T N1    
3426 C C2    . DA  C 3   ? 1.4689 1.0259 0.6328 0.4846  -0.1221 0.0078  3   DA  T C2    
3427 N N3    . DA  C 3   ? 1.3612 0.9485 0.5499 0.4743  -0.1267 0.0036  3   DA  T N3    
3428 C C4    . DA  C 3   ? 1.4505 1.0049 0.6150 0.4414  -0.0997 0.0300  3   DA  T C4    
3429 P P     . DC  C 4   ? 1.1810 1.0509 0.6312 0.3859  -0.1418 -0.0684 4   DC  T P     
3430 O OP1   . DC  C 4   ? 1.1794 1.1206 0.6834 0.3916  -0.1567 -0.0915 4   DC  T OP1   
3431 O OP2   . DC  C 4   ? 1.1007 0.9546 0.5460 0.4019  -0.1503 -0.0870 4   DC  T OP2   
3432 O "O5'" . DC  C 4   ? 0.9448 0.8232 0.4152 0.3293  -0.1101 -0.0412 4   DC  T "O5'" 
3433 C "C5'" . DC  C 4   ? 0.8827 0.7936 0.3762 0.3054  -0.1016 -0.0291 4   DC  T "C5'" 
3434 C "C4'" . DC  C 4   ? 1.0236 0.9511 0.5465 0.2563  -0.0786 -0.0156 4   DC  T "C4'" 
3435 O "O4'" . DC  C 4   ? 1.1024 0.9664 0.5792 0.2455  -0.0597 0.0106  4   DC  T "O4'" 
3436 C "C3'" . DC  C 4   ? 1.0305 0.9900 0.5946 0.2397  -0.0771 -0.0349 4   DC  T "C3'" 
3437 O "O3'" . DC  C 4   ? 0.8420 0.8465 0.4501 0.2008  -0.0667 -0.0349 4   DC  T "O3'" 
3438 C "C2'" . DC  C 4   ? 1.1038 1.0048 0.6314 0.2349  -0.0645 -0.0203 4   DC  T "C2'" 
3439 C "C1'" . DC  C 4   ? 1.1869 1.0436 0.6760 0.2236  -0.0485 0.0099  4   DC  T "C1'" 
3440 N N1    . DC  C 4   ? 1.3123 1.0919 0.7407 0.2357  -0.0393 0.0255  4   DC  T N1    
3441 C C2    . DC  C 4   ? 1.3926 1.1364 0.8045 0.2055  -0.0140 0.0482  4   DC  T C2    
3442 O O2    . DC  C 4   ? 1.3412 1.1216 0.7922 0.1717  -0.0032 0.0532  4   DC  T O2    
3443 N N3    . DC  C 4   ? 1.4507 1.1187 0.8031 0.2145  -0.0024 0.0618  4   DC  T N3    
3444 C C4    . DC  C 4   ? 1.4579 1.0818 0.7622 0.2543  -0.0178 0.0547  4   DC  T C4    
3445 N N4    . DC  C 4   ? 1.5546 1.0950 0.7923 0.2613  -0.0049 0.0690  4   DC  T N4    
3446 C C5    . DC  C 4   ? 1.3766 1.0383 0.6983 0.2890  -0.0475 0.0298  4   DC  T C5    
3447 C C6    . DC  C 4   ? 1.3034 1.0444 0.6900 0.2771  -0.0559 0.0155  4   DC  T C6    
3448 P P     . DG  C 5   ? 0.7902 0.8492 0.4508 0.1849  -0.0680 -0.0632 5   DG  T P     
3449 O OP1   . DG  C 5   ? 0.7478 0.8496 0.4347 0.2105  -0.0857 -0.0923 5   DG  T OP1   
3450 O OP2   . DG  C 5   ? 0.9089 0.9458 0.5658 0.1756  -0.0595 -0.0651 5   DG  T OP2   
3451 O "O5'" . DG  C 5   ? 0.8331 0.9163 0.5159 0.1444  -0.0560 -0.0531 5   DG  T "O5'" 
3452 C "C5'" . DG  C 5   ? 0.7464 0.7982 0.4115 0.1199  -0.0422 -0.0281 5   DG  T "C5'" 
3453 C "C4'" . DG  C 5   ? 0.6440 0.7240 0.3345 0.0857  -0.0366 -0.0300 5   DG  T "C4'" 
3454 O "O4'" . DG  C 5   ? 0.6399 0.6989 0.3181 0.0660  -0.0287 -0.0088 5   DG  T "O4'" 
3455 C "C3'" . DG  C 5   ? 0.6534 0.7415 0.3618 0.0650  -0.0296 -0.0441 5   DG  T "C3'" 
3456 O "O3'" . DG  C 5   ? 0.6502 0.7715 0.3796 0.0459  -0.0297 -0.0562 5   DG  T "O3'" 
3457 C "C2'" . DG  C 5   ? 0.6134 0.6637 0.3055 0.0454  -0.0189 -0.0256 5   DG  T "C2'" 
3458 C "C1'" . DG  C 5   ? 0.6197 0.6653 0.3028 0.0400  -0.0193 -0.0080 5   DG  T "C1'" 
3459 N N9    . DG  C 5   ? 0.6649 0.6722 0.3282 0.0371  -0.0101 0.0105  5   DG  T N9    
3460 C C8    . DG  C 5   ? 0.6720 0.6424 0.3104 0.0543  -0.0047 0.0183  5   DG  T C8    
3461 N N7    . DG  C 5   ? 0.6995 0.6390 0.3233 0.0445  0.0070  0.0338  5   DG  T N7    
3462 C C5    . DG  C 5   ? 0.6541 0.6163 0.2983 0.0219  0.0068  0.0345  5   DG  T C5    
3463 C C6    . DG  C 5   ? 0.6935 0.6443 0.3403 0.0038  0.0164  0.0433  5   DG  T C6    
3464 O O6    . DG  C 5   ? 0.7577 0.6746 0.3898 0.0007  0.0312  0.0530  5   DG  T O6    
3465 N N1    . DG  C 5   ? 0.6165 0.5979 0.2850 -0.0123 0.0080  0.0374  5   DG  T N1    
3466 C C2    . DG  C 5   ? 0.6591 0.6715 0.3390 -0.0130 -0.0054 0.0266  5   DG  T C2    
3467 N N2    . DG  C 5   ? 0.5619 0.5921 0.2534 -0.0287 -0.0132 0.0222  5   DG  T N2    
3468 N N3    . DG  C 5   ? 0.6781 0.7019 0.3573 0.0003  -0.0104 0.0181  5   DG  T N3    
3469 C C4    . DG  C 5   ? 0.6558 0.6561 0.3198 0.0182  -0.0048 0.0217  5   DG  T C4    
3470 P P     . DC  C 6   ? 0.6868 0.8181 0.4311 0.0202  -0.0200 -0.0741 6   DC  T P     
3471 O OP1   . DC  C 6   ? 0.6227 0.7877 0.3832 0.0100  -0.0217 -0.0881 6   DC  T OP1   
3472 O OP2   . DC  C 6   ? 0.6404 0.7703 0.3922 0.0318  -0.0170 -0.0894 6   DC  T OP2   
3473 O "O5'" . DC  C 6   ? 0.6423 0.7425 0.3691 -0.0062 -0.0140 -0.0564 6   DC  T "O5'" 
3474 C "C5'" . DC  C 6   ? 0.6442 0.7484 0.3661 -0.0208 -0.0180 -0.0490 6   DC  T "C5'" 
3475 C "C4'" . DC  C 6   ? 0.6734 0.7468 0.3806 -0.0407 -0.0158 -0.0373 6   DC  T "C4'" 
3476 O "O4'" . DC  C 6   ? 0.6367 0.6895 0.3380 -0.0302 -0.0147 -0.0208 6   DC  T "O4'" 
3477 C "C3'" . DC  C 6   ? 0.6600 0.7129 0.3612 -0.0582 -0.0079 -0.0463 6   DC  T "C3'" 
3478 O "O3'" . DC  C 6   ? 0.7099 0.7466 0.3962 -0.0792 -0.0114 -0.0459 6   DC  T "O3'" 
3479 C "C2'" . DC  C 6   ? 0.6091 0.6364 0.3069 -0.0506 -0.0045 -0.0351 6   DC  T "C2'" 
3480 C "C1'" . DC  C 6   ? 0.5887 0.6136 0.2844 -0.0449 -0.0093 -0.0190 6   DC  T "C1'" 
3481 N N1    . DC  C 6   ? 0.5954 0.5970 0.2858 -0.0344 -0.0036 -0.0059 6   DC  T N1    
3482 C C2    . DC  C 6   ? 0.5914 0.5795 0.2811 -0.0434 -0.0022 0.0046  6   DC  T C2    
3483 O O2    . DC  C 6   ? 0.6403 0.6376 0.3344 -0.0566 -0.0092 0.0017  6   DC  T O2    
3484 N N3    . DC  C 6   ? 0.7017 0.6652 0.3846 -0.0375 0.0073  0.0154  6   DC  T N3    
3485 C C4    . DC  C 6   ? 0.7428 0.6899 0.4133 -0.0208 0.0124  0.0179  6   DC  T C4    
3486 N N4    . DC  C 6   ? 0.8146 0.7289 0.4707 -0.0171 0.0235  0.0292  6   DC  T N4    
3487 C C5    . DC  C 6   ? 0.6530 0.6153 0.3246 -0.0075 0.0068  0.0062  6   DC  T C5    
3488 C C6    . DC  C 6   ? 0.6123 0.6046 0.2974 -0.0159 0.0003  -0.0063 6   DC  T C6    
3489 P P     . DC  C 7   ? 0.7727 0.7890 0.4414 -0.1011 -0.0049 -0.0600 7   DC  T P     
3490 O OP1   . DC  C 7   ? 0.8228 0.8380 0.4750 -0.1141 -0.0108 -0.0640 7   DC  T OP1   
3491 O OP2   . DC  C 7   ? 0.8322 0.8595 0.5116 -0.0989 0.0074  -0.0746 7   DC  T OP2   
3492 O "O5'" . DC  C 7   ? 0.8471 0.8264 0.5020 -0.1087 -0.0092 -0.0521 7   DC  T "O5'" 
3493 C "C5'" . DC  C 7   ? 0.7920 0.7657 0.4444 -0.1094 -0.0213 -0.0431 7   DC  T "C5'" 
3494 C "C4'" . DC  C 7   ? 0.6717 0.6266 0.3315 -0.1075 -0.0223 -0.0358 7   DC  T "C4'" 
3495 O "O4'" . DC  C 7   ? 0.6869 0.6527 0.3639 -0.0925 -0.0138 -0.0263 7   DC  T "O4'" 
3496 C "C3'" . DC  C 7   ? 0.7311 0.6535 0.3780 -0.1171 -0.0196 -0.0428 7   DC  T "C3'" 
3497 O "O3'" . DC  C 7   ? 0.8373 0.7353 0.4675 -0.1272 -0.0328 -0.0483 7   DC  T "O3'" 
3498 C "C2'" . DC  C 7   ? 0.7145 0.6320 0.3793 -0.1085 -0.0130 -0.0343 7   DC  T "C2'" 
3499 C "C1'" . DC  C 7   ? 0.6641 0.6061 0.3442 -0.0962 -0.0118 -0.0231 7   DC  T "C1'" 
3500 N N1    . DC  C 7   ? 0.6558 0.5941 0.3431 -0.0830 -0.0012 -0.0142 7   DC  T N1    
3501 C C2    . DC  C 7   ? 0.7018 0.6259 0.3964 -0.0839 0.0034  -0.0059 7   DC  T C2    
3502 O O2    . DC  C 7   ? 0.8269 0.7508 0.5294 -0.0944 -0.0025 -0.0085 7   DC  T O2    
3503 N N3    . DC  C 7   ? 0.6933 0.6026 0.3845 -0.0730 0.0142  0.0026  7   DC  T N3    
3504 C C4    . DC  C 7   ? 0.7364 0.6468 0.4189 -0.0585 0.0164  0.0015  7   DC  T C4    
3505 N N4    . DC  C 7   ? 0.8415 0.7299 0.5132 -0.0454 0.0245  0.0095  7   DC  T N4    
3506 C C5    . DC  C 7   ? 0.6331 0.5652 0.3164 -0.0571 0.0109  -0.0103 7   DC  T C5    
3507 C C6    . DC  C 7   ? 0.6398 0.5839 0.3247 -0.0714 0.0042  -0.0172 7   DC  T C6    
3508 P P     . DC  C 8   ? 0.8231 0.6787 0.4240 -0.1381 -0.0353 -0.0594 8   DC  T P     
3509 O OP1   . DC  C 8   ? 0.9849 0.8199 0.5521 -0.1463 -0.0483 -0.0676 8   DC  T OP1   
3510 O OP2   . DC  C 8   ? 1.0038 0.8572 0.6018 -0.1392 -0.0191 -0.0623 8   DC  T OP2   
3511 O "O5'" . DC  C 8   ? 0.9820 0.8220 0.5993 -0.1357 -0.0411 -0.0587 8   DC  T "O5'" 
3512 C "C5'" . DC  C 8   ? 0.9038 0.7384 0.5269 -0.1363 -0.0578 -0.0638 8   DC  T "C5'" 
3513 C "C4'" . DC  C 8   ? 0.8629 0.7048 0.5213 -0.1333 -0.0538 -0.0608 8   DC  T "C4'" 
3514 O "O4'" . DC  C 8   ? 0.8927 0.7594 0.5702 -0.1266 -0.0361 -0.0462 8   DC  T "O4'" 
3515 C "C3'" . DC  C 8   ? 0.8274 0.6402 0.4849 -0.1357 -0.0522 -0.0666 8   DC  T "C3'" 
3516 O "O3'" . DC  C 8   ? 0.9291 0.7190 0.5813 -0.1382 -0.0719 -0.0826 8   DC  T "O3'" 
3517 C "C2'" . DC  C 8   ? 0.8541 0.6810 0.5451 -0.1328 -0.0372 -0.0570 8   DC  T "C2'" 
3518 C "C1'" . DC  C 8   ? 0.8744 0.7331 0.5729 -0.1265 -0.0277 -0.0437 8   DC  T "C1'" 
3519 N N1    . DC  C 8   ? 0.8092 0.6714 0.5081 -0.1181 -0.0107 -0.0312 8   DC  T N1    
3520 C C2    . DC  C 8   ? 0.8398 0.6959 0.5538 -0.1159 0.0017  -0.0235 8   DC  T C2    
3521 O O2    . DC  C 8   ? 0.9013 0.7551 0.6343 -0.1237 0.0014  -0.0281 8   DC  T O2    
3522 N N3    . DC  C 8   ? 0.8375 0.6885 0.5434 -0.1052 0.0139  -0.0133 8   DC  T N3    
3523 C C4    . DC  C 8   ? 0.8362 0.6957 0.5284 -0.0964 0.0130  -0.0139 8   DC  T C4    
3524 N N4    . DC  C 8   ? 0.8454 0.6996 0.5304 -0.0823 0.0216  -0.0074 8   DC  T N4    
3525 C C5    . DC  C 8   ? 0.7534 0.6240 0.4368 -0.1018 0.0038  -0.0236 8   DC  T C5    
3526 C C6    . DC  C 8   ? 0.7582 0.6258 0.4410 -0.1128 -0.0074 -0.0305 8   DC  T C6    
3527 P P     . DT  C 9   ? 0.8922 0.6475 0.5413 -0.1394 -0.0769 -0.0934 9   DT  T P     
3528 O OP1   . DT  C 9   ? 1.0523 0.7823 0.6856 -0.1379 -0.1035 -0.1134 9   DT  T OP1   
3529 O OP2   . DT  C 9   ? 0.9759 0.7150 0.6006 -0.1402 -0.0634 -0.0863 9   DT  T OP2   
3530 O "O5'" . DT  C 9   ? 0.9735 0.7460 0.6693 -0.1401 -0.0646 -0.0897 9   DT  T "O5'" 
3531 C "C5'" . DT  C 9   ? 0.9585 0.7472 0.6899 -0.1424 -0.0717 -0.1010 9   DT  T "C5'" 
3532 C "C4'" . DT  C 9   ? 1.0095 0.7994 0.7767 -0.1471 -0.0560 -0.1006 9   DT  T "C4'" 
3533 O "O4'" . DT  C 9   ? 0.9547 0.7634 0.7310 -0.1474 -0.0316 -0.0804 9   DT  T "O4'" 
3534 C "C3'" . DT  C 9   ? 1.0817 0.8421 0.8379 -0.1467 -0.0514 -0.0993 9   DT  T "C3'" 
3535 O "O3'" . DT  C 9   ? 1.3551 1.0874 1.1019 -0.1451 -0.0739 -0.1201 9   DT  T "O3'" 
3536 C "C2'" . DT  C 9   ? 0.9153 0.6820 0.7038 -0.1523 -0.0299 -0.0928 9   DT  T "C2'" 
3537 C "C1'" . DT  C 9   ? 0.9564 0.7477 0.7408 -0.1498 -0.0150 -0.0744 9   DT  T "C1'" 
3538 N N1    . DT  C 9   ? 0.9197 0.7057 0.6758 -0.1412 -0.0032 -0.0551 9   DT  T N1    
3539 C C2    . DT  C 9   ? 0.9247 0.7024 0.6814 -0.1388 0.0170  -0.0413 9   DT  T C2    
3540 O O2    . DT  C 9   ? 0.9840 0.7546 0.7602 -0.1463 0.0298  -0.0419 9   DT  T O2    
3541 N N3    . DT  C 9   ? 0.8709 0.6458 0.6024 -0.1272 0.0221  -0.0290 9   DT  T N3    
3542 C C4    . DT  C 9   ? 0.9481 0.7322 0.6603 -0.1211 0.0131  -0.0305 9   DT  T C4    
3543 O O4    . DT  C 9   ? 0.9759 0.7624 0.6732 -0.1105 0.0188  -0.0237 9   DT  T O4    
3544 C C5    . DT  C 9   ? 0.9875 0.7755 0.6966 -0.1278 -0.0036 -0.0433 9   DT  T C5    
3545 C C7    . DT  C 9   ? 0.6936 0.4841 0.3766 -0.1260 -0.0098 -0.0468 9   DT  T C7    
3546 C C6    . DT  C 9   ? 0.9141 0.7007 0.6422 -0.1357 -0.0126 -0.0542 9   DT  T C6    
3547 P P     . DG  C 10  ? 1.1182 0.8466 0.9040 -0.1478 -0.0871 -0.1459 10  DG  T P     
3548 O OP1   . DG  C 10  ? 1.2373 0.9965 1.0545 -0.1502 -0.0942 -0.1590 10  DG  T OP1   
3549 O OP2   . DG  C 10  ? 1.1438 0.8331 0.8982 -0.1406 -0.1095 -0.1604 10  DG  T OP2   
3550 O "O5'" . DG  C 10  ? 0.9215 0.6497 0.7374 -0.1551 -0.0630 -0.1383 10  DG  T "O5'" 
3551 C "C5'" . DG  C 10  ? 0.9592 0.7057 0.8252 -0.1649 -0.0541 -0.1513 10  DG  T "C5'" 
3552 C "C4'" . DG  C 10  ? 1.0553 0.7912 0.9333 -0.1726 -0.0268 -0.1382 10  DG  T "C4'" 
3553 O "O4'" . DG  C 10  ? 1.1019 0.8353 0.9462 -0.1678 -0.0092 -0.1087 10  DG  T "O4'" 
3554 C "C3'" . DG  C 10  ? 1.1556 0.8607 1.0311 -0.1709 -0.0330 -0.1460 10  DG  T "C3'" 
3555 O "O3'" . DG  C 10  ? 1.1936 0.8957 1.1037 -0.1830 -0.0135 -0.1506 10  DG  T "O3'" 
3556 C "C2'" . DG  C 10  ? 1.1149 0.8019 0.9437 -0.1621 -0.0260 -0.1211 10  DG  T "C2'" 
3557 C "C1'" . DG  C 10  ? 1.0764 0.7819 0.9018 -0.1641 -0.0033 -0.0997 10  DG  T "C1'" 
3558 N N9    . DG  C 10  ? 1.0398 0.7449 0.8263 -0.1536 -0.0001 -0.0799 10  DG  T N9    
3559 C C8    . DG  C 10  ? 1.0435 0.7502 0.8018 -0.1466 -0.0150 -0.0808 10  DG  T C8    
3560 N N7    . DG  C 10  ? 1.0218 0.7332 0.7557 -0.1393 -0.0058 -0.0651 10  DG  T N7    
3561 C C5    . DG  C 10  ? 1.0136 0.7230 0.7555 -0.1382 0.0131  -0.0522 10  DG  T C5    
3562 C C6    . DG  C 10  ? 1.0004 0.7108 0.7232 -0.1276 0.0257  -0.0361 10  DG  T C6    
3563 O O6    . DG  C 10  ? 1.0104 0.7315 0.7136 -0.1181 0.0234  -0.0321 10  DG  T O6    
3564 N N1    . DG  C 10  ? 0.9228 0.6177 0.6498 -0.1284 0.0423  -0.0268 10  DG  T N1    
3565 C C2    . DG  C 10  ? 0.9841 0.6672 0.7353 -0.1420 0.0502  -0.0332 10  DG  T C2    
3566 N N2    . DG  C 10  ? 0.9625 0.6228 0.7065 -0.1433 0.0703  -0.0225 10  DG  T N2    
3567 N N3    . DG  C 10  ? 0.9929 0.6834 0.7720 -0.1530 0.0391  -0.0514 10  DG  T N3    
3568 C C4    . DG  C 10  ? 1.0109 0.7133 0.7817 -0.1485 0.0188  -0.0597 10  DG  T C4    
3569 P P     . DA  C 11  ? 1.3708 1.0478 1.2995 -0.1851 -0.0208 -0.1688 11  DA  T P     
3570 O OP1   . DA  C 11  ? 1.4623 1.1543 1.4318 -0.1865 -0.0433 -0.2048 11  DA  T OP1   
3571 O OP2   . DA  C 11  ? 1.2427 0.8905 1.1270 -0.1727 -0.0298 -0.1557 11  DA  T OP2   
3572 O "O5'" . DA  C 11  ? 1.3465 1.0156 1.2963 -0.2006 0.0134  -0.1600 11  DA  T "O5'" 
3573 C "C5'" . DA  C 11  ? 1.2243 0.9056 1.1720 -0.2089 0.0402  -0.1430 11  DA  T "C5'" 
3574 C "C4'" . DA  C 11  ? 1.1632 0.8123 1.0792 -0.2096 0.0656  -0.1170 11  DA  T "C4'" 
3575 O "O4'" . DA  C 11  ? 1.1351 0.7808 1.0026 -0.1923 0.0606  -0.0922 11  DA  T "O4'" 
3576 C "C3'" . DA  C 11  ? 1.2414 0.8581 1.1588 -0.2110 0.0654  -0.1221 11  DA  T "C3'" 
3577 O "O3'" . DA  C 11  ? 1.4250 1.0147 1.3397 -0.2239 0.0964  -0.1126 11  DA  T "O3'" 
3578 C "C2'" . DA  C 11  ? 1.1608 0.7629 1.0310 -0.1912 0.0508  -0.1043 11  DA  T "C2'" 
3579 C "C1'" . DA  C 11  ? 1.1692 0.7839 1.0093 -0.1838 0.0605  -0.0818 11  DA  T "C1'" 
3580 N N9    . DA  C 11  ? 1.1946 0.8159 1.0009 -0.1667 0.0442  -0.0720 11  DA  T N9    
3581 C C8    . DA  C 11  ? 1.1783 0.8111 0.9823 -0.1612 0.0204  -0.0839 11  DA  T C8    
3582 N N7    . DA  C 11  ? 1.1137 0.7490 0.8841 -0.1492 0.0151  -0.0727 11  DA  T N7    
3583 C C5    . DA  C 11  ? 1.0920 0.7212 0.8456 -0.1437 0.0331  -0.0539 11  DA  T C5    
3584 C C6    . DA  C 11  ? 1.0533 0.6854 0.7764 -0.1297 0.0359  -0.0403 11  DA  T C6    
3585 N N6    . DA  C 11  ? 0.9729 0.6178 0.6799 -0.1226 0.0247  -0.0433 11  DA  T N6    
3586 N N1    . DA  C 11  ? 1.1289 0.7477 0.8370 -0.1230 0.0512  -0.0259 11  DA  T N1    
3587 C C2    . DA  C 11  ? 1.1998 0.7985 0.9175 -0.1328 0.0664  -0.0231 11  DA  T C2    
3588 N N3    . DA  C 11  ? 1.2380 0.8346 0.9877 -0.1502 0.0697  -0.0354 11  DA  T N3    
3589 C C4    . DA  C 11  ? 1.1680 0.7838 0.9377 -0.1536 0.0506  -0.0517 11  DA  T C4    
3590 P P     . DT  C 12  ? 1.6045 1.1584 1.5286 -0.2317 0.1032  -0.1206 12  DT  T P     
3591 O OP1   . DT  C 12  ? 1.6160 1.1688 1.5824 -0.2574 0.1292  -0.1384 12  DT  T OP1   
3592 O OP2   . DT  C 12  ? 1.5188 1.0741 1.4490 -0.2194 0.0718  -0.1345 12  DT  T OP2   
3593 O "O5'" . DT  C 12  ? 1.3624 0.8753 1.2274 -0.2214 0.1188  -0.0890 12  DT  T "O5'" 
3594 C "C5'" . DT  C 12  ? 1.2863 0.8024 1.1110 -0.2093 0.1246  -0.0656 12  DT  T "C5'" 
3595 C "C4'" . DT  C 12  ? 1.2795 0.7623 1.0532 -0.1906 0.1227  -0.0451 12  DT  T "C4'" 
3596 O "O4'" . DT  C 12  ? 1.2456 0.7543 1.0025 -0.1705 0.0995  -0.0398 12  DT  T "O4'" 
3597 C "C3'" . DT  C 12  ? 1.3108 0.7635 1.0878 -0.1920 0.1183  -0.0524 12  DT  T "C3'" 
3598 O "O3'" . DT  C 12  ? 1.4545 0.8605 1.1853 -0.1843 0.1322  -0.0343 12  DT  T "O3'" 
3599 C "C2'" . DT  C 12  ? 1.2690 0.7434 1.0454 -0.1756 0.0883  -0.0581 12  DT  T "C2'" 
3600 C "C1'" . DT  C 12  ? 1.2991 0.7919 1.0438 -0.1597 0.0854  -0.0416 12  DT  T "C1'" 
3601 N N1    . DT  C 12  ? 1.2970 0.8200 1.0412 -0.1486 0.0621  -0.0474 12  DT  T N1    
3602 C C2    . DT  C 12  ? 1.2495 0.7814 0.9619 -0.1313 0.0579  -0.0353 12  DT  T C2    
3603 O O2    . DT  C 12  ? 1.2740 0.7911 0.9592 -0.1212 0.0684  -0.0211 12  DT  T O2    
3604 N N3    . DT  C 12  ? 1.1567 0.7121 0.8681 -0.1258 0.0410  -0.0428 12  DT  T N3    
3605 C C4    . DT  C 12  ? 1.0905 0.6542 0.8204 -0.1330 0.0258  -0.0592 12  DT  T C4    
3606 O O4    . DT  C 12  ? 0.9936 0.5688 0.7105 -0.1278 0.0131  -0.0641 12  DT  T O4    
3607 C C5    . DT  C 12  ? 1.1742 0.7288 0.9377 -0.1469 0.0261  -0.0727 12  DT  T C5    
3608 C C7    . DT  C 12  ? 1.1347 0.6943 0.9185 -0.1509 0.0052  -0.0950 12  DT  T C7    
3609 C C6    . DT  C 12  ? 1.2639 0.8021 1.0370 -0.1554 0.0453  -0.0671 12  DT  T C6    
3610 P P     . DC  C 13  ? 1.6245 0.9855 1.3505 -0.1890 0.1365  -0.0382 13  DC  T P     
3611 O OP1   . DC  C 13  ? 1.5447 0.8784 1.2862 -0.2153 0.1661  -0.0444 13  DC  T OP1   
3612 O OP2   . DC  C 13  ? 1.6343 1.0152 1.3878 -0.1837 0.1103  -0.0542 13  DC  T OP2   
3613 O "O5'" . DC  C 13  ? 1.5614 0.8838 1.2227 -0.1652 0.1361  -0.0160 13  DC  T "O5'" 
3614 C "C5'" . DC  C 13  ? 1.5550 0.8936 1.1850 -0.1455 0.1306  -0.0022 13  DC  T "C5'" 
3615 C "C4'" . DC  C 13  ? 1.5323 0.8850 1.1458 -0.1204 0.1064  -0.0012 13  DC  T "C4'" 
3616 O "O4'" . DC  C 13  ? 1.5214 0.9271 1.1678 -0.1206 0.0890  -0.0123 13  DC  T "O4'" 
3617 C "C3'" . DC  C 13  ? 1.5092 0.8324 1.1166 -0.1159 0.0983  -0.0060 13  DC  T "C3'" 
3618 O "O3'" . DC  C 13  ? 1.5406 0.8389 1.1011 -0.0910 0.0924  0.0039  13  DC  T "O3'" 
3619 C "C2'" . DC  C 13  ? 1.4523 0.8155 1.0942 -0.1159 0.0773  -0.0212 13  DC  T "C2'" 
3620 C "C1'" . DC  C 13  ? 1.4957 0.9033 1.1403 -0.1096 0.0715  -0.0192 13  DC  T "C1'" 
3621 N N1    . DC  C 13  ? 1.4323 0.8763 1.1081 -0.1160 0.0563  -0.0337 13  DC  T N1    
3622 C C2    . DC  C 13  ? 1.3891 0.8633 1.0553 -0.1039 0.0443  -0.0348 13  DC  T C2    
3623 O O2    . DC  C 13  ? 1.4249 0.9030 1.0657 -0.0880 0.0459  -0.0262 13  DC  T O2    
3624 N N3    . DC  C 13  ? 1.3159 0.8113 0.9990 -0.1097 0.0312  -0.0475 13  DC  T N3    
3625 C C4    . DC  C 13  ? 1.2772 0.7671 0.9878 -0.1231 0.0260  -0.0604 13  DC  T C4    
3626 N N4    . DC  C 13  ? 1.2543 0.7576 0.9719 -0.1248 0.0100  -0.0737 13  DC  T N4    
3627 C C5    . DC  C 13  ? 1.3279 0.7954 1.0582 -0.1350 0.0369  -0.0626 13  DC  T C5    
3628 C C6    . DC  C 13  ? 1.3957 0.8394 1.1065 -0.1328 0.0539  -0.0481 13  DC  T C6    
3629 P P     . DA  C 14  ? 2.0409 1.2913 1.5778 -0.0833 0.0886  0.0037  14  DA  T P     
3630 O OP1   . DA  C 14  ? 2.1022 1.2907 1.5898 -0.0807 0.1059  0.0173  14  DA  T OP1   
3631 O OP2   . DA  C 14  ? 1.9997 1.2578 1.5791 -0.1010 0.0842  -0.0104 14  DA  T OP2   
3632 O "O5'" . DA  C 14  ? 1.6260 0.8970 1.1452 -0.0542 0.0668  0.0010  14  DA  T "O5'" 
3633 C "C5'" . DA  C 14  ? 1.5713 0.8761 1.0810 -0.0379 0.0610  0.0031  14  DA  T "C5'" 
3634 C "C4'" . DA  C 14  ? 1.4699 0.8194 0.9979 -0.0275 0.0436  -0.0097 14  DA  T "C4'" 
3635 O "O4'" . DA  C 14  ? 1.4157 0.8032 0.9831 -0.0469 0.0429  -0.0170 14  DA  T "O4'" 
3636 C "C3'" . DA  C 14  ? 1.4124 0.7430 0.9357 -0.0199 0.0333  -0.0175 14  DA  T "C3'" 
3637 O "O3'" . DA  C 14  ? 1.4195 0.7563 0.9192 0.0075  0.0220  -0.0226 14  DA  T "O3'" 
3638 C "C2'" . DA  C 14  ? 1.3532 0.7152 0.9129 -0.0347 0.0268  -0.0295 14  DA  T "C2'" 
3639 C "C1'" . DA  C 14  ? 1.3725 0.7753 0.9509 -0.0442 0.0305  -0.0293 14  DA  T "C1'" 
3640 N N9    . DA  C 14  ? 1.3466 0.7638 0.9559 -0.0642 0.0281  -0.0372 14  DA  T N9    
3641 C C8    . DA  C 14  ? 1.4187 0.8191 1.0496 -0.0825 0.0332  -0.0388 14  DA  T C8    
3642 N N7    . DA  C 14  ? 1.4095 0.8280 1.0655 -0.0936 0.0247  -0.0507 14  DA  T N7    
3643 C C5    . DA  C 14  ? 1.2763 0.7197 0.9205 -0.0840 0.0161  -0.0545 14  DA  T C5    
3644 C C6    . DA  C 14  ? 1.1659 0.6264 0.8146 -0.0883 0.0056  -0.0657 14  DA  T C6    
3645 N N6    . DA  C 14  ? 1.1876 0.6441 0.8557 -0.0998 -0.0030 -0.0765 14  DA  T N6    
3646 N N1    . DA  C 14  ? 1.0498 0.5286 0.6801 -0.0797 0.0041  -0.0680 14  DA  T N1    
3647 C C2    . DA  C 14  ? 1.0603 0.5470 0.6764 -0.0659 0.0101  -0.0624 14  DA  T C2    
3648 N N3    . DA  C 14  ? 1.1608 0.6328 0.7700 -0.0566 0.0156  -0.0528 14  DA  T N3    
3649 C C4    . DA  C 14  ? 1.2661 0.7129 0.8862 -0.0672 0.0194  -0.0476 14  DA  T C4    
3650 P P     . DG  C 15  ? 1.7433 1.0608 1.2312 0.0220  0.0099  -0.0317 15  DG  T P     
3651 O OP1   . DG  C 15  ? 1.6813 0.9965 1.1390 0.0531  -0.0001 -0.0366 15  DG  T OP1   
3652 O OP2   . DG  C 15  ? 1.8006 1.0700 1.2847 0.0085  0.0149  -0.0256 15  DG  T OP2   
3653 O "O5'" . DG  C 15  ? 1.5915 0.9545 1.1113 0.0143  0.0039  -0.0466 15  DG  T "O5'" 
3654 C "C5'" . DG  C 15  ? 1.4986 0.9106 1.0283 0.0211  0.0020  -0.0565 15  DG  T "C5'" 
3655 C "C4'" . DG  C 15  ? 1.3904 0.8272 0.9395 0.0097  0.0001  -0.0692 15  DG  T "C4'" 
3656 O "O4'" . DG  C 15  ? 1.4061 0.8425 0.9724 -0.0134 0.0044  -0.0641 15  DG  T "O4'" 
3657 C "C3'" . DG  C 15  ? 1.4028 0.8154 0.9455 0.0142  -0.0070 -0.0766 15  DG  T "C3'" 
3658 O "O3'" . DG  C 15  ? 1.4133 0.8513 0.9531 0.0289  -0.0105 -0.0932 15  DG  T "O3'" 
3659 C "C2'" . DG  C 15  ? 1.4161 0.8219 0.9738 -0.0071 -0.0070 -0.0782 15  DG  T "C2'" 
3660 C "C1'" . DG  C 15  ? 1.3592 0.7900 0.9309 -0.0215 -0.0006 -0.0738 15  DG  T "C1'" 
3661 N N9    . DG  C 15  ? 1.3097 0.7243 0.8969 -0.0397 -0.0013 -0.0701 15  DG  T N9    
3662 C C8    . DG  C 15  ? 1.2759 0.6650 0.8713 -0.0471 0.0024  -0.0612 15  DG  T C8    
3663 N N7    . DG  C 15  ? 1.3204 0.7064 0.9373 -0.0635 0.0002  -0.0656 15  DG  T N7    
3664 C C5    . DG  C 15  ? 1.2239 0.6283 0.8393 -0.0649 -0.0075 -0.0759 15  DG  T C5    
3665 C C6    . DG  C 15  ? 1.1731 0.5775 0.8000 -0.0761 -0.0163 -0.0862 15  DG  T C6    
3666 O O6    . DG  C 15  ? 1.2035 0.5993 0.8535 -0.0866 -0.0204 -0.0910 15  DG  T O6    
3667 N N1    . DG  C 15  ? 1.1648 0.5783 0.7720 -0.0736 -0.0205 -0.0940 15  DG  T N1    
3668 C C2    . DG  C 15  ? 1.1466 0.5746 0.7341 -0.0645 -0.0139 -0.0942 15  DG  T C2    
3669 N N2    . DG  C 15  ? 1.0329 0.4638 0.6007 -0.0674 -0.0145 -0.1039 15  DG  T N2    
3670 N N3    . DG  C 15  ? 1.1486 0.5851 0.7341 -0.0530 -0.0072 -0.0880 15  DG  T N3    
3671 C C4    . DG  C 15  ? 1.2140 0.6348 0.8102 -0.0526 -0.0058 -0.0780 15  DG  T C4    
3672 P P     . DT  C 16  ? 1.8741 1.2942 1.4061 0.0369  -0.0177 -0.1045 16  DT  T P     
3673 O OP1   . DT  C 16  ? 1.8771 1.3088 1.3993 0.0629  -0.0240 -0.1166 16  DT  T OP1   
3674 O OP2   . DT  C 16  ? 1.8831 1.2578 1.4115 0.0280  -0.0215 -0.0932 16  DT  T OP2   
3675 O "O5'" . DT  C 16  ? 1.2612 0.7060 0.8021 0.0229  -0.0117 -0.1183 16  DT  T "O5'" 
3676 C "C5'" . DT  C 16  ? 1.2447 0.6977 0.7936 0.0027  -0.0058 -0.1133 16  DT  T "C5'" 
3677 C "C4'" . DT  C 16  ? 1.2815 0.7291 0.8226 -0.0088 -0.0035 -0.1246 16  DT  T "C4'" 
3678 O "O4'" . DT  C 16  ? 1.3163 0.7448 0.8592 -0.0252 -0.0069 -0.1169 16  DT  T "O4'" 
3679 C "C3'" . DT  C 16  ? 1.3829 0.8027 0.9119 -0.0006 -0.0101 -0.1321 16  DT  T "C3'" 
3680 O "O3'" . DT  C 16  ? 1.3736 0.7978 0.8885 -0.0063 -0.0026 -0.1480 16  DT  T "O3'" 
3681 C "C2'" . DT  C 16  ? 1.4343 0.8151 0.9649 -0.0086 -0.0200 -0.1215 16  DT  T "C2'" 
3682 C "C1'" . DT  C 16  ? 1.3461 0.7362 0.8822 -0.0255 -0.0168 -0.1183 16  DT  T "C1'" 
3683 N N1    . DT  C 16  ? 1.2620 0.6339 0.8146 -0.0338 -0.0236 -0.1082 16  DT  T N1    
3684 C C2    . DT  C 16  ? 1.2020 0.5641 0.7566 -0.0460 -0.0294 -0.1120 16  DT  T C2    
3685 O O2    . DT  C 16  ? 1.2378 0.5986 0.7734 -0.0502 -0.0293 -0.1207 16  DT  T O2    
3686 N N3    . DT  C 16  ? 1.1503 0.5014 0.7278 -0.0533 -0.0349 -0.1074 16  DT  T N3    
3687 C C4    . DT  C 16  ? 1.1732 0.5174 0.7673 -0.0526 -0.0312 -0.0980 16  DT  T C4    
3688 O O4    . DT  C 16  ? 1.1865 0.5219 0.8036 -0.0629 -0.0326 -0.0975 16  DT  T O4    
3689 C C5    . DT  C 16  ? 1.0847 0.4302 0.6653 -0.0389 -0.0252 -0.0915 16  DT  T C5    
3690 C C7    . DT  C 16  ? 1.1058 0.4313 0.6894 -0.0362 -0.0205 -0.0804 16  DT  T C7    
3691 C C6    . DT  C 16  ? 1.0828 0.4444 0.6458 -0.0287 -0.0237 -0.0978 16  DT  T C6    
3692 P P     . DG  C 17  ? 1.8177 1.2237 1.3181 0.0041  -0.0051 -0.1610 17  DG  T P     
3693 O OP1   . DG  C 17  ? 1.7684 1.2103 1.2688 0.0061  0.0096  -0.1812 17  DG  T OP1   
3694 O OP2   . DG  C 17  ? 1.7249 1.1090 1.2298 0.0193  -0.0190 -0.1526 17  DG  T OP2   
3695 O "O5'" . DG  C 17  ? 1.5455 0.9097 1.0228 -0.0082 -0.0087 -0.1619 17  DG  T "O5'" 
3696 C "C5'" . DG  C 17  ? 1.4212 0.7836 0.8818 -0.0245 0.0004  -0.1658 17  DG  T "C5'" 
3697 C "C4'" . DG  C 17  ? 1.3438 0.6565 0.7820 -0.0301 -0.0122 -0.1639 17  DG  T "C4'" 
3698 O "O4'" . DG  C 17  ? 1.3075 0.6155 0.7687 -0.0323 -0.0258 -0.1512 17  DG  T "O4'" 
3699 C "C3'" . DG  C 17  ? 1.3462 0.6214 0.7682 -0.0196 -0.0222 -0.1697 17  DG  T "C3'" 
3700 O "O3'" . DG  C 17  ? 1.3544 0.5909 0.7328 -0.0255 -0.0198 -0.1802 17  DG  T "O3'" 
3701 C "C2'" . DG  C 17  ? 1.2258 0.4807 0.6699 -0.0152 -0.0422 -0.1591 17  DG  T "C2'" 
3702 C "C1'" . DG  C 17  ? 1.2716 0.5394 0.7298 -0.0273 -0.0430 -0.1520 17  DG  T "C1'" 
3703 N N9    . DG  C 17  ? 1.2749 0.5479 0.7684 -0.0275 -0.0514 -0.1412 17  DG  T N9    
3704 C C8    . DG  C 17  ? 1.2304 0.5202 0.7446 -0.0212 -0.0474 -0.1318 17  DG  T C8    
3705 N N7    . DG  C 17  ? 1.2190 0.5031 0.7578 -0.0262 -0.0521 -0.1239 17  DG  T N7    
3706 C C5    . DG  C 17  ? 1.2084 0.4781 0.7504 -0.0353 -0.0618 -0.1308 17  DG  T C5    
3707 C C6    . DG  C 17  ? 1.1678 0.4309 0.7385 -0.0443 -0.0697 -0.1317 17  DG  T C6    
3708 O O6    . DG  C 17  ? 1.1907 0.4573 0.7886 -0.0494 -0.0653 -0.1248 17  DG  T O6    
3709 N N1    . DG  C 17  ? 1.1542 0.4024 0.7177 -0.0474 -0.0832 -0.1445 17  DG  T N1    
3710 C C2    . DG  C 17  ? 1.2213 0.4536 0.7447 -0.0433 -0.0867 -0.1525 17  DG  T C2    
3711 N N2    . DG  C 17  ? 1.2396 0.4606 0.7590 -0.0435 -0.1013 -0.1627 17  DG  T N2    
3712 N N3    . DG  C 17  ? 1.1525 0.3884 0.6468 -0.0386 -0.0747 -0.1505 17  DG  T N3    
3713 C C4    . DG  C 17  ? 1.2616 0.5208 0.7717 -0.0345 -0.0634 -0.1408 17  DG  T C4    
3714 P P     . DC  C 18  ? 1.4935 0.6848 0.8423 -0.0153 -0.0275 -0.1892 18  DC  T P     
3715 O OP1   . DC  C 18  ? 1.6596 0.8356 0.9659 -0.0236 -0.0103 -0.1998 18  DC  T OP1   
3716 O OP2   . DC  C 18  ? 1.4360 0.6457 0.8101 -0.0012 -0.0306 -0.1884 18  DC  T OP2   
3717 O "O5'" . DC  C 18  ? 1.6826 0.8430 1.0375 -0.0119 -0.0525 -0.1819 18  DC  T "O5'" 
3718 C "C5'" . DC  C 18  ? 1.5691 0.7353 0.9261 -0.0207 -0.0569 -0.1765 18  DC  T "C5'" 
3719 C "C4'" . DC  C 18  ? 1.4432 0.6054 0.8317 -0.0144 -0.0812 -0.1718 18  DC  T "C4'" 
3720 O "O4'" . DC  C 18  ? 1.3114 0.4841 0.7353 -0.0174 -0.0851 -0.1682 18  DC  T "O4'" 
3721 C "C3'" . DC  C 18  ? 1.3967 0.5417 0.7894 -0.0009 -0.0950 -0.1737 18  DC  T "C3'" 
3722 O "O3'" . DC  C 18  ? 1.3985 0.5315 0.7727 0.0039  -0.1044 -0.1749 18  DC  T "O3'" 
3723 C "C2'" . DC  C 18  ? 1.3401 0.4919 0.7807 0.0013  -0.1099 -0.1717 18  DC  T "C2'" 
3724 C "C1'" . DC  C 18  ? 1.2845 0.4537 0.7419 -0.0111 -0.1032 -0.1680 18  DC  T "C1'" 
3725 N N1    . DC  C 18  ? 1.3407 0.5096 0.8248 -0.0130 -0.1017 -0.1636 18  DC  T N1    
3726 C C2    . DC  C 18  ? 1.3707 0.5472 0.8976 -0.0185 -0.1104 -0.1629 18  DC  T C2    
3727 O O2    . DC  C 18  ? 1.3835 0.5717 0.9294 -0.0198 -0.1213 -0.1691 18  DC  T O2    
3728 N N3    . DC  C 18  ? 1.3220 0.4969 0.8699 -0.0219 -0.1047 -0.1559 18  DC  T N3    
3729 C C4    . DC  C 18  ? 1.2669 0.4541 0.8051 -0.0157 -0.0923 -0.1458 18  DC  T C4    
3730 N N4    . DC  C 18  ? 1.2006 0.3936 0.7598 -0.0171 -0.0857 -0.1354 18  DC  T N4    
3731 C C5    . DC  C 18  ? 1.2886 0.4799 0.7930 -0.0076 -0.0857 -0.1485 18  DC  T C5    
3732 C C6    . DC  C 18  ? 1.3129 0.4886 0.7882 -0.0086 -0.0892 -0.1587 18  DC  T C6    
3733 P P     . DC  C 19  ? 1.5321 0.6416 0.8873 0.0173  -0.1126 -0.1775 19  DC  T P     
3734 O OP1   . DC  C 19  ? 1.6380 0.7290 0.9506 0.0178  -0.1108 -0.1769 19  DC  T OP1   
3735 O OP2   . DC  C 19  ? 1.4256 0.5306 0.7741 0.0204  -0.1016 -0.1797 19  DC  T OP2   
3736 O "O5'" . DC  C 19  ? 1.4511 0.5654 0.8498 0.0264  -0.1375 -0.1798 19  DC  T "O5'" 
3737 C "C5'" . DC  C 19  ? 1.4361 0.5614 0.8556 0.0257  -0.1510 -0.1825 19  DC  T "C5'" 
3738 C "C4'" . DC  C 19  ? 1.4076 0.5444 0.8798 0.0306  -0.1682 -0.1890 19  DC  T "C4'" 
3739 O "O4'" . DC  C 19  ? 1.3642 0.5202 0.8755 0.0191  -0.1613 -0.1875 19  DC  T "O4'" 
3740 C "C3'" . DC  C 19  ? 1.3796 0.5035 0.8560 0.0404  -0.1738 -0.1902 19  DC  T "C3'" 
3741 O "O3'" . DC  C 19  ? 1.4923 0.5993 0.9468 0.0535  -0.1881 -0.1944 19  DC  T "O3'" 
3742 C "C2'" . DC  C 19  ? 1.3311 0.4717 0.8666 0.0362  -0.1804 -0.1950 19  DC  T "C2'" 
3743 C "C1'" . DC  C 19  ? 1.4358 0.5935 0.9867 0.0214  -0.1684 -0.1913 19  DC  T "C1'" 
3744 N N1    . DC  C 19  ? 1.3796 0.5345 0.9345 0.0148  -0.1546 -0.1830 19  DC  T N1    
3745 C C2    . DC  C 19  ? 1.2986 0.4629 0.8948 0.0044  -0.1514 -0.1829 19  DC  T C2    
3746 O O2    . DC  C 19  ? 1.2721 0.4511 0.9059 -0.0006 -0.1587 -0.1922 19  DC  T O2    
3747 N N3    . DC  C 19  ? 1.3425 0.4971 0.9339 0.0002  -0.1397 -0.1735 19  DC  T N3    
3748 C C4    . DC  C 19  ? 1.3867 0.5278 0.9386 0.0077  -0.1327 -0.1677 19  DC  T C4    
3749 N N4    . DC  C 19  ? 1.3058 0.4356 0.8510 0.0070  -0.1233 -0.1600 19  DC  T N4    
3750 C C5    . DC  C 19  ? 1.4364 0.5725 0.9516 0.0167  -0.1341 -0.1710 19  DC  T C5    
3751 C C6    . DC  C 19  ? 1.4035 0.5443 0.9194 0.0191  -0.1443 -0.1770 19  DC  T C6    
3754 N N1    . DCP F .   ? 0.7065 0.7231 0.4357 -0.0707 0.0026  0.0225  403 DCP A N1    
3755 C C2    . DCP F .   ? 0.5708 0.5820 0.2820 -0.0569 0.0018  0.0287  403 DCP A C2    
3756 N N3    . DCP F .   ? 0.6005 0.5869 0.2947 -0.0455 0.0156  0.0384  403 DCP A N3    
3757 C C4    . DCP F .   ? 0.6831 0.6434 0.3728 -0.0504 0.0343  0.0446  403 DCP A C4    
3758 C C5    . DCP F .   ? 0.6241 0.5909 0.3354 -0.0681 0.0403  0.0384  403 DCP A C5    
3759 C C6    . DCP F .   ? 0.5886 0.5875 0.3227 -0.0770 0.0221  0.0258  403 DCP A C6    
3760 O O2    . DCP F .   ? 0.5775 0.6072 0.2866 -0.0540 -0.0135 0.0227  403 DCP A O2    
3761 N N4    . DCP F .   ? 0.7282 0.6524 0.3895 -0.0369 0.0475  0.0550  403 DCP A N4    
3762 C "C1'" . DCP F .   ? 0.5873 0.6274 0.3284 -0.0783 -0.0178 0.0100  403 DCP A "C1'" 
3763 C "C2'" . DCP F .   ? 0.5905 0.6530 0.3302 -0.0693 -0.0219 0.0149  403 DCP A "C2'" 
3764 C "C3'" . DCP F .   ? 0.5385 0.6068 0.2999 -0.0799 -0.0158 0.0075  403 DCP A "C3'" 
3765 C "C4'" . DCP F .   ? 0.5604 0.6236 0.3369 -0.0936 -0.0263 -0.0092 403 DCP A "C4'" 
3766 O "O4'" . DCP F .   ? 0.6115 0.6509 0.3740 -0.0931 -0.0211 -0.0041 403 DCP A "O4'" 
3767 O "O3'" . DCP F .   ? 0.5218 0.6160 0.2872 -0.0752 -0.0268 0.0054  403 DCP A "O3'" 
3768 C "C5'" . DCP F .   ? 0.5324 0.5965 0.3378 -0.1064 -0.0159 -0.0217 403 DCP A "C5'" 
3769 O "O5'" . DCP F .   ? 0.6386 0.6817 0.4447 -0.1107 0.0122  -0.0130 403 DCP A "O5'" 
3770 P PA    . DCP F .   ? 0.6137 0.6618 0.4424 -0.1216 0.0348  -0.0191 403 DCP A PA    
3771 O O1A   . DCP F .   ? 0.6096 0.6246 0.4363 -0.1315 0.0635  -0.0145 403 DCP A O1A   
3772 O O2A   . DCP F .   ? 0.6553 0.7299 0.5257 -0.1343 0.0227  -0.0470 403 DCP A O2A   
3773 O O3A   . DCP F .   ? 0.8635 0.9180 0.6717 -0.1095 0.0445  -0.0032 403 DCP A O3A   
3774 P PB    . DCP F .   ? 0.5519 0.6423 0.3678 -0.1026 0.0275  -0.0082 403 DCP A PB    
3775 O O1B   . DCP F .   ? 0.6077 0.7004 0.3918 -0.0826 0.0121  0.0084  403 DCP A O1B   
3776 O O2B   . DCP F .   ? 0.6413 0.7589 0.4819 -0.1071 -0.0023 -0.0301 403 DCP A O2B   
3777 O O3B   . DCP F .   ? 0.5723 0.6651 0.3955 -0.1085 0.0538  -0.0082 403 DCP A O3B   
3778 P PG    . DCP F .   ? 0.5860 0.6895 0.4525 -0.1313 0.0717  -0.0323 403 DCP A PG    
3779 O O1G   . DCP F .   ? 0.5647 0.7046 0.4506 -0.1304 0.0660  -0.0439 403 DCP A O1G   
3780 O O2G   . DCP F .   ? 0.6907 0.7578 0.5441 -0.1426 0.1136  -0.0235 403 DCP A O2G   
3781 O O3G   . DCP F .   ? 0.8760 0.9873 0.7769 -0.1431 0.0546  -0.0560 403 DCP A O3G   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   ILE 2   2   2   ILE ILE A . n 
A 1 3   VAL 3   3   3   VAL VAL A . n 
A 1 4   ILE 4   4   4   ILE ILE A . n 
A 1 5   PHE 5   5   5   PHE PHE A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   ASP 7   7   7   ASP ASP A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   ASP 9   9   9   ASP ASP A . n 
A 1 10  TYR 10  10  10  TYR TYR A . n 
A 1 11  PHE 11  11  11  PHE PHE A . n 
A 1 12  PHE 12  12  12  PHE PHE A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  GLN 14  14  14  GLN GLN A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  GLU 16  16  16  GLU GLU A . n 
A 1 17  GLU 17  17  17  GLU GLU A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  ASN 20  20  20  ASN ASN A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  GLN 22  22  22  GLN GLN A . n 
A 1 23  TYR 23  23  23  TYR TYR A . n 
A 1 24  LYS 24  24  24  LYS LYS A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  PRO 27  27  27  PRO PRO A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  VAL 30  30  30  VAL VAL A . n 
A 1 31  CYS 31  31  31  CYS CYS A . n 
A 1 32  VAL 32  32  32  VAL VAL A . n 
A 1 33  TYR 33  33  33  TYR TYR A . n 
A 1 34  SER 34  34  34  SER SER A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  ARG 36  36  36  ARG ARG A . n 
A 1 37  THR 37  37  37  THR THR A . n 
A 1 38  LYS 38  38  38  LYS LYS A . n 
A 1 39  THR 39  39  39  THR THR A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  VAL 43  43  43  VAL VAL A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  THR 45  45  45  THR THR A . n 
A 1 46  ALA 46  46  46  ALA ALA A . n 
A 1 47  ASN 47  47  47  ASN ASN A . n 
A 1 48  TYR 48  48  48  TYR TYR A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  ALA 50  50  50  ALA ALA A . n 
A 1 51  ARG 51  51  51  ARG ARG A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  ALA 57  57  57  ALA ALA A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  MET 59  59  59  MET MET A . n 
A 1 60  PRO 60  60  60  PRO PRO A . n 
A 1 61  ILE 61  61  61  ILE ILE A . n 
A 1 62  ILE 62  62  62  ILE ILE A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  MET 65  65  65  MET MET A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  PRO 69  69  69  PRO PRO A . n 
A 1 70  SER 70  70  70  SER SER A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  ILE 72  72  72  ILE ILE A . n 
A 1 73  TYR 73  73  73  TYR TYR A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  PRO 75  75  75  PRO PRO A . n 
A 1 76  MET 76  76  76  MET MET A . n 
A 1 77  ARG 77  77  77  ARG ARG A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  PRO 79  79  79  PRO PRO A . n 
A 1 80  ILE 80  80  80  ILE ILE A . n 
A 1 81  TYR 81  81  81  TYR TYR A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  ALA 83  83  83  ALA ALA A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  ASN 86  86  86  ASN ASN A . n 
A 1 87  ARG 87  87  87  ARG ARG A . n 
A 1 88  ILE 88  88  88  ILE ILE A . n 
A 1 89  MET 89  89  89  MET MET A . n 
A 1 90  ASN 90  90  90  ASN ASN A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  ASN 93  93  93  ASN ASN A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  HIS 95  95  95  HIS HIS A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  LYS 98  98  98  LYS LYS A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 ILE 104 104 104 ILE ILE A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 GLU 106 106 106 GLU GLU A . n 
A 1 107 ALA 107 107 107 ALA ALA A . n 
A 1 108 TYR 108 108 108 TYR TYR A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 ASN 113 113 113 ASN ASN A . n 
A 1 114 LYS 114 114 114 LYS LYS A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 ASN 118 118 118 ASN ASN A . n 
A 1 119 PHE 119 119 119 PHE PHE A . n 
A 1 120 GLU 120 120 120 GLU GLU A . n 
A 1 121 ASN 121 121 121 ASN ASN A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 ILE 123 123 123 ILE ILE A . n 
A 1 124 GLU 124 124 124 GLU GLU A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 ARG 127 127 127 ARG ARG A . n 
A 1 128 LYS 128 128 128 LYS LYS A . n 
A 1 129 ILE 129 129 129 ILE ILE A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 GLN 131 131 131 GLN GLN A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 ILE 133 133 133 ILE ILE A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 LYS 136 136 136 LYS LYS A . n 
A 1 137 GLU 137 137 137 GLU GLU A . n 
A 1 138 LYS 138 138 138 LYS LYS A . n 
A 1 139 ILE 139 139 139 ILE ILE A . n 
A 1 140 THR 140 140 140 THR THR A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 THR 142 142 142 THR THR A . n 
A 1 143 VAL 143 143 143 VAL VAL A . n 
A 1 144 GLY 144 144 144 GLY GLY A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 ALA 146 146 146 ALA ALA A . n 
A 1 147 PRO 147 147 147 PRO PRO A . n 
A 1 148 ASN 148 148 148 ASN ASN A . n 
A 1 149 LYS 149 149 149 LYS LYS A . n 
A 1 150 ILE 150 150 150 ILE ILE A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 LYS 153 153 153 LYS LYS A . n 
A 1 154 ILE 154 154 154 ILE ILE A . n 
A 1 155 ILE 155 155 155 ILE ILE A . n 
A 1 156 ALA 156 156 156 ALA ALA A . n 
A 1 157 ASP 157 157 157 ASP ASP A . n 
A 1 158 LYS 158 158 158 LYS LYS A . n 
A 1 159 SER 159 159 159 SER SER A . n 
A 1 160 LYS 160 160 160 LYS LYS A . n 
A 1 161 PRO 161 161 161 PRO PRO A . n 
A 1 162 ASN 162 162 162 ASN ASN A . n 
A 1 163 GLY 163 163 163 GLY GLY A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 GLY 165 165 165 GLY GLY A . n 
A 1 166 VAL 166 166 166 VAL VAL A . n 
A 1 167 ILE 167 167 167 ILE ILE A . n 
A 1 168 ARG 168 168 168 ARG ARG A . n 
A 1 169 PRO 169 169 169 PRO PRO A . n 
A 1 170 THR 170 170 170 THR THR A . n 
A 1 171 GLU 171 171 171 GLU GLU A . n 
A 1 172 VAL 172 172 172 VAL VAL A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ASP 174 174 174 ASP ASP A . n 
A 1 175 PHE 175 175 175 PHE PHE A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 ASN 177 177 177 ASN ASN A . n 
A 1 178 GLU 178 178 178 GLU GLU A . n 
A 1 179 LEU 179 179 179 LEU LEU A . n 
A 1 180 ASP 180 180 180 ASP ASP A . n 
A 1 181 ILE 181 181 181 ILE ILE A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 GLU 183 183 183 GLU GLU A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 PRO 185 185 185 PRO PRO A . n 
A 1 186 GLY 186 186 186 GLY GLY A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 SER 189 189 189 SER SER A . n 
A 1 190 VAL 190 190 190 VAL VAL A . n 
A 1 191 LEU 191 191 191 LEU LEU A . n 
A 1 192 ALA 192 192 192 ALA ALA A . n 
A 1 193 ARG 193 193 193 ARG ARG A . n 
A 1 194 ARG 194 194 194 ARG ARG A . n 
A 1 195 LEU 195 195 195 LEU LEU A . n 
A 1 196 ASN 196 196 196 ASN ASN A . n 
A 1 197 GLU 197 197 197 GLU GLU A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 GLY 199 199 199 GLY GLY A . n 
A 1 200 ILE 200 200 200 ILE ILE A . n 
A 1 201 GLN 201 201 201 GLN GLN A . n 
A 1 202 LYS 202 202 202 LYS LYS A . n 
A 1 203 LEU 203 203 203 LEU LEU A . n 
A 1 204 ARG 204 204 204 ARG ARG A . n 
A 1 205 ASP 205 205 205 ASP ASP A . n 
A 1 206 ILE 206 206 206 ILE ILE A . n 
A 1 207 LEU 207 207 207 LEU LEU A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 LYS 209 209 209 LYS LYS A . n 
A 1 210 ASN 210 210 210 ASN ASN A . n 
A 1 211 TYR 211 211 211 TYR TYR A . n 
A 1 212 ASN 212 212 212 ASN ASN A . n 
A 1 213 GLU 213 213 213 GLU GLU A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 GLU 215 215 215 GLU GLU A . n 
A 1 216 LYS 216 216 216 LYS LYS A . n 
A 1 217 ILE 217 217 217 ILE ILE A . n 
A 1 218 THR 218 218 218 THR THR A . n 
A 1 219 GLY 219 219 219 GLY GLY A . n 
A 1 220 LYS 220 220 220 LYS LYS A . n 
A 1 221 ALA 221 221 221 ALA ALA A . n 
A 1 222 LYS 222 222 222 LYS LYS A . n 
A 1 223 ALA 223 223 223 ALA ALA A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 TYR 225 225 225 TYR TYR A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 LYS 228 228 228 LYS LYS A . n 
A 1 229 LEU 229 229 229 LEU LEU A . n 
A 1 230 ALA 230 230 230 ALA ALA A . n 
A 1 231 GLN 231 231 231 GLN GLN A . n 
A 1 232 ASN 232 232 232 ASN ASN A . n 
A 1 233 LYS 233 233 233 LYS LYS A . n 
A 1 234 TYR 234 234 234 TYR TYR A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 GLU 236 236 236 GLU GLU A . n 
A 1 237 PRO 237 237 237 PRO PRO A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 GLU 239 239 239 GLU GLU A . n 
A 1 240 ASN 240 240 240 ASN ASN A . n 
A 1 241 LYS 241 241 241 LYS LYS A . n 
A 1 242 SER 242 242 242 SER SER A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 LYS 244 244 244 LYS LYS A . n 
A 1 245 SER 245 245 245 SER SER A . n 
A 1 246 HIS 246 246 246 HIS HIS A . n 
A 1 247 GLY 247 247 247 GLY GLY A . n 
A 1 248 ARG 248 248 248 ARG ARG A . n 
A 1 249 TYR 249 249 249 TYR TYR A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 THR 251 251 251 THR THR A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 PRO 253 253 253 PRO PRO A . n 
A 1 254 TYR 254 254 254 TYR TYR A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 THR 256 256 256 THR THR A . n 
A 1 257 ARG 257 257 257 ARG ARG A . n 
A 1 258 ASP 258 258 258 ASP ASP A . n 
A 1 259 VAL 259 259 259 VAL VAL A . n 
A 1 260 LYS 260 260 260 LYS LYS A . n 
A 1 261 VAL 261 261 261 VAL VAL A . n 
A 1 262 ILE 262 262 262 ILE ILE A . n 
A 1 263 LEU 263 263 263 LEU LEU A . n 
A 1 264 PRO 264 264 264 PRO PRO A . n 
A 1 265 TYR 265 265 265 TYR TYR A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 LYS 267 267 267 LYS LYS A . n 
A 1 268 LYS 268 268 268 LYS LYS A . n 
A 1 269 ALA 269 269 269 ALA ALA A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 ASN 271 271 271 ASN ASN A . n 
A 1 272 GLU 272 272 272 GLU GLU A . n 
A 1 273 ALA 273 273 273 ALA ALA A . n 
A 1 274 TYR 274 274 274 TYR TYR A . n 
A 1 275 ASN 275 275 275 ASN ASN A . n 
A 1 276 LYS 276 276 276 LYS LYS A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 ASN 278 278 278 ASN ASN A . n 
A 1 279 GLY 279 279 279 GLY GLY A . n 
A 1 280 ILE 280 280 280 ILE ILE A . n 
A 1 281 PRO 281 281 281 PRO PRO A . n 
A 1 282 MET 282 282 282 MET MET A . n 
A 1 283 ARG 283 283 283 ARG ARG A . n 
A 1 284 ILE 284 284 284 ILE ILE A . n 
A 1 285 THR 285 285 285 THR THR A . n 
A 1 286 VAL 286 286 286 VAL VAL A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 ALA 288 288 288 ALA ALA A . n 
A 1 289 ILE 289 289 289 ILE ILE A . n 
A 1 290 MET 290 290 290 MET MET A . n 
A 1 291 GLU 291 291 291 GLU GLU A . n 
A 1 292 ASP 292 292 292 ASP ASP A . n 
A 1 293 LEU 293 293 293 LEU LEU A . n 
A 1 294 ASP 294 294 294 ASP ASP A . n 
A 1 295 ILE 295 295 295 ILE ILE A . n 
A 1 296 LEU 296 296 296 LEU LEU A . n 
A 1 297 SER 297 297 297 SER SER A . n 
A 1 298 LYS 298 298 298 LYS LYS A . n 
A 1 299 GLY 299 299 299 GLY GLY A . n 
A 1 300 LYS 300 300 300 LYS LYS A . n 
A 1 301 LYS 301 301 301 LYS LYS A . n 
A 1 302 PHE 302 302 302 PHE PHE A . n 
A 1 303 LYS 303 303 303 LYS LYS A . n 
A 1 304 HIS 304 304 304 HIS HIS A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 ILE 306 306 306 ILE ILE A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 ILE 308 308 308 ILE ILE A . n 
A 1 309 ASP 309 309 309 ASP ASP A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 ALA 311 311 311 ALA ALA A . n 
A 1 312 TYR 312 312 312 TYR TYR A . n 
A 1 313 LYS 313 313 313 LYS LYS A . n 
A 1 314 VAL 314 314 314 VAL VAL A . n 
A 1 315 ALA 315 315 315 ALA ALA A . n 
A 1 316 GLU 316 316 316 GLU GLU A . n 
A 1 317 ASP 317 317 317 ASP ASP A . n 
A 1 318 LEU 318 318 318 LEU LEU A . n 
A 1 319 LEU 319 319 319 LEU LEU A . n 
A 1 320 ARG 320 320 320 ARG ARG A . n 
A 1 321 GLU 321 321 321 GLU GLU A . n 
A 1 322 LEU 322 322 322 LEU LEU A . n 
A 1 323 LEU 323 323 323 LEU LEU A . n 
A 1 324 VAL 324 324 324 VAL VAL A . n 
A 1 325 ARG 325 325 325 ARG ARG A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 LYS 327 327 327 LYS LYS A . n 
A 1 328 ARG 328 328 328 ARG ARG A . n 
A 1 329 ARG 329 329 329 ARG ARG A . n 
A 1 330 ASN 330 330 330 ASN ASN A . n 
A 1 331 VAL 331 331 331 VAL VAL A . n 
A 1 332 ARG 332 332 332 ARG ARG A . n 
A 1 333 ARG 333 333 333 ARG ARG A . n 
A 1 334 ILE 334 334 334 ILE ILE A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 VAL 336 336 336 VAL VAL A . n 
A 1 337 LYS 337 337 337 LYS LYS A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 ASP 339 339 339 ASP ASP A . n 
A 1 340 ASN 340 340 340 ASN ASN A . n 
A 1 341 ILE 341 341 341 ILE ILE A . n 
A 1 342 ILE 342 342 342 ILE ILE A . n 
A 1 343 ILE 343 343 343 ILE ILE A . n 
A 1 344 ASN 344 344 344 ASN ASN A . n 
A 1 345 LYS 345 345 ?   ?   ?   A . n 
A 1 346 THR 346 346 ?   ?   ?   A . n 
A 1 347 ASN 347 347 ?   ?   ?   A . n 
A 1 348 LEU 348 348 ?   ?   ?   A . n 
A 1 349 SER 349 349 ?   ?   ?   A . n 
A 1 350 ASP 350 350 ?   ?   ?   A . n 
A 1 351 PHE 351 351 ?   ?   ?   A . n 
A 1 352 PHE 352 352 ?   ?   ?   A . n 
A 1 353 ASP 353 353 ?   ?   ?   A . n 
A 1 354 ILE 354 354 ?   ?   ?   A . n 
A 1 355 GLY 355 355 ?   ?   ?   A . n 
A 1 356 GLY 356 356 ?   ?   ?   A . n 
A 1 357 HIS 357 357 ?   ?   ?   A . n 
A 1 358 HIS 358 358 ?   ?   ?   A . n 
A 1 359 HIS 359 359 ?   ?   ?   A . n 
A 1 360 HIS 360 360 ?   ?   ?   A . n 
A 1 361 HIS 361 361 ?   ?   ?   A . n 
A 1 362 HIS 362 362 ?   ?   ?   A . n 
B 2 1   DG  1   1   1   DG  DG  P . n 
B 2 2   DG  2   2   2   DG  DG  P . n 
B 2 3   DC  3   3   3   DC  DC  P . n 
B 2 4   DA  4   4   4   DA  DA  P . n 
B 2 5   DC  5   5   5   DC  DC  P . n 
B 2 6   DT  6   6   6   DT  DT  P . n 
B 2 7   DG  7   7   7   DG  DG  P . n 
B 2 8   DA  8   8   8   DA  DA  P . n 
B 2 9   DT  9   9   9   DT  DT  P . n 
B 2 10  DC  10  10  10  DC  DC  P . n 
B 2 11  DG  11  11  11  DG  DG  P . n 
B 2 12  DG  12  12  12  DG  DG  P . n 
B 2 13  DG  13  13  13  DG  DG  P . n 
C 3 1   DT  1   1   ?   ?   ?   T . n 
C 3 2   DT  2   2   2   DT  DT  T . n 
C 3 3   DA  3   3   3   DA  DA  T . n 
C 3 4   DC  4   4   4   DC  DC  T . n 
C 3 5   DG  5   5   5   DG  DG  T . n 
C 3 6   DC  6   6   6   DC  DC  T . n 
C 3 7   DC  7   7   7   DC  DC  T . n 
C 3 8   DC  8   8   8   DC  DC  T . n 
C 3 9   DT  9   9   9   DT  DT  T . n 
C 3 10  DG  10  10  10  DG  DG  T . n 
C 3 11  DA  11  11  11  DA  DA  T . n 
C 3 12  DT  12  12  12  DT  DT  T . n 
C 3 13  DC  13  13  13  DC  DC  T . n 
C 3 14  DA  14  14  14  DA  DA  T . n 
C 3 15  DG  15  15  15  DG  DG  T . n 
C 3 16  DT  16  16  16  DT  DT  T . n 
C 3 17  DG  17  17  17  DG  DG  T . n 
C 3 18  DC  18  18  18  DC  DC  T . n 
C 3 19  DC  19  19  19  DC  DC  T . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5500  ? 
1 MORE         -58   ? 
1 'SSA (A^2)'  20280 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O3G   ? F DCP .   ? A DCP 403 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O     ? A PHE 8   ? A PHE 8   ? 1_555 114.1 ? 
2  O3G   ? F DCP .   ? A DCP 403 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 OD2   ? A ASP 105 ? A ASP 105 ? 1_555 162.1 ? 
3  O     ? A PHE 8   ? A PHE 8   ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 OD2   ? A ASP 105 ? A ASP 105 ? 1_555 79.2  ? 
4  O3G   ? F DCP .   ? A DCP 403 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O2A   ? F DCP .   ? A DCP 403 ? 1_555 76.4  ? 
5  O     ? A PHE 8   ? A PHE 8   ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O2A   ? F DCP .   ? A DCP 403 ? 1_555 162.1 ? 
6  OD2   ? A ASP 105 ? A ASP 105 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O2A   ? F DCP .   ? A DCP 403 ? 1_555 87.7  ? 
7  O3G   ? F DCP .   ? A DCP 403 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O2B   ? F DCP .   ? A DCP 403 ? 1_555 81.5  ? 
8  O     ? A PHE 8   ? A PHE 8   ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O2B   ? F DCP .   ? A DCP 403 ? 1_555 91.8  ? 
9  OD2   ? A ASP 105 ? A ASP 105 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O2B   ? F DCP .   ? A DCP 403 ? 1_555 86.4  ? 
10 O2A   ? F DCP .   ? A DCP 403 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O2B   ? F DCP .   ? A DCP 403 ? 1_555 74.9  ? 
11 O3G   ? F DCP .   ? A DCP 403 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 OD1   ? A ASP 7   ? A ASP 7   ? 1_555 116.4 ? 
12 O     ? A PHE 8   ? A PHE 8   ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 OD1   ? A ASP 7   ? A ASP 7   ? 1_555 99.4  ? 
13 OD2   ? A ASP 105 ? A ASP 105 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 OD1   ? A ASP 7   ? A ASP 7   ? 1_555 70.5  ? 
14 O2A   ? F DCP .   ? A DCP 403 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 OD1   ? A ASP 7   ? A ASP 7   ? 1_555 87.7  ? 
15 O2B   ? F DCP .   ? A DCP 403 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 OD1   ? A ASP 7   ? A ASP 7   ? 1_555 151.7 ? 
16 OD1   ? A ASP 105 ? A ASP 105 ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 OD1   ? A ASP 7   ? A ASP 7   ? 1_555 68.6  ? 
17 OD1   ? A ASP 105 ? A ASP 105 ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 O2A   ? F DCP .   ? A DCP 403 ? 1_555 85.8  ? 
18 OD1   ? A ASP 7   ? A ASP 7   ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 O2A   ? F DCP .   ? A DCP 403 ? 1_555 84.1  ? 
19 OD1   ? A ASP 105 ? A ASP 105 ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 "O3'" ? B DG  13  ? P DG  13  ? 1_555 81.9  ? 
20 OD1   ? A ASP 7   ? A ASP 7   ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 "O3'" ? B DG  13  ? P DG  13  ? 1_555 149.4 ? 
21 O2A   ? F DCP .   ? A DCP 403 ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 "O3'" ? B DG  13  ? P DG  13  ? 1_555 85.9  ? 
22 OD1   ? A ASP 105 ? A ASP 105 ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 OD2   ? A ASP 7   ? A ASP 7   ? 1_555 116.6 ? 
23 OD1   ? A ASP 7   ? A ASP 7   ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 OD2   ? A ASP 7   ? A ASP 7   ? 1_555 49.2  ? 
24 O2A   ? F DCP .   ? A DCP 403 ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 OD2   ? A ASP 7   ? A ASP 7   ? 1_555 97.8  ? 
25 "O3'" ? B DG  13  ? P DG  13  ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 OD2   ? A ASP 7   ? A ASP 7   ? 1_555 161.3 ? 
26 OD1   ? A ASP 105 ? A ASP 105 ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 OE1   ? A GLU 106 ? A GLU 106 ? 1_555 104.2 ? 
27 OD1   ? A ASP 7   ? A ASP 7   ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 OE1   ? A GLU 106 ? A GLU 106 ? 1_555 94.3  ? 
28 O2A   ? F DCP .   ? A DCP 403 ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 OE1   ? A GLU 106 ? A GLU 106 ? 1_555 168.6 ? 
29 "O3'" ? B DG  13  ? P DG  13  ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 OE1   ? A GLU 106 ? A GLU 106 ? 1_555 100.8 ? 
30 OD2   ? A ASP 7   ? A ASP 7   ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 OE1   ? A GLU 106 ? A GLU 106 ? 1_555 73.0  ? 
31 OD1   ? A ASP 105 ? A ASP 105 ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 O     ? G HOH .   ? A HOH 508 ? 1_555 169.0 ? 
32 OD1   ? A ASP 7   ? A ASP 7   ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 O     ? G HOH .   ? A HOH 508 ? 1_555 117.6 ? 
33 O2A   ? F DCP .   ? A DCP 403 ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 O     ? G HOH .   ? A HOH 508 ? 1_555 85.9  ? 
34 "O3'" ? B DG  13  ? P DG  13  ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 O     ? G HOH .   ? A HOH 508 ? 1_555 90.3  ? 
35 OD2   ? A ASP 7   ? A ASP 7   ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 O     ? G HOH .   ? A HOH 508 ? 1_555 71.8  ? 
36 OE1   ? A GLU 106 ? A GLU 106 ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 O     ? G HOH .   ? A HOH 508 ? 1_555 84.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-01-22 
2 'Structure model' 1 1 2014-02-19 
3 'Structure model' 1 2 2014-05-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 19.3314 243.2321 22.4576 0.8335 0.4777 0.5082 -0.1005 0.0351  -0.0281 0.1791 3.8020 2.8345 -0.7864 
0.2024  2.9998  0.1564  0.1932  0.4795  -0.0317 -0.0337 -0.4026 -0.5980 -0.1843 -0.1485 
'X-RAY DIFFRACTION' 2 ? refined 31.4672 222.0900 7.0630  0.3180 0.4488 0.2640 0.0232  0.0038  0.0186  2.9486 2.3234 4.7840 -0.5479 
0.7044  0.6785  0.0076  -0.0326 -0.0767 0.1443  0.0748  -0.3286 0.1663  0.8812  -0.0559 
'X-RAY DIFFRACTION' 3 ? refined 38.5914 245.1380 13.5892 1.1782 0.8311 0.9981 -0.2815 -0.0298 0.1983  2.2278 3.3490 2.9973 0.6250  
-0.8297 -0.0587 -0.1347 0.4886  1.2779  -0.4740 0.3901  -0.4495 -1.3781 0.5549  -0.2470 
'X-RAY DIFFRACTION' 4 ? refined 6.1804  233.7951 22.4076 0.3912 0.3432 0.2819 -0.0130 0.0518  -0.0060 4.6118 2.8383 5.9959 -0.1142 
0.3770  0.7327  0.0151  0.2925  0.3615  0.0631  -0.1163 0.0607  -0.2775 -0.0788 0.0783  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 
;(chain 'P') or (chain 'T') or (chain 'A' and (resseq 403:403))
;
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 
;chain 'A' and ((resseq 1:170))
;
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? 
;chain 'A' and ((resseq 171:245))
;
'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? 
;chain 'A' and ((resseq 246:344))
;
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CBASS    'data collection' .                             ? 1 
PHASER   phasing           .                             ? 2 
PHENIX   refinement        '(phenix.refine: 1.8.3_1479)' ? 3 
HKL-2000 'data reduction'  .                             ? 4 
HKL-2000 'data scaling'    .                             ? 5 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            "O3'" 
_pdbx_validate_rmsd_bond.auth_asym_id_1            T 
_pdbx_validate_rmsd_bond.auth_comp_id_1            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_1             10 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            "C3'" 
_pdbx_validate_rmsd_bond.auth_asym_id_2            T 
_pdbx_validate_rmsd_bond.auth_comp_id_2            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_2             10 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.382 
_pdbx_validate_rmsd_bond.bond_target_value         1.419 
_pdbx_validate_rmsd_bond.bond_deviation            -0.037 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.006 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" T DA 3 ? ? "C1'" T DA 3 ? ? N9    T DA 3 ? ? 110.16 108.30 1.86  0.30 N 
2 1 "C1'" T DC 7 ? ? "O4'" T DC 7 ? ? "C4'" T DC 7 ? ? 103.87 110.10 -6.23 1.00 N 
3 1 "O4'" T DC 7 ? ? "C1'" T DC 7 ? ? N1    T DC 7 ? ? 111.45 108.30 3.15  0.30 N 
4 1 "O4'" T DT 9 ? ? "C4'" T DT 9 ? ? "C3'" T DT 9 ? ? 101.96 104.50 -2.54 0.40 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 10  ? ? 18.65   58.48   
2 1 ALA A 68  ? ? -140.41 59.80   
3 1 SER A 103 ? ? -173.59 -173.71 
4 1 GLN A 201 ? ? -140.86 -7.48   
5 1 THR A 218 ? ? -157.58 -10.49  
6 1 SER A 235 ? ? -161.46 76.44   
7 1 LYS A 327 ? ? 81.82   -22.97  
8 1 ARG A 328 ? ? -131.07 -30.40  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A LYS 345 ? A LYS 345 
2  1 Y 1 A THR 346 ? A THR 346 
3  1 Y 1 A ASN 347 ? A ASN 347 
4  1 Y 1 A LEU 348 ? A LEU 348 
5  1 Y 1 A SER 349 ? A SER 349 
6  1 Y 1 A ASP 350 ? A ASP 350 
7  1 Y 1 A PHE 351 ? A PHE 351 
8  1 Y 1 A PHE 352 ? A PHE 352 
9  1 Y 1 A ASP 353 ? A ASP 353 
10 1 Y 1 A ILE 354 ? A ILE 354 
11 1 Y 1 A GLY 355 ? A GLY 355 
12 1 Y 1 A GLY 356 ? A GLY 356 
13 1 Y 1 A HIS 357 ? A HIS 357 
14 1 Y 1 A HIS 358 ? A HIS 358 
15 1 Y 1 A HIS 359 ? A HIS 359 
16 1 Y 1 A HIS 360 ? A HIS 360 
17 1 Y 1 A HIS 361 ? A HIS 361 
18 1 Y 1 A HIS 362 ? A HIS 362 
19 1 Y 1 T DT  1   ? C DT  1   
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4NLG 'double helix'        
4NLG 'b-form double helix' 
4NLG 'bulge loop'          
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 1  1_555 C DC 19 1_555 -0.755 -0.046 0.269  -6.425  -6.592  0.832  1  P_DG1:DC19_T  P 1  ? T 19 ? 19 1 
1 B DG 2  1_555 C DC 18 1_555 0.038  -0.085 0.233  12.913  -8.924  3.480  2  P_DG2:DC18_T  P 2  ? T 18 ? 19 1 
1 B DC 3  1_555 C DG 17 1_555 0.324  -0.149 -0.103 4.442   -10.020 -0.576 3  P_DC3:DG17_T  P 3  ? T 17 ? 19 1 
1 B DA 4  1_555 C DT 16 1_555 -0.020 -0.313 -0.229 -1.260  -8.106  0.445  4  P_DA4:DT16_T  P 4  ? T 16 ? 20 1 
1 B DC 5  1_555 C DG 15 1_555 0.269  -0.229 -0.089 6.365   -9.085  5.545  5  P_DC5:DG15_T  P 5  ? T 15 ? 19 1 
1 B DT 6  1_555 C DA 14 1_555 0.178  -0.083 -0.144 4.004   -12.489 2.951  6  P_DT6:DA14_T  P 6  ? T 14 ? 20 1 
1 B DG 7  1_555 C DC 13 1_555 -0.463 -0.084 -0.235 -10.512 -10.716 3.514  7  P_DG7:DC13_T  P 7  ? T 13 ? 19 1 
1 B DA 8  1_555 C DT 12 1_555 0.192  -0.068 -0.088 -8.307  0.177   1.308  8  P_DA8:DT12_T  P 8  ? T 12 ? 20 1 
1 B DT 9  1_555 C DA 11 1_555 0.170  -0.152 0.089  2.120   -5.980  -3.775 9  P_DT9:DA11_T  P 9  ? T 11 ? 20 1 
1 B DC 10 1_555 C DG 10 1_555 0.690  -0.155 -0.436 14.229  3.498   4.463  10 P_DC10:DG10_T P 10 ? T 10 ? 19 1 
1 B DG 11 1_555 C DC 8  1_555 0.041  -0.358 0.128  4.301   -6.475  -3.010 11 P_DG11:DC8_T  P 11 ? T 8  ? 19 1 
1 B DG 12 1_555 C DC 7  1_555 -0.453 -0.161 0.376  0.279   -9.986  5.353  12 P_DG12:DC7_T  P 12 ? T 7  ? 19 1 
1 B DG 13 1_555 C DC 6  1_555 -0.160 -0.104 -0.082 -4.676  -7.794  -0.861 13 P_DG13:DC6_T  P 13 ? T 6  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 1  1_555 C DC 19 1_555 B DG 2  1_555 C DC 18 1_555 0.428  0.295  3.017 -0.768  5.820  33.705 -0.352 -0.840 3.015 9.944  
1.312   34.197 1  PP_DG1DG2:DC18DC19_TT  P 1  ? T 19 ? P 2  ? T 18 ? 
1 B DG 2  1_555 C DC 18 1_555 B DC 3  1_555 C DG 17 1_555 -0.837 -0.275 3.474 -0.340  0.422  36.878 -0.496 1.274  3.478 0.668  
0.537   36.882 2  PP_DG2DC3:DG17DC18_TT  P 2  ? T 18 ? P 3  ? T 17 ? 
1 B DC 3  1_555 C DG 17 1_555 B DA 4  1_555 C DT 16 1_555 0.180  -0.172 3.454 1.976   11.466 31.640 -2.263 0.028  3.205 20.195 
-3.480  33.660 3  PP_DC3DA4:DT16DG17_TT  P 3  ? T 17 ? P 4  ? T 16 ? 
1 B DA 4  1_555 C DT 16 1_555 B DC 5  1_555 C DG 15 1_555 0.642  -0.538 3.004 -1.813  4.950  31.173 -1.813 -1.481 2.846 9.129  
3.344   31.605 4  PP_DA4DC5:DG15DT16_TT  P 4  ? T 16 ? P 5  ? T 15 ? 
1 B DC 5  1_555 C DG 15 1_555 B DT 6  1_555 C DA 14 1_555 -0.247 -0.691 3.369 2.934   7.509  32.322 -2.464 0.922  3.101 13.234 
-5.171  33.286 5  PP_DC5DT6:DA14DG15_TT  P 5  ? T 15 ? P 6  ? T 14 ? 
1 B DT 6  1_555 C DA 14 1_555 B DG 7  1_555 C DC 13 1_555 0.149  -0.577 3.545 1.648   10.927 29.851 -3.169 0.047  3.148 20.356 
-3.070  31.787 6  PP_DT6DG7:DC13DA14_TT  P 6  ? T 14 ? P 7  ? T 13 ? 
1 B DG 7  1_555 C DC 13 1_555 B DA 8  1_555 C DT 12 1_555 -0.849 0.146  3.181 -2.902  6.667  37.495 -0.607 0.937  3.214 10.254 
4.463   38.169 7  PP_DG7DA8:DT12DC13_TT  P 7  ? T 13 ? P 8  ? T 12 ? 
1 B DA 8  1_555 C DT 12 1_555 B DT 9  1_555 C DA 11 1_555 -0.510 -0.532 3.163 -1.665  -2.013 28.224 -0.633 0.667  3.217 -4.116 
3.405   28.343 8  PP_DA8DT9:DA11DT12_TT  P 8  ? T 12 ? P 9  ? T 11 ? 
1 B DT 9  1_555 C DA 11 1_555 B DC 10 1_555 C DG 10 1_555 1.078  0.192  3.113 6.104   0.460  35.106 0.248  -0.893 3.251 0.756  
-10.025 35.619 9  PP_DT9DC10:DG10DA11_TT P 9  ? T 11 ? P 10 ? T 10 ? 
1 B DC 10 1_555 C DG 10 1_555 B DG 11 1_555 C DC 8  1_555 1.699  -0.096 6.533 -18.567 11.696 48.448 -1.560 -4.212 5.437 13.480 
21.400  52.912 10 PP_DC10DG11:DC8DG10_TT P 10 ? T 10 ? P 11 ? T 8  ? 
1 B DG 11 1_555 C DC 8  1_555 B DG 12 1_555 C DC 7  1_555 0.168  -0.560 3.304 -1.605  5.352  35.692 -1.658 -0.498 3.179 8.666  
2.598   36.113 11 PP_DG11DG12:DC7DC8_TT  P 11 ? T 8  ? P 12 ? T 7  ? 
1 B DG 12 1_555 C DC 7  1_555 B DG 13 1_555 C DC 6  1_555 -0.914 -0.531 3.502 1.033   4.037  30.428 -1.839 1.939  3.373 7.647  
-1.956  30.705 12 PP_DG12DG13:DC6DC7_TT  P 12 ? T 7  ? P 13 ? T 6  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'CALCIUM ION'                      CA  
5 "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE" DCP 
6 water                              HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 CA  1  401 1  CA  CA  A . 
E 4 CA  1  402 2  CA  CA  A . 
F 5 DCP 1  403 1  DCP DCP A . 
G 6 HOH 1  501 1  HOH HOH A . 
G 6 HOH 2  502 2  HOH HOH A . 
G 6 HOH 3  503 3  HOH HOH A . 
G 6 HOH 4  504 4  HOH HOH A . 
G 6 HOH 5  505 5  HOH HOH A . 
G 6 HOH 6  506 6  HOH HOH A . 
G 6 HOH 7  507 7  HOH HOH A . 
G 6 HOH 8  508 9  HOH HOH A . 
G 6 HOH 9  509 11 HOH HOH A . 
G 6 HOH 10 510 12 HOH HOH A . 
G 6 HOH 11 511 13 HOH HOH A . 
G 6 HOH 12 512 14 HOH HOH A . 
G 6 HOH 13 513 15 HOH HOH A . 
G 6 HOH 14 514 16 HOH HOH A . 
G 6 HOH 15 515 17 HOH HOH A . 
G 6 HOH 16 516 18 HOH HOH A . 
G 6 HOH 17 517 19 HOH HOH A . 
G 6 HOH 18 518 20 HOH HOH A . 
G 6 HOH 19 519 21 HOH HOH A . 
G 6 HOH 20 520 22 HOH HOH A . 
G 6 HOH 21 521 24 HOH HOH A . 
G 6 HOH 22 522 26 HOH HOH A . 
G 6 HOH 23 523 27 HOH HOH A . 
G 6 HOH 24 524 28 HOH HOH A . 
G 6 HOH 25 525 29 HOH HOH A . 
G 6 HOH 26 526 30 HOH HOH A . 
G 6 HOH 27 527 31 HOH HOH A . 
G 6 HOH 28 528 32 HOH HOH A . 
G 6 HOH 29 529 33 HOH HOH A . 
G 6 HOH 30 530 34 HOH HOH A . 
G 6 HOH 31 531 35 HOH HOH A . 
G 6 HOH 32 532 36 HOH HOH A . 
G 6 HOH 33 533 39 HOH HOH A . 
G 6 HOH 34 534 40 HOH HOH A . 
G 6 HOH 35 535 41 HOH HOH A . 
H 6 HOH 1  101 25 HOH HOH P . 
H 6 HOH 2  102 37 HOH HOH P . 
I 6 HOH 1  101 8  HOH HOH T . 
I 6 HOH 2  102 10 HOH HOH T . 
I 6 HOH 3  103 23 HOH HOH T . 
I 6 HOH 4  104 38 HOH HOH T . 
#