data_4NPJ
# 
_entry.id   4NPJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4NPJ         
RCSB  RCSB083494   
WWPDB D_1000083494 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4NPK 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        4NPJ 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-11-21 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tomchick, D.R.' 1 
'Rizo, J.'       2 
'Xu, J.'         3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structure and ca(2+)-binding properties of the tandem c2 domains of e-syt2.'   Structure              22  269  280  2014 
STRUE6 UK 0969-2126 2005 ? 24373768 10.1016/j.str.2013.11.011 
1       'E-Syts, a family of membranous Ca2+-sensor proteins with multiple C2 domains.' Proc.Natl.Acad.Sci.USA 104 3823 3828 2007 
PNASA6 US 0027-8424 0040 ? 17360437 10.1073/pnas.0611725104   
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Xu, J.'         1 
primary 'Bacaj, T.'      2 
primary 'Zhou, A.'       3 
primary 'Tomchick, D.R.' 4 
primary 'Sudhof, T.C.'   5 
primary 'Rizo, J.'       6 
1       'Min, S.W.'      7 
1       'Chang, W.P.'    8 
1       'Sudhof, T.C.'   9 
# 
_cell.length_a           62.300 
_cell.length_b           62.300 
_cell.length_c           226.395 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           4NPJ 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 43' 
_symmetry.entry_id                         4NPJ 
_symmetry.Int_Tables_number                78 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Extended synaptotagmin-2' 34237.070 2   ? ? 'C2 and C2B domains (unp residues 363-660)' ? 
2 non-polymer syn 'CHLORIDE ION'             35.453    3   ? ? ?                                           ? 
3 non-polymer syn 'SODIUM ION'               22.990    1   ? ? ?                                           ? 
4 non-polymer syn 'ACETATE ION'              59.044    2   ? ? ?                                           ? 
5 water       nat water                      18.015    148 ? ? ?                                           ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'E-Syt2, Chr2Syt' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GNRITVPLVSEVQIAQLRFPVPKGVLRIHFIEAQDLQGKDTYLKGLVKGKSDPYGIIRVGNQIFQSRVIKENLSPKWNEV
YEALVYEHPGQELEIELFDEDPDKDDFLGSLMIDLIEVEKERLLDEWFTLDEVPKGKLHLRLEWLTLMPNASNLDKVLTD
IKADKDQANDGLSSALLILYLDSARNLPSGKKISSNPNPVVQMSVGHKAQESKIRYKTNEPVWEENFTFFIHNPKRQDLE
VEVRDEQHQCSLGNLKVPLSQLLTSEDMTVSQRFQLSNSGPNSTIKMKIALRVLHLEKR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GNRITVPLVSEVQIAQLRFPVPKGVLRIHFIEAQDLQGKDTYLKGLVKGKSDPYGIIRVGNQIFQSRVIKENLSPKWNEV
YEALVYEHPGQELEIELFDEDPDKDDFLGSLMIDLIEVEKERLLDEWFTLDEVPKGKLHLRLEWLTLMPNASNLDKVLTD
IKADKDQANDGLSSALLILYLDSARNLPSGKKISSNPNPVVQMSVGHKAQESKIRYKTNEPVWEENFTFFIHNPKRQDLE
VEVRDEQHQCSLGNLKVPLSQLLTSEDMTVSQRFQLSNSGPNSTIKMKIALRVLHLEKR
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ASN n 
1 3   ARG n 
1 4   ILE n 
1 5   THR n 
1 6   VAL n 
1 7   PRO n 
1 8   LEU n 
1 9   VAL n 
1 10  SER n 
1 11  GLU n 
1 12  VAL n 
1 13  GLN n 
1 14  ILE n 
1 15  ALA n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  PHE n 
1 20  PRO n 
1 21  VAL n 
1 22  PRO n 
1 23  LYS n 
1 24  GLY n 
1 25  VAL n 
1 26  LEU n 
1 27  ARG n 
1 28  ILE n 
1 29  HIS n 
1 30  PHE n 
1 31  ILE n 
1 32  GLU n 
1 33  ALA n 
1 34  GLN n 
1 35  ASP n 
1 36  LEU n 
1 37  GLN n 
1 38  GLY n 
1 39  LYS n 
1 40  ASP n 
1 41  THR n 
1 42  TYR n 
1 43  LEU n 
1 44  LYS n 
1 45  GLY n 
1 46  LEU n 
1 47  VAL n 
1 48  LYS n 
1 49  GLY n 
1 50  LYS n 
1 51  SER n 
1 52  ASP n 
1 53  PRO n 
1 54  TYR n 
1 55  GLY n 
1 56  ILE n 
1 57  ILE n 
1 58  ARG n 
1 59  VAL n 
1 60  GLY n 
1 61  ASN n 
1 62  GLN n 
1 63  ILE n 
1 64  PHE n 
1 65  GLN n 
1 66  SER n 
1 67  ARG n 
1 68  VAL n 
1 69  ILE n 
1 70  LYS n 
1 71  GLU n 
1 72  ASN n 
1 73  LEU n 
1 74  SER n 
1 75  PRO n 
1 76  LYS n 
1 77  TRP n 
1 78  ASN n 
1 79  GLU n 
1 80  VAL n 
1 81  TYR n 
1 82  GLU n 
1 83  ALA n 
1 84  LEU n 
1 85  VAL n 
1 86  TYR n 
1 87  GLU n 
1 88  HIS n 
1 89  PRO n 
1 90  GLY n 
1 91  GLN n 
1 92  GLU n 
1 93  LEU n 
1 94  GLU n 
1 95  ILE n 
1 96  GLU n 
1 97  LEU n 
1 98  PHE n 
1 99  ASP n 
1 100 GLU n 
1 101 ASP n 
1 102 PRO n 
1 103 ASP n 
1 104 LYS n 
1 105 ASP n 
1 106 ASP n 
1 107 PHE n 
1 108 LEU n 
1 109 GLY n 
1 110 SER n 
1 111 LEU n 
1 112 MET n 
1 113 ILE n 
1 114 ASP n 
1 115 LEU n 
1 116 ILE n 
1 117 GLU n 
1 118 VAL n 
1 119 GLU n 
1 120 LYS n 
1 121 GLU n 
1 122 ARG n 
1 123 LEU n 
1 124 LEU n 
1 125 ASP n 
1 126 GLU n 
1 127 TRP n 
1 128 PHE n 
1 129 THR n 
1 130 LEU n 
1 131 ASP n 
1 132 GLU n 
1 133 VAL n 
1 134 PRO n 
1 135 LYS n 
1 136 GLY n 
1 137 LYS n 
1 138 LEU n 
1 139 HIS n 
1 140 LEU n 
1 141 ARG n 
1 142 LEU n 
1 143 GLU n 
1 144 TRP n 
1 145 LEU n 
1 146 THR n 
1 147 LEU n 
1 148 MET n 
1 149 PRO n 
1 150 ASN n 
1 151 ALA n 
1 152 SER n 
1 153 ASN n 
1 154 LEU n 
1 155 ASP n 
1 156 LYS n 
1 157 VAL n 
1 158 LEU n 
1 159 THR n 
1 160 ASP n 
1 161 ILE n 
1 162 LYS n 
1 163 ALA n 
1 164 ASP n 
1 165 LYS n 
1 166 ASP n 
1 167 GLN n 
1 168 ALA n 
1 169 ASN n 
1 170 ASP n 
1 171 GLY n 
1 172 LEU n 
1 173 SER n 
1 174 SER n 
1 175 ALA n 
1 176 LEU n 
1 177 LEU n 
1 178 ILE n 
1 179 LEU n 
1 180 TYR n 
1 181 LEU n 
1 182 ASP n 
1 183 SER n 
1 184 ALA n 
1 185 ARG n 
1 186 ASN n 
1 187 LEU n 
1 188 PRO n 
1 189 SER n 
1 190 GLY n 
1 191 LYS n 
1 192 LYS n 
1 193 ILE n 
1 194 SER n 
1 195 SER n 
1 196 ASN n 
1 197 PRO n 
1 198 ASN n 
1 199 PRO n 
1 200 VAL n 
1 201 VAL n 
1 202 GLN n 
1 203 MET n 
1 204 SER n 
1 205 VAL n 
1 206 GLY n 
1 207 HIS n 
1 208 LYS n 
1 209 ALA n 
1 210 GLN n 
1 211 GLU n 
1 212 SER n 
1 213 LYS n 
1 214 ILE n 
1 215 ARG n 
1 216 TYR n 
1 217 LYS n 
1 218 THR n 
1 219 ASN n 
1 220 GLU n 
1 221 PRO n 
1 222 VAL n 
1 223 TRP n 
1 224 GLU n 
1 225 GLU n 
1 226 ASN n 
1 227 PHE n 
1 228 THR n 
1 229 PHE n 
1 230 PHE n 
1 231 ILE n 
1 232 HIS n 
1 233 ASN n 
1 234 PRO n 
1 235 LYS n 
1 236 ARG n 
1 237 GLN n 
1 238 ASP n 
1 239 LEU n 
1 240 GLU n 
1 241 VAL n 
1 242 GLU n 
1 243 VAL n 
1 244 ARG n 
1 245 ASP n 
1 246 GLU n 
1 247 GLN n 
1 248 HIS n 
1 249 GLN n 
1 250 CYS n 
1 251 SER n 
1 252 LEU n 
1 253 GLY n 
1 254 ASN n 
1 255 LEU n 
1 256 LYS n 
1 257 VAL n 
1 258 PRO n 
1 259 LEU n 
1 260 SER n 
1 261 GLN n 
1 262 LEU n 
1 263 LEU n 
1 264 THR n 
1 265 SER n 
1 266 GLU n 
1 267 ASP n 
1 268 MET n 
1 269 THR n 
1 270 VAL n 
1 271 SER n 
1 272 GLN n 
1 273 ARG n 
1 274 PHE n 
1 275 GLN n 
1 276 LEU n 
1 277 SER n 
1 278 ASN n 
1 279 SER n 
1 280 GLY n 
1 281 PRO n 
1 282 ASN n 
1 283 SER n 
1 284 THR n 
1 285 ILE n 
1 286 LYS n 
1 287 MET n 
1 288 LYS n 
1 289 ILE n 
1 290 ALA n 
1 291 LEU n 
1 292 ARG n 
1 293 VAL n 
1 294 LEU n 
1 295 HIS n 
1 296 LEU n 
1 297 GLU n 
1 298 LYS n 
1 299 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ESYT2, extended-synaptotagmin 2, FAM62B, KIAA1228' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ESYT2_HUMAN 
_struct_ref.pdbx_db_accession          A0FGR8 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;NRITVPLVSEVQIAQLRFPVPKGVLRIHFIEAQDLQGKDTYLKGLVKGKSDPYGIIRVGNQIFQSRVIKENLSPKWNEVY
EALVYEHPGQELEIELFDEDPDKDDFLGSLMIDLIEVEKERLLDEWFTLDEVPKGKLHLRLEWLTLMPNASNLDKVLTDI
KADKDQANDGLSSALLILYLDSARNLPSGKKISSNPNPVVQMSVGHKAQESKIRYKTNEPVWEENFTFFIHNPKRQDLEV
EVRDEQHQCSLGNLKVPLSQLLTSEDMTVSQRFQLSNSGPNSTIKMKIALRVLHLEKR
;
_struct_ref.pdbx_align_begin           363 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4NPJ A 2 ? 299 ? A0FGR8 363 ? 660 ? 363 660 
2 1 4NPJ B 2 ? 299 ? A0FGR8 363 ? 660 ? 363 660 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4NPJ GLY A 1 ? UNP A0FGR8 ? ? 'EXPRESSION TAG' 362 1 
2 4NPJ GLY B 1 ? UNP A0FGR8 ? ? 'EXPRESSION TAG' 362 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'   ? 'C2 H3 O2 -1'    59.044  
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'    ? 'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4NPJ 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.21 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   61.66 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              4.9 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pdbx_details    
;2.25 M LiCl, 0.1 M sodium acetate, 0.125 M NaCl, 2.5% glycerol, 25% ethylene glycol, pH 4.9, VAPOR DIFFUSION, HANGING DROP, temperature 293K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 100 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'ADSC QUANTUM 315r' 2012-08-08 monochromator 
2 CCD 'ADSC QUANTUM 315r' 2012-10-18 monochromator 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.monochromator 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.pdbx_scattering_type 
1 'SINGLE WAVELENGTH' 'SAGITALLY FOCUSED Si(111)' 1 ? x-ray 
2 SAD                 'SAGITALLY FOCUSED Si(111)' 1 ? x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.38592 1.0 
2 0.97912 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_wavelength_list 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
1 SYNCHROTRON 'APS BEAMLINE 19-ID' 1.38592 ? APS 19-ID 
2 SYNCHROTRON 'APS BEAMLINE 19-ID' 0.97912 ? APS 19-ID 
# 
_reflns.entry_id                     4NPJ 
_reflns.d_resolution_high            2.100 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   48539 
_reflns.pdbx_Rmerge_I_obs            0.067 
_reflns.pdbx_netI_over_sigmaI        13.100 
_reflns.pdbx_chi_squared             1.066 
_reflns.pdbx_redundancy              5.500 
_reflns.percent_possible_obs         97.000 
_reflns.B_iso_Wilson_estimate        41.960 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.number_all                   48539 
_reflns.pdbx_Rsym_value              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1,2 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.100 2.140  ? ? ? 0.501 1.46 ? 0.970 3.200 ? 1830 73.800  1  1,2 
2.140 2.180  ? ? ? 0.502 ?    ? 0.980 3.500 ? 2096 83.300  2  1,2 
2.180 2.220  ? ? ? 0.548 ?    ? 0.970 3.800 ? 2242 89.400  3  1,2 
2.220 2.260  ? ? ? 0.501 ?    ? 1.014 4.000 ? 2363 95.800  4  1,2 
2.260 2.310  ? ? ? 0.434 ?    ? 0.972 4.500 ? 2494 98.600  5  1,2 
2.310 2.370  ? ? ? 0.404 ?    ? 0.936 4.900 ? 2472 100.000 6  1,2 
2.370 2.420  ? ? ? 0.373 ?    ? 0.937 5.200 ? 2484 100.000 7  1,2 
2.420 2.490  ? ? ? 0.333 ?    ? 0.954 5.600 ? 2521 100.000 8  1,2 
2.490 2.560  ? ? ? 0.309 ?    ? 1.001 5.900 ? 2473 99.900  9  1,2 
2.560 2.650  ? ? ? 0.282 ?    ? 0.999 6.100 ? 2482 100.000 10 1,2 
2.650 2.740  ? ? ? 0.205 ?    ? 0.971 6.100 ? 2532 100.000 11 1,2 
2.740 2.850  ? ? ? 0.148 ?    ? 0.983 6.100 ? 2510 99.800  12 1,2 
2.850 2.980  ? ? ? 0.108 ?    ? 1.065 6.100 ? 2480 99.900  13 1,2 
2.980 3.140  ? ? ? 0.084 ?    ? 1.187 6.200 ? 2500 100.000 14 1,2 
3.140 3.330  ? ? ? 0.068 ?    ? 1.096 6.100 ? 2496 99.900  15 1,2 
3.330 3.590  ? ? ? 0.063 ?    ? 1.173 6.100 ? 2496 99.800  16 1,2 
3.590 3.950  ? ? ? 0.059 ?    ? 1.257 6.100 ? 2508 99.800  17 1,2 
3.950 4.520  ? ? ? 0.045 ?    ? 1.260 6.100 ? 2499 99.800  18 1,2 
4.520 5.700  ? ? ? 0.041 ?    ? 1.116 6.300 ? 2523 100.000 19 1,2 
5.700 50.000 ? ? ? 0.041 ?    ? 1.181 6.400 ? 2538 99.300  20 1,2 
# 
_refine.entry_id                                 4NPJ 
_refine.ls_d_res_high                            2.1010 
_refine.ls_d_res_low                             41.8920 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    96.8800 
_refine.ls_number_reflns_obs                     48422 
_refine.ls_number_reflns_all                     48422 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2019 
_refine.ls_R_factor_R_work                       0.1999 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2388 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.1000 
_refine.ls_number_reflns_R_free                  2468 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               78.5058 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             OVERALL 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.3100 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                183.480 
_refine.B_iso_min                                28.140 
_refine.pdbx_overall_phase_error                 30.9400 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1,2 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        4NPJ 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            0.31 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4637 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             148 
_refine_hist.number_atoms_total               4797 
_refine_hist.d_res_high                       2.1010 
_refine_hist.d_res_low                        41.8920 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           4735 0.005  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          6400 0.904  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     721  0.034  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      835  0.004  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 1820 14.858 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
2.1005 2.1409  18 74.0000  1979 . 0.2946 0.3929 . 108 . 2087 1979 . 'X-RAY DIFFRACTION' 
2.1409 2.1846  18 84.0000  2169 . 0.2910 0.3271 . 105 . 2274 2169 . 'X-RAY DIFFRACTION' 
2.1846 2.2321  18 92.0000  2422 . 0.2937 0.3324 . 143 . 2565 2422 . 'X-RAY DIFFRACTION' 
2.2321 2.2840  18 97.0000  2527 . 0.2824 0.3389 . 148 . 2675 2527 . 'X-RAY DIFFRACTION' 
2.2840 2.3412  18 99.0000  2616 . 0.2719 0.2936 . 127 . 2743 2616 . 'X-RAY DIFFRACTION' 
2.3412 2.4045  18 100.0000 2636 . 0.2610 0.3258 . 162 . 2798 2636 . 'X-RAY DIFFRACTION' 
2.4045 2.4752  18 100.0000 2626 . 0.2528 0.3130 . 132 . 2758 2626 . 'X-RAY DIFFRACTION' 
2.4752 2.5551  18 100.0000 2618 . 0.2562 0.3152 . 133 . 2751 2618 . 'X-RAY DIFFRACTION' 
2.5551 2.6464  18 100.0000 2625 . 0.2552 0.3088 . 134 . 2759 2625 . 'X-RAY DIFFRACTION' 
2.6464 2.7523  18 100.0000 2674 . 0.2451 0.2542 . 131 . 2805 2674 . 'X-RAY DIFFRACTION' 
2.7523 2.8776  18 100.0000 2596 . 0.2451 0.2920 . 143 . 2739 2596 . 'X-RAY DIFFRACTION' 
2.8776 3.0292  18 100.0000 2666 . 0.2315 0.2763 . 136 . 2802 2666 . 'X-RAY DIFFRACTION' 
3.0292 3.2190  18 100.0000 2621 . 0.2293 0.2312 . 130 . 2751 2621 . 'X-RAY DIFFRACTION' 
3.2190 3.4674  18 100.0000 2654 . 0.2149 0.2704 . 144 . 2798 2654 . 'X-RAY DIFFRACTION' 
3.4674 3.8161  18 100.0000 2600 . 0.1858 0.2284 . 150 . 2750 2600 . 'X-RAY DIFFRACTION' 
3.8161 4.3678  18 100.0000 2645 . 0.1582 0.1921 . 149 . 2794 2645 . 'X-RAY DIFFRACTION' 
4.3678 5.5010  18 100.0000 2618 . 0.1430 0.1770 . 169 . 2787 2618 . 'X-RAY DIFFRACTION' 
5.5010 41.9006 18 99.0000  2662 . 0.1726 0.2176 . 124 . 2786 2662 . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4NPJ 
_struct.title                     'Extended-Synaptotagmin 2, C2A- and C2B-domains' 
_struct.pdbx_descriptor           'Extended synaptotagmin-2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4NPJ 
_struct_keywords.text            
;CALCIUM/PHOSPHOLIPID BINDING PROTEIN, C2 domain, membrane traffic, protein targeting, Plasma membrane, membrane protein, ER to plasma membrane
;
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 2 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LEU A 115 ? ARG A 122 ? LEU A 476 ARG A 483 1 ? 8  
HELX_P HELX_P2 2 ASN A 153 ? ASP A 164 ? ASN A 514 ASP A 525 1 ? 12 
HELX_P HELX_P3 3 LEU A 259 ? THR A 264 ? LEU A 620 THR A 625 1 ? 6  
HELX_P HELX_P4 4 SER A 265 ? ASP A 267 ? SER A 626 ASP A 628 5 ? 3  
HELX_P HELX_P5 5 LEU B 115 ? ARG B 122 ? LEU B 476 ARG B 483 1 ? 8  
HELX_P HELX_P6 6 ASN B 153 ? ALA B 163 ? ASN B 514 ALA B 524 1 ? 11 
HELX_P HELX_P7 7 SER B 260 ? ASP B 267 ? SER B 621 ASP B 628 5 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A GLU 220 OE2 ? ? ? 1_555 E NA  . NA ? ? A GLU 581 B NA  701 1_555 ? ? ? ? ? ? ? 2.392 ? 
metalc2 metalc ? ? B ASP 103 O   ? ? ? 1_555 E NA  . NA ? ? B ASP 464 B NA  701 1_555 ? ? ? ? ? ? ? 2.413 ? 
metalc3 metalc ? ? B ASP 105 OD1 ? ? ? 1_555 E NA  . NA ? ? B ASP 466 B NA  701 1_555 ? ? ? ? ? ? ? 2.507 ? 
metalc4 metalc ? ? B ASP 101 O   ? ? ? 1_555 E NA  . NA ? ? B ASP 462 B NA  701 1_555 ? ? ? ? ? ? ? 2.993 ? 
metalc5 metalc ? ? E NA  .   NA  ? ? ? 1_555 I HOH . O  ? ? B NA  701 A HOH 968 1_555 ? ? ? ? ? ? ? 2.470 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 6 ? 
F ? 4 ? 
G ? 4 ? 
H ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 76  ? VAL A 85  ? LYS A 437 VAL A 446 
A 2 GLY A 24  ? GLN A 34  ? GLY A 385 GLN A 395 
A 3 LYS A 137 ? MET A 148 ? LYS A 498 MET A 509 
A 4 THR A 284 ? HIS A 295 ? THR A 645 HIS A 656 
A 5 ALA A 175 ? ARG A 185 ? ALA A 536 ARG A 546 
A 6 VAL A 222 ? ILE A 231 ? VAL A 583 ILE A 592 
B 1 LEU A 123 ? THR A 129 ? LEU A 484 THR A 490 
B 2 LYS A 137 ? MET A 148 ? LYS A 498 MET A 509 
B 3 THR A 284 ? HIS A 295 ? THR A 645 HIS A 656 
B 4 THR A 269 ? GLN A 275 ? THR A 630 GLN A 636 
C 1 GLN A 62  ? GLN A 65  ? GLN A 423 GLN A 426 
C 2 PRO A 53  ? VAL A 59  ? PRO A 414 VAL A 420 
C 3 GLU A 92  ? ASP A 99  ? GLU A 453 ASP A 460 
C 4 ASP A 106 ? ASP A 114 ? ASP A 467 ASP A 475 
D 1 LYS A 208 ? GLU A 211 ? LYS A 569 GLU A 572 
D 2 PRO A 199 ? VAL A 205 ? PRO A 560 VAL A 566 
D 3 ASP A 238 ? ASP A 245 ? ASP A 599 ASP A 606 
D 4 SER A 251 ? PRO A 258 ? SER A 612 PRO A 619 
E 1 LYS B 76  ? VAL B 85  ? LYS B 437 VAL B 446 
E 2 GLY B 24  ? GLN B 34  ? GLY B 385 GLN B 395 
E 3 LYS B 137 ? MET B 148 ? LYS B 498 MET B 509 
E 4 THR B 284 ? LEU B 296 ? THR B 645 LEU B 657 
E 5 ALA B 175 ? ARG B 185 ? ALA B 536 ARG B 546 
E 6 VAL B 222 ? ILE B 231 ? VAL B 583 ILE B 592 
F 1 LEU B 123 ? THR B 129 ? LEU B 484 THR B 490 
F 2 LYS B 137 ? MET B 148 ? LYS B 498 MET B 509 
F 3 THR B 284 ? LEU B 296 ? THR B 645 LEU B 657 
F 4 THR B 269 ? GLN B 275 ? THR B 630 GLN B 636 
G 1 GLN B 62  ? GLN B 65  ? GLN B 423 GLN B 426 
G 2 PRO B 53  ? VAL B 59  ? PRO B 414 VAL B 420 
G 3 GLU B 92  ? ASP B 99  ? GLU B 453 ASP B 460 
G 4 ASP B 106 ? ASP B 114 ? ASP B 467 ASP B 475 
H 1 ALA B 209 ? GLU B 211 ? ALA B 570 GLU B 572 
H 2 PRO B 199 ? SER B 204 ? PRO B 560 SER B 565 
H 3 ASP B 238 ? ASP B 245 ? ASP B 599 ASP B 606 
H 4 CYS B 250 ? PRO B 258 ? CYS B 611 PRO B 619 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR A 81  ? O TYR A 442 N ILE A 28  ? N ILE A 389 
A 2 3 N GLU A 32  ? N GLU A 393 O HIS A 139 ? O HIS A 500 
A 3 4 N THR A 146 ? N THR A 507 O HIS A 295 ? O HIS A 656 
A 4 5 O LYS A 286 ? O LYS A 647 N SER A 183 ? N SER A 544 
A 5 6 N LEU A 181 ? N LEU A 542 O GLU A 225 ? O GLU A 586 
B 1 2 N PHE A 128 ? N PHE A 489 O LEU A 138 ? O LEU A 499 
B 2 3 N THR A 146 ? N THR A 507 O HIS A 295 ? O HIS A 656 
B 3 4 O ILE A 285 ? O ILE A 646 N PHE A 274 ? N PHE A 635 
C 1 2 O PHE A 64  ? O PHE A 425 N ILE A 57  ? N ILE A 418 
C 2 3 N ARG A 58  ? N ARG A 419 O GLU A 94  ? O GLU A 455 
C 3 4 N LEU A 97  ? N LEU A 458 O LEU A 108 ? O LEU A 469 
D 1 2 O GLN A 210 ? O GLN A 571 N MET A 203 ? N MET A 564 
D 2 3 N SER A 204 ? N SER A 565 O GLU A 240 ? O GLU A 601 
D 3 4 N VAL A 243 ? N VAL A 604 O LEU A 252 ? O LEU A 613 
E 1 2 O TYR B 81  ? O TYR B 442 N ILE B 28  ? N ILE B 389 
E 2 3 N GLU B 32  ? N GLU B 393 O HIS B 139 ? O HIS B 500 
E 3 4 N THR B 146 ? N THR B 507 O HIS B 295 ? O HIS B 656 
E 4 5 O ALA B 290 ? O ALA B 651 N ILE B 178 ? N ILE B 539 
E 5 6 N LEU B 181 ? N LEU B 542 O GLU B 225 ? O GLU B 586 
F 1 2 N LEU B 124 ? N LEU B 485 O LEU B 142 ? O LEU B 503 
F 2 3 N THR B 146 ? N THR B 507 O HIS B 295 ? O HIS B 656 
F 3 4 O ILE B 289 ? O ILE B 650 N VAL B 270 ? N VAL B 631 
G 1 2 O PHE B 64  ? O PHE B 425 N ILE B 57  ? N ILE B 418 
G 2 3 N ARG B 58  ? N ARG B 419 O GLU B 94  ? O GLU B 455 
G 3 4 N LEU B 97  ? N LEU B 458 O LEU B 108 ? O LEU B 469 
H 1 2 O GLN B 210 ? O GLN B 571 N MET B 203 ? N MET B 564 
H 2 3 N SER B 204 ? N SER B 565 O GLU B 240 ? O GLU B 601 
H 3 4 N VAL B 241 ? N VAL B 602 O LEU B 255 ? O LEU B 616 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL A 801'  
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL A 802'  
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA B 701'  
AC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL B 702'  
AC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE ACT B 703' 
AC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ACT B 704' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 LEU A 8   ? LEU A 369 . ? 4_555 ? 
2  AC1 3 ARG A 58  ? ARG A 419 . ? 1_555 ? 
3  AC1 3 GLU B 224 ? GLU B 585 . ? 1_555 ? 
4  AC2 3 LYS A 208 ? LYS A 569 . ? 1_555 ? 
5  AC2 3 PHE A 230 ? PHE A 591 . ? 1_555 ? 
6  AC2 3 HOH I .   ? HOH A 922 . ? 1_555 ? 
7  AC3 6 ARG A 185 ? ARG A 546 . ? 1_555 ? 
8  AC3 6 GLU A 220 ? GLU A 581 . ? 1_555 ? 
9  AC3 6 HOH I .   ? HOH A 968 . ? 1_555 ? 
10 AC3 6 ASP B 101 ? ASP B 462 . ? 1_555 ? 
11 AC3 6 ASP B 103 ? ASP B 464 . ? 1_555 ? 
12 AC3 6 ASP B 105 ? ASP B 466 . ? 1_555 ? 
13 AC4 2 LYS B 208 ? LYS B 569 . ? 1_555 ? 
14 AC4 2 PHE B 230 ? PHE B 591 . ? 1_555 ? 
15 AC5 2 TYR B 54  ? TYR B 415 . ? 1_555 ? 
16 AC5 2 PHE B 98  ? PHE B 459 . ? 1_555 ? 
17 AC6 5 GLU B 82  ? GLU B 443 . ? 1_555 ? 
18 AC6 5 ASP B 170 ? ASP B 531 . ? 1_555 ? 
19 AC6 5 GLY B 171 ? GLY B 532 . ? 1_555 ? 
20 AC6 5 PHE B 230 ? PHE B 591 . ? 1_555 ? 
21 AC6 5 HOH J .   ? HOH B 842 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4NPJ 
_atom_sites.fract_transf_matrix[1][1]   0.016051 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016051 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004417 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
H  
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N    . ASN A 1 2   ? 9.817   -15.540 -66.579 1.00 73.34  ? 363 ASN A N    1 
ATOM   2    C  CA   . ASN A 1 2   ? 10.892  -16.261 -65.908 1.00 81.39  ? 363 ASN A CA   1 
ATOM   3    C  C    . ASN A 1 2   ? 11.592  -15.400 -64.866 1.00 82.40  ? 363 ASN A C    1 
ATOM   4    O  O    . ASN A 1 2   ? 11.946  -14.246 -65.129 1.00 71.12  ? 363 ASN A O    1 
ATOM   5    C  CB   . ASN A 1 2   ? 11.913  -16.765 -66.924 1.00 89.65  ? 363 ASN A CB   1 
ATOM   6    C  CG   . ASN A 1 2   ? 11.366  -17.869 -67.803 1.00 105.49 ? 363 ASN A CG   1 
ATOM   7    O  OD1  . ASN A 1 2   ? 10.660  -17.610 -68.777 1.00 117.48 ? 363 ASN A OD1  1 
ATOM   8    N  ND2  . ASN A 1 2   ? 11.697  -19.111 -67.467 1.00 115.12 ? 363 ASN A ND2  1 
ATOM   9    H  HA   . ASN A 1 2   ? 10.517  -17.032 -65.455 1.00 97.67  ? 363 ASN A HA   1 
ATOM   10   H  HB2  . ASN A 1 2   ? 12.179  -16.029 -67.498 1.00 107.57 ? 363 ASN A HB2  1 
ATOM   11   H  HB3  . ASN A 1 2   ? 12.685  -17.112 -66.451 1.00 107.57 ? 363 ASN A HB3  1 
ATOM   12   H  HD21 . ASN A 1 2   ? 11.411  -19.774 -67.935 1.00 138.15 ? 363 ASN A HD21 1 
ATOM   13   H  HD22 . ASN A 1 2   ? 12.198  -19.253 -66.782 1.00 138.15 ? 363 ASN A HD22 1 
ATOM   14   N  N    . ARG A 1 3   ? 11.807  -15.991 -63.694 1.00 75.44  ? 364 ARG A N    1 
ATOM   15   C  CA   . ARG A 1 3   ? 12.328  -15.281 -62.530 1.00 80.14  ? 364 ARG A CA   1 
ATOM   16   C  C    . ARG A 1 3   ? 13.243  -16.160 -61.693 1.00 75.23  ? 364 ARG A C    1 
ATOM   17   O  O    . ARG A 1 3   ? 13.116  -17.382 -61.698 1.00 80.92  ? 364 ARG A O    1 
ATOM   18   C  CB   . ARG A 1 3   ? 11.175  -14.791 -61.651 1.00 80.51  ? 364 ARG A CB   1 
ATOM   19   C  CG   . ARG A 1 3   ? 10.713  -13.387 -61.956 1.00 112.10 ? 364 ARG A CG   1 
ATOM   20   C  CD   . ARG A 1 3   ? 9.226   -13.227 -61.701 1.00 127.84 ? 364 ARG A CD   1 
ATOM   21   N  NE   . ARG A 1 3   ? 8.823   -11.823 -61.705 1.00 137.14 ? 364 ARG A NE   1 
ATOM   22   C  CZ   . ARG A 1 3   ? 7.581   -11.396 -61.498 1.00 127.18 ? 364 ARG A CZ   1 
ATOM   23   N  NH1  . ARG A 1 3   ? 6.604   -12.264 -61.268 1.00 123.58 ? 364 ARG A NH1  1 
ATOM   24   N  NH2  . ARG A 1 3   ? 7.315   -10.097 -61.521 1.00 116.22 ? 364 ARG A NH2  1 
ATOM   25   H  H    . ARG A 1 3   ? 11.655  -16.824 -63.545 1.00 90.53  ? 364 ARG A H    1 
ATOM   26   H  HA   . ARG A 1 3   ? 12.835  -14.509 -62.827 1.00 96.16  ? 364 ARG A HA   1 
ATOM   27   H  HB2  . ARG A 1 3   ? 10.417  -15.384 -61.773 1.00 96.62  ? 364 ARG A HB2  1 
ATOM   28   H  HB3  . ARG A 1 3   ? 11.461  -14.812 -60.724 1.00 96.62  ? 364 ARG A HB3  1 
ATOM   29   H  HG2  . ARG A 1 3   ? 11.189  -12.762 -61.387 1.00 134.52 ? 364 ARG A HG2  1 
ATOM   30   H  HG3  . ARG A 1 3   ? 10.885  -13.189 -62.890 1.00 134.52 ? 364 ARG A HG3  1 
ATOM   31   H  HD2  . ARG A 1 3   ? 8.732   -13.686 -62.398 1.00 153.41 ? 364 ARG A HD2  1 
ATOM   32   H  HD3  . ARG A 1 3   ? 9.009   -13.602 -60.833 1.00 153.41 ? 364 ARG A HD3  1 
ATOM   33   H  HE   . ARG A 1 3   ? 9.430   -11.232 -61.852 1.00 164.57 ? 364 ARG A HE   1 
ATOM   34   H  HH11 . ARG A 1 3   ? 6.772   -13.107 -61.252 1.00 148.29 ? 364 ARG A HH11 1 
ATOM   35   H  HH12 . ARG A 1 3   ? 5.802   -11.983 -61.134 1.00 148.29 ? 364 ARG A HH12 1 
ATOM   36   H  HH21 . ARG A 1 3   ? 7.945   -9.532  -61.670 1.00 139.46 ? 364 ARG A HH21 1 
ATOM   37   H  HH22 . ARG A 1 3   ? 6.511   -9.820  -61.387 1.00 139.46 ? 364 ARG A HH22 1 
ATOM   38   N  N    . ILE A 1 4   ? 14.167  -15.526 -60.979 1.00 73.07  ? 365 ILE A N    1 
ATOM   39   C  CA   . ILE A 1 4   ? 14.850  -16.181 -59.876 1.00 69.39  ? 365 ILE A CA   1 
ATOM   40   C  C    . ILE A 1 4   ? 14.407  -15.473 -58.599 1.00 65.83  ? 365 ILE A C    1 
ATOM   41   O  O    . ILE A 1 4   ? 14.494  -14.249 -58.476 1.00 64.61  ? 365 ILE A O    1 
ATOM   42   C  CB   . ILE A 1 4   ? 16.389  -16.163 -60.020 1.00 66.43  ? 365 ILE A CB   1 
ATOM   43   C  CG1  . ILE A 1 4   ? 17.033  -16.777 -58.772 1.00 91.85  ? 365 ILE A CG1  1 
ATOM   44   C  CG2  . ILE A 1 4   ? 16.909  -14.752 -60.235 1.00 65.13  ? 365 ILE A CG2  1 
ATOM   45   C  CD1  . ILE A 1 4   ? 18.475  -17.203 -58.961 1.00 86.86  ? 365 ILE A CD1  1 
ATOM   46   H  H    . ILE A 1 4   ? 14.417  -14.714 -61.116 1.00 87.68  ? 365 ILE A H    1 
ATOM   47   H  HA   . ILE A 1 4   ? 14.562  -17.106 -59.826 1.00 83.26  ? 365 ILE A HA   1 
ATOM   48   H  HB   . ILE A 1 4   ? 16.633  -16.702 -60.789 1.00 79.72  ? 365 ILE A HB   1 
ATOM   49   H  HG12 . ILE A 1 4   ? 17.010  -16.123 -58.056 1.00 110.21 ? 365 ILE A HG12 1 
ATOM   50   H  HG13 . ILE A 1 4   ? 16.525  -17.562 -58.514 1.00 110.21 ? 365 ILE A HG13 1 
ATOM   51   H  HG21 . ILE A 1 4   ? 17.874  -14.781 -60.320 1.00 78.15  ? 365 ILE A HG21 1 
ATOM   52   H  HG22 . ILE A 1 4   ? 16.515  -14.391 -61.044 1.00 78.15  ? 365 ILE A HG22 1 
ATOM   53   H  HG23 . ILE A 1 4   ? 16.660  -14.205 -59.473 1.00 78.15  ? 365 ILE A HG23 1 
ATOM   54   H  HD11 . ILE A 1 4   ? 18.805  -17.579 -58.130 1.00 104.23 ? 365 ILE A HD11 1 
ATOM   55   H  HD12 . ILE A 1 4   ? 18.517  -17.869 -59.665 1.00 104.23 ? 365 ILE A HD12 1 
ATOM   56   H  HD13 . ILE A 1 4   ? 19.003  -16.427 -59.206 1.00 104.23 ? 365 ILE A HD13 1 
ATOM   57   N  N    . THR A 1 5   ? 13.903  -16.265 -57.663 1.00 61.09  ? 366 THR A N    1 
ATOM   58   C  CA   . THR A 1 5   ? 13.236  -15.750 -56.481 1.00 62.43  ? 366 THR A CA   1 
ATOM   59   C  C    . THR A 1 5   ? 14.062  -16.060 -55.241 1.00 62.96  ? 366 THR A C    1 
ATOM   60   O  O    . THR A 1 5   ? 14.526  -17.192 -55.059 1.00 61.87  ? 366 THR A O    1 
ATOM   61   C  CB   . THR A 1 5   ? 11.813  -16.358 -56.351 1.00 76.23  ? 366 THR A CB   1 
ATOM   62   O  OG1  . THR A 1 5   ? 10.992  -15.885 -57.426 1.00 83.85  ? 366 THR A OG1  1 
ATOM   63   C  CG2  . THR A 1 5   ? 11.162  -15.981 -55.032 1.00 96.17  ? 366 THR A CG2  1 
ATOM   64   H  H    . THR A 1 5   ? 13.936  -17.124 -57.693 1.00 73.31  ? 366 THR A H    1 
ATOM   65   H  HA   . THR A 1 5   ? 13.149  -14.787 -56.556 1.00 74.91  ? 366 THR A HA   1 
ATOM   66   H  HB   . THR A 1 5   ? 11.873  -17.325 -56.395 1.00 91.48  ? 366 THR A HB   1 
ATOM   67   H  HG1  . THR A 1 5   ? 10.220  -16.210 -57.363 1.00 100.62 ? 366 THR A HG1  1 
ATOM   68   H  HG21 . THR A 1 5   ? 10.276  -16.372 -54.976 1.00 115.40 ? 366 THR A HG21 1 
ATOM   69   H  HG22 . THR A 1 5   ? 11.698  -16.307 -54.292 1.00 115.40 ? 366 THR A HG22 1 
ATOM   70   H  HG23 . THR A 1 5   ? 11.085  -15.016 -54.964 1.00 115.40 ? 366 THR A HG23 1 
ATOM   71   N  N    . VAL A 1 6   ? 14.239  -15.042 -54.402 1.00 60.79  ? 367 VAL A N    1 
ATOM   72   C  CA   . VAL A 1 6   ? 14.928  -15.185 -53.124 1.00 60.00  ? 367 VAL A CA   1 
ATOM   73   C  C    . VAL A 1 6   ? 14.000  -14.797 -51.966 1.00 56.36  ? 367 VAL A C    1 
ATOM   74   O  O    . VAL A 1 6   ? 13.800  -13.614 -51.692 1.00 60.25  ? 367 VAL A O    1 
ATOM   75   C  CB   . VAL A 1 6   ? 16.192  -14.314 -53.066 1.00 69.25  ? 367 VAL A CB   1 
ATOM   76   C  CG1  . VAL A 1 6   ? 16.967  -14.583 -51.780 1.00 56.95  ? 367 VAL A CG1  1 
ATOM   77   C  CG2  . VAL A 1 6   ? 17.070  -14.554 -54.298 1.00 57.27  ? 367 VAL A CG2  1 
ATOM   78   H  H    . VAL A 1 6   ? 13.963  -14.242 -54.555 1.00 72.95  ? 367 VAL A H    1 
ATOM   79   H  HA   . VAL A 1 6   ? 15.191  -16.111 -53.005 1.00 72.00  ? 367 VAL A HA   1 
ATOM   80   H  HB   . VAL A 1 6   ? 15.930  -13.380 -53.065 1.00 83.10  ? 367 VAL A HB   1 
ATOM   81   H  HG11 . VAL A 1 6   ? 17.759  -14.023 -51.765 1.00 68.35  ? 367 VAL A HG11 1 
ATOM   82   H  HG12 . VAL A 1 6   ? 16.400  -14.375 -51.020 1.00 68.35  ? 367 VAL A HG12 1 
ATOM   83   H  HG13 . VAL A 1 6   ? 17.222  -15.519 -51.756 1.00 68.35  ? 367 VAL A HG13 1 
ATOM   84   H  HG21 . VAL A 1 6   ? 17.859  -13.993 -54.237 1.00 68.72  ? 367 VAL A HG21 1 
ATOM   85   H  HG22 . VAL A 1 6   ? 17.328  -15.488 -54.324 1.00 68.72  ? 367 VAL A HG22 1 
ATOM   86   H  HG23 . VAL A 1 6   ? 16.564  -14.328 -55.094 1.00 68.72  ? 367 VAL A HG23 1 
ATOM   87   N  N    . PRO A 1 7   ? 13.424  -15.791 -51.281 1.00 54.86  ? 368 PRO A N    1 
ATOM   88   C  CA   . PRO A 1 7   ? 12.547  -15.431 -50.158 1.00 60.52  ? 368 PRO A CA   1 
ATOM   89   C  C    . PRO A 1 7   ? 13.332  -14.862 -48.973 1.00 58.21  ? 368 PRO A C    1 
ATOM   90   O  O    . PRO A 1 7   ? 14.368  -15.415 -48.609 1.00 69.33  ? 368 PRO A O    1 
ATOM   91   C  CB   . PRO A 1 7   ? 11.874  -16.759 -49.799 1.00 53.69  ? 368 PRO A CB   1 
ATOM   92   C  CG   . PRO A 1 7   ? 12.835  -17.805 -50.251 1.00 75.44  ? 368 PRO A CG   1 
ATOM   93   C  CD   . PRO A 1 7   ? 13.511  -17.250 -51.476 1.00 63.23  ? 368 PRO A CD   1 
ATOM   94   H  HA   . PRO A 1 7   ? 11.875  -14.791 -50.442 1.00 72.62  ? 368 PRO A HA   1 
ATOM   95   H  HB2  . PRO A 1 7   ? 11.737  -16.809 -48.840 1.00 64.43  ? 368 PRO A HB2  1 
ATOM   96   H  HB3  . PRO A 1 7   ? 11.031  -16.838 -50.273 1.00 64.43  ? 368 PRO A HB3  1 
ATOM   97   H  HG2  . PRO A 1 7   ? 13.484  -17.973 -49.551 1.00 90.53  ? 368 PRO A HG2  1 
ATOM   98   H  HG3  . PRO A 1 7   ? 12.351  -18.617 -50.469 1.00 90.53  ? 368 PRO A HG3  1 
ATOM   99   H  HD2  . PRO A 1 7   ? 14.439  -17.532 -51.507 1.00 75.87  ? 368 PRO A HD2  1 
ATOM   100  H  HD3  . PRO A 1 7   ? 13.032  -17.513 -52.276 1.00 75.87  ? 368 PRO A HD3  1 
ATOM   101  N  N    . LEU A 1 8   ? 12.854  -13.756 -48.407 1.00 54.93  ? 369 LEU A N    1 
ATOM   102  C  CA   . LEU A 1 8   ? 13.485  -13.155 -47.240 1.00 58.99  ? 369 LEU A CA   1 
ATOM   103  C  C    . LEU A 1 8   ? 12.705  -13.568 -45.998 1.00 55.79  ? 369 LEU A C    1 
ATOM   104  O  O    . LEU A 1 8   ? 11.698  -12.952 -45.643 1.00 62.43  ? 369 LEU A O    1 
ATOM   105  C  CB   . LEU A 1 8   ? 13.550  -11.631 -47.377 1.00 56.37  ? 369 LEU A CB   1 
ATOM   106  C  CG   . LEU A 1 8   ? 14.328  -11.134 -48.605 1.00 77.02  ? 369 LEU A CG   1 
ATOM   107  C  CD1  . LEU A 1 8   ? 14.418  -9.617  -48.627 1.00 59.22  ? 369 LEU A CD1  1 
ATOM   108  C  CD2  . LEU A 1 8   ? 15.729  -11.728 -48.670 1.00 56.41  ? 369 LEU A CD2  1 
ATOM   109  H  H    . LEU A 1 8   ? 12.160  -13.332 -48.685 1.00 65.91  ? 369 LEU A H    1 
ATOM   110  H  HA   . LEU A 1 8   ? 14.390  -13.491 -47.156 1.00 70.78  ? 369 LEU A HA   1 
ATOM   111  H  HB2  . LEU A 1 8   ? 12.646  -11.287 -47.443 1.00 67.65  ? 369 LEU A HB2  1 
ATOM   112  H  HB3  . LEU A 1 8   ? 13.982  -11.267 -46.588 1.00 67.65  ? 369 LEU A HB3  1 
ATOM   113  H  HG   . LEU A 1 8   ? 13.854  -11.411 -49.404 1.00 92.43  ? 369 LEU A HG   1 
ATOM   114  H  HD11 . LEU A 1 8   ? 14.914  -9.342  -49.414 1.00 71.06  ? 369 LEU A HD11 1 
ATOM   115  H  HD12 . LEU A 1 8   ? 13.521  -9.248  -48.656 1.00 71.06  ? 369 LEU A HD12 1 
ATOM   116  H  HD13 . LEU A 1 8   ? 14.874  -9.316  -47.826 1.00 71.06  ? 369 LEU A HD13 1 
ATOM   117  H  HD21 . LEU A 1 8   ? 16.180  -11.387 -49.458 1.00 67.69  ? 369 LEU A HD21 1 
ATOM   118  H  HD22 . LEU A 1 8   ? 16.217  -11.472 -47.872 1.00 67.69  ? 369 LEU A HD22 1 
ATOM   119  H  HD23 . LEU A 1 8   ? 15.659  -12.694 -48.720 1.00 67.69  ? 369 LEU A HD23 1 
ATOM   120  N  N    . VAL A 1 9   ? 13.175  -14.634 -45.358 1.00 59.39  ? 370 VAL A N    1 
ATOM   121  C  CA   . VAL A 1 9   ? 12.488  -15.224 -44.213 1.00 58.82  ? 370 VAL A CA   1 
ATOM   122  C  C    . VAL A 1 9   ? 13.260  -15.004 -42.912 1.00 62.80  ? 370 VAL A C    1 
ATOM   123  O  O    . VAL A 1 9   ? 14.486  -15.134 -42.873 1.00 58.14  ? 370 VAL A O    1 
ATOM   124  C  CB   . VAL A 1 9   ? 12.276  -16.728 -44.411 1.00 52.59  ? 370 VAL A CB   1 
ATOM   125  C  CG1  . VAL A 1 9   ? 11.439  -17.303 -43.280 1.00 57.61  ? 370 VAL A CG1  1 
ATOM   126  C  CG2  . VAL A 1 9   ? 11.607  -16.999 -45.755 1.00 50.96  ? 370 VAL A CG2  1 
ATOM   127  H  H    . VAL A 1 9   ? 13.902  -15.041 -45.571 1.00 71.27  ? 370 VAL A H    1 
ATOM   128  H  HA   . VAL A 1 9   ? 11.616  -14.807 -44.118 1.00 70.59  ? 370 VAL A HA   1 
ATOM   129  H  HB   . VAL A 1 9   ? 13.137  -17.175 -44.406 1.00 63.10  ? 370 VAL A HB   1 
ATOM   130  H  HG11 . VAL A 1 9   ? 11.319  -18.254 -43.428 1.00 69.13  ? 370 VAL A HG11 1 
ATOM   131  H  HG12 . VAL A 1 9   ? 11.899  -17.154 -42.440 1.00 69.13  ? 370 VAL A HG12 1 
ATOM   132  H  HG13 . VAL A 1 9   ? 10.577  -16.858 -43.269 1.00 69.13  ? 370 VAL A HG13 1 
ATOM   133  H  HG21 . VAL A 1 9   ? 11.483  -17.956 -45.859 1.00 61.15  ? 370 VAL A HG21 1 
ATOM   134  H  HG22 . VAL A 1 9   ? 10.747  -16.550 -45.776 1.00 61.15  ? 370 VAL A HG22 1 
ATOM   135  H  HG23 . VAL A 1 9   ? 12.175  -16.660 -46.464 1.00 61.15  ? 370 VAL A HG23 1 
ATOM   136  N  N    . SER A 1 10  ? 12.526  -14.687 -41.847 1.00 59.32  ? 371 SER A N    1 
ATOM   137  C  CA   . SER A 1 10  ? 13.118  -14.500 -40.525 1.00 62.71  ? 371 SER A CA   1 
ATOM   138  C  C    . SER A 1 10  ? 12.189  -15.013 -39.434 1.00 62.74  ? 371 SER A C    1 
ATOM   139  O  O    . SER A 1 10  ? 10.990  -15.197 -39.653 1.00 54.02  ? 371 SER A O    1 
ATOM   140  C  CB   . SER A 1 10  ? 13.442  -13.022 -40.273 1.00 73.22  ? 371 SER A CB   1 
ATOM   141  O  OG   . SER A 1 10  ? 14.578  -12.605 -41.009 1.00 64.11  ? 371 SER A OG   1 
ATOM   142  H  H    . SER A 1 10  ? 11.674  -14.574 -41.865 1.00 71.18  ? 371 SER A H    1 
ATOM   143  H  HA   . SER A 1 10  ? 13.947  -15.003 -40.475 1.00 75.25  ? 371 SER A HA   1 
ATOM   144  H  HB2  . SER A 1 10  ? 12.680  -12.485 -40.540 1.00 87.87  ? 371 SER A HB2  1 
ATOM   145  H  HB3  . SER A 1 10  ? 13.618  -12.897 -39.327 1.00 87.87  ? 371 SER A HB3  1 
ATOM   146  H  HG   . SER A 1 10  ? 14.737  -11.794 -40.856 1.00 76.93  ? 371 SER A HG   1 
ATOM   147  N  N    . GLU A 1 11  ? 12.754  -15.244 -38.255 1.00 67.65  ? 372 GLU A N    1 
ATOM   148  C  CA   . GLU A 1 11  ? 11.976  -15.703 -37.113 1.00 70.14  ? 372 GLU A CA   1 
ATOM   149  C  C    . GLU A 1 11  ? 11.191  -14.534 -36.530 1.00 69.62  ? 372 GLU A C    1 
ATOM   150  O  O    . GLU A 1 11  ? 11.775  -13.533 -36.117 1.00 65.57  ? 372 GLU A O    1 
ATOM   151  C  CB   . GLU A 1 11  ? 12.891  -16.322 -36.055 1.00 62.66  ? 372 GLU A CB   1 
ATOM   152  C  CG   . GLU A 1 11  ? 13.769  -17.463 -36.571 1.00 58.15  ? 372 GLU A CG   1 
ATOM   153  C  CD   . GLU A 1 11  ? 13.022  -18.779 -36.717 1.00 93.11  ? 372 GLU A CD   1 
ATOM   154  O  OE1  . GLU A 1 11  ? 13.660  -19.780 -37.109 1.00 114.83 ? 372 GLU A OE1  1 
ATOM   155  O  OE2  . GLU A 1 11  ? 11.804  -18.818 -36.440 1.00 82.77  ? 372 GLU A OE2  1 
ATOM   156  H  H    . GLU A 1 11  ? 13.591  -15.142 -38.090 1.00 81.17  ? 372 GLU A H    1 
ATOM   157  H  HA   . GLU A 1 11  ? 11.345  -16.380 -37.405 1.00 84.16  ? 372 GLU A HA   1 
ATOM   158  H  HB2  . GLU A 1 11  ? 13.478  -15.632 -35.710 1.00 75.19  ? 372 GLU A HB2  1 
ATOM   159  H  HB3  . GLU A 1 11  ? 12.342  -16.674 -35.337 1.00 75.19  ? 372 GLU A HB3  1 
ATOM   160  H  HG2  . GLU A 1 11  ? 14.119  -17.221 -37.443 1.00 69.79  ? 372 GLU A HG2  1 
ATOM   161  H  HG3  . GLU A 1 11  ? 14.500  -17.603 -35.949 1.00 69.79  ? 372 GLU A HG3  1 
ATOM   162  N  N    . VAL A 1 12  ? 9.867   -14.668 -36.502 1.00 55.43  ? 373 VAL A N    1 
ATOM   163  C  CA   . VAL A 1 12  ? 8.983   -13.611 -36.010 1.00 50.40  ? 373 VAL A CA   1 
ATOM   164  C  C    . VAL A 1 12  ? 8.232   -14.042 -34.748 1.00 59.35  ? 373 VAL A C    1 
ATOM   165  O  O    . VAL A 1 12  ? 7.699   -15.149 -34.685 1.00 51.36  ? 373 VAL A O    1 
ATOM   166  C  CB   . VAL A 1 12  ? 7.966   -13.216 -37.101 1.00 67.64  ? 373 VAL A CB   1 
ATOM   167  C  CG1  . VAL A 1 12  ? 6.885   -12.301 -36.549 1.00 54.63  ? 373 VAL A CG1  1 
ATOM   168  C  CG2  . VAL A 1 12  ? 8.684   -12.553 -38.262 1.00 64.70  ? 373 VAL A CG2  1 
ATOM   169  H  H    . VAL A 1 12  ? 9.450   -15.372 -36.767 1.00 66.52  ? 373 VAL A H    1 
ATOM   170  H  HA   . VAL A 1 12  ? 9.513   -12.828 -35.794 1.00 60.48  ? 373 VAL A HA   1 
ATOM   171  H  HB   . VAL A 1 12  ? 7.536   -14.019 -37.435 1.00 81.16  ? 373 VAL A HB   1 
ATOM   172  H  HG11 . VAL A 1 12  ? 6.268   -12.076 -37.263 1.00 65.56  ? 373 VAL A HG11 1 
ATOM   173  H  HG12 . VAL A 1 12  ? 6.415   -12.762 -35.837 1.00 65.56  ? 373 VAL A HG12 1 
ATOM   174  H  HG13 . VAL A 1 12  ? 7.300   -11.495 -36.204 1.00 65.56  ? 373 VAL A HG13 1 
ATOM   175  H  HG21 . VAL A 1 12  ? 8.033   -12.311 -38.938 1.00 77.64  ? 373 VAL A HG21 1 
ATOM   176  H  HG22 . VAL A 1 12  ? 9.137   -11.758 -37.939 1.00 77.64  ? 373 VAL A HG22 1 
ATOM   177  H  HG23 . VAL A 1 12  ? 9.330   -13.175 -38.631 1.00 77.64  ? 373 VAL A HG23 1 
ATOM   178  N  N    . GLN A 1 13  ? 8.182   -13.165 -33.750 1.00 59.13  ? 374 GLN A N    1 
ATOM   179  C  CA   . GLN A 1 13  ? 7.429   -13.453 -32.539 1.00 60.28  ? 374 GLN A CA   1 
ATOM   180  C  C    . GLN A 1 13  ? 5.932   -13.348 -32.813 1.00 55.34  ? 374 GLN A C    1 
ATOM   181  O  O    . GLN A 1 13  ? 5.387   -12.253 -32.905 1.00 58.38  ? 374 GLN A O    1 
ATOM   182  C  CB   . GLN A 1 13  ? 7.818   -12.505 -31.400 1.00 62.53  ? 374 GLN A CB   1 
ATOM   183  C  CG   . GLN A 1 13  ? 7.171   -12.890 -30.067 1.00 68.39  ? 374 GLN A CG   1 
ATOM   184  C  CD   . GLN A 1 13  ? 7.459   -11.906 -28.957 1.00 70.34  ? 374 GLN A CD   1 
ATOM   185  O  OE1  . GLN A 1 13  ? 6.541   -11.305 -28.393 1.00 63.92  ? 374 GLN A OE1  1 
ATOM   186  N  NE2  . GLN A 1 13  ? 8.736   -11.740 -28.626 1.00 61.97  ? 374 GLN A NE2  1 
ATOM   187  H  H    . GLN A 1 13  ? 8.575   -12.399 -33.750 1.00 70.96  ? 374 GLN A H    1 
ATOM   188  H  HA   . GLN A 1 13  ? 7.621   -14.360 -32.255 1.00 72.34  ? 374 GLN A HA   1 
ATOM   189  H  HB2  . GLN A 1 13  ? 8.780   -12.528 -31.285 1.00 75.04  ? 374 GLN A HB2  1 
ATOM   190  H  HB3  . GLN A 1 13  ? 7.531   -11.606 -31.625 1.00 75.04  ? 374 GLN A HB3  1 
ATOM   191  H  HG2  . GLN A 1 13  ? 6.209   -12.933 -30.185 1.00 82.06  ? 374 GLN A HG2  1 
ATOM   192  H  HG3  . GLN A 1 13  ? 7.510   -13.757 -29.793 1.00 82.06  ? 374 GLN A HG3  1 
ATOM   193  H  HE21 . GLN A 1 13  ? 9.347   -12.183 -29.039 1.00 74.36  ? 374 GLN A HE21 1 
ATOM   194  H  HE22 . GLN A 1 13  ? 8.950   -11.191 -28.000 1.00 74.36  ? 374 GLN A HE22 1 
ATOM   195  N  N    . ILE A 1 14  ? 5.275   -14.496 -32.939 1.00 53.41  ? 375 ILE A N    1 
ATOM   196  C  CA   . ILE A 1 14  ? 3.831   -14.546 -33.161 1.00 56.10  ? 375 ILE A CA   1 
ATOM   197  C  C    . ILE A 1 14  ? 3.058   -14.135 -31.907 1.00 66.00  ? 375 ILE A C    1 
ATOM   198  O  O    . ILE A 1 14  ? 2.045   -13.431 -31.972 1.00 55.25  ? 375 ILE A O    1 
ATOM   199  C  CB   . ILE A 1 14  ? 3.388   -15.961 -33.573 1.00 54.04  ? 375 ILE A CB   1 
ATOM   200  C  CG1  . ILE A 1 14  ? 4.192   -16.439 -34.784 1.00 62.88  ? 375 ILE A CG1  1 
ATOM   201  C  CG2  . ILE A 1 14  ? 1.896   -15.992 -33.860 1.00 48.63  ? 375 ILE A CG2  1 
ATOM   202  C  CD1  . ILE A 1 14  ? 4.113   -15.516 -35.994 1.00 60.39  ? 375 ILE A CD1  1 
ATOM   203  H  H    . ILE A 1 14  ? 5.646   -15.270 -32.900 1.00 64.09  ? 375 ILE A H    1 
ATOM   204  H  HA   . ILE A 1 14  ? 3.597   -13.934 -33.876 1.00 67.32  ? 375 ILE A HA   1 
ATOM   205  H  HB   . ILE A 1 14  ? 3.567   -16.562 -32.833 1.00 64.85  ? 375 ILE A HB   1 
ATOM   206  H  HG12 . ILE A 1 14  ? 5.125   -16.510 -34.528 1.00 75.45  ? 375 ILE A HG12 1 
ATOM   207  H  HG13 . ILE A 1 14  ? 3.860   -17.309 -35.054 1.00 75.45  ? 375 ILE A HG13 1 
ATOM   208  H  HG21 . ILE A 1 14  ? 1.644   -16.893 -34.117 1.00 58.36  ? 375 ILE A HG21 1 
ATOM   209  H  HG22 . ILE A 1 14  ? 1.415   -15.729 -33.061 1.00 58.36  ? 375 ILE A HG22 1 
ATOM   210  H  HG23 . ILE A 1 14  ? 1.701   -15.375 -34.583 1.00 58.36  ? 375 ILE A HG23 1 
ATOM   211  H  HD11 . ILE A 1 14  ? 4.647   -15.890 -36.711 1.00 72.47  ? 375 ILE A HD11 1 
ATOM   212  H  HD12 . ILE A 1 14  ? 3.187   -15.442 -36.274 1.00 72.47  ? 375 ILE A HD12 1 
ATOM   213  H  HD13 . ILE A 1 14  ? 4.455   -14.642 -35.747 1.00 72.47  ? 375 ILE A HD13 1 
ATOM   214  N  N    . ALA A 1 15  ? 3.538   -14.595 -30.762 1.00 48.31  ? 376 ALA A N    1 
ATOM   215  C  CA   . ALA A 1 15  ? 2.876   -14.319 -29.496 1.00 60.59  ? 376 ALA A CA   1 
ATOM   216  C  C    . ALA A 1 15  ? 3.858   -14.500 -28.358 1.00 47.60  ? 376 ALA A C    1 
ATOM   217  O  O    . ALA A 1 15  ? 5.048   -14.739 -28.575 1.00 55.64  ? 376 ALA A O    1 
ATOM   218  C  CB   . ALA A 1 15  ? 1.666   -15.230 -29.307 1.00 50.43  ? 376 ALA A CB   1 
ATOM   219  H  H    . ALA A 1 15  ? 4.250   -15.073 -30.690 1.00 57.98  ? 376 ALA A H    1 
ATOM   220  H  HA   . ALA A 1 15  ? 2.568   -13.399 -29.490 1.00 72.71  ? 376 ALA A HA   1 
ATOM   221  H  HB1  . ALA A 1 15  ? 1.246   -15.024 -28.457 1.00 60.51  ? 376 ALA A HB1  1 
ATOM   222  H  HB2  . ALA A 1 15  ? 1.040   -15.077 -30.031 1.00 60.51  ? 376 ALA A HB2  1 
ATOM   223  H  HB3  . ALA A 1 15  ? 1.962   -16.154 -29.314 1.00 60.51  ? 376 ALA A HB3  1 
ATOM   224  N  N    . GLN A 1 16  ? 3.345   -14.402 -27.139 1.00 56.85  ? 377 GLN A N    1 
ATOM   225  C  CA   . GLN A 1 16  ? 4.183   -14.425 -25.958 1.00 56.48  ? 377 GLN A CA   1 
ATOM   226  C  C    . GLN A 1 16  ? 3.385   -14.921 -24.762 1.00 46.92  ? 377 GLN A C    1 
ATOM   227  O  O    . GLN A 1 16  ? 2.302   -14.407 -24.475 1.00 57.67  ? 377 GLN A O    1 
ATOM   228  C  CB   . GLN A 1 16  ? 4.737   -13.027 -25.699 1.00 65.39  ? 377 GLN A CB   1 
ATOM   229  C  CG   . GLN A 1 16  ? 5.832   -12.952 -24.667 1.00 77.58  ? 377 GLN A CG   1 
ATOM   230  C  CD   . GLN A 1 16  ? 5.958   -11.558 -24.088 1.00 91.73  ? 377 GLN A CD   1 
ATOM   231  O  OE1  . GLN A 1 16  ? 4.982   -10.984 -23.601 1.00 109.13 ? 377 GLN A OE1  1 
ATOM   232  N  NE2  . GLN A 1 16  ? 7.159   -10.999 -24.150 1.00 68.42  ? 377 GLN A NE2  1 
ATOM   233  H  H    . GLN A 1 16  ? 2.505   -14.320 -26.971 1.00 68.22  ? 377 GLN A H    1 
ATOM   234  H  HA   . GLN A 1 16  ? 4.929   -15.029 -26.102 1.00 67.77  ? 377 GLN A HA   1 
ATOM   235  H  HB2  . GLN A 1 16  ? 5.095   -12.679 -26.531 1.00 78.47  ? 377 GLN A HB2  1 
ATOM   236  H  HB3  . GLN A 1 16  ? 4.010   -12.460 -25.396 1.00 78.47  ? 377 GLN A HB3  1 
ATOM   237  H  HG2  . GLN A 1 16  ? 5.631   -13.564 -23.942 1.00 93.09  ? 377 GLN A HG2  1 
ATOM   238  H  HG3  . GLN A 1 16  ? 6.677   -13.187 -25.080 1.00 93.09  ? 377 GLN A HG3  1 
ATOM   239  H  HE21 . GLN A 1 16  ? 7.815   -11.428 -24.506 1.00 82.11  ? 377 GLN A HE21 1 
ATOM   240  H  HE22 . GLN A 1 16  ? 7.282   -10.209 -23.835 1.00 82.11  ? 377 GLN A HE22 1 
ATOM   241  N  N    . LEU A 1 17  ? 3.911   -15.938 -24.087 1.00 49.76  ? 378 LEU A N    1 
ATOM   242  C  CA   . LEU A 1 17  ? 3.329   -16.413 -22.839 1.00 52.18  ? 378 LEU A CA   1 
ATOM   243  C  C    . LEU A 1 17  ? 3.959   -15.656 -21.692 1.00 47.80  ? 378 LEU A C    1 
ATOM   244  O  O    . LEU A 1 17  ? 5.174   -15.451 -21.672 1.00 58.37  ? 378 LEU A O    1 
ATOM   245  C  CB   . LEU A 1 17  ? 3.549   -17.917 -22.651 1.00 49.69  ? 378 LEU A CB   1 
ATOM   246  C  CG   . LEU A 1 17  ? 3.007   -18.829 -23.753 1.00 61.18  ? 378 LEU A CG   1 
ATOM   247  C  CD1  . LEU A 1 17  ? 3.415   -20.267 -23.493 1.00 71.74  ? 378 LEU A CD1  1 
ATOM   248  C  CD2  . LEU A 1 17  ? 1.499   -18.716 -23.851 1.00 67.39  ? 378 LEU A CD2  1 
ATOM   249  H  H    . LEU A 1 17  ? 4.610   -16.373 -24.334 1.00 59.71  ? 378 LEU A H    1 
ATOM   250  H  HA   . LEU A 1 17  ? 2.375   -16.238 -22.839 1.00 62.62  ? 378 LEU A HA   1 
ATOM   251  H  HB2  . LEU A 1 17  ? 4.503   -18.078 -22.588 1.00 59.63  ? 378 LEU A HB2  1 
ATOM   252  H  HB3  . LEU A 1 17  ? 3.123   -18.184 -21.822 1.00 59.63  ? 378 LEU A HB3  1 
ATOM   253  H  HG   . LEU A 1 17  ? 3.385   -18.557 -24.604 1.00 73.42  ? 378 LEU A HG   1 
ATOM   254  H  HD11 . LEU A 1 17  ? 3.062   -20.827 -24.202 1.00 86.08  ? 378 LEU A HD11 1 
ATOM   255  H  HD12 . LEU A 1 17  ? 4.384   -20.322 -23.478 1.00 86.08  ? 378 LEU A HD12 1 
ATOM   256  H  HD13 . LEU A 1 17  ? 3.054   -20.547 -22.638 1.00 86.08  ? 378 LEU A HD13 1 
ATOM   257  H  HD21 . LEU A 1 17  ? 1.183   -19.303 -24.555 1.00 80.87  ? 378 LEU A HD21 1 
ATOM   258  H  HD22 . LEU A 1 17  ? 1.107   -18.976 -23.002 1.00 80.87  ? 378 LEU A HD22 1 
ATOM   259  H  HD23 . LEU A 1 17  ? 1.264   -17.797 -24.055 1.00 80.87  ? 378 LEU A HD23 1 
ATOM   260  N  N    . ARG A 1 18  ? 3.130   -15.241 -20.743 1.00 49.99  ? 379 ARG A N    1 
ATOM   261  C  CA   . ARG A 1 18  ? 3.623   -14.616 -19.527 1.00 65.56  ? 379 ARG A CA   1 
ATOM   262  C  C    . ARG A 1 18  ? 3.180   -15.408 -18.302 1.00 60.81  ? 379 ARG A C    1 
ATOM   263  O  O    . ARG A 1 18  ? 2.000   -15.729 -18.158 1.00 49.12  ? 379 ARG A O    1 
ATOM   264  C  CB   . ARG A 1 18  ? 3.153   -13.165 -19.439 1.00 59.60  ? 379 ARG A CB   1 
ATOM   265  C  CG   . ARG A 1 18  ? 3.883   -12.240 -20.412 1.00 74.09  ? 379 ARG A CG   1 
ATOM   266  C  CD   . ARG A 1 18  ? 3.523   -10.780 -20.191 1.00 91.89  ? 379 ARG A CD   1 
ATOM   267  N  NE   . ARG A 1 18  ? 2.079   -10.569 -20.208 1.00 102.19 ? 379 ARG A NE   1 
ATOM   268  C  CZ   . ARG A 1 18  ? 1.333   -10.567 -21.310 1.00 123.29 ? 379 ARG A CZ   1 
ATOM   269  N  NH1  . ARG A 1 18  ? 1.887   -10.771 -22.499 1.00 119.02 ? 379 ARG A NH1  1 
ATOM   270  N  NH2  . ARG A 1 18  ? 0.025   -10.366 -21.221 1.00 136.49 ? 379 ARG A NH2  1 
ATOM   271  H  H    . ARG A 1 18  ? 2.273   -15.311 -20.781 1.00 59.99  ? 379 ARG A H    1 
ATOM   272  H  HA   . ARG A 1 18  ? 4.593   -14.615 -19.546 1.00 78.68  ? 379 ARG A HA   1 
ATOM   273  H  HB2  . ARG A 1 18  ? 2.206   -13.127 -19.644 1.00 71.52  ? 379 ARG A HB2  1 
ATOM   274  H  HB3  . ARG A 1 18  ? 3.310   -12.836 -18.539 1.00 71.52  ? 379 ARG A HB3  1 
ATOM   275  H  HG2  . ARG A 1 18  ? 4.840   -12.337 -20.287 1.00 88.91  ? 379 ARG A HG2  1 
ATOM   276  H  HG3  . ARG A 1 18  ? 3.639   -12.477 -21.320 1.00 88.91  ? 379 ARG A HG3  1 
ATOM   277  H  HD2  . ARG A 1 18  ? 3.860   -10.495 -19.327 1.00 110.27 ? 379 ARG A HD2  1 
ATOM   278  H  HD3  . ARG A 1 18  ? 3.916   -10.244 -20.897 1.00 110.27 ? 379 ARG A HD3  1 
ATOM   279  H  HE   . ARG A 1 18  ? 1.683   -10.437 -19.456 1.00 122.63 ? 379 ARG A HE   1 
ATOM   280  H  HH11 . ARG A 1 18  ? 2.735   -10.902 -22.562 1.00 142.82 ? 379 ARG A HH11 1 
ATOM   281  H  HH12 . ARG A 1 18  ? 1.399   -10.769 -23.207 1.00 142.82 ? 379 ARG A HH12 1 
ATOM   282  H  HH21 . ARG A 1 18  ? -0.339  -10.235 -20.453 1.00 163.78 ? 379 ARG A HH21 1 
ATOM   283  H  HH22 . ARG A 1 18  ? -0.459  -10.366 -21.932 1.00 163.78 ? 379 ARG A HH22 1 
ATOM   284  N  N    . PHE A 1 19  ? 4.142   -15.745 -17.445 1.00 46.16  ? 380 PHE A N    1 
ATOM   285  C  CA   . PHE A 1 19  ? 3.860   -16.456 -16.193 1.00 51.02  ? 380 PHE A CA   1 
ATOM   286  C  C    . PHE A 1 19  ? 4.373   -15.683 -14.985 1.00 46.06  ? 380 PHE A C    1 
ATOM   287  O  O    . PHE A 1 19  ? 5.459   -15.113 -15.031 1.00 51.17  ? 380 PHE A O    1 
ATOM   288  C  CB   . PHE A 1 19  ? 4.500   -17.848 -16.195 1.00 44.99  ? 380 PHE A CB   1 
ATOM   289  C  CG   . PHE A 1 19  ? 4.105   -18.696 -17.365 1.00 44.80  ? 380 PHE A CG   1 
ATOM   290  C  CD1  . PHE A 1 19  ? 2.843   -19.268 -17.431 1.00 54.47  ? 380 PHE A CD1  1 
ATOM   291  C  CD2  . PHE A 1 19  ? 4.996   -18.922 -18.400 1.00 47.30  ? 380 PHE A CD2  1 
ATOM   292  C  CE1  . PHE A 1 19  ? 2.477   -20.049 -18.514 1.00 51.18  ? 380 PHE A CE1  1 
ATOM   293  C  CE2  . PHE A 1 19  ? 4.639   -19.703 -19.485 1.00 46.37  ? 380 PHE A CE2  1 
ATOM   294  C  CZ   . PHE A 1 19  ? 3.379   -20.268 -19.543 1.00 54.23  ? 380 PHE A CZ   1 
ATOM   295  H  H    . PHE A 1 19  ? 4.976   -15.572 -17.564 1.00 55.39  ? 380 PHE A H    1 
ATOM   296  H  HA   . PHE A 1 19  ? 2.901   -16.565 -16.097 1.00 61.23  ? 380 PHE A HA   1 
ATOM   297  H  HB2  . PHE A 1 19  ? 5.464   -17.748 -16.214 1.00 53.99  ? 380 PHE A HB2  1 
ATOM   298  H  HB3  . PHE A 1 19  ? 4.234   -18.315 -15.388 1.00 53.99  ? 380 PHE A HB3  1 
ATOM   299  H  HD1  . PHE A 1 19  ? 2.235   -19.123 -16.743 1.00 65.36  ? 380 PHE A HD1  1 
ATOM   300  H  HD2  . PHE A 1 19  ? 5.845   -18.544 -18.366 1.00 56.77  ? 380 PHE A HD2  1 
ATOM   301  H  HE1  . PHE A 1 19  ? 1.629   -20.429 -18.549 1.00 61.42  ? 380 PHE A HE1  1 
ATOM   302  H  HE2  . PHE A 1 19  ? 5.246   -19.847 -20.175 1.00 55.64  ? 380 PHE A HE2  1 
ATOM   303  H  HZ   . PHE A 1 19  ? 3.136   -20.794 -20.271 1.00 65.08  ? 380 PHE A HZ   1 
ATOM   304  N  N    . PRO A 1 20  ? 3.612   -15.693 -13.880 1.00 54.67  ? 381 PRO A N    1 
ATOM   305  C  CA   . PRO A 1 20  ? 4.096   -14.964 -12.708 1.00 65.44  ? 381 PRO A CA   1 
ATOM   306  C  C    . PRO A 1 20  ? 5.308   -15.657 -12.097 1.00 54.83  ? 381 PRO A C    1 
ATOM   307  O  O    . PRO A 1 20  ? 5.402   -16.884 -12.165 1.00 57.38  ? 381 PRO A O    1 
ATOM   308  C  CB   . PRO A 1 20  ? 2.899   -14.998 -11.762 1.00 66.62  ? 381 PRO A CB   1 
ATOM   309  C  CG   . PRO A 1 20  ? 2.227   -16.295 -12.080 1.00 68.41  ? 381 PRO A CG   1 
ATOM   310  C  CD   . PRO A 1 20  ? 2.427   -16.513 -13.564 1.00 55.50  ? 381 PRO A CD   1 
ATOM   311  H  HA   . PRO A 1 20  ? 4.315   -14.047 -12.935 1.00 78.53  ? 381 PRO A HA   1 
ATOM   312  H  HB2  . PRO A 1 20  ? 3.205   -14.982 -10.842 1.00 79.95  ? 381 PRO A HB2  1 
ATOM   313  H  HB3  . PRO A 1 20  ? 2.312   -14.248 -11.946 1.00 79.95  ? 381 PRO A HB3  1 
ATOM   314  H  HG2  . PRO A 1 20  ? 2.642   -17.009 -11.572 1.00 82.09  ? 381 PRO A HG2  1 
ATOM   315  H  HG3  . PRO A 1 20  ? 1.282   -16.231 -11.869 1.00 82.09  ? 381 PRO A HG3  1 
ATOM   316  H  HD2  . PRO A 1 20  ? 2.605   -17.448 -13.747 1.00 66.60  ? 381 PRO A HD2  1 
ATOM   317  H  HD3  . PRO A 1 20  ? 1.655   -16.195 -14.059 1.00 66.60  ? 381 PRO A HD3  1 
ATOM   318  N  N    . VAL A 1 21  ? 6.218   -14.880 -11.520 1.00 68.36  ? 382 VAL A N    1 
ATOM   319  C  CA   . VAL A 1 21  ? 7.403   -15.431 -10.871 1.00 59.46  ? 382 VAL A CA   1 
ATOM   320  C  C    . VAL A 1 21  ? 7.548   -14.811 -9.474  1.00 73.85  ? 382 VAL A C    1 
ATOM   321  O  O    . VAL A 1 21  ? 7.198   -13.644 -9.267  1.00 50.45  ? 382 VAL A O    1 
ATOM   322  C  CB   . VAL A 1 21  ? 8.665   -15.184 -11.731 1.00 73.13  ? 382 VAL A CB   1 
ATOM   323  C  CG1  . VAL A 1 21  ? 8.889   -13.691 -11.963 1.00 68.98  ? 382 VAL A CG1  1 
ATOM   324  C  CG2  . VAL A 1 21  ? 9.893   -15.842 -11.113 1.00 63.42  ? 382 VAL A CG2  1 
ATOM   325  H  H    . VAL A 1 21  ? 6.172   -14.022 -11.491 1.00 82.03  ? 382 VAL A H    1 
ATOM   326  H  HA   . VAL A 1 21  ? 7.292   -16.388 -10.766 1.00 71.35  ? 382 VAL A HA   1 
ATOM   327  H  HB   . VAL A 1 21  ? 8.526   -15.592 -12.600 1.00 87.76  ? 382 VAL A HB   1 
ATOM   328  H  HG11 . VAL A 1 21  ? 9.685   -13.572 -12.503 1.00 82.77  ? 382 VAL A HG11 1 
ATOM   329  H  HG12 . VAL A 1 21  ? 8.118   -13.324 -12.423 1.00 82.77  ? 382 VAL A HG12 1 
ATOM   330  H  HG13 . VAL A 1 21  ? 9.002   -13.252 -11.105 1.00 82.77  ? 382 VAL A HG13 1 
ATOM   331  H  HG21 . VAL A 1 21  ? 10.662  -15.667 -11.677 1.00 76.11  ? 382 VAL A HG21 1 
ATOM   332  H  HG22 . VAL A 1 21  ? 10.039  -15.470 -10.229 1.00 76.11  ? 382 VAL A HG22 1 
ATOM   333  H  HG23 . VAL A 1 21  ? 9.740   -16.798 -11.049 1.00 76.11  ? 382 VAL A HG23 1 
ATOM   334  N  N    . PRO A 1 22  ? 8.033   -15.594 -8.497  1.00 60.18  ? 383 PRO A N    1 
ATOM   335  C  CA   . PRO A 1 22  ? 8.116   -15.000 -7.158  1.00 67.00  ? 383 PRO A CA   1 
ATOM   336  C  C    . PRO A 1 22  ? 9.145   -13.876 -7.087  1.00 60.54  ? 383 PRO A C    1 
ATOM   337  O  O    . PRO A 1 22  ? 10.227  -13.984 -7.666  1.00 55.45  ? 383 PRO A O    1 
ATOM   338  C  CB   . PRO A 1 22  ? 8.530   -16.183 -6.266  1.00 50.41  ? 383 PRO A CB   1 
ATOM   339  C  CG   . PRO A 1 22  ? 8.230   -17.411 -7.070  1.00 69.59  ? 383 PRO A CG   1 
ATOM   340  C  CD   . PRO A 1 22  ? 8.438   -17.010 -8.492  1.00 51.02  ? 383 PRO A CD   1 
ATOM   341  H  HA   . PRO A 1 22  ? 7.250   -14.668 -6.877  1.00 80.39  ? 383 PRO A HA   1 
ATOM   342  H  HB2  . PRO A 1 22  ? 9.478   -16.126 -6.068  1.00 60.49  ? 383 PRO A HB2  1 
ATOM   343  H  HB3  . PRO A 1 22  ? 8.007   -16.173 -5.449  1.00 60.49  ? 383 PRO A HB3  1 
ATOM   344  H  HG2  . PRO A 1 22  ? 8.843   -18.121 -6.821  1.00 83.50  ? 383 PRO A HG2  1 
ATOM   345  H  HG3  . PRO A 1 22  ? 7.311   -17.683 -6.921  1.00 83.50  ? 383 PRO A HG3  1 
ATOM   346  H  HD2  . PRO A 1 22  ? 9.372   -17.097 -8.736  1.00 61.22  ? 383 PRO A HD2  1 
ATOM   347  H  HD3  . PRO A 1 22  ? 7.865   -17.529 -9.078  1.00 61.22  ? 383 PRO A HD3  1 
ATOM   348  N  N    . LYS A 1 23  ? 8.786   -12.799 -6.399  1.00 65.78  ? 384 LYS A N    1 
ATOM   349  C  CA   . LYS A 1 23  ? 9.715   -11.717 -6.114  1.00 78.74  ? 384 LYS A CA   1 
ATOM   350  C  C    . LYS A 1 23  ? 10.722  -12.178 -5.057  1.00 75.81  ? 384 LYS A C    1 
ATOM   351  O  O    . LYS A 1 23  ? 11.816  -11.626 -4.937  1.00 66.90  ? 384 LYS A O    1 
ATOM   352  C  CB   . LYS A 1 23  ? 8.952   -10.473 -5.647  1.00 76.60  ? 384 LYS A CB   1 
ATOM   353  C  CG   . LYS A 1 23  ? 9.828   -9.324  -5.182  1.00 100.54 ? 384 LYS A CG   1 
ATOM   354  C  CD   . LYS A 1 23  ? 9.047   -8.016  -5.069  1.00 104.08 ? 384 LYS A CD   1 
ATOM   355  C  CE   . LYS A 1 23  ? 7.834   -8.142  -4.157  1.00 112.47 ? 384 LYS A CE   1 
ATOM   356  N  NZ   . LYS A 1 23  ? 7.141   -6.835  -3.961  1.00 113.23 ? 384 LYS A NZ   1 
ATOM   357  H  H    . LYS A 1 23  ? 7.996   -12.671 -6.083  1.00 78.93  ? 384 LYS A H    1 
ATOM   358  H  HA   . LYS A 1 23  ? 10.203  -11.491 -6.921  1.00 94.49  ? 384 LYS A HA   1 
ATOM   359  H  HB2  . LYS A 1 23  ? 8.410   -10.149 -6.384  1.00 91.92  ? 384 LYS A HB2  1 
ATOM   360  H  HB3  . LYS A 1 23  ? 8.378   -10.723 -4.906  1.00 91.92  ? 384 LYS A HB3  1 
ATOM   361  H  HG2  . LYS A 1 23  ? 10.192  -9.535  -4.308  1.00 120.65 ? 384 LYS A HG2  1 
ATOM   362  H  HG3  . LYS A 1 23  ? 10.547  -9.193  -5.820  1.00 120.65 ? 384 LYS A HG3  1 
ATOM   363  H  HD2  . LYS A 1 23  ? 9.628   -7.330  -4.705  1.00 124.89 ? 384 LYS A HD2  1 
ATOM   364  H  HD3  . LYS A 1 23  ? 8.736   -7.755  -5.950  1.00 124.89 ? 384 LYS A HD3  1 
ATOM   365  H  HE2  . LYS A 1 23  ? 7.202   -8.762  -4.552  1.00 134.97 ? 384 LYS A HE2  1 
ATOM   366  H  HE3  . LYS A 1 23  ? 8.121   -8.464  -3.288  1.00 134.97 ? 384 LYS A HE3  1 
ATOM   367  H  HZ1  . LYS A 1 23  ? 6.439   -6.941  -3.425  1.00 135.87 ? 384 LYS A HZ1  1 
ATOM   368  H  HZ2  . LYS A 1 23  ? 7.699   -6.247  -3.594  1.00 135.87 ? 384 LYS A HZ2  1 
ATOM   369  H  HZ3  . LYS A 1 23  ? 6.862   -6.519  -4.745  1.00 135.87 ? 384 LYS A HZ3  1 
ATOM   370  N  N    . GLY A 1 24  ? 10.350  -13.207 -4.302  1.00 61.68  ? 385 GLY A N    1 
ATOM   371  C  CA   . GLY A 1 24  ? 11.232  -13.778 -3.299  1.00 68.73  ? 385 GLY A CA   1 
ATOM   372  C  C    . GLY A 1 24  ? 10.525  -14.776 -2.400  1.00 51.93  ? 385 GLY A C    1 
ATOM   373  O  O    . GLY A 1 24  ? 9.362   -15.115 -2.627  1.00 66.34  ? 385 GLY A O    1 
ATOM   374  H  H    . GLY A 1 24  ? 9.584   -13.594 -4.354  1.00 74.02  ? 385 GLY A H    1 
ATOM   375  H  HA2  . GLY A 1 24  ? 11.970  -14.229 -3.738  1.00 82.47  ? 385 GLY A HA2  1 
ATOM   376  H  HA3  . GLY A 1 24  ? 11.592  -13.068 -2.745  1.00 82.47  ? 385 GLY A HA3  1 
ATOM   377  N  N    . VAL A 1 25  ? 11.236  -15.246 -1.377  1.00 57.95  ? 386 VAL A N    1 
ATOM   378  C  CA   . VAL A 1 25  ? 10.682  -16.193 -0.415  1.00 60.78  ? 386 VAL A CA   1 
ATOM   379  C  C    . VAL A 1 25  ? 10.764  -15.619 1.000   1.00 68.52  ? 386 VAL A C    1 
ATOM   380  O  O    . VAL A 1 25  ? 11.829  -15.197 1.455   1.00 61.99  ? 386 VAL A O    1 
ATOM   381  C  CB   . VAL A 1 25  ? 11.417  -17.550 -0.476  1.00 72.09  ? 386 VAL A CB   1 
ATOM   382  C  CG1  . VAL A 1 25  ? 10.871  -18.515 0.564   1.00 65.08  ? 386 VAL A CG1  1 
ATOM   383  C  CG2  . VAL A 1 25  ? 11.288  -18.158 -1.868  1.00 69.77  ? 386 VAL A CG2  1 
ATOM   384  H  H    . VAL A 1 25  ? 12.052  -15.027 -1.217  1.00 69.54  ? 386 VAL A H    1 
ATOM   385  H  HA   . VAL A 1 25  ? 9.747   -16.347 -0.624  1.00 72.93  ? 386 VAL A HA   1 
ATOM   386  H  HB   . VAL A 1 25  ? 12.360  -17.410 -0.294  1.00 86.51  ? 386 VAL A HB   1 
ATOM   387  H  HG11 . VAL A 1 25  ? 11.353  -19.355 0.498   1.00 78.09  ? 386 VAL A HG11 1 
ATOM   388  H  HG12 . VAL A 1 25  ? 10.994  -18.131 1.446   1.00 78.09  ? 386 VAL A HG12 1 
ATOM   389  H  HG13 . VAL A 1 25  ? 9.927   -18.661 0.394   1.00 78.09  ? 386 VAL A HG13 1 
ATOM   390  H  HG21 . VAL A 1 25  ? 11.755  -19.008 -1.885  1.00 83.72  ? 386 VAL A HG21 1 
ATOM   391  H  HG22 . VAL A 1 25  ? 10.348  -18.293 -2.067  1.00 83.72  ? 386 VAL A HG22 1 
ATOM   392  H  HG23 . VAL A 1 25  ? 11.679  -17.552 -2.515  1.00 83.72  ? 386 VAL A HG23 1 
ATOM   393  N  N    . LEU A 1 26  ? 9.622   -15.602 1.683   1.00 62.46  ? 387 LEU A N    1 
ATOM   394  C  CA   . LEU A 1 26  ? 9.548   -15.143 3.063   1.00 67.87  ? 387 LEU A CA   1 
ATOM   395  C  C    . LEU A 1 26  ? 9.601   -16.322 4.019   1.00 54.52  ? 387 LEU A C    1 
ATOM   396  O  O    . LEU A 1 26  ? 8.696   -17.150 4.047   1.00 53.51  ? 387 LEU A O    1 
ATOM   397  C  CB   . LEU A 1 26  ? 8.266   -14.340 3.305   1.00 56.04  ? 387 LEU A CB   1 
ATOM   398  C  CG   . LEU A 1 26  ? 8.105   -13.826 4.741   1.00 56.07  ? 387 LEU A CG   1 
ATOM   399  C  CD1  . LEU A 1 26  ? 9.201   -12.828 5.063   1.00 55.05  ? 387 LEU A CD1  1 
ATOM   400  C  CD2  . LEU A 1 26  ? 6.732   -13.211 4.964   1.00 69.27  ? 387 LEU A CD2  1 
ATOM   401  H  H    . LEU A 1 26  ? 8.866   -15.857 1.362   1.00 74.96  ? 387 LEU A H    1 
ATOM   402  H  HA   . LEU A 1 26  ? 10.306  -14.567 3.249   1.00 81.44  ? 387 LEU A HA   1 
ATOM   403  H  HB2  . LEU A 1 26  ? 8.265   -13.570 2.714   1.00 67.25  ? 387 LEU A HB2  1 
ATOM   404  H  HB3  . LEU A 1 26  ? 7.503   -14.905 3.106   1.00 67.25  ? 387 LEU A HB3  1 
ATOM   405  H  HG   . LEU A 1 26  ? 8.197   -14.574 5.352   1.00 67.28  ? 387 LEU A HG   1 
ATOM   406  H  HD11 . LEU A 1 26  ? 9.084   -12.514 5.974   1.00 66.06  ? 387 LEU A HD11 1 
ATOM   407  H  HD12 . LEU A 1 26  ? 10.062  -13.264 4.972   1.00 66.06  ? 387 LEU A HD12 1 
ATOM   408  H  HD13 . LEU A 1 26  ? 9.140   -12.082 4.446   1.00 66.06  ? 387 LEU A HD13 1 
ATOM   409  H  HD21 . LEU A 1 26  ? 6.671   -12.900 5.881   1.00 83.13  ? 387 LEU A HD21 1 
ATOM   410  H  HD22 . LEU A 1 26  ? 6.617   -12.467 4.353   1.00 83.13  ? 387 LEU A HD22 1 
ATOM   411  H  HD23 . LEU A 1 26  ? 6.054   -13.885 4.797   1.00 83.13  ? 387 LEU A HD23 1 
ATOM   412  N  N    . ARG A 1 27  ? 10.672  -16.398 4.791   1.00 56.54  ? 388 ARG A N    1 
ATOM   413  C  CA   . ARG A 1 27  ? 10.799  -17.420 5.814   1.00 57.72  ? 388 ARG A CA   1 
ATOM   414  C  C    . ARG A 1 27  ? 10.271  -16.849 7.130   1.00 58.41  ? 388 ARG A C    1 
ATOM   415  O  O    . ARG A 1 27  ? 10.784  -15.848 7.626   1.00 61.30  ? 388 ARG A O    1 
ATOM   416  C  CB   . ARG A 1 27  ? 12.252  -17.870 5.945   1.00 66.18  ? 388 ARG A CB   1 
ATOM   417  C  CG   . ARG A 1 27  ? 12.419  -19.217 6.608   1.00 75.96  ? 388 ARG A CG   1 
ATOM   418  C  CD   . ARG A 1 27  ? 13.853  -19.689 6.523   1.00 83.45  ? 388 ARG A CD   1 
ATOM   419  N  NE   . ARG A 1 27  ? 14.098  -20.466 5.312   1.00 71.09  ? 388 ARG A NE   1 
ATOM   420  C  CZ   . ARG A 1 27  ? 15.280  -20.581 4.714   1.00 83.70  ? 388 ARG A CZ   1 
ATOM   421  N  NH1  . ARG A 1 27  ? 16.348  -19.958 5.195   1.00 67.47  ? 388 ARG A NH1  1 
ATOM   422  N  NH2  . ARG A 1 27  ? 15.392  -21.317 3.620   1.00 68.54  ? 388 ARG A NH2  1 
ATOM   423  H  H    . ARG A 1 27  ? 11.346  -15.865 4.742   1.00 67.84  ? 388 ARG A H    1 
ATOM   424  H  HA   . ARG A 1 27  ? 10.258  -18.188 5.572   1.00 69.27  ? 388 ARG A HA   1 
ATOM   425  H  HB2  . ARG A 1 27  ? 12.643  -17.927 5.058   1.00 79.42  ? 388 ARG A HB2  1 
ATOM   426  H  HB3  . ARG A 1 27  ? 12.735  -17.217 6.475   1.00 79.42  ? 388 ARG A HB3  1 
ATOM   427  H  HG2  . ARG A 1 27  ? 12.176  -19.147 7.545   1.00 91.15  ? 388 ARG A HG2  1 
ATOM   428  H  HG3  . ARG A 1 27  ? 11.856  -19.868 6.161   1.00 91.15  ? 388 ARG A HG3  1 
ATOM   429  H  HD2  . ARG A 1 27  ? 14.442  -18.918 6.513   1.00 100.14 ? 388 ARG A HD2  1 
ATOM   430  H  HD3  . ARG A 1 27  ? 14.050  -20.251 7.288   1.00 100.14 ? 388 ARG A HD3  1 
ATOM   431  H  HE   . ARG A 1 27  ? 13.430  -20.878 4.960   1.00 85.31  ? 388 ARG A HE   1 
ATOM   432  H  HH11 . ARG A 1 27  ? 16.282  -19.478 5.906   1.00 80.97  ? 388 ARG A HH11 1 
ATOM   433  H  HH12 . ARG A 1 27  ? 17.107  -20.037 4.798   1.00 80.97  ? 388 ARG A HH12 1 
ATOM   434  H  HH21 . ARG A 1 27  ? 14.704  -21.721 3.301   1.00 82.24  ? 388 ARG A HH21 1 
ATOM   435  H  HH22 . ARG A 1 27  ? 16.154  -21.390 3.227   1.00 82.24  ? 388 ARG A HH22 1 
ATOM   436  N  N    . ILE A 1 28  ? 9.237   -17.484 7.674   1.00 61.33  ? 389 ILE A N    1 
ATOM   437  C  CA   . ILE A 1 28  ? 8.545   -16.976 8.857   1.00 61.37  ? 389 ILE A CA   1 
ATOM   438  C  C    . ILE A 1 28  ? 8.818   -17.835 10.089  1.00 59.85  ? 389 ILE A C    1 
ATOM   439  O  O    . ILE A 1 28  ? 8.379   -18.979 10.156  1.00 62.79  ? 389 ILE A O    1 
ATOM   440  C  CB   . ILE A 1 28  ? 7.020   -16.923 8.632   1.00 59.33  ? 389 ILE A CB   1 
ATOM   441  C  CG1  . ILE A 1 28  ? 6.694   -16.343 7.253   1.00 58.19  ? 389 ILE A CG1  1 
ATOM   442  C  CG2  . ILE A 1 28  ? 6.354   -16.103 9.722   1.00 56.19  ? 389 ILE A CG2  1 
ATOM   443  C  CD1  . ILE A 1 28  ? 5.229   -16.433 6.899   1.00 54.56  ? 389 ILE A CD1  1 
ATOM   444  H  H    . ILE A 1 28  ? 8.913   -18.221 7.373   1.00 73.60  ? 389 ILE A H    1 
ATOM   445  H  HA   . ILE A 1 28  ? 8.854   -16.075 9.043   1.00 73.65  ? 389 ILE A HA   1 
ATOM   446  H  HB   . ILE A 1 28  ? 6.673   -17.828 8.673   1.00 71.20  ? 389 ILE A HB   1 
ATOM   447  H  HG12 . ILE A 1 28  ? 6.948   -15.407 7.237   1.00 69.82  ? 389 ILE A HG12 1 
ATOM   448  H  HG13 . ILE A 1 28  ? 7.193   -16.832 6.580   1.00 69.82  ? 389 ILE A HG13 1 
ATOM   449  H  HG21 . ILE A 1 28  ? 5.397   -16.084 9.561   1.00 67.43  ? 389 ILE A HG21 1 
ATOM   450  H  HG22 . ILE A 1 28  ? 6.537   -16.514 10.581  1.00 67.43  ? 389 ILE A HG22 1 
ATOM   451  H  HG23 . ILE A 1 28  ? 6.712   -15.202 9.702   1.00 67.43  ? 389 ILE A HG23 1 
ATOM   452  H  HD11 . ILE A 1 28  ? 5.094   -16.050 6.019   1.00 65.47  ? 389 ILE A HD11 1 
ATOM   453  H  HD12 . ILE A 1 28  ? 4.961   -17.365 6.900   1.00 65.47  ? 389 ILE A HD12 1 
ATOM   454  H  HD13 . ILE A 1 28  ? 4.715   -15.940 7.558   1.00 65.47  ? 389 ILE A HD13 1 
ATOM   455  N  N    . HIS A 1 29  ? 9.534   -17.284 11.061  1.00 61.77  ? 390 HIS A N    1 
ATOM   456  C  CA   . HIS A 1 29  ? 9.776   -17.990 12.316  1.00 72.98  ? 390 HIS A CA   1 
ATOM   457  C  C    . HIS A 1 29  ? 8.670   -17.668 13.316  1.00 63.31  ? 390 HIS A C    1 
ATOM   458  O  O    . HIS A 1 29  ? 8.581   -16.550 13.825  1.00 63.60  ? 390 HIS A O    1 
ATOM   459  C  CB   . HIS A 1 29  ? 11.141  -17.623 12.896  1.00 66.05  ? 390 HIS A CB   1 
ATOM   460  C  CG   . HIS A 1 29  ? 12.293  -17.989 12.011  1.00 80.31  ? 390 HIS A CG   1 
ATOM   461  N  ND1  . HIS A 1 29  ? 12.782  -19.275 11.921  1.00 78.39  ? 390 HIS A ND1  1 
ATOM   462  C  CD2  . HIS A 1 29  ? 13.053  -17.240 11.179  1.00 89.80  ? 390 HIS A CD2  1 
ATOM   463  C  CE1  . HIS A 1 29  ? 13.792  -19.301 11.072  1.00 67.90  ? 390 HIS A CE1  1 
ATOM   464  N  NE2  . HIS A 1 29  ? 13.976  -18.079 10.606  1.00 95.74  ? 390 HIS A NE2  1 
ATOM   465  H  H    . HIS A 1 29  ? 9.891   -16.503 11.021  1.00 74.13  ? 390 HIS A H    1 
ATOM   466  H  HA   . HIS A 1 29  ? 9.766   -18.946 12.150  1.00 87.58  ? 390 HIS A HA   1 
ATOM   467  H  HB2  . HIS A 1 29  ? 11.171  -16.664 13.040  1.00 79.25  ? 390 HIS A HB2  1 
ATOM   468  H  HB3  . HIS A 1 29  ? 11.256  -18.086 13.740  1.00 79.25  ? 390 HIS A HB3  1 
ATOM   469  H  HD1  . HIS A 1 29  ? 12.476  -19.954 12.351  1.00 94.07  ? 390 HIS A HD1  1 
ATOM   470  H  HD2  . HIS A 1 29  ? 12.965  -16.327 11.022  1.00 107.76 ? 390 HIS A HD2  1 
ATOM   471  H  HE1  . HIS A 1 29  ? 14.289  -20.053 10.840  1.00 81.48  ? 390 HIS A HE1  1 
ATOM   472  H  HE2  . HIS A 1 29  ? 14.579  -17.847 10.037  1.00 114.89 ? 390 HIS A HE2  1 
ATOM   473  N  N    . PHE A 1 30  ? 7.816   -18.655 13.562  1.00 62.68  ? 391 PHE A N    1 
ATOM   474  C  CA   . PHE A 1 30  ? 6.726   -18.531 14.521  1.00 62.40  ? 391 PHE A CA   1 
ATOM   475  C  C    . PHE A 1 30  ? 7.232   -19.028 15.870  1.00 64.80  ? 391 PHE A C    1 
ATOM   476  O  O    . PHE A 1 30  ? 7.136   -20.212 16.185  1.00 73.64  ? 391 PHE A O    1 
ATOM   477  C  CB   . PHE A 1 30  ? 5.514   -19.332 14.042  1.00 60.52  ? 391 PHE A CB   1 
ATOM   478  C  CG   . PHE A 1 30  ? 4.233   -19.012 14.764  1.00 66.44  ? 391 PHE A CG   1 
ATOM   479  C  CD1  . PHE A 1 30  ? 3.680   -17.743 14.699  1.00 58.56  ? 391 PHE A CD1  1 
ATOM   480  C  CD2  . PHE A 1 30  ? 3.560   -19.996 15.474  1.00 66.58  ? 391 PHE A CD2  1 
ATOM   481  C  CE1  . PHE A 1 30  ? 2.489   -17.456 15.347  1.00 59.53  ? 391 PHE A CE1  1 
ATOM   482  C  CE2  . PHE A 1 30  ? 2.368   -19.715 16.115  1.00 69.43  ? 391 PHE A CE2  1 
ATOM   483  C  CZ   . PHE A 1 30  ? 1.835   -18.444 16.053  1.00 58.03  ? 391 PHE A CZ   1 
ATOM   484  H  H    . PHE A 1 30  ? 7.849   -19.423 13.177  1.00 75.22  ? 391 PHE A H    1 
ATOM   485  H  HA   . PHE A 1 30  ? 6.469   -17.600 14.607  1.00 74.88  ? 391 PHE A HA   1 
ATOM   486  H  HB2  . PHE A 1 30  ? 5.375   -19.150 13.099  1.00 72.63  ? 391 PHE A HB2  1 
ATOM   487  H  HB3  . PHE A 1 30  ? 5.696   -20.276 14.169  1.00 72.63  ? 391 PHE A HB3  1 
ATOM   488  H  HD1  . PHE A 1 30  ? 4.116   -17.074 14.223  1.00 70.28  ? 391 PHE A HD1  1 
ATOM   489  H  HD2  . PHE A 1 30  ? 3.913   -20.855 15.517  1.00 79.90  ? 391 PHE A HD2  1 
ATOM   490  H  HE1  . PHE A 1 30  ? 2.130   -16.599 15.303  1.00 71.44  ? 391 PHE A HE1  1 
ATOM   491  H  HE2  . PHE A 1 30  ? 1.930   -20.380 16.595  1.00 83.32  ? 391 PHE A HE2  1 
ATOM   492  H  HZ   . PHE A 1 30  ? 1.038   -18.252 16.491  1.00 69.64  ? 391 PHE A HZ   1 
ATOM   493  N  N    . ILE A 1 31  ? 7.792   -18.113 16.649  1.00 66.27  ? 392 ILE A N    1 
ATOM   494  C  CA   . ILE A 1 31  ? 8.590   -18.488 17.812  1.00 74.56  ? 392 ILE A CA   1 
ATOM   495  C  C    . ILE A 1 31  ? 7.733   -18.682 19.057  1.00 69.42  ? 392 ILE A C    1 
ATOM   496  O  O    . ILE A 1 31  ? 7.559   -19.804 19.531  1.00 74.64  ? 392 ILE A O    1 
ATOM   497  C  CB   . ILE A 1 31  ? 9.671   -17.427 18.107  1.00 70.55  ? 392 ILE A CB   1 
ATOM   498  C  CG1  . ILE A 1 31  ? 10.467  -17.113 16.837  1.00 81.65  ? 392 ILE A CG1  1 
ATOM   499  C  CG2  . ILE A 1 31  ? 10.608  -17.917 19.201  1.00 73.43  ? 392 ILE A CG2  1 
ATOM   500  C  CD1  . ILE A 1 31  ? 11.297  -15.858 16.927  1.00 71.05  ? 392 ILE A CD1  1 
ATOM   501  H  H    . ILE A 1 31  ? 7.726   -17.264 16.527  1.00 79.53  ? 392 ILE A H    1 
ATOM   502  H  HA   . ILE A 1 31  ? 9.040   -19.327 17.626  1.00 89.47  ? 392 ILE A HA   1 
ATOM   503  H  HB   . ILE A 1 31  ? 9.235   -16.615 18.411  1.00 84.66  ? 392 ILE A HB   1 
ATOM   504  H  HG12 . ILE A 1 31  ? 11.068  -17.852 16.655  1.00 97.98  ? 392 ILE A HG12 1 
ATOM   505  H  HG13 . ILE A 1 31  ? 9.847   -17.004 16.099  1.00 97.98  ? 392 ILE A HG13 1 
ATOM   506  H  HG21 . ILE A 1 31  ? 11.278  -17.236 19.371  1.00 88.12  ? 392 ILE A HG21 1 
ATOM   507  H  HG22 . ILE A 1 31  ? 10.093  -18.083 20.007  1.00 88.12  ? 392 ILE A HG22 1 
ATOM   508  H  HG23 . ILE A 1 31  ? 11.035  -18.736 18.907  1.00 88.12  ? 392 ILE A HG23 1 
ATOM   509  H  HD11 . ILE A 1 31  ? 11.768  -15.731 16.088  1.00 85.26  ? 392 ILE A HD11 1 
ATOM   510  H  HD12 . ILE A 1 31  ? 10.712  -15.104 17.096  1.00 85.26  ? 392 ILE A HD12 1 
ATOM   511  H  HD13 . ILE A 1 31  ? 11.934  -15.953 17.653  1.00 85.26  ? 392 ILE A HD13 1 
ATOM   512  N  N    . GLU A 1 32  ? 7.182   -17.587 19.568  1.00 69.03  ? 393 GLU A N    1 
ATOM   513  C  CA   . GLU A 1 32  ? 6.482   -17.617 20.843  1.00 69.74  ? 393 GLU A CA   1 
ATOM   514  C  C    . GLU A 1 32  ? 5.607   -16.390 21.062  1.00 71.68  ? 393 GLU A C    1 
ATOM   515  O  O    . GLU A 1 32  ? 5.774   -15.369 20.398  1.00 67.51  ? 393 GLU A O    1 
ATOM   516  C  CB   . GLU A 1 32  ? 7.496   -17.713 21.981  1.00 72.73  ? 393 GLU A CB   1 
ATOM   517  C  CG   . GLU A 1 32  ? 8.457   -16.541 22.002  1.00 73.81  ? 393 GLU A CG   1 
ATOM   518  C  CD   . GLU A 1 32  ? 9.454   -16.626 23.137  1.00 96.70  ? 393 GLU A CD   1 
ATOM   519  O  OE1  . GLU A 1 32  ? 9.995   -17.726 23.376  1.00 111.15 ? 393 GLU A OE1  1 
ATOM   520  O  OE2  . GLU A 1 32  ? 9.690   -15.594 23.798  1.00 82.15  ? 393 GLU A OE2  1 
ATOM   521  H  H    . GLU A 1 32  ? 7.201   -16.813 19.194  1.00 82.83  ? 393 GLU A H    1 
ATOM   522  H  HA   . GLU A 1 32  ? 5.915   -18.403 20.876  1.00 83.69  ? 393 GLU A HA   1 
ATOM   523  H  HB2  . GLU A 1 32  ? 7.022   -17.727 22.828  1.00 87.28  ? 393 GLU A HB2  1 
ATOM   524  H  HB3  . GLU A 1 32  ? 8.015   -18.525 21.876  1.00 87.28  ? 393 GLU A HB3  1 
ATOM   525  H  HG2  . GLU A 1 32  ? 8.952   -16.524 21.168  1.00 88.58  ? 393 GLU A HG2  1 
ATOM   526  H  HG3  . GLU A 1 32  ? 7.952   -15.720 22.106  1.00 88.58  ? 393 GLU A HG3  1 
ATOM   527  N  N    . ALA A 1 33  ? 4.689   -16.500 22.018  1.00 68.41  ? 394 ALA A N    1 
ATOM   528  C  CA   . ALA A 1 33  ? 3.911   -15.362 22.484  1.00 67.54  ? 394 ALA A CA   1 
ATOM   529  C  C    . ALA A 1 33  ? 3.968   -15.317 24.005  1.00 69.59  ? 394 ALA A C    1 
ATOM   530  O  O    . ALA A 1 33  ? 4.268   -16.324 24.642  1.00 76.53  ? 394 ALA A O    1 
ATOM   531  C  CB   . ALA A 1 33  ? 2.482   -15.458 22.011  1.00 64.95  ? 394 ALA A CB   1 
ATOM   532  H  H    . ALA A 1 33  ? 4.496   -17.236 22.417  1.00 82.09  ? 394 ALA A H    1 
ATOM   533  H  HA   . ALA A 1 33  ? 4.296   -14.542 22.136  1.00 81.04  ? 394 ALA A HA   1 
ATOM   534  H  HB1  . ALA A 1 33  ? 1.989   -14.688 22.336  1.00 77.94  ? 394 ALA A HB1  1 
ATOM   535  H  HB2  . ALA A 1 33  ? 2.470   -15.473 21.041  1.00 77.94  ? 394 ALA A HB2  1 
ATOM   536  H  HB3  . ALA A 1 33  ? 2.089   -16.274 22.359  1.00 77.94  ? 394 ALA A HB3  1 
ATOM   537  N  N    . GLN A 1 34  ? 3.689   -14.150 24.576  1.00 71.02  ? 395 GLN A N    1 
ATOM   538  C  CA   . GLN A 1 34  ? 3.635   -13.999 26.025  1.00 81.17  ? 395 GLN A CA   1 
ATOM   539  C  C    . GLN A 1 34  ? 2.417   -13.177 26.425  1.00 80.74  ? 395 GLN A C    1 
ATOM   540  O  O    . GLN A 1 34  ? 1.930   -12.351 25.647  1.00 72.89  ? 395 GLN A O    1 
ATOM   541  C  CB   . GLN A 1 34  ? 4.914   -13.341 26.555  1.00 95.72  ? 395 GLN A CB   1 
ATOM   542  C  CG   . GLN A 1 34  ? 5.035   -11.853 26.255  1.00 94.72  ? 395 GLN A CG   1 
ATOM   543  C  CD   . GLN A 1 34  ? 6.281   -11.235 26.861  1.00 105.04 ? 395 GLN A CD   1 
ATOM   544  O  OE1  . GLN A 1 34  ? 7.191   -11.940 27.303  1.00 106.06 ? 395 GLN A OE1  1 
ATOM   545  N  NE2  . GLN A 1 34  ? 6.327   -9.907  26.888  1.00 89.33  ? 395 GLN A NE2  1 
ATOM   546  H  H    . GLN A 1 34  ? 3.526   -13.425 24.143  1.00 85.22  ? 395 GLN A H    1 
ATOM   547  H  HA   . GLN A 1 34  ? 3.555   -14.876 26.433  1.00 97.41  ? 395 GLN A HA   1 
ATOM   548  H  HB2  . GLN A 1 34  ? 4.941   -13.449 27.519  1.00 114.86 ? 395 GLN A HB2  1 
ATOM   549  H  HB3  . GLN A 1 34  ? 5.679   -13.784 26.155  1.00 114.86 ? 395 GLN A HB3  1 
ATOM   550  H  HG2  . GLN A 1 34  ? 5.073   -11.726 25.294  1.00 113.66 ? 395 GLN A HG2  1 
ATOM   551  H  HG3  . GLN A 1 34  ? 4.263   -11.393 26.621  1.00 113.66 ? 395 GLN A HG3  1 
ATOM   552  H  HE21 . GLN A 1 34  ? 5.672   -9.448  26.572  1.00 107.20 ? 395 GLN A HE21 1 
ATOM   553  H  HE22 . GLN A 1 34  ? 7.012   -9.507  27.221  1.00 107.20 ? 395 GLN A HE22 1 
ATOM   554  N  N    . ASP A 1 35  ? 1.927   -13.428 27.636  1.00 83.04  ? 396 ASP A N    1 
ATOM   555  C  CA   . ASP A 1 35  ? 0.873   -12.623 28.246  1.00 69.62  ? 396 ASP A CA   1 
ATOM   556  C  C    . ASP A 1 35  ? -0.408  -12.577 27.416  1.00 70.79  ? 396 ASP A C    1 
ATOM   557  O  O    . ASP A 1 35  ? -1.010  -11.517 27.259  1.00 69.92  ? 396 ASP A O    1 
ATOM   558  C  CB   . ASP A 1 35  ? 1.383   -11.201 28.484  1.00 87.63  ? 396 ASP A CB   1 
ATOM   559  C  CG   . ASP A 1 35  ? 2.611   -11.164 29.377  1.00 106.35 ? 396 ASP A CG   1 
ATOM   560  O  OD1  . ASP A 1 35  ? 2.788   -12.098 30.189  1.00 101.81 ? 396 ASP A OD1  1 
ATOM   561  O  OD2  . ASP A 1 35  ? 3.399   -10.201 29.267  1.00 123.58 ? 396 ASP A OD2  1 
ATOM   562  H  H    . ASP A 1 35  ? 2.195   -14.075 28.136  1.00 99.64  ? 396 ASP A H    1 
ATOM   563  H  HA   . ASP A 1 35  ? 0.651   -13.006 29.109  1.00 83.54  ? 396 ASP A HA   1 
ATOM   564  H  HB2  . ASP A 1 35  ? 1.619   -10.802 27.632  1.00 105.15 ? 396 ASP A HB2  1 
ATOM   565  H  HB3  . ASP A 1 35  ? 0.684   -10.682 28.913  1.00 105.15 ? 396 ASP A HB3  1 
ATOM   566  N  N    . LEU A 1 36  ? -0.825  -13.724 26.890  1.00 75.34  ? 397 LEU A N    1 
ATOM   567  C  CA   . LEU A 1 36  ? -2.041  -13.783 26.092  1.00 74.19  ? 397 LEU A CA   1 
ATOM   568  C  C    . LEU A 1 36  ? -3.255  -13.617 26.990  1.00 67.04  ? 397 LEU A C    1 
ATOM   569  O  O    . LEU A 1 36  ? -3.151  -13.714 28.208  1.00 69.94  ? 397 LEU A O    1 
ATOM   570  C  CB   . LEU A 1 36  ? -2.133  -15.102 25.320  1.00 62.54  ? 397 LEU A CB   1 
ATOM   571  C  CG   . LEU A 1 36  ? -1.060  -15.360 24.255  1.00 75.71  ? 397 LEU A CG   1 
ATOM   572  C  CD1  . LEU A 1 36  ? -1.370  -16.635 23.484  1.00 62.01  ? 397 LEU A CD1  1 
ATOM   573  C  CD2  . LEU A 1 36  ? -0.939  -14.185 23.301  1.00 61.30  ? 397 LEU A CD2  1 
ATOM   574  H  H    . LEU A 1 36  ? -0.423  -14.479 26.981  1.00 90.41  ? 397 LEU A H    1 
ATOM   575  H  HA   . LEU A 1 36  ? -2.037  -13.056 25.450  1.00 89.03  ? 397 LEU A HA   1 
ATOM   576  H  HB2  . LEU A 1 36  ? -2.083  -15.830 25.959  1.00 75.05  ? 397 LEU A HB2  1 
ATOM   577  H  HB3  . LEU A 1 36  ? -2.993  -15.130 24.871  1.00 75.05  ? 397 LEU A HB3  1 
ATOM   578  H  HG   . LEU A 1 36  ? -0.203  -15.478 24.694  1.00 90.85  ? 397 LEU A HG   1 
ATOM   579  H  HD11 . LEU A 1 36  ? -0.679  -16.777 22.818  1.00 74.42  ? 397 LEU A HD11 1 
ATOM   580  H  HD12 . LEU A 1 36  ? -1.392  -17.381 24.104  1.00 74.42  ? 397 LEU A HD12 1 
ATOM   581  H  HD13 . LEU A 1 36  ? -2.233  -16.539 23.051  1.00 74.42  ? 397 LEU A HD13 1 
ATOM   582  H  HD21 . LEU A 1 36  ? -0.253  -14.382 22.644  1.00 73.56  ? 397 LEU A HD21 1 
ATOM   583  H  HD22 . LEU A 1 36  ? -1.792  -14.048 22.860  1.00 73.56  ? 397 LEU A HD22 1 
ATOM   584  H  HD23 . LEU A 1 36  ? -0.696  -13.393 23.806  1.00 73.56  ? 397 LEU A HD23 1 
ATOM   585  N  N    . GLN A 1 37  ? -4.405  -13.371 26.377  1.00 63.88  ? 398 GLN A N    1 
ATOM   586  C  CA   . GLN A 1 37  ? -5.641  -13.177 27.117  1.00 58.90  ? 398 GLN A CA   1 
ATOM   587  C  C    . GLN A 1 37  ? -6.175  -14.510 27.626  1.00 73.21  ? 398 GLN A C    1 
ATOM   588  O  O    . GLN A 1 37  ? -6.476  -15.408 26.840  1.00 58.66  ? 398 GLN A O    1 
ATOM   589  C  CB   . GLN A 1 37  ? -6.684  -12.485 26.238  1.00 59.46  ? 398 GLN A CB   1 
ATOM   590  C  CG   . GLN A 1 37  ? -8.041  -12.278 26.903  1.00 80.81  ? 398 GLN A CG   1 
ATOM   591  C  CD   . GLN A 1 37  ? -7.959  -11.452 28.174  1.00 95.17  ? 398 GLN A CD   1 
ATOM   592  O  OE1  . GLN A 1 37  ? -7.018  -10.681 28.370  1.00 92.27  ? 398 GLN A OE1  1 
ATOM   593  N  NE2  . GLN A 1 37  ? -8.949  -11.613 29.048  1.00 100.39 ? 398 GLN A NE2  1 
ATOM   594  H  H    . GLN A 1 37  ? -4.496  -13.311 25.524  1.00 76.66  ? 398 GLN A H    1 
ATOM   595  H  HA   . GLN A 1 37  ? -5.467  -12.609 27.883  1.00 70.68  ? 398 GLN A HA   1 
ATOM   596  H  HB2  . GLN A 1 37  ? -6.345  -11.612 25.984  1.00 71.35  ? 398 GLN A HB2  1 
ATOM   597  H  HB3  . GLN A 1 37  ? -6.826  -13.023 25.443  1.00 71.35  ? 398 GLN A HB3  1 
ATOM   598  H  HG2  . GLN A 1 37  ? -8.628  -11.816 26.284  1.00 96.98  ? 398 GLN A HG2  1 
ATOM   599  H  HG3  . GLN A 1 37  ? -8.416  -13.143 27.132  1.00 96.98  ? 398 GLN A HG3  1 
ATOM   600  H  HE21 . GLN A 1 37  ? -9.589  -12.161 28.876  1.00 120.47 ? 398 GLN A HE21 1 
ATOM   601  H  HE22 . GLN A 1 37  ? -8.949  -11.168 29.784  1.00 120.47 ? 398 GLN A HE22 1 
ATOM   602  N  N    . GLY A 1 38  ? -6.282  -14.630 28.947  1.00 61.09  ? 399 GLY A N    1 
ATOM   603  C  CA   . GLY A 1 38  ? -6.833  -15.821 29.568  1.00 72.93  ? 399 GLY A CA   1 
ATOM   604  C  C    . GLY A 1 38  ? -8.347  -15.822 29.485  1.00 64.18  ? 399 GLY A C    1 
ATOM   605  O  O    . GLY A 1 38  ? -8.946  -14.875 28.981  1.00 66.14  ? 399 GLY A O    1 
ATOM   606  H  H    . GLY A 1 38  ? -6.039  -14.025 29.509  1.00 73.31  ? 399 GLY A H    1 
ATOM   607  H  HA2  . GLY A 1 38  ? -6.495  -16.611 29.120  1.00 87.52  ? 399 GLY A HA2  1 
ATOM   608  H  HA3  . GLY A 1 38  ? -6.572  -15.855 30.502  1.00 87.52  ? 399 GLY A HA3  1 
ATOM   609  N  N    . LYS A 1 39  ? -8.973  -16.883 29.984  1.00 76.18  ? 400 LYS A N    1 
ATOM   610  C  CA   . LYS A 1 39  ? -10.425 -16.999 29.927  1.00 70.84  ? 400 LYS A CA   1 
ATOM   611  C  C    . LYS A 1 39  ? -11.094 -16.322 31.124  1.00 75.61  ? 400 LYS A C    1 
ATOM   612  O  O    . LYS A 1 39  ? -10.687 -16.501 32.270  1.00 64.40  ? 400 LYS A O    1 
ATOM   613  C  CB   . LYS A 1 39  ? -10.827 -18.471 29.830  1.00 74.72  ? 400 LYS A CB   1 
ATOM   614  C  CG   . LYS A 1 39  ? -10.910 -18.945 28.377  1.00 66.18  ? 400 LYS A CG   1 
ATOM   615  C  CD   . LYS A 1 39  ? -10.898 -20.456 28.246  1.00 94.41  ? 400 LYS A CD   1 
ATOM   616  C  CE   . LYS A 1 39  ? -10.878 -20.871 26.780  1.00 98.16  ? 400 LYS A CE   1 
ATOM   617  N  NZ   . LYS A 1 39  ? -10.659 -22.333 26.609  1.00 109.20 ? 400 LYS A NZ   1 
ATOM   618  H  H    . LYS A 1 39  ? -8.579  -17.549 30.360  1.00 91.42  ? 400 LYS A H    1 
ATOM   619  H  HA   . LYS A 1 39  ? -10.740 -16.554 29.125  1.00 85.00  ? 400 LYS A HA   1 
ATOM   620  H  HB2  . LYS A 1 39  ? -10.167 -19.013 30.289  1.00 89.66  ? 400 LYS A HB2  1 
ATOM   621  H  HB3  . LYS A 1 39  ? -11.700 -18.591 30.238  1.00 89.66  ? 400 LYS A HB3  1 
ATOM   622  H  HG2  . LYS A 1 39  ? -11.734 -18.618 27.984  1.00 79.42  ? 400 LYS A HG2  1 
ATOM   623  H  HG3  . LYS A 1 39  ? -10.148 -18.597 27.888  1.00 79.42  ? 400 LYS A HG3  1 
ATOM   624  H  HD2  . LYS A 1 39  ? -10.103 -20.811 28.675  1.00 113.29 ? 400 LYS A HD2  1 
ATOM   625  H  HD3  . LYS A 1 39  ? -11.696 -20.822 28.657  1.00 113.29 ? 400 LYS A HD3  1 
ATOM   626  H  HE2  . LYS A 1 39  ? -11.730 -20.645 26.375  1.00 117.80 ? 400 LYS A HE2  1 
ATOM   627  H  HE3  . LYS A 1 39  ? -10.159 -20.403 26.327  1.00 117.80 ? 400 LYS A HE3  1 
ATOM   628  H  HZ1  . LYS A 1 39  ? -9.879  -22.567 26.968  1.00 131.04 ? 400 LYS A HZ1  1 
ATOM   629  H  HZ2  . LYS A 1 39  ? -11.310 -22.787 27.012  1.00 131.04 ? 400 LYS A HZ2  1 
ATOM   630  H  HZ3  . LYS A 1 39  ? -10.653 -22.540 25.744  1.00 131.04 ? 400 LYS A HZ3  1 
ATOM   631  N  N    . ASP A 1 40  ? -12.123 -15.533 30.835  1.00 67.74  ? 401 ASP A N    1 
ATOM   632  C  CA   . ASP A 1 40  ? -12.786 -14.727 31.850  1.00 61.83  ? 401 ASP A CA   1 
ATOM   633  C  C    . ASP A 1 40  ? -13.706 -15.542 32.744  1.00 63.61  ? 401 ASP A C    1 
ATOM   634  O  O    . ASP A 1 40  ? -14.269 -16.556 32.331  1.00 57.22  ? 401 ASP A O    1 
ATOM   635  C  CB   . ASP A 1 40  ? -13.596 -13.603 31.198  1.00 71.35  ? 401 ASP A CB   1 
ATOM   636  C  CG   . ASP A 1 40  ? -14.443 -12.836 32.205  1.00 83.85  ? 401 ASP A CG   1 
ATOM   637  O  OD1  . ASP A 1 40  ? -13.909 -11.903 32.840  1.00 78.62  ? 401 ASP A OD1  1 
ATOM   638  O  OD2  . ASP A 1 40  ? -15.638 -13.171 32.369  1.00 67.12  ? 401 ASP A OD2  1 
ATOM   639  H  H    . ASP A 1 40  ? -12.459 -15.447 30.048  1.00 81.29  ? 401 ASP A H    1 
ATOM   640  H  HA   . ASP A 1 40  ? -12.111 -14.318 32.414  1.00 74.19  ? 401 ASP A HA   1 
ATOM   641  H  HB2  . ASP A 1 40  ? -12.987 -12.976 30.778  1.00 85.62  ? 401 ASP A HB2  1 
ATOM   642  H  HB3  . ASP A 1 40  ? -14.191 -13.985 30.534  1.00 85.62  ? 401 ASP A HB3  1 
ATOM   643  N  N    . THR A 1 41  ? -13.846 -15.073 33.979  1.00 57.38  ? 402 THR A N    1 
ATOM   644  C  CA   . THR A 1 41  ? -14.849 -15.580 34.893  1.00 57.61  ? 402 THR A CA   1 
ATOM   645  C  C    . THR A 1 41  ? -15.447 -14.394 35.660  1.00 78.17  ? 402 THR A C    1 
ATOM   646  O  O    . THR A 1 41  ? -14.872 -13.303 35.675  1.00 56.68  ? 402 THR A O    1 
ATOM   647  C  CB   . THR A 1 41  ? -14.254 -16.626 35.861  1.00 85.53  ? 402 THR A CB   1 
ATOM   648  O  OG1  . THR A 1 41  ? -15.262 -17.070 36.778  1.00 85.73  ? 402 THR A OG1  1 
ATOM   649  C  CG2  . THR A 1 41  ? -13.071 -16.048 36.634  1.00 74.76  ? 402 THR A CG2  1 
ATOM   650  H  H    . THR A 1 41  ? -13.359 -14.448 34.313  1.00 68.85  ? 402 THR A H    1 
ATOM   651  H  HA   . THR A 1 41  ? -15.560 -16.004 34.386  1.00 69.13  ? 402 THR A HA   1 
ATOM   652  H  HB   . THR A 1 41  ? -13.935 -17.386 35.349  1.00 102.63 ? 402 THR A HB   1 
ATOM   653  H  HG1  . THR A 1 41  ? -15.552 -16.419 37.223  1.00 102.87 ? 402 THR A HG1  1 
ATOM   654  H  HG21 . THR A 1 41  ? -12.710 -16.717 37.236  1.00 89.71  ? 402 THR A HG21 1 
ATOM   655  H  HG22 . THR A 1 41  ? -12.376 -15.771 36.017  1.00 89.71  ? 402 THR A HG22 1 
ATOM   656  H  HG23 . THR A 1 41  ? -13.358 -15.280 37.152  1.00 89.71  ? 402 THR A HG23 1 
ATOM   657  N  N    . TYR A 1 42  ? -16.610 -14.601 36.271  1.00 56.14  ? 403 TYR A N    1 
ATOM   658  C  CA   . TYR A 1 42  ? -17.273 -13.555 37.045  1.00 55.29  ? 403 TYR A CA   1 
ATOM   659  C  C    . TYR A 1 42  ? -16.507 -13.290 38.348  1.00 65.68  ? 403 TYR A C    1 
ATOM   660  O  O    . TYR A 1 42  ? -15.950 -12.208 38.534  1.00 63.84  ? 403 TYR A O    1 
ATOM   661  C  CB   . TYR A 1 42  ? -18.725 -13.949 37.328  1.00 54.01  ? 403 TYR A CB   1 
ATOM   662  C  CG   . TYR A 1 42  ? -19.534 -12.891 38.053  1.00 52.85  ? 403 TYR A CG   1 
ATOM   663  C  CD1  . TYR A 1 42  ? -19.560 -11.579 37.602  1.00 51.04  ? 403 TYR A CD1  1 
ATOM   664  C  CD2  . TYR A 1 42  ? -20.283 -13.211 39.179  1.00 59.50  ? 403 TYR A CD2  1 
ATOM   665  C  CE1  . TYR A 1 42  ? -20.297 -10.613 38.254  1.00 49.93  ? 403 TYR A CE1  1 
ATOM   666  C  CE2  . TYR A 1 42  ? -21.031 -12.247 39.844  1.00 57.61  ? 403 TYR A CE2  1 
ATOM   667  C  CZ   . TYR A 1 42  ? -21.032 -10.948 39.376  1.00 50.56  ? 403 TYR A CZ   1 
ATOM   668  O  OH   . TYR A 1 42  ? -21.764 -9.975  40.022  1.00 49.40  ? 403 TYR A OH   1 
ATOM   669  H  H    . TYR A 1 42  ? -17.039 -15.346 36.252  1.00 67.36  ? 403 TYR A H    1 
ATOM   670  H  HA   . TYR A 1 42  ? -17.280 -12.734 36.527  1.00 66.35  ? 403 TYR A HA   1 
ATOM   671  H  HB2  . TYR A 1 42  ? -19.168 -14.130 36.485  1.00 64.81  ? 403 TYR A HB2  1 
ATOM   672  H  HB3  . TYR A 1 42  ? -18.728 -14.749 37.877  1.00 64.81  ? 403 TYR A HB3  1 
ATOM   673  H  HD1  . TYR A 1 42  ? -19.067 -11.346 36.849  1.00 61.25  ? 403 TYR A HD1  1 
ATOM   674  H  HD2  . TYR A 1 42  ? -20.281 -14.086 39.495  1.00 71.40  ? 403 TYR A HD2  1 
ATOM   675  H  HE1  . TYR A 1 42  ? -20.299 -9.738  37.940  1.00 59.92  ? 403 TYR A HE1  1 
ATOM   676  H  HE2  . TYR A 1 42  ? -21.524 -12.474 40.599  1.00 69.13  ? 403 TYR A HE2  1 
ATOM   677  H  HH   . TYR A 1 42  ? -22.161 -10.307 40.684  1.00 59.28  ? 403 TYR A HH   1 
ATOM   678  N  N    . LEU A 1 43  ? -16.474 -14.277 39.238  1.00 59.92  ? 404 LEU A N    1 
ATOM   679  C  CA   . LEU A 1 43  ? -15.620 -14.213 40.428  1.00 62.72  ? 404 LEU A CA   1 
ATOM   680  C  C    . LEU A 1 43  ? -14.411 -15.127 40.270  1.00 65.09  ? 404 LEU A C    1 
ATOM   681  O  O    . LEU A 1 43  ? -14.430 -16.075 39.482  1.00 67.98  ? 404 LEU A O    1 
ATOM   682  C  CB   . LEU A 1 43  ? -16.388 -14.616 41.688  1.00 67.75  ? 404 LEU A CB   1 
ATOM   683  C  CG   . LEU A 1 43  ? -17.689 -13.879 41.989  1.00 61.56  ? 404 LEU A CG   1 
ATOM   684  C  CD1  . LEU A 1 43  ? -18.322 -14.454 43.244  1.00 62.96  ? 404 LEU A CD1  1 
ATOM   685  C  CD2  . LEU A 1 43  ? -17.456 -12.386 42.136  1.00 64.98  ? 404 LEU A CD2  1 
ATOM   686  H  H    . LEU A 1 43  ? -16.937 -14.998 39.179  1.00 71.91  ? 404 LEU A H    1 
ATOM   687  H  HA   . LEU A 1 43  ? -15.301 -13.305 40.544  1.00 75.27  ? 404 LEU A HA   1 
ATOM   688  H  HB2  . LEU A 1 43  ? -16.606 -15.558 41.617  1.00 81.29  ? 404 LEU A HB2  1 
ATOM   689  H  HB3  . LEU A 1 43  ? -15.803 -14.482 42.450  1.00 81.29  ? 404 LEU A HB3  1 
ATOM   690  H  HG   . LEU A 1 43  ? -18.306 -14.015 41.253  1.00 73.87  ? 404 LEU A HG   1 
ATOM   691  H  HD11 . LEU A 1 43  ? -19.148 -13.980 43.426  1.00 75.55  ? 404 LEU A HD11 1 
ATOM   692  H  HD12 . LEU A 1 43  ? -18.506 -15.396 43.100  1.00 75.55  ? 404 LEU A HD12 1 
ATOM   693  H  HD13 . LEU A 1 43  ? -17.707 -14.346 43.986  1.00 75.55  ? 404 LEU A HD13 1 
ATOM   694  H  HD21 . LEU A 1 43  ? -18.302 -11.952 42.326  1.00 77.97  ? 404 LEU A HD21 1 
ATOM   695  H  HD22 . LEU A 1 43  ? -16.834 -12.234 42.864  1.00 77.97  ? 404 LEU A HD22 1 
ATOM   696  H  HD23 . LEU A 1 43  ? -17.086 -12.043 41.307  1.00 77.97  ? 404 LEU A HD23 1 
ATOM   697  N  N    . LYS A 1 44  ? -13.357 -14.841 41.027  1.00 91.96  ? 405 LYS A N    1 
ATOM   698  C  CA   . LYS A 1 44  ? -12.214 -15.736 41.088  1.00 94.42  ? 405 LYS A CA   1 
ATOM   699  C  C    . LYS A 1 44  ? -12.681 -17.045 41.713  1.00 98.22  ? 405 LYS A C    1 
ATOM   700  O  O    . LYS A 1 44  ? -13.515 -17.039 42.622  1.00 90.11  ? 405 LYS A O    1 
ATOM   701  C  CB   . LYS A 1 44  ? -11.069 -15.115 41.894  1.00 117.81 ? 405 LYS A CB   1 
ATOM   702  C  CG   . LYS A 1 44  ? -10.558 -13.793 41.330  1.00 134.01 ? 405 LYS A CG   1 
ATOM   703  C  CD   . LYS A 1 44  ? -9.685  -13.051 42.335  1.00 144.13 ? 405 LYS A CD   1 
ATOM   704  C  CE   . LYS A 1 44  ? -9.379  -11.634 41.868  1.00 140.38 ? 405 LYS A CE   1 
ATOM   705  N  NZ   . LYS A 1 44  ? -8.488  -10.904 42.814  1.00 119.93 ? 405 LYS A NZ   1 
ATOM   706  H  H    . LYS A 1 44  ? -13.281 -14.135 41.512  1.00 110.35 ? 405 LYS A H    1 
ATOM   707  H  HA   . LYS A 1 44  ? -11.896 -15.919 40.190  1.00 113.30 ? 405 LYS A HA   1 
ATOM   708  H  HB2  . LYS A 1 44  ? -11.378 -14.950 42.799  1.00 141.38 ? 405 LYS A HB2  1 
ATOM   709  H  HB3  . LYS A 1 44  ? -10.325 -15.737 41.909  1.00 141.38 ? 405 LYS A HB3  1 
ATOM   710  H  HG2  . LYS A 1 44  ? -10.027 -13.968 40.538  1.00 160.81 ? 405 LYS A HG2  1 
ATOM   711  H  HG3  . LYS A 1 44  ? -11.314 -13.227 41.109  1.00 160.81 ? 405 LYS A HG3  1 
ATOM   712  H  HD2  . LYS A 1 44  ? -10.150 -12.998 43.185  1.00 172.95 ? 405 LYS A HD2  1 
ATOM   713  H  HD3  . LYS A 1 44  ? -8.845  -13.525 42.441  1.00 172.95 ? 405 LYS A HD3  1 
ATOM   714  H  HE2  . LYS A 1 44  ? -8.936  -11.673 41.006  1.00 168.45 ? 405 LYS A HE2  1 
ATOM   715  H  HE3  . LYS A 1 44  ? -10.210 -11.139 41.793  1.00 168.45 ? 405 LYS A HE3  1 
ATOM   716  H  HZ1  . LYS A 1 44  ? -8.331  -10.083 42.511  1.00 143.91 ? 405 LYS A HZ1  1 
ATOM   717  H  HZ2  . LYS A 1 44  ? -8.875  -10.848 43.614  1.00 143.91 ? 405 LYS A HZ2  1 
ATOM   718  H  HZ3  . LYS A 1 44  ? -7.714  -11.336 42.897  1.00 143.91 ? 405 LYS A HZ3  1 
ATOM   719  N  N    . GLY A 1 45  ? -12.165 -18.163 41.214  1.00 107.38 ? 406 GLY A N    1 
ATOM   720  C  CA   . GLY A 1 45  ? -12.548 -19.466 41.728  1.00 121.92 ? 406 GLY A CA   1 
ATOM   721  C  C    . GLY A 1 45  ? -11.450 -20.500 41.586  1.00 120.61 ? 406 GLY A C    1 
ATOM   722  O  O    . GLY A 1 45  ? -10.273 -20.162 41.457  1.00 114.72 ? 406 GLY A O    1 
ATOM   723  H  H    . GLY A 1 45  ? -11.589 -18.191 40.576  1.00 128.85 ? 406 GLY A H    1 
ATOM   724  H  HA2  . GLY A 1 45  ? -12.774 -19.387 42.667  1.00 146.31 ? 406 GLY A HA2  1 
ATOM   725  H  HA3  . GLY A 1 45  ? -13.330 -19.783 41.250  1.00 146.31 ? 406 GLY A HA3  1 
ATOM   726  N  N    . LEU A 1 46  ? -11.843 -21.768 41.626  1.00 131.05 ? 407 LEU A N    1 
ATOM   727  C  CA   . LEU A 1 46  ? -10.935 -22.863 41.319  1.00 147.02 ? 407 LEU A CA   1 
ATOM   728  C  C    . LEU A 1 46  ? -10.602 -22.783 39.832  1.00 145.67 ? 407 LEU A C    1 
ATOM   729  O  O    . LEU A 1 46  ? -11.407 -22.261 39.060  1.00 156.09 ? 407 LEU A O    1 
ATOM   730  C  CB   . LEU A 1 46  ? -11.575 -24.207 41.672  1.00 146.59 ? 407 LEU A CB   1 
ATOM   731  C  CG   . LEU A 1 46  ? -10.653 -25.405 41.904  1.00 142.47 ? 407 LEU A CG   1 
ATOM   732  C  CD1  . LEU A 1 46  ? -9.764  -25.189 43.120  1.00 133.36 ? 407 LEU A CD1  1 
ATOM   733  C  CD2  . LEU A 1 46  ? -11.484 -26.667 42.065  1.00 133.11 ? 407 LEU A CD2  1 
ATOM   734  H  H    . LEU A 1 46  ? -12.639 -22.022 41.830  1.00 157.26 ? 407 LEU A H    1 
ATOM   735  H  HA   . LEU A 1 46  ? -10.116 -22.763 41.828  1.00 176.42 ? 407 LEU A HA   1 
ATOM   736  H  HB2  . LEU A 1 46  ? -12.090 -24.087 42.485  1.00 175.90 ? 407 LEU A HB2  1 
ATOM   737  H  HB3  . LEU A 1 46  ? -12.176 -24.450 40.950  1.00 175.90 ? 407 LEU A HB3  1 
ATOM   738  H  HG   . LEU A 1 46  ? -10.080 -25.519 41.129  1.00 170.97 ? 407 LEU A HG   1 
ATOM   739  H  HD11 . LEU A 1 46  ? -9.194  -25.965 43.237  1.00 160.03 ? 407 LEU A HD11 1 
ATOM   740  H  HD12 . LEU A 1 46  ? -9.221  -24.398 42.977  1.00 160.03 ? 407 LEU A HD12 1 
ATOM   741  H  HD13 . LEU A 1 46  ? -10.324 -25.068 43.903  1.00 160.03 ? 407 LEU A HD13 1 
ATOM   742  H  HD21 . LEU A 1 46  ? -10.890 -27.420 42.211  1.00 159.73 ? 407 LEU A HD21 1 
ATOM   743  H  HD22 . LEU A 1 46  ? -12.076 -26.560 42.826  1.00 159.73 ? 407 LEU A HD22 1 
ATOM   744  H  HD23 . LEU A 1 46  ? -12.004 -26.808 41.258  1.00 159.73 ? 407 LEU A HD23 1 
ATOM   745  N  N    . VAL A 1 47  ? -9.426  -23.275 39.435  1.00 136.83 ? 408 VAL A N    1 
ATOM   746  C  CA   . VAL A 1 47  ? -8.980  -23.209 38.037  1.00 121.77 ? 408 VAL A CA   1 
ATOM   747  C  C    . VAL A 1 47  ? -8.769  -21.743 37.621  1.00 128.40 ? 408 VAL A C    1 
ATOM   748  O  O    . VAL A 1 47  ? -9.223  -20.826 38.304  1.00 134.64 ? 408 VAL A O    1 
ATOM   749  C  CB   . VAL A 1 47  ? -10.003 -23.930 37.090  1.00 127.13 ? 408 VAL A CB   1 
ATOM   750  C  CG1  . VAL A 1 47  ? -9.740  -23.641 35.614  1.00 130.69 ? 408 VAL A CG1  1 
ATOM   751  C  CG2  . VAL A 1 47  ? -9.986  -25.428 37.340  1.00 121.82 ? 408 VAL A CG2  1 
ATOM   752  H  H    . VAL A 1 47  ? -8.862  -23.656 39.960  1.00 164.20 ? 408 VAL A H    1 
ATOM   753  H  HA   . VAL A 1 47  ? -8.129  -23.667 37.958  1.00 146.12 ? 408 VAL A HA   1 
ATOM   754  H  HB   . VAL A 1 47  ? -10.895 -23.609 37.297  1.00 152.55 ? 408 VAL A HB   1 
ATOM   755  H  HG11 . VAL A 1 47  ? -10.399 -24.111 35.078  1.00 156.83 ? 408 VAL A HG11 1 
ATOM   756  H  HG12 . VAL A 1 47  ? -9.809  -22.686 35.462  1.00 156.83 ? 408 VAL A HG12 1 
ATOM   757  H  HG13 . VAL A 1 47  ? -8.848  -23.949 35.386  1.00 156.83 ? 408 VAL A HG13 1 
ATOM   758  H  HG21 . VAL A 1 47  ? -10.623 -25.854 36.746  1.00 146.18 ? 408 VAL A HG21 1 
ATOM   759  H  HG22 . VAL A 1 47  ? -9.094  -25.766 37.166  1.00 146.18 ? 408 VAL A HG22 1 
ATOM   760  H  HG23 . VAL A 1 47  ? -10.230 -25.596 38.264  1.00 146.18 ? 408 VAL A HG23 1 
ATOM   761  N  N    . LYS A 1 48  ? -8.044  -21.523 36.527  1.00 151.19 ? 409 LYS A N    1 
ATOM   762  C  CA   . LYS A 1 48  ? -7.847  -20.174 35.990  1.00 152.90 ? 409 LYS A CA   1 
ATOM   763  C  C    . LYS A 1 48  ? -8.354  -20.079 34.548  1.00 143.38 ? 409 LYS A C    1 
ATOM   764  O  O    . LYS A 1 48  ? -8.618  -18.988 34.038  1.00 148.91 ? 409 LYS A O    1 
ATOM   765  C  CB   . LYS A 1 48  ? -6.364  -19.779 36.077  1.00 151.06 ? 409 LYS A CB   1 
ATOM   766  C  CG   . LYS A 1 48  ? -5.960  -18.547 35.264  1.00 151.53 ? 409 LYS A CG   1 
ATOM   767  C  CD   . LYS A 1 48  ? -6.792  -17.304 35.587  1.00 149.32 ? 409 LYS A CD   1 
ATOM   768  C  CE   . LYS A 1 48  ? -6.808  -16.338 34.409  1.00 148.26 ? 409 LYS A CE   1 
ATOM   769  N  NZ   . LYS A 1 48  ? -7.851  -15.283 34.545  1.00 140.51 ? 409 LYS A NZ   1 
ATOM   770  H  H    . LYS A 1 48  ? -7.652  -22.140 36.073  1.00 181.43 ? 409 LYS A H    1 
ATOM   771  H  HA   . LYS A 1 48  ? -8.354  -19.546 36.526  1.00 183.48 ? 409 LYS A HA   1 
ATOM   772  H  HB2  . LYS A 1 48  ? -6.150  -19.598 37.006  1.00 181.27 ? 409 LYS A HB2  1 
ATOM   773  H  HB3  . LYS A 1 48  ? -5.830  -20.524 35.761  1.00 181.27 ? 409 LYS A HB3  1 
ATOM   774  H  HG2  . LYS A 1 48  ? -5.031  -18.339 35.450  1.00 181.83 ? 409 LYS A HG2  1 
ATOM   775  H  HG3  . LYS A 1 48  ? -6.072  -18.743 34.321  1.00 181.83 ? 409 LYS A HG3  1 
ATOM   776  H  HD2  . LYS A 1 48  ? -7.706  -17.569 35.777  1.00 179.19 ? 409 LYS A HD2  1 
ATOM   777  H  HD3  . LYS A 1 48  ? -6.406  -16.848 36.351  1.00 179.19 ? 409 LYS A HD3  1 
ATOM   778  H  HE2  . LYS A 1 48  ? -5.945  -15.901 34.347  1.00 177.91 ? 409 LYS A HE2  1 
ATOM   779  H  HE3  . LYS A 1 48  ? -6.988  -16.835 33.595  1.00 177.91 ? 409 LYS A HE3  1 
ATOM   780  H  HZ1  . LYS A 1 48  ? -7.828  -14.740 33.840  1.00 168.61 ? 409 LYS A HZ1  1 
ATOM   781  H  HZ2  . LYS A 1 48  ? -8.657  -15.656 34.597  1.00 168.61 ? 409 LYS A HZ2  1 
ATOM   782  H  HZ3  . LYS A 1 48  ? -7.706  -14.805 35.282  1.00 168.61 ? 409 LYS A HZ3  1 
ATOM   783  N  N    . GLY A 1 49  ? -8.506  -21.230 33.902  1.00 131.84 ? 410 GLY A N    1 
ATOM   784  C  CA   . GLY A 1 49  ? -8.975  -21.284 32.531  1.00 126.68 ? 410 GLY A CA   1 
ATOM   785  C  C    . GLY A 1 49  ? -7.905  -21.873 31.643  1.00 116.11 ? 410 GLY A C    1 
ATOM   786  O  O    . GLY A 1 49  ? -6.819  -21.310 31.500  1.00 121.06 ? 410 GLY A O    1 
ATOM   787  H  H    . GLY A 1 49  ? -8.340  -22.001 34.244  1.00 158.21 ? 410 GLY A H    1 
ATOM   788  H  HA2  . GLY A 1 49  ? -9.771  -21.835 32.475  1.00 152.02 ? 410 GLY A HA2  1 
ATOM   789  H  HA3  . GLY A 1 49  ? -9.188  -20.391 32.218  1.00 152.02 ? 410 GLY A HA3  1 
ATOM   790  N  N    . LYS A 1 50  ? -8.216  -23.016 31.045  1.00 112.62 ? 411 LYS A N    1 
ATOM   791  C  CA   . LYS A 1 50  ? -7.239  -23.758 30.265  1.00 116.54 ? 411 LYS A CA   1 
ATOM   792  C  C    . LYS A 1 50  ? -7.197  -23.253 28.829  1.00 96.68  ? 411 LYS A C    1 
ATOM   793  O  O    . LYS A 1 50  ? -8.050  -23.590 28.009  1.00 105.44 ? 411 LYS A O    1 
ATOM   794  C  CB   . LYS A 1 50  ? -7.559  -25.251 30.323  1.00 123.54 ? 411 LYS A CB   1 
ATOM   795  C  CG   . LYS A 1 50  ? -7.512  -25.780 31.750  1.00 137.51 ? 411 LYS A CG   1 
ATOM   796  C  CD   . LYS A 1 50  ? -7.898  -27.240 31.872  1.00 139.67 ? 411 LYS A CD   1 
ATOM   797  C  CE   . LYS A 1 50  ? -7.826  -27.674 33.331  1.00 134.03 ? 411 LYS A CE   1 
ATOM   798  N  NZ   . LYS A 1 50  ? -8.133  -29.114 33.536  1.00 128.30 ? 411 LYS A NZ   1 
ATOM   799  H  H    . LYS A 1 50  ? -8.992  -23.385 31.077  1.00 135.14 ? 411 LYS A H    1 
ATOM   800  H  HA   . LYS A 1 50  ? -6.360  -23.626 30.654  1.00 139.85 ? 411 LYS A HA   1 
ATOM   801  H  HB2  . LYS A 1 50  ? -8.451  -25.401 29.973  1.00 148.25 ? 411 LYS A HB2  1 
ATOM   802  H  HB3  . LYS A 1 50  ? -6.906  -25.739 29.797  1.00 148.25 ? 411 LYS A HB3  1 
ATOM   803  H  HG2  . LYS A 1 50  ? -6.609  -25.682 32.090  1.00 165.01 ? 411 LYS A HG2  1 
ATOM   804  H  HG3  . LYS A 1 50  ? -8.126  -25.263 32.295  1.00 165.01 ? 411 LYS A HG3  1 
ATOM   805  H  HD2  . LYS A 1 50  ? -8.807  -27.363 31.557  1.00 167.60 ? 411 LYS A HD2  1 
ATOM   806  H  HD3  . LYS A 1 50  ? -7.282  -27.783 31.357  1.00 167.60 ? 411 LYS A HD3  1 
ATOM   807  H  HE2  . LYS A 1 50  ? -6.929  -27.511 33.663  1.00 160.83 ? 411 LYS A HE2  1 
ATOM   808  H  HE3  . LYS A 1 50  ? -8.467  -27.158 33.844  1.00 160.83 ? 411 LYS A HE3  1 
ATOM   809  H  HZ1  . LYS A 1 50  ? -8.078  -29.317 34.401  1.00 153.96 ? 411 LYS A HZ1  1 
ATOM   810  H  HZ2  . LYS A 1 50  ? -8.956  -29.294 33.249  1.00 153.96 ? 411 LYS A HZ2  1 
ATOM   811  H  HZ3  . LYS A 1 50  ? -7.553  -29.616 33.084  1.00 153.96 ? 411 LYS A HZ3  1 
ATOM   812  N  N    . SER A 1 51  ? -6.195  -22.424 28.552  1.00 66.49  ? 412 SER A N    1 
ATOM   813  C  CA   . SER A 1 51  ? -5.991  -21.851 27.231  1.00 77.94  ? 412 SER A CA   1 
ATOM   814  C  C    . SER A 1 51  ? -4.994  -22.677 26.429  1.00 78.65  ? 412 SER A C    1 
ATOM   815  O  O    . SER A 1 51  ? -3.936  -23.042 26.938  1.00 85.34  ? 412 SER A O    1 
ATOM   816  C  CB   . SER A 1 51  ? -5.500  -20.409 27.354  1.00 86.65  ? 412 SER A CB   1 
ATOM   817  O  OG   . SER A 1 51  ? -6.355  -19.656 28.195  1.00 86.16  ? 412 SER A OG   1 
ATOM   818  H  H    . SER A 1 51  ? -5.607  -22.175 29.128  1.00 79.79  ? 412 SER A H    1 
ATOM   819  H  HA   . SER A 1 51  ? -6.834  -21.844 26.751  1.00 93.53  ? 412 SER A HA   1 
ATOM   820  H  HB2  . SER A 1 51  ? -4.607  -20.412 27.733  1.00 103.98 ? 412 SER A HB2  1 
ATOM   821  H  HB3  . SER A 1 51  ? -5.486  -20.004 26.473  1.00 103.98 ? 412 SER A HB3  1 
ATOM   822  H  HG   . SER A 1 51  ? -7.133  -19.646 27.878  1.00 103.39 ? 412 SER A HG   1 
ATOM   823  N  N    . ASP A 1 52  ? -5.332  -22.963 25.174  1.00 76.27  ? 413 ASP A N    1 
ATOM   824  C  CA   . ASP A 1 52  ? -4.503  -23.813 24.323  1.00 63.21  ? 413 ASP A CA   1 
ATOM   825  C  C    . ASP A 1 52  ? -4.214  -23.131 22.984  1.00 80.83  ? 413 ASP A C    1 
ATOM   826  O  O    . ASP A 1 52  ? -4.852  -23.443 21.983  1.00 59.60  ? 413 ASP A O    1 
ATOM   827  C  CB   . ASP A 1 52  ? -5.194  -25.163 24.104  1.00 63.05  ? 413 ASP A CB   1 
ATOM   828  C  CG   . ASP A 1 52  ? -5.629  -25.809 25.410  1.00 85.15  ? 413 ASP A CG   1 
ATOM   829  O  OD1  . ASP A 1 52  ? -4.810  -25.844 26.351  1.00 90.33  ? 413 ASP A OD1  1 
ATOM   830  O  OD2  . ASP A 1 52  ? -6.789  -26.269 25.503  1.00 63.90  ? 413 ASP A OD2  1 
ATOM   831  H  H    . ASP A 1 52  ? -6.045  -22.674 24.788  1.00 91.53  ? 413 ASP A H    1 
ATOM   832  H  HA   . ASP A 1 52  ? -3.656  -23.976 24.766  1.00 75.85  ? 413 ASP A HA   1 
ATOM   833  H  HB2  . ASP A 1 52  ? -5.983  -25.030 23.556  1.00 75.65  ? 413 ASP A HB2  1 
ATOM   834  H  HB3  . ASP A 1 52  ? -4.577  -25.767 23.661  1.00 75.65  ? 413 ASP A HB3  1 
ATOM   835  N  N    . PRO A 1 53  ? -3.240  -22.203 22.962  1.00 67.09  ? 414 PRO A N    1 
ATOM   836  C  CA   . PRO A 1 53  ? -3.087  -21.336 21.790  1.00 64.47  ? 414 PRO A CA   1 
ATOM   837  C  C    . PRO A 1 53  ? -2.481  -22.003 20.556  1.00 62.88  ? 414 PRO A C    1 
ATOM   838  O  O    . PRO A 1 53  ? -1.666  -22.920 20.644  1.00 64.01  ? 414 PRO A O    1 
ATOM   839  C  CB   . PRO A 1 53  ? -2.154  -20.223 22.291  1.00 65.41  ? 414 PRO A CB   1 
ATOM   840  C  CG   . PRO A 1 53  ? -2.155  -20.334 23.778  1.00 69.64  ? 414 PRO A CG   1 
ATOM   841  C  CD   . PRO A 1 53  ? -2.355  -21.782 24.059  1.00 76.95  ? 414 PRO A CD   1 
ATOM   842  H  HA   . PRO A 1 53  ? -3.943  -20.947 21.550  1.00 77.36  ? 414 PRO A HA   1 
ATOM   843  H  HB2  . PRO A 1 53  ? -1.261  -20.364 21.939  1.00 78.50  ? 414 PRO A HB2  1 
ATOM   844  H  HB3  . PRO A 1 53  ? -2.499  -19.360 22.013  1.00 78.50  ? 414 PRO A HB3  1 
ATOM   845  H  HG2  . PRO A 1 53  ? -1.303  -20.030 24.129  1.00 83.57  ? 414 PRO A HG2  1 
ATOM   846  H  HG3  . PRO A 1 53  ? -2.884  -19.809 24.144  1.00 83.57  ? 414 PRO A HG3  1 
ATOM   847  H  HD2  . PRO A 1 53  ? -1.510  -22.256 24.016  1.00 92.34  ? 414 PRO A HD2  1 
ATOM   848  H  HD3  . PRO A 1 53  ? -2.792  -21.905 24.916  1.00 92.34  ? 414 PRO A HD3  1 
ATOM   849  N  N    . TYR A 1 54  ? -2.907  -21.519 19.399  1.00 60.48  ? 415 TYR A N    1 
ATOM   850  C  CA   . TYR A 1 54  ? -2.290  -21.871 18.124  1.00 58.85  ? 415 TYR A CA   1 
ATOM   851  C  C    . TYR A 1 54  ? -2.529  -20.722 17.160  1.00 59.42  ? 415 TYR A C    1 
ATOM   852  O  O    . TYR A 1 54  ? -3.346  -19.836 17.432  1.00 56.83  ? 415 TYR A O    1 
ATOM   853  C  CB   . TYR A 1 54  ? -2.851  -23.182 17.577  1.00 58.49  ? 415 TYR A CB   1 
ATOM   854  C  CG   . TYR A 1 54  ? -4.276  -23.087 17.085  1.00 59.89  ? 415 TYR A CG   1 
ATOM   855  C  CD1  . TYR A 1 54  ? -5.333  -23.051 17.976  1.00 58.48  ? 415 TYR A CD1  1 
ATOM   856  C  CD2  . TYR A 1 54  ? -4.565  -23.044 15.723  1.00 65.55  ? 415 TYR A CD2  1 
ATOM   857  C  CE1  . TYR A 1 54  ? -6.636  -22.968 17.540  1.00 57.76  ? 415 TYR A CE1  1 
ATOM   858  C  CE2  . TYR A 1 54  ? -5.872  -22.959 15.274  1.00 64.43  ? 415 TYR A CE2  1 
ATOM   859  C  CZ   . TYR A 1 54  ? -6.903  -22.922 16.193  1.00 67.04  ? 415 TYR A CZ   1 
ATOM   860  O  OH   . TYR A 1 54  ? -8.213  -22.838 15.792  1.00 61.72  ? 415 TYR A OH   1 
ATOM   861  H  H    . TYR A 1 54  ? -3.567  -20.972 19.322  1.00 72.58  ? 415 TYR A H    1 
ATOM   862  H  HA   . TYR A 1 54  ? -1.334  -21.974 18.246  1.00 70.62  ? 415 TYR A HA   1 
ATOM   863  H  HB2  . TYR A 1 54  ? -2.300  -23.470 16.833  1.00 70.19  ? 415 TYR A HB2  1 
ATOM   864  H  HB3  . TYR A 1 54  ? -2.825  -23.849 18.281  1.00 70.19  ? 415 TYR A HB3  1 
ATOM   865  H  HD1  . TYR A 1 54  ? -5.160  -23.081 18.889  1.00 70.17  ? 415 TYR A HD1  1 
ATOM   866  H  HD2  . TYR A 1 54  ? -3.869  -23.068 15.106  1.00 78.66  ? 415 TYR A HD2  1 
ATOM   867  H  HE1  . TYR A 1 54  ? -7.334  -22.942 18.155  1.00 69.32  ? 415 TYR A HE1  1 
ATOM   868  H  HE2  . TYR A 1 54  ? -6.054  -22.929 14.363  1.00 77.32  ? 415 TYR A HE2  1 
ATOM   869  H  HH   . TYR A 1 54  ? -8.719  -22.824 16.463  1.00 74.06  ? 415 TYR A HH   1 
ATOM   870  N  N    . GLY A 1 55  ? -1.813  -20.731 16.037  1.00 57.73  ? 416 GLY A N    1 
ATOM   871  C  CA   . GLY A 1 55  ? -1.849  -19.616 15.115  1.00 54.21  ? 416 GLY A CA   1 
ATOM   872  C  C    . GLY A 1 55  ? -2.191  -20.027 13.698  1.00 54.25  ? 416 GLY A C    1 
ATOM   873  O  O    . GLY A 1 55  ? -1.872  -21.140 13.272  1.00 55.04  ? 416 GLY A O    1 
ATOM   874  H  H    . GLY A 1 55  ? -1.298  -21.375 15.792  1.00 69.28  ? 416 GLY A H    1 
ATOM   875  H  HA2  . GLY A 1 55  ? -2.511  -18.974 15.415  1.00 65.05  ? 416 GLY A HA2  1 
ATOM   876  H  HA3  . GLY A 1 55  ? -0.983  -19.180 15.105  1.00 65.05  ? 416 GLY A HA3  1 
ATOM   877  N  N    . ILE A 1 56  ? -2.851  -19.115 12.984  1.00 56.46  ? 417 ILE A N    1 
ATOM   878  C  CA   . ILE A 1 56  ? -3.087  -19.241 11.545  1.00 53.48  ? 417 ILE A CA   1 
ATOM   879  C  C    . ILE A 1 56  ? -2.321  -18.121 10.855  1.00 49.76  ? 417 ILE A C    1 
ATOM   880  O  O    . ILE A 1 56  ? -2.518  -16.943 11.162  1.00 55.51  ? 417 ILE A O    1 
ATOM   881  C  CB   . ILE A 1 56  ? -4.589  -19.161 11.190  1.00 49.70  ? 417 ILE A CB   1 
ATOM   882  C  CG1  . ILE A 1 56  ? -5.372  -20.261 11.913  1.00 58.72  ? 417 ILE A CG1  1 
ATOM   883  C  CG2  . ILE A 1 56  ? -4.813  -19.267 9.666   1.00 48.55  ? 417 ILE A CG2  1 
ATOM   884  C  CD1  . ILE A 1 56  ? -4.945  -21.676 11.536  1.00 50.19  ? 417 ILE A CD1  1 
ATOM   885  H  H    . ILE A 1 56  ? -3.181  -18.395 13.320  1.00 67.76  ? 417 ILE A H    1 
ATOM   886  H  HA   . ILE A 1 56  ? -2.740  -20.091 11.233  1.00 64.18  ? 417 ILE A HA   1 
ATOM   887  H  HB   . ILE A 1 56  ? -4.926  -18.301 11.488  1.00 59.63  ? 417 ILE A HB   1 
ATOM   888  H  HG12 . ILE A 1 56  ? -5.244  -20.158 12.869  1.00 70.47  ? 417 ILE A HG12 1 
ATOM   889  H  HG13 . ILE A 1 56  ? -6.312  -20.168 11.696  1.00 70.47  ? 417 ILE A HG13 1 
ATOM   890  H  HG21 . ILE A 1 56  ? -5.764  -19.213 9.482   1.00 58.26  ? 417 ILE A HG21 1 
ATOM   891  H  HG22 . ILE A 1 56  ? -4.348  -18.537 9.227   1.00 58.26  ? 417 ILE A HG22 1 
ATOM   892  H  HG23 . ILE A 1 56  ? -4.463  -20.117 9.354   1.00 58.26  ? 417 ILE A HG23 1 
ATOM   893  H  HD11 . ILE A 1 56  ? -5.484  -22.311 12.033  1.00 60.23  ? 417 ILE A HD11 1 
ATOM   894  H  HD12 . ILE A 1 56  ? -5.078  -21.803 10.584  1.00 60.23  ? 417 ILE A HD12 1 
ATOM   895  H  HD13 . ILE A 1 56  ? -4.008  -21.792 11.758  1.00 60.23  ? 417 ILE A HD13 1 
ATOM   896  N  N    . ILE A 1 57  ? -1.432  -18.502 9.944   1.00 49.09  ? 418 ILE A N    1 
ATOM   897  C  CA   . ILE A 1 57  ? -0.569  -17.561 9.246   1.00 52.78  ? 418 ILE A CA   1 
ATOM   898  C  C    . ILE A 1 57  ? -0.899  -17.543 7.757   1.00 53.00  ? 418 ILE A C    1 
ATOM   899  O  O    . ILE A 1 57  ? -0.921  -18.591 7.110   1.00 47.20  ? 418 ILE A O    1 
ATOM   900  C  CB   . ILE A 1 57  ? 0.915   -17.924 9.428   1.00 53.63  ? 418 ILE A CB   1 
ATOM   901  C  CG1  . ILE A 1 57  ? 1.263   -18.033 10.917  1.00 62.39  ? 418 ILE A CG1  1 
ATOM   902  C  CG2  . ILE A 1 57  ? 1.806   -16.899 8.742   1.00 49.98  ? 418 ILE A CG2  1 
ATOM   903  C  CD1  . ILE A 1 57  ? 1.080   -19.422 11.485  1.00 76.06  ? 418 ILE A CD1  1 
ATOM   904  H  H    . ILE A 1 57  ? -1.309  -19.320 9.709   1.00 58.91  ? 418 ILE A H    1 
ATOM   905  H  HA   . ILE A 1 57  ? -0.712  -16.670 9.601   1.00 63.34  ? 418 ILE A HA   1 
ATOM   906  H  HB   . ILE A 1 57  ? 1.070   -18.788 9.014   1.00 64.35  ? 418 ILE A HB   1 
ATOM   907  H  HG12 . ILE A 1 57  ? 2.193   -17.783 11.040  1.00 74.86  ? 418 ILE A HG12 1 
ATOM   908  H  HG13 . ILE A 1 57  ? 0.692   -17.430 11.418  1.00 74.86  ? 418 ILE A HG13 1 
ATOM   909  H  HG21 . ILE A 1 57  ? 2.733   -17.150 8.872   1.00 59.98  ? 418 ILE A HG21 1 
ATOM   910  H  HG22 . ILE A 1 57  ? 1.596   -16.882 7.795   1.00 59.98  ? 418 ILE A HG22 1 
ATOM   911  H  HG23 . ILE A 1 57  ? 1.641   -16.026 9.134   1.00 59.98  ? 418 ILE A HG23 1 
ATOM   912  H  HD11 . ILE A 1 57  ? 1.318   -19.413 12.425  1.00 91.27  ? 418 ILE A HD11 1 
ATOM   913  H  HD12 . ILE A 1 57  ? 0.152   -19.685 11.381  1.00 91.27  ? 418 ILE A HD12 1 
ATOM   914  H  HD13 . ILE A 1 57  ? 1.654   -20.038 11.003  1.00 91.27  ? 418 ILE A HD13 1 
ATOM   915  N  N    . ARG A 1 58  ? -1.135  -16.350 7.216   1.00 54.59  ? 419 ARG A N    1 
ATOM   916  C  CA   . ARG A 1 58  ? -1.485  -16.210 5.807   1.00 47.67  ? 419 ARG A CA   1 
ATOM   917  C  C    . ARG A 1 58  ? -0.544  -15.279 5.065   1.00 48.22  ? 419 ARG A C    1 
ATOM   918  O  O    . ARG A 1 58  ? -0.251  -14.169 5.516   1.00 51.48  ? 419 ARG A O    1 
ATOM   919  C  CB   . ARG A 1 58  ? -2.913  -15.694 5.633   1.00 62.37  ? 419 ARG A CB   1 
ATOM   920  C  CG   . ARG A 1 58  ? -3.284  -15.496 4.152   1.00 64.82  ? 419 ARG A CG   1 
ATOM   921  C  CD   . ARG A 1 58  ? -4.719  -15.069 3.961   1.00 55.09  ? 419 ARG A CD   1 
ATOM   922  N  NE   . ARG A 1 58  ? -5.659  -16.137 4.285   1.00 69.16  ? 419 ARG A NE   1 
ATOM   923  C  CZ   . ARG A 1 58  ? -6.058  -17.079 3.436   1.00 69.47  ? 419 ARG A CZ   1 
ATOM   924  N  NH1  . ARG A 1 58  ? -5.600  -17.106 2.189   1.00 79.21  ? 419 ARG A NH1  1 
ATOM   925  N  NH2  . ARG A 1 58  ? -6.921  -18.001 3.843   1.00 65.80  ? 419 ARG A NH2  1 
ATOM   926  H  H    . ARG A 1 58  ? -1.099  -15.606 7.646   1.00 65.50  ? 419 ARG A H    1 
ATOM   927  H  HA   . ARG A 1 58  ? -1.432  -17.082 5.385   1.00 57.20  ? 419 ARG A HA   1 
ATOM   928  H  HB2  . ARG A 1 58  ? -3.531  -16.335 6.016   1.00 74.85  ? 419 ARG A HB2  1 
ATOM   929  H  HB3  . ARG A 1 58  ? -2.998  -14.839 6.083   1.00 74.85  ? 419 ARG A HB3  1 
ATOM   930  H  HG2  . ARG A 1 58  ? -2.714  -14.809 3.772   1.00 77.79  ? 419 ARG A HG2  1 
ATOM   931  H  HG3  . ARG A 1 58  ? -3.155  -16.333 3.679   1.00 77.79  ? 419 ARG A HG3  1 
ATOM   932  H  HD2  . ARG A 1 58  ? -4.906  -14.316 4.543   1.00 66.11  ? 419 ARG A HD2  1 
ATOM   933  H  HD3  . ARG A 1 58  ? -4.855  -14.817 3.034   1.00 66.11  ? 419 ARG A HD3  1 
ATOM   934  H  HE   . ARG A 1 58  ? -5.978  -16.159 5.083   1.00 83.00  ? 419 ARG A HE   1 
ATOM   935  H  HH11 . ARG A 1 58  ? -5.041  -16.509 1.923   1.00 95.06  ? 419 ARG A HH11 1 
ATOM   936  H  HH12 . ARG A 1 58  ? -5.864  -17.720 1.647   1.00 95.06  ? 419 ARG A HH12 1 
ATOM   937  H  HH21 . ARG A 1 58  ? -7.218  -17.986 4.650   1.00 78.96  ? 419 ARG A HH21 1 
ATOM   938  H  HH22 . ARG A 1 58  ? -7.183  -18.615 3.300   1.00 78.96  ? 419 ARG A HH22 1 
ATOM   939  N  N    . VAL A 1 59  ? -0.094  -15.754 3.908   1.00 49.72  ? 420 VAL A N    1 
ATOM   940  C  CA   . VAL A 1 59  ? 0.580   -14.926 2.917   1.00 52.33  ? 420 VAL A CA   1 
ATOM   941  C  C    . VAL A 1 59  ? -0.073  -15.211 1.578   1.00 48.04  ? 420 VAL A C    1 
ATOM   942  O  O    . VAL A 1 59  ? 0.131   -16.276 0.990   1.00 52.57  ? 420 VAL A O    1 
ATOM   943  C  CB   . VAL A 1 59  ? 2.085   -15.212 2.832   1.00 56.81  ? 420 VAL A CB   1 
ATOM   944  C  CG1  . VAL A 1 59  ? 2.750   -14.297 1.800   1.00 50.05  ? 420 VAL A CG1  1 
ATOM   945  C  CG2  . VAL A 1 59  ? 2.735   -15.046 4.196   1.00 56.22  ? 420 VAL A CG2  1 
ATOM   946  H  H    . VAL A 1 59  ? -0.171  -16.576 3.669   1.00 59.67  ? 420 VAL A H    1 
ATOM   947  H  HA   . VAL A 1 59  ? 0.454   -13.989 3.132   1.00 62.80  ? 420 VAL A HA   1 
ATOM   948  H  HB   . VAL A 1 59  ? 2.216   -16.130 2.547   1.00 68.17  ? 420 VAL A HB   1 
ATOM   949  H  HG11 . VAL A 1 59  ? 3.698   -14.498 1.765   1.00 60.06  ? 420 VAL A HG11 1 
ATOM   950  H  HG12 . VAL A 1 59  ? 2.346   -14.456 0.932   1.00 60.06  ? 420 VAL A HG12 1 
ATOM   951  H  HG13 . VAL A 1 59  ? 2.616   -13.374 2.064   1.00 60.06  ? 420 VAL A HG13 1 
ATOM   952  H  HG21 . VAL A 1 59  ? 3.684   -15.231 4.118   1.00 67.47  ? 420 VAL A HG21 1 
ATOM   953  H  HG22 . VAL A 1 59  ? 2.600   -14.135 4.501   1.00 67.47  ? 420 VAL A HG22 1 
ATOM   954  H  HG23 . VAL A 1 59  ? 2.326   -15.667 4.819   1.00 67.47  ? 420 VAL A HG23 1 
ATOM   955  N  N    . GLY A 1 60  ? -0.879  -14.266 1.113   1.00 54.15  ? 421 GLY A N    1 
ATOM   956  C  CA   . GLY A 1 60  ? -1.627  -14.459 -0.113  1.00 57.12  ? 421 GLY A CA   1 
ATOM   957  C  C    . GLY A 1 60  ? -2.568  -15.634 0.055   1.00 51.44  ? 421 GLY A C    1 
ATOM   958  O  O    . GLY A 1 60  ? -3.415  -15.637 0.942   1.00 55.67  ? 421 GLY A O    1 
ATOM   959  H  H    . GLY A 1 60  ? -1.009  -13.504 1.491   1.00 64.98  ? 421 GLY A H    1 
ATOM   960  H  HA2  . GLY A 1 60  ? -2.145  -13.665 -0.317  1.00 68.54  ? 421 GLY A HA2  1 
ATOM   961  H  HA3  . GLY A 1 60  ? -1.021  -14.640 -0.848  1.00 68.54  ? 421 GLY A HA3  1 
ATOM   962  N  N    . ASN A 1 61  ? -2.400  -16.647 -0.788  1.00 47.34  ? 422 ASN A N    1 
ATOM   963  C  CA   . ASN A 1 61  ? -3.236  -17.841 -0.731  1.00 57.67  ? 422 ASN A CA   1 
ATOM   964  C  C    . ASN A 1 61  ? -2.640  -18.935 0.140   1.00 45.23  ? 422 ASN A C    1 
ATOM   965  O  O    . ASN A 1 61  ? -3.284  -19.940 0.408   1.00 49.93  ? 422 ASN A O    1 
ATOM   966  C  CB   . ASN A 1 61  ? -3.465  -18.389 -2.137  1.00 61.22  ? 422 ASN A CB   1 
ATOM   967  C  CG   . ASN A 1 61  ? -4.501  -17.602 -2.905  1.00 72.59  ? 422 ASN A CG   1 
ATOM   968  O  OD1  . ASN A 1 61  ? -5.408  -17.009 -2.317  1.00 59.29  ? 422 ASN A OD1  1 
ATOM   969  N  ND2  . ASN A 1 61  ? -4.382  -17.602 -4.230  1.00 68.53  ? 422 ASN A ND2  1 
ATOM   970  H  H    . ASN A 1 61  ? -1.804  -16.667 -1.407  1.00 56.81  ? 422 ASN A H    1 
ATOM   971  H  HA   . ASN A 1 61  ? -4.100  -17.603 -0.360  1.00 69.21  ? 422 ASN A HA   1 
ATOM   972  H  HB2  . ASN A 1 61  ? -2.631  -18.351 -2.632  1.00 73.46  ? 422 ASN A HB2  1 
ATOM   973  H  HB3  . ASN A 1 61  ? -3.771  -19.308 -2.074  1.00 73.46  ? 422 ASN A HB3  1 
ATOM   974  H  HD21 . ASN A 1 61  ? -4.947  -17.168 -4.712  1.00 82.24  ? 422 ASN A HD21 1 
ATOM   975  H  HD22 . ASN A 1 61  ? -3.741  -18.035 -4.604  1.00 82.24  ? 422 ASN A HD22 1 
ATOM   976  N  N    . GLN A 1 62  ? -1.395  -18.753 0.549   1.00 45.11  ? 423 GLN A N    1 
ATOM   977  C  CA   . GLN A 1 62  ? -0.728  -19.753 1.355   1.00 44.75  ? 423 GLN A CA   1 
ATOM   978  C  C    . GLN A 1 62  ? -1.157  -19.615 2.817   1.00 49.76  ? 423 GLN A C    1 
ATOM   979  O  O    . GLN A 1 62  ? -1.104  -18.526 3.384   1.00 52.16  ? 423 GLN A O    1 
ATOM   980  C  CB   . GLN A 1 62  ? 0.785   -19.622 1.217   1.00 44.89  ? 423 GLN A CB   1 
ATOM   981  C  CG   . GLN A 1 62  ? 1.271   -19.827 -0.210  1.00 46.69  ? 423 GLN A CG   1 
ATOM   982  C  CD   . GLN A 1 62  ? 2.581   -19.130 -0.462  1.00 45.26  ? 423 GLN A CD   1 
ATOM   983  O  OE1  . GLN A 1 62  ? 3.640   -19.759 -0.496  1.00 50.44  ? 423 GLN A OE1  1 
ATOM   984  N  NE2  . GLN A 1 62  ? 2.519   -17.814 -0.634  1.00 48.90  ? 423 GLN A NE2  1 
ATOM   985  H  H    . GLN A 1 62  ? -0.917  -18.059 0.373   1.00 54.14  ? 423 GLN A H    1 
ATOM   986  H  HA   . GLN A 1 62  ? -0.985  -20.636 1.046   1.00 53.70  ? 423 GLN A HA   1 
ATOM   987  H  HB2  . GLN A 1 62  ? 1.051   -18.732 1.498   1.00 53.87  ? 423 GLN A HB2  1 
ATOM   988  H  HB3  . GLN A 1 62  ? 1.212   -20.288 1.777   1.00 53.87  ? 423 GLN A HB3  1 
ATOM   989  H  HG2  . GLN A 1 62  ? 1.396   -20.775 -0.370  1.00 56.03  ? 423 GLN A HG2  1 
ATOM   990  H  HG3  . GLN A 1 62  ? 0.613   -19.468 -0.826  1.00 56.03  ? 423 GLN A HG3  1 
ATOM   991  H  HE21 . GLN A 1 62  ? 1.761   -17.411 -0.598  1.00 58.68  ? 423 GLN A HE21 1 
ATOM   992  H  HE22 . GLN A 1 62  ? 3.238   -17.366 -0.781  1.00 58.68  ? 423 GLN A HE22 1 
ATOM   993  N  N    . ILE A 1 63  ? -1.601  -20.725 3.398   1.00 45.00  ? 424 ILE A N    1 
ATOM   994  C  CA   . ILE A 1 63  ? -2.009  -20.777 4.805   1.00 45.51  ? 424 ILE A CA   1 
ATOM   995  C  C    . ILE A 1 63  ? -1.173  -21.795 5.565   1.00 49.38  ? 424 ILE A C    1 
ATOM   996  O  O    . ILE A 1 63  ? -0.886  -22.884 5.057   1.00 45.82  ? 424 ILE A O    1 
ATOM   997  C  CB   . ILE A 1 63  ? -3.504  -21.135 4.960   1.00 53.14  ? 424 ILE A CB   1 
ATOM   998  C  CG1  . ILE A 1 63  ? -4.377  -19.915 4.675   1.00 59.49  ? 424 ILE A CG1  1 
ATOM   999  C  CG2  . ILE A 1 63  ? -3.819  -21.636 6.383   1.00 55.74  ? 424 ILE A CG2  1 
ATOM   1000 C  CD1  . ILE A 1 63  ? -4.353  -18.868 5.785   1.00 85.83  ? 424 ILE A CD1  1 
ATOM   1001 H  H    . ILE A 1 63  ? -1.677  -21.479 2.992   1.00 54.00  ? 424 ILE A H    1 
ATOM   1002 H  HA   . ILE A 1 63  ? -1.865  -19.907 5.209   1.00 54.61  ? 424 ILE A HA   1 
ATOM   1003 H  HB   . ILE A 1 63  ? -3.727  -21.834 4.325   1.00 63.76  ? 424 ILE A HB   1 
ATOM   1004 H  HG12 . ILE A 1 63  ? -4.065  -19.490 3.860   1.00 71.39  ? 424 ILE A HG12 1 
ATOM   1005 H  HG13 . ILE A 1 63  ? -5.295  -20.206 4.562   1.00 71.39  ? 424 ILE A HG13 1 
ATOM   1006 H  HG21 . ILE A 1 63  ? -4.764  -21.850 6.440   1.00 66.89  ? 424 ILE A HG21 1 
ATOM   1007 H  HG22 . ILE A 1 63  ? -3.289  -22.428 6.563   1.00 66.89  ? 424 ILE A HG22 1 
ATOM   1008 H  HG23 . ILE A 1 63  ? -3.598  -20.938 7.019   1.00 66.89  ? 424 ILE A HG23 1 
ATOM   1009 H  HD11 . ILE A 1 63  ? -4.927  -18.128 5.533   1.00 102.99 ? 424 ILE A HD11 1 
ATOM   1010 H  HD12 . ILE A 1 63  ? -4.674  -19.272 6.606   1.00 102.99 ? 424 ILE A HD12 1 
ATOM   1011 H  HD13 . ILE A 1 63  ? -3.443  -18.555 5.904   1.00 102.99 ? 424 ILE A HD13 1 
ATOM   1012 N  N    . PHE A 1 64  ? -0.801  -21.429 6.791   1.00 47.45  ? 425 PHE A N    1 
ATOM   1013 C  CA   . PHE A 1 64  ? -0.044  -22.298 7.687   1.00 47.59  ? 425 PHE A CA   1 
ATOM   1014 C  C    . PHE A 1 64  ? -0.731  -22.376 9.049   1.00 57.02  ? 425 PHE A C    1 
ATOM   1015 O  O    . PHE A 1 64  ? -1.220  -21.367 9.549   1.00 49.18  ? 425 PHE A O    1 
ATOM   1016 C  CB   . PHE A 1 64  ? 1.381   -21.787 7.859   1.00 48.15  ? 425 PHE A CB   1 
ATOM   1017 C  CG   . PHE A 1 64  ? 2.107   -21.561 6.567   1.00 63.78  ? 425 PHE A CG   1 
ATOM   1018 C  CD1  . PHE A 1 64  ? 2.739   -22.608 5.921   1.00 48.13  ? 425 PHE A CD1  1 
ATOM   1019 C  CD2  . PHE A 1 64  ? 2.166   -20.298 6.004   1.00 49.76  ? 425 PHE A CD2  1 
ATOM   1020 C  CE1  . PHE A 1 64  ? 3.414   -22.400 4.733   1.00 58.95  ? 425 PHE A CE1  1 
ATOM   1021 C  CE2  . PHE A 1 64  ? 2.837   -20.084 4.815   1.00 55.90  ? 425 PHE A CE2  1 
ATOM   1022 C  CZ   . PHE A 1 64  ? 3.464   -21.136 4.182   1.00 46.58  ? 425 PHE A CZ   1 
ATOM   1023 H  H    . PHE A 1 64  ? -0.980  -20.660 7.133   1.00 56.94  ? 425 PHE A H    1 
ATOM   1024 H  HA   . PHE A 1 64  ? -0.006  -23.192 7.312   1.00 57.10  ? 425 PHE A HA   1 
ATOM   1025 H  HB2  . PHE A 1 64  ? 1.354   -20.942 8.335   1.00 57.78  ? 425 PHE A HB2  1 
ATOM   1026 H  HB3  . PHE A 1 64  ? 1.886   -22.437 8.372   1.00 57.78  ? 425 PHE A HB3  1 
ATOM   1027 H  HD1  . PHE A 1 64  ? 2.710   -23.462 6.290   1.00 57.76  ? 425 PHE A HD1  1 
ATOM   1028 H  HD2  . PHE A 1 64  ? 1.746   -19.585 6.429   1.00 59.71  ? 425 PHE A HD2  1 
ATOM   1029 H  HE1  . PHE A 1 64  ? 3.834   -23.111 4.305   1.00 70.74  ? 425 PHE A HE1  1 
ATOM   1030 H  HE2  . PHE A 1 64  ? 2.870   -19.232 4.445   1.00 67.08  ? 425 PHE A HE2  1 
ATOM   1031 H  HZ   . PHE A 1 64  ? 3.915   -20.995 3.381   1.00 55.90  ? 425 PHE A HZ   1 
ATOM   1032 N  N    . GLN A 1 65  ? -0.759  -23.569 9.638   1.00 49.47  ? 426 GLN A N    1 
ATOM   1033 C  CA   . GLN A 1 65  ? -1.389  -23.793 10.940  1.00 50.71  ? 426 GLN A CA   1 
ATOM   1034 C  C    . GLN A 1 65  ? -0.338  -24.338 11.908  1.00 56.96  ? 426 GLN A C    1 
ATOM   1035 O  O    . GLN A 1 65  ? 0.307   -25.349 11.627  1.00 55.35  ? 426 GLN A O    1 
ATOM   1036 C  CB   . GLN A 1 65  ? -2.568  -24.766 10.809  1.00 50.90  ? 426 GLN A CB   1 
ATOM   1037 C  CG   . GLN A 1 65  ? -3.391  -24.966 12.078  1.00 52.29  ? 426 GLN A CG   1 
ATOM   1038 C  CD   . GLN A 1 65  ? -4.458  -26.034 11.911  1.00 61.46  ? 426 GLN A CD   1 
ATOM   1039 O  OE1  . GLN A 1 65  ? -4.641  -26.579 10.820  1.00 52.25  ? 426 GLN A OE1  1 
ATOM   1040 N  NE2  . GLN A 1 65  ? -5.164  -26.344 12.995  1.00 54.43  ? 426 GLN A NE2  1 
ATOM   1041 H  H    . GLN A 1 65  ? -0.413  -24.279 9.297   1.00 59.36  ? 426 GLN A H    1 
ATOM   1042 H  HA   . GLN A 1 65  ? -1.721  -22.951 11.288  1.00 60.85  ? 426 GLN A HA   1 
ATOM   1043 H  HB2  . GLN A 1 65  ? -3.166  -24.432 10.123  1.00 61.08  ? 426 GLN A HB2  1 
ATOM   1044 H  HB3  . GLN A 1 65  ? -2.223  -25.633 10.545  1.00 61.08  ? 426 GLN A HB3  1 
ATOM   1045 H  HG2  . GLN A 1 65  ? -2.802  -25.239 12.799  1.00 62.75  ? 426 GLN A HG2  1 
ATOM   1046 H  HG3  . GLN A 1 65  ? -3.832  -24.133 12.305  1.00 62.75  ? 426 GLN A HG3  1 
ATOM   1047 H  HE21 . GLN A 1 65  ? -5.004  -25.946 13.740  1.00 65.32  ? 426 GLN A HE21 1 
ATOM   1048 H  HE22 . GLN A 1 65  ? -5.779  -26.943 12.951  1.00 65.32  ? 426 GLN A HE22 1 
ATOM   1049 N  N    . SER A 1 66  ? -0.143  -23.650 13.026  1.00 57.79  ? 427 SER A N    1 
ATOM   1050 C  CA   . SER A 1 66  ? 0.830   -24.087 14.027  1.00 61.68  ? 427 SER A CA   1 
ATOM   1051 C  C    . SER A 1 66  ? 0.266   -25.190 14.899  1.00 61.44  ? 427 SER A C    1 
ATOM   1052 O  O    . SER A 1 66  ? -0.940  -25.443 14.910  1.00 56.90  ? 427 SER A O    1 
ATOM   1053 C  CB   . SER A 1 66  ? 1.260   -22.923 14.922  1.00 56.45  ? 427 SER A CB   1 
ATOM   1054 O  OG   . SER A 1 66  ? 0.255   -22.627 15.880  1.00 57.07  ? 427 SER A OG   1 
ATOM   1055 H  H    . SER A 1 66  ? -0.560  -22.927 13.232  1.00 69.35  ? 427 SER A H    1 
ATOM   1056 H  HA   . SER A 1 66  ? 1.617   -24.429 13.577  1.00 74.02  ? 427 SER A HA   1 
ATOM   1057 H  HB2  . SER A 1 66  ? 2.076   -23.167 15.386  1.00 67.74  ? 427 SER A HB2  1 
ATOM   1058 H  HB3  . SER A 1 66  ? 1.412   -22.140 14.371  1.00 67.74  ? 427 SER A HB3  1 
ATOM   1059 H  HG   . SER A 1 66  ? 0.501   -21.987 16.366  1.00 68.49  ? 427 SER A HG   1 
ATOM   1060 N  N    . ARG A 1 67  ? 1.147   -25.832 15.651  1.00 59.51  ? 428 ARG A N    1 
ATOM   1061 C  CA   . ARG A 1 67  ? 0.716   -26.812 16.628  1.00 61.79  ? 428 ARG A CA   1 
ATOM   1062 C  C    . ARG A 1 67  ? -0.062  -26.119 17.740  1.00 62.47  ? 428 ARG A C    1 
ATOM   1063 O  O    . ARG A 1 67  ? 0.082   -24.911 17.952  1.00 61.80  ? 428 ARG A O    1 
ATOM   1064 C  CB   . ARG A 1 67  ? 1.915   -27.563 17.205  1.00 71.45  ? 428 ARG A CB   1 
ATOM   1065 C  CG   . ARG A 1 67  ? 2.617   -28.447 16.203  1.00 89.88  ? 428 ARG A CG   1 
ATOM   1066 C  CD   . ARG A 1 67  ? 3.762   -29.227 16.833  1.00 105.00 ? 428 ARG A CD   1 
ATOM   1067 N  NE   . ARG A 1 67  ? 4.433   -30.064 15.841  1.00 126.47 ? 428 ARG A NE   1 
ATOM   1068 C  CZ   . ARG A 1 67  ? 3.994   -31.254 15.442  1.00 129.28 ? 428 ARG A CZ   1 
ATOM   1069 N  NH1  . ARG A 1 67  ? 2.880   -31.765 15.952  1.00 127.58 ? 428 ARG A NH1  1 
ATOM   1070 N  NH2  . ARG A 1 67  ? 4.672   -31.936 14.528  1.00 125.73 ? 428 ARG A NH2  1 
ATOM   1071 H  H    . ARG A 1 67  ? 1.998   -25.717 15.614  1.00 71.41  ? 428 ARG A H    1 
ATOM   1072 H  HA   . ARG A 1 67  ? 0.130   -27.455 16.200  1.00 74.14  ? 428 ARG A HA   1 
ATOM   1073 H  HB2  . ARG A 1 67  ? 2.560   -26.918 17.534  1.00 85.74  ? 428 ARG A HB2  1 
ATOM   1074 H  HB3  . ARG A 1 67  ? 1.610   -28.125 17.935  1.00 85.74  ? 428 ARG A HB3  1 
ATOM   1075 H  HG2  . ARG A 1 67  ? 1.981   -29.084 15.840  1.00 107.85 ? 428 ARG A HG2  1 
ATOM   1076 H  HG3  . ARG A 1 67  ? 2.981   -27.896 15.493  1.00 107.85 ? 428 ARG A HG3  1 
ATOM   1077 H  HD2  . ARG A 1 67  ? 4.411   -28.606 17.199  1.00 126.00 ? 428 ARG A HD2  1 
ATOM   1078 H  HD3  . ARG A 1 67  ? 3.413   -29.802 17.532  1.00 126.00 ? 428 ARG A HD3  1 
ATOM   1079 H  HE   . ARG A 1 67  ? 5.161   -29.767 15.493  1.00 151.76 ? 428 ARG A HE   1 
ATOM   1080 H  HH11 . ARG A 1 67  ? 2.436   -31.326 16.543  1.00 153.10 ? 428 ARG A HH11 1 
ATOM   1081 H  HH12 . ARG A 1 67  ? 2.602   -32.536 15.691  1.00 153.10 ? 428 ARG A HH12 1 
ATOM   1082 H  HH21 . ARG A 1 67  ? 5.395   -31.609 14.196  1.00 150.87 ? 428 ARG A HH21 1 
ATOM   1083 H  HH22 . ARG A 1 67  ? 4.391   -32.707 14.271  1.00 150.87 ? 428 ARG A HH22 1 
ATOM   1084 N  N    . VAL A 1 68  ? -0.898  -26.885 18.433  1.00 64.02  ? 429 VAL A N    1 
ATOM   1085 C  CA   . VAL A 1 68  ? -1.542  -26.409 19.655  1.00 65.36  ? 429 VAL A CA   1 
ATOM   1086 C  C    . VAL A 1 68  ? -0.671  -26.765 20.844  1.00 68.57  ? 429 VAL A C    1 
ATOM   1087 O  O    . VAL A 1 68  ? -0.403  -27.943 21.081  1.00 85.00  ? 429 VAL A O    1 
ATOM   1088 C  CB   . VAL A 1 68  ? -2.935  -27.031 19.874  1.00 65.84  ? 429 VAL A CB   1 
ATOM   1089 C  CG1  . VAL A 1 68  ? -3.470  -26.676 21.263  1.00 67.82  ? 429 VAL A CG1  1 
ATOM   1090 C  CG2  . VAL A 1 68  ? -3.902  -26.579 18.803  1.00 63.11  ? 429 VAL A CG2  1 
ATOM   1091 H  H    . VAL A 1 68  ? -1.111  -27.689 18.215  1.00 76.83  ? 429 VAL A H    1 
ATOM   1092 H  HA   . VAL A 1 68  ? -1.636  -25.444 19.618  1.00 78.43  ? 429 VAL A HA   1 
ATOM   1093 H  HB   . VAL A 1 68  ? -2.860  -27.997 19.820  1.00 79.01  ? 429 VAL A HB   1 
ATOM   1094 H  HG11 . VAL A 1 68  ? -4.346  -27.078 21.376  1.00 81.38  ? 429 VAL A HG11 1 
ATOM   1095 H  HG12 . VAL A 1 68  ? -2.859  -27.019 21.933  1.00 81.38  ? 429 VAL A HG12 1 
ATOM   1096 H  HG13 . VAL A 1 68  ? -3.537  -25.711 21.338  1.00 81.38  ? 429 VAL A HG13 1 
ATOM   1097 H  HG21 . VAL A 1 68  ? -4.767  -26.986 18.967  1.00 75.73  ? 429 VAL A HG21 1 
ATOM   1098 H  HG22 . VAL A 1 68  ? -3.979  -25.613 18.835  1.00 75.73  ? 429 VAL A HG22 1 
ATOM   1099 H  HG23 . VAL A 1 68  ? -3.565  -26.856 17.936  1.00 75.73  ? 429 VAL A HG23 1 
ATOM   1100 N  N    . ILE A 1 69  ? -0.239  -25.759 21.596  1.00 69.24  ? 430 ILE A N    1 
ATOM   1101 C  CA   . ILE A 1 69  ? 0.460   -26.014 22.850  1.00 72.72  ? 430 ILE A CA   1 
ATOM   1102 C  C    . ILE A 1 69  ? -0.534  -25.796 24.001  1.00 87.54  ? 430 ILE A C    1 
ATOM   1103 O  O    . ILE A 1 69  ? -1.208  -24.766 24.086  1.00 84.44  ? 430 ILE A O    1 
ATOM   1104 C  CB   . ILE A 1 69  ? 1.729   -25.130 22.995  1.00 95.14  ? 430 ILE A CB   1 
ATOM   1105 C  CG1  . ILE A 1 69  ? 1.377   -23.668 23.227  1.00 82.14  ? 430 ILE A CG1  1 
ATOM   1106 C  CG2  . ILE A 1 69  ? 2.642   -25.261 21.771  1.00 71.63  ? 430 ILE A CG2  1 
ATOM   1107 C  CD1  . ILE A 1 69  ? 1.445   -23.312 24.673  1.00 104.94 ? 430 ILE A CD1  1 
ATOM   1108 H  H    . ILE A 1 69  ? -0.336  -24.926 21.404  1.00 83.09  ? 430 ILE A H    1 
ATOM   1109 H  HA   . ILE A 1 69  ? 0.741   -26.943 22.870  1.00 87.26  ? 430 ILE A HA   1 
ATOM   1110 H  HB   . ILE A 1 69  ? 2.223   -25.443 23.769  1.00 114.17 ? 430 ILE A HB   1 
ATOM   1111 H  HG12 . ILE A 1 69  ? 2.006   -23.108 22.746  1.00 98.57  ? 430 ILE A HG12 1 
ATOM   1112 H  HG13 . ILE A 1 69  ? 0.474   -23.503 22.916  1.00 98.57  ? 430 ILE A HG13 1 
ATOM   1113 H  HG21 . ILE A 1 69  ? 3.420   -24.697 21.897  1.00 85.95  ? 430 ILE A HG21 1 
ATOM   1114 H  HG22 . ILE A 1 69  ? 2.915   -26.187 21.679  1.00 85.95  ? 430 ILE A HG22 1 
ATOM   1115 H  HG23 . ILE A 1 69  ? 2.153   -24.980 20.982  1.00 85.95  ? 430 ILE A HG23 1 
ATOM   1116 H  HD11 . ILE A 1 69  ? 1.215   -22.375 24.778  1.00 125.92 ? 430 ILE A HD11 1 
ATOM   1117 H  HD12 . ILE A 1 69  ? 0.817   -23.864 25.164  1.00 125.92 ? 430 ILE A HD12 1 
ATOM   1118 H  HD13 . ILE A 1 69  ? 2.347   -23.469 24.994  1.00 125.92 ? 430 ILE A HD13 1 
ATOM   1119 N  N    . LYS A 1 70  ? -0.637  -26.792 24.874  1.00 77.86  ? 431 LYS A N    1 
ATOM   1120 C  CA   . LYS A 1 70  ? -1.733  -26.865 25.828  1.00 89.75  ? 431 LYS A CA   1 
ATOM   1121 C  C    . LYS A 1 70  ? -1.461  -26.109 27.123  1.00 81.19  ? 431 LYS A C    1 
ATOM   1122 O  O    . LYS A 1 70  ? -0.320  -26.022 27.577  1.00 83.20  ? 431 LYS A O    1 
ATOM   1123 C  CB   . LYS A 1 70  ? -2.043  -28.331 26.138  1.00 81.50  ? 431 LYS A CB   1 
ATOM   1124 C  CG   . LYS A 1 70  ? -2.272  -29.169 24.889  1.00 104.33 ? 431 LYS A CG   1 
ATOM   1125 C  CD   . LYS A 1 70  ? -2.868  -30.528 25.214  1.00 108.22 ? 431 LYS A CD   1 
ATOM   1126 C  CE   . LYS A 1 70  ? -3.325  -31.243 23.951  1.00 111.80 ? 431 LYS A CE   1 
ATOM   1127 N  NZ   . LYS A 1 70  ? -4.060  -32.502 24.252  1.00 120.97 ? 431 LYS A NZ   1 
ATOM   1128 H  H    . LYS A 1 70  ? -0.078  -27.443 24.933  1.00 93.43  ? 431 LYS A H    1 
ATOM   1129 H  HA   . LYS A 1 70  ? -2.524  -26.477 25.422  1.00 107.71 ? 431 LYS A HA   1 
ATOM   1130 H  HB2  . LYS A 1 70  ? -1.295  -28.715 26.623  1.00 97.80  ? 431 LYS A HB2  1 
ATOM   1131 H  HB3  . LYS A 1 70  ? -2.846  -28.376 26.680  1.00 97.80  ? 431 LYS A HB3  1 
ATOM   1132 H  HG2  . LYS A 1 70  ? -2.886  -28.702 24.301  1.00 125.20 ? 431 LYS A HG2  1 
ATOM   1133 H  HG3  . LYS A 1 70  ? -1.423  -29.311 24.441  1.00 125.20 ? 431 LYS A HG3  1 
ATOM   1134 H  HD2  . LYS A 1 70  ? -2.198  -31.077 25.650  1.00 129.86 ? 431 LYS A HD2  1 
ATOM   1135 H  HD3  . LYS A 1 70  ? -3.637  -30.411 25.793  1.00 129.86 ? 431 LYS A HD3  1 
ATOM   1136 H  HE2  . LYS A 1 70  ? -3.918  -30.659 23.452  1.00 134.16 ? 431 LYS A HE2  1 
ATOM   1137 H  HE3  . LYS A 1 70  ? -2.549  -31.468 23.414  1.00 134.16 ? 431 LYS A HE3  1 
ATOM   1138 H  HZ1  . LYS A 1 70  ? -4.313  -32.895 23.494  1.00 145.17 ? 431 LYS A HZ1  1 
ATOM   1139 H  HZ2  . LYS A 1 70  ? -3.536  -33.059 24.706  1.00 145.17 ? 431 LYS A HZ2  1 
ATOM   1140 H  HZ3  . LYS A 1 70  ? -4.783  -32.323 24.740  1.00 145.17 ? 431 LYS A HZ3  1 
ATOM   1141 N  N    . GLU A 1 71  ? -2.530  -25.548 27.683  1.00 87.35  ? 432 GLU A N    1 
ATOM   1142 C  CA   . GLU A 1 71  ? -2.520  -24.942 29.015  1.00 91.76  ? 432 GLU A CA   1 
ATOM   1143 C  C    . GLU A 1 71  ? -1.370  -23.967 29.220  1.00 91.88  ? 432 GLU A C    1 
ATOM   1144 O  O    . GLU A 1 71  ? -0.535  -24.175 30.100  1.00 87.40  ? 432 GLU A O    1 
ATOM   1145 C  CB   . GLU A 1 71  ? -2.443  -26.030 30.091  1.00 87.95  ? 432 GLU A CB   1 
ATOM   1146 C  CG   . GLU A 1 71  ? -3.682  -26.900 30.215  1.00 111.72 ? 432 GLU A CG   1 
ATOM   1147 C  CD   . GLU A 1 71  ? -3.773  -27.587 31.570  1.00 127.11 ? 432 GLU A CD   1 
ATOM   1148 O  OE1  . GLU A 1 71  ? -2.727  -28.034 32.090  1.00 125.22 ? 432 GLU A OE1  1 
ATOM   1149 O  OE2  . GLU A 1 71  ? -4.889  -27.670 32.124  1.00 131.16 ? 432 GLU A OE2  1 
ATOM   1150 H  H    . GLU A 1 71  ? -3.298  -25.504 27.298  1.00 104.82 ? 432 GLU A H    1 
ATOM   1151 H  HA   . GLU A 1 71  ? -3.349  -24.454 29.143  1.00 110.11 ? 432 GLU A HA   1 
ATOM   1152 H  HB2  . GLU A 1 71  ? -1.695  -26.613 29.887  1.00 105.54 ? 432 GLU A HB2  1 
ATOM   1153 H  HB3  . GLU A 1 71  ? -2.298  -25.604 30.951  1.00 105.54 ? 432 GLU A HB3  1 
ATOM   1154 H  HG2  . GLU A 1 71  ? -4.471  -26.347 30.104  1.00 134.06 ? 432 GLU A HG2  1 
ATOM   1155 H  HG3  . GLU A 1 71  ? -3.658  -27.587 29.530  1.00 134.06 ? 432 GLU A HG3  1 
ATOM   1156 N  N    . ASN A 1 72  ? -1.318  -22.904 28.425  1.00 81.06  ? 433 ASN A N    1 
ATOM   1157 C  CA   . ASN A 1 72  ? -0.186  -21.994 28.502  1.00 81.55  ? 433 ASN A CA   1 
ATOM   1158 C  C    . ASN A 1 72  ? -0.437  -20.686 27.759  1.00 78.61  ? 433 ASN A C    1 
ATOM   1159 O  O    . ASN A 1 72  ? -0.725  -20.679 26.559  1.00 77.29  ? 433 ASN A O    1 
ATOM   1160 C  CB   . ASN A 1 72  ? 1.054   -22.701 27.953  1.00 82.02  ? 433 ASN A CB   1 
ATOM   1161 C  CG   . ASN A 1 72  ? 2.337   -21.927 28.179  1.00 83.47  ? 433 ASN A CG   1 
ATOM   1162 O  OD1  . ASN A 1 72  ? 2.325   -20.733 28.467  1.00 83.41  ? 433 ASN A OD1  1 
ATOM   1163 N  ND2  . ASN A 1 72  ? 3.463   -22.616 28.034  1.00 85.08  ? 433 ASN A ND2  1 
ATOM   1164 H  H    . ASN A 1 72  ? -1.914  -22.691 27.844  1.00 97.27  ? 433 ASN A H    1 
ATOM   1165 H  HA   . ASN A 1 72  ? -0.019  -21.779 29.433  1.00 97.86  ? 433 ASN A HA   1 
ATOM   1166 H  HB2  . ASN A 1 72  ? 1.145   -23.562 28.392  1.00 98.42  ? 433 ASN A HB2  1 
ATOM   1167 H  HB3  . ASN A 1 72  ? 0.947   -22.827 26.997  1.00 98.42  ? 433 ASN A HB3  1 
ATOM   1168 H  HD21 . ASN A 1 72  ? 4.222   -22.229 28.150  1.00 102.09 ? 433 ASN A HD21 1 
ATOM   1169 H  HD22 . ASN A 1 72  ? 3.434   -23.450 27.824  1.00 102.09 ? 433 ASN A HD22 1 
ATOM   1170 N  N    . LEU A 1 73  ? -0.309  -19.581 28.487  1.00 79.95  ? 434 LEU A N    1 
ATOM   1171 C  CA   . LEU A 1 73  ? -0.535  -18.247 27.938  1.00 83.15  ? 434 LEU A CA   1 
ATOM   1172 C  C    . LEU A 1 73  ? 0.760   -17.579 27.484  1.00 81.22  ? 434 LEU A C    1 
ATOM   1173 O  O    . LEU A 1 73  ? 0.754   -16.420 27.069  1.00 77.58  ? 434 LEU A O    1 
ATOM   1174 C  CB   . LEU A 1 73  ? -1.231  -17.368 28.975  1.00 79.60  ? 434 LEU A CB   1 
ATOM   1175 C  CG   . LEU A 1 73  ? -2.689  -17.726 29.259  1.00 82.31  ? 434 LEU A CG   1 
ATOM   1176 C  CD1  . LEU A 1 73  ? -3.146  -17.050 30.537  1.00 90.12  ? 434 LEU A CD1  1 
ATOM   1177 C  CD2  . LEU A 1 73  ? -3.587  -17.327 28.093  1.00 77.92  ? 434 LEU A CD2  1 
ATOM   1178 H  H    . LEU A 1 73  ? -0.088  -19.577 29.318  1.00 95.94  ? 434 LEU A H    1 
ATOM   1179 H  HA   . LEU A 1 73  ? -1.119  -18.320 27.167  1.00 99.77  ? 434 LEU A HA   1 
ATOM   1180 H  HB2  . LEU A 1 73  ? -0.745  -17.437 29.812  1.00 95.52  ? 434 LEU A HB2  1 
ATOM   1181 H  HB3  . LEU A 1 73  ? -1.211  -16.450 28.663  1.00 95.52  ? 434 LEU A HB3  1 
ATOM   1182 H  HG   . LEU A 1 73  ? -2.763  -18.686 29.382  1.00 98.77  ? 434 LEU A HG   1 
ATOM   1183 H  HD11 . LEU A 1 73  ? -4.072  -17.286 30.705  1.00 108.14 ? 434 LEU A HD11 1 
ATOM   1184 H  HD12 . LEU A 1 73  ? -2.589  -17.354 31.271  1.00 108.14 ? 434 LEU A HD12 1 
ATOM   1185 H  HD13 . LEU A 1 73  ? -3.062  -16.090 30.433  1.00 108.14 ? 434 LEU A HD13 1 
ATOM   1186 H  HD21 . LEU A 1 73  ? -4.503  -17.567 28.304  1.00 93.50  ? 434 LEU A HD21 1 
ATOM   1187 H  HD22 . LEU A 1 73  ? -3.519  -16.370 27.956  1.00 93.50  ? 434 LEU A HD22 1 
ATOM   1188 H  HD23 . LEU A 1 73  ? -3.297  -17.798 27.296  1.00 93.50  ? 434 LEU A HD23 1 
ATOM   1189 N  N    . SER A 1 74  ? 1.869   -18.305 27.587  1.00 82.66  ? 435 SER A N    1 
ATOM   1190 C  CA   . SER A 1 74  ? 3.134   -17.866 27.012  1.00 89.33  ? 435 SER A CA   1 
ATOM   1191 C  C    . SER A 1 74  ? 3.665   -18.955 26.087  1.00 81.50  ? 435 SER A C    1 
ATOM   1192 O  O    . SER A 1 74  ? 4.761   -19.475 26.297  1.00 80.67  ? 435 SER A O    1 
ATOM   1193 C  CB   . SER A 1 74  ? 4.146   -17.537 28.106  1.00 92.49  ? 435 SER A CB   1 
ATOM   1194 O  OG   . SER A 1 74  ? 3.737   -16.386 28.824  1.00 93.77  ? 435 SER A OG   1 
ATOM   1195 H  H    . SER A 1 74  ? 1.914   -19.063 27.990  1.00 99.19  ? 435 SER A H    1 
ATOM   1196 H  HA   . SER A 1 74  ? 2.985   -17.066 26.484  1.00 107.20 ? 435 SER A HA   1 
ATOM   1197 H  HB2  . SER A 1 74  ? 4.208   -18.287 28.718  1.00 110.99 ? 435 SER A HB2  1 
ATOM   1198 H  HB3  . SER A 1 74  ? 5.010   -17.367 27.699  1.00 110.99 ? 435 SER A HB3  1 
ATOM   1199 H  HG   . SER A 1 74  ? 4.296   -16.208 29.425  1.00 112.53 ? 435 SER A HG   1 
ATOM   1200 N  N    . PRO A 1 75  ? 2.880   -19.299 25.054  1.00 75.26  ? 436 PRO A N    1 
ATOM   1201 C  CA   . PRO A 1 75  ? 3.183   -20.433 24.177  1.00 74.05  ? 436 PRO A CA   1 
ATOM   1202 C  C    . PRO A 1 75  ? 4.568   -20.340 23.555  1.00 74.36  ? 436 PRO A C    1 
ATOM   1203 O  O    . PRO A 1 75  ? 5.048   -19.237 23.302  1.00 74.11  ? 436 PRO A O    1 
ATOM   1204 C  CB   . PRO A 1 75  ? 2.088   -20.350 23.096  1.00 70.48  ? 436 PRO A CB   1 
ATOM   1205 C  CG   . PRO A 1 75  ? 1.587   -18.961 23.140  1.00 69.67  ? 436 PRO A CG   1 
ATOM   1206 C  CD   . PRO A 1 75  ? 1.712   -18.538 24.580  1.00 72.73  ? 436 PRO A CD   1 
ATOM   1207 H  HA   . PRO A 1 75  ? 3.098   -21.270 24.660  1.00 88.86  ? 436 PRO A HA   1 
ATOM   1208 H  HB2  . PRO A 1 75  ? 2.472   -20.546 22.227  1.00 84.57  ? 436 PRO A HB2  1 
ATOM   1209 H  HB3  . PRO A 1 75  ? 1.377   -20.976 23.304  1.00 84.57  ? 436 PRO A HB3  1 
ATOM   1210 H  HG2  . PRO A 1 75  ? 2.133   -18.398 22.570  1.00 83.60  ? 436 PRO A HG2  1 
ATOM   1211 H  HG3  . PRO A 1 75  ? 0.660   -18.939 22.857  1.00 83.60  ? 436 PRO A HG3  1 
ATOM   1212 H  HD2  . PRO A 1 75  ? 1.882   -17.585 24.639  1.00 87.28  ? 436 PRO A HD2  1 
ATOM   1213 H  HD3  . PRO A 1 75  ? 0.918   -18.790 25.077  1.00 87.28  ? 436 PRO A HD3  1 
ATOM   1214 N  N    . LYS A 1 76  ? 5.201   -21.490 23.338  1.00 82.44  ? 437 LYS A N    1 
ATOM   1215 C  CA   . LYS A 1 76  ? 6.497   -21.558 22.668  1.00 75.60  ? 437 LYS A CA   1 
ATOM   1216 C  C    . LYS A 1 76  ? 6.399   -22.593 21.556  1.00 73.59  ? 437 LYS A C    1 
ATOM   1217 O  O    . LYS A 1 76  ? 6.469   -23.798 21.807  1.00 79.72  ? 437 LYS A O    1 
ATOM   1218 C  CB   . LYS A 1 76  ? 7.622   -21.918 23.649  1.00 79.78  ? 437 LYS A CB   1 
ATOM   1219 C  CG   . LYS A 1 76  ? 7.434   -21.324 25.040  1.00 95.88  ? 437 LYS A CG   1 
ATOM   1220 C  CD   . LYS A 1 76  ? 8.686   -20.642 25.558  1.00 115.62 ? 437 LYS A CD   1 
ATOM   1221 C  CE   . LYS A 1 76  ? 8.328   -19.572 26.580  1.00 121.64 ? 437 LYS A CE   1 
ATOM   1222 N  NZ   . LYS A 1 76  ? 9.482   -18.691 26.884  1.00 107.64 ? 437 LYS A NZ   1 
ATOM   1223 H  H    . LYS A 1 76  ? 4.894   -22.258 23.574  1.00 98.93  ? 437 LYS A H    1 
ATOM   1224 H  HA   . LYS A 1 76  ? 6.701   -20.698 22.269  1.00 90.72  ? 437 LYS A HA   1 
ATOM   1225 H  HB2  . LYS A 1 76  ? 7.660   -22.882 23.740  1.00 95.74  ? 437 LYS A HB2  1 
ATOM   1226 H  HB3  . LYS A 1 76  ? 8.462   -21.587 23.296  1.00 95.74  ? 437 LYS A HB3  1 
ATOM   1227 H  HG2  . LYS A 1 76  ? 6.724   -20.664 25.010  1.00 115.05 ? 437 LYS A HG2  1 
ATOM   1228 H  HG3  . LYS A 1 76  ? 7.202   -22.035 25.659  1.00 115.05 ? 437 LYS A HG3  1 
ATOM   1229 H  HD2  . LYS A 1 76  ? 9.257   -21.298 25.987  1.00 138.74 ? 437 LYS A HD2  1 
ATOM   1230 H  HD3  . LYS A 1 76  ? 9.152   -20.219 24.820  1.00 138.74 ? 437 LYS A HD3  1 
ATOM   1231 H  HE2  . LYS A 1 76  ? 7.611   -19.021 26.228  1.00 145.96 ? 437 LYS A HE2  1 
ATOM   1232 H  HE3  . LYS A 1 76  ? 8.047   -19.999 27.404  1.00 145.96 ? 437 LYS A HE3  1 
ATOM   1233 H  HZ1  . LYS A 1 76  ? 9.246   -18.076 27.482  1.00 129.16 ? 437 LYS A HZ1  1 
ATOM   1234 H  HZ2  . LYS A 1 76  ? 10.154  -19.173 27.214  1.00 129.16 ? 437 LYS A HZ2  1 
ATOM   1235 H  HZ3  . LYS A 1 76  ? 9.756   -18.282 26.142  1.00 129.16 ? 437 LYS A HZ3  1 
ATOM   1236 N  N    . TRP A 1 77  ? 6.212   -22.111 20.331  1.00 70.47  ? 438 TRP A N    1 
ATOM   1237 C  CA   . TRP A 1 77  ? 6.053   -22.979 19.170  1.00 68.42  ? 438 TRP A CA   1 
ATOM   1238 C  C    . TRP A 1 77  ? 7.371   -23.298 18.480  1.00 69.03  ? 438 TRP A C    1 
ATOM   1239 O  O    . TRP A 1 77  ? 7.630   -24.449 18.140  1.00 70.66  ? 438 TRP A O    1 
ATOM   1240 C  CB   . TRP A 1 77  ? 5.117   -22.341 18.153  1.00 64.98  ? 438 TRP A CB   1 
ATOM   1241 C  CG   . TRP A 1 77  ? 3.702   -22.198 18.601  1.00 64.17  ? 438 TRP A CG   1 
ATOM   1242 C  CD1  . TRP A 1 77  ? 2.767   -23.183 18.679  1.00 63.94  ? 438 TRP A CD1  1 
ATOM   1243 C  CD2  . TRP A 1 77  ? 3.051   -20.990 19.001  1.00 63.73  ? 438 TRP A CD2  1 
ATOM   1244 N  NE1  . TRP A 1 77  ? 1.570   -22.664 19.103  1.00 63.33  ? 438 TRP A NE1  1 
ATOM   1245 C  CE2  . TRP A 1 77  ? 1.718   -21.318 19.308  1.00 66.38  ? 438 TRP A CE2  1 
ATOM   1246 C  CE3  . TRP A 1 77  ? 3.464   -19.661 19.127  1.00 64.05  ? 438 TRP A CE3  1 
ATOM   1247 C  CZ2  . TRP A 1 77  ? 0.799   -20.369 19.740  1.00 69.49  ? 438 TRP A CZ2  1 
ATOM   1248 C  CZ3  . TRP A 1 77  ? 2.552   -18.720 19.551  1.00 63.78  ? 438 TRP A CZ3  1 
ATOM   1249 C  CH2  . TRP A 1 77  ? 1.234   -19.078 19.854  1.00 63.91  ? 438 TRP A CH2  1 
ATOM   1250 H  H    . TRP A 1 77  ? 6.172   -21.272 20.145  1.00 84.57  ? 438 TRP A H    1 
ATOM   1251 H  HA   . TRP A 1 77  ? 5.657   -23.817 19.456  1.00 82.10  ? 438 TRP A HA   1 
ATOM   1252 H  HB2  . TRP A 1 77  ? 5.449   -21.454 17.943  1.00 77.98  ? 438 TRP A HB2  1 
ATOM   1253 H  HB3  . TRP A 1 77  ? 5.116   -22.886 17.350  1.00 77.98  ? 438 TRP A HB3  1 
ATOM   1254 H  HD1  . TRP A 1 77  ? 2.915   -24.076 18.467  1.00 76.72  ? 438 TRP A HD1  1 
ATOM   1255 H  HE1  . TRP A 1 77  ? 0.846   -23.112 19.226  1.00 75.99  ? 438 TRP A HE1  1 
ATOM   1256 H  HE3  . TRP A 1 77  ? 4.338   -19.416 18.923  1.00 76.85  ? 438 TRP A HE3  1 
ATOM   1257 H  HZ2  . TRP A 1 77  ? -0.077  -20.604 19.945  1.00 83.39  ? 438 TRP A HZ2  1 
ATOM   1258 H  HZ3  . TRP A 1 77  ? 2.817   -17.833 19.640  1.00 76.54  ? 438 TRP A HZ3  1 
ATOM   1259 H  HH2  . TRP A 1 77  ? 0.641   -18.423 20.143  1.00 76.69  ? 438 TRP A HH2  1 
ATOM   1260 N  N    . ASN A 1 78  ? 8.191   -22.275 18.264  1.00 69.23  ? 439 ASN A N    1 
ATOM   1261 C  CA   . ASN A 1 78  ? 9.449   -22.445 17.549  1.00 69.85  ? 439 ASN A CA   1 
ATOM   1262 C  C    . ASN A 1 78  ? 9.242   -23.173 16.231  1.00 73.66  ? 439 ASN A C    1 
ATOM   1263 O  O    . ASN A 1 78  ? 9.848   -24.216 15.990  1.00 68.53  ? 439 ASN A O    1 
ATOM   1264 C  CB   . ASN A 1 78  ? 10.451  -23.210 18.403  1.00 73.62  ? 439 ASN A CB   1 
ATOM   1265 C  CG   . ASN A 1 78  ? 10.744  -22.511 19.703  1.00 76.48  ? 439 ASN A CG   1 
ATOM   1266 O  OD1  . ASN A 1 78  ? 11.064  -21.323 19.718  1.00 76.55  ? 439 ASN A OD1  1 
ATOM   1267 N  ND2  . ASN A 1 78  ? 10.611  -23.233 20.808  1.00 79.13  ? 439 ASN A ND2  1 
ATOM   1268 H  H    . ASN A 1 78  ? 8.041   -21.468 18.522  1.00 83.08  ? 439 ASN A H    1 
ATOM   1269 H  HA   . ASN A 1 78  ? 9.824   -21.571 17.354  1.00 83.82  ? 439 ASN A HA   1 
ATOM   1270 H  HB2  . ASN A 1 78  ? 10.089  -24.087 18.607  1.00 88.34  ? 439 ASN A HB2  1 
ATOM   1271 H  HB3  . ASN A 1 78  ? 11.283  -23.298 17.914  1.00 88.34  ? 439 ASN A HB3  1 
ATOM   1272 H  HD21 . ASN A 1 78  ? 10.768  -22.878 21.575  1.00 94.95  ? 439 ASN A HD21 1 
ATOM   1273 H  HD22 . ASN A 1 78  ? 10.369  -24.056 20.757  1.00 94.95  ? 439 ASN A HD22 1 
ATOM   1274 N  N    . GLU A 1 79  ? 8.358   -22.636 15.400  1.00 64.38  ? 440 GLU A N    1 
ATOM   1275 C  CA   . GLU A 1 79  ? 8.094   -23.218 14.091  1.00 62.11  ? 440 GLU A CA   1 
ATOM   1276 C  C    . GLU A 1 79  ? 8.560   -22.284 12.981  1.00 60.61  ? 440 GLU A C    1 
ATOM   1277 O  O    . GLU A 1 79  ? 8.755   -21.088 13.203  1.00 60.92  ? 440 GLU A O    1 
ATOM   1278 C  CB   . GLU A 1 79  ? 6.606   -23.535 13.941  1.00 60.32  ? 440 GLU A CB   1 
ATOM   1279 C  CG   . GLU A 1 79  ? 6.141   -24.704 14.808  1.00 63.44  ? 440 GLU A CG   1 
ATOM   1280 C  CD   . GLU A 1 79  ? 4.709   -25.116 14.514  1.00 68.93  ? 440 GLU A CD   1 
ATOM   1281 O  OE1  . GLU A 1 79  ? 4.341   -25.209 13.322  1.00 74.69  ? 440 GLU A OE1  1 
ATOM   1282 O  OE2  . GLU A 1 79  ? 3.946   -25.342 15.472  1.00 64.31  ? 440 GLU A OE2  1 
ATOM   1283 H  H    . GLU A 1 79  ? 7.896   -21.931 15.570  1.00 77.26  ? 440 GLU A H    1 
ATOM   1284 H  HA   . GLU A 1 79  ? 8.587   -24.050 14.010  1.00 74.53  ? 440 GLU A HA   1 
ATOM   1285 H  HB2  . GLU A 1 79  ? 6.092   -22.753 14.196  1.00 72.38  ? 440 GLU A HB2  1 
ATOM   1286 H  HB3  . GLU A 1 79  ? 6.425   -23.761 13.015  1.00 72.38  ? 440 GLU A HB3  1 
ATOM   1287 H  HG2  . GLU A 1 79  ? 6.714   -25.469 14.643  1.00 76.13  ? 440 GLU A HG2  1 
ATOM   1288 H  HG3  . GLU A 1 79  ? 6.193   -24.446 15.742  1.00 76.13  ? 440 GLU A HG3  1 
ATOM   1289 N  N    . VAL A 1 80  ? 8.736   -22.835 11.783  1.00 59.27  ? 441 VAL A N    1 
ATOM   1290 C  CA   . VAL A 1 80  ? 9.183   -22.043 10.644  1.00 66.15  ? 441 VAL A CA   1 
ATOM   1291 C  C    . VAL A 1 80  ? 8.448   -22.460 9.369   1.00 55.62  ? 441 VAL A C    1 
ATOM   1292 O  O    . VAL A 1 80  ? 8.323   -23.646 9.072   1.00 65.74  ? 441 VAL A O    1 
ATOM   1293 C  CB   . VAL A 1 80  ? 10.718  -22.161 10.445  1.00 64.06  ? 441 VAL A CB   1 
ATOM   1294 C  CG1  . VAL A 1 80  ? 11.126  -23.603 10.182  1.00 60.65  ? 441 VAL A CG1  1 
ATOM   1295 C  CG2  . VAL A 1 80  ? 11.188  -21.239 9.323   1.00 59.03  ? 441 VAL A CG2  1 
ATOM   1296 H  H    . VAL A 1 80  ? 8.604   -23.666 11.605  1.00 71.12  ? 441 VAL A H    1 
ATOM   1297 H  HA   . VAL A 1 80  ? 8.978   -21.110 10.813  1.00 79.38  ? 441 VAL A HA   1 
ATOM   1298 H  HB   . VAL A 1 80  ? 11.158  -21.877 11.262  1.00 76.88  ? 441 VAL A HB   1 
ATOM   1299 H  HG11 . VAL A 1 80  ? 12.088  -23.641 10.063  1.00 72.78  ? 441 VAL A HG11 1 
ATOM   1300 H  HG12 . VAL A 1 80  ? 10.865  -24.148 10.941  1.00 72.78  ? 441 VAL A HG12 1 
ATOM   1301 H  HG13 . VAL A 1 80  ? 10.681  -23.915 9.380   1.00 72.78  ? 441 VAL A HG13 1 
ATOM   1302 H  HG21 . VAL A 1 80  ? 12.148  -21.332 9.220   1.00 70.83  ? 441 VAL A HG21 1 
ATOM   1303 H  HG22 . VAL A 1 80  ? 10.741  -21.491 8.500   1.00 70.83  ? 441 VAL A HG22 1 
ATOM   1304 H  HG23 . VAL A 1 80  ? 10.967  -20.324 9.553   1.00 70.83  ? 441 VAL A HG23 1 
ATOM   1305 N  N    . TYR A 1 81  ? 7.942   -21.469 8.640   1.00 54.00  ? 442 TYR A N    1 
ATOM   1306 C  CA   . TYR A 1 81  ? 7.224   -21.702 7.391   1.00 59.90  ? 442 TYR A CA   1 
ATOM   1307 C  C    . TYR A 1 81  ? 7.873   -20.915 6.264   1.00 55.07  ? 442 TYR A C    1 
ATOM   1308 O  O    . TYR A 1 81  ? 8.561   -19.922 6.506   1.00 56.71  ? 442 TYR A O    1 
ATOM   1309 C  CB   . TYR A 1 81  ? 5.752   -21.307 7.525   1.00 55.93  ? 442 TYR A CB   1 
ATOM   1310 C  CG   . TYR A 1 81  ? 5.131   -21.744 8.834   1.00 54.68  ? 442 TYR A CG   1 
ATOM   1311 C  CD1  . TYR A 1 81  ? 4.752   -23.063 9.043   1.00 59.22  ? 442 TYR A CD1  1 
ATOM   1312 C  CD2  . TYR A 1 81  ? 4.933   -20.836 9.860   1.00 58.31  ? 442 TYR A CD2  1 
ATOM   1313 C  CE1  . TYR A 1 81  ? 4.194   -23.466 10.245  1.00 58.81  ? 442 TYR A CE1  1 
ATOM   1314 C  CE2  . TYR A 1 81  ? 4.374   -21.228 11.063  1.00 69.75  ? 442 TYR A CE2  1 
ATOM   1315 C  CZ   . TYR A 1 81  ? 4.004   -22.541 11.252  1.00 69.74  ? 442 TYR A CZ   1 
ATOM   1316 O  OH   . TYR A 1 81  ? 3.446   -22.921 12.455  1.00 71.08  ? 442 TYR A OH   1 
ATOM   1317 H  H    . TYR A 1 81  ? 8.003   -20.638 8.853   1.00 64.80  ? 442 TYR A H    1 
ATOM   1318 H  HA   . TYR A 1 81  ? 7.267   -22.645 7.169   1.00 71.88  ? 442 TYR A HA   1 
ATOM   1319 H  HB2  . TYR A 1 81  ? 5.679   -20.342 7.468   1.00 67.12  ? 442 TYR A HB2  1 
ATOM   1320 H  HB3  . TYR A 1 81  ? 5.250   -21.719 6.805   1.00 67.12  ? 442 TYR A HB3  1 
ATOM   1321 H  HD1  . TYR A 1 81  ? 4.881   -23.688 8.367   1.00 71.07  ? 442 TYR A HD1  1 
ATOM   1322 H  HD2  . TYR A 1 81  ? 5.182   -19.949 9.739   1.00 69.98  ? 442 TYR A HD2  1 
ATOM   1323 H  HE1  . TYR A 1 81  ? 3.943   -24.353 10.370  1.00 70.57  ? 442 TYR A HE1  1 
ATOM   1324 H  HE2  . TYR A 1 81  ? 4.246   -20.605 11.742  1.00 83.70  ? 442 TYR A HE2  1 
ATOM   1325 H  HH   . TYR A 1 81  ? 3.267   -23.742 12.443  1.00 85.29  ? 442 TYR A HH   1 
ATOM   1326 N  N    . GLU A 1 82  ? 7.637   -21.368 5.035   1.00 52.40  ? 443 GLU A N    1 
ATOM   1327 C  CA   . GLU A 1 82  ? 8.189   -20.738 3.842   1.00 49.99  ? 443 GLU A CA   1 
ATOM   1328 C  C    . GLU A 1 82  ? 7.058   -20.347 2.894   1.00 54.65  ? 443 GLU A C    1 
ATOM   1329 O  O    . GLU A 1 82  ? 6.257   -21.191 2.491   1.00 56.27  ? 443 GLU A O    1 
ATOM   1330 C  CB   . GLU A 1 82  ? 9.178   -21.683 3.151   1.00 50.44  ? 443 GLU A CB   1 
ATOM   1331 C  CG   . GLU A 1 82  ? 10.593  -21.593 3.710   1.00 52.47  ? 443 GLU A CG   1 
ATOM   1332 C  CD   . GLU A 1 82  ? 11.534  -22.653 3.158   1.00 53.24  ? 443 GLU A CD   1 
ATOM   1333 O  OE1  . GLU A 1 82  ? 11.051  -23.665 2.602   1.00 59.56  ? 443 GLU A OE1  1 
ATOM   1334 O  OE2  . GLU A 1 82  ? 12.762  -22.470 3.288   1.00 55.01  ? 443 GLU A OE2  1 
ATOM   1335 H  H    . GLU A 1 82  ? 7.149   -22.055 4.864   1.00 62.88  ? 443 GLU A H    1 
ATOM   1336 H  HA   . GLU A 1 82  ? 8.665   -19.932 4.097   1.00 59.99  ? 443 GLU A HA   1 
ATOM   1337 H  HB2  . GLU A 1 82  ? 8.871   -22.596 3.264   1.00 60.52  ? 443 GLU A HB2  1 
ATOM   1338 H  HB3  . GLU A 1 82  ? 9.216   -21.462 2.208   1.00 60.52  ? 443 GLU A HB3  1 
ATOM   1339 H  HG2  . GLU A 1 82  ? 10.963  -20.723 3.489   1.00 62.97  ? 443 GLU A HG2  1 
ATOM   1340 H  HG3  . GLU A 1 82  ? 10.557  -21.699 4.674   1.00 62.97  ? 443 GLU A HG3  1 
ATOM   1341 N  N    . ALA A 1 83  ? 6.985   -19.062 2.559   1.00 48.61  ? 444 ALA A N    1 
ATOM   1342 C  CA   . ALA A 1 83  ? 5.945   -18.557 1.665   1.00 47.66  ? 444 ALA A CA   1 
ATOM   1343 C  C    . ALA A 1 83  ? 6.535   -17.896 0.414   1.00 48.07  ? 444 ALA A C    1 
ATOM   1344 O  O    . ALA A 1 83  ? 7.480   -17.115 0.505   1.00 49.35  ? 444 ALA A O    1 
ATOM   1345 C  CB   . ALA A 1 83  ? 5.067   -17.572 2.401   1.00 47.90  ? 444 ALA A CB   1 
ATOM   1346 H  H    . ALA A 1 83  ? 7.530   -18.458 2.839   1.00 58.33  ? 444 ALA A H    1 
ATOM   1347 H  HA   . ALA A 1 83  ? 5.389   -19.298 1.378   1.00 57.20  ? 444 ALA A HA   1 
ATOM   1348 H  HB1  . ALA A 1 83  ? 4.383   -17.246 1.795   1.00 57.47  ? 444 ALA A HB1  1 
ATOM   1349 H  HB2  . ALA A 1 83  ? 4.655   -18.020 3.156   1.00 57.47  ? 444 ALA A HB2  1 
ATOM   1350 H  HB3  . ALA A 1 83  ? 5.613   -16.834 2.712   1.00 57.47  ? 444 ALA A HB3  1 
ATOM   1351 N  N    . LEU A 1 84  ? 5.976   -18.208 -0.751  1.00 47.27  ? 445 LEU A N    1 
ATOM   1352 C  CA   . LEU A 1 84  ? 6.343   -17.506 -1.976  1.00 48.59  ? 445 LEU A CA   1 
ATOM   1353 C  C    . LEU A 1 84  ? 5.703   -16.129 -1.951  1.00 54.17  ? 445 LEU A C    1 
ATOM   1354 O  O    . LEU A 1 84  ? 4.561   -15.986 -1.522  1.00 48.19  ? 445 LEU A O    1 
ATOM   1355 C  CB   . LEU A 1 84  ? 5.888   -18.269 -3.226  1.00 52.89  ? 445 LEU A CB   1 
ATOM   1356 C  CG   . LEU A 1 84  ? 6.479   -19.654 -3.469  1.00 49.51  ? 445 LEU A CG   1 
ATOM   1357 C  CD1  . LEU A 1 84  ? 5.772   -20.306 -4.656  1.00 51.88  ? 445 LEU A CD1  1 
ATOM   1358 C  CD2  . LEU A 1 84  ? 7.981   -19.585 -3.700  1.00 47.57  ? 445 LEU A CD2  1 
ATOM   1359 H  H    . LEU A 1 84  ? 5.382   -18.821 -0.858  1.00 56.72  ? 445 LEU A H    1 
ATOM   1360 H  HA   . LEU A 1 84  ? 7.306   -17.399 -2.013  1.00 58.30  ? 445 LEU A HA   1 
ATOM   1361 H  HB2  . LEU A 1 84  ? 4.926   -18.377 -3.176  1.00 63.47  ? 445 LEU A HB2  1 
ATOM   1362 H  HB3  . LEU A 1 84  ? 6.106   -17.728 -4.001  1.00 63.47  ? 445 LEU A HB3  1 
ATOM   1363 H  HG   . LEU A 1 84  ? 6.322   -20.206 -2.687  1.00 59.41  ? 445 LEU A HG   1 
ATOM   1364 H  HD11 . LEU A 1 84  ? 6.153   -21.186 -4.805  1.00 62.25  ? 445 LEU A HD11 1 
ATOM   1365 H  HD12 . LEU A 1 84  ? 4.826   -20.383 -4.455  1.00 62.25  ? 445 LEU A HD12 1 
ATOM   1366 H  HD13 . LEU A 1 84  ? 5.900   -19.752 -5.442  1.00 62.25  ? 445 LEU A HD13 1 
ATOM   1367 H  HD21 . LEU A 1 84  ? 8.319   -20.482 -3.851  1.00 57.09  ? 445 LEU A HD21 1 
ATOM   1368 H  HD22 . LEU A 1 84  ? 8.155   -19.031 -4.477  1.00 57.09  ? 445 LEU A HD22 1 
ATOM   1369 H  HD23 . LEU A 1 84  ? 8.403   -19.199 -2.917  1.00 57.09  ? 445 LEU A HD23 1 
ATOM   1370 N  N    . VAL A 1 85  ? 6.437   -15.123 -2.409  1.00 50.10  ? 446 VAL A N    1 
ATOM   1371 C  CA   . VAL A 1 85  ? 5.913   -13.767 -2.480  1.00 58.83  ? 446 VAL A CA   1 
ATOM   1372 C  C    . VAL A 1 85  ? 5.992   -13.243 -3.905  1.00 52.41  ? 446 VAL A C    1 
ATOM   1373 O  O    . VAL A 1 85  ? 7.050   -13.285 -4.532  1.00 55.19  ? 446 VAL A O    1 
ATOM   1374 C  CB   . VAL A 1 85  ? 6.676   -12.820 -1.546  1.00 53.05  ? 446 VAL A CB   1 
ATOM   1375 C  CG1  . VAL A 1 85  ? 6.110   -11.406 -1.642  1.00 67.44  ? 446 VAL A CG1  1 
ATOM   1376 C  CG2  . VAL A 1 85  ? 6.599   -13.335 -0.110  1.00 53.05  ? 446 VAL A CG2  1 
ATOM   1377 H  H    . VAL A 1 85  ? 7.247   -15.200 -2.686  1.00 60.12  ? 446 VAL A H    1 
ATOM   1378 H  HA   . VAL A 1 85  ? 4.981   -13.771 -2.211  1.00 70.59  ? 446 VAL A HA   1 
ATOM   1379 H  HB   . VAL A 1 85  ? 7.609   -12.793 -1.810  1.00 63.65  ? 446 VAL A HB   1 
ATOM   1380 H  HG11 . VAL A 1 85  ? 6.607   -10.826 -1.044  1.00 80.92  ? 446 VAL A HG11 1 
ATOM   1381 H  HG12 . VAL A 1 85  ? 6.198   -11.093 -2.556  1.00 80.92  ? 446 VAL A HG12 1 
ATOM   1382 H  HG13 . VAL A 1 85  ? 5.175   -11.423 -1.386  1.00 80.92  ? 446 VAL A HG13 1 
ATOM   1383 H  HG21 . VAL A 1 85  ? 7.085   -12.727 0.470   1.00 63.66  ? 446 VAL A HG21 1 
ATOM   1384 H  HG22 . VAL A 1 85  ? 5.668   -13.377 0.161   1.00 63.66  ? 446 VAL A HG22 1 
ATOM   1385 H  HG23 . VAL A 1 85  ? 6.996   -14.219 -0.070  1.00 63.66  ? 446 VAL A HG23 1 
ATOM   1386 N  N    . TYR A 1 86  ? 4.860   -12.752 -4.397  1.00 61.97  ? 447 TYR A N    1 
ATOM   1387 C  CA   . TYR A 1 86  ? 4.756   -12.209 -5.744  1.00 72.10  ? 447 TYR A CA   1 
ATOM   1388 C  C    . TYR A 1 86  ? 4.516   -10.704 -5.693  1.00 81.06  ? 447 TYR A C    1 
ATOM   1389 O  O    . TYR A 1 86  ? 4.222   -10.148 -4.636  1.00 83.91  ? 447 TYR A O    1 
ATOM   1390 C  CB   . TYR A 1 86  ? 3.619   -12.893 -6.510  1.00 56.52  ? 447 TYR A CB   1 
ATOM   1391 C  CG   . TYR A 1 86  ? 3.836   -14.370 -6.774  1.00 58.17  ? 447 TYR A CG   1 
ATOM   1392 C  CD1  . TYR A 1 86  ? 4.497   -14.799 -7.915  1.00 64.43  ? 447 TYR A CD1  1 
ATOM   1393 C  CD2  . TYR A 1 86  ? 3.372   -15.335 -5.886  1.00 71.19  ? 447 TYR A CD2  1 
ATOM   1394 C  CE1  . TYR A 1 86  ? 4.696   -16.145 -8.167  1.00 56.18  ? 447 TYR A CE1  1 
ATOM   1395 C  CE2  . TYR A 1 86  ? 3.567   -16.690 -6.133  1.00 51.38  ? 447 TYR A CE2  1 
ATOM   1396 C  CZ   . TYR A 1 86  ? 4.231   -17.086 -7.275  1.00 59.59  ? 447 TYR A CZ   1 
ATOM   1397 O  OH   . TYR A 1 86  ? 4.434   -18.423 -7.532  1.00 86.30  ? 447 TYR A OH   1 
ATOM   1398 H  H    . TYR A 1 86  ? 4.121   -12.723 -3.958  1.00 74.37  ? 447 TYR A H    1 
ATOM   1399 H  HA   . TYR A 1 86  ? 5.586   -12.370 -6.220  1.00 86.52  ? 447 TYR A HA   1 
ATOM   1400 H  HB2  . TYR A 1 86  ? 2.801   -12.804 -5.996  1.00 67.82  ? 447 TYR A HB2  1 
ATOM   1401 H  HB3  . TYR A 1 86  ? 3.515   -12.453 -7.368  1.00 67.82  ? 447 TYR A HB3  1 
ATOM   1402 H  HD1  . TYR A 1 86  ? 4.814   -14.170 -8.522  1.00 77.31  ? 447 TYR A HD1  1 
ATOM   1403 H  HD2  . TYR A 1 86  ? 2.924   -15.071 -5.115  1.00 85.42  ? 447 TYR A HD2  1 
ATOM   1404 H  HE1  . TYR A 1 86  ? 5.143   -16.414 -8.937  1.00 67.41  ? 447 TYR A HE1  1 
ATOM   1405 H  HE2  . TYR A 1 86  ? 3.253   -17.325 -5.530  1.00 61.66  ? 447 TYR A HE2  1 
ATOM   1406 H  HH   . TYR A 1 86  ? 4.104   -18.887 -6.915  1.00 103.56 ? 447 TYR A HH   1 
ATOM   1407 N  N    . GLU A 1 87  ? 4.640   -10.050 -6.841  1.00 76.05  ? 448 GLU A N    1 
ATOM   1408 C  CA   . GLU A 1 87  ? 4.292   -8.641  -6.954  1.00 66.14  ? 448 GLU A CA   1 
ATOM   1409 C  C    . GLU A 1 87  ? 2.796   -8.466  -6.723  1.00 72.56  ? 448 GLU A C    1 
ATOM   1410 O  O    . GLU A 1 87  ? 1.971   -8.952  -7.496  1.00 83.73  ? 448 GLU A O    1 
ATOM   1411 C  CB   . GLU A 1 87  ? 4.692   -8.088  -8.323  1.00 82.88  ? 448 GLU A CB   1 
ATOM   1412 C  CG   . GLU A 1 87  ? 4.281   -6.641  -8.545  1.00 98.22  ? 448 GLU A CG   1 
ATOM   1413 C  CD   . GLU A 1 87  ? 4.767   -5.727  -7.438  1.00 118.46 ? 448 GLU A CD   1 
ATOM   1414 O  OE1  . GLU A 1 87  ? 5.981   -5.747  -7.141  1.00 117.72 ? 448 GLU A OE1  1 
ATOM   1415 O  OE2  . GLU A 1 87  ? 3.934   -4.999  -6.857  1.00 118.88 ? 448 GLU A OE2  1 
ATOM   1416 H  H    . GLU A 1 87  ? 4.925   -10.401 -7.573  1.00 91.26  ? 448 GLU A H    1 
ATOM   1417 H  HA   . GLU A 1 87  ? 4.766   -8.138  -6.273  1.00 79.36  ? 448 GLU A HA   1 
ATOM   1418 H  HB2  . GLU A 1 87  ? 5.656   -8.139  -8.411  1.00 99.46  ? 448 GLU A HB2  1 
ATOM   1419 H  HB3  . GLU A 1 87  ? 4.270   -8.625  -9.011  1.00 99.46  ? 448 GLU A HB3  1 
ATOM   1420 H  HG2  . GLU A 1 87  ? 4.660   -6.329  -9.382  1.00 117.86 ? 448 GLU A HG2  1 
ATOM   1421 H  HG3  . GLU A 1 87  ? 3.313   -6.588  -8.577  1.00 117.86 ? 448 GLU A HG3  1 
ATOM   1422 N  N    . HIS A 1 88  ? 2.456   -7.773  -5.644  1.00 81.63  ? 449 HIS A N    1 
ATOM   1423 C  CA   . HIS A 1 88  ? 1.070   -7.595  -5.250  1.00 84.56  ? 449 HIS A CA   1 
ATOM   1424 C  C    . HIS A 1 88  ? 1.024   -6.445  -4.250  1.00 95.96  ? 449 HIS A C    1 
ATOM   1425 O  O    . HIS A 1 88  ? 1.221   -6.657  -3.054  1.00 92.33  ? 449 HIS A O    1 
ATOM   1426 C  CB   . HIS A 1 88  ? 0.513   -8.893  -4.654  1.00 98.61  ? 449 HIS A CB   1 
ATOM   1427 C  CG   . HIS A 1 88  ? -0.980  -8.923  -4.532  1.00 116.25 ? 449 HIS A CG   1 
ATOM   1428 N  ND1  . HIS A 1 88  ? -1.743  -7.785  -4.380  1.00 119.09 ? 449 HIS A ND1  1 
ATOM   1429 C  CD2  . HIS A 1 88  ? -1.851  -9.960  -4.540  1.00 112.40 ? 449 HIS A CD2  1 
ATOM   1430 C  CE1  . HIS A 1 88  ? -3.019  -8.120  -4.298  1.00 108.60 ? 449 HIS A CE1  1 
ATOM   1431 N  NE2  . HIS A 1 88  ? -3.111  -9.434  -4.393  1.00 106.60 ? 449 HIS A NE2  1 
ATOM   1432 H  H    . HIS A 1 88  ? 3.019   -7.392  -5.118  1.00 97.95  ? 449 HIS A H    1 
ATOM   1433 H  HA   . HIS A 1 88  ? 0.538   -7.355  -6.025  1.00 101.47 ? 449 HIS A HA   1 
ATOM   1434 H  HB2  . HIS A 1 88  ? 0.778   -9.634  -5.221  1.00 118.34 ? 449 HIS A HB2  1 
ATOM   1435 H  HB3  . HIS A 1 88  ? 0.884   -9.012  -3.766  1.00 118.34 ? 449 HIS A HB3  1 
ATOM   1436 H  HD1  . HIS A 1 88  ? -1.436  -6.982  -4.343  1.00 142.91 ? 449 HIS A HD1  1 
ATOM   1437 H  HD2  . HIS A 1 88  ? -1.636  -10.861 -4.628  1.00 134.88 ? 449 HIS A HD2  1 
ATOM   1438 H  HE1  . HIS A 1 88  ? -3.730  -7.531  -4.193  1.00 130.33 ? 449 HIS A HE1  1 
ATOM   1439 H  HE2  . HIS A 1 88  ? -3.842  -9.886  -4.368  1.00 127.92 ? 449 HIS A HE2  1 
ATOM   1440 N  N    . PRO A 1 89  ? 0.796   -5.213  -4.740  1.00 100.51 ? 450 PRO A N    1 
ATOM   1441 C  CA   . PRO A 1 89  ? 0.832   -4.040  -3.859  1.00 91.98  ? 450 PRO A CA   1 
ATOM   1442 C  C    . PRO A 1 89  ? -0.138  -4.145  -2.690  1.00 82.92  ? 450 PRO A C    1 
ATOM   1443 O  O    . PRO A 1 89  ? -1.233  -4.683  -2.846  1.00 83.26  ? 450 PRO A O    1 
ATOM   1444 C  CB   . PRO A 1 89  ? 0.433   -2.889  -4.787  1.00 92.82  ? 450 PRO A CB   1 
ATOM   1445 C  CG   . PRO A 1 89  ? 0.771   -3.362  -6.153  1.00 83.81  ? 450 PRO A CG   1 
ATOM   1446 C  CD   . PRO A 1 89  ? 0.521   -4.837  -6.140  1.00 90.10  ? 450 PRO A CD   1 
ATOM   1447 H  HA   . PRO A 1 89  ? 1.731   -3.892  -3.526  1.00 110.38 ? 450 PRO A HA   1 
ATOM   1448 H  HB2  . PRO A 1 89  ? -0.518  -2.719  -4.708  1.00 111.39 ? 450 PRO A HB2  1 
ATOM   1449 H  HB3  . PRO A 1 89  ? 0.945   -2.095  -4.563  1.00 111.39 ? 450 PRO A HB3  1 
ATOM   1450 H  HG2  . PRO A 1 89  ? 0.196   -2.924  -6.801  1.00 100.57 ? 450 PRO A HG2  1 
ATOM   1451 H  HG3  . PRO A 1 89  ? 1.704   -3.175  -6.342  1.00 100.57 ? 450 PRO A HG3  1 
ATOM   1452 H  HD2  . PRO A 1 89  ? -0.403  -5.026  -6.366  1.00 108.12 ? 450 PRO A HD2  1 
ATOM   1453 H  HD3  . PRO A 1 89  ? 1.135   -5.290  -6.739  1.00 108.12 ? 450 PRO A HD3  1 
ATOM   1454 N  N    . GLY A 1 90  ? 0.279   -3.641  -1.532  1.00 85.53  ? 451 GLY A N    1 
ATOM   1455 C  CA   . GLY A 1 90  ? -0.558  -3.631  -0.347  1.00 77.82  ? 451 GLY A CA   1 
ATOM   1456 C  C    . GLY A 1 90  ? -0.760  -4.999  0.279   1.00 84.73  ? 451 GLY A C    1 
ATOM   1457 O  O    . GLY A 1 90  ? -1.651  -5.177  1.113   1.00 84.64  ? 451 GLY A O    1 
ATOM   1458 H  H    . GLY A 1 90  ? 1.056   -3.294  -1.410  1.00 102.64 ? 451 GLY A H    1 
ATOM   1459 H  HA2  . GLY A 1 90  ? -0.158  -3.050  0.319   1.00 93.38  ? 451 GLY A HA2  1 
ATOM   1460 H  HA3  . GLY A 1 90  ? -1.430  -3.273  -0.577  1.00 93.38  ? 451 GLY A HA3  1 
ATOM   1461 N  N    . GLN A 1 91  ? 0.070   -5.964  -0.107  1.00 82.67  ? 452 GLN A N    1 
ATOM   1462 C  CA   . GLN A 1 91  ? -0.037  -7.314  0.436   1.00 77.25  ? 452 GLN A CA   1 
ATOM   1463 C  C    . GLN A 1 91  ? 0.600   -7.365  1.817   1.00 76.94  ? 452 GLN A C    1 
ATOM   1464 O  O    . GLN A 1 91  ? 1.616   -6.714  2.073   1.00 77.82  ? 452 GLN A O    1 
ATOM   1465 C  CB   . GLN A 1 91  ? 0.622   -8.334  -0.495  1.00 89.94  ? 452 GLN A CB   1 
ATOM   1466 C  CG   . GLN A 1 91  ? 0.206   -9.772  -0.232  1.00 91.83  ? 452 GLN A CG   1 
ATOM   1467 C  CD   . GLN A 1 91  ? 0.865   -10.756 -1.183  1.00 89.65  ? 452 GLN A CD   1 
ATOM   1468 O  OE1  . GLN A 1 91  ? 1.798   -10.410 -1.909  1.00 100.71 ? 452 GLN A OE1  1 
ATOM   1469 N  NE2  . GLN A 1 91  ? 0.378   -11.991 -1.183  1.00 86.88  ? 452 GLN A NE2  1 
ATOM   1470 H  H    . GLN A 1 91  ? 0.702   -5.863  -0.681  1.00 99.20  ? 452 GLN A H    1 
ATOM   1471 H  HA   . GLN A 1 91  ? -0.974  -7.548  0.526   1.00 92.70  ? 452 GLN A HA   1 
ATOM   1472 H  HB2  . GLN A 1 91  ? 0.383   -8.120  -1.411  1.00 107.93 ? 452 GLN A HB2  1 
ATOM   1473 H  HB3  . GLN A 1 91  ? 1.584   -8.280  -0.386  1.00 107.93 ? 452 GLN A HB3  1 
ATOM   1474 H  HG2  . GLN A 1 91  ? 0.459   -10.014 0.673   1.00 110.19 ? 452 GLN A HG2  1 
ATOM   1475 H  HG3  . GLN A 1 91  ? -0.755  -9.849  -0.339  1.00 110.19 ? 452 GLN A HG3  1 
ATOM   1476 H  HE21 . GLN A 1 91  ? -0.276  -12.195 -0.663  1.00 104.25 ? 452 GLN A HE21 1 
ATOM   1477 H  HE22 . GLN A 1 91  ? 0.716   -12.586 -1.704  1.00 104.25 ? 452 GLN A HE22 1 
ATOM   1478 N  N    . GLU A 1 92  ? -0.005  -8.148  2.702   1.00 68.91  ? 453 GLU A N    1 
ATOM   1479 C  CA   . GLU A 1 92  ? 0.396   -8.177  4.097   1.00 70.53  ? 453 GLU A CA   1 
ATOM   1480 C  C    . GLU A 1 92  ? 0.542   -9.599  4.617   1.00 70.16  ? 453 GLU A C    1 
ATOM   1481 O  O    . GLU A 1 92  ? -0.115  -10.519 4.134   1.00 66.71  ? 453 GLU A O    1 
ATOM   1482 C  CB   . GLU A 1 92  ? -0.624  -7.417  4.947   1.00 65.86  ? 453 GLU A CB   1 
ATOM   1483 C  CG   . GLU A 1 92  ? -0.691  -5.924  4.655   1.00 84.72  ? 453 GLU A CG   1 
ATOM   1484 C  CD   . GLU A 1 92  ? -1.790  -5.222  5.437   1.00 113.57 ? 453 GLU A CD   1 
ATOM   1485 O  OE1  . GLU A 1 92  ? -2.583  -5.913  6.112   1.00 108.41 ? 453 GLU A OE1  1 
ATOM   1486 O  OE2  . GLU A 1 92  ? -1.860  -3.975  5.377   1.00 124.34 ? 453 GLU A OE2  1 
ATOM   1487 H  H    . GLU A 1 92  ? -0.657  -8.677  2.515   1.00 82.70  ? 453 GLU A H    1 
ATOM   1488 H  HA   . GLU A 1 92  ? 1.254   -7.734  4.189   1.00 84.63  ? 453 GLU A HA   1 
ATOM   1489 H  HB2  . GLU A 1 92  ? -1.504  -7.790  4.784   1.00 79.03  ? 453 GLU A HB2  1 
ATOM   1490 H  HB3  . GLU A 1 92  ? -0.391  -7.525  5.883   1.00 79.03  ? 453 GLU A HB3  1 
ATOM   1491 H  HG2  . GLU A 1 92  ? 0.156   -5.516  4.895   1.00 101.66 ? 453 GLU A HG2  1 
ATOM   1492 H  HG3  . GLU A 1 92  ? -0.866  -5.795  3.710   1.00 101.66 ? 453 GLU A HG3  1 
ATOM   1493 N  N    . LEU A 1 93  ? 1.422   -9.770  5.598   1.00 62.50  ? 454 LEU A N    1 
ATOM   1494 C  CA   . LEU A 1 93  ? 1.477   -11.002 6.367   1.00 54.00  ? 454 LEU A CA   1 
ATOM   1495 C  C    . LEU A 1 93  ? 0.387   -10.938 7.433   1.00 54.10  ? 454 LEU A C    1 
ATOM   1496 O  O    . LEU A 1 93  ? 0.388   -10.038 8.272   1.00 62.37  ? 454 LEU A O    1 
ATOM   1497 C  CB   . LEU A 1 93  ? 2.856   -11.192 6.996   1.00 54.73  ? 454 LEU A CB   1 
ATOM   1498 C  CG   . LEU A 1 93  ? 2.979   -12.343 7.997   1.00 63.89  ? 454 LEU A CG   1 
ATOM   1499 C  CD1  . LEU A 1 93  ? 2.720   -13.673 7.311   1.00 61.84  ? 454 LEU A CD1  1 
ATOM   1500 C  CD2  . LEU A 1 93  ? 4.338   -12.338 8.679   1.00 65.44  ? 454 LEU A CD2  1 
ATOM   1501 H  H    . LEU A 1 93  ? 2.001   -9.181  5.837   1.00 74.99  ? 454 LEU A H    1 
ATOM   1502 H  HA   . LEU A 1 93  ? 1.296   -11.756 5.785   1.00 64.80  ? 454 LEU A HA   1 
ATOM   1503 H  HB2  . LEU A 1 93  ? 3.496   -11.356 6.286   1.00 65.67  ? 454 LEU A HB2  1 
ATOM   1504 H  HB3  . LEU A 1 93  ? 3.094   -10.376 7.463   1.00 65.67  ? 454 LEU A HB3  1 
ATOM   1505 H  HG   . LEU A 1 93  ? 2.304   -12.230 8.684   1.00 76.66  ? 454 LEU A HG   1 
ATOM   1506 H  HD11 . LEU A 1 93  ? 2.804   -14.386 7.964   1.00 74.20  ? 454 LEU A HD11 1 
ATOM   1507 H  HD12 . LEU A 1 93  ? 1.824   -13.667 6.940   1.00 74.20  ? 454 LEU A HD12 1 
ATOM   1508 H  HD13 . LEU A 1 93  ? 3.371   -13.795 6.603   1.00 74.20  ? 454 LEU A HD13 1 
ATOM   1509 H  HD21 . LEU A 1 93  ? 4.381   -13.078 9.304   1.00 78.53  ? 454 LEU A HD21 1 
ATOM   1510 H  HD22 . LEU A 1 93  ? 5.030   -12.433 8.006   1.00 78.53  ? 454 LEU A HD22 1 
ATOM   1511 H  HD23 . LEU A 1 93  ? 4.450   -11.498 9.152   1.00 78.53  ? 454 LEU A HD23 1 
ATOM   1512 N  N    . GLU A 1 94  ? -0.547  -11.882 7.381   1.00 55.74  ? 455 GLU A N    1 
ATOM   1513 C  CA   . GLU A 1 94  ? -1.683  -11.908 8.301   1.00 54.87  ? 455 GLU A CA   1 
ATOM   1514 C  C    . GLU A 1 94  ? -1.552  -13.059 9.290   1.00 60.47  ? 455 GLU A C    1 
ATOM   1515 O  O    . GLU A 1 94  ? -1.339  -14.205 8.893   1.00 56.19  ? 455 GLU A O    1 
ATOM   1516 C  CB   . GLU A 1 94  ? -3.004  -12.035 7.531   1.00 58.82  ? 455 GLU A CB   1 
ATOM   1517 C  CG   . GLU A 1 94  ? -3.303  -10.882 6.584   1.00 82.83  ? 455 GLU A CG   1 
ATOM   1518 C  CD   . GLU A 1 94  ? -4.659  -11.018 5.904   1.00 98.42  ? 455 GLU A CD   1 
ATOM   1519 O  OE1  . GLU A 1 94  ? -5.229  -12.131 5.911   1.00 99.92  ? 455 GLU A OE1  1 
ATOM   1520 O  OE2  . GLU A 1 94  ? -5.160  -10.009 5.366   1.00 88.47  ? 455 GLU A OE2  1 
ATOM   1521 H  H    . GLU A 1 94  ? -0.547  -12.529 6.814   1.00 66.88  ? 455 GLU A H    1 
ATOM   1522 H  HA   . GLU A 1 94  ? -1.705  -11.079 8.804   1.00 65.85  ? 455 GLU A HA   1 
ATOM   1523 H  HB2  . GLU A 1 94  ? -2.977  -12.848 7.004   1.00 70.59  ? 455 GLU A HB2  1 
ATOM   1524 H  HB3  . GLU A 1 94  ? -3.731  -12.085 8.171   1.00 70.59  ? 455 GLU A HB3  1 
ATOM   1525 H  HG2  . GLU A 1 94  ? -3.300  -10.052 7.086   1.00 99.40  ? 455 GLU A HG2  1 
ATOM   1526 H  HG3  . GLU A 1 94  ? -2.622  -10.856 5.894   1.00 99.40  ? 455 GLU A HG3  1 
ATOM   1527 N  N    . ILE A 1 95  ? -1.681  -12.746 10.576  1.00 54.49  ? 456 ILE A N    1 
ATOM   1528 C  CA   . ILE A 1 95  ? -1.589  -13.752 11.624  1.00 59.38  ? 456 ILE A CA   1 
ATOM   1529 C  C    . ILE A 1 95  ? -2.759  -13.618 12.582  1.00 58.34  ? 456 ILE A C    1 
ATOM   1530 O  O    . ILE A 1 95  ? -3.028  -12.533 13.087  1.00 57.45  ? 456 ILE A O    1 
ATOM   1531 C  CB   . ILE A 1 95  ? -0.271  -13.632 12.407  1.00 70.73  ? 456 ILE A CB   1 
ATOM   1532 C  CG1  . ILE A 1 95  ? 0.910   -13.945 11.488  1.00 59.37  ? 456 ILE A CG1  1 
ATOM   1533 C  CG2  . ILE A 1 95  ? -0.266  -14.575 13.625  1.00 56.48  ? 456 ILE A CG2  1 
ATOM   1534 C  CD1  . ILE A 1 95  ? 2.246   -13.559 12.063  1.00 61.46  ? 456 ILE A CD1  1 
ATOM   1535 H  H    . ILE A 1 95  ? -1.824  -11.950 10.868  1.00 65.38  ? 456 ILE A H    1 
ATOM   1536 H  HA   . ILE A 1 95  ? -1.624  -14.635 11.224  1.00 71.26  ? 456 ILE A HA   1 
ATOM   1537 H  HB   . ILE A 1 95  ? -0.183  -12.719 12.723  1.00 84.87  ? 456 ILE A HB   1 
ATOM   1538 H  HG12 . ILE A 1 95  ? 0.927   -14.900 11.315  1.00 71.25  ? 456 ILE A HG12 1 
ATOM   1539 H  HG13 . ILE A 1 95  ? 0.795   -13.462 10.654  1.00 71.25  ? 456 ILE A HG13 1 
ATOM   1540 H  HG21 . ILE A 1 95  ? 0.575   -14.477 14.097  1.00 67.77  ? 456 ILE A HG21 1 
ATOM   1541 H  HG22 . ILE A 1 95  ? -1.003  -14.339 14.210  1.00 67.77  ? 456 ILE A HG22 1 
ATOM   1542 H  HG23 . ILE A 1 95  ? -0.368  -15.489 13.316  1.00 67.77  ? 456 ILE A HG23 1 
ATOM   1543 H  HD11 . ILE A 1 95  ? 2.941   -13.788 11.426  1.00 73.75  ? 456 ILE A HD11 1 
ATOM   1544 H  HD12 . ILE A 1 95  ? 2.252   -12.604 12.231  1.00 73.75  ? 456 ILE A HD12 1 
ATOM   1545 H  HD13 . ILE A 1 95  ? 2.384   -14.043 12.892  1.00 73.75  ? 456 ILE A HD13 1 
ATOM   1546 N  N    . GLU A 1 96  ? -3.451  -14.728 12.817  1.00 61.28  ? 457 GLU A N    1 
ATOM   1547 C  CA   . GLU A 1 96  ? -4.505  -14.794 13.820  1.00 54.68  ? 457 GLU A CA   1 
ATOM   1548 C  C    . GLU A 1 96  ? -4.197  -15.902 14.826  1.00 57.24  ? 457 GLU A C    1 
ATOM   1549 O  O    . GLU A 1 96  ? -3.825  -17.011 14.442  1.00 61.15  ? 457 GLU A O    1 
ATOM   1550 C  CB   . GLU A 1 96  ? -5.868  -15.034 13.167  1.00 68.34  ? 457 GLU A CB   1 
ATOM   1551 C  CG   . GLU A 1 96  ? -6.484  -13.794 12.533  1.00 65.35  ? 457 GLU A CG   1 
ATOM   1552 C  CD   . GLU A 1 96  ? -7.968  -13.960 12.239  1.00 74.53  ? 457 GLU A CD   1 
ATOM   1553 O  OE1  . GLU A 1 96  ? -8.337  -14.082 11.051  1.00 67.65  ? 457 GLU A OE1  1 
ATOM   1554 O  OE2  . GLU A 1 96  ? -8.767  -13.960 13.198  1.00 69.42  ? 457 GLU A OE2  1 
ATOM   1555 H  H    . GLU A 1 96  ? -3.325  -15.470 12.400  1.00 73.53  ? 457 GLU A H    1 
ATOM   1556 H  HA   . GLU A 1 96  ? -4.543  -13.952 14.299  1.00 65.61  ? 457 GLU A HA   1 
ATOM   1557 H  HB2  . GLU A 1 96  ? -5.766  -15.701 12.470  1.00 82.01  ? 457 GLU A HB2  1 
ATOM   1558 H  HB3  . GLU A 1 96  ? -6.484  -15.358 13.842  1.00 82.01  ? 457 GLU A HB3  1 
ATOM   1559 H  HG2  . GLU A 1 96  ? -6.381  -13.045 13.140  1.00 78.42  ? 457 GLU A HG2  1 
ATOM   1560 H  HG3  . GLU A 1 96  ? -6.031  -13.609 11.696  1.00 78.42  ? 457 GLU A HG3  1 
ATOM   1561 N  N    . LEU A 1 97  ? -4.347  -15.587 16.112  1.00 55.54  ? 458 LEU A N    1 
ATOM   1562 C  CA   . LEU A 1 97  ? -4.145  -16.564 17.185  1.00 56.51  ? 458 LEU A CA   1 
ATOM   1563 C  C    . LEU A 1 97  ? -5.475  -16.995 17.782  1.00 67.61  ? 458 LEU A C    1 
ATOM   1564 O  O    . LEU A 1 97  ? -6.351  -16.167 18.031  1.00 62.10  ? 458 LEU A O    1 
ATOM   1565 C  CB   . LEU A 1 97  ? -3.256  -15.991 18.281  1.00 58.38  ? 458 LEU A CB   1 
ATOM   1566 C  CG   . LEU A 1 97  ? -1.794  -15.720 17.936  1.00 68.20  ? 458 LEU A CG   1 
ATOM   1567 C  CD1  . LEU A 1 97  ? -1.072  -15.263 19.191  1.00 71.39  ? 458 LEU A CD1  1 
ATOM   1568 C  CD2  . LEU A 1 97  ? -1.108  -16.942 17.342  1.00 64.96  ? 458 LEU A CD2  1 
ATOM   1569 H  H    . LEU A 1 97  ? -4.569  -14.806 16.393  1.00 66.65  ? 458 LEU A H    1 
ATOM   1570 H  HA   . LEU A 1 97  ? -3.708  -17.350 16.822  1.00 67.81  ? 458 LEU A HA   1 
ATOM   1571 H  HB2  . LEU A 1 97  ? -3.641  -15.148 18.568  1.00 70.06  ? 458 LEU A HB2  1 
ATOM   1572 H  HB3  . LEU A 1 97  ? -3.261  -16.612 19.026  1.00 70.06  ? 458 LEU A HB3  1 
ATOM   1573 H  HG   . LEU A 1 97  ? -1.749  -15.003 17.285  1.00 81.84  ? 458 LEU A HG   1 
ATOM   1574 H  HD11 . LEU A 1 97  ? -0.142  -15.090 18.975  1.00 85.67  ? 458 LEU A HD11 1 
ATOM   1575 H  HD12 . LEU A 1 97  ? -1.492  -14.453 19.519  1.00 85.67  ? 458 LEU A HD12 1 
ATOM   1576 H  HD13 . LEU A 1 97  ? -1.132  -15.962 19.861  1.00 85.67  ? 458 LEU A HD13 1 
ATOM   1577 H  HD21 . LEU A 1 97  ? -0.185  -16.719 17.141  1.00 77.96  ? 458 LEU A HD21 1 
ATOM   1578 H  HD22 . LEU A 1 97  ? -1.141  -17.667 17.986  1.00 77.96  ? 458 LEU A HD22 1 
ATOM   1579 H  HD23 . LEU A 1 97  ? -1.571  -17.200 16.529  1.00 77.96  ? 458 LEU A HD23 1 
ATOM   1580 N  N    . PHE A 1 98  ? -5.622  -18.297 18.002  1.00 57.08  ? 459 PHE A N    1 
ATOM   1581 C  CA   . PHE A 1 98  ? -6.852  -18.845 18.550  1.00 57.78  ? 459 PHE A CA   1 
ATOM   1582 C  C    . PHE A 1 98  ? -6.575  -19.740 19.751  1.00 65.48  ? 459 PHE A C    1 
ATOM   1583 O  O    . PHE A 1 98  ? -5.464  -20.234 19.933  1.00 60.15  ? 459 PHE A O    1 
ATOM   1584 C  CB   . PHE A 1 98  ? -7.612  -19.646 17.495  1.00 69.09  ? 459 PHE A CB   1 
ATOM   1585 C  CG   . PHE A 1 98  ? -8.076  -18.832 16.317  1.00 64.09  ? 459 PHE A CG   1 
ATOM   1586 C  CD1  . PHE A 1 98  ? -9.284  -18.151 16.356  1.00 61.38  ? 459 PHE A CD1  1 
ATOM   1587 C  CD2  . PHE A 1 98  ? -7.315  -18.765 15.162  1.00 61.49  ? 459 PHE A CD2  1 
ATOM   1588 C  CE1  . PHE A 1 98  ? -9.719  -17.409 15.261  1.00 61.83  ? 459 PHE A CE1  1 
ATOM   1589 C  CE2  . PHE A 1 98  ? -7.751  -18.025 14.063  1.00 57.15  ? 459 PHE A CE2  1 
ATOM   1590 C  CZ   . PHE A 1 98  ? -8.951  -17.348 14.119  1.00 54.66  ? 459 PHE A CZ   1 
ATOM   1591 H  H    . PHE A 1 98  ? -5.017  -18.887 17.840  1.00 68.49  ? 459 PHE A H    1 
ATOM   1592 H  HA   . PHE A 1 98  ? -7.421  -18.115 18.843  1.00 69.34  ? 459 PHE A HA   1 
ATOM   1593 H  HB2  . PHE A 1 98  ? -7.031  -20.347 17.159  1.00 82.91  ? 459 PHE A HB2  1 
ATOM   1594 H  HB3  . PHE A 1 98  ? -8.395  -20.040 17.909  1.00 82.91  ? 459 PHE A HB3  1 
ATOM   1595 H  HD1  . PHE A 1 98  ? -9.808  -18.189 17.123  1.00 73.66  ? 459 PHE A HD1  1 
ATOM   1596 H  HD2  . PHE A 1 98  ? -6.505  -19.220 15.117  1.00 73.78  ? 459 PHE A HD2  1 
ATOM   1597 H  HE1  . PHE A 1 98  ? -10.529 -16.954 15.301  1.00 74.19  ? 459 PHE A HE1  1 
ATOM   1598 H  HE2  . PHE A 1 98  ? -7.229  -17.983 13.294  1.00 68.58  ? 459 PHE A HE2  1 
ATOM   1599 H  HZ   . PHE A 1 98  ? -9.240  -16.851 13.389  1.00 65.59  ? 459 PHE A HZ   1 
ATOM   1600 N  N    . ASP A 1 99  ? -7.610  -19.937 20.557  1.00 60.89  ? 460 ASP A N    1 
ATOM   1601 C  CA   . ASP A 1 99  ? -7.605  -20.909 21.637  1.00 66.95  ? 460 ASP A CA   1 
ATOM   1602 C  C    . ASP A 1 99  ? -8.347  -22.145 21.147  1.00 77.86  ? 460 ASP A C    1 
ATOM   1603 O  O    . ASP A 1 99  ? -9.533  -22.063 20.837  1.00 71.79  ? 460 ASP A O    1 
ATOM   1604 C  CB   . ASP A 1 99  ? -8.283  -20.320 22.880  1.00 79.22  ? 460 ASP A CB   1 
ATOM   1605 C  CG   . ASP A 1 99  ? -7.900  -21.031 24.158  1.00 93.34  ? 460 ASP A CG   1 
ATOM   1606 O  OD1  . ASP A 1 99  ? -7.857  -22.280 24.178  1.00 100.16 ? 460 ASP A OD1  1 
ATOM   1607 O  OD2  . ASP A 1 99  ? -7.650  -20.322 25.153  1.00 116.98 ? 460 ASP A OD2  1 
ATOM   1608 H  H    . ASP A 1 99  ? -8.351  -19.504 20.493  1.00 73.06  ? 460 ASP A H    1 
ATOM   1609 H  HA   . ASP A 1 99  ? -6.694  -21.154 21.860  1.00 80.34  ? 460 ASP A HA   1 
ATOM   1610 H  HB2  . ASP A 1 99  ? -8.025  -19.389 22.967  1.00 95.06  ? 460 ASP A HB2  1 
ATOM   1611 H  HB3  . ASP A 1 99  ? -9.245  -20.389 22.776  1.00 95.06  ? 460 ASP A HB3  1 
ATOM   1612 N  N    . GLU A 1 100 ? -7.667  -23.282 21.043  1.00 64.26  ? 461 GLU A N    1 
ATOM   1613 C  CA   . GLU A 1 100 ? -8.366  -24.506 20.675  1.00 63.83  ? 461 GLU A CA   1 
ATOM   1614 C  C    . GLU A 1 100 ? -9.317  -24.896 21.800  1.00 68.16  ? 461 GLU A C    1 
ATOM   1615 O  O    . GLU A 1 100 ? -8.888  -25.353 22.866  1.00 73.02  ? 461 GLU A O    1 
ATOM   1616 C  CB   . GLU A 1 100 ? -7.400  -25.653 20.379  1.00 64.38  ? 461 GLU A CB   1 
ATOM   1617 C  CG   . GLU A 1 100 ? -8.122  -26.931 19.954  1.00 74.14  ? 461 GLU A CG   1 
ATOM   1618 C  CD   . GLU A 1 100 ? -7.202  -28.126 19.811  1.00 98.55  ? 461 GLU A CD   1 
ATOM   1619 O  OE1  . GLU A 1 100 ? -7.409  -28.927 18.877  1.00 118.66 ? 461 GLU A OE1  1 
ATOM   1620 O  OE2  . GLU A 1 100 ? -6.281  -28.279 20.637  1.00 113.86 ? 461 GLU A OE2  1 
ATOM   1621 H  H    . GLU A 1 100 ? -6.822  -23.371 21.176  1.00 77.11  ? 461 GLU A H    1 
ATOM   1622 H  HA   . GLU A 1 100 ? -8.894  -24.343 19.878  1.00 76.60  ? 461 GLU A HA   1 
ATOM   1623 H  HB2  . GLU A 1 100 ? -6.806  -25.389 19.659  1.00 77.26  ? 461 GLU A HB2  1 
ATOM   1624 H  HB3  . GLU A 1 100 ? -6.886  -25.850 21.178  1.00 77.26  ? 461 GLU A HB3  1 
ATOM   1625 H  HG2  . GLU A 1 100 ? -8.792  -27.150 20.621  1.00 88.97  ? 461 GLU A HG2  1 
ATOM   1626 H  HG3  . GLU A 1 100 ? -8.549  -26.780 19.096  1.00 88.97  ? 461 GLU A HG3  1 
ATOM   1627 N  N    . ASP A 1 101 ? -10.606 -24.697 21.546  1.00 78.50  ? 462 ASP A N    1 
ATOM   1628 C  CA   . ASP A 1 101 ? -11.664 -25.047 22.486  1.00 78.77  ? 462 ASP A CA   1 
ATOM   1629 C  C    . ASP A 1 101 ? -12.525 -26.162 21.897  1.00 78.26  ? 462 ASP A C    1 
ATOM   1630 O  O    . ASP A 1 101 ? -12.469 -26.419 20.697  1.00 75.94  ? 462 ASP A O    1 
ATOM   1631 C  CB   . ASP A 1 101 ? -12.525 -23.821 22.808  1.00 99.76  ? 462 ASP A CB   1 
ATOM   1632 C  CG   . ASP A 1 101 ? -11.704 -22.634 23.296  1.00 108.99 ? 462 ASP A CG   1 
ATOM   1633 O  OD1  . ASP A 1 101 ? -10.697 -22.849 24.008  1.00 110.49 ? 462 ASP A OD1  1 
ATOM   1634 O  OD2  . ASP A 1 101 ? -12.071 -21.483 22.970  1.00 75.03  ? 462 ASP A OD2  1 
ATOM   1635 H  H    . ASP A 1 101 ? -10.900 -24.351 20.816  1.00 94.20  ? 462 ASP A H    1 
ATOM   1636 H  HA   . ASP A 1 101 ? -11.268 -25.368 23.311  1.00 94.53  ? 462 ASP A HA   1 
ATOM   1637 H  HB2  . ASP A 1 101 ? -12.998 -23.549 22.006  1.00 119.71 ? 462 ASP A HB2  1 
ATOM   1638 H  HB3  . ASP A 1 101 ? -13.159 -24.054 23.504  1.00 119.71 ? 462 ASP A HB3  1 
ATOM   1639 N  N    . PRO A 1 102 ? -13.331 -26.832 22.737  1.00 85.71  ? 463 PRO A N    1 
ATOM   1640 C  CA   . PRO A 1 102 ? -14.158 -27.928 22.217  1.00 94.40  ? 463 PRO A CA   1 
ATOM   1641 C  C    . PRO A 1 102 ? -15.292 -27.429 21.321  1.00 91.98  ? 463 PRO A C    1 
ATOM   1642 O  O    . PRO A 1 102 ? -15.777 -28.178 20.472  1.00 98.90  ? 463 PRO A O    1 
ATOM   1643 C  CB   . PRO A 1 102 ? -14.711 -28.591 23.487  1.00 97.25  ? 463 PRO A CB   1 
ATOM   1644 C  CG   . PRO A 1 102 ? -13.895 -28.043 24.618  1.00 81.25  ? 463 PRO A CG   1 
ATOM   1645 C  CD   . PRO A 1 102 ? -13.479 -26.681 24.192  1.00 84.04  ? 463 PRO A CD   1 
ATOM   1646 H  HA   . PRO A 1 102 ? -13.613 -28.565 21.729  1.00 113.28 ? 463 PRO A HA   1 
ATOM   1647 H  HB2  . PRO A 1 102 ? -15.646 -28.356 23.596  1.00 116.70 ? 463 PRO A HB2  1 
ATOM   1648 H  HB3  . PRO A 1 102 ? -14.605 -29.553 23.425  1.00 116.70 ? 463 PRO A HB3  1 
ATOM   1649 H  HG2  . PRO A 1 102 ? -14.439 -27.998 25.420  1.00 97.50  ? 463 PRO A HG2  1 
ATOM   1650 H  HG3  . PRO A 1 102 ? -13.119 -28.607 24.762  1.00 97.50  ? 463 PRO A HG3  1 
ATOM   1651 H  HD2  . PRO A 1 102 ? -14.172 -26.033 24.398  1.00 100.85 ? 463 PRO A HD2  1 
ATOM   1652 H  HD3  . PRO A 1 102 ? -12.632 -26.441 24.598  1.00 100.85 ? 463 PRO A HD3  1 
ATOM   1653 N  N    . ASP A 1 103 ? -15.702 -26.178 21.517  1.00 97.47  ? 464 ASP A N    1 
ATOM   1654 C  CA   . ASP A 1 103 ? -16.713 -25.546 20.676  1.00 98.60  ? 464 ASP A CA   1 
ATOM   1655 C  C    . ASP A 1 103 ? -16.027 -24.519 19.763  1.00 96.53  ? 464 ASP A C    1 
ATOM   1656 O  O    . ASP A 1 103 ? -15.037 -24.848 19.108  1.00 97.67  ? 464 ASP A O    1 
ATOM   1657 C  CB   . ASP A 1 103 ? -17.811 -24.913 21.546  1.00 104.18 ? 464 ASP A CB   1 
ATOM   1658 C  CG   . ASP A 1 103 ? -17.254 -24.071 22.681  1.00 131.76 ? 464 ASP A CG   1 
ATOM   1659 O  OD1  . ASP A 1 103 ? -16.049 -24.195 22.985  1.00 131.88 ? 464 ASP A OD1  1 
ATOM   1660 O  OD2  . ASP A 1 103 ? -18.030 -23.298 23.285  1.00 138.24 ? 464 ASP A OD2  1 
ATOM   1661 H  H    . ASP A 1 103 ? -15.403 -25.667 22.141  1.00 116.96 ? 464 ASP A H    1 
ATOM   1662 H  HA   . ASP A 1 103 ? -17.126 -26.220 20.114  1.00 118.32 ? 464 ASP A HA   1 
ATOM   1663 H  HB2  . ASP A 1 103 ? -18.362 -24.340 20.990  1.00 125.02 ? 464 ASP A HB2  1 
ATOM   1664 H  HB3  . ASP A 1 103 ? -18.352 -25.619 21.933  1.00 125.02 ? 464 ASP A HB3  1 
ATOM   1665 N  N    . LYS A 1 104 ? -16.535 -23.291 19.707  1.00 94.90  ? 465 LYS A N    1 
ATOM   1666 C  CA   . LYS A 1 104 ? -15.889 -22.250 18.914  1.00 85.80  ? 465 LYS A CA   1 
ATOM   1667 C  C    . LYS A 1 104 ? -14.549 -21.868 19.535  1.00 96.27  ? 465 LYS A C    1 
ATOM   1668 O  O    . LYS A 1 104 ? -14.474 -21.546 20.726  1.00 86.15  ? 465 LYS A O    1 
ATOM   1669 C  CB   . LYS A 1 104 ? -16.792 -21.018 18.799  1.00 90.88  ? 465 LYS A CB   1 
ATOM   1670 C  CG   . LYS A 1 104 ? -16.273 -19.955 17.832  1.00 86.21  ? 465 LYS A CG   1 
ATOM   1671 C  CD   . LYS A 1 104 ? -17.295 -18.842 17.614  1.00 105.38 ? 465 LYS A CD   1 
ATOM   1672 C  CE   . LYS A 1 104 ? -16.798 -17.804 16.614  1.00 119.58 ? 465 LYS A CE   1 
ATOM   1673 N  NZ   . LYS A 1 104 ? -17.813 -16.740 16.352  1.00 117.14 ? 465 LYS A NZ   1 
ATOM   1674 H  H    . LYS A 1 104 ? -17.247 -23.037 20.115  1.00 113.88 ? 465 LYS A H    1 
ATOM   1675 H  HA   . LYS A 1 104 ? -15.723 -22.588 18.020  1.00 102.96 ? 465 LYS A HA   1 
ATOM   1676 H  HB2  . LYS A 1 104 ? -17.666 -21.300 18.488  1.00 109.06 ? 465 LYS A HB2  1 
ATOM   1677 H  HB3  . LYS A 1 104 ? -16.872 -20.608 19.674  1.00 109.06 ? 465 LYS A HB3  1 
ATOM   1678 H  HG2  . LYS A 1 104 ? -15.466 -19.559 18.195  1.00 103.45 ? 465 LYS A HG2  1 
ATOM   1679 H  HG3  . LYS A 1 104 ? -16.087 -20.368 16.974  1.00 103.45 ? 465 LYS A HG3  1 
ATOM   1680 H  HD2  . LYS A 1 104 ? -18.117 -19.226 17.270  1.00 126.45 ? 465 LYS A HD2  1 
ATOM   1681 H  HD3  . LYS A 1 104 ? -17.463 -18.394 18.458  1.00 126.45 ? 465 LYS A HD3  1 
ATOM   1682 H  HE2  . LYS A 1 104 ? -16.001 -17.379 16.967  1.00 143.50 ? 465 LYS A HE2  1 
ATOM   1683 H  HE3  . LYS A 1 104 ? -16.598 -18.243 15.773  1.00 143.50 ? 465 LYS A HE3  1 
ATOM   1684 H  HZ1  . LYS A 1 104 ? -17.492 -16.152 15.766  1.00 140.57 ? 465 LYS A HZ1  1 
ATOM   1685 H  HZ2  . LYS A 1 104 ? -18.555 -17.103 16.021  1.00 140.57 ? 465 LYS A HZ2  1 
ATOM   1686 H  HZ3  . LYS A 1 104 ? -18.011 -16.316 17.108  1.00 140.57 ? 465 LYS A HZ3  1 
ATOM   1687 N  N    . ASP A 1 105 ? -13.491 -21.915 18.728  1.00 61.30  ? 466 ASP A N    1 
ATOM   1688 C  CA   . ASP A 1 105 ? -12.160 -21.530 19.190  1.00 69.26  ? 466 ASP A CA   1 
ATOM   1689 C  C    . ASP A 1 105 ? -12.123 -20.026 19.456  1.00 77.87  ? 466 ASP A C    1 
ATOM   1690 O  O    . ASP A 1 105 ? -12.468 -19.228 18.587  1.00 74.32  ? 466 ASP A O    1 
ATOM   1691 C  CB   . ASP A 1 105 ? -11.083 -21.920 18.164  1.00 61.03  ? 466 ASP A CB   1 
ATOM   1692 C  CG   . ASP A 1 105 ? -10.913 -23.432 18.026  1.00 74.05  ? 466 ASP A CG   1 
ATOM   1693 O  OD1  . ASP A 1 105 ? -11.505 -24.183 18.831  1.00 61.75  ? 466 ASP A OD1  1 
ATOM   1694 O  OD2  . ASP A 1 105 ? -10.177 -23.869 17.110  1.00 65.41  ? 466 ASP A OD2  1 
ATOM   1695 H  H    . ASP A 1 105 ? -13.518 -22.167 17.907  1.00 73.55  ? 466 ASP A H    1 
ATOM   1696 H  HA   . ASP A 1 105 ? -11.966 -21.990 20.022  1.00 83.11  ? 466 ASP A HA   1 
ATOM   1697 H  HB2  . ASP A 1 105 ? -11.331 -21.566 17.296  1.00 73.23  ? 466 ASP A HB2  1 
ATOM   1698 H  HB3  . ASP A 1 105 ? -10.232 -21.548 18.443  1.00 73.23  ? 466 ASP A HB3  1 
ATOM   1699 N  N    . ASP A 1 106 ? -11.713 -19.646 20.664  1.00 74.61  ? 467 ASP A N    1 
ATOM   1700 C  CA   . ASP A 1 106 ? -11.681 -18.241 21.062  1.00 62.25  ? 467 ASP A CA   1 
ATOM   1701 C  C    . ASP A 1 106 ? -10.537 -17.494 20.382  1.00 68.72  ? 467 ASP A C    1 
ATOM   1702 O  O    . ASP A 1 106 ? -9.468  -18.051 20.155  1.00 60.27  ? 467 ASP A O    1 
ATOM   1703 C  CB   . ASP A 1 106 ? -11.548 -18.117 22.586  1.00 83.79  ? 467 ASP A CB   1 
ATOM   1704 C  CG   . ASP A 1 106 ? -12.884 -18.206 23.309  1.00 93.71  ? 467 ASP A CG   1 
ATOM   1705 O  OD1  . ASP A 1 106 ? -13.841 -18.785 22.752  1.00 82.82  ? 467 ASP A OD1  1 
ATOM   1706 O  OD2  . ASP A 1 106 ? -12.968 -17.700 24.447  1.00 101.67 ? 467 ASP A OD2  1 
ATOM   1707 H  H    . ASP A 1 106 ? -11.445 -20.188 21.276  1.00 89.53  ? 467 ASP A H    1 
ATOM   1708 H  HA   . ASP A 1 106 ? -12.514 -17.820 20.798  1.00 74.70  ? 467 ASP A HA   1 
ATOM   1709 H  HB2  . ASP A 1 106 ? -10.983 -18.834 22.913  1.00 100.55 ? 467 ASP A HB2  1 
ATOM   1710 H  HB3  . ASP A 1 106 ? -11.150 -17.258 22.798  1.00 100.55 ? 467 ASP A HB3  1 
ATOM   1711 N  N    . PHE A 1 107 ? -10.778 -16.222 20.082  1.00 60.75  ? 468 PHE A N    1 
ATOM   1712 C  CA   . PHE A 1 107 ? -9.809  -15.352 19.424  1.00 62.15  ? 468 PHE A CA   1 
ATOM   1713 C  C    . PHE A 1 107 ? -8.800  -14.769 20.415  1.00 74.95  ? 468 PHE A C    1 
ATOM   1714 O  O    . PHE A 1 107 ? -9.194  -14.161 21.410  1.00 62.84  ? 468 PHE A O    1 
ATOM   1715 C  CB   . PHE A 1 107 ? -10.553 -14.226 18.711  1.00 59.80  ? 468 PHE A CB   1 
ATOM   1716 C  CG   . PHE A 1 107 ? -9.661  -13.211 18.073  1.00 59.44  ? 468 PHE A CG   1 
ATOM   1717 C  CD1  . PHE A 1 107 ? -8.920  -13.538 16.942  1.00 59.19  ? 468 PHE A CD1  1 
ATOM   1718 C  CD2  . PHE A 1 107 ? -9.580  -11.924 18.574  1.00 67.68  ? 468 PHE A CD2  1 
ATOM   1719 C  CE1  . PHE A 1 107 ? -8.098  -12.606 16.339  1.00 57.77  ? 468 PHE A CE1  1 
ATOM   1720 C  CE2  . PHE A 1 107 ? -8.762  -10.982 17.973  1.00 63.39  ? 468 PHE A CE2  1 
ATOM   1721 C  CZ   . PHE A 1 107 ? -8.020  -11.324 16.852  1.00 59.42  ? 468 PHE A CZ   1 
ATOM   1722 H  H    . PHE A 1 107 ? -11.522 -15.827 20.256  1.00 72.90  ? 468 PHE A H    1 
ATOM   1723 H  HA   . PHE A 1 107 ? -9.321  -15.862 18.759  1.00 74.58  ? 468 PHE A HA   1 
ATOM   1724 H  HB2  . PHE A 1 107 ? -11.108 -14.612 18.015  1.00 71.76  ? 468 PHE A HB2  1 
ATOM   1725 H  HB3  . PHE A 1 107 ? -11.111 -13.765 19.357  1.00 71.76  ? 468 PHE A HB3  1 
ATOM   1726 H  HD1  . PHE A 1 107 ? -8.969  -14.399 16.595  1.00 71.03  ? 468 PHE A HD1  1 
ATOM   1727 H  HD2  . PHE A 1 107 ? -10.075 -11.691 19.326  1.00 81.21  ? 468 PHE A HD2  1 
ATOM   1728 H  HE1  . PHE A 1 107 ? -7.604  -12.838 15.587  1.00 69.33  ? 468 PHE A HE1  1 
ATOM   1729 H  HE2  . PHE A 1 107 ? -8.710  -10.121 18.321  1.00 76.07  ? 468 PHE A HE2  1 
ATOM   1730 H  HZ   . PHE A 1 107 ? -7.469  -10.693 16.447  1.00 71.31  ? 468 PHE A HZ   1 
ATOM   1731 N  N    . LEU A 1 108 ? -7.506  -14.935 20.137  1.00 60.62  ? 469 LEU A N    1 
ATOM   1732 C  CA   . LEU A 1 108 ? -6.467  -14.493 21.073  1.00 62.17  ? 469 LEU A CA   1 
ATOM   1733 C  C    . LEU A 1 108 ? -5.633  -13.318 20.549  1.00 65.88  ? 469 LEU A C    1 
ATOM   1734 O  O    . LEU A 1 108 ? -4.680  -12.892 21.209  1.00 64.73  ? 469 LEU A O    1 
ATOM   1735 C  CB   . LEU A 1 108 ? -5.543  -15.664 21.431  1.00 62.44  ? 469 LEU A CB   1 
ATOM   1736 C  CG   . LEU A 1 108 ? -6.151  -16.823 22.233  1.00 63.37  ? 469 LEU A CG   1 
ATOM   1737 C  CD1  . LEU A 1 108 ? -5.065  -17.834 22.578  1.00 64.18  ? 469 LEU A CD1  1 
ATOM   1738 C  CD2  . LEU A 1 108 ? -6.865  -16.345 23.510  1.00 65.61  ? 469 LEU A CD2  1 
ATOM   1739 H  H    . LEU A 1 108 ? -7.204  -15.297 19.418  1.00 72.74  ? 469 LEU A H    1 
ATOM   1740 H  HA   . LEU A 1 108 ? -6.898  -14.201 21.892  1.00 74.61  ? 469 LEU A HA   1 
ATOM   1741 H  HB2  . LEU A 1 108 ? -5.200  -16.039 20.605  1.00 74.93  ? 469 LEU A HB2  1 
ATOM   1742 H  HB3  . LEU A 1 108 ? -4.803  -15.314 21.953  1.00 74.93  ? 469 LEU A HB3  1 
ATOM   1743 H  HG   . LEU A 1 108 ? -6.808  -17.273 21.679  1.00 76.04  ? 469 LEU A HG   1 
ATOM   1744 H  HD11 . LEU A 1 108 ? -5.461  -18.561 23.084  1.00 77.02  ? 469 LEU A HD11 1 
ATOM   1745 H  HD12 . LEU A 1 108 ? -4.679  -18.175 21.756  1.00 77.02  ? 469 LEU A HD12 1 
ATOM   1746 H  HD13 . LEU A 1 108 ? -4.382  -17.395 23.108  1.00 77.02  ? 469 LEU A HD13 1 
ATOM   1747 H  HD21 . LEU A 1 108 ? -7.228  -17.115 23.975  1.00 78.74  ? 469 LEU A HD21 1 
ATOM   1748 H  HD22 . LEU A 1 108 ? -6.225  -15.887 24.077  1.00 78.74  ? 469 LEU A HD22 1 
ATOM   1749 H  HD23 . LEU A 1 108 ? -7.581  -15.739 23.262  1.00 78.74  ? 469 LEU A HD23 1 
ATOM   1750 N  N    . GLY A 1 109 ? -6.003  -12.782 19.386  1.00 60.93  ? 470 GLY A N    1 
ATOM   1751 C  CA   . GLY A 1 109 ? -5.351  -11.598 18.846  1.00 64.79  ? 470 GLY A CA   1 
ATOM   1752 C  C    . GLY A 1 109 ? -4.853  -11.753 17.414  1.00 59.58  ? 470 GLY A C    1 
ATOM   1753 O  O    . GLY A 1 109 ? -4.690  -12.871 16.920  1.00 58.09  ? 470 GLY A O    1 
ATOM   1754 H  H    . GLY A 1 109 ? -6.635  -13.090 18.890  1.00 73.12  ? 470 GLY A H    1 
ATOM   1755 H  HA2  . GLY A 1 109 ? -5.974  -10.855 18.869  1.00 77.75  ? 470 GLY A HA2  1 
ATOM   1756 H  HA3  . GLY A 1 109 ? -4.591  -11.372 19.405  1.00 77.75  ? 470 GLY A HA3  1 
ATOM   1757 N  N    . SER A 1 110 ? -4.602  -10.621 16.756  1.00 60.07  ? 471 SER A N    1 
ATOM   1758 C  CA   . SER A 1 110 ? -4.213  -10.619 15.349  1.00 63.45  ? 471 SER A CA   1 
ATOM   1759 C  C    . SER A 1 110 ? -3.068  -9.659  15.054  1.00 62.95  ? 471 SER A C    1 
ATOM   1760 O  O    . SER A 1 110 ? -2.729  -8.788  15.856  1.00 63.08  ? 471 SER A O    1 
ATOM   1761 C  CB   . SER A 1 110 ? -5.404  -10.251 14.463  1.00 73.73  ? 471 SER A CB   1 
ATOM   1762 O  OG   . SER A 1 110 ? -5.710  -8.874  14.586  1.00 76.98  ? 471 SER A OG   1 
ATOM   1763 H  H    . SER A 1 110 ? -4.652  -9.837  17.105  1.00 72.08  ? 471 SER A H    1 
ATOM   1764 H  HA   . SER A 1 110 ? -3.923  -11.511 15.103  1.00 76.14  ? 471 SER A HA   1 
ATOM   1765 H  HB2  . SER A 1 110 ? -5.182  -10.445 13.539  1.00 88.48  ? 471 SER A HB2  1 
ATOM   1766 H  HB3  . SER A 1 110 ? -6.175  -10.772 14.737  1.00 88.48  ? 471 SER A HB3  1 
ATOM   1767 H  HG   . SER A 1 110 ? -6.365  -8.681  14.096  1.00 92.38  ? 471 SER A HG   1 
ATOM   1768 N  N    . LEU A 1 111 ? -2.504  -9.819  13.864  1.00 58.79  ? 472 LEU A N    1 
ATOM   1769 C  CA   . LEU A 1 111 ? -1.353  -9.054  13.425  1.00 59.86  ? 472 LEU A CA   1 
ATOM   1770 C  C    . LEU A 1 111 ? -1.405  -8.905  11.900  1.00 58.89  ? 472 LEU A C    1 
ATOM   1771 O  O    . LEU A 1 111 ? -1.743  -9.857  11.198  1.00 63.52  ? 472 LEU A O    1 
ATOM   1772 C  CB   . LEU A 1 111 ? -0.073  -9.755  13.873  1.00 59.88  ? 472 LEU A CB   1 
ATOM   1773 C  CG   . LEU A 1 111 ? 1.228   -8.961  13.985  1.00 74.00  ? 472 LEU A CG   1 
ATOM   1774 C  CD1  . LEU A 1 111 ? 1.050   -7.683  14.797  1.00 84.39  ? 472 LEU A CD1  1 
ATOM   1775 C  CD2  . LEU A 1 111 ? 2.300   -9.849  14.612  1.00 70.66  ? 472 LEU A CD2  1 
ATOM   1776 H  H    . LEU A 1 111 ? -2.782  -10.384 13.278  1.00 70.54  ? 472 LEU A H    1 
ATOM   1777 H  HA   . LEU A 1 111 ? -1.378  -8.170  13.823  1.00 71.83  ? 472 LEU A HA   1 
ATOM   1778 H  HB2  . LEU A 1 111 ? -0.240  -10.135 14.750  1.00 71.86  ? 472 LEU A HB2  1 
ATOM   1779 H  HB3  . LEU A 1 111 ? 0.098   -10.477 13.248  1.00 71.86  ? 472 LEU A HB3  1 
ATOM   1780 H  HG   . LEU A 1 111 ? 1.525   -8.713  13.096  1.00 88.80  ? 472 LEU A HG   1 
ATOM   1781 H  HD11 . LEU A 1 111 ? 1.898   -7.216  14.840  1.00 101.26 ? 472 LEU A HD11 1 
ATOM   1782 H  HD12 . LEU A 1 111 ? 0.385   -7.125  14.364  1.00 101.26 ? 472 LEU A HD12 1 
ATOM   1783 H  HD13 . LEU A 1 111 ? 0.754   -7.917  15.691  1.00 101.26 ? 472 LEU A HD13 1 
ATOM   1784 H  HD21 . LEU A 1 111 ? 3.126   -9.345  14.683  1.00 84.79  ? 472 LEU A HD21 1 
ATOM   1785 H  HD22 . LEU A 1 111 ? 2.004   -10.127 15.493  1.00 84.79  ? 472 LEU A HD22 1 
ATOM   1786 H  HD23 . LEU A 1 111 ? 2.434   -10.627 14.047  1.00 84.79  ? 472 LEU A HD23 1 
ATOM   1787 N  N    . MET A 1 112 ? -1.104  -7.707  11.404  1.00 71.41  ? 473 MET A N    1 
ATOM   1788 C  CA   . MET A 1 112 ? -1.085  -7.425  9.965   1.00 60.30  ? 473 MET A CA   1 
ATOM   1789 C  C    . MET A 1 112 ? 0.195   -6.670  9.633   1.00 70.59  ? 473 MET A C    1 
ATOM   1790 O  O    . MET A 1 112 ? 0.308   -5.477  9.923   1.00 73.27  ? 473 MET A O    1 
ATOM   1791 C  CB   . MET A 1 112 ? -2.305  -6.599  9.535   1.00 66.67  ? 473 MET A CB   1 
ATOM   1792 C  CG   . MET A 1 112 ? -3.638  -7.084  10.089  1.00 88.11  ? 473 MET A CG   1 
ATOM   1793 S  SD   . MET A 1 112 ? -4.316  -8.499  9.209   1.00 113.69 ? 473 MET A SD   1 
ATOM   1794 C  CE   . MET A 1 112 ? -5.122  -7.676  7.838   1.00 112.95 ? 473 MET A CE   1 
ATOM   1795 H  H    . MET A 1 112 ? -0.902  -7.026  11.889  1.00 85.69  ? 473 MET A H    1 
ATOM   1796 H  HA   . MET A 1 112 ? -1.098  -8.263  9.475   1.00 72.36  ? 473 MET A HA   1 
ATOM   1797 H  HB2  . MET A 1 112 ? -2.179  -5.685  9.834   1.00 80.01  ? 473 MET A HB2  1 
ATOM   1798 H  HB3  . MET A 1 112 ? -2.366  -6.619  8.567   1.00 80.01  ? 473 MET A HB3  1 
ATOM   1799 H  HG2  . MET A 1 112 ? -3.517  -7.341  11.017  1.00 105.73 ? 473 MET A HG2  1 
ATOM   1800 H  HG3  . MET A 1 112 ? -4.283  -6.361  10.030  1.00 105.73 ? 473 MET A HG3  1 
ATOM   1801 H  HE1  . MET A 1 112 ? -5.539  -8.343  7.270   1.00 135.54 ? 473 MET A HE1  1 
ATOM   1802 H  HE2  . MET A 1 112 ? -5.795  -7.069  8.186   1.00 135.54 ? 473 MET A HE2  1 
ATOM   1803 H  HE3  . MET A 1 112 ? -4.459  -7.180  7.334   1.00 135.54 ? 473 MET A HE3  1 
ATOM   1804 N  N    . ILE A 1 113 ? 1.162   -7.367  9.045   1.00 60.79  ? 474 ILE A N    1 
ATOM   1805 C  CA   . ILE A 1 113 ? 2.447   -6.759  8.720   1.00 62.48  ? 474 ILE A CA   1 
ATOM   1806 C  C    . ILE A 1 113 ? 2.585   -6.520  7.217   1.00 62.37  ? 474 ILE A C    1 
ATOM   1807 O  O    . ILE A 1 113 ? 2.296   -7.395  6.402   1.00 63.04  ? 474 ILE A O    1 
ATOM   1808 C  CB   . ILE A 1 113 ? 3.626   -7.631  9.207   1.00 62.79  ? 474 ILE A CB   1 
ATOM   1809 C  CG1  . ILE A 1 113 ? 3.533   -7.880  10.719  1.00 62.48  ? 474 ILE A CG1  1 
ATOM   1810 C  CG2  . ILE A 1 113 ? 4.962   -6.972  8.863   1.00 65.32  ? 474 ILE A CG2  1 
ATOM   1811 C  CD1  . ILE A 1 113 ? 3.419   -6.622  11.555  1.00 101.40 ? 474 ILE A CD1  1 
ATOM   1812 H  H    . ILE A 1 113 ? 1.099   -8.196  8.823   1.00 72.95  ? 474 ILE A H    1 
ATOM   1813 H  HA   . ILE A 1 113 ? 2.508   -5.899  9.166   1.00 74.97  ? 474 ILE A HA   1 
ATOM   1814 H  HB   . ILE A 1 113 ? 3.582   -8.486  8.752   1.00 75.35  ? 474 ILE A HB   1 
ATOM   1815 H  HG12 . ILE A 1 113 ? 2.749   -8.424  10.896  1.00 74.98  ? 474 ILE A HG12 1 
ATOM   1816 H  HG13 . ILE A 1 113 ? 4.330   -8.353  11.005  1.00 74.98  ? 474 ILE A HG13 1 
ATOM   1817 H  HG21 . ILE A 1 113 ? 5.683   -7.538  9.178   1.00 78.39  ? 474 ILE A HG21 1 
ATOM   1818 H  HG22 . ILE A 1 113 ? 5.022   -6.864  7.901   1.00 78.39  ? 474 ILE A HG22 1 
ATOM   1819 H  HG23 . ILE A 1 113 ? 5.007   -6.105  9.296   1.00 78.39  ? 474 ILE A HG23 1 
ATOM   1820 H  HD11 . ILE A 1 113 ? 3.366   -6.869  12.491  1.00 121.68 ? 474 ILE A HD11 1 
ATOM   1821 H  HD12 . ILE A 1 113 ? 4.202   -6.070  11.402  1.00 121.68 ? 474 ILE A HD12 1 
ATOM   1822 H  HD13 . ILE A 1 113 ? 2.619   -6.141  11.293  1.00 121.68 ? 474 ILE A HD13 1 
ATOM   1823 N  N    . ASP A 1 114 ? 3.042   -5.320  6.876   1.00 65.81  ? 475 ASP A N    1 
ATOM   1824 C  CA   . ASP A 1 114 ? 3.270   -4.918  5.499   1.00 72.68  ? 475 ASP A CA   1 
ATOM   1825 C  C    . ASP A 1 114 ? 4.538   -5.573  4.954   1.00 88.26  ? 475 ASP A C    1 
ATOM   1826 O  O    . ASP A 1 114 ? 5.615   -5.442  5.536   1.00 86.85  ? 475 ASP A O    1 
ATOM   1827 C  CB   . ASP A 1 114 ? 3.373   -3.396  5.412   1.00 82.44  ? 475 ASP A CB   1 
ATOM   1828 C  CG   . ASP A 1 114 ? 3.690   -2.914  4.016   1.00 106.18 ? 475 ASP A CG   1 
ATOM   1829 O  OD1  . ASP A 1 114 ? 2.982   -3.325  3.072   1.00 111.52 ? 475 ASP A OD1  1 
ATOM   1830 O  OD2  . ASP A 1 114 ? 4.652   -2.131  3.864   1.00 96.17  ? 475 ASP A OD2  1 
ATOM   1831 H  H    . ASP A 1 114 ? 3.233   -4.704  7.446   1.00 78.97  ? 475 ASP A H    1 
ATOM   1832 H  HA   . ASP A 1 114 ? 2.520   -5.205  4.954   1.00 87.21  ? 475 ASP A HA   1 
ATOM   1833 H  HB2  . ASP A 1 114 ? 2.526   -3.005  5.679   1.00 98.93  ? 475 ASP A HB2  1 
ATOM   1834 H  HB3  . ASP A 1 114 ? 4.080   -3.092  6.002   1.00 98.93  ? 475 ASP A HB3  1 
ATOM   1835 N  N    . LEU A 1 115 ? 4.407   -6.276  3.835   1.00 68.13  ? 476 LEU A N    1 
ATOM   1836 C  CA   . LEU A 1 115 ? 5.525   -7.031  3.280   1.00 64.22  ? 476 LEU A CA   1 
ATOM   1837 C  C    . LEU A 1 115 ? 6.608   -6.126  2.705   1.00 64.97  ? 476 LEU A C    1 
ATOM   1838 O  O    . LEU A 1 115 ? 7.785   -6.302  3.009   1.00 75.45  ? 476 LEU A O    1 
ATOM   1839 C  CB   . LEU A 1 115 ? 5.026   -7.996  2.207   1.00 59.93  ? 476 LEU A CB   1 
ATOM   1840 C  CG   . LEU A 1 115 ? 4.168   -9.139  2.752   1.00 69.62  ? 476 LEU A CG   1 
ATOM   1841 C  CD1  . LEU A 1 115 ? 3.516   -9.895  1.619   1.00 75.99  ? 476 LEU A CD1  1 
ATOM   1842 C  CD2  . LEU A 1 115 ? 4.999   -10.085 3.612   1.00 64.09  ? 476 LEU A CD2  1 
ATOM   1843 H  H    . LEU A 1 115 ? 3.682   -6.332  3.377   1.00 81.76  ? 476 LEU A H    1 
ATOM   1844 H  HA   . LEU A 1 115 ? 5.926   -7.558  3.988   1.00 77.06  ? 476 LEU A HA   1 
ATOM   1845 H  HB2  . LEU A 1 115 ? 4.490   -7.502  1.567   1.00 71.91  ? 476 LEU A HB2  1 
ATOM   1846 H  HB3  . LEU A 1 115 ? 5.792   -8.389  1.759   1.00 71.91  ? 476 LEU A HB3  1 
ATOM   1847 H  HG   . LEU A 1 115 ? 3.465   -8.768  3.308   1.00 83.54  ? 476 LEU A HG   1 
ATOM   1848 H  HD11 . LEU A 1 115 ? 2.978   -10.613 1.988   1.00 91.19  ? 476 LEU A HD11 1 
ATOM   1849 H  HD12 . LEU A 1 115 ? 2.954   -9.285  1.115   1.00 91.19  ? 476 LEU A HD12 1 
ATOM   1850 H  HD13 . LEU A 1 115 ? 4.207   -10.260 1.045   1.00 91.19  ? 476 LEU A HD13 1 
ATOM   1851 H  HD21 . LEU A 1 115 ? 4.427   -10.796 3.941   1.00 76.90  ? 476 LEU A HD21 1 
ATOM   1852 H  HD22 . LEU A 1 115 ? 5.713   -10.458 3.071   1.00 76.90  ? 476 LEU A HD22 1 
ATOM   1853 H  HD23 . LEU A 1 115 ? 5.372   -9.589  4.357   1.00 76.90  ? 476 LEU A HD23 1 
ATOM   1854 N  N    . ILE A 1 116 ? 6.217   -5.151  1.890   1.00 76.34  ? 477 ILE A N    1 
ATOM   1855 C  CA   . ILE A 1 116 ? 7.189   -4.242  1.280   1.00 72.54  ? 477 ILE A CA   1 
ATOM   1856 C  C    . ILE A 1 116 ? 8.002   -3.503  2.350   1.00 82.99  ? 477 ILE A C    1 
ATOM   1857 O  O    . ILE A 1 116 ? 9.076   -2.972  2.059   1.00 85.68  ? 477 ILE A O    1 
ATOM   1858 C  CB   . ILE A 1 116 ? 6.505   -3.226  0.329   1.00 79.48  ? 477 ILE A CB   1 
ATOM   1859 C  CG1  . ILE A 1 116 ? 5.383   -2.475  1.052   1.00 96.46  ? 477 ILE A CG1  1 
ATOM   1860 C  CG2  . ILE A 1 116 ? 5.983   -3.952  -0.907  1.00 89.22  ? 477 ILE A CG2  1 
ATOM   1861 C  CD1  . ILE A 1 116 ? 4.500   -1.623  0.160   1.00 97.85  ? 477 ILE A CD1  1 
ATOM   1862 H  H    . ILE A 1 116 ? 5.400   -4.993  1.674   1.00 91.60  ? 477 ILE A H    1 
ATOM   1863 H  HA   . ILE A 1 116 ? 7.810   -4.766  0.750   1.00 87.05  ? 477 ILE A HA   1 
ATOM   1864 H  HB   . ILE A 1 116 ? 7.170   -2.580  0.045   1.00 95.38  ? 477 ILE A HB   1 
ATOM   1865 H  HG12 . ILE A 1 116 ? 4.813   -3.124  1.494   1.00 115.76 ? 477 ILE A HG12 1 
ATOM   1866 H  HG13 . ILE A 1 116 ? 5.782   -1.889  1.715   1.00 115.76 ? 477 ILE A HG13 1 
ATOM   1867 H  HG21 . ILE A 1 116 ? 5.557   -3.308  -1.494  1.00 107.07 ? 477 ILE A HG21 1 
ATOM   1868 H  HG22 . ILE A 1 116 ? 6.727   -4.375  -1.363  1.00 107.07 ? 477 ILE A HG22 1 
ATOM   1869 H  HG23 . ILE A 1 116 ? 5.339   -4.623  -0.630  1.00 107.07 ? 477 ILE A HG23 1 
ATOM   1870 H  HD11 . ILE A 1 116 ? 3.825   -1.190  0.705   1.00 117.42 ? 477 ILE A HD11 1 
ATOM   1871 H  HD12 . ILE A 1 116 ? 5.048   -0.955  -0.280  1.00 117.42 ? 477 ILE A HD12 1 
ATOM   1872 H  HD13 . ILE A 1 116 ? 4.077   -2.192  -0.501  1.00 117.42 ? 477 ILE A HD13 1 
ATOM   1873 N  N    . GLU A 1 117 ? 7.502   -3.487  3.585   1.00 72.04  ? 478 GLU A N    1 
ATOM   1874 C  CA   . GLU A 1 117 ? 8.303   -3.035  4.719   1.00 80.91  ? 478 GLU A CA   1 
ATOM   1875 C  C    . GLU A 1 117 ? 9.299   -4.125  5.110   1.00 74.51  ? 478 GLU A C    1 
ATOM   1876 O  O    . GLU A 1 117 ? 10.471  -3.844  5.339   1.00 80.65  ? 478 GLU A O    1 
ATOM   1877 C  CB   . GLU A 1 117 ? 7.421   -2.669  5.916   1.00 93.51  ? 478 GLU A CB   1 
ATOM   1878 C  CG   . GLU A 1 117 ? 8.203   -2.251  7.164   1.00 107.86 ? 478 GLU A CG   1 
ATOM   1879 C  CD   . GLU A 1 117 ? 7.314   -2.064  8.385   1.00 124.36 ? 478 GLU A CD   1 
ATOM   1880 O  OE1  . GLU A 1 117 ? 7.855   -1.965  9.509   1.00 111.15 ? 478 GLU A OE1  1 
ATOM   1881 O  OE2  . GLU A 1 117 ? 6.076   -2.016  8.224   1.00 120.89 ? 478 GLU A OE2  1 
ATOM   1882 H  H    . GLU A 1 117 ? 6.704   -3.732  3.791   1.00 86.45  ? 478 GLU A H    1 
ATOM   1883 H  HA   . GLU A 1 117 ? 8.804   -2.246  4.460   1.00 97.09  ? 478 GLU A HA   1 
ATOM   1884 H  HB2  . GLU A 1 117 ? 6.847   -1.929  5.665   1.00 112.21 ? 478 GLU A HB2  1 
ATOM   1885 H  HB3  . GLU A 1 117 ? 6.879   -3.439  6.151   1.00 112.21 ? 478 GLU A HB3  1 
ATOM   1886 H  HG2  . GLU A 1 117 ? 8.856   -2.938  7.371   1.00 129.43 ? 478 GLU A HG2  1 
ATOM   1887 H  HG3  . GLU A 1 117 ? 8.651   -1.409  6.988   1.00 129.43 ? 478 GLU A HG3  1 
ATOM   1888 N  N    . VAL A 1 118 ? 8.829   -5.366  5.184   1.00 81.99  ? 479 VAL A N    1 
ATOM   1889 C  CA   . VAL A 1 118 ? 9.693   -6.500  5.511   1.00 77.67  ? 479 VAL A CA   1 
ATOM   1890 C  C    . VAL A 1 118 ? 10.802  -6.675  4.478   1.00 83.95  ? 479 VAL A C    1 
ATOM   1891 O  O    . VAL A 1 118 ? 11.956  -6.922  4.831   1.00 88.98  ? 479 VAL A O    1 
ATOM   1892 C  CB   . VAL A 1 118 ? 8.886   -7.810  5.600   1.00 78.38  ? 479 VAL A CB   1 
ATOM   1893 C  CG1  . VAL A 1 118 ? 9.816   -9.020  5.700   1.00 73.05  ? 479 VAL A CG1  1 
ATOM   1894 C  CG2  . VAL A 1 118 ? 7.933   -7.763  6.783   1.00 76.50  ? 479 VAL A CG2  1 
ATOM   1895 H  H    . VAL A 1 118 ? 8.008   -5.581  5.048   1.00 98.39  ? 479 VAL A H    1 
ATOM   1896 H  HA   . VAL A 1 118 ? 10.107  -6.343  6.373   1.00 93.20  ? 479 VAL A HA   1 
ATOM   1897 H  HB   . VAL A 1 118 ? 8.356   -7.908  4.794   1.00 94.06  ? 479 VAL A HB   1 
ATOM   1898 H  HG11 . VAL A 1 118 ? 9.280   -9.826  5.755   1.00 87.66  ? 479 VAL A HG11 1 
ATOM   1899 H  HG12 . VAL A 1 118 ? 10.380  -9.050  4.911   1.00 87.66  ? 479 VAL A HG12 1 
ATOM   1900 H  HG13 . VAL A 1 118 ? 10.364  -8.931  6.496   1.00 87.66  ? 479 VAL A HG13 1 
ATOM   1901 H  HG21 . VAL A 1 118 ? 7.436   -8.596  6.821   1.00 91.81  ? 479 VAL A HG21 1 
ATOM   1902 H  HG22 . VAL A 1 118 ? 8.446   -7.646  7.598   1.00 91.81  ? 479 VAL A HG22 1 
ATOM   1903 H  HG23 . VAL A 1 118 ? 7.322   -7.019  6.667   1.00 91.81  ? 479 VAL A HG23 1 
ATOM   1904 N  N    . GLU A 1 119 ? 10.437  -6.567  3.205   1.00 73.47  ? 480 GLU A N    1 
ATOM   1905 C  CA   . GLU A 1 119 ? 11.403  -6.668  2.119   1.00 80.35  ? 480 GLU A CA   1 
ATOM   1906 C  C    . GLU A 1 119 ? 12.500  -5.640  2.341   1.00 87.23  ? 480 GLU A C    1 
ATOM   1907 O  O    . GLU A 1 119 ? 13.691  -5.953  2.298   1.00 88.57  ? 480 GLU A O    1 
ATOM   1908 C  CB   . GLU A 1 119 ? 10.725  -6.443  0.763   1.00 76.20  ? 480 GLU A CB   1 
ATOM   1909 C  CG   . GLU A 1 119 ? 9.540   -7.364  0.486   1.00 74.08  ? 480 GLU A CG   1 
ATOM   1910 C  CD   . GLU A 1 119 ? 8.743   -6.950  -0.740  1.00 100.12 ? 480 GLU A CD   1 
ATOM   1911 O  OE1  . GLU A 1 119 ? 9.291   -6.204  -1.578  1.00 104.15 ? 480 GLU A OE1  1 
ATOM   1912 O  OE2  . GLU A 1 119 ? 7.570   -7.370  -0.862  1.00 99.09  ? 480 GLU A OE2  1 
ATOM   1913 H  H    . GLU A 1 119 ? 9.629   -6.434  2.942   1.00 88.16  ? 480 GLU A H    1 
ATOM   1914 H  HA   . GLU A 1 119 ? 11.803  -7.552  2.121   1.00 96.42  ? 480 GLU A HA   1 
ATOM   1915 H  HB2  . GLU A 1 119 ? 10.401  -5.529  0.726   1.00 91.44  ? 480 GLU A HB2  1 
ATOM   1916 H  HB3  . GLU A 1 119 ? 11.379  -6.586  0.061   1.00 91.44  ? 480 GLU A HB3  1 
ATOM   1917 H  HG2  . GLU A 1 119 ? 9.868   -8.265  0.339   1.00 88.90  ? 480 GLU A HG2  1 
ATOM   1918 H  HG3  . GLU A 1 119 ? 8.943   -7.349  1.250   1.00 88.90  ? 480 GLU A HG3  1 
ATOM   1919 N  N    . LYS A 1 120 ? 12.071  -4.413  2.604   1.00 75.95  ? 481 LYS A N    1 
ATOM   1920 C  CA   . LYS A 1 120 ? 12.970  -3.293  2.844   1.00 79.14  ? 481 LYS A CA   1 
ATOM   1921 C  C    . LYS A 1 120 ? 13.955  -3.574  3.984   1.00 90.25  ? 481 LYS A C    1 
ATOM   1922 O  O    . LYS A 1 120 ? 15.095  -3.117  3.942   1.00 83.43  ? 481 LYS A O    1 
ATOM   1923 C  CB   . LYS A 1 120 ? 12.137  -2.041  3.141   1.00 99.32  ? 481 LYS A CB   1 
ATOM   1924 C  CG   . LYS A 1 120 ? 12.911  -0.810  3.572   1.00 118.92 ? 481 LYS A CG   1 
ATOM   1925 C  CD   . LYS A 1 120 ? 11.945  0.292   3.983   1.00 120.29 ? 481 LYS A CD   1 
ATOM   1926 C  CE   . LYS A 1 120 ? 12.667  1.519   4.505   1.00 114.79 ? 481 LYS A CE   1 
ATOM   1927 N  NZ   . LYS A 1 120 ? 11.705  2.563   4.954   1.00 112.43 ? 481 LYS A NZ   1 
ATOM   1928 H  H    . LYS A 1 120 ? 11.240  -4.198  2.650   1.00 91.14  ? 481 LYS A H    1 
ATOM   1929 H  HA   . LYS A 1 120 ? 13.485  -3.126  2.039   1.00 94.97  ? 481 LYS A HA   1 
ATOM   1930 H  HB2  . LYS A 1 120 ? 11.644  -1.806  2.340   1.00 119.19 ? 481 LYS A HB2  1 
ATOM   1931 H  HB3  . LYS A 1 120 ? 11.512  -2.253  3.853   1.00 119.19 ? 481 LYS A HB3  1 
ATOM   1932 H  HG2  . LYS A 1 120 ? 13.472  -1.028  4.333   1.00 142.71 ? 481 LYS A HG2  1 
ATOM   1933 H  HG3  . LYS A 1 120 ? 13.449  -0.488  2.832   1.00 142.71 ? 481 LYS A HG3  1 
ATOM   1934 H  HD2  . LYS A 1 120 ? 11.417  0.556   3.213   1.00 144.35 ? 481 LYS A HD2  1 
ATOM   1935 H  HD3  . LYS A 1 120 ? 11.365  -0.040  4.687   1.00 144.35 ? 481 LYS A HD3  1 
ATOM   1936 H  HE2  . LYS A 1 120 ? 13.220  1.268   5.261   1.00 137.75 ? 481 LYS A HE2  1 
ATOM   1937 H  HE3  . LYS A 1 120 ? 13.215  1.893   3.797   1.00 137.75 ? 481 LYS A HE3  1 
ATOM   1938 H  HZ1  . LYS A 1 120 ? 12.148  3.274   5.256   1.00 134.91 ? 481 LYS A HZ1  1 
ATOM   1939 H  HZ2  . LYS A 1 120 ? 11.188  2.812   4.274   1.00 134.91 ? 481 LYS A HZ2  1 
ATOM   1940 H  HZ3  . LYS A 1 120 ? 11.192  2.243   5.607   1.00 134.91 ? 481 LYS A HZ3  1 
ATOM   1941 N  N    . GLU A 1 121 ? 13.522  -4.333  4.990   1.00 78.25  ? 482 GLU A N    1 
ATOM   1942 C  CA   . GLU A 1 121 ? 14.355  -4.588  6.166   1.00 91.94  ? 482 GLU A CA   1 
ATOM   1943 C  C    . GLU A 1 121 ? 15.204  -5.854  6.025   1.00 92.59  ? 482 GLU A C    1 
ATOM   1944 O  O    . GLU A 1 121 ? 16.180  -6.031  6.754   1.00 80.35  ? 482 GLU A O    1 
ATOM   1945 C  CB   . GLU A 1 121 ? 13.489  -4.702  7.426   1.00 90.34  ? 482 GLU A CB   1 
ATOM   1946 C  CG   . GLU A 1 121 ? 12.385  -3.651  7.539   1.00 98.66  ? 482 GLU A CG   1 
ATOM   1947 C  CD   . GLU A 1 121 ? 12.331  -2.941  8.884   1.00 114.51 ? 482 GLU A CD   1 
ATOM   1948 O  OE1  . GLU A 1 121 ? 13.355  -2.888  9.598   1.00 115.72 ? 482 GLU A OE1  1 
ATOM   1949 O  OE2  . GLU A 1 121 ? 11.244  -2.429  9.226   1.00 125.86 ? 482 GLU A OE2  1 
ATOM   1950 H  H    . GLU A 1 121 ? 12.751  -4.713  5.016   1.00 93.90  ? 482 GLU A H    1 
ATOM   1951 H  HA   . GLU A 1 121 ? 14.959  -3.838  6.288   1.00 110.32 ? 482 GLU A HA   1 
ATOM   1952 H  HB2  . GLU A 1 121 ? 13.065  -5.575  7.432   1.00 108.40 ? 482 GLU A HB2  1 
ATOM   1953 H  HB3  . GLU A 1 121 ? 14.061  -4.612  8.204   1.00 108.40 ? 482 GLU A HB3  1 
ATOM   1954 H  HG2  . GLU A 1 121 ? 12.526  -2.977  6.855   1.00 118.39 ? 482 GLU A HG2  1 
ATOM   1955 H  HG3  . GLU A 1 121 ? 11.528  -4.084  7.400   1.00 118.39 ? 482 GLU A HG3  1 
ATOM   1956 N  N    . ARG A 1 122 ? 14.818  -6.735  5.107   1.00 97.04  ? 483 ARG A N    1 
ATOM   1957 C  CA   . ARG A 1 122 ? 15.526  -7.997  4.853   1.00 87.78  ? 483 ARG A CA   1 
ATOM   1958 C  C    . ARG A 1 122 ? 15.423  -8.984  6.021   1.00 85.21  ? 483 ARG A C    1 
ATOM   1959 O  O    . ARG A 1 122 ? 15.126  -10.160 5.808   1.00 80.49  ? 483 ARG A O    1 
ATOM   1960 C  CB   . ARG A 1 122 ? 17.004  -7.742  4.530   1.00 87.92  ? 483 ARG A CB   1 
ATOM   1961 C  CG   . ARG A 1 122 ? 17.241  -6.872  3.310   1.00 104.28 ? 483 ARG A CG   1 
ATOM   1962 C  CD   . ARG A 1 122 ? 16.942  -7.635  2.035   1.00 122.60 ? 483 ARG A CD   1 
ATOM   1963 N  NE   . ARG A 1 122 ? 17.225  -6.843  0.842   1.00 128.25 ? 483 ARG A NE   1 
ATOM   1964 C  CZ   . ARG A 1 122 ? 16.978  -7.250  -0.399  1.00 121.67 ? 483 ARG A CZ   1 
ATOM   1965 N  NH1  . ARG A 1 122 ? 16.438  -8.442  -0.613  1.00 109.58 ? 483 ARG A NH1  1 
ATOM   1966 N  NH2  . ARG A 1 122 ? 17.270  -6.463  -1.427  1.00 124.84 ? 483 ARG A NH2  1 
ATOM   1967 H  H    . ARG A 1 122 ? 14.130  -6.625  4.602   1.00 116.45 ? 483 ARG A H    1 
ATOM   1968 H  HA   . ARG A 1 122 ? 15.127  -8.422  4.077   1.00 105.34 ? 483 ARG A HA   1 
ATOM   1969 H  HB2  . ARG A 1 122 ? 17.415  -7.301  5.290   1.00 105.50 ? 483 ARG A HB2  1 
ATOM   1970 H  HB3  . ARG A 1 122 ? 17.438  -8.594  4.372   1.00 105.50 ? 483 ARG A HB3  1 
ATOM   1971 H  HG2  . ARG A 1 122 ? 16.656  -6.098  3.348   1.00 125.14 ? 483 ARG A HG2  1 
ATOM   1972 H  HG3  . ARG A 1 122 ? 18.169  -6.593  3.289   1.00 125.14 ? 483 ARG A HG3  1 
ATOM   1973 H  HD2  . ARG A 1 122 ? 17.492  -8.433  2.006   1.00 147.12 ? 483 ARG A HD2  1 
ATOM   1974 H  HD3  . ARG A 1 122 ? 16.002  -7.876  2.022   1.00 147.12 ? 483 ARG A HD3  1 
ATOM   1975 H  HE   . ARG A 1 122 ? 17.595  -6.074  0.948   1.00 153.90 ? 483 ARG A HE   1 
ATOM   1976 H  HH11 . ARG A 1 122 ? 16.248  -8.954  0.051   1.00 131.49 ? 483 ARG A HH11 1 
ATOM   1977 H  HH12 . ARG A 1 122 ? 16.278  -8.703  -1.417  1.00 131.49 ? 483 ARG A HH12 1 
ATOM   1978 H  HH21 . ARG A 1 122 ? 17.619  -5.690  -1.291  1.00 149.81 ? 483 ARG A HH21 1 
ATOM   1979 H  HH22 . ARG A 1 122 ? 17.108  -6.727  -2.229  1.00 149.81 ? 483 ARG A HH22 1 
ATOM   1980 N  N    . LEU A 1 123 ? 15.678  -8.517  7.243   1.00 75.04  ? 484 LEU A N    1 
ATOM   1981 C  CA   . LEU A 1 123 ? 15.627  -9.386  8.418   1.00 81.91  ? 484 LEU A CA   1 
ATOM   1982 C  C    . LEU A 1 123 ? 15.049  -8.676  9.644   1.00 89.24  ? 484 LEU A C    1 
ATOM   1983 O  O    . LEU A 1 123 ? 15.590  -7.669  10.100  1.00 94.99  ? 484 LEU A O    1 
ATOM   1984 C  CB   . LEU A 1 123 ? 17.026  -9.919  8.744   1.00 84.91  ? 484 LEU A CB   1 
ATOM   1985 C  CG   . LEU A 1 123 ? 17.133  -10.829 9.973   1.00 94.34  ? 484 LEU A CG   1 
ATOM   1986 C  CD1  . LEU A 1 123 ? 16.367  -12.122 9.765   1.00 95.87  ? 484 LEU A CD1  1 
ATOM   1987 C  CD2  . LEU A 1 123 ? 18.584  -11.124 10.302  1.00 97.79  ? 484 LEU A CD2  1 
ATOM   1988 H  H    . LEU A 1 123 ? 15.884  -7.701  7.418   1.00 90.04  ? 484 LEU A H    1 
ATOM   1989 H  HA   . LEU A 1 123 ? 15.058  -10.146 8.219   1.00 98.29  ? 484 LEU A HA   1 
ATOM   1990 H  HB2  . LEU A 1 123 ? 17.343  -10.427 7.981   1.00 101.89 ? 484 LEU A HB2  1 
ATOM   1991 H  HB3  . LEU A 1 123 ? 17.613  -9.162  8.893   1.00 101.89 ? 484 LEU A HB3  1 
ATOM   1992 H  HG   . LEU A 1 123 ? 16.743  -10.373 10.735  1.00 113.21 ? 484 LEU A HG   1 
ATOM   1993 H  HD11 . LEU A 1 123 ? 16.455  -12.673 10.559  1.00 115.04 ? 484 LEU A HD11 1 
ATOM   1994 H  HD12 . LEU A 1 123 ? 15.433  -11.913 9.609   1.00 115.04 ? 484 LEU A HD12 1 
ATOM   1995 H  HD13 . LEU A 1 123 ? 16.735  -12.587 8.997   1.00 115.04 ? 484 LEU A HD13 1 
ATOM   1996 H  HD21 . LEU A 1 123 ? 18.620  -11.699 11.082  1.00 117.35 ? 484 LEU A HD21 1 
ATOM   1997 H  HD22 . LEU A 1 123 ? 18.995  -11.567 9.544   1.00 117.35 ? 484 LEU A HD22 1 
ATOM   1998 H  HD23 . LEU A 1 123 ? 19.041  -10.288 10.486  1.00 117.35 ? 484 LEU A HD23 1 
ATOM   1999 N  N    . LEU A 1 124 ? 13.949  -9.217  10.164  1.00 100.71 ? 485 LEU A N    1 
ATOM   2000 C  CA   . LEU A 1 124 ? 13.347  -8.738  11.405  1.00 91.47  ? 485 LEU A CA   1 
ATOM   2001 C  C    . LEU A 1 124 ? 13.400  -9.804  12.492  1.00 84.60  ? 485 LEU A C    1 
ATOM   2002 O  O    . LEU A 1 124 ? 13.331  -10.997 12.213  1.00 89.13  ? 485 LEU A O    1 
ATOM   2003 C  CB   . LEU A 1 124 ? 11.887  -8.323  11.189  1.00 94.62  ? 485 LEU A CB   1 
ATOM   2004 C  CG   . LEU A 1 124 ? 11.576  -7.018  10.451  1.00 89.36  ? 485 LEU A CG   1 
ATOM   2005 C  CD1  . LEU A 1 124 ? 10.111  -6.668  10.656  1.00 82.08  ? 485 LEU A CD1  1 
ATOM   2006 C  CD2  . LEU A 1 124 ? 12.462  -5.874  10.917  1.00 113.28 ? 485 LEU A CD2  1 
ATOM   2007 H  H    . LEU A 1 124 ? 13.526  -9.876  9.809   1.00 120.85 ? 485 LEU A H    1 
ATOM   2008 H  HA   . LEU A 1 124 ? 13.838  -7.963  11.719  1.00 109.76 ? 485 LEU A HA   1 
ATOM   2009 H  HB2  . LEU A 1 124 ? 11.452  -9.032  10.691  1.00 113.54 ? 485 LEU A HB2  1 
ATOM   2010 H  HB3  . LEU A 1 124 ? 11.470  -8.253  12.062  1.00 113.54 ? 485 LEU A HB3  1 
ATOM   2011 H  HG   . LEU A 1 124 ? 11.725  -7.147  9.501   1.00 107.23 ? 485 LEU A HG   1 
ATOM   2012 H  HD11 . LEU A 1 124 ? 9.917   -5.841  10.187  1.00 98.49  ? 485 LEU A HD11 1 
ATOM   2013 H  HD12 . LEU A 1 124 ? 9.563   -7.386  10.303  1.00 98.49  ? 485 LEU A HD12 1 
ATOM   2014 H  HD13 . LEU A 1 124 ? 9.943   -6.558  11.605  1.00 98.49  ? 485 LEU A HD13 1 
ATOM   2015 H  HD21 . LEU A 1 124 ? 12.228  -5.072  10.423  1.00 135.94 ? 485 LEU A HD21 1 
ATOM   2016 H  HD22 . LEU A 1 124 ? 12.320  -5.731  11.866  1.00 135.94 ? 485 LEU A HD22 1 
ATOM   2017 H  HD23 . LEU A 1 124 ? 13.389  -6.106  10.753  1.00 135.94 ? 485 LEU A HD23 1 
ATOM   2018 N  N    . ASP A 1 125 ? 13.524  -9.352  13.733  1.00 80.07  ? 486 ASP A N    1 
ATOM   2019 C  CA   . ASP A 1 125 ? 13.420  -10.214 14.901  1.00 83.97  ? 486 ASP A CA   1 
ATOM   2020 C  C    . ASP A 1 125 ? 12.827  -9.366  16.017  1.00 90.46  ? 486 ASP A C    1 
ATOM   2021 O  O    . ASP A 1 125 ? 13.553  -8.655  16.711  1.00 97.81  ? 486 ASP A O    1 
ATOM   2022 C  CB   . ASP A 1 125 ? 14.785  -10.784 15.298  1.00 101.22 ? 486 ASP A CB   1 
ATOM   2023 C  CG   . ASP A 1 125 ? 14.691  -11.807 16.416  1.00 110.34 ? 486 ASP A CG   1 
ATOM   2024 O  OD1  . ASP A 1 125 ? 14.512  -11.403 17.584  1.00 110.74 ? 486 ASP A OD1  1 
ATOM   2025 O  OD2  . ASP A 1 125 ? 14.805  -13.016 16.125  1.00 96.56  ? 486 ASP A OD2  1 
ATOM   2026 H  H    . ASP A 1 125 ? 13.672  -8.528  13.928  1.00 96.09  ? 486 ASP A H    1 
ATOM   2027 H  HA   . ASP A 1 125 ? 12.816  -10.950 14.714  1.00 100.76 ? 486 ASP A HA   1 
ATOM   2028 H  HB2  . ASP A 1 125 ? 15.182  -11.219 14.527  1.00 121.47 ? 486 ASP A HB2  1 
ATOM   2029 H  HB3  . ASP A 1 125 ? 15.354  -10.060 15.601  1.00 121.47 ? 486 ASP A HB3  1 
ATOM   2030 N  N    . GLU A 1 126 ? 11.507  -9.429  16.171  1.00 90.85  ? 487 GLU A N    1 
ATOM   2031 C  CA   . GLU A 1 126 ? 10.797  -8.472  17.013  1.00 97.75  ? 487 GLU A CA   1 
ATOM   2032 C  C    . GLU A 1 126 ? 9.560   -9.023  17.705  1.00 99.59  ? 487 GLU A C    1 
ATOM   2033 O  O    . GLU A 1 126 ? 8.950   -9.999  17.257  1.00 77.35  ? 487 GLU A O    1 
ATOM   2034 C  CB   . GLU A 1 126 ? 10.374  -7.263  16.178  1.00 96.74  ? 487 GLU A CB   1 
ATOM   2035 C  CG   . GLU A 1 126 ? 11.510  -6.342  15.782  1.00 110.81 ? 487 GLU A CG   1 
ATOM   2036 C  CD   . GLU A 1 126 ? 11.016  -5.071  15.115  1.00 128.34 ? 487 GLU A CD   1 
ATOM   2037 O  OE1  . GLU A 1 126 ? 9.794   -4.959  14.876  1.00 132.91 ? 487 GLU A OE1  1 
ATOM   2038 O  OE2  . GLU A 1 126 ? 11.849  -4.184  14.831  1.00 132.66 ? 487 GLU A OE2  1 
ATOM   2039 H  H    . GLU A 1 126 ? 11.000  -10.016 15.800  1.00 109.02 ? 487 GLU A H    1 
ATOM   2040 H  HA   . GLU A 1 126 ? 11.403  -8.158  17.702  1.00 117.29 ? 487 GLU A HA   1 
ATOM   2041 H  HB2  . GLU A 1 126 ? 9.956   -7.581  15.363  1.00 116.09 ? 487 GLU A HB2  1 
ATOM   2042 H  HB3  . GLU A 1 126 ? 9.737   -6.741  16.690  1.00 116.09 ? 487 GLU A HB3  1 
ATOM   2043 H  HG2  . GLU A 1 126 ? 12.007  -6.091  16.576  1.00 132.98 ? 487 GLU A HG2  1 
ATOM   2044 H  HG3  . GLU A 1 126 ? 12.091  -6.804  15.158  1.00 132.98 ? 487 GLU A HG3  1 
ATOM   2045 N  N    . TRP A 1 127 ? 9.203   -8.357  18.800  1.00 78.22  ? 488 TRP A N    1 
ATOM   2046 C  CA   . TRP A 1 127 ? 7.938   -8.567  19.483  1.00 77.03  ? 488 TRP A CA   1 
ATOM   2047 C  C    . TRP A 1 127 ? 6.899   -7.603  18.942  1.00 75.99  ? 488 TRP A C    1 
ATOM   2048 O  O    . TRP A 1 127 ? 7.159   -6.407  18.817  1.00 82.95  ? 488 TRP A O    1 
ATOM   2049 C  CB   . TRP A 1 127 ? 8.091   -8.364  20.990  1.00 80.11  ? 488 TRP A CB   1 
ATOM   2050 C  CG   . TRP A 1 127 ? 8.854   -9.448  21.658  1.00 81.24  ? 488 TRP A CG   1 
ATOM   2051 C  CD1  . TRP A 1 127 ? 10.207  -9.531  21.800  1.00 83.83  ? 488 TRP A CD1  1 
ATOM   2052 C  CD2  . TRP A 1 127 ? 8.312   -10.616 22.279  1.00 80.26  ? 488 TRP A CD2  1 
ATOM   2053 N  NE1  . TRP A 1 127 ? 10.542  -10.680 22.473  1.00 84.57  ? 488 TRP A NE1  1 
ATOM   2054 C  CE2  . TRP A 1 127 ? 9.395   -11.364 22.779  1.00 82.44  ? 488 TRP A CE2  1 
ATOM   2055 C  CE3  . TRP A 1 127 ? 7.017   -11.104 22.461  1.00 78.06  ? 488 TRP A CE3  1 
ATOM   2056 C  CZ2  . TRP A 1 127 ? 9.223   -12.570 23.448  1.00 82.58  ? 488 TRP A CZ2  1 
ATOM   2057 C  CZ3  . TRP A 1 127 ? 6.847   -12.302 23.125  1.00 78.12  ? 488 TRP A CZ3  1 
ATOM   2058 C  CH2  . TRP A 1 127 ? 7.943   -13.021 23.610  1.00 80.41  ? 488 TRP A CH2  1 
ATOM   2059 H  H    . TRP A 1 127 ? 9.696   -7.760  19.174  1.00 93.86  ? 488 TRP A H    1 
ATOM   2060 H  HA   . TRP A 1 127 ? 7.630   -9.473  19.324  1.00 92.43  ? 488 TRP A HA   1 
ATOM   2061 H  HB2  . TRP A 1 127 ? 8.560   -7.530  21.148  1.00 96.13  ? 488 TRP A HB2  1 
ATOM   2062 H  HB3  . TRP A 1 127 ? 7.210   -8.329  21.393  1.00 96.13  ? 488 TRP A HB3  1 
ATOM   2063 H  HD1  . TRP A 1 127 ? 10.815  -8.900  21.488  1.00 100.59 ? 488 TRP A HD1  1 
ATOM   2064 H  HE1  . TRP A 1 127 ? 11.341  -10.928 22.672  1.00 101.48 ? 488 TRP A HE1  1 
ATOM   2065 H  HE3  . TRP A 1 127 ? 6.283   -10.631 22.141  1.00 93.67  ? 488 TRP A HE3  1 
ATOM   2066 H  HZ2  . TRP A 1 127 ? 9.950   -13.051 23.772  1.00 99.09  ? 488 TRP A HZ2  1 
ATOM   2067 H  HZ3  . TRP A 1 127 ? 5.988   -12.636 23.253  1.00 93.75  ? 488 TRP A HZ3  1 
ATOM   2068 H  HH2  . TRP A 1 127 ? 7.798   -13.825 24.054  1.00 96.49  ? 488 TRP A HH2  1 
ATOM   2069 N  N    . PHE A 1 128 ? 5.726   -8.133  18.622  1.00 73.14  ? 489 PHE A N    1 
ATOM   2070 C  CA   . PHE A 1 128 ? 4.616   -7.317  18.161  1.00 72.33  ? 489 PHE A CA   1 
ATOM   2071 C  C    . PHE A 1 128 ? 3.464   -7.426  19.138  1.00 72.24  ? 489 PHE A C    1 
ATOM   2072 O  O    . PHE A 1 128 ? 3.098   -8.523  19.557  1.00 73.65  ? 489 PHE A O    1 
ATOM   2073 C  CB   . PHE A 1 128 ? 4.161   -7.751  16.765  1.00 69.31  ? 489 PHE A CB   1 
ATOM   2074 C  CG   . PHE A 1 128 ? 5.202   -7.560  15.699  1.00 74.06  ? 489 PHE A CG   1 
ATOM   2075 C  CD1  . PHE A 1 128 ? 6.155   -8.537  15.458  1.00 80.90  ? 489 PHE A CD1  1 
ATOM   2076 C  CD2  . PHE A 1 128 ? 5.222   -6.408  14.929  1.00 88.61  ? 489 PHE A CD2  1 
ATOM   2077 C  CE1  . PHE A 1 128 ? 7.113   -8.364  14.474  1.00 74.19  ? 489 PHE A CE1  1 
ATOM   2078 C  CE2  . PHE A 1 128 ? 6.177   -6.230  13.943  1.00 77.89  ? 489 PHE A CE2  1 
ATOM   2079 C  CZ   . PHE A 1 128 ? 7.123   -7.209  13.718  1.00 71.81  ? 489 PHE A CZ   1 
ATOM   2080 H  H    . PHE A 1 128 ? 5.547   -8.973  18.664  1.00 87.77  ? 489 PHE A H    1 
ATOM   2081 H  HA   . PHE A 1 128 ? 4.894   -6.389  18.118  1.00 86.80  ? 489 PHE A HA   1 
ATOM   2082 H  HB2  . PHE A 1 128 ? 3.932   -8.693  16.790  1.00 83.17  ? 489 PHE A HB2  1 
ATOM   2083 H  HB3  . PHE A 1 128 ? 3.382   -7.230  16.514  1.00 83.17  ? 489 PHE A HB3  1 
ATOM   2084 H  HD1  . PHE A 1 128 ? 6.153   -9.316  15.966  1.00 97.08  ? 489 PHE A HD1  1 
ATOM   2085 H  HD2  . PHE A 1 128 ? 4.588   -5.744  15.079  1.00 106.34 ? 489 PHE A HD2  1 
ATOM   2086 H  HE1  . PHE A 1 128 ? 7.749   -9.025  14.323  1.00 89.02  ? 489 PHE A HE1  1 
ATOM   2087 H  HE2  . PHE A 1 128 ? 6.183   -5.452  13.435  1.00 93.47  ? 489 PHE A HE2  1 
ATOM   2088 H  HZ   . PHE A 1 128 ? 7.765   -7.092  13.056  1.00 86.18  ? 489 PHE A HZ   1 
ATOM   2089 N  N    . THR A 1 129 ? 2.893   -6.286  19.499  1.00 73.93  ? 490 THR A N    1 
ATOM   2090 C  CA   . THR A 1 129 ? 1.727   -6.283  20.364  1.00 91.41  ? 490 THR A CA   1 
ATOM   2091 C  C    . THR A 1 129 ? 0.518   -6.668  19.525  1.00 85.89  ? 490 THR A C    1 
ATOM   2092 O  O    . THR A 1 129 ? 0.216   -6.032  18.515  1.00 74.15  ? 490 THR A O    1 
ATOM   2093 C  CB   . THR A 1 129 ? 1.511   -4.913  21.044  1.00 94.41  ? 490 THR A CB   1 
ATOM   2094 O  OG1  . THR A 1 129 ? 1.388   -3.886  20.054  1.00 123.01 ? 490 THR A OG1  1 
ATOM   2095 C  CG2  . THR A 1 129 ? 2.683   -4.595  21.949  1.00 82.06  ? 490 THR A CG2  1 
ATOM   2096 H  H    . THR A 1 129 ? 3.161   -5.505  19.259  1.00 88.72  ? 490 THR A H    1 
ATOM   2097 H  HA   . THR A 1 129 ? 1.841   -6.951  21.057  1.00 109.69 ? 490 THR A HA   1 
ATOM   2098 H  HB   . THR A 1 129 ? 0.705   -4.943  21.583  1.00 113.29 ? 490 THR A HB   1 
ATOM   2099 H  HG1  . THR A 1 129 ? 1.270   -3.142  20.425  1.00 147.61 ? 490 THR A HG1  1 
ATOM   2100 H  HG21 . THR A 1 129 ? 2.547   -3.735  22.376  1.00 98.47  ? 490 THR A HG21 1 
ATOM   2101 H  HG22 . THR A 1 129 ? 2.768   -5.278  22.633  1.00 98.47  ? 490 THR A HG22 1 
ATOM   2102 H  HG23 . THR A 1 129 ? 3.502   -4.564  21.431  1.00 98.47  ? 490 THR A HG23 1 
ATOM   2103 N  N    . LEU A 1 130 ? -0.152  -7.735  19.942  1.00 75.88  ? 491 LEU A N    1 
ATOM   2104 C  CA   . LEU A 1 130 ? -1.310  -8.245  19.230  1.00 69.92  ? 491 LEU A CA   1 
ATOM   2105 C  C    . LEU A 1 130 ? -2.455  -7.245  19.188  1.00 67.93  ? 491 LEU A C    1 
ATOM   2106 O  O    . LEU A 1 130 ? -2.744  -6.558  20.170  1.00 70.07  ? 491 LEU A O    1 
ATOM   2107 C  CB   . LEU A 1 130 ? -1.783  -9.549  19.869  1.00 66.09  ? 491 LEU A CB   1 
ATOM   2108 C  CG   . LEU A 1 130 ? -0.857  -10.741 19.634  1.00 65.02  ? 491 LEU A CG   1 
ATOM   2109 C  CD1  . LEU A 1 130 ? -1.261  -11.912 20.506  1.00 65.38  ? 491 LEU A CD1  1 
ATOM   2110 C  CD2  . LEU A 1 130 ? -0.873  -11.145 18.160  1.00 62.60  ? 491 LEU A CD2  1 
ATOM   2111 H  H    . LEU A 1 130 ? 0.049   -8.186  20.646  1.00 91.06  ? 491 LEU A H    1 
ATOM   2112 H  HA   . LEU A 1 130 ? -1.053  -8.440  18.315  1.00 83.90  ? 491 LEU A HA   1 
ATOM   2113 H  HB2  . LEU A 1 130 ? -1.855  -9.416  20.827  1.00 79.31  ? 491 LEU A HB2  1 
ATOM   2114 H  HB3  . LEU A 1 130 ? -2.653  -9.775  19.504  1.00 79.31  ? 491 LEU A HB3  1 
ATOM   2115 H  HG   . LEU A 1 130 ? 0.050   -10.490 19.868  1.00 78.03  ? 491 LEU A HG   1 
ATOM   2116 H  HD11 . LEU A 1 130 ? -0.659  -12.653 20.337  1.00 78.46  ? 491 LEU A HD11 1 
ATOM   2117 H  HD12 . LEU A 1 130 ? -1.206  -11.645 21.437  1.00 78.46  ? 491 LEU A HD12 1 
ATOM   2118 H  HD13 . LEU A 1 130 ? -2.171  -12.168 20.288  1.00 78.46  ? 491 LEU A HD13 1 
ATOM   2119 H  HD21 . LEU A 1 130 ? -0.280  -11.902 18.034  1.00 75.12  ? 491 LEU A HD21 1 
ATOM   2120 H  HD22 . LEU A 1 130 ? -1.778  -11.388 17.909  1.00 75.12  ? 491 LEU A HD22 1 
ATOM   2121 H  HD23 . LEU A 1 130 ? -0.571  -10.394 17.624  1.00 75.12  ? 491 LEU A HD23 1 
ATOM   2122 N  N    . ASP A 1 131 ? -3.109  -7.194  18.032  1.00 66.38  ? 492 ASP A N    1 
ATOM   2123 C  CA   . ASP A 1 131 ? -4.217  -6.287  17.777  1.00 67.21  ? 492 ASP A CA   1 
ATOM   2124 C  C    . ASP A 1 131 ? -5.524  -6.930  18.219  1.00 66.36  ? 492 ASP A C    1 
ATOM   2125 O  O    . ASP A 1 131 ? -5.626  -8.155  18.268  1.00 64.59  ? 492 ASP A O    1 
ATOM   2126 C  CB   . ASP A 1 131 ? -4.280  -5.942  16.283  1.00 66.37  ? 492 ASP A CB   1 
ATOM   2127 C  CG   . ASP A 1 131 ? -4.382  -4.450  16.022  1.00 94.59  ? 492 ASP A CG   1 
ATOM   2128 O  OD1  . ASP A 1 131 ? -3.327  -3.802  15.849  1.00 97.58  ? 492 ASP A OD1  1 
ATOM   2129 O  OD2  . ASP A 1 131 ? -5.517  -3.928  15.967  1.00 98.91  ? 492 ASP A OD2  1 
ATOM   2130 H  H    . ASP A 1 131 ? -2.920  -7.694  17.359  1.00 79.66  ? 492 ASP A H    1 
ATOM   2131 H  HA   . ASP A 1 131 ? -4.090  -5.467  18.279  1.00 80.65  ? 492 ASP A HA   1 
ATOM   2132 H  HB2  . ASP A 1 131 ? -3.474  -6.266  15.851  1.00 79.64  ? 492 ASP A HB2  1 
ATOM   2133 H  HB3  . ASP A 1 131 ? -5.059  -6.368  15.893  1.00 79.64  ? 492 ASP A HB3  1 
ATOM   2134 N  N    . GLU A 1 132 ? -6.511  -6.101  18.551  1.00 68.22  ? 493 GLU A N    1 
ATOM   2135 C  CA   . GLU A 1 132 ? -7.872  -6.561  18.838  1.00 67.77  ? 493 GLU A CA   1 
ATOM   2136 C  C    . GLU A 1 132 ? -7.971  -7.457  20.076  1.00 76.98  ? 493 GLU A C    1 
ATOM   2137 O  O    . GLU A 1 132 ? -8.881  -8.279  20.183  1.00 66.80  ? 493 GLU A O    1 
ATOM   2138 C  CB   . GLU A 1 132 ? -8.437  -7.300  17.620  1.00 74.18  ? 493 GLU A CB   1 
ATOM   2139 C  CG   . GLU A 1 132 ? -8.495  -6.444  16.361  1.00 87.62  ? 493 GLU A CG   1 
ATOM   2140 C  CD   . GLU A 1 132 ? -9.454  -5.280  16.503  1.00 105.08 ? 493 GLU A CD   1 
ATOM   2141 O  OE1  . GLU A 1 132 ? -10.486 -5.449  17.186  1.00 101.21 ? 493 GLU A OE1  1 
ATOM   2142 O  OE2  . GLU A 1 132 ? -9.172  -4.198  15.945  1.00 108.80 ? 493 GLU A OE2  1 
ATOM   2143 H  H    . GLU A 1 132 ? -6.416  -5.248  18.618  1.00 81.86  ? 493 GLU A H    1 
ATOM   2144 H  HA   . GLU A 1 132 ? -8.433  -5.785  18.995  1.00 81.32  ? 493 GLU A HA   1 
ATOM   2145 H  HB2  . GLU A 1 132 ? -7.876  -8.068  17.431  1.00 89.02  ? 493 GLU A HB2  1 
ATOM   2146 H  HB3  . GLU A 1 132 ? -9.340  -7.593  17.822  1.00 89.02  ? 493 GLU A HB3  1 
ATOM   2147 H  HG2  . GLU A 1 132 ? -7.612  -6.087  16.180  1.00 105.14 ? 493 GLU A HG2  1 
ATOM   2148 H  HG3  . GLU A 1 132 ? -8.793  -6.991  15.618  1.00 105.14 ? 493 GLU A HG3  1 
ATOM   2149 N  N    . VAL A 1 133 ? -7.034  -7.291  21.005  1.00 70.34  ? 494 VAL A N    1 
ATOM   2150 C  CA   . VAL A 1 133 ? -7.097  -7.968  22.296  1.00 69.51  ? 494 VAL A CA   1 
ATOM   2151 C  C    . VAL A 1 133 ? -6.566  -7.052  23.384  1.00 73.32  ? 494 VAL A C    1 
ATOM   2152 O  O    . VAL A 1 133 ? -5.756  -6.171  23.103  1.00 73.43  ? 494 VAL A O    1 
ATOM   2153 C  CB   . VAL A 1 133 ? -6.293  -9.287  22.314  1.00 78.15  ? 494 VAL A CB   1 
ATOM   2154 C  CG1  . VAL A 1 133 ? -7.078  -10.392 21.642  1.00 77.64  ? 494 VAL A CG1  1 
ATOM   2155 C  CG2  . VAL A 1 133 ? -4.918  -9.106  21.663  1.00 67.71  ? 494 VAL A CG2  1 
ATOM   2156 H  H    . VAL A 1 133 ? -6.344  -6.787  20.910  1.00 84.40  ? 494 VAL A H    1 
ATOM   2157 H  HA   . VAL A 1 133 ? -8.022  -8.176  22.501  1.00 83.41  ? 494 VAL A HA   1 
ATOM   2158 H  HB   . VAL A 1 133 ? -6.148  -9.549  23.237  1.00 93.78  ? 494 VAL A HB   1 
ATOM   2159 H  HG11 . VAL A 1 133 ? -6.555  -11.209 21.664  1.00 93.16  ? 494 VAL A HG11 1 
ATOM   2160 H  HG12 . VAL A 1 133 ? -7.913  -10.520 22.118  1.00 93.16  ? 494 VAL A HG12 1 
ATOM   2161 H  HG13 . VAL A 1 133 ? -7.256  -10.138 20.723  1.00 93.16  ? 494 VAL A HG13 1 
ATOM   2162 H  HG21 . VAL A 1 133 ? -4.442  -9.950  21.691  1.00 81.25  ? 494 VAL A HG21 1 
ATOM   2163 H  HG22 . VAL A 1 133 ? -5.040  -8.825  20.742  1.00 81.25  ? 494 VAL A HG22 1 
ATOM   2164 H  HG23 . VAL A 1 133 ? -4.424  -8.430  22.153  1.00 81.25  ? 494 VAL A HG23 1 
ATOM   2165 N  N    . PRO A 1 134 ? -7.015  -7.259  24.636  1.00 73.81  ? 495 PRO A N    1 
ATOM   2166 C  CA   . PRO A 1 134 ? -6.566  -6.401  25.739  1.00 76.83  ? 495 PRO A CA   1 
ATOM   2167 C  C    . PRO A 1 134 ? -5.075  -6.538  26.028  1.00 84.96  ? 495 PRO A C    1 
ATOM   2168 O  O    . PRO A 1 134 ? -4.441  -5.570  26.443  1.00 93.74  ? 495 PRO A O    1 
ATOM   2169 C  CB   . PRO A 1 134 ? -7.389  -6.896  26.941  1.00 77.92  ? 495 PRO A CB   1 
ATOM   2170 C  CG   . PRO A 1 134 ? -8.425  -7.804  26.391  1.00 77.13  ? 495 PRO A CG   1 
ATOM   2171 C  CD   . PRO A 1 134 ? -7.894  -8.341  25.108  1.00 73.04  ? 495 PRO A CD   1 
ATOM   2172 H  HA   . PRO A 1 134 ? -6.780  -5.472  25.558  1.00 92.20  ? 495 PRO A HA   1 
ATOM   2173 H  HB2  . PRO A 1 134 ? -6.809  -7.374  27.554  1.00 93.50  ? 495 PRO A HB2  1 
ATOM   2174 H  HB3  . PRO A 1 134 ? -7.802  -6.138  27.384  1.00 93.50  ? 495 PRO A HB3  1 
ATOM   2175 H  HG2  . PRO A 1 134 ? -8.586  -8.526  27.019  1.00 92.56  ? 495 PRO A HG2  1 
ATOM   2176 H  HG3  . PRO A 1 134 ? -9.242  -7.303  26.236  1.00 92.56  ? 495 PRO A HG3  1 
ATOM   2177 H  HD2  . PRO A 1 134 ? -7.383  -9.150  25.264  1.00 87.65  ? 495 PRO A HD2  1 
ATOM   2178 H  HD3  . PRO A 1 134 ? -8.616  -8.490  24.477  1.00 87.65  ? 495 PRO A HD3  1 
ATOM   2179 N  N    . LYS A 1 135 ? -4.531  -7.732  25.817  1.00 76.01  ? 496 LYS A N    1 
ATOM   2180 C  CA   . LYS A 1 135 ? -3.130  -8.009  26.125  1.00 77.03  ? 496 LYS A CA   1 
ATOM   2181 C  C    . LYS A 1 135 ? -2.624  -9.122  25.227  1.00 74.49  ? 496 LYS A C    1 
ATOM   2182 O  O    . LYS A 1 135 ? -3.417  -9.878  24.666  1.00 72.24  ? 496 LYS A O    1 
ATOM   2183 C  CB   . LYS A 1 135 ? -2.960  -8.403  27.601  1.00 79.46  ? 496 LYS A CB   1 
ATOM   2184 C  CG   . LYS A 1 135 ? -3.725  -9.664  27.992  1.00 78.44  ? 496 LYS A CG   1 
ATOM   2185 C  CD   . LYS A 1 135 ? -3.658  -9.966  29.491  1.00 81.31  ? 496 LYS A CD   1 
ATOM   2186 C  CE   . LYS A 1 135 ? -2.371  -10.679 29.875  1.00 85.47  ? 496 LYS A CE   1 
ATOM   2187 N  NZ   . LYS A 1 135 ? -2.411  -11.207 31.264  1.00 119.37 ? 496 LYS A NZ   1 
ATOM   2188 H  H    . LYS A 1 135 ? -4.955  -8.406  25.493  1.00 91.21  ? 496 LYS A H    1 
ATOM   2189 H  HA   . LYS A 1 135 ? -2.600  -7.215  25.957  1.00 92.43  ? 496 LYS A HA   1 
ATOM   2190 H  HB2  . LYS A 1 135 ? -2.019  -8.560  27.776  1.00 95.36  ? 496 LYS A HB2  1 
ATOM   2191 H  HB3  . LYS A 1 135 ? -3.282  -7.677  28.157  1.00 95.36  ? 496 LYS A HB3  1 
ATOM   2192 H  HG2  . LYS A 1 135 ? -4.658  -9.555  27.751  1.00 94.13  ? 496 LYS A HG2  1 
ATOM   2193 H  HG3  . LYS A 1 135 ? -3.348  -10.421 27.517  1.00 94.13  ? 496 LYS A HG3  1 
ATOM   2194 H  HD2  . LYS A 1 135 ? -3.700  -9.133  29.986  1.00 97.58  ? 496 LYS A HD2  1 
ATOM   2195 H  HD3  . LYS A 1 135 ? -4.403  -10.537 29.735  1.00 97.58  ? 496 LYS A HD3  1 
ATOM   2196 H  HE2  . LYS A 1 135 ? -2.230  -11.426 29.273  1.00 102.57 ? 496 LYS A HE2  1 
ATOM   2197 H  HE3  . LYS A 1 135 ? -1.631  -10.055 29.811  1.00 102.57 ? 496 LYS A HE3  1 
ATOM   2198 H  HZ1  . LYS A 1 135 ? -1.644  -11.617 31.456  1.00 143.24 ? 496 LYS A HZ1  1 
ATOM   2199 H  HZ2  . LYS A 1 135 ? -2.533  -10.539 31.840  1.00 143.24 ? 496 LYS A HZ2  1 
ATOM   2200 H  HZ3  . LYS A 1 135 ? -3.079  -11.788 31.349  1.00 143.24 ? 496 LYS A HZ3  1 
ATOM   2201 N  N    . GLY A 1 136 ? -1.306  -9.225  25.096  1.00 75.12  ? 497 GLY A N    1 
ATOM   2202 C  CA   . GLY A 1 136 ? -0.709  -10.251 24.262  1.00 93.24  ? 497 GLY A CA   1 
ATOM   2203 C  C    . GLY A 1 136 ? 0.329   -9.716  23.301  1.00 86.46  ? 497 GLY A C    1 
ATOM   2204 O  O    . GLY A 1 136 ? 0.143   -8.675  22.671  1.00 72.74  ? 497 GLY A O    1 
ATOM   2205 H  H    . GLY A 1 136 ? -0.736  -8.709  25.483  1.00 90.14  ? 497 GLY A H    1 
ATOM   2206 H  HA2  . GLY A 1 136 ? -0.285  -10.916 24.828  1.00 111.89 ? 497 GLY A HA2  1 
ATOM   2207 H  HA3  . GLY A 1 136 ? -1.404  -10.688 23.746  1.00 111.89 ? 497 GLY A HA3  1 
ATOM   2208 N  N    . LYS A 1 137 ? 1.429   -10.451 23.200  1.00 74.66  ? 498 LYS A N    1 
ATOM   2209 C  CA   . LYS A 1 137 ? 2.543   -10.102 22.338  1.00 72.92  ? 498 LYS A CA   1 
ATOM   2210 C  C    . LYS A 1 137 ? 3.027   -11.365 21.642  1.00 72.22  ? 498 LYS A C    1 
ATOM   2211 O  O    . LYS A 1 137 ? 3.005   -12.445 22.233  1.00 71.37  ? 498 LYS A O    1 
ATOM   2212 C  CB   . LYS A 1 137 ? 3.679   -9.460  23.137  1.00 76.36  ? 498 LYS A CB   1 
ATOM   2213 C  CG   . LYS A 1 137 ? 3.473   -7.987  23.458  1.00 90.49  ? 498 LYS A CG   1 
ATOM   2214 C  CD   . LYS A 1 137 ? 4.564   -7.467  24.382  1.00 94.04  ? 498 LYS A CD   1 
ATOM   2215 C  CE   . LYS A 1 137 ? 4.332   -6.013  24.766  1.00 93.57  ? 498 LYS A CE   1 
ATOM   2216 N  NZ   . LYS A 1 137 ? 5.253   -5.565  25.847  1.00 104.39 ? 498 LYS A NZ   1 
ATOM   2217 H  H    . LYS A 1 137 ? 1.554   -11.181 23.638  1.00 89.59  ? 498 LYS A H    1 
ATOM   2218 H  HA   . LYS A 1 137 ? 2.246   -9.472  21.663  1.00 87.50  ? 498 LYS A HA   1 
ATOM   2219 H  HB2  . LYS A 1 137 ? 3.772   -9.934  23.978  1.00 91.63  ? 498 LYS A HB2  1 
ATOM   2220 H  HB3  . LYS A 1 137 ? 4.499   -9.537  22.625  1.00 91.63  ? 498 LYS A HB3  1 
ATOM   2221 H  HG2  . LYS A 1 137 ? 3.499   -7.472  22.636  1.00 108.59 ? 498 LYS A HG2  1 
ATOM   2222 H  HG3  . LYS A 1 137 ? 2.618   -7.871  23.901  1.00 108.59 ? 498 LYS A HG3  1 
ATOM   2223 H  HD2  . LYS A 1 137 ? 4.574   -7.997  25.195  1.00 112.85 ? 498 LYS A HD2  1 
ATOM   2224 H  HD3  . LYS A 1 137 ? 5.421   -7.528  23.931  1.00 112.85 ? 498 LYS A HD3  1 
ATOM   2225 H  HE2  . LYS A 1 137 ? 4.482   -5.451  23.990  1.00 112.28 ? 498 LYS A HE2  1 
ATOM   2226 H  HE3  . LYS A 1 137 ? 3.421   -5.909  25.083  1.00 112.28 ? 498 LYS A HE3  1 
ATOM   2227 H  HZ1  . LYS A 1 137 ? 5.093   -4.713  26.049  1.00 125.27 ? 498 LYS A HZ1  1 
ATOM   2228 H  HZ2  . LYS A 1 137 ? 5.132   -6.063  26.575  1.00 125.27 ? 498 LYS A HZ2  1 
ATOM   2229 H  HZ3  . LYS A 1 137 ? 6.098   -5.645  25.579  1.00 125.27 ? 498 LYS A HZ3  1 
ATOM   2230 N  N    . LEU A 1 138 ? 3.450   -11.223 20.387  1.00 75.91  ? 499 LEU A N    1 
ATOM   2231 C  CA   . LEU A 1 138 ? 3.929   -12.348 19.589  1.00 67.74  ? 499 LEU A CA   1 
ATOM   2232 C  C    . LEU A 1 138 ? 5.342   -12.077 19.084  1.00 68.83  ? 499 LEU A C    1 
ATOM   2233 O  O    . LEU A 1 138 ? 5.644   -10.984 18.599  1.00 69.49  ? 499 LEU A O    1 
ATOM   2234 C  CB   . LEU A 1 138 ? 2.982   -12.613 18.415  1.00 64.76  ? 499 LEU A CB   1 
ATOM   2235 C  CG   . LEU A 1 138 ? 3.374   -13.702 17.409  1.00 62.76  ? 499 LEU A CG   1 
ATOM   2236 C  CD1  . LEU A 1 138 ? 3.274   -15.085 18.035  1.00 69.48  ? 499 LEU A CD1  1 
ATOM   2237 C  CD2  . LEU A 1 138 ? 2.507   -13.611 16.153  1.00 60.28  ? 499 LEU A CD2  1 
ATOM   2238 H  H    . LEU A 1 138 ? 3.469   -10.471 19.969  1.00 91.09  ? 499 LEU A H    1 
ATOM   2239 H  HA   . LEU A 1 138 ? 3.953   -13.144 20.143  1.00 81.29  ? 499 LEU A HA   1 
ATOM   2240 H  HB2  . LEU A 1 138 ? 2.118   -12.862 18.778  1.00 77.71  ? 499 LEU A HB2  1 
ATOM   2241 H  HB3  . LEU A 1 138 ? 2.889   -11.787 17.915  1.00 77.71  ? 499 LEU A HB3  1 
ATOM   2242 H  HG   . LEU A 1 138 ? 4.296   -13.563 17.142  1.00 75.32  ? 499 LEU A HG   1 
ATOM   2243 H  HD11 . LEU A 1 138 ? 3.528   -15.749 17.375  1.00 83.38  ? 499 LEU A HD11 1 
ATOM   2244 H  HD12 . LEU A 1 138 ? 3.873   -15.131 18.797  1.00 83.38  ? 499 LEU A HD12 1 
ATOM   2245 H  HD13 . LEU A 1 138 ? 2.360   -15.236 18.323  1.00 83.38  ? 499 LEU A HD13 1 
ATOM   2246 H  HD21 . LEU A 1 138 ? 2.774   -14.309 15.535  1.00 72.33  ? 499 LEU A HD21 1 
ATOM   2247 H  HD22 . LEU A 1 138 ? 1.577   -13.728 16.404  1.00 72.33  ? 499 LEU A HD22 1 
ATOM   2248 H  HD23 . LEU A 1 138 ? 2.633   -12.740 15.745  1.00 72.33  ? 499 LEU A HD23 1 
ATOM   2249 N  N    . HIS A 1 139 ? 6.195   -13.088 19.202  1.00 75.16  ? 500 HIS A N    1 
ATOM   2250 C  CA   . HIS A 1 139 ? 7.606   -12.979 18.849  1.00 70.79  ? 500 HIS A CA   1 
ATOM   2251 C  C    . HIS A 1 139 ? 7.859   -13.630 17.485  1.00 68.41  ? 500 HIS A C    1 
ATOM   2252 O  O    . HIS A 1 139 ? 7.687   -14.838 17.331  1.00 74.08  ? 500 HIS A O    1 
ATOM   2253 C  CB   . HIS A 1 139 ? 8.464   -13.637 19.938  1.00 73.58  ? 500 HIS A CB   1 
ATOM   2254 C  CG   . HIS A 1 139 ? 9.936   -13.405 19.785  1.00 80.51  ? 500 HIS A CG   1 
ATOM   2255 N  ND1  . HIS A 1 139 ? 10.460  -12.422 18.972  1.00 87.37  ? 500 HIS A ND1  1 
ATOM   2256 C  CD2  . HIS A 1 139 ? 10.997  -14.032 20.347  1.00 88.89  ? 500 HIS A CD2  1 
ATOM   2257 C  CE1  . HIS A 1 139 ? 11.778  -12.454 19.039  1.00 88.20  ? 500 HIS A CE1  1 
ATOM   2258 N  NE2  . HIS A 1 139 ? 12.131  -13.422 19.867  1.00 96.57  ? 500 HIS A NE2  1 
ATOM   2259 H  H    . HIS A 1 139 ? 5.974   -13.867 19.491  1.00 90.19  ? 500 HIS A H    1 
ATOM   2260 H  HA   . HIS A 1 139 ? 7.851   -12.042 18.791  1.00 84.95  ? 500 HIS A HA   1 
ATOM   2261 H  HB2  . HIS A 1 139 ? 8.197   -13.282 20.800  1.00 88.29  ? 500 HIS A HB2  1 
ATOM   2262 H  HB3  . HIS A 1 139 ? 8.312   -14.595 19.916  1.00 88.29  ? 500 HIS A HB3  1 
ATOM   2263 H  HD1  . HIS A 1 139 ? 9.999   -11.874 18.496  1.00 104.85 ? 500 HIS A HD1  1 
ATOM   2264 H  HD2  . HIS A 1 139 ? 10.965  -14.743 20.945  1.00 106.67 ? 500 HIS A HD2  1 
ATOM   2265 H  HE1  . HIS A 1 139 ? 12.360  -11.891 18.582  1.00 105.84 ? 500 HIS A HE1  1 
ATOM   2266 H  HE2  . HIS A 1 139 ? 12.938  -13.636 20.071  1.00 115.88 ? 500 HIS A HE2  1 
ATOM   2267 N  N    . LEU A 1 140 ? 8.248   -12.823 16.500  1.00 68.07  ? 501 LEU A N    1 
ATOM   2268 C  CA   . LEU A 1 140 ? 8.508   -13.321 15.143  1.00 66.01  ? 501 LEU A CA   1 
ATOM   2269 C  C    . LEU A 1 140 ? 9.907   -12.987 14.661  1.00 67.71  ? 501 LEU A C    1 
ATOM   2270 O  O    . LEU A 1 140 ? 10.481  -11.965 15.031  1.00 71.20  ? 501 LEU A O    1 
ATOM   2271 C  CB   . LEU A 1 140 ? 7.499   -12.745 14.153  1.00 63.78  ? 501 LEU A CB   1 
ATOM   2272 C  CG   . LEU A 1 140 ? 6.032   -13.086 14.406  1.00 61.99  ? 501 LEU A CG   1 
ATOM   2273 C  CD1  . LEU A 1 140 ? 5.165   -12.338 13.420  1.00 68.91  ? 501 LEU A CD1  1 
ATOM   2274 C  CD2  . LEU A 1 140 ? 5.787   -14.585 14.325  1.00 60.45  ? 501 LEU A CD2  1 
ATOM   2275 H  H    . LEU A 1 140 ? 8.370   -11.976 16.589  1.00 81.68  ? 501 LEU A H    1 
ATOM   2276 H  HA   . LEU A 1 140 ? 8.413   -14.286 15.140  1.00 79.22  ? 501 LEU A HA   1 
ATOM   2277 H  HB2  . LEU A 1 140 ? 7.576   -11.778 14.168  1.00 76.54  ? 501 LEU A HB2  1 
ATOM   2278 H  HB3  . LEU A 1 140 ? 7.722   -13.072 13.267  1.00 76.54  ? 501 LEU A HB3  1 
ATOM   2279 H  HG   . LEU A 1 140 ? 5.790   -12.793 15.298  1.00 74.39  ? 501 LEU A HG   1 
ATOM   2280 H  HD11 . LEU A 1 140 ? 4.235   -12.559 13.587  1.00 82.69  ? 501 LEU A HD11 1 
ATOM   2281 H  HD12 . LEU A 1 140 ? 5.305   -11.385 13.538  1.00 82.69  ? 501 LEU A HD12 1 
ATOM   2282 H  HD13 . LEU A 1 140 ? 5.412   -12.600 12.520  1.00 82.69  ? 501 LEU A HD13 1 
ATOM   2283 H  HD21 . LEU A 1 140 ? 4.847   -14.761 14.490  1.00 72.53  ? 501 LEU A HD21 1 
ATOM   2284 H  HD22 . LEU A 1 140 ? 6.031   -14.897 13.439  1.00 72.53  ? 501 LEU A HD22 1 
ATOM   2285 H  HD23 . LEU A 1 140 ? 6.330   -15.030 14.994  1.00 72.53  ? 501 LEU A HD23 1 
ATOM   2286 N  N    . ARG A 1 141 ? 10.441  -13.863 13.818  1.00 69.21  ? 502 ARG A N    1 
ATOM   2287 C  CA   . ARG A 1 141 ? 11.680  -13.594 13.106  1.00 80.54  ? 502 ARG A CA   1 
ATOM   2288 C  C    . ARG A 1 141 ? 11.410  -13.836 11.624  1.00 70.77  ? 502 ARG A C    1 
ATOM   2289 O  O    . ARG A 1 141 ? 11.029  -14.935 11.220  1.00 65.31  ? 502 ARG A O    1 
ATOM   2290 C  CB   . ARG A 1 141 ? 12.823  -14.467 13.641  1.00 78.88  ? 502 ARG A CB   1 
ATOM   2291 C  CG   . ARG A 1 141 ? 14.184  -14.228 13.009  1.00 91.48  ? 502 ARG A CG   1 
ATOM   2292 C  CD   . ARG A 1 141 ? 15.218  -15.180 13.603  1.00 93.73  ? 502 ARG A CD   1 
ATOM   2293 N  NE   . ARG A 1 141 ? 16.530  -15.051 12.976  1.00 112.20 ? 502 ARG A NE   1 
ATOM   2294 C  CZ   . ARG A 1 141 ? 17.615  -15.712 13.371  1.00 128.34 ? 502 ARG A CZ   1 
ATOM   2295 N  NH1  . ARG A 1 141 ? 17.553  -16.550 14.398  1.00 135.78 ? 502 ARG A NH1  1 
ATOM   2296 N  NH2  . ARG A 1 141 ? 18.768  -15.533 12.742  1.00 119.99 ? 502 ARG A NH2  1 
ATOM   2297 H  H    . ARG A 1 141 ? 10.099  -14.632 13.641  1.00 83.05  ? 502 ARG A H    1 
ATOM   2298 H  HA   . ARG A 1 141 ? 11.925  -12.663 13.226  1.00 96.65  ? 502 ARG A HA   1 
ATOM   2299 H  HB2  . ARG A 1 141 ? 12.913  -14.305 14.593  1.00 94.66  ? 502 ARG A HB2  1 
ATOM   2300 H  HB3  . ARG A 1 141 ? 12.593  -15.398 13.491  1.00 94.66  ? 502 ARG A HB3  1 
ATOM   2301 H  HG2  . ARG A 1 141 ? 14.130  -14.390 12.054  1.00 109.78 ? 502 ARG A HG2  1 
ATOM   2302 H  HG3  . ARG A 1 141 ? 14.467  -13.317 13.184  1.00 109.78 ? 502 ARG A HG3  1 
ATOM   2303 H  HD2  . ARG A 1 141 ? 15.317  -14.987 14.549  1.00 112.47 ? 502 ARG A HD2  1 
ATOM   2304 H  HD3  . ARG A 1 141 ? 14.915  -16.093 13.480  1.00 112.47 ? 502 ARG A HD3  1 
ATOM   2305 H  HE   . ARG A 1 141 ? 16.612  -14.497 12.323  1.00 134.64 ? 502 ARG A HE   1 
ATOM   2306 H  HH11 . ARG A 1 141 ? 16.808  -16.671 14.811  1.00 162.93 ? 502 ARG A HH11 1 
ATOM   2307 H  HH12 . ARG A 1 141 ? 18.258  -16.975 14.650  1.00 162.93 ? 502 ARG A HH12 1 
ATOM   2308 H  HH21 . ARG A 1 141 ? 18.815  -14.990 12.076  1.00 143.99 ? 502 ARG A HH21 1 
ATOM   2309 H  HH22 . ARG A 1 141 ? 19.469  -15.960 12.998  1.00 143.99 ? 502 ARG A HH22 1 
ATOM   2310 N  N    . LEU A 1 142 ? 11.572  -12.783 10.828  1.00 78.43  ? 503 LEU A N    1 
ATOM   2311 C  CA   . LEU A 1 142 ? 11.234  -12.818 9.409   1.00 73.73  ? 503 LEU A CA   1 
ATOM   2312 C  C    . LEU A 1 142 ? 12.465  -12.627 8.539   1.00 77.51  ? 503 LEU A C    1 
ATOM   2313 O  O    . LEU A 1 142 ? 13.188  -11.644 8.690   1.00 81.81  ? 503 LEU A O    1 
ATOM   2314 C  CB   . LEU A 1 142 ? 10.201  -11.738 9.085   1.00 67.04  ? 503 LEU A CB   1 
ATOM   2315 C  CG   . LEU A 1 142 ? 8.927   -11.765 9.927   1.00 81.65  ? 503 LEU A CG   1 
ATOM   2316 C  CD1  . LEU A 1 142 ? 8.031   -10.591 9.567   1.00 61.95  ? 503 LEU A CD1  1 
ATOM   2317 C  CD2  . LEU A 1 142 ? 8.192   -13.079 9.739   1.00 61.52  ? 503 LEU A CD2  1 
ATOM   2318 H  H    . LEU A 1 142 ? 11.882  -12.025 11.090  1.00 94.12  ? 503 LEU A H    1 
ATOM   2319 H  HA   . LEU A 1 142 ? 10.845  -13.681 9.197   1.00 88.48  ? 503 LEU A HA   1 
ATOM   2320 H  HB2  . LEU A 1 142 ? 10.615  -10.871 9.214   1.00 80.45  ? 503 LEU A HB2  1 
ATOM   2321 H  HB3  . LEU A 1 142 ? 9.938   -11.836 8.157   1.00 80.45  ? 503 LEU A HB3  1 
ATOM   2322 H  HG   . LEU A 1 142 ? 9.164   -11.685 10.864  1.00 97.99  ? 503 LEU A HG   1 
ATOM   2323 H  HD11 . LEU A 1 142 ? 7.230   -10.627 10.111  1.00 74.33  ? 503 LEU A HD11 1 
ATOM   2324 H  HD12 . LEU A 1 142 ? 8.511   -9.765  9.737   1.00 74.33  ? 503 LEU A HD12 1 
ATOM   2325 H  HD13 . LEU A 1 142 ? 7.797   -10.651 8.627   1.00 74.33  ? 503 LEU A HD13 1 
ATOM   2326 H  HD21 . LEU A 1 142 ? 7.389   -13.072 10.282  1.00 73.82  ? 503 LEU A HD21 1 
ATOM   2327 H  HD22 . LEU A 1 142 ? 7.958   -13.178 8.803   1.00 73.82  ? 503 LEU A HD22 1 
ATOM   2328 H  HD23 . LEU A 1 142 ? 8.772   -13.806 10.014  1.00 73.82  ? 503 LEU A HD23 1 
ATOM   2329 N  N    . GLU A 1 143 ? 12.692  -13.579 7.634   1.00 66.04  ? 504 GLU A N    1 
ATOM   2330 C  CA   . GLU A 1 143 ? 13.793  -13.512 6.676   1.00 64.14  ? 504 GLU A CA   1 
ATOM   2331 C  C    . GLU A 1 143 ? 13.239  -13.379 5.261   1.00 80.23  ? 504 GLU A C    1 
ATOM   2332 O  O    . GLU A 1 143 ? 12.488  -14.239 4.799   1.00 63.42  ? 504 GLU A O    1 
ATOM   2333 C  CB   . GLU A 1 143 ? 14.681  -14.757 6.761   1.00 64.53  ? 504 GLU A CB   1 
ATOM   2334 C  CG   . GLU A 1 143 ? 15.032  -15.200 8.171   1.00 66.28  ? 504 GLU A CG   1 
ATOM   2335 C  CD   . GLU A 1 143 ? 16.011  -16.366 8.198   1.00 92.31  ? 504 GLU A CD   1 
ATOM   2336 O  OE1  . GLU A 1 143 ? 16.400  -16.851 7.114   1.00 99.91  ? 504 GLU A OE1  1 
ATOM   2337 O  OE2  . GLU A 1 143 ? 16.394  -16.796 9.308   1.00 118.01 ? 504 GLU A OE2  1 
ATOM   2338 H  H    . GLU A 1 143 ? 12.211  -14.287 7.554   1.00 79.25  ? 504 GLU A H    1 
ATOM   2339 H  HA   . GLU A 1 143 ? 14.339  -12.733 6.866   1.00 76.97  ? 504 GLU A HA   1 
ATOM   2340 H  HB2  . GLU A 1 143 ? 14.221  -15.494 6.329   1.00 77.44  ? 504 GLU A HB2  1 
ATOM   2341 H  HB3  . GLU A 1 143 ? 15.513  -14.576 6.295   1.00 77.44  ? 504 GLU A HB3  1 
ATOM   2342 H  HG2  . GLU A 1 143 ? 15.439  -14.457 8.643   1.00 79.53  ? 504 GLU A HG2  1 
ATOM   2343 H  HG3  . GLU A 1 143 ? 14.222  -15.479 8.625   1.00 79.53  ? 504 GLU A HG3  1 
ATOM   2344 N  N    . TRP A 1 144 ? 13.609  -12.300 4.581   1.00 63.60  ? 505 TRP A N    1 
ATOM   2345 C  CA   . TRP A 1 144 ? 13.247  -12.105 3.182   1.00 62.42  ? 505 TRP A CA   1 
ATOM   2346 C  C    . TRP A 1 144 ? 14.368  -12.604 2.279   1.00 63.00  ? 505 TRP A C    1 
ATOM   2347 O  O    . TRP A 1 144 ? 15.442  -12.011 2.235   1.00 65.55  ? 505 TRP A O    1 
ATOM   2348 C  CB   . TRP A 1 144 ? 12.954  -10.632 2.907   1.00 71.41  ? 505 TRP A CB   1 
ATOM   2349 C  CG   . TRP A 1 144 ? 12.730  -10.325 1.467   1.00 70.61  ? 505 TRP A CG   1 
ATOM   2350 C  CD1  . TRP A 1 144 ? 13.645  -9.844  0.584   1.00 72.87  ? 505 TRP A CD1  1 
ATOM   2351 C  CD2  . TRP A 1 144 ? 11.508  -10.472 0.738   1.00 61.49  ? 505 TRP A CD2  1 
ATOM   2352 N  NE1  . TRP A 1 144 ? 13.073  -9.681  -0.651  1.00 79.61  ? 505 TRP A NE1  1 
ATOM   2353 C  CE2  . TRP A 1 144 ? 11.759  -10.060 -0.583  1.00 72.69  ? 505 TRP A CE2  1 
ATOM   2354 C  CE3  . TRP A 1 144 ? 10.225  -10.911 1.076   1.00 63.20  ? 505 TRP A CE3  1 
ATOM   2355 C  CZ2  . TRP A 1 144 ? 10.775  -10.078 -1.573  1.00 70.66  ? 505 TRP A CZ2  1 
ATOM   2356 C  CZ3  . TRP A 1 144 ? 9.248   -10.926 0.093   1.00 85.56  ? 505 TRP A CZ3  1 
ATOM   2357 C  CH2  . TRP A 1 144 ? 9.529   -10.513 -1.215  1.00 81.08  ? 505 TRP A CH2  1 
ATOM   2358 H  H    . TRP A 1 144 ? 14.076  -11.657 4.911   1.00 76.32  ? 505 TRP A H    1 
ATOM   2359 H  HA   . TRP A 1 144 ? 12.446  -12.617 2.985   1.00 74.90  ? 505 TRP A HA   1 
ATOM   2360 H  HB2  . TRP A 1 144 ? 12.154  -10.376 3.393   1.00 85.70  ? 505 TRP A HB2  1 
ATOM   2361 H  HB3  . TRP A 1 144 ? 13.707  -10.101 3.210   1.00 85.70  ? 505 TRP A HB3  1 
ATOM   2362 H  HD1  . TRP A 1 144 ? 14.532  -9.652  0.789   1.00 87.45  ? 505 TRP A HD1  1 
ATOM   2363 H  HE1  . TRP A 1 144 ? 13.474  -9.391  -1.354  1.00 95.53  ? 505 TRP A HE1  1 
ATOM   2364 H  HE3  . TRP A 1 144 ? 10.031  -11.188 1.942   1.00 75.84  ? 505 TRP A HE3  1 
ATOM   2365 H  HZ2  . TRP A 1 144 ? 10.960  -9.802  -2.441  1.00 84.79  ? 505 TRP A HZ2  1 
ATOM   2366 H  HZ3  . TRP A 1 144 ? 8.391   -11.217 0.305   1.00 102.67 ? 505 TRP A HZ3  1 
ATOM   2367 H  HH2  . TRP A 1 144 ? 8.854   -10.533 -1.854  1.00 97.29  ? 505 TRP A HH2  1 
ATOM   2368 N  N    . LEU A 1 145 ? 14.116  -13.696 1.563   1.00 68.84  ? 506 LEU A N    1 
ATOM   2369 C  CA   . LEU A 1 145 ? 15.142  -14.330 0.735   1.00 72.59  ? 506 LEU A CA   1 
ATOM   2370 C  C    . LEU A 1 145 ? 14.935  -14.030 -0.746  1.00 64.72  ? 506 LEU A C    1 
ATOM   2371 O  O    . LEU A 1 145 ? 13.825  -14.147 -1.258  1.00 60.62  ? 506 LEU A O    1 
ATOM   2372 C  CB   . LEU A 1 145 ? 15.144  -15.843 0.964   1.00 70.97  ? 506 LEU A CB   1 
ATOM   2373 C  CG   . LEU A 1 145 ? 15.219  -16.290 2.429   1.00 76.26  ? 506 LEU A CG   1 
ATOM   2374 C  CD1  . LEU A 1 145 ? 15.096  -17.800 2.550   1.00 67.83  ? 506 LEU A CD1  1 
ATOM   2375 C  CD2  . LEU A 1 145 ? 16.505  -15.815 3.075   1.00 72.16  ? 506 LEU A CD2  1 
ATOM   2376 H  H    . LEU A 1 145 ? 13.353  -14.093 1.538   1.00 82.60  ? 506 LEU A H    1 
ATOM   2377 H  HA   . LEU A 1 145 ? 16.012  -13.986 0.992   1.00 87.11  ? 506 LEU A HA   1 
ATOM   2378 H  HB2  . LEU A 1 145 ? 14.328  -16.210 0.589   1.00 85.16  ? 506 LEU A HB2  1 
ATOM   2379 H  HB3  . LEU A 1 145 ? 15.910  -16.221 0.505   1.00 85.16  ? 506 LEU A HB3  1 
ATOM   2380 H  HG   . LEU A 1 145 ? 14.479  -15.893 2.914   1.00 91.51  ? 506 LEU A HG   1 
ATOM   2381 H  HD11 . LEU A 1 145 ? 15.147  -18.046 3.486   1.00 81.39  ? 506 LEU A HD11 1 
ATOM   2382 H  HD12 . LEU A 1 145 ? 14.243  -18.078 2.180   1.00 81.39  ? 506 LEU A HD12 1 
ATOM   2383 H  HD13 . LEU A 1 145 ? 15.821  -18.216 2.058   1.00 81.39  ? 506 LEU A HD13 1 
ATOM   2384 H  HD21 . LEU A 1 145 ? 16.523  -16.112 3.998   1.00 86.59  ? 506 LEU A HD21 1 
ATOM   2385 H  HD22 . LEU A 1 145 ? 17.258  -16.189 2.592   1.00 86.59  ? 506 LEU A HD22 1 
ATOM   2386 H  HD23 . LEU A 1 145 ? 16.537  -14.846 3.039   1.00 86.59  ? 506 LEU A HD23 1 
ATOM   2387 N  N    . THR A 1 146 ? 16.009  -13.658 -1.434  1.00 62.71  ? 507 THR A N    1 
ATOM   2388 C  CA   . THR A 1 146 ? 15.926  -13.325 -2.851  1.00 73.42  ? 507 THR A CA   1 
ATOM   2389 C  C    . THR A 1 146 ? 16.513  -14.426 -3.724  1.00 72.05  ? 507 THR A C    1 
ATOM   2390 O  O    . THR A 1 146 ? 17.263  -15.278 -3.251  1.00 62.32  ? 507 THR A O    1 
ATOM   2391 C  CB   . THR A 1 146 ? 16.641  -12.000 -3.155  1.00 82.70  ? 507 THR A CB   1 
ATOM   2392 O  OG1  . THR A 1 146 ? 17.798  -11.874 -2.320  1.00 75.07  ? 507 THR A OG1  1 
ATOM   2393 C  CG2  . THR A 1 146 ? 15.700  -10.831 -2.898  1.00 70.86  ? 507 THR A CG2  1 
ATOM   2394 H  H    . THR A 1 146 ? 16.800  -13.590 -1.103  1.00 75.25  ? 507 THR A H    1 
ATOM   2395 H  HA   . THR A 1 146 ? 14.992  -13.221 -3.093  1.00 88.10  ? 507 THR A HA   1 
ATOM   2396 H  HB   . THR A 1 146 ? 16.909  -11.981 -4.087  1.00 99.24  ? 507 THR A HB   1 
ATOM   2397 H  HG1  . THR A 1 146 ? 18.193  -11.150 -2.482  1.00 90.09  ? 507 THR A HG1  1 
ATOM   2398 H  HG21 . THR A 1 146 ? 16.151  -9.994  -3.089  1.00 85.03  ? 507 THR A HG21 1 
ATOM   2399 H  HG22 . THR A 1 146 ? 14.917  -10.905 -3.466  1.00 85.03  ? 507 THR A HG22 1 
ATOM   2400 H  HG23 . THR A 1 146 ? 15.417  -10.832 -1.970  1.00 85.03  ? 507 THR A HG23 1 
ATOM   2401 N  N    . LEU A 1 147 ? 16.153  -14.391 -5.003  1.00 74.30  ? 508 LEU A N    1 
ATOM   2402 C  CA   . LEU A 1 147 ? 16.564  -15.399 -5.973  1.00 79.08  ? 508 LEU A CA   1 
ATOM   2403 C  C    . LEU A 1 147 ? 17.890  -15.034 -6.634  1.00 66.36  ? 508 LEU A C    1 
ATOM   2404 O  O    . LEU A 1 147 ? 17.991  -13.991 -7.276  1.00 88.07  ? 508 LEU A O    1 
ATOM   2405 C  CB   . LEU A 1 147 ? 15.486  -15.561 -7.046  1.00 65.96  ? 508 LEU A CB   1 
ATOM   2406 C  CG   . LEU A 1 147 ? 14.247  -16.404 -6.728  1.00 69.07  ? 508 LEU A CG   1 
ATOM   2407 C  CD1  . LEU A 1 147 ? 13.636  -16.052 -5.381  1.00 72.74  ? 508 LEU A CD1  1 
ATOM   2408 C  CD2  . LEU A 1 147 ? 13.218  -16.242 -7.838  1.00 58.57  ? 508 LEU A CD2  1 
ATOM   2409 H  H    . LEU A 1 147 ? 15.656  -13.776 -5.342  1.00 89.16  ? 508 LEU A H    1 
ATOM   2410 H  HA   . LEU A 1 147 ? 16.674  -16.251 -5.521  1.00 94.90  ? 508 LEU A HA   1 
ATOM   2411 H  HB2  . LEU A 1 147 ? 15.168  -14.676 -7.281  1.00 79.15  ? 508 LEU A HB2  1 
ATOM   2412 H  HB3  . LEU A 1 147 ? 15.903  -15.961 -7.825  1.00 79.15  ? 508 LEU A HB3  1 
ATOM   2413 H  HG   . LEU A 1 147 ? 14.506  -17.339 -6.700  1.00 82.88  ? 508 LEU A HG   1 
ATOM   2414 H  HD11 . LEU A 1 147 ? 12.859  -16.613 -5.231  1.00 87.29  ? 508 LEU A HD11 1 
ATOM   2415 H  HD12 . LEU A 1 147 ? 14.294  -16.206 -4.686  1.00 87.29  ? 508 LEU A HD12 1 
ATOM   2416 H  HD13 . LEU A 1 147 ? 13.374  -15.118 -5.388  1.00 87.29  ? 508 LEU A HD13 1 
ATOM   2417 H  HD21 . LEU A 1 147 ? 12.439  -16.779 -7.626  1.00 70.28  ? 508 LEU A HD21 1 
ATOM   2418 H  HD22 . LEU A 1 147 ? 12.968  -15.307 -7.901  1.00 70.28  ? 508 LEU A HD22 1 
ATOM   2419 H  HD23 . LEU A 1 147 ? 13.607  -16.538 -8.675  1.00 70.28  ? 508 LEU A HD23 1 
ATOM   2420 N  N    . MET A 1 148 ? 18.900  -15.886 -6.475  1.00 63.97  ? 509 MET A N    1 
ATOM   2421 C  CA   . MET A 1 148 ? 20.200  -15.671 -7.111  1.00 66.53  ? 509 MET A CA   1 
ATOM   2422 C  C    . MET A 1 148 ? 20.376  -16.565 -8.335  1.00 65.82  ? 509 MET A C    1 
ATOM   2423 O  O    . MET A 1 148 ? 20.019  -17.741 -8.292  1.00 72.12  ? 509 MET A O    1 
ATOM   2424 C  CB   . MET A 1 148 ? 21.334  -15.939 -6.131  1.00 71.39  ? 509 MET A CB   1 
ATOM   2425 C  CG   . MET A 1 148 ? 21.459  -14.911 -5.026  1.00 89.65  ? 509 MET A CG   1 
ATOM   2426 S  SD   . MET A 1 148 ? 23.013  -15.107 -4.142  1.00 92.32  ? 509 MET A SD   1 
ATOM   2427 C  CE   . MET A 1 148 ? 24.191  -14.473 -5.335  1.00 123.29 ? 509 MET A CE   1 
ATOM   2428 H  H    . MET A 1 148 ? 18.858  -16.602 -6.000  1.00 76.76  ? 509 MET A H    1 
ATOM   2429 H  HA   . MET A 1 148 ? 20.261  -14.744 -7.390  1.00 79.83  ? 509 MET A HA   1 
ATOM   2430 H  HB2  . MET A 1 148 ? 21.188  -16.803 -5.715  1.00 85.66  ? 509 MET A HB2  1 
ATOM   2431 H  HB3  . MET A 1 148 ? 22.172  -15.949 -6.620  1.00 85.66  ? 509 MET A HB3  1 
ATOM   2432 H  HG2  . MET A 1 148 ? 21.436  -14.020 -5.410  1.00 107.58 ? 509 MET A HG2  1 
ATOM   2433 H  HG3  . MET A 1 148 ? 20.731  -15.026 -4.395  1.00 107.58 ? 509 MET A HG3  1 
ATOM   2434 H  HE1  . MET A 1 148 ? 25.083  -14.530 -4.958  1.00 147.95 ? 509 MET A HE1  1 
ATOM   2435 H  HE2  . MET A 1 148 ? 24.139  -15.005 -6.144  1.00 147.95 ? 509 MET A HE2  1 
ATOM   2436 H  HE3  . MET A 1 148 ? 23.974  -13.548 -5.532  1.00 147.95 ? 509 MET A HE3  1 
ATOM   2437 N  N    . PRO A 1 149 ? 20.955  -16.023 -9.424  1.00 67.90  ? 510 PRO A N    1 
ATOM   2438 C  CA   . PRO A 1 149 ? 21.043  -16.807 -10.657 1.00 71.45  ? 510 PRO A CA   1 
ATOM   2439 C  C    . PRO A 1 149 ? 22.361  -17.569 -10.793 1.00 68.70  ? 510 PRO A C    1 
ATOM   2440 O  O    . PRO A 1 149 ? 22.811  -17.832 -11.909 1.00 69.50  ? 510 PRO A O    1 
ATOM   2441 C  CB   . PRO A 1 149 ? 20.906  -15.736 -11.743 1.00 70.10  ? 510 PRO A CB   1 
ATOM   2442 C  CG   . PRO A 1 149 ? 21.439  -14.458 -11.101 1.00 75.72  ? 510 PRO A CG   1 
ATOM   2443 C  CD   . PRO A 1 149 ? 21.569  -14.697 -9.607  1.00 73.72  ? 510 PRO A CD   1 
ATOM   2444 H  HA   . PRO A 1 149 ? 20.300  -17.428 -10.720 1.00 85.74  ? 510 PRO A HA   1 
ATOM   2445 H  HB2  . PRO A 1 149 ? 21.441  -15.982 -12.514 1.00 84.12  ? 510 PRO A HB2  1 
ATOM   2446 H  HB3  . PRO A 1 149 ? 19.973  -15.635 -11.988 1.00 84.12  ? 510 PRO A HB3  1 
ATOM   2447 H  HG2  . PRO A 1 149 ? 22.306  -14.248 -11.482 1.00 90.86  ? 510 PRO A HG2  1 
ATOM   2448 H  HG3  . PRO A 1 149 ? 20.816  -13.734 -11.270 1.00 90.86  ? 510 PRO A HG3  1 
ATOM   2449 H  HD2  . PRO A 1 149 ? 22.504  -14.718 -9.348  1.00 88.46  ? 510 PRO A HD2  1 
ATOM   2450 H  HD3  . PRO A 1 149 ? 21.077  -14.024 -9.112  1.00 88.46  ? 510 PRO A HD3  1 
ATOM   2451 N  N    . ASN A 1 150 ? 22.966  -17.907 -9.659  1.00 69.46  ? 511 ASN A N    1 
ATOM   2452 C  CA   . ASN A 1 150 ? 24.181  -18.716 -9.620  1.00 71.26  ? 511 ASN A CA   1 
ATOM   2453 C  C    . ASN A 1 150 ? 24.285  -19.417 -8.262  1.00 77.76  ? 511 ASN A C    1 
ATOM   2454 O  O    . ASN A 1 150 ? 23.592  -19.048 -7.318  1.00 70.03  ? 511 ASN A O    1 
ATOM   2455 C  CB   . ASN A 1 150 ? 25.419  -17.856 -9.882  1.00 76.17  ? 511 ASN A CB   1 
ATOM   2456 C  CG   . ASN A 1 150 ? 25.683  -16.863 -8.771  1.00 83.79  ? 511 ASN A CG   1 
ATOM   2457 O  OD1  . ASN A 1 150 ? 26.140  -17.234 -7.694  1.00 92.13  ? 511 ASN A OD1  1 
ATOM   2458 N  ND2  . ASN A 1 150 ? 25.401  -15.592 -9.029  1.00 85.45  ? 511 ASN A ND2  1 
ATOM   2459 H  H    . ASN A 1 150 ? 22.685  -17.675 -8.880  1.00 83.35  ? 511 ASN A H    1 
ATOM   2460 H  HA   . ASN A 1 150 ? 24.134  -19.396 -10.310 1.00 85.51  ? 511 ASN A HA   1 
ATOM   2461 H  HB2  . ASN A 1 150 ? 26.194  -18.433 -9.960  1.00 91.41  ? 511 ASN A HB2  1 
ATOM   2462 H  HB3  . ASN A 1 150 ? 25.290  -17.358 -10.705 1.00 91.41  ? 511 ASN A HB3  1 
ATOM   2463 H  HD21 . ASN A 1 150 ? 25.534  -14.992 -8.429  1.00 102.54 ? 511 ASN A HD21 1 
ATOM   2464 H  HD22 . ASN A 1 150 ? 25.084  -15.370 -9.797  1.00 102.54 ? 511 ASN A HD22 1 
ATOM   2465 N  N    . ALA A 1 151 ? 25.148  -20.425 -8.173  1.00 72.37  ? 512 ALA A N    1 
ATOM   2466 C  CA   . ALA A 1 151 ? 25.239  -21.271 -6.986  1.00 72.51  ? 512 ALA A CA   1 
ATOM   2467 C  C    . ALA A 1 151 ? 26.340  -20.831 -6.025  1.00 75.79  ? 512 ALA A C    1 
ATOM   2468 O  O    . ALA A 1 151 ? 26.735  -21.599 -5.152  1.00 84.17  ? 512 ALA A O    1 
ATOM   2469 C  CB   . ALA A 1 151 ? 25.473  -22.716 -7.402  1.00 72.38  ? 512 ALA A CB   1 
ATOM   2470 H  H    . ALA A 1 151 ? 25.701  -20.642 -8.796  1.00 86.84  ? 512 ALA A H    1 
ATOM   2471 H  HA   . ALA A 1 151 ? 24.395  -21.231 -6.509  1.00 87.01  ? 512 ALA A HA   1 
ATOM   2472 H  HB1  . ALA A 1 151 ? 25.531  -23.267 -6.606  1.00 86.85  ? 512 ALA A HB1  1 
ATOM   2473 H  HB2  . ALA A 1 151 ? 24.731  -23.009 -7.955  1.00 86.85  ? 512 ALA A HB2  1 
ATOM   2474 H  HB3  . ALA A 1 151 ? 26.301  -22.769 -7.904  1.00 86.85  ? 512 ALA A HB3  1 
ATOM   2475 N  N    . SER A 1 152 ? 26.824  -19.602 -6.179  1.00 77.64  ? 513 SER A N    1 
ATOM   2476 C  CA   . SER A 1 152 ? 28.011  -19.148 -5.453  1.00 99.07  ? 513 SER A CA   1 
ATOM   2477 C  C    . SER A 1 152 ? 27.822  -19.160 -3.939  1.00 107.92 ? 513 SER A C    1 
ATOM   2478 O  O    . SER A 1 152 ? 28.797  -19.270 -3.197  1.00 105.67 ? 513 SER A O    1 
ATOM   2479 C  CB   . SER A 1 152 ? 28.404  -17.737 -5.900  1.00 87.55  ? 513 SER A CB   1 
ATOM   2480 O  OG   . SER A 1 152 ? 27.395  -16.797 -5.573  1.00 104.55 ? 513 SER A OG   1 
ATOM   2481 H  H    . SER A 1 152 ? 26.483  -19.009 -6.700  1.00 93.16  ? 513 SER A H    1 
ATOM   2482 H  HA   . SER A 1 152 ? 28.749  -19.742 -5.663  1.00 118.89 ? 513 SER A HA   1 
ATOM   2483 H  HB2  . SER A 1 152 ? 29.227  -17.483 -5.453  1.00 105.06 ? 513 SER A HB2  1 
ATOM   2484 H  HB3  . SER A 1 152 ? 28.536  -17.736 -6.861  1.00 105.06 ? 513 SER A HB3  1 
ATOM   2485 H  HG   . SER A 1 152 ? 27.270  -16.787 -4.743  1.00 125.46 ? 513 SER A HG   1 
ATOM   2486 N  N    . ASN A 1 153 ? 26.574  -19.049 -3.489  1.00 78.84  ? 514 ASN A N    1 
ATOM   2487 C  CA   . ASN A 1 153 ? 26.283  -18.926 -2.063  1.00 79.16  ? 514 ASN A CA   1 
ATOM   2488 C  C    . ASN A 1 153 ? 25.489  -20.096 -1.493  1.00 76.92  ? 514 ASN A C    1 
ATOM   2489 O  O    . ASN A 1 153 ? 25.049  -20.048 -0.343  1.00 76.80  ? 514 ASN A O    1 
ATOM   2490 C  CB   . ASN A 1 153 ? 25.527  -17.621 -1.797  1.00 91.99  ? 514 ASN A CB   1 
ATOM   2491 C  CG   . ASN A 1 153 ? 26.394  -16.394 -2.004  1.00 113.69 ? 514 ASN A CG   1 
ATOM   2492 O  OD1  . ASN A 1 153 ? 27.115  -16.288 -2.996  1.00 120.72 ? 514 ASN A OD1  1 
ATOM   2493 N  ND2  . ASN A 1 153 ? 26.343  -15.468 -1.055  1.00 117.82 ? 514 ASN A ND2  1 
ATOM   2494 H  H    . ASN A 1 153 ? 25.875  -19.043 -3.990  1.00 94.61  ? 514 ASN A H    1 
ATOM   2495 H  HA   . ASN A 1 153 ? 27.123  -18.881 -1.581  1.00 95.00  ? 514 ASN A HA   1 
ATOM   2496 H  HB2  . ASN A 1 153 ? 24.773  -17.562 -2.404  1.00 110.38 ? 514 ASN A HB2  1 
ATOM   2497 H  HB3  . ASN A 1 153 ? 25.216  -17.617 -0.878  1.00 110.38 ? 514 ASN A HB3  1 
ATOM   2498 H  HD21 . ASN A 1 153 ? 26.816  -14.753 -1.126  1.00 141.38 ? 514 ASN A HD21 1 
ATOM   2499 H  HD22 . ASN A 1 153 ? 25.836  -15.583 -0.370  1.00 141.38 ? 514 ASN A HD22 1 
ATOM   2500 N  N    . LEU A 1 154 ? 25.328  -21.149 -2.287  1.00 75.47  ? 515 LEU A N    1 
ATOM   2501 C  CA   . LEU A 1 154 ? 24.539  -22.309 -1.879  1.00 73.55  ? 515 LEU A CA   1 
ATOM   2502 C  C    . LEU A 1 154 ? 25.070  -22.978 -0.609  1.00 75.93  ? 515 LEU A C    1 
ATOM   2503 O  O    . LEU A 1 154 ? 24.296  -23.379 0.259   1.00 74.85  ? 515 LEU A O    1 
ATOM   2504 C  CB   . LEU A 1 154 ? 24.497  -23.333 -3.011  1.00 72.46  ? 515 LEU A CB   1 
ATOM   2505 C  CG   . LEU A 1 154 ? 23.822  -24.674 -2.712  1.00 71.15  ? 515 LEU A CG   1 
ATOM   2506 C  CD1  . LEU A 1 154 ? 22.393  -24.485 -2.203  1.00 68.27  ? 515 LEU A CD1  1 
ATOM   2507 C  CD2  . LEU A 1 154 ? 23.826  -25.549 -3.960  1.00 70.39  ? 515 LEU A CD2  1 
ATOM   2508 H  H    . LEU A 1 154 ? 25.667  -21.217 -3.074  1.00 90.56  ? 515 LEU A H    1 
ATOM   2509 H  HA   . LEU A 1 154 ? 23.629  -22.022 -1.704  1.00 88.26  ? 515 LEU A HA   1 
ATOM   2510 H  HB2  . LEU A 1 154 ? 24.024  -22.936 -3.759  1.00 86.95  ? 515 LEU A HB2  1 
ATOM   2511 H  HB3  . LEU A 1 154 ? 25.410  -23.526 -3.278  1.00 86.95  ? 515 LEU A HB3  1 
ATOM   2512 H  HG   . LEU A 1 154 ? 24.327  -25.134 -2.023  1.00 85.38  ? 515 LEU A HG   1 
ATOM   2513 H  HD11 . LEU A 1 154 ? 22.003  -25.355 -2.027  1.00 81.93  ? 515 LEU A HD11 1 
ATOM   2514 H  HD12 . LEU A 1 154 ? 22.416  -23.960 -1.388  1.00 81.93  ? 515 LEU A HD12 1 
ATOM   2515 H  HD13 . LEU A 1 154 ? 21.876  -24.021 -2.881  1.00 81.93  ? 515 LEU A HD13 1 
ATOM   2516 H  HD21 . LEU A 1 154 ? 23.396  -26.394 -3.755  1.00 84.46  ? 515 LEU A HD21 1 
ATOM   2517 H  HD22 . LEU A 1 154 ? 23.341  -25.094 -4.666  1.00 84.46  ? 515 LEU A HD22 1 
ATOM   2518 H  HD23 . LEU A 1 154 ? 24.744  -25.703 -4.235  1.00 84.46  ? 515 LEU A HD23 1 
ATOM   2519 N  N    . ASP A 1 155 ? 26.389  -23.107 -0.518  1.00 79.46  ? 516 ASP A N    1 
ATOM   2520 C  CA   . ASP A 1 155 ? 27.023  -23.835 0.575   1.00 82.40  ? 516 ASP A CA   1 
ATOM   2521 C  C    . ASP A 1 155 ? 26.647  -23.279 1.950   1.00 82.95  ? 516 ASP A C    1 
ATOM   2522 O  O    . ASP A 1 155 ? 26.480  -24.039 2.900   1.00 83.81  ? 516 ASP A O    1 
ATOM   2523 C  CB   . ASP A 1 155 ? 28.541  -23.806 0.409   1.00 90.50  ? 516 ASP A CB   1 
ATOM   2524 C  CG   . ASP A 1 155 ? 29.116  -22.409 0.562   1.00 119.35 ? 516 ASP A CG   1 
ATOM   2525 O  OD1  . ASP A 1 155 ? 28.409  -21.432 0.226   1.00 86.10  ? 516 ASP A OD1  1 
ATOM   2526 O  OD2  . ASP A 1 155 ? 30.276  -22.288 1.015   1.00 131.18 ? 516 ASP A OD2  1 
ATOM   2527 H  H    . ASP A 1 155 ? 26.946  -22.777 -1.084  1.00 95.36  ? 516 ASP A H    1 
ATOM   2528 H  HA   . ASP A 1 155 ? 26.737  -24.761 0.540   1.00 98.89  ? 516 ASP A HA   1 
ATOM   2529 H  HB2  . ASP A 1 155 ? 28.944  -24.373 1.086   1.00 108.60 ? 516 ASP A HB2  1 
ATOM   2530 H  HB3  . ASP A 1 155 ? 28.769  -24.130 -0.476  1.00 108.60 ? 516 ASP A HB3  1 
ATOM   2531 N  N    . LYS A 1 156 ? 26.510  -21.961 2.052   1.00 82.71  ? 517 LYS A N    1 
ATOM   2532 C  CA   . LYS A 1 156 ? 26.215  -21.337 3.333   1.00 83.55  ? 517 LYS A CA   1 
ATOM   2533 C  C    . LYS A 1 156 ? 24.739  -21.455 3.715   1.00 79.99  ? 517 LYS A C    1 
ATOM   2534 O  O    . LYS A 1 156 ? 24.418  -21.570 4.897   1.00 80.68  ? 517 LYS A O    1 
ATOM   2535 C  CB   . LYS A 1 156 ? 26.642  -19.861 3.327   1.00 85.11  ? 517 LYS A CB   1 
ATOM   2536 C  CG   . LYS A 1 156 ? 25.790  -18.927 2.477   1.00 98.81  ? 517 LYS A CG   1 
ATOM   2537 C  CD   . LYS A 1 156 ? 25.567  -17.592 3.172   1.00 102.76 ? 517 LYS A CD   1 
ATOM   2538 C  CE   . LYS A 1 156 ? 24.351  -16.871 2.604   1.00 122.52 ? 517 LYS A CE   1 
ATOM   2539 N  NZ   . LYS A 1 156 ? 24.146  -15.531 3.222   1.00 122.37 ? 517 LYS A NZ   1 
ATOM   2540 H  H    . LYS A 1 156 ? 26.583  -21.409 1.396   1.00 99.25  ? 517 LYS A H    1 
ATOM   2541 H  HA   . LYS A 1 156 ? 26.731  -21.787 4.021   1.00 100.26 ? 517 LYS A HA   1 
ATOM   2542 H  HB2  . LYS A 1 156 ? 26.613  -19.531 4.238   1.00 102.13 ? 517 LYS A HB2  1 
ATOM   2543 H  HB3  . LYS A 1 156 ? 27.551  -19.808 2.993   1.00 102.13 ? 517 LYS A HB3  1 
ATOM   2544 H  HG2  . LYS A 1 156 ? 26.240  -18.760 1.634   1.00 118.58 ? 517 LYS A HG2  1 
ATOM   2545 H  HG3  . LYS A 1 156 ? 24.924  -19.336 2.320   1.00 118.58 ? 517 LYS A HG3  1 
ATOM   2546 H  HD2  . LYS A 1 156 ? 25.417  -17.743 4.118   1.00 123.31 ? 517 LYS A HD2  1 
ATOM   2547 H  HD3  . LYS A 1 156 ? 26.345  -17.028 3.040   1.00 123.31 ? 517 LYS A HD3  1 
ATOM   2548 H  HE2  . LYS A 1 156 ? 24.472  -16.747 1.649   1.00 147.02 ? 517 LYS A HE2  1 
ATOM   2549 H  HE3  . LYS A 1 156 ? 23.558  -17.404 2.772   1.00 147.02 ? 517 LYS A HE3  1 
ATOM   2550 H  HZ1  . LYS A 1 156 ? 23.430  -15.139 2.868   1.00 146.84 ? 517 LYS A HZ1  1 
ATOM   2551 H  HZ2  . LYS A 1 156 ? 24.025  -15.617 4.100   1.00 146.84 ? 517 LYS A HZ2  1 
ATOM   2552 H  HZ3  . LYS A 1 156 ? 24.858  -15.018 3.077   1.00 146.84 ? 517 LYS A HZ3  1 
ATOM   2553 N  N    . VAL A 1 157 ? 23.838  -21.430 2.735   1.00 76.47  ? 518 VAL A N    1 
ATOM   2554 C  CA   . VAL A 1 157 ? 22.425  -21.486 3.066   1.00 73.35  ? 518 VAL A CA   1 
ATOM   2555 C  C    . VAL A 1 157 ? 22.109  -22.908 3.497   1.00 90.29  ? 518 VAL A C    1 
ATOM   2556 O  O    . VAL A 1 157 ? 21.234  -23.130 4.327   1.00 72.05  ? 518 VAL A O    1 
ATOM   2557 C  CB   . VAL A 1 157 ? 21.496  -21.058 1.895   1.00 74.74  ? 518 VAL A CB   1 
ATOM   2558 C  CG1  . VAL A 1 157 ? 22.104  -19.904 1.108   1.00 73.74  ? 518 VAL A CG1  1 
ATOM   2559 C  CG2  . VAL A 1 157 ? 21.174  -22.228 0.979   1.00 78.82  ? 518 VAL A CG2  1 
ATOM   2560 H  H    . VAL A 1 157 ? 24.015  -21.381 1.895   1.00 91.76  ? 518 VAL A H    1 
ATOM   2561 H  HA   . VAL A 1 157 ? 22.251  -20.898 3.818   1.00 88.02  ? 518 VAL A HA   1 
ATOM   2562 H  HB   . VAL A 1 157 ? 20.658  -20.743 2.269   1.00 89.69  ? 518 VAL A HB   1 
ATOM   2563 H  HG11 . VAL A 1 157 ? 21.502  -19.662 0.387   1.00 88.48  ? 518 VAL A HG11 1 
ATOM   2564 H  HG12 . VAL A 1 157 ? 22.231  -19.148 1.702   1.00 88.48  ? 518 VAL A HG12 1 
ATOM   2565 H  HG13 . VAL A 1 157 ? 22.958  -20.187 0.745   1.00 88.48  ? 518 VAL A HG13 1 
ATOM   2566 H  HG21 . VAL A 1 157 ? 20.594  -21.919 0.265   1.00 94.58  ? 518 VAL A HG21 1 
ATOM   2567 H  HG22 . VAL A 1 157 ? 22.000  -22.575 0.608   1.00 94.58  ? 518 VAL A HG22 1 
ATOM   2568 H  HG23 . VAL A 1 157 ? 20.726  -22.918 1.494   1.00 94.58  ? 518 VAL A HG23 1 
ATOM   2569 N  N    . LEU A 1 158 ? 22.837  -23.871 2.943   1.00 74.29  ? 519 LEU A N    1 
ATOM   2570 C  CA   . LEU A 1 158 ? 22.645  -25.265 3.316   1.00 74.70  ? 519 LEU A CA   1 
ATOM   2571 C  C    . LEU A 1 158 ? 23.070  -25.516 4.764   1.00 83.30  ? 519 LEU A C    1 
ATOM   2572 O  O    . LEU A 1 158 ? 22.416  -26.272 5.486   1.00 77.62  ? 519 LEU A O    1 
ATOM   2573 C  CB   . LEU A 1 158 ? 23.422  -26.180 2.375   1.00 75.83  ? 519 LEU A CB   1 
ATOM   2574 C  CG   . LEU A 1 158 ? 22.830  -26.335 0.972   1.00 76.75  ? 519 LEU A CG   1 
ATOM   2575 C  CD1  . LEU A 1 158 ? 23.832  -27.003 0.049   1.00 74.54  ? 519 LEU A CD1  1 
ATOM   2576 C  CD2  . LEU A 1 158 ? 21.532  -27.132 1.019   1.00 70.33  ? 519 LEU A CD2  1 
ATOM   2577 H  H    . LEU A 1 158 ? 23.447  -23.743 2.350   1.00 89.15  ? 519 LEU A H    1 
ATOM   2578 H  HA   . LEU A 1 158 ? 21.703  -25.485 3.238   1.00 89.65  ? 519 LEU A HA   1 
ATOM   2579 H  HB2  . LEU A 1 158 ? 24.319  -25.827 2.274   1.00 90.99  ? 519 LEU A HB2  1 
ATOM   2580 H  HB3  . LEU A 1 158 ? 23.464  -27.064 2.772   1.00 90.99  ? 519 LEU A HB3  1 
ATOM   2581 H  HG   . LEU A 1 158 ? 22.630  -25.456 0.614   1.00 92.10  ? 519 LEU A HG   1 
ATOM   2582 H  HD11 . LEU A 1 158 ? 23.437  -27.091 -0.833  1.00 89.45  ? 519 LEU A HD11 1 
ATOM   2583 H  HD12 . LEU A 1 158 ? 24.631  -26.455 0.001   1.00 89.45  ? 519 LEU A HD12 1 
ATOM   2584 H  HD13 . LEU A 1 158 ? 24.052  -27.879 0.403   1.00 89.45  ? 519 LEU A HD13 1 
ATOM   2585 H  HD21 . LEU A 1 158 ? 21.180  -27.214 0.119   1.00 84.39  ? 519 LEU A HD21 1 
ATOM   2586 H  HD22 . LEU A 1 158 ? 21.715  -28.012 1.385   1.00 84.39  ? 519 LEU A HD22 1 
ATOM   2587 H  HD23 . LEU A 1 158 ? 20.895  -26.665 1.582   1.00 84.39  ? 519 LEU A HD23 1 
ATOM   2588 N  N    . THR A 1 159 ? 24.159  -24.880 5.187   1.00 80.95  ? 520 THR A N    1 
ATOM   2589 C  CA   . THR A 1 159 ? 24.630  -25.031 6.562   1.00 87.96  ? 520 THR A CA   1 
ATOM   2590 C  C    . THR A 1 159 ? 23.695  -24.292 7.527   1.00 83.12  ? 520 THR A C    1 
ATOM   2591 O  O    . THR A 1 159 ? 23.417  -24.779 8.620   1.00 84.42  ? 520 THR A O    1 
ATOM   2592 C  CB   . THR A 1 159 ? 26.084  -24.521 6.733   1.00 92.35  ? 520 THR A CB   1 
ATOM   2593 O  OG1  . THR A 1 159 ? 26.180  -23.155 6.313   1.00 104.10 ? 520 THR A OG1  1 
ATOM   2594 C  CG2  . THR A 1 159 ? 27.051  -25.373 5.913   1.00 90.39  ? 520 THR A CG2  1 
ATOM   2595 H  H    . THR A 1 159 ? 24.641  -24.359 4.702   1.00 97.14  ? 520 THR A H    1 
ATOM   2596 H  HA   . THR A 1 159 ? 24.615  -25.972 6.797   1.00 105.55 ? 520 THR A HA   1 
ATOM   2597 H  HB   . THR A 1 159 ? 26.338  -24.587 7.667   1.00 110.82 ? 520 THR A HB   1 
ATOM   2598 H  HG1  . THR A 1 159 ? 25.961  -23.087 5.505   1.00 124.92 ? 520 THR A HG1  1 
ATOM   2599 H  HG21 . THR A 1 159 ? 27.957  -25.047 6.026   1.00 108.46 ? 520 THR A HG21 1 
ATOM   2600 H  HG22 . THR A 1 159 ? 27.009  -26.297 6.207   1.00 108.46 ? 520 THR A HG22 1 
ATOM   2601 H  HG23 . THR A 1 159 ? 26.815  -25.330 4.973   1.00 108.46 ? 520 THR A HG23 1 
ATOM   2602 N  N    . ASP A 1 160 ? 23.202  -23.128 7.113   1.00 88.38  ? 521 ASP A N    1 
ATOM   2603 C  CA   . ASP A 1 160 ? 22.208  -22.397 7.896   1.00 81.92  ? 521 ASP A CA   1 
ATOM   2604 C  C    . ASP A 1 160 ? 20.950  -23.229 8.093   1.00 82.87  ? 521 ASP A C    1 
ATOM   2605 O  O    . ASP A 1 160 ? 20.389  -23.262 9.184   1.00 79.34  ? 521 ASP A O    1 
ATOM   2606 C  CB   . ASP A 1 160 ? 21.848  -21.074 7.223   1.00 89.98  ? 521 ASP A CB   1 
ATOM   2607 C  CG   . ASP A 1 160 ? 22.958  -20.053 7.322   1.00 81.18  ? 521 ASP A CG   1 
ATOM   2608 O  OD1  . ASP A 1 160 ? 24.077  -20.431 7.724   1.00 92.99  ? 521 ASP A OD1  1 
ATOM   2609 O  OD2  . ASP A 1 160 ? 22.712  -18.873 6.995   1.00 107.40 ? 521 ASP A OD2  1 
ATOM   2610 H  H    . ASP A 1 160 ? 23.426  -22.738 6.380   1.00 106.05 ? 521 ASP A H    1 
ATOM   2611 H  HA   . ASP A 1 160 ? 22.578  -22.199 8.771   1.00 98.30  ? 521 ASP A HA   1 
ATOM   2612 H  HB2  . ASP A 1 160 ? 21.670  -21.235 6.283   1.00 107.97 ? 521 ASP A HB2  1 
ATOM   2613 H  HB3  . ASP A 1 160 ? 21.060  -20.704 7.651   1.00 107.97 ? 521 ASP A HB3  1 
ATOM   2614 N  N    . ILE A 1 161 ? 20.501  -23.890 7.031   1.00 74.20  ? 522 ILE A N    1 
ATOM   2615 C  CA   . ILE A 1 161 ? 19.353  -24.783 7.126   1.00 75.38  ? 522 ILE A CA   1 
ATOM   2616 C  C    . ILE A 1 161 ? 19.627  -25.871 8.160   1.00 88.75  ? 522 ILE A C    1 
ATOM   2617 O  O    . ILE A 1 161 ? 18.736  -26.269 8.909   1.00 95.80  ? 522 ILE A O    1 
ATOM   2618 C  CB   . ILE A 1 161 ? 19.020  -25.422 5.757   1.00 71.09  ? 522 ILE A CB   1 
ATOM   2619 C  CG1  . ILE A 1 161 ? 18.248  -24.420 4.892   1.00 77.48  ? 522 ILE A CG1  1 
ATOM   2620 C  CG2  . ILE A 1 161 ? 18.212  -26.715 5.934   1.00 69.03  ? 522 ILE A CG2  1 
ATOM   2621 C  CD1  . ILE A 1 161 ? 17.897  -24.920 3.486   1.00 76.96  ? 522 ILE A CD1  1 
ATOM   2622 H  H    . ILE A 1 161 ? 20.844  -23.838 6.245   1.00 89.04  ? 522 ILE A H    1 
ATOM   2623 H  HA   . ILE A 1 161 ? 18.579  -24.276 7.418   1.00 90.46  ? 522 ILE A HA   1 
ATOM   2624 H  HB   . ILE A 1 161 ? 19.852  -25.638 5.309   1.00 85.30  ? 522 ILE A HB   1 
ATOM   2625 H  HG12 . ILE A 1 161 ? 17.417  -24.199 5.340   1.00 92.97  ? 522 ILE A HG12 1 
ATOM   2626 H  HG13 . ILE A 1 161 ? 18.787  -23.619 4.791   1.00 92.97  ? 522 ILE A HG13 1 
ATOM   2627 H  HG21 . ILE A 1 161 ? 18.020  -27.089 5.060   1.00 82.84  ? 522 ILE A HG21 1 
ATOM   2628 H  HG22 . ILE A 1 161 ? 18.734  -27.344 6.457   1.00 82.84  ? 522 ILE A HG22 1 
ATOM   2629 H  HG23 . ILE A 1 161 ? 17.384  -26.508 6.395   1.00 82.84  ? 522 ILE A HG23 1 
ATOM   2630 H  HD11 . ILE A 1 161 ? 17.413  -24.223 3.015   1.00 92.36  ? 522 ILE A HD11 1 
ATOM   2631 H  HD12 . ILE A 1 161 ? 18.716  -25.132 3.012   1.00 92.36  ? 522 ILE A HD12 1 
ATOM   2632 H  HD13 . ILE A 1 161 ? 17.344  -25.713 3.562   1.00 92.36  ? 522 ILE A HD13 1 
ATOM   2633 N  N    . LYS A 1 162 ? 20.866  -26.348 8.196   1.00 78.13  ? 523 LYS A N    1 
ATOM   2634 C  CA   . LYS A 1 162 ? 21.247  -27.403 9.124   1.00 81.47  ? 523 LYS A CA   1 
ATOM   2635 C  C    . LYS A 1 162 ? 21.272  -26.890 10.563  1.00 83.73  ? 523 LYS A C    1 
ATOM   2636 O  O    . LYS A 1 162 ? 20.869  -27.598 11.484  1.00 94.33  ? 523 LYS A O    1 
ATOM   2637 C  CB   . LYS A 1 162 ? 22.615  -27.977 8.747   1.00 84.78  ? 523 LYS A CB   1 
ATOM   2638 C  CG   . LYS A 1 162 ? 23.055  -29.151 9.610   1.00 96.57  ? 523 LYS A CG   1 
ATOM   2639 C  CD   . LYS A 1 162 ? 24.457  -29.604 9.248   1.00 115.89 ? 523 LYS A CD   1 
ATOM   2640 C  CE   . LYS A 1 162 ? 24.926  -30.736 10.148  1.00 126.20 ? 523 LYS A CE   1 
ATOM   2641 N  NZ   . LYS A 1 162 ? 26.248  -31.275 9.720   1.00 121.21 ? 523 LYS A NZ   1 
ATOM   2642 H  H    . LYS A 1 162 ? 21.506  -26.075 7.691   1.00 93.76  ? 523 LYS A H    1 
ATOM   2643 H  HA   . LYS A 1 162 ? 20.595  -28.120 9.072   1.00 97.76  ? 523 LYS A HA   1 
ATOM   2644 H  HB2  . LYS A 1 162 ? 22.582  -28.282 7.827   1.00 101.73 ? 523 LYS A HB2  1 
ATOM   2645 H  HB3  . LYS A 1 162 ? 23.281  -27.278 8.837   1.00 101.73 ? 523 LYS A HB3  1 
ATOM   2646 H  HG2  . LYS A 1 162 ? 23.052  -28.883 10.542  1.00 115.89 ? 523 LYS A HG2  1 
ATOM   2647 H  HG3  . LYS A 1 162 ? 22.449  -29.896 9.472   1.00 115.89 ? 523 LYS A HG3  1 
ATOM   2648 H  HD2  . LYS A 1 162 ? 24.465  -29.922 8.332   1.00 139.07 ? 523 LYS A HD2  1 
ATOM   2649 H  HD3  . LYS A 1 162 ? 25.071  -28.860 9.351   1.00 139.07 ? 523 LYS A HD3  1 
ATOM   2650 H  HE2  . LYS A 1 162 ? 25.013  -30.406 11.056  1.00 151.44 ? 523 LYS A HE2  1 
ATOM   2651 H  HE3  . LYS A 1 162 ? 24.279  -31.458 10.114  1.00 151.44 ? 523 LYS A HE3  1 
ATOM   2652 H  HZ1  . LYS A 1 162 ? 26.497  -31.935 10.264  1.00 145.45 ? 523 LYS A HZ1  1 
ATOM   2653 H  HZ2  . LYS A 1 162 ? 26.194  -31.589 8.890   1.00 145.45 ? 523 LYS A HZ2  1 
ATOM   2654 H  HZ3  . LYS A 1 162 ? 26.862  -30.631 9.747   1.00 145.45 ? 523 LYS A HZ3  1 
ATOM   2655 N  N    . ALA A 1 163 ? 21.740  -25.658 10.748  1.00 84.35  ? 524 ALA A N    1 
ATOM   2656 C  CA   . ALA A 1 163 ? 21.886  -25.080 12.085  1.00 88.41  ? 524 ALA A CA   1 
ATOM   2657 C  C    . ALA A 1 163 ? 20.546  -24.607 12.636  1.00 85.16  ? 524 ALA A C    1 
ATOM   2658 O  O    . ALA A 1 163 ? 20.320  -24.634 13.844  1.00 86.13  ? 524 ALA A O    1 
ATOM   2659 C  CB   . ALA A 1 163 ? 22.881  -23.926 12.062  1.00 88.93  ? 524 ALA A CB   1 
ATOM   2660 H  H    . ALA A 1 163 ? 21.983  -25.132 10.113  1.00 101.21 ? 524 ALA A H    1 
ATOM   2661 H  HA   . ALA A 1 163 ? 22.231  -25.760 12.685  1.00 106.09 ? 524 ALA A HA   1 
ATOM   2662 H  HB1  . ALA A 1 163 ? 22.961  -23.560 12.957  1.00 106.72 ? 524 ALA A HB1  1 
ATOM   2663 H  HB2  . ALA A 1 163 ? 23.742  -24.258 11.762  1.00 106.72 ? 524 ALA A HB2  1 
ATOM   2664 H  HB3  . ALA A 1 163 ? 22.559  -23.243 11.453  1.00 106.72 ? 524 ALA A HB3  1 
ATOM   2665 N  N    . ASP A 1 164 ? 19.664  -24.159 11.749  1.00 80.17  ? 525 ASP A N    1 
ATOM   2666 C  CA   . ASP A 1 164 ? 18.322  -23.755 12.153  1.00 90.13  ? 525 ASP A CA   1 
ATOM   2667 C  C    . ASP A 1 164 ? 17.583  -24.965 12.715  1.00 77.59  ? 525 ASP A C    1 
ATOM   2668 O  O    . ASP A 1 164 ? 17.425  -25.973 12.027  1.00 95.60  ? 525 ASP A O    1 
ATOM   2669 C  CB   . ASP A 1 164 ? 17.559  -23.153 10.971  1.00 90.29  ? 525 ASP A CB   1 
ATOM   2670 C  CG   . ASP A 1 164 ? 16.402  -22.273 11.408  1.00 108.00 ? 525 ASP A CG   1 
ATOM   2671 O  OD1  . ASP A 1 164 ? 15.263  -22.780 11.495  1.00 100.27 ? 525 ASP A OD1  1 
ATOM   2672 O  OD2  . ASP A 1 164 ? 16.635  -21.072 11.662  1.00 115.63 ? 525 ASP A OD2  1 
ATOM   2673 H  H    . ASP A 1 164 ? 19.817  -24.081 10.906  1.00 96.20  ? 525 ASP A H    1 
ATOM   2674 H  HA   . ASP A 1 164 ? 18.385  -23.083 12.850  1.00 108.16 ? 525 ASP A HA   1 
ATOM   2675 H  HB2  . ASP A 1 164 ? 18.167  -22.610 10.445  1.00 108.35 ? 525 ASP A HB2  1 
ATOM   2676 H  HB3  . ASP A 1 164 ? 17.200  -23.872 10.427  1.00 108.35 ? 525 ASP A HB3  1 
ATOM   2677 N  N    . LYS A 1 165 ? 17.138  -24.862 13.964  1.00 78.91  ? 526 LYS A N    1 
ATOM   2678 C  CA   . LYS A 1 165 ? 16.523  -25.992 14.657  1.00 87.48  ? 526 LYS A CA   1 
ATOM   2679 C  C    . LYS A 1 165 ? 15.028  -25.798 14.936  1.00 77.82  ? 526 LYS A C    1 
ATOM   2680 O  O    . LYS A 1 165 ? 14.415  -26.612 15.625  1.00 77.92  ? 526 LYS A O    1 
ATOM   2681 C  CB   . LYS A 1 165 ? 17.261  -26.261 15.975  1.00 84.47  ? 526 LYS A CB   1 
ATOM   2682 C  CG   . LYS A 1 165 ? 18.705  -26.753 15.814  1.00 88.27  ? 526 LYS A CG   1 
ATOM   2683 C  CD   . LYS A 1 165 ? 18.852  -27.760 14.676  1.00 99.63  ? 526 LYS A CD   1 
ATOM   2684 C  CE   . LYS A 1 165 ? 20.195  -28.471 14.700  1.00 112.72 ? 526 LYS A CE   1 
ATOM   2685 N  NZ   . LYS A 1 165 ? 20.237  -29.533 15.743  1.00 131.23 ? 526 LYS A NZ   1 
ATOM   2686 H  H    . LYS A 1 165 ? 17.179  -24.144 14.435  1.00 94.69  ? 526 LYS A H    1 
ATOM   2687 H  HA   . LYS A 1 165 ? 16.617  -26.782 14.102  1.00 104.97 ? 526 LYS A HA   1 
ATOM   2688 H  HB2  . LYS A 1 165 ? 17.287  -25.438 16.488  1.00 101.36 ? 526 LYS A HB2  1 
ATOM   2689 H  HB3  . LYS A 1 165 ? 16.774  -26.939 16.470  1.00 101.36 ? 526 LYS A HB3  1 
ATOM   2690 H  HG2  . LYS A 1 165 ? 19.279  -25.995 15.621  1.00 105.92 ? 526 LYS A HG2  1 
ATOM   2691 H  HG3  . LYS A 1 165 ? 18.987  -27.183 16.636  1.00 105.92 ? 526 LYS A HG3  1 
ATOM   2692 H  HD2  . LYS A 1 165 ? 18.155  -28.431 14.754  1.00 119.56 ? 526 LYS A HD2  1 
ATOM   2693 H  HD3  . LYS A 1 165 ? 18.772  -27.295 13.828  1.00 119.56 ? 526 LYS A HD3  1 
ATOM   2694 H  HE2  . LYS A 1 165 ? 20.353  -28.886 13.838  1.00 135.27 ? 526 LYS A HE2  1 
ATOM   2695 H  HE3  . LYS A 1 165 ? 20.894  -27.827 14.896  1.00 135.27 ? 526 LYS A HE3  1 
ATOM   2696 H  HZ1  . LYS A 1 165 ? 21.031  -29.933 15.737  1.00 157.47 ? 526 LYS A HZ1  1 
ATOM   2697 H  HZ2  . LYS A 1 165 ? 20.098  -29.176 16.546  1.00 157.47 ? 526 LYS A HZ2  1 
ATOM   2698 H  HZ3  . LYS A 1 165 ? 19.606  -30.140 15.583  1.00 157.47 ? 526 LYS A HZ3  1 
ATOM   2699 N  N    . ASP A 1 166 ? 14.445  -24.729 14.406  1.00 74.01  ? 527 ASP A N    1 
ATOM   2700 C  CA   . ASP A 1 166 ? 12.998  -24.549 14.471  1.00 76.13  ? 527 ASP A CA   1 
ATOM   2701 C  C    . ASP A 1 166 ? 12.304  -25.658 13.687  1.00 77.77  ? 527 ASP A C    1 
ATOM   2702 O  O    . ASP A 1 166 ? 12.857  -26.186 12.725  1.00 81.79  ? 527 ASP A O    1 
ATOM   2703 C  CB   . ASP A 1 166 ? 12.592  -23.181 13.921  1.00 70.42  ? 527 ASP A CB   1 
ATOM   2704 C  CG   . ASP A 1 166 ? 13.047  -22.035 14.803  1.00 82.51  ? 527 ASP A CG   1 
ATOM   2705 O  OD1  . ASP A 1 166 ? 13.803  -22.282 15.767  1.00 100.38 ? 527 ASP A OD1  1 
ATOM   2706 O  OD2  . ASP A 1 166 ? 12.653  -20.884 14.522  1.00 85.53  ? 527 ASP A OD2  1 
ATOM   2707 H  H    . ASP A 1 166 ? 14.863  -24.094 14.004  1.00 88.82  ? 527 ASP A H    1 
ATOM   2708 H  HA   . ASP A 1 166 ? 12.709  -24.603 15.396  1.00 91.36  ? 527 ASP A HA   1 
ATOM   2709 H  HB2  . ASP A 1 166 ? 12.990  -23.062 13.045  1.00 84.51  ? 527 ASP A HB2  1 
ATOM   2710 H  HB3  . ASP A 1 166 ? 11.625  -23.142 13.854  1.00 84.51  ? 527 ASP A HB3  1 
ATOM   2711 N  N    . GLN A 1 167 ? 11.088  -26.000 14.093  1.00 81.33  ? 528 GLN A N    1 
ATOM   2712 C  CA   . GLN A 1 167 ? 10.361  -27.103 13.476  1.00 89.42  ? 528 GLN A CA   1 
ATOM   2713 C  C    . GLN A 1 167 ? 9.755   -26.710 12.127  1.00 71.42  ? 528 GLN A C    1 
ATOM   2714 O  O    . GLN A 1 167 ? 8.956   -25.771 12.039  1.00 63.61  ? 528 GLN A O    1 
ATOM   2715 C  CB   . GLN A 1 167 ? 9.263   -27.600 14.421  1.00 82.40  ? 528 GLN A CB   1 
ATOM   2716 C  CG   . GLN A 1 167 ? 8.523   -28.833 13.923  1.00 97.43  ? 528 GLN A CG   1 
ATOM   2717 C  CD   . GLN A 1 167 ? 9.432   -30.042 13.794  1.00 115.30 ? 528 GLN A CD   1 
ATOM   2718 O  OE1  . GLN A 1 167 ? 10.119  -30.418 14.744  1.00 121.77 ? 528 GLN A OE1  1 
ATOM   2719 N  NE2  . GLN A 1 167 ? 9.444   -30.653 12.613  1.00 108.22 ? 528 GLN A NE2  1 
ATOM   2720 H  H    . GLN A 1 167 ? 10.659  -25.608 14.726  1.00 97.60  ? 528 GLN A H    1 
ATOM   2721 H  HA   . GLN A 1 167 ? 10.977  -27.837 13.323  1.00 107.30 ? 528 GLN A HA   1 
ATOM   2722 H  HB2  . GLN A 1 167 ? 9.664   -27.822 15.275  1.00 98.88  ? 528 GLN A HB2  1 
ATOM   2723 H  HB3  . GLN A 1 167 ? 8.610   -26.892 14.539  1.00 98.88  ? 528 GLN A HB3  1 
ATOM   2724 H  HG2  . GLN A 1 167 ? 7.816   -29.053 14.550  1.00 116.91 ? 528 GLN A HG2  1 
ATOM   2725 H  HG3  . GLN A 1 167 ? 8.146   -28.645 13.049  1.00 116.91 ? 528 GLN A HG3  1 
ATOM   2726 H  HE21 . GLN A 1 167 ? 8.954   -30.359 11.971  1.00 129.86 ? 528 GLN A HE21 1 
ATOM   2727 H  HE22 . GLN A 1 167 ? 9.944   -31.343 12.491  1.00 129.86 ? 528 GLN A HE22 1 
ATOM   2728 N  N    . ALA A 1 168 ? 10.145  -27.440 11.084  1.00 66.79  ? 529 ALA A N    1 
ATOM   2729 C  CA   . ALA A 1 168 ? 9.603   -27.245 9.737   1.00 60.26  ? 529 ALA A CA   1 
ATOM   2730 C  C    . ALA A 1 168 ? 8.864   -28.496 9.283   1.00 75.35  ? 529 ALA A C    1 
ATOM   2731 O  O    . ALA A 1 168 ? 9.472   -29.553 9.099   1.00 84.67  ? 529 ALA A O    1 
ATOM   2732 C  CB   . ALA A 1 168 ? 10.711  -26.906 8.760   1.00 68.93  ? 529 ALA A CB   1 
ATOM   2733 H  H    . ALA A 1 168 ? 10.732  -28.067 11.131  1.00 80.15  ? 529 ALA A H    1 
ATOM   2734 H  HA   . ALA A 1 168 ? 8.974   -26.507 9.750   1.00 72.31  ? 529 ALA A HA   1 
ATOM   2735 H  HB1  . ALA A 1 168 ? 10.327  -26.782 7.878   1.00 82.72  ? 529 ALA A HB1  1 
ATOM   2736 H  HB2  . ALA A 1 168 ? 11.148  -26.090 9.050   1.00 82.72  ? 529 ALA A HB2  1 
ATOM   2737 H  HB3  . ALA A 1 168 ? 11.351  -27.636 8.743   1.00 82.72  ? 529 ALA A HB3  1 
ATOM   2738 N  N    . ASN A 1 169 ? 7.554   -28.363 9.096   1.00 61.83  ? 530 ASN A N    1 
ATOM   2739 C  CA   . ASN A 1 169 ? 6.693   -29.482 8.726   1.00 57.88  ? 530 ASN A CA   1 
ATOM   2740 C  C    . ASN A 1 169 ? 7.193   -30.288 7.524   1.00 73.79  ? 530 ASN A C    1 
ATOM   2741 O  O    . ASN A 1 169 ? 6.990   -31.504 7.465   1.00 73.20  ? 530 ASN A O    1 
ATOM   2742 C  CB   . ASN A 1 169 ? 5.278   -28.970 8.434   1.00 64.58  ? 530 ASN A CB   1 
ATOM   2743 C  CG   . ASN A 1 169 ? 4.495   -28.646 9.698   1.00 66.01  ? 530 ASN A CG   1 
ATOM   2744 O  OD1  . ASN A 1 169 ? 4.990   -28.808 10.815  1.00 66.90  ? 530 ASN A OD1  1 
ATOM   2745 N  ND2  . ASN A 1 169 ? 3.262   -28.180 9.524   1.00 56.63  ? 530 ASN A ND2  1 
ATOM   2746 H  H    . ASN A 1 169 ? 7.132   -27.618 9.179   1.00 74.20  ? 530 ASN A H    1 
ATOM   2747 H  HA   . ASN A 1 169 ? 6.636   -30.089 9.481   1.00 69.45  ? 530 ASN A HA   1 
ATOM   2748 H  HB2  . ASN A 1 169 ? 5.338   -28.160 7.903   1.00 77.50  ? 530 ASN A HB2  1 
ATOM   2749 H  HB3  . ASN A 1 169 ? 4.790   -29.651 7.946   1.00 77.50  ? 530 ASN A HB3  1 
ATOM   2750 H  HD21 . ASN A 1 169 ? 2.777   -27.982 10.205  1.00 67.95  ? 530 ASN A HD21 1 
ATOM   2751 H  HD22 . ASN A 1 169 ? 2.950   -28.078 8.729   1.00 67.95  ? 530 ASN A HD22 1 
ATOM   2752 N  N    . ASP A 1 170 ? 7.844   -29.612 6.577   1.00 68.03  ? 531 ASP A N    1 
ATOM   2753 C  CA   . ASP A 1 170 ? 8.298   -30.250 5.340   1.00 81.90  ? 531 ASP A CA   1 
ATOM   2754 C  C    . ASP A 1 170 ? 9.711   -29.807 4.982   1.00 81.26  ? 531 ASP A C    1 
ATOM   2755 O  O    . ASP A 1 170 ? 10.069  -29.723 3.808   1.00 66.31  ? 531 ASP A O    1 
ATOM   2756 C  CB   . ASP A 1 170 ? 7.340   -29.931 4.184   1.00 83.26  ? 531 ASP A CB   1 
ATOM   2757 C  CG   . ASP A 1 170 ? 7.226   -28.442 3.908   1.00 100.19 ? 531 ASP A CG   1 
ATOM   2758 O  OD1  . ASP A 1 170 ? 7.564   -27.639 4.805   1.00 111.50 ? 531 ASP A OD1  1 
ATOM   2759 O  OD2  . ASP A 1 170 ? 6.789   -28.075 2.795   1.00 95.30  ? 531 ASP A OD2  1 
ATOM   2760 H  H    . ASP A 1 170 ? 8.036   -28.775 6.628   1.00 81.64  ? 531 ASP A H    1 
ATOM   2761 H  HA   . ASP A 1 170 ? 8.308   -31.211 5.466   1.00 98.28  ? 531 ASP A HA   1 
ATOM   2762 H  HB2  . ASP A 1 170 ? 7.663   -30.362 3.378   1.00 99.91  ? 531 ASP A HB2  1 
ATOM   2763 H  HB3  . ASP A 1 170 ? 6.456   -30.263 4.406   1.00 99.91  ? 531 ASP A HB3  1 
ATOM   2764 N  N    . GLY A 1 171 ? 10.510  -29.522 6.003   1.00 60.42  ? 532 GLY A N    1 
ATOM   2765 C  CA   . GLY A 1 171 ? 11.882  -29.095 5.800   1.00 71.70  ? 532 GLY A CA   1 
ATOM   2766 C  C    . GLY A 1 171 ? 11.953  -27.699 5.214   1.00 74.67  ? 532 GLY A C    1 
ATOM   2767 O  O    . GLY A 1 171 ? 10.931  -27.117 4.843   1.00 62.11  ? 532 GLY A O    1 
ATOM   2768 H  H    . GLY A 1 171 ? 10.277  -29.570 6.829   1.00 72.50  ? 532 GLY A H    1 
ATOM   2769 H  HA2  . GLY A 1 171 ? 12.353  -29.099 6.648   1.00 86.04  ? 532 GLY A HA2  1 
ATOM   2770 H  HA3  . GLY A 1 171 ? 12.327  -29.708 5.194   1.00 86.04  ? 532 GLY A HA3  1 
ATOM   2771 N  N    . LEU A 1 172 ? 13.166  -27.163 5.130   1.00 59.31  ? 533 LEU A N    1 
ATOM   2772 C  CA   . LEU A 1 172 ? 13.391  -25.843 4.554   1.00 68.01  ? 533 LEU A CA   1 
ATOM   2773 C  C    . LEU A 1 172 ? 14.008  -25.970 3.164   1.00 63.36  ? 533 LEU A C    1 
ATOM   2774 O  O    . LEU A 1 172 ? 14.476  -27.043 2.782   1.00 58.77  ? 533 LEU A O    1 
ATOM   2775 C  CB   . LEU A 1 172 ? 14.291  -25.013 5.465   1.00 75.77  ? 533 LEU A CB   1 
ATOM   2776 C  CG   . LEU A 1 172 ? 13.706  -24.717 6.850   1.00 60.76  ? 533 LEU A CG   1 
ATOM   2777 C  CD1  . LEU A 1 172 ? 14.805  -24.262 7.787   1.00 68.93  ? 533 LEU A CD1  1 
ATOM   2778 C  CD2  . LEU A 1 172 ? 12.600  -23.670 6.755   1.00 58.49  ? 533 LEU A CD2  1 
ATOM   2779 H  H    . LEU A 1 172 ? 13.884  -27.549 5.403   1.00 71.18  ? 533 LEU A H    1 
ATOM   2780 H  HA   . LEU A 1 172 ? 12.541  -25.383 4.468   1.00 81.61  ? 533 LEU A HA   1 
ATOM   2781 H  HB2  . LEU A 1 172 ? 15.125  -25.492 5.595   1.00 90.92  ? 533 LEU A HB2  1 
ATOM   2782 H  HB3  . LEU A 1 172 ? 14.468  -24.163 5.034   1.00 90.92  ? 533 LEU A HB3  1 
ATOM   2783 H  HG   . LEU A 1 172 ? 13.321  -25.530 7.212   1.00 72.92  ? 533 LEU A HG   1 
ATOM   2784 H  HD11 . LEU A 1 172 ? 14.421  -24.078 8.658   1.00 82.71  ? 533 LEU A HD11 1 
ATOM   2785 H  HD12 . LEU A 1 172 ? 15.469  -24.965 7.859   1.00 82.71  ? 533 LEU A HD12 1 
ATOM   2786 H  HD13 . LEU A 1 172 ? 15.213  -23.458 7.428   1.00 82.71  ? 533 LEU A HD13 1 
ATOM   2787 H  HD21 . LEU A 1 172 ? 12.248  -23.502 7.643   1.00 70.19  ? 533 LEU A HD21 1 
ATOM   2788 H  HD22 . LEU A 1 172 ? 12.970  -22.853 6.385   1.00 70.19  ? 533 LEU A HD22 1 
ATOM   2789 H  HD23 . LEU A 1 172 ? 11.897  -24.006 6.178   1.00 70.19  ? 533 LEU A HD23 1 
ATOM   2790 N  N    . SER A 1 173 ? 14.024  -24.866 2.421   1.00 56.60  ? 534 SER A N    1 
ATOM   2791 C  CA   . SER A 1 173 ? 14.468  -24.884 1.032   1.00 62.33  ? 534 SER A CA   1 
ATOM   2792 C  C    . SER A 1 173 ? 15.647  -23.952 0.780   1.00 57.55  ? 534 SER A C    1 
ATOM   2793 O  O    . SER A 1 173 ? 15.666  -22.812 1.239   1.00 62.82  ? 534 SER A O    1 
ATOM   2794 C  CB   . SER A 1 173 ? 13.306  -24.508 0.113   1.00 53.68  ? 534 SER A CB   1 
ATOM   2795 O  OG   . SER A 1 173 ? 12.234  -25.424 0.263   1.00 60.56  ? 534 SER A OG   1 
ATOM   2796 H  H    . SER A 1 173 ? 13.781  -24.090 2.701   1.00 67.92  ? 534 SER A H    1 
ATOM   2797 H  HA   . SER A 1 173 ? 14.747  -25.785 0.804   1.00 74.80  ? 534 SER A HA   1 
ATOM   2798 H  HB2  . SER A 1 173 ? 12.996  -23.618 0.343   1.00 64.41  ? 534 SER A HB2  1 
ATOM   2799 H  HB3  . SER A 1 173 ? 13.612  -24.527 -0.807  1.00 64.41  ? 534 SER A HB3  1 
ATOM   2800 H  HG   . SER A 1 173 ? 11.960  -25.418 1.057   1.00 72.67  ? 534 SER A HG   1 
ATOM   2801 N  N    . SER A 1 174 ? 16.625  -24.451 0.035   1.00 58.71  ? 535 SER A N    1 
ATOM   2802 C  CA   . SER A 1 174 ? 17.776  -23.657 -0.368  1.00 65.21  ? 535 SER A CA   1 
ATOM   2803 C  C    . SER A 1 174 ? 17.609  -23.097 -1.784  1.00 69.87  ? 535 SER A C    1 
ATOM   2804 O  O    . SER A 1 174 ? 18.414  -22.279 -2.232  1.00 60.27  ? 535 SER A O    1 
ATOM   2805 C  CB   . SER A 1 174 ? 19.047  -24.502 -0.296  1.00 65.31  ? 535 SER A CB   1 
ATOM   2806 O  OG   . SER A 1 174 ? 18.912  -25.676 -1.080  1.00 62.29  ? 535 SER A OG   1 
ATOM   2807 H  H    . SER A 1 174 ? 16.645  -25.261 -0.254  1.00 70.45  ? 535 SER A H    1 
ATOM   2808 H  HA   . SER A 1 174 ? 17.875  -22.909 0.242   1.00 78.25  ? 535 SER A HA   1 
ATOM   2809 H  HB2  . SER A 1 174 ? 19.793  -23.981 -0.632  1.00 78.37  ? 535 SER A HB2  1 
ATOM   2810 H  HB3  . SER A 1 174 ? 19.207  -24.755 0.627   1.00 78.37  ? 535 SER A HB3  1 
ATOM   2811 H  HG   . SER A 1 174 ? 18.268  -26.137 -0.799  1.00 74.75  ? 535 SER A HG   1 
ATOM   2812 N  N    . ALA A 1 175 ? 16.576  -23.540 -2.493  1.00 49.89  ? 536 ALA A N    1 
ATOM   2813 C  CA   . ALA A 1 175 ? 16.377  -23.089 -3.870  1.00 47.85  ? 536 ALA A CA   1 
ATOM   2814 C  C    . ALA A 1 175 ? 14.953  -23.275 -4.358  1.00 48.01  ? 536 ALA A C    1 
ATOM   2815 O  O    . ALA A 1 175 ? 14.176  -24.033 -3.778  1.00 44.15  ? 536 ALA A O    1 
ATOM   2816 C  CB   . ALA A 1 175 ? 17.336  -23.825 -4.808  1.00 48.78  ? 536 ALA A CB   1 
ATOM   2817 H  H    . ALA A 1 175 ? 15.984  -24.094 -2.208  1.00 59.87  ? 536 ALA A H    1 
ATOM   2818 H  HA   . ALA A 1 175 ? 16.584  -22.143 -3.919  1.00 57.42  ? 536 ALA A HA   1 
ATOM   2819 H  HB1  . ALA A 1 175 ? 17.190  -23.515 -5.715  1.00 58.54  ? 536 ALA A HB1  1 
ATOM   2820 H  HB2  . ALA A 1 175 ? 18.248  -23.638 -4.536  1.00 58.54  ? 536 ALA A HB2  1 
ATOM   2821 H  HB3  . ALA A 1 175 ? 17.163  -24.778 -4.752  1.00 58.54  ? 536 ALA A HB3  1 
ATOM   2822 N  N    . LEU A 1 176 ? 14.627  -22.556 -5.429  1.00 45.44  ? 537 LEU A N    1 
ATOM   2823 C  CA   . LEU A 1 176 ? 13.403  -22.774 -6.179  1.00 40.42  ? 537 LEU A CA   1 
ATOM   2824 C  C    . LEU A 1 176 ? 13.755  -23.387 -7.520  1.00 46.04  ? 537 LEU A C    1 
ATOM   2825 O  O    . LEU A 1 176 ? 14.780  -23.059 -8.114  1.00 46.73  ? 537 LEU A O    1 
ATOM   2826 C  CB   . LEU A 1 176 ? 12.634  -21.473 -6.395  1.00 44.80  ? 537 LEU A CB   1 
ATOM   2827 C  CG   . LEU A 1 176 ? 12.007  -20.796 -5.179  1.00 52.90  ? 537 LEU A CG   1 
ATOM   2828 C  CD1  . LEU A 1 176 ? 11.257  -19.547 -5.624  1.00 51.55  ? 537 LEU A CD1  1 
ATOM   2829 C  CD2  . LEU A 1 176 ? 11.091  -21.743 -4.418  1.00 53.56  ? 537 LEU A CD2  1 
ATOM   2830 H  H    . LEU A 1 176 ? 15.114  -21.922 -5.745  1.00 54.53  ? 537 LEU A H    1 
ATOM   2831 H  HA   . LEU A 1 176 ? 12.833  -23.394 -5.697  1.00 48.51  ? 537 LEU A HA   1 
ATOM   2832 H  HB2  . LEU A 1 176 ? 13.243  -20.831 -6.792  1.00 53.75  ? 537 LEU A HB2  1 
ATOM   2833 H  HB3  . LEU A 1 176 ? 11.914  -21.653 -7.020  1.00 53.75  ? 537 LEU A HB3  1 
ATOM   2834 H  HG   . LEU A 1 176 ? 12.714  -20.519 -4.576  1.00 63.48  ? 537 LEU A HG   1 
ATOM   2835 H  HD11 . LEU A 1 176 ? 10.861  -19.123 -4.846  1.00 61.86  ? 537 LEU A HD11 1 
ATOM   2836 H  HD12 . LEU A 1 176 ? 11.881  -18.939 -6.050  1.00 61.86  ? 537 LEU A HD12 1 
ATOM   2837 H  HD13 . LEU A 1 176 ? 10.562  -19.802 -6.251  1.00 61.86  ? 537 LEU A HD13 1 
ATOM   2838 H  HD21 . LEU A 1 176 ? 10.715  -21.274 -3.657  1.00 64.27  ? 537 LEU A HD21 1 
ATOM   2839 H  HD22 . LEU A 1 176 ? 10.380  -22.038 -5.009  1.00 64.27  ? 537 LEU A HD22 1 
ATOM   2840 H  HD23 . LEU A 1 176 ? 11.607  -22.506 -4.115  1.00 64.27  ? 537 LEU A HD23 1 
ATOM   2841 N  N    . LEU A 1 177 ? 12.903  -24.289 -7.978  1.00 46.24  ? 538 LEU A N    1 
ATOM   2842 C  CA   . LEU A 1 177 ? 13.006  -24.835 -9.310  1.00 40.93  ? 538 LEU A CA   1 
ATOM   2843 C  C    . LEU A 1 177 ? 11.840  -24.287 -10.104 1.00 46.59  ? 538 LEU A C    1 
ATOM   2844 O  O    . LEU A 1 177 ? 10.686  -24.496 -9.732  1.00 36.35  ? 538 LEU A O    1 
ATOM   2845 C  CB   . LEU A 1 177 ? 12.978  -26.361 -9.289  1.00 41.50  ? 538 LEU A CB   1 
ATOM   2846 C  CG   . LEU A 1 177 ? 13.132  -27.016 -10.664 1.00 39.74  ? 538 LEU A CG   1 
ATOM   2847 C  CD1  . LEU A 1 177 ? 14.552  -26.869 -11.136 1.00 43.63  ? 538 LEU A CD1  1 
ATOM   2848 C  CD2  . LEU A 1 177 ? 12.737  -28.481 -10.607 1.00 53.12  ? 538 LEU A CD2  1 
ATOM   2849 H  H    . LEU A 1 177 ? 12.245  -24.605 -7.524  1.00 55.49  ? 538 LEU A H    1 
ATOM   2850 H  HA   . LEU A 1 177 ? 13.833  -24.541 -9.724  1.00 49.12  ? 538 LEU A HA   1 
ATOM   2851 H  HB2  . LEU A 1 177 ? 13.705  -26.677 -8.729  1.00 49.80  ? 538 LEU A HB2  1 
ATOM   2852 H  HB3  . LEU A 1 177 ? 12.130  -26.650 -8.918  1.00 49.80  ? 538 LEU A HB3  1 
ATOM   2853 H  HG   . LEU A 1 177 ? 12.551  -26.569 -11.299 1.00 47.69  ? 538 LEU A HG   1 
ATOM   2854 H  HD11 . LEU A 1 177 ? 14.640  -27.287 -12.007 1.00 52.36  ? 538 LEU A HD11 1 
ATOM   2855 H  HD12 . LEU A 1 177 ? 14.768  -25.926 -11.199 1.00 52.36  ? 538 LEU A HD12 1 
ATOM   2856 H  HD13 . LEU A 1 177 ? 15.143  -27.303 -10.500 1.00 52.36  ? 538 LEU A HD13 1 
ATOM   2857 H  HD21 . LEU A 1 177 ? 12.843  -28.870 -11.489 1.00 63.75  ? 538 LEU A HD21 1 
ATOM   2858 H  HD22 . LEU A 1 177 ? 13.310  -28.937 -9.971  1.00 63.75  ? 538 LEU A HD22 1 
ATOM   2859 H  HD23 . LEU A 1 177 ? 11.811  -28.547 -10.325 1.00 63.75  ? 538 LEU A HD23 1 
ATOM   2860 N  N    . ILE A 1 178 ? 12.144  -23.564 -11.177 1.00 47.30  ? 539 ILE A N    1 
ATOM   2861 C  CA   . ILE A 1 178 ? 11.119  -23.009 -12.052 1.00 44.89  ? 539 ILE A CA   1 
ATOM   2862 C  C    . ILE A 1 178 ? 11.295  -23.630 -13.424 1.00 45.52  ? 539 ILE A C    1 
ATOM   2863 O  O    . ILE A 1 178 ? 12.396  -23.633 -13.957 1.00 39.00  ? 539 ILE A O    1 
ATOM   2864 C  CB   . ILE A 1 178 ? 11.214  -21.476 -12.134 1.00 48.19  ? 539 ILE A CB   1 
ATOM   2865 C  CG1  . ILE A 1 178 ? 11.127  -20.877 -10.722 1.00 49.32  ? 539 ILE A CG1  1 
ATOM   2866 C  CG2  . ILE A 1 178 ? 10.099  -20.922 -13.010 1.00 41.47  ? 539 ILE A CG2  1 
ATOM   2867 C  CD1  . ILE A 1 178 ? 11.366  -19.382 -10.660 1.00 46.23  ? 539 ILE A CD1  1 
ATOM   2868 H  H    . ILE A 1 178 ? 12.948  -23.380 -11.422 1.00 56.76  ? 539 ILE A H    1 
ATOM   2869 H  HA   . ILE A 1 178 ? 10.241  -23.246 -11.715 1.00 53.87  ? 539 ILE A HA   1 
ATOM   2870 H  HB   . ILE A 1 178 ? 12.069  -21.235 -12.525 1.00 57.83  ? 539 ILE A HB   1 
ATOM   2871 H  HG12 . ILE A 1 178 ? 10.241  -21.049 -10.366 1.00 59.18  ? 539 ILE A HG12 1 
ATOM   2872 H  HG13 . ILE A 1 178 ? 11.793  -21.305 -10.162 1.00 59.18  ? 539 ILE A HG13 1 
ATOM   2873 H  HG21 . ILE A 1 178 ? 10.178  -19.956 -13.048 1.00 49.77  ? 539 ILE A HG21 1 
ATOM   2874 H  HG22 . ILE A 1 178 ? 10.182  -21.297 -13.901 1.00 49.77  ? 539 ILE A HG22 1 
ATOM   2875 H  HG23 . ILE A 1 178 ? 9.243   -21.170 -12.626 1.00 49.77  ? 539 ILE A HG23 1 
ATOM   2876 H  HD11 . ILE A 1 178 ? 11.292  -19.089 -9.738  1.00 55.48  ? 539 ILE A HD11 1 
ATOM   2877 H  HD12 . ILE A 1 178 ? 12.254  -19.190 -10.999 1.00 55.48  ? 539 ILE A HD12 1 
ATOM   2878 H  HD13 . ILE A 1 178 ? 10.699  -18.933 -11.204 1.00 55.48  ? 539 ILE A HD13 1 
ATOM   2879 N  N    . LEU A 1 179 ? 10.233  -24.191 -13.986 1.00 36.63  ? 540 LEU A N    1 
ATOM   2880 C  CA   . LEU A 1 179 ? 10.380  -24.882 -15.254 1.00 63.06  ? 540 LEU A CA   1 
ATOM   2881 C  C    . LEU A 1 179 ? 9.192   -24.687 -16.170 1.00 43.66  ? 540 LEU A C    1 
ATOM   2882 O  O    . LEU A 1 179 ? 8.064   -24.468 -15.732 1.00 38.72  ? 540 LEU A O    1 
ATOM   2883 C  CB   . LEU A 1 179 ? 10.628  -26.376 -15.021 1.00 52.01  ? 540 LEU A CB   1 
ATOM   2884 C  CG   . LEU A 1 179 ? 9.494   -27.258 -14.504 1.00 38.73  ? 540 LEU A CG   1 
ATOM   2885 C  CD1  . LEU A 1 179 ? 8.570   -27.728 -15.620 1.00 67.93  ? 540 LEU A CD1  1 
ATOM   2886 C  CD2  . LEU A 1 179 ? 10.073  -28.459 -13.778 1.00 62.42  ? 540 LEU A CD2  1 
ATOM   2887 H  H    . LEU A 1 179 ? 9.436   -24.186 -13.663 1.00 43.96  ? 540 LEU A H    1 
ATOM   2888 H  HA   . LEU A 1 179 ? 11.159  -24.525 -15.708 1.00 75.68  ? 540 LEU A HA   1 
ATOM   2889 H  HB2  . LEU A 1 179 ? 10.913  -26.759 -15.865 1.00 62.42  ? 540 LEU A HB2  1 
ATOM   2890 H  HB3  . LEU A 1 179 ? 11.353  -26.455 -14.381 1.00 62.42  ? 540 LEU A HB3  1 
ATOM   2891 H  HG   . LEU A 1 179 ? 8.964   -26.751 -13.869 1.00 46.48  ? 540 LEU A HG   1 
ATOM   2892 H  HD11 . LEU A 1 179 ? 7.871   -28.282 -15.238 1.00 81.52  ? 540 LEU A HD11 1 
ATOM   2893 H  HD12 . LEU A 1 179 ? 8.179   -26.953 -16.053 1.00 81.52  ? 540 LEU A HD12 1 
ATOM   2894 H  HD13 . LEU A 1 179 ? 9.086   -28.241 -16.261 1.00 81.52  ? 540 LEU A HD13 1 
ATOM   2895 H  HD21 . LEU A 1 179 ? 9.346   -29.013 -13.453 1.00 74.90  ? 540 LEU A HD21 1 
ATOM   2896 H  HD22 . LEU A 1 179 ? 10.625  -28.965 -14.395 1.00 74.90  ? 540 LEU A HD22 1 
ATOM   2897 H  HD23 . LEU A 1 179 ? 10.611  -28.148 -13.032 1.00 74.90  ? 540 LEU A HD23 1 
ATOM   2898 N  N    . TYR A 1 180 ? 9.483   -24.788 -17.458 1.00 42.44  ? 541 TYR A N    1 
ATOM   2899 C  CA   . TYR A 1 180 ? 8.504   -24.605 -18.506 1.00 37.68  ? 541 TYR A CA   1 
ATOM   2900 C  C    . TYR A 1 180 ? 8.389   -25.897 -19.284 1.00 30.89  ? 541 TYR A C    1 
ATOM   2901 O  O    . TYR A 1 180 ? 9.374   -26.385 -19.831 1.00 33.62  ? 541 TYR A O    1 
ATOM   2902 C  CB   . TYR A 1 180 ? 8.906   -23.453 -19.421 1.00 40.23  ? 541 TYR A CB   1 
ATOM   2903 C  CG   . TYR A 1 180 ? 8.037   -23.306 -20.648 1.00 38.86  ? 541 TYR A CG   1 
ATOM   2904 C  CD1  . TYR A 1 180 ? 6.730   -22.877 -20.535 1.00 31.66  ? 541 TYR A CD1  1 
ATOM   2905 C  CD2  . TYR A 1 180 ? 8.530   -23.583 -21.918 1.00 42.54  ? 541 TYR A CD2  1 
ATOM   2906 C  CE1  . TYR A 1 180 ? 5.928   -22.727 -21.638 1.00 33.49  ? 541 TYR A CE1  1 
ATOM   2907 C  CE2  . TYR A 1 180 ? 7.732   -23.435 -23.043 1.00 32.29  ? 541 TYR A CE2  1 
ATOM   2908 C  CZ   . TYR A 1 180 ? 6.429   -23.005 -22.888 1.00 39.19  ? 541 TYR A CZ   1 
ATOM   2909 O  OH   . TYR A 1 180 ? 5.601   -22.849 -23.965 1.00 38.28  ? 541 TYR A OH   1 
ATOM   2910 H  H    . TYR A 1 180 ? 10.269  -24.969 -17.755 1.00 50.93  ? 541 TYR A H    1 
ATOM   2911 H  HA   . TYR A 1 180 ? 7.640   -24.402 -18.113 1.00 45.22  ? 541 TYR A HA   1 
ATOM   2912 H  HB2  . TYR A 1 180 ? 8.853   -22.624 -18.920 1.00 48.27  ? 541 TYR A HB2  1 
ATOM   2913 H  HB3  . TYR A 1 180 ? 9.818   -23.597 -19.721 1.00 48.27  ? 541 TYR A HB3  1 
ATOM   2914 H  HD1  . TYR A 1 180 ? 6.386   -22.684 -19.693 1.00 37.99  ? 541 TYR A HD1  1 
ATOM   2915 H  HD2  . TYR A 1 180 ? 9.409   -23.869 -22.015 1.00 51.05  ? 541 TYR A HD2  1 
ATOM   2916 H  HE1  . TYR A 1 180 ? 5.049   -22.439 -21.541 1.00 40.19  ? 541 TYR A HE1  1 
ATOM   2917 H  HE2  . TYR A 1 180 ? 8.069   -23.625 -23.888 1.00 38.75  ? 541 TYR A HE2  1 
ATOM   2918 H  HH   . TYR A 1 180 ? 6.010   -23.045 -24.672 1.00 45.93  ? 541 TYR A HH   1 
ATOM   2919 N  N    . LEU A 1 181 ? 7.186   -26.458 -19.288 1.00 29.83  ? 542 LEU A N    1 
ATOM   2920 C  CA   . LEU A 1 181 ? 6.884   -27.661 -20.048 1.00 36.23  ? 542 LEU A CA   1 
ATOM   2921 C  C    . LEU A 1 181 ? 6.253   -27.258 -21.376 1.00 39.43  ? 542 LEU A C    1 
ATOM   2922 O  O    . LEU A 1 181 ? 5.097   -26.830 -21.419 1.00 38.72  ? 542 LEU A O    1 
ATOM   2923 C  CB   . LEU A 1 181 ? 5.941   -28.577 -19.263 1.00 34.31  ? 542 LEU A CB   1 
ATOM   2924 C  CG   . LEU A 1 181 ? 5.423   -29.795 -20.029 1.00 45.96  ? 542 LEU A CG   1 
ATOM   2925 C  CD1  . LEU A 1 181 ? 6.544   -30.792 -20.274 1.00 37.77  ? 542 LEU A CD1  1 
ATOM   2926 C  CD2  . LEU A 1 181 ? 4.269   -30.441 -19.294 1.00 39.38  ? 542 LEU A CD2  1 
ATOM   2927 H  H    . LEU A 1 181 ? 6.514   -26.153 -18.848 1.00 35.79  ? 542 LEU A H    1 
ATOM   2928 H  HA   . LEU A 1 181 ? 7.705   -28.145 -20.230 1.00 43.47  ? 542 LEU A HA   1 
ATOM   2929 H  HB2  . LEU A 1 181 ? 6.411   -28.904 -18.480 1.00 41.17  ? 542 LEU A HB2  1 
ATOM   2930 H  HB3  . LEU A 1 181 ? 5.170   -28.058 -18.985 1.00 41.17  ? 542 LEU A HB3  1 
ATOM   2931 H  HG   . LEU A 1 181 ? 5.094   -29.502 -20.893 1.00 55.16  ? 542 LEU A HG   1 
ATOM   2932 H  HD11 . LEU A 1 181 ? 6.189   -31.553 -20.760 1.00 45.33  ? 542 LEU A HD11 1 
ATOM   2933 H  HD12 . LEU A 1 181 ? 7.240   -30.362 -20.796 1.00 45.33  ? 542 LEU A HD12 1 
ATOM   2934 H  HD13 . LEU A 1 181 ? 6.901   -31.082 -19.420 1.00 45.33  ? 542 LEU A HD13 1 
ATOM   2935 H  HD21 . LEU A 1 181 ? 3.962   -31.208 -19.801 1.00 47.25  ? 542 LEU A HD21 1 
ATOM   2936 H  HD22 . LEU A 1 181 ? 4.573   -30.723 -18.417 1.00 47.25  ? 542 LEU A HD22 1 
ATOM   2937 H  HD23 . LEU A 1 181 ? 3.551   -29.795 -19.204 1.00 47.25  ? 542 LEU A HD23 1 
ATOM   2938 N  N    . ASP A 1 182 ? 7.018   -27.389 -22.453 1.00 30.67  ? 543 ASP A N    1 
ATOM   2939 C  CA   . ASP A 1 182 ? 6.549   -27.003 -23.781 1.00 47.69  ? 543 ASP A CA   1 
ATOM   2940 C  C    . ASP A 1 182 ? 5.715   -28.109 -24.423 1.00 32.88  ? 543 ASP A C    1 
ATOM   2941 O  O    . ASP A 1 182 ? 4.498   -27.989 -24.560 1.00 34.60  ? 543 ASP A O    1 
ATOM   2942 C  CB   . ASP A 1 182 ? 7.739   -26.655 -24.680 1.00 44.91  ? 543 ASP A CB   1 
ATOM   2943 C  CG   . ASP A 1 182 ? 7.324   -25.939 -25.954 1.00 49.45  ? 543 ASP A CG   1 
ATOM   2944 O  OD1  . ASP A 1 182 ? 7.562   -24.716 -26.055 1.00 79.27  ? 543 ASP A OD1  1 
ATOM   2945 O  OD2  . ASP A 1 182 ? 6.762   -26.598 -26.854 1.00 53.81  ? 543 ASP A OD2  1 
ATOM   2946 H  H    . ASP A 1 182 ? 7.819   -27.701 -22.442 1.00 36.80  ? 543 ASP A H    1 
ATOM   2947 H  HA   . ASP A 1 182 ? 5.991   -26.214 -23.702 1.00 57.23  ? 543 ASP A HA   1 
ATOM   2948 H  HB2  . ASP A 1 182 ? 8.344   -26.073 -24.192 1.00 53.89  ? 543 ASP A HB2  1 
ATOM   2949 H  HB3  . ASP A 1 182 ? 8.196   -27.473 -24.930 1.00 53.89  ? 543 ASP A HB3  1 
ATOM   2950 N  N    . SER A 1 183 ? 6.372   -29.199 -24.796 1.00 35.19  ? 544 SER A N    1 
ATOM   2951 C  CA   . SER A 1 183 ? 5.725   -30.224 -25.596 1.00 38.53  ? 544 SER A CA   1 
ATOM   2952 C  C    . SER A 1 183 ? 6.548   -31.496 -25.647 1.00 46.82  ? 544 SER A C    1 
ATOM   2953 O  O    . SER A 1 183 ? 7.673   -31.535 -25.147 1.00 48.90  ? 544 SER A O    1 
ATOM   2954 C  CB   . SER A 1 183 ? 5.500   -29.704 -27.015 1.00 42.56  ? 544 SER A CB   1 
ATOM   2955 O  OG   . SER A 1 183 ? 6.724   -29.259 -27.577 1.00 40.75  ? 544 SER A OG   1 
ATOM   2956 H  H    . SER A 1 183 ? 7.191   -29.368 -24.598 1.00 42.23  ? 544 SER A H    1 
ATOM   2957 H  HA   . SER A 1 183 ? 4.861   -30.436 -25.209 1.00 46.23  ? 544 SER A HA   1 
ATOM   2958 H  HB2  . SER A 1 183 ? 5.142   -30.420 -27.563 1.00 51.07  ? 544 SER A HB2  1 
ATOM   2959 H  HB3  . SER A 1 183 ? 4.876   -28.962 -26.986 1.00 51.07  ? 544 SER A HB3  1 
ATOM   2960 H  HG   . SER A 1 183 ? 7.046   -28.639 -27.110 1.00 48.91  ? 544 SER A HG   1 
ATOM   2961 N  N    . ALA A 1 184 ? 5.988   -32.526 -26.277 1.00 36.68  ? 545 ALA A N    1 
ATOM   2962 C  CA   . ALA A 1 184 ? 6.718   -33.766 -26.531 1.00 45.35  ? 545 ALA A CA   1 
ATOM   2963 C  C    . ALA A 1 184 ? 6.557   -34.199 -27.986 1.00 46.26  ? 545 ALA A C    1 
ATOM   2964 O  O    . ALA A 1 184 ? 5.572   -33.858 -28.638 1.00 49.57  ? 545 ALA A O    1 
ATOM   2965 C  CB   . ALA A 1 184 ? 6.242   -34.861 -25.602 1.00 44.48  ? 545 ALA A CB   1 
ATOM   2966 H  H    . ALA A 1 184 ? 5.179   -32.531 -26.571 1.00 44.02  ? 545 ALA A H    1 
ATOM   2967 H  HA   . ALA A 1 184 ? 7.662   -33.618 -26.363 1.00 54.42  ? 545 ALA A HA   1 
ATOM   2968 H  HB1  . ALA A 1 184 ? 6.741   -35.672 -25.789 1.00 53.37  ? 545 ALA A HB1  1 
ATOM   2969 H  HB2  . ALA A 1 184 ? 6.393   -34.584 -24.684 1.00 53.37  ? 545 ALA A HB2  1 
ATOM   2970 H  HB3  . ALA A 1 184 ? 5.296   -35.012 -25.751 1.00 53.37  ? 545 ALA A HB3  1 
ATOM   2971 N  N    . ARG A 1 185 ? 7.532   -34.958 -28.476 1.00 51.80  ? 546 ARG A N    1 
ATOM   2972 C  CA   . ARG A 1 185 ? 7.536   -35.455 -29.849 1.00 45.66  ? 546 ARG A CA   1 
ATOM   2973 C  C    . ARG A 1 185 ? 7.611   -36.975 -29.889 1.00 47.83  ? 546 ARG A C    1 
ATOM   2974 O  O    . ARG A 1 185 ? 8.268   -37.591 -29.051 1.00 53.84  ? 546 ARG A O    1 
ATOM   2975 C  CB   . ARG A 1 185 ? 8.725   -34.887 -30.629 1.00 55.27  ? 546 ARG A CB   1 
ATOM   2976 C  CG   . ARG A 1 185 ? 8.459   -33.623 -31.422 1.00 73.31  ? 546 ARG A CG   1 
ATOM   2977 C  CD   . ARG A 1 185 ? 9.424   -33.551 -32.597 1.00 72.54  ? 546 ARG A CD   1 
ATOM   2978 N  NE   . ARG A 1 185 ? 9.594   -32.195 -33.117 1.00 86.01  ? 546 ARG A NE   1 
ATOM   2979 C  CZ   . ARG A 1 185 ? 10.764  -31.571 -33.264 1.00 93.11  ? 546 ARG A CZ   1 
ATOM   2980 N  NH1  . ARG A 1 185 ? 11.909  -32.163 -32.937 1.00 87.27  ? 546 ARG A NH1  1 
ATOM   2981 N  NH2  . ARG A 1 185 ? 10.790  -30.338 -33.748 1.00 89.51  ? 546 ARG A NH2  1 
ATOM   2982 H  H    . ARG A 1 185 ? 8.219   -35.204 -28.022 1.00 62.16  ? 546 ARG A H    1 
ATOM   2983 H  HA   . ARG A 1 185 ? 6.719   -35.178 -30.293 1.00 54.79  ? 546 ARG A HA   1 
ATOM   2984 H  HB2  . ARG A 1 185 ? 9.435   -34.689 -29.999 1.00 66.33  ? 546 ARG A HB2  1 
ATOM   2985 H  HB3  . ARG A 1 185 ? 9.029   -35.562 -31.255 1.00 66.33  ? 546 ARG A HB3  1 
ATOM   2986 H  HG2  . ARG A 1 185 ? 7.552   -33.638 -31.766 1.00 87.97  ? 546 ARG A HG2  1 
ATOM   2987 H  HG3  . ARG A 1 185 ? 8.599   -32.847 -30.857 1.00 87.97  ? 546 ARG A HG3  1 
ATOM   2988 H  HD2  . ARG A 1 185 ? 10.293  -33.873 -32.311 1.00 87.04  ? 546 ARG A HD2  1 
ATOM   2989 H  HD3  . ARG A 1 185 ? 9.086   -34.107 -33.317 1.00 87.04  ? 546 ARG A HD3  1 
ATOM   2990 H  HE   . ARG A 1 185 ? 8.884   -31.766 -33.346 1.00 103.21 ? 546 ARG A HE   1 
ATOM   2991 H  HH11 . ARG A 1 185 ? 11.905  -32.963 -32.622 1.00 104.72 ? 546 ARG A HH11 1 
ATOM   2992 H  HH12 . ARG A 1 185 ? 12.654  -31.745 -33.039 1.00 104.72 ? 546 ARG A HH12 1 
ATOM   2993 H  HH21 . ARG A 1 185 ? 10.056  -29.945 -33.963 1.00 107.41 ? 546 ARG A HH21 1 
ATOM   2994 H  HH22 . ARG A 1 185 ? 11.541  -29.930 -33.845 1.00 107.41 ? 546 ARG A HH22 1 
ATOM   2995 N  N    . ASN A 1 186 ? 6.955   -37.563 -30.885 1.00 55.99  ? 547 ASN A N    1 
ATOM   2996 C  CA   . ASN A 1 186 ? 7.101   -38.983 -31.201 1.00 55.50  ? 547 ASN A CA   1 
ATOM   2997 C  C    . ASN A 1 186 ? 6.899   -39.905 -30.004 1.00 51.99  ? 547 ASN A C    1 
ATOM   2998 O  O    . ASN A 1 186 ? 7.732   -40.765 -29.743 1.00 61.52  ? 547 ASN A O    1 
ATOM   2999 C  CB   . ASN A 1 186 ? 8.490   -39.257 -31.804 1.00 62.17  ? 547 ASN A CB   1 
ATOM   3000 C  CG   . ASN A 1 186 ? 8.792   -38.390 -33.014 1.00 53.81  ? 547 ASN A CG   1 
ATOM   3001 O  OD1  . ASN A 1 186 ? 9.887   -37.841 -33.135 1.00 60.50  ? 547 ASN A OD1  1 
ATOM   3002 N  ND2  . ASN A 1 186 ? 7.826   -38.265 -33.917 1.00 71.25  ? 547 ASN A ND2  1 
ATOM   3003 H  H    . ASN A 1 186 ? 6.408   -37.152 -31.405 1.00 67.19  ? 547 ASN A H    1 
ATOM   3004 H  HA   . ASN A 1 186 ? 6.439   -39.220 -31.868 1.00 66.59  ? 547 ASN A HA   1 
ATOM   3005 H  HB2  . ASN A 1 186 ? 9.166   -39.080 -31.132 1.00 74.60  ? 547 ASN A HB2  1 
ATOM   3006 H  HB3  . ASN A 1 186 ? 8.535   -40.185 -32.082 1.00 74.60  ? 547 ASN A HB3  1 
ATOM   3007 H  HD21 . ASN A 1 186 ? 7.953   -37.784 -34.618 1.00 85.50  ? 547 ASN A HD21 1 
ATOM   3008 H  HD22 . ASN A 1 186 ? 7.074   -38.666 -33.800 1.00 85.50  ? 547 ASN A HD22 1 
ATOM   3009 N  N    . LEU A 1 187 ? 5.801   -39.729 -29.277 1.00 50.77  ? 548 LEU A N    1 
ATOM   3010 C  CA   . LEU A 1 187 ? 5.492   -40.614 -28.161 1.00 54.65  ? 548 LEU A CA   1 
ATOM   3011 C  C    . LEU A 1 187 ? 5.006   -41.970 -28.680 1.00 65.83  ? 548 LEU A C    1 
ATOM   3012 O  O    . LEU A 1 187 ? 4.532   -42.060 -29.812 1.00 74.27  ? 548 LEU A O    1 
ATOM   3013 C  CB   . LEU A 1 187 ? 4.443   -39.979 -27.250 1.00 49.15  ? 548 LEU A CB   1 
ATOM   3014 C  CG   . LEU A 1 187 ? 4.917   -38.765 -26.442 1.00 46.18  ? 548 LEU A CG   1 
ATOM   3015 C  CD1  . LEU A 1 187 ? 3.755   -38.138 -25.711 1.00 50.28  ? 548 LEU A CD1  1 
ATOM   3016 C  CD2  . LEU A 1 187 ? 6.005   -39.148 -25.458 1.00 66.08  ? 548 LEU A CD2  1 
ATOM   3017 H  H    . LEU A 1 187 ? 5.222   -39.107 -29.409 1.00 60.92  ? 548 LEU A H    1 
ATOM   3018 H  HA   . LEU A 1 187 ? 6.296   -40.761 -27.638 1.00 65.58  ? 548 LEU A HA   1 
ATOM   3019 H  HB2  . LEU A 1 187 ? 3.696   -39.689 -27.798 1.00 58.98  ? 548 LEU A HB2  1 
ATOM   3020 H  HB3  . LEU A 1 187 ? 4.139   -40.648 -26.617 1.00 58.98  ? 548 LEU A HB3  1 
ATOM   3021 H  HG   . LEU A 1 187 ? 5.282   -38.103 -27.050 1.00 55.42  ? 548 LEU A HG   1 
ATOM   3022 H  HD11 . LEU A 1 187 ? 4.075   -37.374 -25.207 1.00 60.33  ? 548 LEU A HD11 1 
ATOM   3023 H  HD12 . LEU A 1 187 ? 3.091   -37.853 -26.358 1.00 60.33  ? 548 LEU A HD12 1 
ATOM   3024 H  HD13 . LEU A 1 187 ? 3.370   -38.794 -25.109 1.00 60.33  ? 548 LEU A HD13 1 
ATOM   3025 H  HD21 . LEU A 1 187 ? 6.279   -38.357 -24.967 1.00 79.30  ? 548 LEU A HD21 1 
ATOM   3026 H  HD22 . LEU A 1 187 ? 5.656   -39.813 -24.845 1.00 79.30  ? 548 LEU A HD22 1 
ATOM   3027 H  HD23 . LEU A 1 187 ? 6.760   -39.511 -25.947 1.00 79.30  ? 548 LEU A HD23 1 
ATOM   3028 N  N    . PRO A 1 188 ? 5.124   -43.028 -27.854 1.00 68.58  ? 549 PRO A N    1 
ATOM   3029 C  CA   . PRO A 1 188 ? 4.795   -44.409 -28.243 1.00 73.88  ? 549 PRO A CA   1 
ATOM   3030 C  C    . PRO A 1 188 ? 3.411   -44.602 -28.869 1.00 89.30  ? 549 PRO A C    1 
ATOM   3031 O  O    . PRO A 1 188 ? 2.510   -43.791 -28.649 1.00 89.42  ? 549 PRO A O    1 
ATOM   3032 C  CB   . PRO A 1 188 ? 4.878   -45.169 -26.917 1.00 68.35  ? 549 PRO A CB   1 
ATOM   3033 C  CG   . PRO A 1 188 ? 5.847   -44.409 -26.113 1.00 67.96  ? 549 PRO A CG   1 
ATOM   3034 C  CD   . PRO A 1 188 ? 5.625   -42.966 -26.468 1.00 60.33  ? 549 PRO A CD   1 
ATOM   3035 H  HA   . PRO A 1 188 ? 5.468   -44.755 -28.850 1.00 88.65  ? 549 PRO A HA   1 
ATOM   3036 H  HB2  . PRO A 1 188 ? 4.008   -45.178 -26.489 1.00 82.02  ? 549 PRO A HB2  1 
ATOM   3037 H  HB3  . PRO A 1 188 ? 5.195   -46.072 -27.075 1.00 82.02  ? 549 PRO A HB3  1 
ATOM   3038 H  HG2  . PRO A 1 188 ? 5.676   -44.558 -25.170 1.00 81.55  ? 549 PRO A HG2  1 
ATOM   3039 H  HG3  . PRO A 1 188 ? 6.748   -44.683 -26.345 1.00 81.55  ? 549 PRO A HG3  1 
ATOM   3040 H  HD2  . PRO A 1 188 ? 4.958   -42.573 -25.885 1.00 72.40  ? 549 PRO A HD2  1 
ATOM   3041 H  HD3  . PRO A 1 188 ? 6.462   -42.477 -26.433 1.00 72.40  ? 549 PRO A HD3  1 
ATOM   3042 N  N    . SER A 1 189 ? 3.269   -45.696 -29.619 1.00 119.63 ? 550 SER A N    1 
ATOM   3043 C  CA   . SER A 1 189 ? 2.054   -46.036 -30.365 1.00 131.91 ? 550 SER A CA   1 
ATOM   3044 C  C    . SER A 1 189 ? 1.811   -45.063 -31.516 1.00 127.70 ? 550 SER A C    1 
ATOM   3045 O  O    . SER A 1 189 ? 2.092   -43.871 -31.408 1.00 117.25 ? 550 SER A O    1 
ATOM   3046 C  CB   . SER A 1 189 ? 0.829   -46.072 -29.446 1.00 130.89 ? 550 SER A CB   1 
ATOM   3047 O  OG   . SER A 1 189 ? -0.295  -46.591 -30.136 1.00 134.03 ? 550 SER A OG   1 
ATOM   3048 H  H    . SER A 1 189 ? 3.892   -46.281 -29.714 1.00 143.56 ? 550 SER A H    1 
ATOM   3049 H  HA   . SER A 1 189 ? 2.162   -46.922 -30.746 1.00 158.29 ? 550 SER A HA   1 
ATOM   3050 H  HB2  . SER A 1 189 ? 1.022   -46.639 -28.683 1.00 157.07 ? 550 SER A HB2  1 
ATOM   3051 H  HB3  . SER A 1 189 ? 0.630   -45.171 -29.149 1.00 157.07 ? 550 SER A HB3  1 
ATOM   3052 H  HG   . SER A 1 189 ? -0.963  -46.608 -29.626 1.00 160.84 ? 550 SER A HG   1 
ATOM   3053 N  N    . GLY A 1 190 ? 1.284   -45.588 -32.619 1.00 119.93 ? 551 GLY A N    1 
ATOM   3054 C  CA   . GLY A 1 190 ? 1.022   -44.784 -33.798 1.00 112.71 ? 551 GLY A CA   1 
ATOM   3055 C  C    . GLY A 1 190 ? -0.106  -45.350 -34.636 1.00 114.99 ? 551 GLY A C    1 
ATOM   3056 O  O    . GLY A 1 190 ? 0.014   -46.436 -35.200 1.00 124.94 ? 551 GLY A O    1 
ATOM   3057 H  H    . GLY A 1 190 ? 1.070   -46.416 -32.706 1.00 143.91 ? 551 GLY A H    1 
ATOM   3058 H  HA2  . GLY A 1 190 ? 0.784   -43.883 -33.530 1.00 135.25 ? 551 GLY A HA2  1 
ATOM   3059 H  HA3  . GLY A 1 190 ? 1.821   -44.742 -34.346 1.00 135.25 ? 551 GLY A HA3  1 
ATOM   3060 N  N    . ASN A 1 196 ? -3.798  -43.484 -30.836 1.00 92.46  ? 557 ASN A N    1 
ATOM   3061 C  CA   . ASN A 1 196 ? -2.938  -42.598 -30.061 1.00 98.85  ? 557 ASN A CA   1 
ATOM   3062 C  C    . ASN A 1 196 ? -3.293  -42.600 -28.572 1.00 86.39  ? 557 ASN A C    1 
ATOM   3063 O  O    . ASN A 1 196 ? -4.390  -43.011 -28.195 1.00 107.70 ? 557 ASN A O    1 
ATOM   3064 C  CB   . ASN A 1 196 ? -3.021  -41.168 -30.606 1.00 102.41 ? 557 ASN A CB   1 
ATOM   3065 C  CG   . ASN A 1 196 ? -1.997  -40.888 -31.701 1.00 102.37 ? 557 ASN A CG   1 
ATOM   3066 O  OD1  . ASN A 1 196 ? -0.961  -41.547 -31.794 1.00 107.28 ? 557 ASN A OD1  1 
ATOM   3067 N  ND2  . ASN A 1 196 ? -2.283  -39.888 -32.527 1.00 95.75  ? 557 ASN A ND2  1 
ATOM   3068 H  HA   . ASN A 1 196 ? -2.020  -42.897 -30.149 1.00 118.62 ? 557 ASN A HA   1 
ATOM   3069 H  HB2  . ASN A 1 196 ? -3.904  -41.023 -30.978 1.00 122.89 ? 557 ASN A HB2  1 
ATOM   3070 H  HB3  . ASN A 1 196 ? -2.861  -40.545 -29.880 1.00 122.89 ? 557 ASN A HB3  1 
ATOM   3071 H  HD21 . ASN A 1 196 ? -1.740  -39.687 -33.163 1.00 114.91 ? 557 ASN A HD21 1 
ATOM   3072 H  HD22 . ASN A 1 196 ? -3.011  -39.442 -32.426 1.00 114.91 ? 557 ASN A HD22 1 
ATOM   3073 N  N    . PRO A 1 197 ? -2.355  -42.147 -27.720 1.00 69.35  ? 558 PRO A N    1 
ATOM   3074 C  CA   . PRO A 1 197 ? -2.575  -42.036 -26.274 1.00 60.62  ? 558 PRO A CA   1 
ATOM   3075 C  C    . PRO A 1 197 ? -3.093  -40.660 -25.857 1.00 62.86  ? 558 PRO A C    1 
ATOM   3076 O  O    . PRO A 1 197 ? -3.240  -39.782 -26.705 1.00 59.67  ? 558 PRO A O    1 
ATOM   3077 C  CB   . PRO A 1 197 ? -1.179  -42.275 -25.707 1.00 58.84  ? 558 PRO A CB   1 
ATOM   3078 C  CG   . PRO A 1 197 ? -0.285  -41.625 -26.720 1.00 67.83  ? 558 PRO A CG   1 
ATOM   3079 C  CD   . PRO A 1 197 ? -0.962  -41.810 -28.070 1.00 77.42  ? 558 PRO A CD   1 
ATOM   3080 H  HA   . PRO A 1 197 ? -3.180  -42.727 -25.962 1.00 72.74  ? 558 PRO A HA   1 
ATOM   3081 H  HB2  . PRO A 1 197 ? -1.094  -41.847 -24.841 1.00 70.60  ? 558 PRO A HB2  1 
ATOM   3082 H  HB3  . PRO A 1 197 ? -1.003  -43.227 -25.646 1.00 70.60  ? 558 PRO A HB3  1 
ATOM   3083 H  HG2  . PRO A 1 197 ? -0.194  -40.681 -26.513 1.00 81.39  ? 558 PRO A HG2  1 
ATOM   3084 H  HG3  . PRO A 1 197 ? 0.582   -42.059 -26.713 1.00 81.39  ? 558 PRO A HG3  1 
ATOM   3085 H  HD2  . PRO A 1 197 ? -0.933  -40.984 -28.579 1.00 92.90  ? 558 PRO A HD2  1 
ATOM   3086 H  HD3  . PRO A 1 197 ? -0.551  -42.541 -28.557 1.00 92.90  ? 558 PRO A HD3  1 
ATOM   3087 N  N    . ASN A 1 198 ? -3.358  -40.491 -24.562 1.00 59.05  ? 559 ASN A N    1 
ATOM   3088 C  CA   . ASN A 1 198 ? -3.766  -39.210 -23.989 1.00 47.76  ? 559 ASN A CA   1 
ATOM   3089 C  C    . ASN A 1 198 ? -2.712  -38.704 -23.007 1.00 48.31  ? 559 ASN A C    1 
ATOM   3090 O  O    . ASN A 1 198 ? -2.875  -38.858 -21.799 1.00 49.31  ? 559 ASN A O    1 
ATOM   3091 C  CB   . ASN A 1 198 ? -5.112  -39.342 -23.275 1.00 51.63  ? 559 ASN A CB   1 
ATOM   3092 C  CG   . ASN A 1 198 ? -6.262  -39.593 -24.228 1.00 63.54  ? 559 ASN A CG   1 
ATOM   3093 O  OD1  . ASN A 1 198 ? -6.079  -39.646 -25.445 1.00 61.19  ? 559 ASN A OD1  1 
ATOM   3094 N  ND2  . ASN A 1 198 ? -7.460  -39.758 -23.675 1.00 65.71  ? 559 ASN A ND2  1 
ATOM   3095 H  H    . ASN A 1 198 ? -3.306  -41.122 -23.980 1.00 70.86  ? 559 ASN A H    1 
ATOM   3096 H  HA   . ASN A 1 198 ? -3.861  -38.556 -24.699 1.00 57.32  ? 559 ASN A HA   1 
ATOM   3097 H  HB2  . ASN A 1 198 ? -5.068  -40.087 -22.655 1.00 61.95  ? 559 ASN A HB2  1 
ATOM   3098 H  HB3  . ASN A 1 198 ? -5.295  -38.521 -22.793 1.00 61.95  ? 559 ASN A HB3  1 
ATOM   3099 H  HD21 . ASN A 1 198 ? -8.147  -39.903 -24.172 1.00 78.86  ? 559 ASN A HD21 1 
ATOM   3100 H  HD22 . ASN A 1 198 ? -7.548  -39.720 -22.821 1.00 78.86  ? 559 ASN A HD22 1 
ATOM   3101 N  N    . PRO A 1 199 ? -1.636  -38.083 -23.519 1.00 48.88  ? 560 PRO A N    1 
ATOM   3102 C  CA   . PRO A 1 199 ? -0.458  -37.786 -22.698 1.00 46.92  ? 560 PRO A CA   1 
ATOM   3103 C  C    . PRO A 1 199 ? -0.711  -36.792 -21.568 1.00 59.26  ? 560 PRO A C    1 
ATOM   3104 O  O    . PRO A 1 199 ? -1.357  -35.762 -21.765 1.00 42.40  ? 560 PRO A O    1 
ATOM   3105 C  CB   . PRO A 1 199 ? 0.536   -37.194 -23.709 1.00 51.57  ? 560 PRO A CB   1 
ATOM   3106 C  CG   . PRO A 1 199 ? -0.004  -37.543 -25.050 1.00 53.00  ? 560 PRO A CG   1 
ATOM   3107 C  CD   . PRO A 1 199 ? -1.474  -37.569 -24.887 1.00 55.25  ? 560 PRO A CD   1 
ATOM   3108 H  HA   . PRO A 1 199 ? -0.090  -38.605 -22.329 1.00 56.30  ? 560 PRO A HA   1 
ATOM   3109 H  HB2  . PRO A 1 199 ? 0.578   -36.231 -23.598 1.00 61.88  ? 560 PRO A HB2  1 
ATOM   3110 H  HB3  . PRO A 1 199 ? 1.410   -37.592 -23.578 1.00 61.88  ? 560 PRO A HB3  1 
ATOM   3111 H  HG2  . PRO A 1 199 ? 0.258   -36.866 -25.693 1.00 63.61  ? 560 PRO A HG2  1 
ATOM   3112 H  HG3  . PRO A 1 199 ? 0.327   -38.415 -25.317 1.00 63.61  ? 560 PRO A HG3  1 
ATOM   3113 H  HD2  . PRO A 1 199 ? -1.840  -36.674 -24.960 1.00 66.30  ? 560 PRO A HD2  1 
ATOM   3114 H  HD3  . PRO A 1 199 ? -1.877  -38.175 -25.528 1.00 66.30  ? 560 PRO A HD3  1 
ATOM   3115 N  N    . VAL A 1 200 ? -0.192  -37.114 -20.389 1.00 53.74  ? 561 VAL A N    1 
ATOM   3116 C  CA   . VAL A 1 200 ? -0.207  -36.199 -19.262 1.00 39.12  ? 561 VAL A CA   1 
ATOM   3117 C  C    . VAL A 1 200 ? 1.147   -36.316 -18.575 1.00 41.71  ? 561 VAL A C    1 
ATOM   3118 O  O    . VAL A 1 200 ? 1.722   -37.401 -18.523 1.00 46.45  ? 561 VAL A O    1 
ATOM   3119 C  CB   . VAL A 1 200 ? -1.361  -36.506 -18.286 1.00 47.98  ? 561 VAL A CB   1 
ATOM   3120 C  CG1  . VAL A 1 200 ? -1.176  -37.874 -17.634 1.00 51.86  ? 561 VAL A CG1  1 
ATOM   3121 C  CG2  . VAL A 1 200 ? -1.480  -35.412 -17.236 1.00 47.04  ? 561 VAL A CG2  1 
ATOM   3122 H  H    . VAL A 1 200 ? 0.181   -37.870 -20.217 1.00 64.49  ? 561 VAL A H    1 
ATOM   3123 H  HA   . VAL A 1 200 ? -0.311  -35.290 -19.584 1.00 46.95  ? 561 VAL A HA   1 
ATOM   3124 H  HB   . VAL A 1 200 ? -2.193  -36.527 -18.784 1.00 57.58  ? 561 VAL A HB   1 
ATOM   3125 H  HG11 . VAL A 1 200 ? -1.915  -38.037 -17.028 1.00 62.23  ? 561 VAL A HG11 1 
ATOM   3126 H  HG12 . VAL A 1 200 ? -1.159  -38.553 -18.327 1.00 62.23  ? 561 VAL A HG12 1 
ATOM   3127 H  HG13 . VAL A 1 200 ? -0.339  -37.879 -17.145 1.00 62.23  ? 561 VAL A HG13 1 
ATOM   3128 H  HG21 . VAL A 1 200 ? -2.211  -35.628 -16.636 1.00 56.45  ? 561 VAL A HG21 1 
ATOM   3129 H  HG22 . VAL A 1 200 ? -0.648  -35.360 -16.739 1.00 56.45  ? 561 VAL A HG22 1 
ATOM   3130 H  HG23 . VAL A 1 200 ? -1.654  -34.567 -17.679 1.00 56.45  ? 561 VAL A HG23 1 
ATOM   3131 N  N    . VAL A 1 201 ? 1.669   -35.196 -18.083 1.00 46.36  ? 562 VAL A N    1 
ATOM   3132 C  CA   . VAL A 1 201 ? 2.983   -35.177 -17.446 1.00 36.45  ? 562 VAL A CA   1 
ATOM   3133 C  C    . VAL A 1 201 ? 2.856   -34.995 -15.940 1.00 50.16  ? 562 VAL A C    1 
ATOM   3134 O  O    . VAL A 1 201 ? 2.081   -34.171 -15.467 1.00 45.68  ? 562 VAL A O    1 
ATOM   3135 C  CB   . VAL A 1 201 ? 3.869   -34.058 -18.009 1.00 45.87  ? 562 VAL A CB   1 
ATOM   3136 C  CG1  . VAL A 1 201 ? 5.232   -34.061 -17.334 1.00 43.33  ? 562 VAL A CG1  1 
ATOM   3137 C  CG2  . VAL A 1 201 ? 4.027   -34.222 -19.507 1.00 42.31  ? 562 VAL A CG2  1 
ATOM   3138 H  H    . VAL A 1 201 ? 1.280   -34.429 -18.105 1.00 55.63  ? 562 VAL A H    1 
ATOM   3139 H  HA   . VAL A 1 201 ? 3.427   -36.023 -17.611 1.00 43.73  ? 562 VAL A HA   1 
ATOM   3140 H  HB   . VAL A 1 201 ? 3.448   -33.200 -17.839 1.00 55.04  ? 562 VAL A HB   1 
ATOM   3141 H  HG11 . VAL A 1 201 ? 5.770   -33.346 -17.708 1.00 51.99  ? 562 VAL A HG11 1 
ATOM   3142 H  HG12 . VAL A 1 201 ? 5.113   -33.923 -16.382 1.00 51.99  ? 562 VAL A HG12 1 
ATOM   3143 H  HG13 . VAL A 1 201 ? 5.661   -34.916 -17.494 1.00 51.99  ? 562 VAL A HG13 1 
ATOM   3144 H  HG21 . VAL A 1 201 ? 4.589   -33.508 -19.845 1.00 50.77  ? 562 VAL A HG21 1 
ATOM   3145 H  HG22 . VAL A 1 201 ? 4.439   -35.081 -19.688 1.00 50.77  ? 562 VAL A HG22 1 
ATOM   3146 H  HG23 . VAL A 1 201 ? 3.152   -34.180 -19.923 1.00 50.77  ? 562 VAL A HG23 1 
ATOM   3147 N  N    . GLN A 1 202 ? 3.633   -35.777 -15.200 1.00 50.52  ? 563 GLN A N    1 
ATOM   3148 C  CA   . GLN A 1 202 ? 3.735   -35.637 -13.757 1.00 38.60  ? 563 GLN A CA   1 
ATOM   3149 C  C    . GLN A 1 202 ? 5.183   -35.318 -13.383 1.00 38.66  ? 563 GLN A C    1 
ATOM   3150 O  O    . GLN A 1 202 ? 6.093   -36.094 -13.674 1.00 48.50  ? 563 GLN A O    1 
ATOM   3151 C  CB   . GLN A 1 202 ? 3.255   -36.914 -13.067 1.00 51.55  ? 563 GLN A CB   1 
ATOM   3152 C  CG   . GLN A 1 202 ? 3.290   -36.863 -11.551 1.00 85.99  ? 563 GLN A CG   1 
ATOM   3153 C  CD   . GLN A 1 202 ? 2.400   -37.918 -10.915 1.00 101.04 ? 563 GLN A CD   1 
ATOM   3154 O  OE1  . GLN A 1 202 ? 1.270   -38.146 -11.354 1.00 96.65  ? 563 GLN A OE1  1 
ATOM   3155 N  NE2  . GLN A 1 202 ? 2.909   -38.571 -9.878  1.00 87.47  ? 563 GLN A NE2  1 
ATOM   3156 H  H    . GLN A 1 202 ? 4.121   -36.410 -15.520 1.00 60.63  ? 563 GLN A H    1 
ATOM   3157 H  HA   . GLN A 1 202 ? 3.174   -34.901 -13.465 1.00 46.31  ? 563 GLN A HA   1 
ATOM   3158 H  HB2  . GLN A 1 202 ? 2.339   -37.086 -13.335 1.00 61.86  ? 563 GLN A HB2  1 
ATOM   3159 H  HB3  . GLN A 1 202 ? 3.821   -37.650 -13.349 1.00 61.86  ? 563 GLN A HB3  1 
ATOM   3160 H  HG2  . GLN A 1 202 ? 4.199   -37.014 -11.249 1.00 103.19 ? 563 GLN A HG2  1 
ATOM   3161 H  HG3  . GLN A 1 202 ? 2.981   -35.991 -11.256 1.00 103.19 ? 563 GLN A HG3  1 
ATOM   3162 H  HE21 . GLN A 1 202 ? 3.702   -38.388 -9.602  1.00 104.96 ? 563 GLN A HE21 1 
ATOM   3163 H  HE22 . GLN A 1 202 ? 2.446   -39.178 -9.483  1.00 104.96 ? 563 GLN A HE22 1 
ATOM   3164 N  N    . MET A 1 203 ? 5.389   -34.159 -12.768 1.00 53.59  ? 564 MET A N    1 
ATOM   3165 C  CA   . MET A 1 203 ? 6.714   -33.742 -12.324 1.00 52.91  ? 564 MET A CA   1 
ATOM   3166 C  C    . MET A 1 203 ? 6.832   -33.789 -10.816 1.00 43.59  ? 564 MET A C    1 
ATOM   3167 O  O    . MET A 1 203 ? 5.903   -33.412 -10.101 1.00 37.37  ? 564 MET A O    1 
ATOM   3168 C  CB   . MET A 1 203 ? 7.018   -32.332 -12.802 1.00 35.84  ? 564 MET A CB   1 
ATOM   3169 C  CG   . MET A 1 203 ? 7.274   -32.238 -14.284 1.00 64.92  ? 564 MET A CG   1 
ATOM   3170 S  SD   . MET A 1 203 ? 6.629   -30.694 -14.915 1.00 86.64  ? 564 MET A SD   1 
ATOM   3171 C  CE   . MET A 1 203 ? 4.874   -31.006 -14.822 1.00 65.45  ? 564 MET A CE   1 
ATOM   3172 H  H    . MET A 1 203 ? 4.770   -33.588 -12.593 1.00 64.31  ? 564 MET A H    1 
ATOM   3173 H  HA   . MET A 1 203 ? 7.376   -34.337 -12.710 1.00 63.50  ? 564 MET A HA   1 
ATOM   3174 H  HB2  . MET A 1 203 ? 6.262   -31.761 -12.594 1.00 43.00  ? 564 MET A HB2  1 
ATOM   3175 H  HB3  . MET A 1 203 ? 7.810   -32.009 -12.343 1.00 43.00  ? 564 MET A HB3  1 
ATOM   3176 H  HG2  . MET A 1 203 ? 8.229   -32.266 -14.453 1.00 77.90  ? 564 MET A HG2  1 
ATOM   3177 H  HG3  . MET A 1 203 ? 6.826   -32.969 -14.739 1.00 77.90  ? 564 MET A HG3  1 
ATOM   3178 H  HE1  . MET A 1 203 ? 4.397   -30.225 -15.144 1.00 78.54  ? 564 MET A HE1  1 
ATOM   3179 H  HE2  . MET A 1 203 ? 4.661   -31.775 -15.374 1.00 78.54  ? 564 MET A HE2  1 
ATOM   3180 H  HE3  . MET A 1 203 ? 4.633   -31.185 -13.899 1.00 78.54  ? 564 MET A HE3  1 
ATOM   3181 N  N    . SER A 1 204 ? 7.989   -34.232 -10.339 1.00 46.43  ? 565 SER A N    1 
ATOM   3182 C  CA   . SER A 1 204 ? 8.239   -34.306 -8.913  1.00 59.29  ? 565 SER A CA   1 
ATOM   3183 C  C    . SER A 1 204 ? 9.704   -34.077 -8.574  1.00 58.24  ? 565 SER A C    1 
ATOM   3184 O  O    . SER A 1 204 ? 10.604  -34.441 -9.338  1.00 53.57  ? 565 SER A O    1 
ATOM   3185 C  CB   . SER A 1 204 ? 7.784   -35.664 -8.370  1.00 50.03  ? 565 SER A CB   1 
ATOM   3186 O  OG   . SER A 1 204 ? 8.228   -36.717 -9.206  1.00 60.19  ? 565 SER A OG   1 
ATOM   3187 H  H    . SER A 1 204 ? 8.647   -34.496 -10.826 1.00 55.72  ? 565 SER A H    1 
ATOM   3188 H  HA   . SER A 1 204 ? 7.719   -33.619 -8.468  1.00 71.14  ? 565 SER A HA   1 
ATOM   3189 H  HB2  . SER A 1 204 ? 8.154   -35.789 -7.482  1.00 60.03  ? 565 SER A HB2  1 
ATOM   3190 H  HB3  . SER A 1 204 ? 6.815   -35.679 -8.330  1.00 60.03  ? 565 SER A HB3  1 
ATOM   3191 H  HG   . SER A 1 204 ? 7.972   -37.455 -8.898  1.00 72.22  ? 565 SER A HG   1 
ATOM   3192 N  N    . VAL A 1 205 ? 9.922   -33.432 -7.431  1.00 54.11  ? 566 VAL A N    1 
ATOM   3193 C  CA   . VAL A 1 205 ? 11.228  -33.394 -6.786  1.00 48.58  ? 566 VAL A CA   1 
ATOM   3194 C  C    . VAL A 1 205 ? 11.032  -33.980 -5.398  1.00 65.07  ? 566 VAL A C    1 
ATOM   3195 O  O    . VAL A 1 205 ? 10.461  -33.337 -4.517  1.00 73.80  ? 566 VAL A O    1 
ATOM   3196 C  CB   . VAL A 1 205 ? 11.811  -31.971 -6.685  1.00 62.84  ? 566 VAL A CB   1 
ATOM   3197 C  CG1  . VAL A 1 205 ? 13.224  -32.015 -6.123  1.00 76.51  ? 566 VAL A CG1  1 
ATOM   3198 C  CG2  . VAL A 1 205 ? 11.813  -31.296 -8.041  1.00 60.40  ? 566 VAL A CG2  1 
ATOM   3199 H  H    . VAL A 1 205 ? 9.315   -32.999 -7.003  1.00 64.93  ? 566 VAL A H    1 
ATOM   3200 H  HA   . VAL A 1 205 ? 11.852  -33.952 -7.275  1.00 58.29  ? 566 VAL A HA   1 
ATOM   3201 H  HB   . VAL A 1 205 ? 11.262  -31.442 -6.085  1.00 75.40  ? 566 VAL A HB   1 
ATOM   3202 H  HG11 . VAL A 1 205 ? 13.570  -31.110 -6.069  1.00 91.81  ? 566 VAL A HG11 1 
ATOM   3203 H  HG12 . VAL A 1 205 ? 13.199  -32.413 -5.239  1.00 91.81  ? 566 VAL A HG12 1 
ATOM   3204 H  HG13 . VAL A 1 205 ? 13.781  -32.548 -6.711  1.00 91.81  ? 566 VAL A HG13 1 
ATOM   3205 H  HG21 . VAL A 1 205 ? 12.184  -30.405 -7.949  1.00 72.48  ? 566 VAL A HG21 1 
ATOM   3206 H  HG22 . VAL A 1 205 ? 12.355  -31.819 -8.652  1.00 72.48  ? 566 VAL A HG22 1 
ATOM   3207 H  HG23 . VAL A 1 205 ? 10.902  -31.243 -8.368  1.00 72.48  ? 566 VAL A HG23 1 
ATOM   3208 N  N    . GLY A 1 206 ? 11.475  -35.215 -5.214  1.00 64.43  ? 567 GLY A N    1 
ATOM   3209 C  CA   . GLY A 1 206 ? 11.237  -35.913 -3.966  1.00 73.53  ? 567 GLY A CA   1 
ATOM   3210 C  C    . GLY A 1 206 ? 9.758   -36.177 -3.759  1.00 82.76  ? 567 GLY A C    1 
ATOM   3211 O  O    . GLY A 1 206 ? 9.180   -37.036 -4.423  1.00 95.85  ? 567 GLY A O    1 
ATOM   3212 H  H    . GLY A 1 206 ? 11.915  -35.669 -5.797  1.00 77.32  ? 567 GLY A H    1 
ATOM   3213 H  HA2  . GLY A 1 206 ? 11.707  -36.761 -3.971  1.00 88.24  ? 567 GLY A HA2  1 
ATOM   3214 H  HA3  . GLY A 1 206 ? 11.565  -35.380 -3.225  1.00 88.24  ? 567 GLY A HA3  1 
ATOM   3215 N  N    . HIS A 1 207 ? 9.141   -35.408 -2.865  1.00 78.22  ? 568 HIS A N    1 
ATOM   3216 C  CA   . HIS A 1 207 ? 7.761   -35.648 -2.447  1.00 96.26  ? 568 HIS A CA   1 
ATOM   3217 C  C    . HIS A 1 207 ? 6.815   -34.573 -2.988  1.00 71.85  ? 568 HIS A C    1 
ATOM   3218 O  O    . HIS A 1 207 ? 5.598   -34.763 -3.029  1.00 67.94  ? 568 HIS A O    1 
ATOM   3219 C  CB   . HIS A 1 207 ? 7.671   -35.723 -0.915  1.00 115.04 ? 568 HIS A CB   1 
ATOM   3220 C  CG   . HIS A 1 207 ? 8.494   -34.695 -0.201  1.00 126.24 ? 568 HIS A CG   1 
ATOM   3221 N  ND1  . HIS A 1 207 ? 9.870   -34.655 -0.279  1.00 129.10 ? 568 HIS A ND1  1 
ATOM   3222 C  CD2  . HIS A 1 207 ? 8.136   -33.682 0.624   1.00 124.41 ? 568 HIS A CD2  1 
ATOM   3223 C  CE1  . HIS A 1 207 ? 10.323  -33.654 0.452   1.00 129.75 ? 568 HIS A CE1  1 
ATOM   3224 N  NE2  . HIS A 1 207 ? 9.291   -33.048 1.013   1.00 129.14 ? 568 HIS A NE2  1 
ATOM   3225 H  H    . HIS A 1 207 ? 9.506   -34.732 -2.479  1.00 93.86  ? 568 HIS A H    1 
ATOM   3226 H  HA   . HIS A 1 207 ? 7.472   -36.502 -2.803  1.00 115.51 ? 568 HIS A HA   1 
ATOM   3227 H  HB2  . HIS A 1 207 ? 6.746   -35.597 -0.651  1.00 138.05 ? 568 HIS A HB2  1 
ATOM   3228 H  HB3  . HIS A 1 207 ? 7.977   -36.598 -0.628  1.00 138.05 ? 568 HIS A HB3  1 
ATOM   3229 H  HD1  . HIS A 1 207 ? 10.357  -35.193 -0.741  1.00 154.92 ? 568 HIS A HD1  1 
ATOM   3230 H  HD2  . HIS A 1 207 ? 7.270   -33.454 0.874   1.00 149.29 ? 568 HIS A HD2  1 
ATOM   3231 H  HE1  . HIS A 1 207 ? 11.216  -33.418 0.559   1.00 155.70 ? 568 HIS A HE1  1 
ATOM   3232 H  HE2  . HIS A 1 207 ? 9.335   -32.367 1.537   1.00 154.97 ? 568 HIS A HE2  1 
ATOM   3233 N  N    . LYS A 1 208 ? 7.377   -33.444 -3.399  1.00 80.54  ? 569 LYS A N    1 
ATOM   3234 C  CA   . LYS A 1 208 ? 6.601   -32.427 -4.086  1.00 83.28  ? 569 LYS A CA   1 
ATOM   3235 C  C    . LYS A 1 208 ? 6.205   -33.005 -5.440  1.00 74.16  ? 569 LYS A C    1 
ATOM   3236 O  O    . LYS A 1 208 ? 7.050   -33.575 -6.132  1.00 72.68  ? 569 LYS A O    1 
ATOM   3237 C  CB   . LYS A 1 208 ? 7.402   -31.130 -4.270  1.00 98.86  ? 569 LYS A CB   1 
ATOM   3238 C  CG   . LYS A 1 208 ? 8.317   -30.728 -3.108  1.00 96.51  ? 569 LYS A CG   1 
ATOM   3239 C  CD   . LYS A 1 208 ? 7.544   -30.301 -1.867  1.00 81.84  ? 569 LYS A CD   1 
ATOM   3240 C  CE   . LYS A 1 208 ? 8.480   -29.658 -0.851  1.00 102.55 ? 569 LYS A CE   1 
ATOM   3241 N  NZ   . LYS A 1 208 ? 7.767   -29.066 0.314   1.00 101.85 ? 569 LYS A NZ   1 
ATOM   3242 H  H    . LYS A 1 208 ? 8.207   -33.245 -3.292  1.00 96.65  ? 569 LYS A H    1 
ATOM   3243 H  HA   . LYS A 1 208 ? 5.796   -32.229 -3.581  1.00 99.93  ? 569 LYS A HA   1 
ATOM   3244 H  HB2  . LYS A 1 208 ? 7.961   -31.227 -5.056  1.00 118.63 ? 569 LYS A HB2  1 
ATOM   3245 H  HB3  . LYS A 1 208 ? 6.776   -30.403 -4.409  1.00 118.63 ? 569 LYS A HB3  1 
ATOM   3246 H  HG2  . LYS A 1 208 ? 8.874   -31.485 -2.868  1.00 115.81 ? 569 LYS A HG2  1 
ATOM   3247 H  HG3  . LYS A 1 208 ? 8.872   -29.983 -3.386  1.00 115.81 ? 569 LYS A HG3  1 
ATOM   3248 H  HD2  . LYS A 1 208 ? 6.867   -29.652 -2.115  1.00 98.21  ? 569 LYS A HD2  1 
ATOM   3249 H  HD3  . LYS A 1 208 ? 7.134   -31.079 -1.458  1.00 98.21  ? 569 LYS A HD3  1 
ATOM   3250 H  HE2  . LYS A 1 208 ? 9.091   -30.333 -0.515  1.00 123.06 ? 569 LYS A HE2  1 
ATOM   3251 H  HE3  . LYS A 1 208 ? 8.979   -28.950 -1.287  1.00 123.06 ? 569 LYS A HE3  1 
ATOM   3252 H  HZ1  . LYS A 1 208 ? 8.353   -28.704 0.877   1.00 122.22 ? 569 LYS A HZ1  1 
ATOM   3253 H  HZ2  . LYS A 1 208 ? 7.204   -28.434 0.037   1.00 122.22 ? 569 LYS A HZ2  1 
ATOM   3254 H  HZ3  . LYS A 1 208 ? 7.306   -29.696 0.741   1.00 122.22 ? 569 LYS A HZ3  1 
ATOM   3255 N  N    . ALA A 1 209 ? 4.933   -32.884 -5.814  1.00 57.11  ? 570 ALA A N    1 
ATOM   3256 C  CA   . ALA A 1 209 ? 4.480   -33.373 -7.116  1.00 62.01  ? 570 ALA A CA   1 
ATOM   3257 C  C    . ALA A 1 209 ? 3.410   -32.478 -7.732  1.00 53.89  ? 570 ALA A C    1 
ATOM   3258 O  O    . ALA A 1 209 ? 2.512   -31.993 -7.046  1.00 44.69  ? 570 ALA A O    1 
ATOM   3259 C  CB   . ALA A 1 209 ? 3.960   -34.788 -6.993  1.00 48.18  ? 570 ALA A CB   1 
ATOM   3260 H  H    . ALA A 1 209 ? 4.316   -32.524 -5.335  1.00 68.53  ? 570 ALA A H    1 
ATOM   3261 H  HA   . ALA A 1 209 ? 5.237   -33.388 -7.722  1.00 74.42  ? 570 ALA A HA   1 
ATOM   3262 H  HB1  . ALA A 1 209 ? 3.666   -35.092 -7.865  1.00 57.81  ? 570 ALA A HB1  1 
ATOM   3263 H  HB2  . ALA A 1 209 ? 4.674   -35.358 -6.666  1.00 57.81  ? 570 ALA A HB2  1 
ATOM   3264 H  HB3  . ALA A 1 209 ? 3.217   -34.797 -6.370  1.00 57.81  ? 570 ALA A HB3  1 
ATOM   3265 N  N    . GLN A 1 210 ? 3.518   -32.270 -9.039  1.00 56.45  ? 571 GLN A N    1 
ATOM   3266 C  CA   . GLN A 1 210 ? 2.563   -31.457 -9.777  1.00 48.56  ? 571 GLN A CA   1 
ATOM   3267 C  C    . GLN A 1 210 ? 2.307   -32.090 -11.141 1.00 43.01  ? 571 GLN A C    1 
ATOM   3268 O  O    . GLN A 1 210 ? 3.144   -32.840 -11.652 1.00 46.82  ? 571 GLN A O    1 
ATOM   3269 C  CB   . GLN A 1 210 ? 3.080   -30.027 -9.932  1.00 41.71  ? 571 GLN A CB   1 
ATOM   3270 C  CG   . GLN A 1 210 ? 3.124   -29.227 -8.637  1.00 43.04  ? 571 GLN A CG   1 
ATOM   3271 C  CD   . GLN A 1 210 ? 3.815   -27.889 -8.808  1.00 54.14  ? 571 GLN A CD   1 
ATOM   3272 O  OE1  . GLN A 1 210 ? 3.415   -27.058 -9.633  1.00 46.05  ? 571 GLN A OE1  1 
ATOM   3273 N  NE2  . GLN A 1 210 ? 4.875   -27.679 -8.040  1.00 39.92  ? 571 GLN A NE2  1 
ATOM   3274 H  H    . GLN A 1 210 ? 4.146   -32.594 -9.528  1.00 67.74  ? 571 GLN A H    1 
ATOM   3275 H  HA   . GLN A 1 210 ? 1.724   -31.427 -9.291  1.00 58.27  ? 571 GLN A HA   1 
ATOM   3276 H  HB2  . GLN A 1 210 ? 3.982   -30.060 -10.287 1.00 50.05  ? 571 GLN A HB2  1 
ATOM   3277 H  HB3  . GLN A 1 210 ? 2.503   -29.554 -10.551 1.00 50.05  ? 571 GLN A HB3  1 
ATOM   3278 H  HG2  . GLN A 1 210 ? 2.217   -29.061 -8.336  1.00 51.65  ? 571 GLN A HG2  1 
ATOM   3279 H  HG3  . GLN A 1 210 ? 3.610   -29.733 -7.968  1.00 51.65  ? 571 GLN A HG3  1 
ATOM   3280 H  HE21 . GLN A 1 210 ? 5.132   -28.285 -7.486  1.00 47.91  ? 571 GLN A HE21 1 
ATOM   3281 H  HE22 . GLN A 1 210 ? 5.306   -26.936 -8.095  1.00 47.91  ? 571 GLN A HE22 1 
ATOM   3282 N  N    . GLU A 1 211 ? 1.151   -31.781 -11.719 1.00 42.25  ? 572 GLU A N    1 
ATOM   3283 C  CA   . GLU A 1 211 ? 0.692   -32.425 -12.944 1.00 51.37  ? 572 GLU A CA   1 
ATOM   3284 C  C    . GLU A 1 211 ? 0.303   -31.410 -14.012 1.00 45.32  ? 572 GLU A C    1 
ATOM   3285 O  O    . GLU A 1 211 ? -0.236  -30.350 -13.698 1.00 41.44  ? 572 GLU A O    1 
ATOM   3286 C  CB   . GLU A 1 211 ? -0.507  -33.326 -12.648 1.00 50.20  ? 572 GLU A CB   1 
ATOM   3287 C  CG   . GLU A 1 211 ? -0.268  -34.793 -12.954 1.00 81.31  ? 572 GLU A CG   1 
ATOM   3288 C  CD   . GLU A 1 211 ? -1.469  -35.666 -12.633 1.00 87.51  ? 572 GLU A CD   1 
ATOM   3289 O  OE1  . GLU A 1 211 ? -2.566  -35.113 -12.400 1.00 95.39  ? 572 GLU A OE1  1 
ATOM   3290 O  OE2  . GLU A 1 211 ? -1.316  -36.906 -12.612 1.00 92.32  ? 572 GLU A OE2  1 
ATOM   3291 H  H    . GLU A 1 211 ? 0.605   -31.190 -11.415 1.00 50.70  ? 572 GLU A H    1 
ATOM   3292 H  HA   . GLU A 1 211 ? 1.406   -32.978 -13.299 1.00 61.64  ? 572 GLU A HA   1 
ATOM   3293 H  HB2  . GLU A 1 211 ? -0.727  -33.252 -11.706 1.00 60.24  ? 572 GLU A HB2  1 
ATOM   3294 H  HB3  . GLU A 1 211 ? -1.260  -33.030 -13.184 1.00 60.24  ? 572 GLU A HB3  1 
ATOM   3295 H  HG2  . GLU A 1 211 ? -0.071  -34.890 -13.899 1.00 97.57  ? 572 GLU A HG2  1 
ATOM   3296 H  HG3  . GLU A 1 211 ? 0.481   -35.108 -12.425 1.00 97.57  ? 572 GLU A HG3  1 
ATOM   3297 N  N    . SER A 1 212 ? 0.562   -31.749 -15.272 1.00 46.56  ? 573 SER A N    1 
ATOM   3298 C  CA   . SER A 1 212 ? 0.101   -30.940 -16.397 1.00 41.81  ? 573 SER A CA   1 
ATOM   3299 C  C    . SER A 1 212 ? -1.360  -31.244 -16.684 1.00 41.05  ? 573 SER A C    1 
ATOM   3300 O  O    . SER A 1 212 ? -1.949  -32.133 -16.064 1.00 36.91  ? 573 SER A O    1 
ATOM   3301 C  CB   . SER A 1 212 ? 0.922   -31.222 -17.646 1.00 38.73  ? 573 SER A CB   1 
ATOM   3302 O  OG   . SER A 1 212 ? 0.581   -32.493 -18.180 1.00 32.89  ? 573 SER A OG   1 
ATOM   3303 H  H    . SER A 1 212 ? 1.007   -32.448 -15.503 1.00 55.87  ? 573 SER A H    1 
ATOM   3304 H  HA   . SER A 1 212 ? 0.184   -29.999 -16.178 1.00 50.17  ? 573 SER A HA   1 
ATOM   3305 H  HB2  . SER A 1 212 ? 0.737   -30.539 -18.310 1.00 46.47  ? 573 SER A HB2  1 
ATOM   3306 H  HB3  . SER A 1 212 ? 1.864   -31.217 -17.415 1.00 46.47  ? 573 SER A HB3  1 
ATOM   3307 H  HG   . SER A 1 212 ? -0.235  -32.510 -18.381 1.00 39.47  ? 573 SER A HG   1 
ATOM   3308 N  N    . LYS A 1 213 ? -1.941  -30.525 -17.638 1.00 36.28  ? 574 LYS A N    1 
ATOM   3309 C  CA   . LYS A 1 213 ? -3.268  -30.880 -18.123 1.00 40.64  ? 574 LYS A CA   1 
ATOM   3310 C  C    . LYS A 1 213 ? -3.139  -32.117 -18.999 1.00 41.35  ? 574 LYS A C    1 
ATOM   3311 O  O    . LYS A 1 213 ? -2.027  -32.520 -19.364 1.00 38.28  ? 574 LYS A O    1 
ATOM   3312 C  CB   . LYS A 1 213 ? -3.904  -29.726 -18.899 1.00 44.74  ? 574 LYS A CB   1 
ATOM   3313 C  CG   . LYS A 1 213 ? -4.098  -28.460 -18.075 1.00 47.00  ? 574 LYS A CG   1 
ATOM   3314 C  CD   . LYS A 1 213 ? -4.984  -28.702 -16.849 1.00 59.92  ? 574 LYS A CD   1 
ATOM   3315 C  CE   . LYS A 1 213 ? -5.099  -27.456 -15.982 1.00 70.11  ? 574 LYS A CE   1 
ATOM   3316 N  NZ   . LYS A 1 213 ? -4.583  -27.686 -14.600 1.00 92.23  ? 574 LYS A NZ   1 
ATOM   3317 H  H    . LYS A 1 213 ? -1.593  -29.836 -18.016 1.00 43.54  ? 574 LYS A H    1 
ATOM   3318 H  HA   . LYS A 1 213 ? -3.840  -31.096 -17.370 1.00 48.77  ? 574 LYS A HA   1 
ATOM   3319 H  HB2  . LYS A 1 213 ? -3.335  -29.505 -19.653 1.00 53.69  ? 574 LYS A HB2  1 
ATOM   3320 H  HB3  . LYS A 1 213 ? -4.776  -30.008 -19.219 1.00 53.69  ? 574 LYS A HB3  1 
ATOM   3321 H  HG2  . LYS A 1 213 ? -3.234  -28.146 -17.767 1.00 56.40  ? 574 LYS A HG2  1 
ATOM   3322 H  HG3  . LYS A 1 213 ? -4.522  -27.783 -18.626 1.00 56.40  ? 574 LYS A HG3  1 
ATOM   3323 H  HD2  . LYS A 1 213 ? -5.874  -28.951 -17.142 1.00 71.90  ? 574 LYS A HD2  1 
ATOM   3324 H  HD3  . LYS A 1 213 ? -4.597  -29.411 -16.311 1.00 71.90  ? 574 LYS A HD3  1 
ATOM   3325 H  HE2  . LYS A 1 213 ? -4.582  -26.740 -16.383 1.00 84.14  ? 574 LYS A HE2  1 
ATOM   3326 H  HE3  . LYS A 1 213 ? -6.032  -27.198 -15.917 1.00 84.14  ? 574 LYS A HE3  1 
ATOM   3327 H  HZ1  . LYS A 1 213 ? -5.046  -28.337 -14.207 1.00 110.67 ? 574 LYS A HZ1  1 
ATOM   3328 H  HZ2  . LYS A 1 213 ? -3.725  -27.920 -14.631 1.00 110.67 ? 574 LYS A HZ2  1 
ATOM   3329 H  HZ3  . LYS A 1 213 ? -4.663  -26.943 -14.117 1.00 110.67 ? 574 LYS A HZ3  1 
ATOM   3330 N  N    . ILE A 1 214 ? -4.275  -32.723 -19.319 1.00 45.78  ? 575 ILE A N    1 
ATOM   3331 C  CA   . ILE A 1 214 ? -4.321  -33.857 -20.236 1.00 48.70  ? 575 ILE A CA   1 
ATOM   3332 C  C    . ILE A 1 214 ? -4.450  -33.380 -21.682 1.00 54.98  ? 575 ILE A C    1 
ATOM   3333 O  O    . ILE A 1 214 ? -5.235  -32.474 -21.980 1.00 44.57  ? 575 ILE A O    1 
ATOM   3334 C  CB   . ILE A 1 214 ? -5.506  -34.792 -19.908 1.00 51.24  ? 575 ILE A CB   1 
ATOM   3335 C  CG1  . ILE A 1 214 ? -5.376  -35.354 -18.490 1.00 65.52  ? 575 ILE A CG1  1 
ATOM   3336 C  CG2  . ILE A 1 214 ? -5.592  -35.939 -20.911 1.00 57.27  ? 575 ILE A CG2  1 
ATOM   3337 C  CD1  . ILE A 1 214 ? -6.688  -35.874 -17.924 1.00 60.73  ? 575 ILE A CD1  1 
ATOM   3338 H  H    . ILE A 1 214 ? -5.045  -32.493 -19.014 1.00 54.93  ? 575 ILE A H    1 
ATOM   3339 H  HA   . ILE A 1 214 ? -3.499  -34.366 -20.156 1.00 58.44  ? 575 ILE A HA   1 
ATOM   3340 H  HB   . ILE A 1 214 ? -6.326  -34.277 -19.960 1.00 61.49  ? 575 ILE A HB   1 
ATOM   3341 H  HG12 . ILE A 1 214 ? -4.744  -36.089 -18.500 1.00 78.62  ? 575 ILE A HG12 1 
ATOM   3342 H  HG13 . ILE A 1 214 ? -5.056  -34.651 -17.902 1.00 78.62  ? 575 ILE A HG13 1 
ATOM   3343 H  HG21 . ILE A 1 214 ? -6.343  -36.506 -20.678 1.00 68.72  ? 575 ILE A HG21 1 
ATOM   3344 H  HG22 . ILE A 1 214 ? -5.717  -35.571 -21.800 1.00 68.72  ? 575 ILE A HG22 1 
ATOM   3345 H  HG23 . ILE A 1 214 ? -4.768  -36.450 -20.877 1.00 68.72  ? 575 ILE A HG23 1 
ATOM   3346 H  HD11 . ILE A 1 214 ? -6.533  -36.212 -17.028 1.00 72.88  ? 575 ILE A HD11 1 
ATOM   3347 H  HD12 . ILE A 1 214 ? -7.330  -35.147 -17.897 1.00 72.88  ? 575 ILE A HD12 1 
ATOM   3348 H  HD13 . ILE A 1 214 ? -7.018  -36.585 -18.495 1.00 72.88  ? 575 ILE A HD13 1 
ATOM   3349 N  N    . ARG A 1 215 ? -3.662  -33.986 -22.567 1.00 49.60  ? 576 ARG A N    1 
ATOM   3350 C  CA   . ARG A 1 215 ? -3.856  -33.845 -24.003 1.00 44.32  ? 576 ARG A CA   1 
ATOM   3351 C  C    . ARG A 1 215 ? -4.472  -35.127 -24.519 1.00 54.67  ? 576 ARG A C    1 
ATOM   3352 O  O    . ARG A 1 215 ? -4.192  -36.204 -23.998 1.00 52.75  ? 576 ARG A O    1 
ATOM   3353 C  CB   . ARG A 1 215 ? -2.542  -33.556 -24.724 1.00 37.90  ? 576 ARG A CB   1 
ATOM   3354 C  CG   . ARG A 1 215 ? -1.984  -32.174 -24.470 1.00 34.25  ? 576 ARG A CG   1 
ATOM   3355 C  CD   . ARG A 1 215 ? -2.881  -31.086 -25.028 1.00 44.18  ? 576 ARG A CD   1 
ATOM   3356 N  NE   . ARG A 1 215 ? -2.526  -29.784 -24.471 1.00 71.61  ? 576 ARG A NE   1 
ATOM   3357 C  CZ   . ARG A 1 215 ? -3.297  -29.053 -23.670 1.00 35.11  ? 576 ARG A CZ   1 
ATOM   3358 N  NH1  . ARG A 1 215 ? -4.513  -29.463 -23.312 1.00 47.55  ? 576 ARG A NH1  1 
ATOM   3359 N  NH2  . ARG A 1 215 ? -2.852  -27.887 -23.228 1.00 82.17  ? 576 ARG A NH2  1 
ATOM   3360 H  H    . ARG A 1 215 ? -2.999  -34.490 -22.354 1.00 59.52  ? 576 ARG A H    1 
ATOM   3361 H  HA   . ARG A 1 215 ? -4.470  -33.116 -24.177 1.00 53.18  ? 576 ARG A HA   1 
ATOM   3362 H  HB2  . ARG A 1 215 ? -1.878  -34.200 -24.432 1.00 45.48  ? 576 ARG A HB2  1 
ATOM   3363 H  HB3  . ARG A 1 215 ? -2.685  -33.644 -25.679 1.00 45.48  ? 576 ARG A HB3  1 
ATOM   3364 H  HG2  . ARG A 1 215 ? -1.901  -32.036 -23.513 1.00 41.10  ? 576 ARG A HG2  1 
ATOM   3365 H  HG3  . ARG A 1 215 ? -1.116  -32.098 -24.895 1.00 41.10  ? 576 ARG A HG3  1 
ATOM   3366 H  HD2  . ARG A 1 215 ? -2.778  -31.045 -25.991 1.00 53.02  ? 576 ARG A HD2  1 
ATOM   3367 H  HD3  . ARG A 1 215 ? -3.803  -31.277 -24.795 1.00 53.02  ? 576 ARG A HD3  1 
ATOM   3368 H  HE   . ARG A 1 215 ? -1.756  -29.463 -24.678 1.00 85.93  ? 576 ARG A HE   1 
ATOM   3369 H  HH11 . ARG A 1 215 ? -4.811  -30.219 -23.593 1.00 57.06  ? 576 ARG A HH11 1 
ATOM   3370 H  HH12 . ARG A 1 215 ? -4.996  -28.974 -22.796 1.00 57.06  ? 576 ARG A HH12 1 
ATOM   3371 H  HH21 . ARG A 1 215 ? -2.070  -27.611 -23.456 1.00 98.60  ? 576 ARG A HH21 1 
ATOM   3372 H  HH22 . ARG A 1 215 ? -3.345  -27.405 -22.714 1.00 98.60  ? 576 ARG A HH22 1 
ATOM   3373 N  N    . TYR A 1 216 ? -5.303  -35.009 -25.549 1.00 45.93  ? 577 TYR A N    1 
ATOM   3374 C  CA   . TYR A 1 216 ? -6.116  -36.131 -25.992 1.00 58.28  ? 577 TYR A CA   1 
ATOM   3375 C  C    . TYR A 1 216 ? -5.711  -36.639 -27.365 1.00 61.36  ? 577 TYR A C    1 
ATOM   3376 O  O    . TYR A 1 216 ? -5.544  -35.865 -28.309 1.00 46.43  ? 577 TYR A O    1 
ATOM   3377 C  CB   . TYR A 1 216 ? -7.592  -35.730 -25.976 1.00 53.29  ? 577 TYR A CB   1 
ATOM   3378 C  CG   . TYR A 1 216 ? -8.106  -35.533 -24.565 1.00 69.07  ? 577 TYR A CG   1 
ATOM   3379 C  CD1  . TYR A 1 216 ? -8.586  -36.606 -23.823 1.00 58.98  ? 577 TYR A CD1  1 
ATOM   3380 C  CD2  . TYR A 1 216 ? -8.080  -34.280 -23.962 1.00 58.45  ? 577 TYR A CD2  1 
ATOM   3381 C  CE1  . TYR A 1 216 ? -9.045  -36.434 -22.529 1.00 66.98  ? 577 TYR A CE1  1 
ATOM   3382 C  CE2  . TYR A 1 216 ? -8.540  -34.097 -22.668 1.00 60.40  ? 577 TYR A CE2  1 
ATOM   3383 C  CZ   . TYR A 1 216 ? -9.019  -35.177 -21.957 1.00 56.70  ? 577 TYR A CZ   1 
ATOM   3384 O  OH   . TYR A 1 216 ? -9.473  -35.000 -20.669 1.00 69.66  ? 577 TYR A OH   1 
ATOM   3385 H  H    . TYR A 1 216 ? -5.413  -34.289 -26.007 1.00 55.12  ? 577 TYR A H    1 
ATOM   3386 H  HA   . TYR A 1 216 ? -6.003  -36.861 -25.364 1.00 69.94  ? 577 TYR A HA   1 
ATOM   3387 H  HB2  . TYR A 1 216 ? -7.702  -34.896 -26.459 1.00 63.94  ? 577 TYR A HB2  1 
ATOM   3388 H  HB3  . TYR A 1 216 ? -8.117  -36.431 -26.395 1.00 63.94  ? 577 TYR A HB3  1 
ATOM   3389 H  HD1  . TYR A 1 216 ? -8.606  -37.453 -24.206 1.00 70.78  ? 577 TYR A HD1  1 
ATOM   3390 H  HD2  . TYR A 1 216 ? -7.759  -33.549 -24.440 1.00 70.14  ? 577 TYR A HD2  1 
ATOM   3391 H  HE1  . TYR A 1 216 ? -9.369  -37.161 -22.048 1.00 80.38  ? 577 TYR A HE1  1 
ATOM   3392 H  HE2  . TYR A 1 216 ? -8.522  -33.252 -22.281 1.00 72.49  ? 577 TYR A HE2  1 
ATOM   3393 H  HH   . TYR A 1 216 ? -9.401  -34.193 -20.448 1.00 83.59  ? 577 TYR A HH   1 
ATOM   3394 N  N    . LYS A 1 217 ? -5.535  -37.957 -27.432 1.00 52.61  ? 578 LYS A N    1 
ATOM   3395 C  CA   . LYS A 1 217 ? -5.286  -38.688 -28.672 1.00 56.65  ? 578 LYS A CA   1 
ATOM   3396 C  C    . LYS A 1 217 ? -4.245  -38.014 -29.553 1.00 65.53  ? 578 LYS A C    1 
ATOM   3397 O  O    . LYS A 1 217 ? -4.542  -37.573 -30.662 1.00 61.09  ? 578 LYS A O    1 
ATOM   3398 C  CB   . LYS A 1 217 ? -6.598  -38.877 -29.438 1.00 72.29  ? 578 LYS A CB   1 
ATOM   3399 C  CG   . LYS A 1 217 ? -7.578  -39.836 -28.750 1.00 81.83  ? 578 LYS A CG   1 
ATOM   3400 C  CD   . LYS A 1 217 ? -6.994  -41.246 -28.605 1.00 106.47 ? 578 LYS A CD   1 
ATOM   3401 C  CE   . LYS A 1 217 ? -7.914  -42.183 -27.833 1.00 121.44 ? 578 LYS A CE   1 
ATOM   3402 N  NZ   . LYS A 1 217 ? -7.226  -43.459 -27.470 1.00 119.06 ? 578 LYS A NZ   1 
ATOM   3403 H  H    . LYS A 1 217 ? -5.557  -38.469 -26.742 1.00 63.13  ? 578 LYS A H    1 
ATOM   3404 H  HA   . LYS A 1 217 ? -4.950  -39.569 -28.446 1.00 67.99  ? 578 LYS A HA   1 
ATOM   3405 H  HB2  . LYS A 1 217 ? -7.037  -38.016 -29.526 1.00 86.75  ? 578 LYS A HB2  1 
ATOM   3406 H  HB3  . LYS A 1 217 ? -6.399  -39.236 -30.317 1.00 86.75  ? 578 LYS A HB3  1 
ATOM   3407 H  HG2  . LYS A 1 217 ? -7.782  -39.500 -27.863 1.00 98.19  ? 578 LYS A HG2  1 
ATOM   3408 H  HG3  . LYS A 1 217 ? -8.389  -39.897 -29.278 1.00 98.19  ? 578 LYS A HG3  1 
ATOM   3409 H  HD2  . LYS A 1 217 ? -6.853  -41.622 -29.488 1.00 127.76 ? 578 LYS A HD2  1 
ATOM   3410 H  HD3  . LYS A 1 217 ? -6.151  -41.192 -28.128 1.00 127.76 ? 578 LYS A HD3  1 
ATOM   3411 H  HE2  . LYS A 1 217 ? -8.198  -41.748 -27.014 1.00 145.73 ? 578 LYS A HE2  1 
ATOM   3412 H  HE3  . LYS A 1 217 ? -8.684  -42.399 -28.382 1.00 145.73 ? 578 LYS A HE3  1 
ATOM   3413 H  HZ1  . LYS A 1 217 ? -6.516  -43.288 -26.961 1.00 142.87 ? 578 LYS A HZ1  1 
ATOM   3414 H  HZ2  . LYS A 1 217 ? -7.783  -43.988 -27.021 1.00 142.87 ? 578 LYS A HZ2  1 
ATOM   3415 H  HZ3  . LYS A 1 217 ? -6.958  -43.881 -28.208 1.00 142.87 ? 578 LYS A HZ3  1 
ATOM   3416 N  N    . THR A 1 218 ? -3.022  -37.942 -29.037 1.00 54.26  ? 579 THR A N    1 
ATOM   3417 C  CA   . THR A 1 218 ? -1.899  -37.400 -29.782 1.00 52.70  ? 579 THR A CA   1 
ATOM   3418 C  C    . THR A 1 218 ? -0.575  -37.934 -29.238 1.00 50.80  ? 579 THR A C    1 
ATOM   3419 O  O    . THR A 1 218 ? -0.408  -38.089 -28.032 1.00 53.13  ? 579 THR A O    1 
ATOM   3420 C  CB   . THR A 1 218 ? -1.877  -35.868 -29.725 1.00 50.75  ? 579 THR A CB   1 
ATOM   3421 O  OG1  . THR A 1 218 ? -0.711  -35.380 -30.405 1.00 52.73  ? 579 THR A OG1  1 
ATOM   3422 C  CG2  . THR A 1 218 ? -1.853  -35.391 -28.283 1.00 49.21  ? 579 THR A CG2  1 
ATOM   3423 H  H    . THR A 1 218 ? -2.818  -38.206 -28.245 1.00 65.11  ? 579 THR A H    1 
ATOM   3424 H  HA   . THR A 1 218 ? -1.974  -37.668 -30.711 1.00 63.24  ? 579 THR A HA   1 
ATOM   3425 H  HB   . THR A 1 218 ? -2.673  -35.517 -30.153 1.00 60.90  ? 579 THR A HB   1 
ATOM   3426 H  HG1  . THR A 1 218 ? -0.693  -34.541 -30.377 1.00 63.28  ? 579 THR A HG1  1 
ATOM   3427 H  HG21 . THR A 1 218 ? -1.840  -34.421 -28.255 1.00 59.05  ? 579 THR A HG21 1 
ATOM   3428 H  HG22 . THR A 1 218 ? -2.642  -35.709 -27.816 1.00 59.05  ? 579 THR A HG22 1 
ATOM   3429 H  HG23 . THR A 1 218 ? -1.063  -35.730 -27.835 1.00 59.05  ? 579 THR A HG23 1 
ATOM   3430 N  N    . ASN A 1 219 ? 0.361   -38.220 -30.133 1.00 51.67  ? 580 ASN A N    1 
ATOM   3431 C  CA   . ASN A 1 219 ? 1.718   -38.569 -29.728 1.00 63.66  ? 580 ASN A CA   1 
ATOM   3432 C  C    . ASN A 1 219 ? 2.622   -37.343 -29.818 1.00 48.36  ? 580 ASN A C    1 
ATOM   3433 O  O    . ASN A 1 219 ? 3.843   -37.447 -29.696 1.00 51.11  ? 580 ASN A O    1 
ATOM   3434 C  CB   . ASN A 1 219 ? 2.268   -39.708 -30.591 1.00 63.90  ? 580 ASN A CB   1 
ATOM   3435 C  CG   . ASN A 1 219 ? 2.197   -39.406 -32.071 1.00 78.86  ? 580 ASN A CG   1 
ATOM   3436 O  OD1  . ASN A 1 219 ? 2.860   -38.492 -32.564 1.00 61.88  ? 580 ASN A OD1  1 
ATOM   3437 N  ND2  . ASN A 1 219 ? 1.400   -40.184 -32.794 1.00 113.45 ? 580 ASN A ND2  1 
ATOM   3438 H  H    . ASN A 1 219 ? 0.237   -38.219 -30.984 1.00 62.01  ? 580 ASN A H    1 
ATOM   3439 H  HA   . ASN A 1 219 ? 1.706   -38.868 -28.806 1.00 76.39  ? 580 ASN A HA   1 
ATOM   3440 H  HB2  . ASN A 1 219 ? 3.198   -39.859 -30.359 1.00 76.68  ? 580 ASN A HB2  1 
ATOM   3441 H  HB3  . ASN A 1 219 ? 1.750   -40.511 -30.423 1.00 76.68  ? 580 ASN A HB3  1 
ATOM   3442 H  HD21 . ASN A 1 219 ? 1.325   -40.054 -33.641 1.00 136.14 ? 580 ASN A HD21 1 
ATOM   3443 H  HD22 . ASN A 1 219 ? 0.960   -40.819 -32.416 1.00 136.14 ? 580 ASN A HD22 1 
ATOM   3444 N  N    . GLU A 1 220 ? 1.999   -36.183 -30.015 1.00 51.03  ? 581 GLU A N    1 
ATOM   3445 C  CA   . GLU A 1 220 ? 2.712   -34.919 -30.163 1.00 48.76  ? 581 GLU A CA   1 
ATOM   3446 C  C    . GLU A 1 220 ? 2.052   -33.840 -29.294 1.00 50.15  ? 581 GLU A C    1 
ATOM   3447 O  O    . GLU A 1 220 ? 1.646   -32.788 -29.787 1.00 43.12  ? 581 GLU A O    1 
ATOM   3448 C  CB   . GLU A 1 220 ? 2.726   -34.504 -31.637 1.00 60.57  ? 581 GLU A CB   1 
ATOM   3449 C  CG   . GLU A 1 220 ? 3.859   -33.574 -32.015 1.00 97.32  ? 581 GLU A CG   1 
ATOM   3450 C  CD   . GLU A 1 220 ? 3.690   -32.976 -33.400 1.00 104.72 ? 581 GLU A CD   1 
ATOM   3451 O  OE1  . GLU A 1 220 ? 2.546   -32.627 -33.766 1.00 95.79  ? 581 GLU A OE1  1 
ATOM   3452 O  OE2  . GLU A 1 220 ? 4.701   -32.855 -34.121 1.00 114.16 ? 581 GLU A OE2  1 
ATOM   3453 H  H    . GLU A 1 220 ? 1.145   -36.103 -30.066 1.00 61.23  ? 581 GLU A H    1 
ATOM   3454 H  HA   . GLU A 1 220 ? 3.629   -35.030 -29.869 1.00 58.51  ? 581 GLU A HA   1 
ATOM   3455 H  HB2  . GLU A 1 220 ? 2.805   -35.301 -32.184 1.00 72.68  ? 581 GLU A HB2  1 
ATOM   3456 H  HB3  . GLU A 1 220 ? 1.893   -34.050 -31.840 1.00 72.68  ? 581 GLU A HB3  1 
ATOM   3457 H  HG2  . GLU A 1 220 ? 3.896   -32.845 -31.376 1.00 116.79 ? 581 GLU A HG2  1 
ATOM   3458 H  HG3  . GLU A 1 220 ? 4.693   -34.070 -32.002 1.00 116.79 ? 581 GLU A HG3  1 
ATOM   3459 N  N    . PRO A 1 221 ? 1.943   -34.101 -27.985 1.00 38.77  ? 582 PRO A N    1 
ATOM   3460 C  CA   . PRO A 1 221 ? 1.233   -33.174 -27.098 1.00 36.93  ? 582 PRO A CA   1 
ATOM   3461 C  C    . PRO A 1 221 ? 1.937   -31.833 -26.925 1.00 35.37  ? 582 PRO A C    1 
ATOM   3462 O  O    . PRO A 1 221 ? 3.165   -31.774 -26.888 1.00 36.33  ? 582 PRO A O    1 
ATOM   3463 C  CB   . PRO A 1 221 ? 1.189   -33.933 -25.768 1.00 41.11  ? 582 PRO A CB   1 
ATOM   3464 C  CG   . PRO A 1 221 ? 2.389   -34.816 -25.810 1.00 47.41  ? 582 PRO A CG   1 
ATOM   3465 C  CD   . PRO A 1 221 ? 2.500   -35.248 -27.247 1.00 49.27  ? 582 PRO A CD   1 
ATOM   3466 H  HA   . PRO A 1 221 ? 0.329   -33.026 -27.416 1.00 44.32  ? 582 PRO A HA   1 
ATOM   3467 H  HB2  . PRO A 1 221 ? 1.247   -33.307 -25.029 1.00 49.34  ? 582 PRO A HB2  1 
ATOM   3468 H  HB3  . PRO A 1 221 ? 0.375   -34.457 -25.714 1.00 49.34  ? 582 PRO A HB3  1 
ATOM   3469 H  HG2  . PRO A 1 221 ? 3.174   -34.316 -25.540 1.00 56.89  ? 582 PRO A HG2  1 
ATOM   3470 H  HG3  . PRO A 1 221 ? 2.252   -35.582 -25.231 1.00 56.89  ? 582 PRO A HG3  1 
ATOM   3471 H  HD2  . PRO A 1 221 ? 3.429   -35.388 -27.488 1.00 59.13  ? 582 PRO A HD2  1 
ATOM   3472 H  HD3  . PRO A 1 221 ? 1.967   -36.043 -27.404 1.00 59.13  ? 582 PRO A HD3  1 
ATOM   3473 N  N    . VAL A 1 222 ? 1.138   -30.774 -26.823 1.00 33.64  ? 583 VAL A N    1 
ATOM   3474 C  CA   . VAL A 1 222 ? 1.614   -29.434 -26.500 1.00 38.36  ? 583 VAL A CA   1 
ATOM   3475 C  C    . VAL A 1 222 ? 0.959   -28.964 -25.199 1.00 33.68  ? 583 VAL A C    1 
ATOM   3476 O  O    . VAL A 1 222 ? -0.265  -28.965 -25.102 1.00 31.66  ? 583 VAL A O    1 
ATOM   3477 C  CB   . VAL A 1 222 ? 1.279   -28.438 -27.614 1.00 33.01  ? 583 VAL A CB   1 
ATOM   3478 C  CG1  . VAL A 1 222 ? 1.775   -27.044 -27.257 1.00 44.20  ? 583 VAL A CG1  1 
ATOM   3479 C  CG2  . VAL A 1 222 ? 1.867   -28.909 -28.953 1.00 47.35  ? 583 VAL A CG2  1 
ATOM   3480 H  H    . VAL A 1 222 ? 0.287   -30.811 -26.941 1.00 40.37  ? 583 VAL A H    1 
ATOM   3481 H  HA   . VAL A 1 222 ? 2.576   -29.449 -26.376 1.00 46.03  ? 583 VAL A HA   1 
ATOM   3482 H  HB   . VAL A 1 222 ? 0.315   -28.393 -27.714 1.00 39.61  ? 583 VAL A HB   1 
ATOM   3483 H  HG11 . VAL A 1 222 ? 1.550   -26.435 -27.977 1.00 53.05  ? 583 VAL A HG11 1 
ATOM   3484 H  HG12 . VAL A 1 222 ? 1.345   -26.758 -26.435 1.00 53.05  ? 583 VAL A HG12 1 
ATOM   3485 H  HG13 . VAL A 1 222 ? 2.736   -27.073 -27.135 1.00 53.05  ? 583 VAL A HG13 1 
ATOM   3486 H  HG21 . VAL A 1 222 ? 1.642   -28.263 -29.641 1.00 56.82  ? 583 VAL A HG21 1 
ATOM   3487 H  HG22 . VAL A 1 222 ? 2.831   -28.978 -28.868 1.00 56.82  ? 583 VAL A HG22 1 
ATOM   3488 H  HG23 . VAL A 1 222 ? 1.491   -29.774 -29.176 1.00 56.82  ? 583 VAL A HG23 1 
ATOM   3489 N  N    . TRP A 1 223 ? 1.755   -28.552 -24.215 1.00 34.36  ? 584 TRP A N    1 
ATOM   3490 C  CA   . TRP A 1 223 ? 1.197   -28.105 -22.931 1.00 36.62  ? 584 TRP A CA   1 
ATOM   3491 C  C    . TRP A 1 223 ? 1.426   -26.618 -22.679 1.00 28.85  ? 584 TRP A C    1 
ATOM   3492 O  O    . TRP A 1 223 ? 0.512   -25.918 -22.252 1.00 34.83  ? 584 TRP A O    1 
ATOM   3493 C  CB   . TRP A 1 223 ? 1.790   -28.908 -21.771 1.00 42.12  ? 584 TRP A CB   1 
ATOM   3494 C  CG   . TRP A 1 223 ? 1.410   -30.349 -21.770 1.00 32.06  ? 584 TRP A CG   1 
ATOM   3495 C  CD1  . TRP A 1 223 ? 0.218   -30.879 -21.394 1.00 31.91  ? 584 TRP A CD1  1 
ATOM   3496 C  CD2  . TRP A 1 223 ? 2.237   -31.450 -22.155 1.00 33.22  ? 584 TRP A CD2  1 
ATOM   3497 N  NE1  . TRP A 1 223 ? 0.243   -32.248 -21.527 1.00 33.18  ? 584 TRP A NE1  1 
ATOM   3498 C  CE2  . TRP A 1 223 ? 1.476   -32.623 -21.994 1.00 32.61  ? 584 TRP A CE2  1 
ATOM   3499 C  CE3  . TRP A 1 223 ? 3.548   -31.559 -22.625 1.00 32.36  ? 584 TRP A CE3  1 
ATOM   3500 C  CZ2  . TRP A 1 223 ? 1.977   -33.887 -22.288 1.00 42.80  ? 584 TRP A CZ2  1 
ATOM   3501 C  CZ3  . TRP A 1 223 ? 4.048   -32.816 -22.911 1.00 49.18  ? 584 TRP A CZ3  1 
ATOM   3502 C  CH2  . TRP A 1 223 ? 3.265   -33.962 -22.741 1.00 40.33  ? 584 TRP A CH2  1 
ATOM   3503 H  H    . TRP A 1 223 ? 2.613   -28.520 -24.259 1.00 41.23  ? 584 TRP A H    1 
ATOM   3504 H  HA   . TRP A 1 223 ? 0.239   -28.260 -22.938 1.00 43.94  ? 584 TRP A HA   1 
ATOM   3505 H  HB2  . TRP A 1 223 ? 2.758   -28.858 -21.820 1.00 50.54  ? 584 TRP A HB2  1 
ATOM   3506 H  HB3  . TRP A 1 223 ? 1.484   -28.521 -20.935 1.00 50.54  ? 584 TRP A HB3  1 
ATOM   3507 H  HD1  . TRP A 1 223 ? -0.513  -30.387 -21.095 1.00 38.29  ? 584 TRP A HD1  1 
ATOM   3508 H  HE1  . TRP A 1 223 ? -0.408  -32.781 -21.347 1.00 39.82  ? 584 TRP A HE1  1 
ATOM   3509 H  HE3  . TRP A 1 223 ? 4.074   -30.802 -22.742 1.00 38.83  ? 584 TRP A HE3  1 
ATOM   3510 H  HZ2  . TRP A 1 223 ? 1.461   -34.652 -22.172 1.00 51.36  ? 584 TRP A HZ2  1 
ATOM   3511 H  HZ3  . TRP A 1 223 ? 4.919   -32.900 -23.226 1.00 59.02  ? 584 TRP A HZ3  1 
ATOM   3512 H  HH2  . TRP A 1 223 ? 3.628   -34.794 -22.944 1.00 48.40  ? 584 TRP A HH2  1 
ATOM   3513 N  N    . GLU A 1 224 ? 2.645   -26.149 -22.932 1.00 30.57  ? 585 GLU A N    1 
ATOM   3514 C  CA   . GLU A 1 224 ? 3.020   -24.763 -22.660 1.00 41.39  ? 585 GLU A CA   1 
ATOM   3515 C  C    . GLU A 1 224 ? 2.604   -24.357 -21.242 1.00 41.46  ? 585 GLU A C    1 
ATOM   3516 O  O    . GLU A 1 224 ? 1.871   -23.386 -21.049 1.00 29.20  ? 585 GLU A O    1 
ATOM   3517 C  CB   . GLU A 1 224 ? 2.399   -23.832 -23.711 1.00 36.22  ? 585 GLU A CB   1 
ATOM   3518 C  CG   . GLU A 1 224 ? 2.945   -24.098 -25.140 1.00 37.46  ? 585 GLU A CG   1 
ATOM   3519 C  CD   . GLU A 1 224 ? 2.285   -23.273 -26.236 1.00 49.11  ? 585 GLU A CD   1 
ATOM   3520 O  OE1  . GLU A 1 224 ? 1.284   -22.583 -25.957 1.00 43.73  ? 585 GLU A OE1  1 
ATOM   3521 O  OE2  . GLU A 1 224 ? 2.773   -23.330 -27.389 1.00 48.89  ? 585 GLU A OE2  1 
ATOM   3522 H  H    . GLU A 1 224 ? 3.282   -26.620 -23.267 1.00 36.68  ? 585 GLU A H    1 
ATOM   3523 H  HA   . GLU A 1 224 ? 3.985   -24.680 -22.723 1.00 49.67  ? 585 GLU A HA   1 
ATOM   3524 H  HB2  . GLU A 1 224 ? 1.438   -23.969 -23.726 1.00 43.47  ? 585 GLU A HB2  1 
ATOM   3525 H  HB3  . GLU A 1 224 ? 2.600   -22.912 -23.478 1.00 43.47  ? 585 GLU A HB3  1 
ATOM   3526 H  HG2  . GLU A 1 224 ? 3.894   -23.896 -25.151 1.00 44.95  ? 585 GLU A HG2  1 
ATOM   3527 H  HG3  . GLU A 1 224 ? 2.809   -25.034 -25.354 1.00 44.95  ? 585 GLU A HG3  1 
ATOM   3528 N  N    . GLU A 1 225 ? 3.056   -25.126 -20.254 1.00 32.69  ? 586 GLU A N    1 
ATOM   3529 C  CA   . GLU A 1 225 ? 2.731   -24.850 -18.851 1.00 34.48  ? 586 GLU A CA   1 
ATOM   3530 C  C    . GLU A 1 225 ? 3.986   -24.551 -18.053 1.00 35.05  ? 586 GLU A C    1 
ATOM   3531 O  O    . GLU A 1 225 ? 5.062   -25.027 -18.387 1.00 32.28  ? 586 GLU A O    1 
ATOM   3532 C  CB   . GLU A 1 225 ? 1.987   -26.033 -18.225 1.00 34.31  ? 586 GLU A CB   1 
ATOM   3533 C  CG   . GLU A 1 225 ? 0.508   -26.128 -18.616 1.00 38.64  ? 586 GLU A CG   1 
ATOM   3534 C  CD   . GLU A 1 225 ? -0.159  -27.388 -18.081 1.00 44.87  ? 586 GLU A CD   1 
ATOM   3535 O  OE1  . GLU A 1 225 ? -0.264  -27.534 -16.846 1.00 51.48  ? 586 GLU A OE1  1 
ATOM   3536 O  OE2  . GLU A 1 225 ? -0.574  -28.238 -18.900 1.00 39.24  ? 586 GLU A OE2  1 
ATOM   3537 H  H    . GLU A 1 225 ? 3.554   -25.818 -20.368 1.00 39.22  ? 586 GLU A H    1 
ATOM   3538 H  HA   . GLU A 1 225 ? 2.153   -24.073 -18.806 1.00 41.37  ? 586 GLU A HA   1 
ATOM   3539 H  HB2  . GLU A 1 225 ? 2.418   -26.855 -18.505 1.00 41.17  ? 586 GLU A HB2  1 
ATOM   3540 H  HB3  . GLU A 1 225 ? 2.032   -25.952 -17.260 1.00 41.17  ? 586 GLU A HB3  1 
ATOM   3541 H  HG2  . GLU A 1 225 ? 0.035   -25.361 -18.254 1.00 46.37  ? 586 GLU A HG2  1 
ATOM   3542 H  HG3  . GLU A 1 225 ? 0.436   -26.137 -19.583 1.00 46.37  ? 586 GLU A HG3  1 
ATOM   3543 N  N    . ASN A 1 226 ? 3.839   -23.763 -16.993 1.00 35.14  ? 587 ASN A N    1 
ATOM   3544 C  CA   . ASN A 1 226 ? 4.961   -23.410 -16.143 1.00 46.41  ? 587 ASN A CA   1 
ATOM   3545 C  C    . ASN A 1 226 ? 4.719   -23.912 -14.720 1.00 29.53  ? 587 ASN A C    1 
ATOM   3546 O  O    . ASN A 1 226 ? 3.583   -23.948 -14.264 1.00 32.19  ? 587 ASN A O    1 
ATOM   3547 C  CB   . ASN A 1 226 ? 5.178   -21.899 -16.162 1.00 33.05  ? 587 ASN A CB   1 
ATOM   3548 C  CG   . ASN A 1 226 ? 6.625   -21.524 -15.996 1.00 42.94  ? 587 ASN A CG   1 
ATOM   3549 O  OD1  . ASN A 1 226 ? 7.384   -21.505 -16.964 1.00 35.80  ? 587 ASN A OD1  1 
ATOM   3550 N  ND2  . ASN A 1 226 ? 7.024   -21.225 -14.764 1.00 41.32  ? 587 ASN A ND2  1 
ATOM   3551 H  H    . ASN A 1 226 ? 3.091   -23.418 -16.746 1.00 42.17  ? 587 ASN A H    1 
ATOM   3552 H  HA   . ASN A 1 226 ? 5.764   -23.836 -16.481 1.00 55.70  ? 587 ASN A HA   1 
ATOM   3553 H  HB2  . ASN A 1 226 ? 4.871   -21.546 -17.012 1.00 39.66  ? 587 ASN A HB2  1 
ATOM   3554 H  HB3  . ASN A 1 226 ? 4.677   -21.498 -15.435 1.00 39.66  ? 587 ASN A HB3  1 
ATOM   3555 H  HD21 . ASN A 1 226 ? 7.843   -21.005 -14.619 1.00 49.58  ? 587 ASN A HD21 1 
ATOM   3556 H  HD22 . ASN A 1 226 ? 6.464   -21.252 -14.112 1.00 49.58  ? 587 ASN A HD22 1 
ATOM   3557 N  N    . PHE A 1 227 ? 5.789   -24.315 -14.039 1.00 37.81  ? 588 PHE A N    1 
ATOM   3558 C  CA   . PHE A 1 227 ? 5.685   -24.864 -12.687 1.00 38.08  ? 588 PHE A CA   1 
ATOM   3559 C  C    . PHE A 1 227 ? 6.800   -24.351 -11.795 1.00 49.83  ? 588 PHE A C    1 
ATOM   3560 O  O    . PHE A 1 227 ? 7.908   -24.076 -12.260 1.00 34.55  ? 588 PHE A O    1 
ATOM   3561 C  CB   . PHE A 1 227 ? 5.730   -26.393 -12.722 1.00 34.45  ? 588 PHE A CB   1 
ATOM   3562 C  CG   . PHE A 1 227 ? 4.722   -27.002 -13.638 1.00 43.35  ? 588 PHE A CG   1 
ATOM   3563 C  CD1  . PHE A 1 227 ? 5.010   -27.171 -14.982 1.00 38.17  ? 588 PHE A CD1  1 
ATOM   3564 C  CD2  . PHE A 1 227 ? 3.480   -27.395 -13.164 1.00 42.00  ? 588 PHE A CD2  1 
ATOM   3565 C  CE1  . PHE A 1 227 ? 4.081   -27.724 -15.834 1.00 45.25  ? 588 PHE A CE1  1 
ATOM   3566 C  CE2  . PHE A 1 227 ? 2.545   -27.953 -14.015 1.00 51.79  ? 588 PHE A CE2  1 
ATOM   3567 C  CZ   . PHE A 1 227 ? 2.845   -28.115 -15.353 1.00 46.40  ? 588 PHE A CZ   1 
ATOM   3568 H  H    . PHE A 1 227 ? 6.594   -24.280 -14.339 1.00 45.37  ? 588 PHE A H    1 
ATOM   3569 H  HA   . PHE A 1 227 ? 4.838   -24.595 -12.298 1.00 45.69  ? 588 PHE A HA   1 
ATOM   3570 H  HB2  . PHE A 1 227 ? 6.610   -26.673 -13.020 1.00 41.34  ? 588 PHE A HB2  1 
ATOM   3571 H  HB3  . PHE A 1 227 ? 5.562   -26.732 -11.828 1.00 41.34  ? 588 PHE A HB3  1 
ATOM   3572 H  HD1  . PHE A 1 227 ? 5.839   -26.908 -15.312 1.00 45.80  ? 588 PHE A HD1  1 
ATOM   3573 H  HD2  . PHE A 1 227 ? 3.274   -27.285 -12.263 1.00 50.40  ? 588 PHE A HD2  1 
ATOM   3574 H  HE1  . PHE A 1 227 ? 4.285   -27.835 -16.735 1.00 54.30  ? 588 PHE A HE1  1 
ATOM   3575 H  HE2  . PHE A 1 227 ? 1.714   -28.215 -13.689 1.00 62.15  ? 588 PHE A HE2  1 
ATOM   3576 H  HZ   . PHE A 1 227 ? 2.219   -28.491 -15.928 1.00 55.68  ? 588 PHE A HZ   1 
ATOM   3577 N  N    . THR A 1 228 ? 6.495   -24.244 -10.508 1.00 36.42  ? 589 THR A N    1 
ATOM   3578 C  CA   . THR A 1 228 ? 7.460   -23.825 -9.509  1.00 43.07  ? 589 THR A CA   1 
ATOM   3579 C  C    . THR A 1 228 ? 7.504   -24.856 -8.395  1.00 42.17  ? 589 THR A C    1 
ATOM   3580 O  O    . THR A 1 228 ? 6.463   -25.314 -7.934  1.00 35.64  ? 589 THR A O    1 
ATOM   3581 C  CB   . THR A 1 228 ? 7.114   -22.450 -8.932  1.00 48.94  ? 589 THR A CB   1 
ATOM   3582 O  OG1  . THR A 1 228 ? 7.104   -21.488 -9.991  1.00 43.10  ? 589 THR A OG1  1 
ATOM   3583 C  CG2  . THR A 1 228 ? 8.140   -22.028 -7.890  1.00 54.85  ? 589 THR A CG2  1 
ATOM   3584 H  H    . THR A 1 228 ? 5.717   -24.414 -10.185 1.00 43.70  ? 589 THR A H    1 
ATOM   3585 H  HA   . THR A 1 228 ? 8.340   -23.774 -9.913  1.00 51.69  ? 589 THR A HA   1 
ATOM   3586 H  HB   . THR A 1 228 ? 6.240   -22.482 -8.512  1.00 58.72  ? 589 THR A HB   1 
ATOM   3587 H  HG1  . THR A 1 228 ? 6.915   -20.728 -9.688  1.00 51.73  ? 589 THR A HG1  1 
ATOM   3588 H  HG21 . THR A 1 228 ? 7.910   -21.156 -7.533  1.00 65.82  ? 589 THR A HG21 1 
ATOM   3589 H  HG22 . THR A 1 228 ? 8.159   -22.671 -7.165  1.00 65.82  ? 589 THR A HG22 1 
ATOM   3590 H  HG23 . THR A 1 228 ? 9.021   -21.981 -8.293  1.00 65.82  ? 589 THR A HG23 1 
ATOM   3591 N  N    . PHE A 1 229 ? 8.716   -25.229 -7.994  1.00 41.10  ? 590 PHE A N    1 
ATOM   3592 C  CA   . PHE A 1 229 ? 8.932   -26.169 -6.896  1.00 44.19  ? 590 PHE A CA   1 
ATOM   3593 C  C    . PHE A 1 229 ? 9.894   -25.596 -5.870  1.00 42.79  ? 590 PHE A C    1 
ATOM   3594 O  O    . PHE A 1 229 ? 10.910  -24.989 -6.232  1.00 43.21  ? 590 PHE A O    1 
ATOM   3595 C  CB   . PHE A 1 229 ? 9.518   -27.491 -7.396  1.00 53.40  ? 590 PHE A CB   1 
ATOM   3596 C  CG   . PHE A 1 229 ? 8.578   -28.323 -8.209  1.00 52.44  ? 590 PHE A CG   1 
ATOM   3597 C  CD1  . PHE A 1 229 ? 8.526   -28.183 -9.586  1.00 43.13  ? 590 PHE A CD1  1 
ATOM   3598 C  CD2  . PHE A 1 229 ? 7.782   -29.280 -7.604  1.00 49.32  ? 590 PHE A CD2  1 
ATOM   3599 C  CE1  . PHE A 1 229 ? 7.673   -28.960 -10.343 1.00 42.85  ? 590 PHE A CE1  1 
ATOM   3600 C  CE2  . PHE A 1 229 ? 6.930   -30.064 -8.351  1.00 48.44  ? 590 PHE A CE2  1 
ATOM   3601 C  CZ   . PHE A 1 229 ? 6.875   -29.904 -9.727  1.00 54.70  ? 590 PHE A CZ   1 
ATOM   3602 H  H    . PHE A 1 229 ? 9.445   -24.945 -8.350  1.00 49.32  ? 590 PHE A H    1 
ATOM   3603 H  HA   . PHE A 1 229 ? 8.087   -26.353 -6.456  1.00 53.03  ? 590 PHE A HA   1 
ATOM   3604 H  HB2  . PHE A 1 229 ? 10.292  -27.298 -7.948  1.00 64.08  ? 590 PHE A HB2  1 
ATOM   3605 H  HB3  . PHE A 1 229 ? 9.789   -28.020 -6.629  1.00 64.08  ? 590 PHE A HB3  1 
ATOM   3606 H  HD1  . PHE A 1 229 ? 9.061   -27.548 -10.004 1.00 51.76  ? 590 PHE A HD1  1 
ATOM   3607 H  HD2  . PHE A 1 229 ? 7.816   -29.389 -6.681  1.00 59.18  ? 590 PHE A HD2  1 
ATOM   3608 H  HE1  . PHE A 1 229 ? 7.639   -28.852 -11.266 1.00 51.42  ? 590 PHE A HE1  1 
ATOM   3609 H  HE2  . PHE A 1 229 ? 6.392   -30.697 -7.934  1.00 58.13  ? 590 PHE A HE2  1 
ATOM   3610 H  HZ   . PHE A 1 229 ? 6.300   -30.429 -10.235 1.00 65.64  ? 590 PHE A HZ   1 
ATOM   3611 N  N    . PHE A 1 230 ? 9.582   -25.813 -4.596  1.00 37.78  ? 591 PHE A N    1 
ATOM   3612 C  CA   . PHE A 1 230 ? 10.544  -25.635 -3.512  1.00 39.99  ? 591 PHE A CA   1 
ATOM   3613 C  C    . PHE A 1 230 ? 11.589  -26.747 -3.546  1.00 41.77  ? 591 PHE A C    1 
ATOM   3614 O  O    . PHE A 1 230 ? 11.243  -27.918 -3.701  1.00 61.47  ? 591 PHE A O    1 
ATOM   3615 C  CB   . PHE A 1 230 ? 9.839   -25.643 -2.148  1.00 47.94  ? 591 PHE A CB   1 
ATOM   3616 C  CG   . PHE A 1 230 ? 9.244   -24.325 -1.760  1.00 40.46  ? 591 PHE A CG   1 
ATOM   3617 C  CD1  . PHE A 1 230 ? 10.053  -23.293 -1.307  1.00 44.70  ? 591 PHE A CD1  1 
ATOM   3618 C  CD2  . PHE A 1 230 ? 7.877   -24.118 -1.838  1.00 46.47  ? 591 PHE A CD2  1 
ATOM   3619 C  CE1  . PHE A 1 230 ? 9.510   -22.078 -0.948  1.00 41.63  ? 591 PHE A CE1  1 
ATOM   3620 C  CE2  . PHE A 1 230 ? 7.326   -22.903 -1.479  1.00 44.17  ? 591 PHE A CE2  1 
ATOM   3621 C  CZ   . PHE A 1 230 ? 8.143   -21.881 -1.032  1.00 41.05  ? 591 PHE A CZ   1 
ATOM   3622 H  H    . PHE A 1 230 ? 8.806   -26.069 -4.329  1.00 45.33  ? 591 PHE A H    1 
ATOM   3623 H  HA   . PHE A 1 230 ? 10.997  -24.784 -3.619  1.00 47.98  ? 591 PHE A HA   1 
ATOM   3624 H  HB2  . PHE A 1 230 ? 9.122   -26.295 -2.171  1.00 57.53  ? 591 PHE A HB2  1 
ATOM   3625 H  HB3  . PHE A 1 230 ? 10.484  -25.888 -1.465  1.00 57.53  ? 591 PHE A HB3  1 
ATOM   3626 H  HD1  . PHE A 1 230 ? 10.973  -23.421 -1.250  1.00 53.64  ? 591 PHE A HD1  1 
ATOM   3627 H  HD2  . PHE A 1 230 ? 7.324   -24.803 -2.139  1.00 55.76  ? 591 PHE A HD2  1 
ATOM   3628 H  HE1  . PHE A 1 230 ? 10.062  -21.392 -0.647  1.00 49.95  ? 591 PHE A HE1  1 
ATOM   3629 H  HE2  . PHE A 1 230 ? 6.407   -22.773 -1.537  1.00 53.01  ? 591 PHE A HE2  1 
ATOM   3630 H  HZ   . PHE A 1 230 ? 7.775   -21.062 -0.790  1.00 49.26  ? 591 PHE A HZ   1 
ATOM   3631 N  N    . ILE A 1 231 ? 12.857  -26.378 -3.376  1.00 43.47  ? 592 ILE A N    1 
ATOM   3632 C  CA   . ILE A 1 231 ? 13.959  -27.337 -3.422  1.00 45.69  ? 592 ILE A CA   1 
ATOM   3633 C  C    . ILE A 1 231 ? 14.732  -27.358 -2.105  1.00 52.91  ? 592 ILE A C    1 
ATOM   3634 O  O    . ILE A 1 231 ? 15.236  -26.329 -1.651  1.00 49.52  ? 592 ILE A O    1 
ATOM   3635 C  CB   . ILE A 1 231 ? 14.938  -27.014 -4.571  1.00 45.71  ? 592 ILE A CB   1 
ATOM   3636 C  CG1  . ILE A 1 231 ? 14.203  -26.979 -5.917  1.00 48.13  ? 592 ILE A CG1  1 
ATOM   3637 C  CG2  . ILE A 1 231 ? 16.085  -28.022 -4.620  1.00 48.44  ? 592 ILE A CG2  1 
ATOM   3638 C  CD1  . ILE A 1 231 ? 13.534  -28.279 -6.297  1.00 55.03  ? 592 ILE A CD1  1 
ATOM   3639 H  H    . ILE A 1 231 ? 13.108  -25.569 -3.231  1.00 52.17  ? 592 ILE A H    1 
ATOM   3640 H  HA   . ILE A 1 231 ? 13.600  -28.226 -3.574  1.00 54.83  ? 592 ILE A HA   1 
ATOM   3641 H  HB   . ILE A 1 231 ? 15.314  -26.135 -4.409  1.00 54.85  ? 592 ILE A HB   1 
ATOM   3642 H  HG12 . ILE A 1 231 ? 13.516  -26.294 -5.878  1.00 57.76  ? 592 ILE A HG12 1 
ATOM   3643 H  HG13 . ILE A 1 231 ? 14.841  -26.761 -6.614  1.00 57.76  ? 592 ILE A HG13 1 
ATOM   3644 H  HG21 . ILE A 1 231 ? 16.679  -27.790 -5.351  1.00 58.13  ? 592 ILE A HG21 1 
ATOM   3645 H  HG22 . ILE A 1 231 ? 16.568  -27.992 -3.779  1.00 58.13  ? 592 ILE A HG22 1 
ATOM   3646 H  HG23 . ILE A 1 231 ? 15.720  -28.910 -4.760  1.00 58.13  ? 592 ILE A HG23 1 
ATOM   3647 H  HD11 . ILE A 1 231 ? 13.095  -28.170 -7.156  1.00 66.04  ? 592 ILE A HD11 1 
ATOM   3648 H  HD12 . ILE A 1 231 ? 14.207  -28.975 -6.355  1.00 66.04  ? 592 ILE A HD12 1 
ATOM   3649 H  HD13 . ILE A 1 231 ? 12.879  -28.508 -5.618  1.00 66.04  ? 592 ILE A HD13 1 
ATOM   3650 N  N    . HIS A 1 232 ? 14.836  -28.540 -1.507  1.00 50.74  ? 593 HIS A N    1 
ATOM   3651 C  CA   . HIS A 1 232 ? 15.560  -28.702 -0.254  1.00 54.07  ? 593 HIS A CA   1 
ATOM   3652 C  C    . HIS A 1 232 ? 17.070  -28.590 -0.471  1.00 60.53  ? 593 HIS A C    1 
ATOM   3653 O  O    . HIS A 1 232 ? 17.720  -27.728 0.117   1.00 57.97  ? 593 HIS A O    1 
ATOM   3654 C  CB   . HIS A 1 232 ? 15.207  -30.044 0.391   1.00 62.18  ? 593 HIS A CB   1 
ATOM   3655 C  CG   . HIS A 1 232 ? 13.804  -30.110 0.911   1.00 109.96 ? 593 HIS A CG   1 
ATOM   3656 N  ND1  . HIS A 1 232 ? 13.156  -31.301 1.162   1.00 117.36 ? 593 HIS A ND1  1 
ATOM   3657 C  CD2  . HIS A 1 232 ? 12.925  -29.130 1.229   1.00 119.15 ? 593 HIS A CD2  1 
ATOM   3658 C  CE1  . HIS A 1 232 ? 11.938  -31.051 1.610   1.00 107.84 ? 593 HIS A CE1  1 
ATOM   3659 N  NE2  . HIS A 1 232 ? 11.773  -29.741 1.661   1.00 113.33 ? 593 HIS A NE2  1 
ATOM   3660 H  H    . HIS A 1 232 ? 14.492  -29.268 -1.809  1.00 60.89  ? 593 HIS A H    1 
ATOM   3661 H  HA   . HIS A 1 232 ? 15.294  -27.997 0.358   1.00 64.88  ? 593 HIS A HA   1 
ATOM   3662 H  HB2  . HIS A 1 232 ? 15.312  -30.746 -0.270  1.00 74.61  ? 593 HIS A HB2  1 
ATOM   3663 H  HB3  . HIS A 1 232 ? 15.808  -30.201 1.136   1.00 74.61  ? 593 HIS A HB3  1 
ATOM   3664 H  HD1  . HIS A 1 232 ? 13.491  -32.084 1.044   1.00 140.83 ? 593 HIS A HD1  1 
ATOM   3665 H  HD2  . HIS A 1 232 ? 13.073  -28.214 1.167   1.00 142.97 ? 593 HIS A HD2  1 
ATOM   3666 H  HE1  . HIS A 1 232 ? 11.306  -31.689 1.850   1.00 129.41 ? 593 HIS A HE1  1 
ATOM   3667 H  HE2  . HIS A 1 232 ? 11.060  -29.337 1.922   1.00 135.99 ? 593 HIS A HE2  1 
ATOM   3668 N  N    . ASN A 1 233 ? 17.614  -29.456 -1.326  1.00 59.25  ? 594 ASN A N    1 
ATOM   3669 C  CA   . ASN A 1 233 ? 19.048  -29.479 -1.612  1.00 59.90  ? 594 ASN A CA   1 
ATOM   3670 C  C    . ASN A 1 233 ? 19.331  -29.862 -3.074  1.00 59.35  ? 594 ASN A C    1 
ATOM   3671 O  O    . ASN A 1 233 ? 19.271  -31.040 -3.426  1.00 59.78  ? 594 ASN A O    1 
ATOM   3672 C  CB   . ASN A 1 233 ? 19.758  -30.457 -0.675  1.00 64.13  ? 594 ASN A CB   1 
ATOM   3673 C  CG   . ASN A 1 233 ? 21.262  -30.475 -0.876  1.00 83.03  ? 594 ASN A CG   1 
ATOM   3674 O  OD1  . ASN A 1 233 ? 21.799  -29.780 -1.742  1.00 75.17  ? 594 ASN A OD1  1 
ATOM   3675 N  ND2  . ASN A 1 233 ? 21.955  -31.264 -0.061  1.00 71.73  ? 594 ASN A ND2  1 
ATOM   3676 H  H    . ASN A 1 233 ? 17.166  -30.049 -1.758  1.00 71.11  ? 594 ASN A H    1 
ATOM   3677 H  HA   . ASN A 1 233 ? 19.415  -28.594 -1.457  1.00 71.88  ? 594 ASN A HA   1 
ATOM   3678 H  HB2  . ASN A 1 233 ? 19.581  -30.199 0.243   1.00 76.96  ? 594 ASN A HB2  1 
ATOM   3679 H  HB3  . ASN A 1 233 ? 19.422  -31.352 -0.839  1.00 76.96  ? 594 ASN A HB3  1 
ATOM   3680 H  HD21 . ASN A 1 233 ? 22.811  -31.311 -0.133  1.00 86.08  ? 594 ASN A HD21 1 
ATOM   3681 H  HD22 . ASN A 1 233 ? 21.547  -31.728 0.537   1.00 86.08  ? 594 ASN A HD22 1 
ATOM   3682 N  N    . PRO A 1 234 ? 19.659  -28.868 -3.921  1.00 59.64  ? 595 PRO A N    1 
ATOM   3683 C  CA   . PRO A 1 234 ? 19.896  -29.118 -5.353  1.00 57.53  ? 595 PRO A CA   1 
ATOM   3684 C  C    . PRO A 1 234 ? 21.062  -30.068 -5.625  1.00 64.84  ? 595 PRO A C    1 
ATOM   3685 O  O    . PRO A 1 234 ? 21.115  -30.710 -6.679  1.00 64.85  ? 595 PRO A O    1 
ATOM   3686 C  CB   . PRO A 1 234 ? 20.220  -27.729 -5.914  1.00 70.92  ? 595 PRO A CB   1 
ATOM   3687 C  CG   . PRO A 1 234 ? 19.788  -26.759 -4.892  1.00 71.45  ? 595 PRO A CG   1 
ATOM   3688 C  CD   . PRO A 1 234 ? 19.838  -27.447 -3.576  1.00 57.31  ? 595 PRO A CD   1 
ATOM   3689 H  HA   . PRO A 1 234 ? 19.093  -29.460 -5.776  1.00 69.04  ? 595 PRO A HA   1 
ATOM   3690 H  HB2  . PRO A 1 234 ? 21.175  -27.657 -6.068  1.00 85.10  ? 595 PRO A HB2  1 
ATOM   3691 H  HB3  . PRO A 1 234 ? 19.731  -27.592 -6.740  1.00 85.10  ? 595 PRO A HB3  1 
ATOM   3692 H  HG2  . PRO A 1 234 ? 20.391  -25.999 -4.897  1.00 85.74  ? 595 PRO A HG2  1 
ATOM   3693 H  HG3  . PRO A 1 234 ? 18.882  -26.472 -5.087  1.00 85.74  ? 595 PRO A HG3  1 
ATOM   3694 H  HD2  . PRO A 1 234 ? 20.700  -27.308 -3.154  1.00 68.78  ? 595 PRO A HD2  1 
ATOM   3695 H  HD3  . PRO A 1 234 ? 19.112  -27.144 -3.008  1.00 68.78  ? 595 PRO A HD3  1 
ATOM   3696 N  N    . LYS A 1 235 ? 22.000  -30.145 -4.693  1.00 63.90  ? 596 LYS A N    1 
ATOM   3697 C  CA   . LYS A 1 235 ? 23.164  -30.994 -4.891  1.00 67.90  ? 596 LYS A CA   1 
ATOM   3698 C  C    . LYS A 1 235 ? 22.781  -32.468 -4.824  1.00 71.69  ? 596 LYS A C    1 
ATOM   3699 O  O    . LYS A 1 235 ? 23.529  -33.325 -5.287  1.00 71.89  ? 596 LYS A O    1 
ATOM   3700 C  CB   . LYS A 1 235 ? 24.238  -30.682 -3.852  1.00 71.90  ? 596 LYS A CB   1 
ATOM   3701 C  CG   . LYS A 1 235 ? 24.794  -29.272 -3.944  1.00 71.88  ? 596 LYS A CG   1 
ATOM   3702 C  CD   . LYS A 1 235 ? 25.567  -28.889 -2.689  1.00 84.17  ? 596 LYS A CD   1 
ATOM   3703 C  CE   . LYS A 1 235 ? 26.584  -29.951 -2.291  1.00 86.93  ? 596 LYS A CE   1 
ATOM   3704 N  NZ   . LYS A 1 235 ? 27.340  -29.557 -1.076  1.00 90.64  ? 596 LYS A NZ   1 
ATOM   3705 H  H    . LYS A 1 235 ? 21.987  -29.721 -3.945  1.00 76.67  ? 596 LYS A H    1 
ATOM   3706 H  HA   . LYS A 1 235 ? 23.537  -30.820 -5.769  1.00 81.48  ? 596 LYS A HA   1 
ATOM   3707 H  HB2  . LYS A 1 235 ? 23.857  -30.793 -2.967  1.00 86.28  ? 596 LYS A HB2  1 
ATOM   3708 H  HB3  . LYS A 1 235 ? 24.976  -31.300 -3.971  1.00 86.28  ? 596 LYS A HB3  1 
ATOM   3709 H  HG2  . LYS A 1 235 ? 25.398  -29.216 -4.701  1.00 86.25  ? 596 LYS A HG2  1 
ATOM   3710 H  HG3  . LYS A 1 235 ? 24.062  -28.646 -4.052  1.00 86.25  ? 596 LYS A HG3  1 
ATOM   3711 H  HD2  . LYS A 1 235 ? 26.045  -28.060 -2.850  1.00 101.00 ? 596 LYS A HD2  1 
ATOM   3712 H  HD3  . LYS A 1 235 ? 24.945  -28.777 -1.954  1.00 101.00 ? 596 LYS A HD3  1 
ATOM   3713 H  HE2  . LYS A 1 235 ? 26.122  -30.783 -2.104  1.00 104.32 ? 596 LYS A HE2  1 
ATOM   3714 H  HE3  . LYS A 1 235 ? 27.217  -30.075 -3.016  1.00 104.32 ? 596 LYS A HE3  1 
ATOM   3715 H  HZ1  . LYS A 1 235 ? 27.927  -30.192 -0.864  1.00 108.76 ? 596 LYS A HZ1  1 
ATOM   3716 H  HZ2  . LYS A 1 235 ? 27.778  -28.796 -1.224  1.00 108.76 ? 596 LYS A HZ2  1 
ATOM   3717 H  HZ3  . LYS A 1 235 ? 26.780  -29.441 -0.394  1.00 108.76 ? 596 LYS A HZ3  1 
ATOM   3718 N  N    . ARG A 1 236 ? 21.609  -32.756 -4.259  1.00 66.94  ? 597 ARG A N    1 
ATOM   3719 C  CA   . ARG A 1 236 ? 21.200  -34.137 -4.013  1.00 83.88  ? 597 ARG A CA   1 
ATOM   3720 C  C    . ARG A 1 236 ? 19.977  -34.554 -4.819  1.00 65.21  ? 597 ARG A C    1 
ATOM   3721 O  O    . ARG A 1 236 ? 19.862  -35.708 -5.231  1.00 69.49  ? 597 ARG A O    1 
ATOM   3722 C  CB   . ARG A 1 236 ? 20.905  -34.345 -2.522  1.00 80.17  ? 597 ARG A CB   1 
ATOM   3723 C  CG   . ARG A 1 236 ? 22.135  -34.544 -1.653  1.00 89.40  ? 597 ARG A CG   1 
ATOM   3724 C  CD   . ARG A 1 236 ? 21.758  -35.115 -0.289  1.00 106.68 ? 597 ARG A CD   1 
ATOM   3725 N  NE   . ARG A 1 236 ? 22.918  -35.623 0.444   1.00 118.50 ? 597 ARG A NE   1 
ATOM   3726 C  CZ   . ARG A 1 236 ? 23.366  -36.877 0.381   1.00 123.34 ? 597 ARG A CZ   1 
ATOM   3727 N  NH1  . ARG A 1 236 ? 22.759  -37.777 -0.384  1.00 121.31 ? 597 ARG A NH1  1 
ATOM   3728 N  NH2  . ARG A 1 236 ? 24.429  -37.234 1.088   1.00 123.93 ? 597 ARG A NH2  1 
ATOM   3729 H  H    . ARG A 1 236 ? 21.033  -32.169 -4.010  1.00 80.33  ? 597 ARG A H    1 
ATOM   3730 H  HA   . ARG A 1 236 ? 21.931  -34.726 -4.256  1.00 100.66 ? 597 ARG A HA   1 
ATOM   3731 H  HB2  . ARG A 1 236 ? 20.432  -33.567 -2.189  1.00 96.20  ? 597 ARG A HB2  1 
ATOM   3732 H  HB3  . ARG A 1 236 ? 20.346  -35.132 -2.425  1.00 96.20  ? 597 ARG A HB3  1 
ATOM   3733 H  HG2  . ARG A 1 236 ? 22.739  -35.166 -2.088  1.00 107.28 ? 597 ARG A HG2  1 
ATOM   3734 H  HG3  . ARG A 1 236 ? 22.573  -33.689 -1.516  1.00 107.28 ? 597 ARG A HG3  1 
ATOM   3735 H  HD2  . ARG A 1 236 ? 21.347  -34.417 0.244   1.00 128.02 ? 597 ARG A HD2  1 
ATOM   3736 H  HD3  . ARG A 1 236 ? 21.135  -35.848 -0.414  1.00 128.02 ? 597 ARG A HD3  1 
ATOM   3737 H  HE   . ARG A 1 236 ? 23.341  -35.074 0.952   1.00 142.20 ? 597 ARG A HE   1 
ATOM   3738 H  HH11 . ARG A 1 236 ? 22.069  -37.554 -0.846  1.00 145.57 ? 597 ARG A HH11 1 
ATOM   3739 H  HH12 . ARG A 1 236 ? 23.057  -38.584 -0.417  1.00 145.57 ? 597 ARG A HH12 1 
ATOM   3740 H  HH21 . ARG A 1 236 ? 24.827  -36.657 1.586   1.00 148.72 ? 597 ARG A HH21 1 
ATOM   3741 H  HH22 . ARG A 1 236 ? 24.719  -38.043 1.049   1.00 148.72 ? 597 ARG A HH22 1 
ATOM   3742 N  N    . GLN A 1 237 ? 19.063  -33.620 -5.039  1.00 61.13  ? 598 GLN A N    1 
ATOM   3743 C  CA   . GLN A 1 237 ? 17.739  -33.970 -5.539  1.00 58.23  ? 598 GLN A CA   1 
ATOM   3744 C  C    . GLN A 1 237 ? 17.629  -33.987 -7.062  1.00 77.21  ? 598 GLN A C    1 
ATOM   3745 O  O    . GLN A 1 237 ? 18.314  -33.239 -7.763  1.00 63.30  ? 598 GLN A O    1 
ATOM   3746 C  CB   . GLN A 1 237 ? 16.709  -33.006 -4.962  1.00 55.22  ? 598 GLN A CB   1 
ATOM   3747 C  CG   . GLN A 1 237 ? 16.504  -33.179 -3.468  1.00 57.05  ? 598 GLN A CG   1 
ATOM   3748 C  CD   . GLN A 1 237 ? 15.326  -32.393 -2.960  1.00 55.27  ? 598 GLN A CD   1 
ATOM   3749 O  OE1  . GLN A 1 237 ? 15.389  -31.170 -2.829  1.00 56.94  ? 598 GLN A OE1  1 
ATOM   3750 N  NE2  . GLN A 1 237 ? 14.230  -33.089 -2.683  1.00 81.78  ? 598 GLN A NE2  1 
ATOM   3751 H  H    . GLN A 1 237 ? 19.182  -32.778 -4.909  1.00 73.36  ? 598 GLN A H    1 
ATOM   3752 H  HA   . GLN A 1 237 ? 17.517  -34.859 -5.221  1.00 69.87  ? 598 GLN A HA   1 
ATOM   3753 H  HB2  . GLN A 1 237 ? 17.005  -32.096 -5.120  1.00 66.26  ? 598 GLN A HB2  1 
ATOM   3754 H  HB3  . GLN A 1 237 ? 15.856  -33.157 -5.400  1.00 66.26  ? 598 GLN A HB3  1 
ATOM   3755 H  HG2  . GLN A 1 237 ? 16.347  -34.116 -3.275  1.00 68.46  ? 598 GLN A HG2  1 
ATOM   3756 H  HG3  . GLN A 1 237 ? 17.296  -32.870 -3.002  1.00 68.46  ? 598 GLN A HG3  1 
ATOM   3757 H  HE21 . GLN A 1 237 ? 14.222  -33.941 -2.797  1.00 98.13  ? 598 GLN A HE21 1 
ATOM   3758 H  HE22 . GLN A 1 237 ? 13.528  -32.688 -2.389  1.00 98.13  ? 598 GLN A HE22 1 
ATOM   3759 N  N    . ASP A 1 238 ? 16.747  -34.855 -7.550  1.00 70.89  ? 599 ASP A N    1 
ATOM   3760 C  CA   . ASP A 1 238 ? 16.483  -35.005 -8.973  1.00 59.58  ? 599 ASP A CA   1 
ATOM   3761 C  C    . ASP A 1 238 ? 15.080  -34.541 -9.324  1.00 68.74  ? 599 ASP A C    1 
ATOM   3762 O  O    . ASP A 1 238 ? 14.133  -34.765 -8.568  1.00 56.63  ? 599 ASP A O    1 
ATOM   3763 C  CB   . ASP A 1 238 ? 16.646  -36.467 -9.398  1.00 77.66  ? 599 ASP A CB   1 
ATOM   3764 C  CG   . ASP A 1 238 ? 17.992  -37.042 -9.013  1.00 89.61  ? 599 ASP A CG   1 
ATOM   3765 O  OD1  . ASP A 1 238 ? 18.955  -36.262 -8.856  1.00 87.76  ? 599 ASP A OD1  1 
ATOM   3766 O  OD2  . ASP A 1 238 ? 18.086  -38.279 -8.871  1.00 94.86  ? 599 ASP A OD2  1 
ATOM   3767 H  H    . ASP A 1 238 ? 16.277  -35.383 -7.060  1.00 85.07  ? 599 ASP A H    1 
ATOM   3768 H  HA   . ASP A 1 238 ? 17.117  -34.469 -9.475  1.00 71.49  ? 599 ASP A HA   1 
ATOM   3769 H  HB2  . ASP A 1 238 ? 15.959  -36.999 -8.967  1.00 93.19  ? 599 ASP A HB2  1 
ATOM   3770 H  HB3  . ASP A 1 238 ? 16.558  -36.527 -10.362 1.00 93.19  ? 599 ASP A HB3  1 
ATOM   3771 N  N    . LEU A 1 239 ? 14.948  -33.891 -10.474 1.00 61.69  ? 600 LEU A N    1 
ATOM   3772 C  CA   . LEU A 1 239 ? 13.640  -33.659 -11.058 1.00 65.38  ? 600 LEU A CA   1 
ATOM   3773 C  C    . LEU A 1 239 ? 13.253  -34.916 -11.816 1.00 57.46  ? 600 LEU A C    1 
ATOM   3774 O  O    . LEU A 1 239 ? 13.985  -35.361 -12.701 1.00 55.64  ? 600 LEU A O    1 
ATOM   3775 C  CB   . LEU A 1 239 ? 13.649  -32.442 -11.983 1.00 53.75  ? 600 LEU A CB   1 
ATOM   3776 C  CG   . LEU A 1 239 ? 12.457  -32.331 -12.937 1.00 57.75  ? 600 LEU A CG   1 
ATOM   3777 C  CD1  . LEU A 1 239 ? 11.144  -32.226 -12.164 1.00 54.61  ? 600 LEU A CD1  1 
ATOM   3778 C  CD2  . LEU A 1 239 ? 12.630  -31.150 -13.884 1.00 49.38  ? 600 LEU A CD2  1 
ATOM   3779 H  H    . LEU A 1 239 ? 15.603  -33.576 -10.934 1.00 74.02  ? 600 LEU A H    1 
ATOM   3780 H  HA   . LEU A 1 239 ? 12.990  -33.508 -10.353 1.00 78.46  ? 600 LEU A HA   1 
ATOM   3781 H  HB2  . LEU A 1 239 ? 13.659  -31.641 -11.436 1.00 64.50  ? 600 LEU A HB2  1 
ATOM   3782 H  HB3  . LEU A 1 239 ? 14.453  -32.475 -12.524 1.00 64.50  ? 600 LEU A HB3  1 
ATOM   3783 H  HG   . LEU A 1 239 ? 12.416  -33.136 -13.477 1.00 69.30  ? 600 LEU A HG   1 
ATOM   3784 H  HD11 . LEU A 1 239 ? 10.411  -32.157 -12.796 1.00 65.54  ? 600 LEU A HD11 1 
ATOM   3785 H  HD12 . LEU A 1 239 ? 11.036  -33.019 -11.617 1.00 65.54  ? 600 LEU A HD12 1 
ATOM   3786 H  HD13 . LEU A 1 239 ? 11.172  -31.436 -11.601 1.00 65.54  ? 600 LEU A HD13 1 
ATOM   3787 H  HD21 . LEU A 1 239 ? 11.862  -31.104 -14.475 1.00 59.25  ? 600 LEU A HD21 1 
ATOM   3788 H  HD22 . LEU A 1 239 ? 12.695  -30.335 -13.362 1.00 59.25  ? 600 LEU A HD22 1 
ATOM   3789 H  HD23 . LEU A 1 239 ? 13.440  -31.277 -14.402 1.00 59.25  ? 600 LEU A HD23 1 
ATOM   3790 N  N    . GLU A 1 240 ? 12.123  -35.506 -11.446 1.00 45.77  ? 601 GLU A N    1 
ATOM   3791 C  CA   . GLU A 1 240 ? 11.616  -36.674 -12.145 1.00 50.34  ? 601 GLU A CA   1 
ATOM   3792 C  C    . GLU A 1 240 ? 10.401  -36.267 -12.958 1.00 45.62  ? 601 GLU A C    1 
ATOM   3793 O  O    . GLU A 1 240 ? 9.489   -35.614 -12.453 1.00 51.23  ? 601 GLU A O    1 
ATOM   3794 C  CB   . GLU A 1 240 ? 11.265  -37.802 -11.175 1.00 55.83  ? 601 GLU A CB   1 
ATOM   3795 C  CG   . GLU A 1 240 ? 10.905  -39.104 -11.877 1.00 88.66  ? 601 GLU A CG   1 
ATOM   3796 C  CD   . GLU A 1 240 ? 11.545  -40.319 -11.231 1.00 116.46 ? 601 GLU A CD   1 
ATOM   3797 O  OE1  . GLU A 1 240 ? 12.792  -40.393 -11.209 1.00 117.98 ? 601 GLU A OE1  1 
ATOM   3798 O  OE2  . GLU A 1 240 ? 10.804  -41.202 -10.749 1.00 119.69 ? 601 GLU A OE2  1 
ATOM   3799 H  H    . GLU A 1 240 ? 11.631  -35.247 -10.790 1.00 54.92  ? 601 GLU A H    1 
ATOM   3800 H  HA   . GLU A 1 240 ? 12.295  -37.000 -12.756 1.00 60.40  ? 601 GLU A HA   1 
ATOM   3801 H  HB2  . GLU A 1 240 ? 12.028  -37.973 -10.601 1.00 67.00  ? 601 GLU A HB2  1 
ATOM   3802 H  HB3  . GLU A 1 240 ? 10.503  -37.531 -10.639 1.00 67.00  ? 601 GLU A HB3  1 
ATOM   3803 H  HG2  . GLU A 1 240 ? 9.942   -39.223 -11.849 1.00 106.39 ? 601 GLU A HG2  1 
ATOM   3804 H  HG3  . GLU A 1 240 ? 11.207  -39.060 -12.798 1.00 106.39 ? 601 GLU A HG3  1 
ATOM   3805 N  N    . VAL A 1 241 ? 10.419  -36.650 -14.231 1.00 58.12  ? 602 VAL A N    1 
ATOM   3806 C  CA   . VAL A 1 241 ? 9.354   -36.331 -15.166 1.00 55.63  ? 602 VAL A CA   1 
ATOM   3807 C  C    . VAL A 1 241 ? 8.803   -37.628 -15.735 1.00 61.02  ? 602 VAL A C    1 
ATOM   3808 O  O    . VAL A 1 241 ? 9.547   -38.395 -16.344 1.00 55.72  ? 602 VAL A O    1 
ATOM   3809 C  CB   . VAL A 1 241 ? 9.868   -35.434 -16.305 1.00 57.37  ? 602 VAL A CB   1 
ATOM   3810 C  CG1  . VAL A 1 241 ? 8.772   -35.166 -17.336 1.00 52.16  ? 602 VAL A CG1  1 
ATOM   3811 C  CG2  . VAL A 1 241 ? 10.423  -34.131 -15.742 1.00 50.57  ? 602 VAL A CG2  1 
ATOM   3812 H  H    . VAL A 1 241 ? 11.056  -37.107 -14.582 1.00 69.74  ? 602 VAL A H    1 
ATOM   3813 H  HA   . VAL A 1 241 ? 8.640   -35.866 -14.703 1.00 66.76  ? 602 VAL A HA   1 
ATOM   3814 H  HB   . VAL A 1 241 ? 10.594  -35.891 -16.758 1.00 68.84  ? 602 VAL A HB   1 
ATOM   3815 H  HG11 . VAL A 1 241 ? 9.130   -34.600 -18.037 1.00 62.59  ? 602 VAL A HG11 1 
ATOM   3816 H  HG12 . VAL A 1 241 ? 8.479   -36.012 -17.711 1.00 62.59  ? 602 VAL A HG12 1 
ATOM   3817 H  HG13 . VAL A 1 241 ? 8.029   -34.722 -16.898 1.00 62.59  ? 602 VAL A HG13 1 
ATOM   3818 H  HG21 . VAL A 1 241 ? 10.741  -33.581 -16.475 1.00 60.69  ? 602 VAL A HG21 1 
ATOM   3819 H  HG22 . VAL A 1 241 ? 9.717   -33.669 -15.263 1.00 60.69  ? 602 VAL A HG22 1 
ATOM   3820 H  HG23 . VAL A 1 241 ? 11.155  -34.335 -15.139 1.00 60.69  ? 602 VAL A HG23 1 
ATOM   3821 N  N    . GLU A 1 242 ? 7.512   -37.881 -15.531 1.00 46.21  ? 603 GLU A N    1 
ATOM   3822 C  CA   . GLU A 1 242 ? 6.877   -39.066 -16.099 1.00 59.50  ? 603 GLU A CA   1 
ATOM   3823 C  C    . GLU A 1 242 ? 5.730   -38.680 -17.016 1.00 57.71  ? 603 GLU A C    1 
ATOM   3824 O  O    . GLU A 1 242 ? 4.830   -37.942 -16.630 1.00 55.21  ? 603 GLU A O    1 
ATOM   3825 C  CB   . GLU A 1 242 ? 6.377   -40.004 -14.996 1.00 62.02  ? 603 GLU A CB   1 
ATOM   3826 C  CG   . GLU A 1 242 ? 5.419   -41.096 -15.493 1.00 105.92 ? 603 GLU A CG   1 
ATOM   3827 C  CD   . GLU A 1 242 ? 5.707   -42.479 -14.923 1.00 124.90 ? 603 GLU A CD   1 
ATOM   3828 O  OE1  . GLU A 1 242 ? 6.891   -42.817 -14.710 1.00 129.94 ? 603 GLU A OE1  1 
ATOM   3829 O  OE2  . GLU A 1 242 ? 4.738   -43.237 -14.698 1.00 117.99 ? 603 GLU A OE2  1 
ATOM   3830 H  H    . GLU A 1 242 ? 6.984   -37.383 -15.070 1.00 55.46  ? 603 GLU A H    1 
ATOM   3831 H  HA   . GLU A 1 242 ? 7.531   -39.549 -16.628 1.00 71.40  ? 603 GLU A HA   1 
ATOM   3832 H  HB2  . GLU A 1 242 ? 7.140   -40.443 -14.589 1.00 74.42  ? 603 GLU A HB2  1 
ATOM   3833 H  HB3  . GLU A 1 242 ? 5.907   -39.479 -14.329 1.00 74.42  ? 603 GLU A HB3  1 
ATOM   3834 H  HG2  . GLU A 1 242 ? 4.514   -40.855 -15.241 1.00 127.11 ? 603 GLU A HG2  1 
ATOM   3835 H  HG3  . GLU A 1 242 ? 5.486   -41.154 -16.459 1.00 127.11 ? 603 GLU A HG3  1 
ATOM   3836 N  N    . VAL A 1 243 ? 5.782   -39.186 -18.242 1.00 55.85  ? 604 VAL A N    1 
ATOM   3837 C  CA   . VAL A 1 243 ? 4.694   -39.009 -19.188 1.00 48.62  ? 604 VAL A CA   1 
ATOM   3838 C  C    . VAL A 1 243 ? 3.825   -40.252 -19.133 1.00 46.40  ? 604 VAL A C    1 
ATOM   3839 O  O    . VAL A 1 243 ? 4.328   -41.368 -19.258 1.00 62.63  ? 604 VAL A O    1 
ATOM   3840 C  CB   . VAL A 1 243 ? 5.203   -38.789 -20.624 1.00 49.85  ? 604 VAL A CB   1 
ATOM   3841 C  CG1  . VAL A 1 243 ? 4.109   -38.172 -21.479 1.00 49.23  ? 604 VAL A CG1  1 
ATOM   3842 C  CG2  . VAL A 1 243 ? 6.445   -37.903 -20.623 1.00 49.91  ? 604 VAL A CG2  1 
ATOM   3843 H  H    . VAL A 1 243 ? 6.443   -39.640 -18.551 1.00 67.02  ? 604 VAL A H    1 
ATOM   3844 H  HA   . VAL A 1 243 ? 4.158   -38.243 -18.929 1.00 58.35  ? 604 VAL A HA   1 
ATOM   3845 H  HB   . VAL A 1 243 ? 5.443   -39.645 -21.012 1.00 59.82  ? 604 VAL A HB   1 
ATOM   3846 H  HG11 . VAL A 1 243 ? 4.447   -38.041 -22.378 1.00 59.08  ? 604 VAL A HG11 1 
ATOM   3847 H  HG12 . VAL A 1 243 ? 3.346   -38.771 -21.495 1.00 59.08  ? 604 VAL A HG12 1 
ATOM   3848 H  HG13 . VAL A 1 243 ? 3.852   -37.319 -21.094 1.00 59.08  ? 604 VAL A HG13 1 
ATOM   3849 H  HG21 . VAL A 1 243 ? 6.745   -37.780 -21.538 1.00 59.90  ? 604 VAL A HG21 1 
ATOM   3850 H  HG22 . VAL A 1 243 ? 6.220   -37.045 -20.230 1.00 59.90  ? 604 VAL A HG22 1 
ATOM   3851 H  HG23 . VAL A 1 243 ? 7.140   -38.335 -20.102 1.00 59.90  ? 604 VAL A HG23 1 
ATOM   3852 N  N    . ARG A 1 244 ? 2.526   -40.058 -18.932 1.00 47.28  ? 605 ARG A N    1 
ATOM   3853 C  CA   . ARG A 1 244 ? 1.596   -41.173 -18.830 1.00 68.66  ? 605 ARG A CA   1 
ATOM   3854 C  C    . ARG A 1 244 ? 0.467   -41.030 -19.830 1.00 75.57  ? 605 ARG A C    1 
ATOM   3855 O  O    . ARG A 1 244 ? 0.130   -39.923 -20.252 1.00 52.70  ? 605 ARG A O    1 
ATOM   3856 C  CB   . ARG A 1 244 ? 1.028   -41.271 -17.413 1.00 73.12  ? 605 ARG A CB   1 
ATOM   3857 C  CG   . ARG A 1 244 ? 2.071   -41.580 -16.360 1.00 91.72  ? 605 ARG A CG   1 
ATOM   3858 C  CD   . ARG A 1 244 ? 1.519   -41.391 -14.958 1.00 110.52 ? 605 ARG A CD   1 
ATOM   3859 N  NE   . ARG A 1 244 ? 0.394   -42.281 -14.680 1.00 117.55 ? 605 ARG A NE   1 
ATOM   3860 C  CZ   . ARG A 1 244 ? -0.375  -42.202 -13.598 1.00 118.26 ? 605 ARG A CZ   1 
ATOM   3861 N  NH1  . ARG A 1 244 ? -0.151  -41.268 -12.683 1.00 116.56 ? 605 ARG A NH1  1 
ATOM   3862 N  NH2  . ARG A 1 244 ? -1.375  -43.057 -13.432 1.00 115.26 ? 605 ARG A NH2  1 
ATOM   3863 H  H    . ARG A 1 244 ? 2.157   -39.285 -18.852 1.00 56.74  ? 605 ARG A H    1 
ATOM   3864 H  HA   . ARG A 1 244 ? 2.068   -41.998 -19.023 1.00 82.39  ? 605 ARG A HA   1 
ATOM   3865 H  HB2  . ARG A 1 244 ? 0.614   -40.424 -17.182 1.00 87.75  ? 605 ARG A HB2  1 
ATOM   3866 H  HB3  . ARG A 1 244 ? 0.364   -41.978 -17.390 1.00 87.75  ? 605 ARG A HB3  1 
ATOM   3867 H  HG2  . ARG A 1 244 ? 2.357   -42.502 -16.453 1.00 110.07 ? 605 ARG A HG2  1 
ATOM   3868 H  HG3  . ARG A 1 244 ? 2.826   -40.981 -16.472 1.00 110.07 ? 605 ARG A HG3  1 
ATOM   3869 H  HD2  . ARG A 1 244 ? 2.218   -41.579 -14.313 1.00 132.62 ? 605 ARG A HD2  1 
ATOM   3870 H  HD3  . ARG A 1 244 ? 1.211   -40.477 -14.858 1.00 132.62 ? 605 ARG A HD3  1 
ATOM   3871 H  HE   . ARG A 1 244 ? 0.218   -42.897 -15.255 1.00 141.06 ? 605 ARG A HE   1 
ATOM   3872 H  HH11 . ARG A 1 244 ? 0.497   -40.711 -12.786 1.00 139.87 ? 605 ARG A HH11 1 
ATOM   3873 H  HH12 . ARG A 1 244 ? -0.651  -41.221 -11.985 1.00 139.87 ? 605 ARG A HH12 1 
ATOM   3874 H  HH21 . ARG A 1 244 ? -1.525  -43.664 -14.023 1.00 138.31 ? 605 ARG A HH21 1 
ATOM   3875 H  HH22 . ARG A 1 244 ? -1.873  -43.005 -12.733 1.00 138.31 ? 605 ARG A HH22 1 
ATOM   3876 N  N    . ASP A 1 245 ? -0.095  -42.168 -20.219 1.00 63.68  ? 606 ASP A N    1 
ATOM   3877 C  CA   . ASP A 1 245 ? -1.305  -42.199 -21.022 1.00 60.27  ? 606 ASP A CA   1 
ATOM   3878 C  C    . ASP A 1 245 ? -2.499  -42.272 -20.081 1.00 69.92  ? 606 ASP A C    1 
ATOM   3879 O  O    . ASP A 1 245 ? -2.728  -43.297 -19.440 1.00 66.66  ? 606 ASP A O    1 
ATOM   3880 C  CB   . ASP A 1 245 ? -1.296  -43.391 -21.982 1.00 72.43  ? 606 ASP A CB   1 
ATOM   3881 C  CG   . ASP A 1 245 ? -2.591  -43.524 -22.763 1.00 78.30  ? 606 ASP A CG   1 
ATOM   3882 O  OD1  . ASP A 1 245 ? -3.323  -42.519 -22.886 1.00 95.33  ? 606 ASP A OD1  1 
ATOM   3883 O  OD2  . ASP A 1 245 ? -2.877  -44.635 -23.258 1.00 84.08  ? 606 ASP A OD2  1 
ATOM   3884 H  H    . ASP A 1 245 ? 0.212   -42.948 -20.026 1.00 76.42  ? 606 ASP A H    1 
ATOM   3885 H  HA   . ASP A 1 245 ? -1.371  -41.383 -21.542 1.00 72.32  ? 606 ASP A HA   1 
ATOM   3886 H  HB2  . ASP A 1 245 ? -0.572  -43.279 -22.619 1.00 86.92  ? 606 ASP A HB2  1 
ATOM   3887 H  HB3  . ASP A 1 245 ? -1.167  -44.206 -21.473 1.00 86.92  ? 606 ASP A HB3  1 
ATOM   3888 N  N    . GLU A 1 246 ? -3.249  -41.179 -19.999 1.00 71.56  ? 607 GLU A N    1 
ATOM   3889 C  CA   . GLU A 1 246 ? -4.397  -41.099 -19.104 1.00 85.11  ? 607 GLU A CA   1 
ATOM   3890 C  C    . GLU A 1 246 ? -5.438  -42.158 -19.444 1.00 91.20  ? 607 GLU A C    1 
ATOM   3891 O  O    . GLU A 1 246 ? -6.152  -42.647 -18.568 1.00 102.61 ? 607 GLU A O    1 
ATOM   3892 C  CB   . GLU A 1 246 ? -5.025  -39.704 -19.170 1.00 88.96  ? 607 GLU A CB   1 
ATOM   3893 C  CG   . GLU A 1 246 ? -6.416  -39.605 -18.551 1.00 106.74 ? 607 GLU A CG   1 
ATOM   3894 C  CD   . GLU A 1 246 ? -6.452  -40.066 -17.106 1.00 125.45 ? 607 GLU A CD   1 
ATOM   3895 O  OE1  . GLU A 1 246 ? -5.407  -39.976 -16.427 1.00 129.69 ? 607 GLU A OE1  1 
ATOM   3896 O  OE2  . GLU A 1 246 ? -7.525  -40.522 -16.651 1.00 124.29 ? 607 GLU A OE2  1 
ATOM   3897 H  H    . GLU A 1 246 ? -3.112  -40.463 -20.456 1.00 85.87  ? 607 GLU A H    1 
ATOM   3898 H  HA   . GLU A 1 246 ? -4.100  -41.252 -18.193 1.00 102.14 ? 607 GLU A HA   1 
ATOM   3899 H  HB2  . GLU A 1 246 ? -4.449  -39.082 -18.698 1.00 106.75 ? 607 GLU A HB2  1 
ATOM   3900 H  HB3  . GLU A 1 246 ? -5.098  -39.440 -20.100 1.00 106.75 ? 607 GLU A HB3  1 
ATOM   3901 H  HG2  . GLU A 1 246 ? -6.709  -38.680 -18.578 1.00 128.09 ? 607 GLU A HG2  1 
ATOM   3902 H  HG3  . GLU A 1 246 ? -7.028  -40.161 -19.059 1.00 128.09 ? 607 GLU A HG3  1 
ATOM   3903 N  N    . GLN A 1 247 ? -5.519  -42.504 -20.723 1.00 88.28  ? 608 GLN A N    1 
ATOM   3904 C  CA   . GLN A 1 247 ? -6.473  -43.498 -21.191 1.00 89.85  ? 608 GLN A CA   1 
ATOM   3905 C  C    . GLN A 1 247 ? -6.267  -44.845 -20.500 1.00 98.29  ? 608 GLN A C    1 
ATOM   3906 O  O    . GLN A 1 247 ? -7.226  -45.460 -20.031 1.00 102.59 ? 608 GLN A O    1 
ATOM   3907 C  CB   . GLN A 1 247 ? -6.353  -43.668 -22.707 1.00 101.34 ? 608 GLN A CB   1 
ATOM   3908 C  CG   . GLN A 1 247 ? -7.579  -44.275 -23.366 1.00 107.37 ? 608 GLN A CG   1 
ATOM   3909 C  CD   . GLN A 1 247 ? -8.771  -43.338 -23.352 1.00 113.99 ? 608 GLN A CD   1 
ATOM   3910 O  OE1  . GLN A 1 247 ? -9.587  -43.366 -22.431 1.00 123.36 ? 608 GLN A OE1  1 
ATOM   3911 N  NE2  . GLN A 1 247 ? -8.877  -42.499 -24.378 1.00 97.57  ? 608 GLN A NE2  1 
ATOM   3912 H  H    . GLN A 1 247 ? -5.027  -42.173 -21.345 1.00 105.94 ? 608 GLN A H    1 
ATOM   3913 H  HA   . GLN A 1 247 ? -7.372  -43.193 -20.992 1.00 107.82 ? 608 GLN A HA   1 
ATOM   3914 H  HB2  . GLN A 1 247 ? -6.203  -42.797 -23.106 1.00 121.61 ? 608 GLN A HB2  1 
ATOM   3915 H  HB3  . GLN A 1 247 ? -5.599  -44.248 -22.896 1.00 121.61 ? 608 GLN A HB3  1 
ATOM   3916 H  HG2  . GLN A 1 247 ? -7.371  -44.483 -24.290 1.00 128.84 ? 608 GLN A HG2  1 
ATOM   3917 H  HG3  . GLN A 1 247 ? -7.827  -45.084 -22.891 1.00 128.84 ? 608 GLN A HG3  1 
ATOM   3918 H  HE21 . GLN A 1 247 ? -8.287  -42.508 -25.003 1.00 117.09 ? 608 GLN A HE21 1 
ATOM   3919 H  HE22 . GLN A 1 247 ? -9.535  -41.947 -24.416 1.00 117.09 ? 608 GLN A HE22 1 
ATOM   3920 N  N    . HIS A 1 248 ? -5.011  -45.286 -20.429 1.00 96.42  ? 609 HIS A N    1 
ATOM   3921 C  CA   . HIS A 1 248 ? -4.683  -46.634 -19.963 1.00 100.76 ? 609 HIS A CA   1 
ATOM   3922 C  C    . HIS A 1 248 ? -3.749  -46.647 -18.748 1.00 100.95 ? 609 HIS A C    1 
ATOM   3923 O  O    . HIS A 1 248 ? -3.289  -47.707 -18.325 1.00 100.30 ? 609 HIS A O    1 
ATOM   3924 C  CB   . HIS A 1 248 ? -4.050  -47.426 -21.107 1.00 111.60 ? 609 HIS A CB   1 
ATOM   3925 C  CG   . HIS A 1 248 ? -4.781  -47.286 -22.407 1.00 122.67 ? 609 HIS A CG   1 
ATOM   3926 N  ND1  . HIS A 1 248 ? -4.133  -47.162 -23.617 1.00 124.48 ? 609 HIS A ND1  1 
ATOM   3927 C  CD2  . HIS A 1 248 ? -6.106  -47.248 -22.685 1.00 128.17 ? 609 HIS A CD2  1 
ATOM   3928 C  CE1  . HIS A 1 248 ? -5.026  -47.053 -24.584 1.00 127.38 ? 609 HIS A CE1  1 
ATOM   3929 N  NE2  . HIS A 1 248 ? -6.231  -47.102 -24.045 1.00 129.40 ? 609 HIS A NE2  1 
ATOM   3930 H  H    . HIS A 1 248 ? -4.324  -44.818 -20.649 1.00 115.70 ? 609 HIS A H    1 
ATOM   3931 H  HA   . HIS A 1 248 ? -5.503  -47.084 -19.709 1.00 120.92 ? 609 HIS A HA   1 
ATOM   3932 H  HB2  . HIS A 1 248 ? -3.142  -47.112 -21.241 1.00 133.91 ? 609 HIS A HB2  1 
ATOM   3933 H  HB3  . HIS A 1 248 ? -4.042  -48.367 -20.870 1.00 133.91 ? 609 HIS A HB3  1 
ATOM   3934 H  HD1  . HIS A 1 248 ? -3.280  -47.156 -23.725 1.00 149.37 ? 609 HIS A HD1  1 
ATOM   3935 H  HD2  . HIS A 1 248 ? -6.800  -47.308 -22.069 1.00 153.81 ? 609 HIS A HD2  1 
ATOM   3936 H  HE1  . HIS A 1 248 ? -4.839  -46.959 -25.490 1.00 152.85 ? 609 HIS A HE1  1 
ATOM   3937 H  HE2  . HIS A 1 248 ? -6.974  -47.052 -24.476 1.00 155.28 ? 609 HIS A HE2  1 
ATOM   3938 N  N    . GLN A 1 249 ? -3.461  -45.465 -18.209 1.00 109.30 ? 610 GLN A N    1 
ATOM   3939 C  CA   . GLN A 1 249 ? -2.709  -45.319 -16.960 1.00 118.87 ? 610 GLN A CA   1 
ATOM   3940 C  C    . GLN A 1 249 ? -1.278  -45.866 -17.003 1.00 113.28 ? 610 GLN A C    1 
ATOM   3941 O  O    . GLN A 1 249 ? -0.617  -45.950 -15.967 1.00 116.17 ? 610 GLN A O    1 
ATOM   3942 C  CB   . GLN A 1 249 ? -3.472  -45.995 -15.813 1.00 117.56 ? 610 GLN A CB   1 
ATOM   3943 C  CG   . GLN A 1 249 ? -4.819  -45.361 -15.510 1.00 121.26 ? 610 GLN A CG   1 
ATOM   3944 C  CD   . GLN A 1 249 ? -4.701  -43.896 -15.130 1.00 122.76 ? 610 GLN A CD   1 
ATOM   3945 O  OE1  . GLN A 1 249 ? -3.687  -43.464 -14.578 1.00 114.04 ? 610 GLN A OE1  1 
ATOM   3946 N  NE2  . GLN A 1 249 ? -5.735  -43.121 -15.435 1.00 123.42 ? 610 GLN A NE2  1 
ATOM   3947 H  H    . GLN A 1 249 ? -3.695  -44.714 -18.556 1.00 131.16 ? 610 GLN A H    1 
ATOM   3948 H  HA   . GLN A 1 249 ? -2.650  -44.374 -16.750 1.00 142.65 ? 610 GLN A HA   1 
ATOM   3949 H  HB2  . GLN A 1 249 ? -3.627  -46.923 -16.047 1.00 141.07 ? 610 GLN A HB2  1 
ATOM   3950 H  HB3  . GLN A 1 249 ? -2.933  -45.944 -15.008 1.00 141.07 ? 610 GLN A HB3  1 
ATOM   3951 H  HG2  . GLN A 1 249 ? -5.382  -45.423 -16.298 1.00 145.51 ? 610 GLN A HG2  1 
ATOM   3952 H  HG3  . GLN A 1 249 ? -5.231  -45.832 -14.769 1.00 145.51 ? 610 GLN A HG3  1 
ATOM   3953 H  HE21 . GLN A 1 249 ? -6.423  -43.457 -15.827 1.00 148.11 ? 610 GLN A HE21 1 
ATOM   3954 H  HE22 . GLN A 1 249 ? -5.717  -42.284 -15.240 1.00 148.11 ? 610 GLN A HE22 1 
ATOM   3955 N  N    . CYS A 1 250 ? -0.794  -46.220 -18.190 1.00 99.29  ? 611 CYS A N    1 
ATOM   3956 C  CA   . CYS A 1 250 ? 0.575   -46.709 -18.337 1.00 82.54  ? 611 CYS A CA   1 
ATOM   3957 C  C    . CYS A 1 250 ? 1.541   -45.561 -18.618 1.00 73.83  ? 611 CYS A C    1 
ATOM   3958 O  O    . CYS A 1 250 ? 1.119   -44.428 -18.854 1.00 68.78  ? 611 CYS A O    1 
ATOM   3959 C  CB   . CYS A 1 250 ? 0.658   -47.750 -19.454 1.00 86.06  ? 611 CYS A CB   1 
ATOM   3960 S  SG   . CYS A 1 250 ? -0.015  -47.200 -21.039 1.00 107.34 ? 611 CYS A SG   1 
ATOM   3961 H  H    . CYS A 1 250 ? -1.236  -46.186 -18.927 1.00 119.15 ? 611 CYS A H    1 
ATOM   3962 H  HA   . CYS A 1 250 ? 0.849   -47.135 -17.509 1.00 99.05  ? 611 CYS A HA   1 
ATOM   3963 H  HB2  . CYS A 1 250 ? 1.589   -47.982 -19.595 1.00 103.27 ? 611 CYS A HB2  1 
ATOM   3964 H  HB3  . CYS A 1 250 ? 0.162   -48.538 -19.182 1.00 103.27 ? 611 CYS A HB3  1 
ATOM   3965 H  HG   . CYS A 1 250 ? 0.099   -48.086 -21.840 1.00 128.81 ? 611 CYS A HG   1 
ATOM   3966 N  N    . SER A 1 251 ? 2.837   -45.859 -18.587 1.00 74.12  ? 612 SER A N    1 
ATOM   3967 C  CA   . SER A 1 251 ? 3.860   -44.854 -18.858 1.00 85.98  ? 612 SER A CA   1 
ATOM   3968 C  C    . SER A 1 251 ? 4.145   -44.733 -20.351 1.00 79.31  ? 612 SER A C    1 
ATOM   3969 O  O    . SER A 1 251 ? 4.051   -45.709 -21.092 1.00 70.39  ? 612 SER A O    1 
ATOM   3970 C  CB   . SER A 1 251 ? 5.154   -45.190 -18.115 1.00 87.69  ? 612 SER A CB   1 
ATOM   3971 O  OG   . SER A 1 251 ? 6.229   -44.400 -18.597 1.00 90.14  ? 612 SER A OG   1 
ATOM   3972 H  H    . SER A 1 251 ? 3.151   -46.640 -18.410 1.00 88.94  ? 612 SER A H    1 
ATOM   3973 H  HA   . SER A 1 251 ? 3.548   -43.992 -18.542 1.00 103.17 ? 612 SER A HA   1 
ATOM   3974 H  HB2  . SER A 1 251 ? 5.030   -45.013 -17.170 1.00 105.23 ? 612 SER A HB2  1 
ATOM   3975 H  HB3  . SER A 1 251 ? 5.363   -46.127 -18.253 1.00 105.23 ? 612 SER A HB3  1 
ATOM   3976 H  HG   . SER A 1 251 ? 6.934   -44.591 -18.183 1.00 108.17 ? 612 SER A HG   1 
ATOM   3977 N  N    . LEU A 1 252 ? 4.497   -43.525 -20.778 1.00 64.52  ? 613 LEU A N    1 
ATOM   3978 C  CA   . LEU A 1 252 ? 4.876   -43.263 -22.164 1.00 63.76  ? 613 LEU A CA   1 
ATOM   3979 C  C    . LEU A 1 252 ? 6.352   -42.886 -22.252 1.00 65.47  ? 613 LEU A C    1 
ATOM   3980 O  O    . LEU A 1 252 ? 6.847   -42.519 -23.319 1.00 69.28  ? 613 LEU A O    1 
ATOM   3981 C  CB   . LEU A 1 252 ? 4.016   -42.145 -22.752 1.00 51.55  ? 613 LEU A CB   1 
ATOM   3982 C  CG   . LEU A 1 252 ? 2.521   -42.440 -22.857 1.00 52.11  ? 613 LEU A CG   1 
ATOM   3983 C  CD1  . LEU A 1 252 ? 1.770   -41.154 -23.103 1.00 48.74  ? 613 LEU A CD1  1 
ATOM   3984 C  CD2  . LEU A 1 252 ? 2.242   -43.445 -23.968 1.00 62.64  ? 613 LEU A CD2  1 
ATOM   3985 H  H    . LEU A 1 252 ? 4.526   -42.828 -20.275 1.00 77.42  ? 613 LEU A H    1 
ATOM   3986 H  HA   . LEU A 1 252 ? 4.735   -44.065 -22.691 1.00 76.51  ? 613 LEU A HA   1 
ATOM   3987 H  HB2  . LEU A 1 252 ? 4.117   -41.357 -22.195 1.00 61.86  ? 613 LEU A HB2  1 
ATOM   3988 H  HB3  . LEU A 1 252 ? 4.336   -41.952 -23.646 1.00 61.86  ? 613 LEU A HB3  1 
ATOM   3989 H  HG   . LEU A 1 252 ? 2.210   -42.818 -22.020 1.00 62.53  ? 613 LEU A HG   1 
ATOM   3990 H  HD11 . LEU A 1 252 ? 0.822   -41.350 -23.169 1.00 58.49  ? 613 LEU A HD11 1 
ATOM   3991 H  HD12 . LEU A 1 252 ? 1.932   -40.547 -22.364 1.00 58.49  ? 613 LEU A HD12 1 
ATOM   3992 H  HD13 . LEU A 1 252 ? 2.084   -40.758 -23.931 1.00 58.49  ? 613 LEU A HD13 1 
ATOM   3993 H  HD21 . LEU A 1 252 ? 1.287   -43.611 -24.011 1.00 75.16  ? 613 LEU A HD21 1 
ATOM   3994 H  HD22 . LEU A 1 252 ? 2.552   -43.077 -24.811 1.00 75.16  ? 613 LEU A HD22 1 
ATOM   3995 H  HD23 . LEU A 1 252 ? 2.714   -44.269 -23.773 1.00 75.16  ? 613 LEU A HD23 1 
ATOM   3996 N  N    . GLY A 1 253 ? 7.044   -42.978 -21.121 1.00 55.90  ? 614 GLY A N    1 
ATOM   3997 C  CA   . GLY A 1 253 ? 8.444   -42.611 -21.037 1.00 67.80  ? 614 GLY A CA   1 
ATOM   3998 C  C    . GLY A 1 253 ? 8.665   -41.684 -19.861 1.00 58.83  ? 614 GLY A C    1 
ATOM   3999 O  O    . GLY A 1 253 ? 7.711   -41.109 -19.340 1.00 60.62  ? 614 GLY A O    1 
ATOM   4000 H  H    . GLY A 1 253 ? 6.714   -43.256 -20.377 1.00 67.08  ? 614 GLY A H    1 
ATOM   4001 H  HA2  . GLY A 1 253 ? 8.988   -43.406 -20.919 1.00 81.36  ? 614 GLY A HA2  1 
ATOM   4002 H  HA3  . GLY A 1 253 ? 8.718   -42.160 -21.851 1.00 81.36  ? 614 GLY A HA3  1 
ATOM   4003 N  N    . ASN A 1 254 ? 9.917   -41.547 -19.437 1.00 66.85  ? 615 ASN A N    1 
ATOM   4004 C  CA   . ASN A 1 254 ? 10.247  -40.660 -18.329 1.00 70.99  ? 615 ASN A CA   1 
ATOM   4005 C  C    . ASN A 1 254 ? 11.643  -40.066 -18.453 1.00 75.25  ? 615 ASN A C    1 
ATOM   4006 O  O    . ASN A 1 254 ? 12.444  -40.480 -19.292 1.00 75.55  ? 615 ASN A O    1 
ATOM   4007 C  CB   . ASN A 1 254 ? 10.122  -41.401 -17.000 1.00 63.07  ? 615 ASN A CB   1 
ATOM   4008 C  CG   . ASN A 1 254 ? 10.942  -42.667 -16.965 1.00 84.40  ? 615 ASN A CG   1 
ATOM   4009 O  OD1  . ASN A 1 254 ? 12.156  -42.627 -16.767 1.00 91.31  ? 615 ASN A OD1  1 
ATOM   4010 N  ND2  . ASN A 1 254 ? 10.283  -43.804 -17.159 1.00 82.82  ? 615 ASN A ND2  1 
ATOM   4011 H  H    . ASN A 1 254 ? 10.593  -41.956 -19.774 1.00 80.22  ? 615 ASN A H    1 
ATOM   4012 H  HA   . ASN A 1 254 ? 9.613   -39.926 -18.319 1.00 85.19  ? 615 ASN A HA   1 
ATOM   4013 H  HB2  . ASN A 1 254 ? 10.430  -40.823 -16.285 1.00 75.68  ? 615 ASN A HB2  1 
ATOM   4014 H  HB3  . ASN A 1 254 ? 9.193   -41.640 -16.857 1.00 75.68  ? 615 ASN A HB3  1 
ATOM   4015 H  HD21 . ASN A 1 254 ? 10.705  -44.553 -17.148 1.00 99.38  ? 615 ASN A HD21 1 
ATOM   4016 H  HD22 . ASN A 1 254 ? 9.434   -43.791 -17.294 1.00 99.38  ? 615 ASN A HD22 1 
ATOM   4017 N  N    . LEU A 1 255 ? 11.920  -39.094 -17.593 1.00 76.17  ? 616 LEU A N    1 
ATOM   4018 C  CA   . LEU A 1 255 ? 13.143  -38.315 -17.654 1.00 61.78  ? 616 LEU A CA   1 
ATOM   4019 C  C    . LEU A 1 255 ? 13.558  -37.922 -16.249 1.00 65.00  ? 616 LEU A C    1 
ATOM   4020 O  O    . LEU A 1 255 ? 12.781  -37.314 -15.517 1.00 70.70  ? 616 LEU A O    1 
ATOM   4021 C  CB   . LEU A 1 255 ? 12.935  -37.065 -18.510 1.00 59.07  ? 616 LEU A CB   1 
ATOM   4022 C  CG   . LEU A 1 255 ? 14.119  -36.117 -18.688 1.00 62.11  ? 616 LEU A CG   1 
ATOM   4023 C  CD1  . LEU A 1 255 ? 15.106  -36.679 -19.680 1.00 61.62  ? 616 LEU A CD1  1 
ATOM   4024 C  CD2  . LEU A 1 255 ? 13.627  -34.756 -19.137 1.00 47.63  ? 616 LEU A CD2  1 
ATOM   4025 H  H    . LEU A 1 255 ? 11.398  -38.863 -16.949 1.00 91.41  ? 616 LEU A H    1 
ATOM   4026 H  HA   . LEU A 1 255 ? 13.850  -38.848 -18.049 1.00 74.13  ? 616 LEU A HA   1 
ATOM   4027 H  HB2  . LEU A 1 255 ? 12.667  -37.352 -19.397 1.00 70.88  ? 616 LEU A HB2  1 
ATOM   4028 H  HB3  . LEU A 1 255 ? 12.216  -36.548 -18.113 1.00 70.88  ? 616 LEU A HB3  1 
ATOM   4029 H  HG   . LEU A 1 255 ? 14.572  -36.010 -17.837 1.00 74.53  ? 616 LEU A HG   1 
ATOM   4030 H  HD11 . LEU A 1 255 ? 15.846  -36.059 -19.774 1.00 73.94  ? 616 LEU A HD11 1 
ATOM   4031 H  HD12 . LEU A 1 255 ? 15.429  -37.534 -19.354 1.00 73.94  ? 616 LEU A HD12 1 
ATOM   4032 H  HD13 . LEU A 1 255 ? 14.662  -36.797 -20.534 1.00 73.94  ? 616 LEU A HD13 1 
ATOM   4033 H  HD21 . LEU A 1 255 ? 14.389  -34.166 -19.246 1.00 57.15  ? 616 LEU A HD21 1 
ATOM   4034 H  HD22 . LEU A 1 255 ? 13.160  -34.853 -19.982 1.00 57.15  ? 616 LEU A HD22 1 
ATOM   4035 H  HD23 . LEU A 1 255 ? 13.025  -34.401 -18.465 1.00 57.15  ? 616 LEU A HD23 1 
ATOM   4036 N  N    . LYS A 1 256 ? 14.778  -38.284 -15.875 1.00 61.61  ? 617 LYS A N    1 
ATOM   4037 C  CA   . LYS A 1 256 ? 15.348  -37.881 -14.598 1.00 73.46  ? 617 LYS A CA   1 
ATOM   4038 C  C    . LYS A 1 256 ? 16.420  -36.835 -14.863 1.00 66.90  ? 617 LYS A C    1 
ATOM   4039 O  O    . LYS A 1 256 ? 17.303  -37.038 -15.694 1.00 67.34  ? 617 LYS A O    1 
ATOM   4040 C  CB   . LYS A 1 256 ? 15.930  -39.085 -13.850 1.00 75.06  ? 617 LYS A CB   1 
ATOM   4041 C  CG   . LYS A 1 256 ? 16.573  -38.736 -12.514 1.00 80.11  ? 617 LYS A CG   1 
ATOM   4042 C  CD   . LYS A 1 256 ? 16.988  -39.980 -11.730 1.00 98.60  ? 617 LYS A CD   1 
ATOM   4043 C  CE   . LYS A 1 256 ? 15.786  -40.705 -11.139 1.00 109.87 ? 617 LYS A CE   1 
ATOM   4044 N  NZ   . LYS A 1 256 ? 16.184  -41.810 -10.218 1.00 118.29 ? 617 LYS A NZ   1 
ATOM   4045 H  H    . LYS A 1 256 ? 15.304  -38.771 -16.351 1.00 73.93  ? 617 LYS A H    1 
ATOM   4046 H  HA   . LYS A 1 256 ? 14.658  -37.481 -14.047 1.00 88.15  ? 617 LYS A HA   1 
ATOM   4047 H  HB2  . LYS A 1 256 ? 15.216  -39.719 -13.678 1.00 90.08  ? 617 LYS A HB2  1 
ATOM   4048 H  HB3  . LYS A 1 256 ? 16.609  -39.499 -14.406 1.00 90.08  ? 617 LYS A HB3  1 
ATOM   4049 H  HG2  . LYS A 1 256 ? 17.367  -38.202 -12.673 1.00 96.14  ? 617 LYS A HG2  1 
ATOM   4050 H  HG3  . LYS A 1 256 ? 15.938  -38.239 -11.975 1.00 96.14  ? 617 LYS A HG3  1 
ATOM   4051 H  HD2  . LYS A 1 256 ? 17.449  -40.592 -12.324 1.00 118.32 ? 617 LYS A HD2  1 
ATOM   4052 H  HD3  . LYS A 1 256 ? 17.572  -39.717 -11.001 1.00 118.32 ? 617 LYS A HD3  1 
ATOM   4053 H  HE2  . LYS A 1 256 ? 15.250  -40.072 -10.636 1.00 131.84 ? 617 LYS A HE2  1 
ATOM   4054 H  HE3  . LYS A 1 256 ? 15.261  -41.088 -11.859 1.00 131.84 ? 617 LYS A HE3  1 
ATOM   4055 H  HZ1  . LYS A 1 256 ? 15.459  -42.210 -9.892  1.00 141.94 ? 617 LYS A HZ1  1 
ATOM   4056 H  HZ2  . LYS A 1 256 ? 16.673  -42.410 -10.657 1.00 141.94 ? 617 LYS A HZ2  1 
ATOM   4057 H  HZ3  . LYS A 1 256 ? 16.663  -41.484 -9.542  1.00 141.94 ? 617 LYS A HZ3  1 
ATOM   4058 N  N    . VAL A 1 257 ? 16.326  -35.710 -14.166 1.00 56.29  ? 618 VAL A N    1 
ATOM   4059 C  CA   . VAL A 1 257 ? 17.279  -34.621 -14.331 1.00 69.82  ? 618 VAL A CA   1 
ATOM   4060 C  C    . VAL A 1 257 ? 17.892  -34.219 -12.992 1.00 63.74  ? 618 VAL A C    1 
ATOM   4061 O  O    . VAL A 1 257 ? 17.274  -33.481 -12.231 1.00 54.40  ? 618 VAL A O    1 
ATOM   4062 C  CB   . VAL A 1 257 ? 16.606  -33.393 -14.962 1.00 63.94  ? 618 VAL A CB   1 
ATOM   4063 C  CG1  . VAL A 1 257 ? 17.615  -32.265 -15.161 1.00 52.26  ? 618 VAL A CG1  1 
ATOM   4064 C  CG2  . VAL A 1 257 ? 15.958  -33.774 -16.283 1.00 83.11  ? 618 VAL A CG2  1 
ATOM   4065 H  H    . VAL A 1 257 ? 15.713  -35.551 -13.584 1.00 67.55  ? 618 VAL A H    1 
ATOM   4066 H  HA   . VAL A 1 257 ? 17.995  -34.909 -14.918 1.00 83.79  ? 618 VAL A HA   1 
ATOM   4067 H  HB   . VAL A 1 257 ? 15.910  -33.073 -14.367 1.00 76.73  ? 618 VAL A HB   1 
ATOM   4068 H  HG11 . VAL A 1 257 ? 17.164  -31.505 -15.560 1.00 62.71  ? 618 VAL A HG11 1 
ATOM   4069 H  HG12 . VAL A 1 257 ? 17.984  -32.016 -14.299 1.00 62.71  ? 618 VAL A HG12 1 
ATOM   4070 H  HG13 . VAL A 1 257 ? 18.323  -32.575 -15.747 1.00 62.71  ? 618 VAL A HG13 1 
ATOM   4071 H  HG21 . VAL A 1 257 ? 15.538  -32.988 -16.667 1.00 99.73  ? 618 VAL A HG21 1 
ATOM   4072 H  HG22 . VAL A 1 257 ? 16.641  -34.112 -16.884 1.00 99.73  ? 618 VAL A HG22 1 
ATOM   4073 H  HG23 . VAL A 1 257 ? 15.291  -34.460 -16.121 1.00 99.73  ? 618 VAL A HG23 1 
ATOM   4074 N  N    . PRO A 1 258 ? 19.113  -34.697 -12.700 1.00 65.12  ? 619 PRO A N    1 
ATOM   4075 C  CA   . PRO A 1 258 ? 19.775  -34.242 -11.473 1.00 62.49  ? 619 PRO A CA   1 
ATOM   4076 C  C    . PRO A 1 258 ? 19.943  -32.730 -11.480 1.00 66.79  ? 619 PRO A C    1 
ATOM   4077 O  O    . PRO A 1 258 ? 20.513  -32.186 -12.423 1.00 67.05  ? 619 PRO A O    1 
ATOM   4078 C  CB   . PRO A 1 258 ? 21.133  -34.954 -11.512 1.00 70.69  ? 619 PRO A CB   1 
ATOM   4079 C  CG   . PRO A 1 258 ? 20.930  -36.121 -12.411 1.00 70.79  ? 619 PRO A CG   1 
ATOM   4080 C  CD   . PRO A 1 258 ? 19.935  -35.672 -13.438 1.00 73.14  ? 619 PRO A CD   1 
ATOM   4081 H  HA   . PRO A 1 258 ? 19.278  -34.518 -10.687 1.00 74.99  ? 619 PRO A HA   1 
ATOM   4082 H  HB2  . PRO A 1 258 ? 21.806  -34.355 -11.872 1.00 84.83  ? 619 PRO A HB2  1 
ATOM   4083 H  HB3  . PRO A 1 258 ? 21.375  -35.246 -10.619 1.00 84.83  ? 619 PRO A HB3  1 
ATOM   4084 H  HG2  . PRO A 1 258 ? 21.772  -36.357 -12.832 1.00 84.95  ? 619 PRO A HG2  1 
ATOM   4085 H  HG3  . PRO A 1 258 ? 20.581  -36.868 -11.900 1.00 84.95  ? 619 PRO A HG3  1 
ATOM   4086 H  HD2  . PRO A 1 258 ? 20.385  -35.243 -14.182 1.00 87.77  ? 619 PRO A HD2  1 
ATOM   4087 H  HD3  . PRO A 1 258 ? 19.392  -36.420 -13.732 1.00 87.77  ? 619 PRO A HD3  1 
ATOM   4088 N  N    . LEU A 1 259 ? 19.434  -32.061 -10.453 1.00 56.59  ? 620 LEU A N    1 
ATOM   4089 C  CA   . LEU A 1 259 ? 19.470  -30.605 -10.403 1.00 56.48  ? 620 LEU A CA   1 
ATOM   4090 C  C    . LEU A 1 259 ? 20.893  -30.071 -10.266 1.00 56.28  ? 620 LEU A C    1 
ATOM   4091 O  O    . LEU A 1 259 ? 21.130  -28.879 -10.456 1.00 58.84  ? 620 LEU A O    1 
ATOM   4092 C  CB   . LEU A 1 259 ? 18.612  -30.092 -9.243  1.00 65.12  ? 620 LEU A CB   1 
ATOM   4093 C  CG   . LEU A 1 259 ? 17.121  -30.434 -9.306  1.00 63.55  ? 620 LEU A CG   1 
ATOM   4094 C  CD1  . LEU A 1 259 ? 16.384  -29.791 -8.139  1.00 56.24  ? 620 LEU A CD1  1 
ATOM   4095 C  CD2  . LEU A 1 259 ? 16.511  -29.999 -10.631 1.00 59.64  ? 620 LEU A CD2  1 
ATOM   4096 H  H    . LEU A 1 259 ? 19.062  -32.427 -9.769  1.00 67.91  ? 620 LEU A H    1 
ATOM   4097 H  HA   . LEU A 1 259 ? 19.099  -30.254 -11.227 1.00 67.78  ? 620 LEU A HA   1 
ATOM   4098 H  HB2  . LEU A 1 259 ? 18.959  -30.466 -8.418  1.00 78.14  ? 620 LEU A HB2  1 
ATOM   4099 H  HB3  . LEU A 1 259 ? 18.685  -29.125 -9.214  1.00 78.14  ? 620 LEU A HB3  1 
ATOM   4100 H  HG   . LEU A 1 259 ? 17.016  -31.395 -9.231  1.00 76.26  ? 620 LEU A HG   1 
ATOM   4101 H  HD11 . LEU A 1 259 ? 15.443  -30.019 -8.197  1.00 67.49  ? 620 LEU A HD11 1 
ATOM   4102 H  HD12 . LEU A 1 259 ? 16.755  -30.126 -7.308  1.00 67.49  ? 620 LEU A HD12 1 
ATOM   4103 H  HD13 . LEU A 1 259 ? 16.495  -28.829 -8.188  1.00 67.49  ? 620 LEU A HD13 1 
ATOM   4104 H  HD21 . LEU A 1 259 ? 15.569  -30.231 -10.635 1.00 71.57  ? 620 LEU A HD21 1 
ATOM   4105 H  HD22 . LEU A 1 259 ? 16.617  -29.040 -10.727 1.00 71.57  ? 620 LEU A HD22 1 
ATOM   4106 H  HD23 . LEU A 1 259 ? 16.968  -30.457 -11.353 1.00 71.57  ? 620 LEU A HD23 1 
ATOM   4107 N  N    . SER A 1 260 ? 21.836  -30.944 -9.927  1.00 59.45  ? 621 SER A N    1 
ATOM   4108 C  CA   . SER A 1 260 ? 23.233  -30.533 -9.820  1.00 62.93  ? 621 SER A CA   1 
ATOM   4109 C  C    . SER A 1 260 ? 23.752  -30.043 -11.168 1.00 63.08  ? 621 SER A C    1 
ATOM   4110 O  O    . SER A 1 260 ? 24.589  -29.144 -11.226 1.00 64.74  ? 621 SER A O    1 
ATOM   4111 C  CB   . SER A 1 260 ? 24.102  -31.683 -9.304  1.00 67.22  ? 621 SER A CB   1 
ATOM   4112 O  OG   . SER A 1 260 ? 24.071  -32.791 -10.183 1.00 76.01  ? 621 SER A OG   1 
ATOM   4113 H  H    . SER A 1 260 ? 21.696  -31.774 -9.754  1.00 71.34  ? 621 SER A H    1 
ATOM   4114 H  HA   . SER A 1 260 ? 23.299  -29.800 -9.189  1.00 75.52  ? 621 SER A HA   1 
ATOM   4115 H  HB2  . SER A 1 260 ? 25.018  -31.372 -9.224  1.00 80.67  ? 621 SER A HB2  1 
ATOM   4116 H  HB3  . SER A 1 260 ? 23.771  -31.961 -8.436  1.00 80.67  ? 621 SER A HB3  1 
ATOM   4117 H  HG   . SER A 1 260 ? 24.553  -33.410 -9.883  1.00 91.21  ? 621 SER A HG   1 
ATOM   4118 N  N    . GLN A 1 261 ? 23.243  -30.628 -12.249 1.00 61.69  ? 622 GLN A N    1 
ATOM   4119 C  CA   . GLN A 1 261 ? 23.641  -30.226 -13.595 1.00 61.84  ? 622 GLN A CA   1 
ATOM   4120 C  C    . GLN A 1 261 ? 23.367  -28.744 -13.818 1.00 59.74  ? 622 GLN A C    1 
ATOM   4121 O  O    . GLN A 1 261 ? 24.102  -28.069 -14.533 1.00 67.70  ? 622 GLN A O    1 
ATOM   4122 C  CB   . GLN A 1 261 ? 22.901  -31.053 -14.645 1.00 67.14  ? 622 GLN A CB   1 
ATOM   4123 C  CG   . GLN A 1 261 ? 23.242  -32.532 -14.639 1.00 80.76  ? 622 GLN A CG   1 
ATOM   4124 C  CD   . GLN A 1 261 ? 22.341  -33.334 -15.561 1.00 101.59 ? 622 GLN A CD   1 
ATOM   4125 O  OE1  . GLN A 1 261 ? 21.491  -32.775 -16.256 1.00 100.13 ? 622 GLN A OE1  1 
ATOM   4126 N  NE2  . GLN A 1 261 ? 22.517  -34.650 -15.567 1.00 99.95  ? 622 GLN A NE2  1 
ATOM   4127 H  H    . GLN A 1 261 ? 22.664  -31.263 -12.229 1.00 74.03  ? 622 GLN A H    1 
ATOM   4128 H  HA   . GLN A 1 261 ? 24.593  -30.378 -13.705 1.00 74.21  ? 622 GLN A HA   1 
ATOM   4129 H  HB2  . GLN A 1 261 ? 21.947  -30.970 -14.488 1.00 80.57  ? 622 GLN A HB2  1 
ATOM   4130 H  HB3  . GLN A 1 261 ? 23.118  -30.704 -15.524 1.00 80.57  ? 622 GLN A HB3  1 
ATOM   4131 H  HG2  . GLN A 1 261 ? 24.158  -32.648 -14.938 1.00 96.91  ? 622 GLN A HG2  1 
ATOM   4132 H  HG3  . GLN A 1 261 ? 23.138  -32.879 -13.739 1.00 96.91  ? 622 GLN A HG3  1 
ATOM   4133 H  HE21 . GLN A 1 261 ? 23.117  -35.006 -15.064 1.00 119.94 ? 622 GLN A HE21 1 
ATOM   4134 H  HE22 . GLN A 1 261 ? 22.030  -35.147 -16.072 1.00 119.94 ? 622 GLN A HE22 1 
ATOM   4135 N  N    . LEU A 1 262 ? 22.308  -28.240 -13.192 1.00 63.91  ? 623 LEU A N    1 
ATOM   4136 C  CA   . LEU A 1 262 ? 21.934  -26.841 -13.343 1.00 54.80  ? 623 LEU A CA   1 
ATOM   4137 C  C    . LEU A 1 262 ? 22.896  -25.921 -12.603 1.00 57.38  ? 623 LEU A C    1 
ATOM   4138 O  O    . LEU A 1 262 ? 23.086  -24.773 -12.992 1.00 57.59  ? 623 LEU A O    1 
ATOM   4139 C  CB   . LEU A 1 262 ? 20.510  -26.612 -12.838 1.00 56.02  ? 623 LEU A CB   1 
ATOM   4140 C  CG   . LEU A 1 262 ? 19.415  -27.461 -13.487 1.00 63.59  ? 623 LEU A CG   1 
ATOM   4141 C  CD1  . LEU A 1 262 ? 18.113  -27.297 -12.727 1.00 52.83  ? 623 LEU A CD1  1 
ATOM   4142 C  CD2  . LEU A 1 262 ? 19.228  -27.079 -14.941 1.00 69.24  ? 623 LEU A CD2  1 
ATOM   4143 H  H    . LEU A 1 262 ? 21.790  -28.690 -12.674 1.00 76.69  ? 623 LEU A H    1 
ATOM   4144 H  HA   . LEU A 1 262 ? 21.960  -26.608 -14.284 1.00 65.76  ? 623 LEU A HA   1 
ATOM   4145 H  HB2  . LEU A 1 262 ? 20.492  -26.798 -11.886 1.00 67.22  ? 623 LEU A HB2  1 
ATOM   4146 H  HB3  . LEU A 1 262 ? 20.281  -25.682 -12.989 1.00 67.22  ? 623 LEU A HB3  1 
ATOM   4147 H  HG   . LEU A 1 262 ? 19.671  -28.395 -13.449 1.00 76.30  ? 623 LEU A HG   1 
ATOM   4148 H  HD11 . LEU A 1 262 ? 17.431  -27.841 -13.151 1.00 63.40  ? 623 LEU A HD11 1 
ATOM   4149 H  HD12 . LEU A 1 262 ? 18.245  -27.585 -11.810 1.00 63.40  ? 623 LEU A HD12 1 
ATOM   4150 H  HD13 . LEU A 1 262 ? 17.852  -26.363 -12.747 1.00 63.40  ? 623 LEU A HD13 1 
ATOM   4151 H  HD21 . LEU A 1 262 ? 18.529  -27.632 -15.325 1.00 83.09  ? 623 LEU A HD21 1 
ATOM   4152 H  HD22 . LEU A 1 262 ? 18.976  -26.144 -14.992 1.00 83.09  ? 623 LEU A HD22 1 
ATOM   4153 H  HD23 . LEU A 1 262 ? 20.062  -27.224 -15.414 1.00 83.09  ? 623 LEU A HD23 1 
ATOM   4154 N  N    . LEU A 1 263 ? 23.501  -26.430 -11.536 1.00 63.46  ? 624 LEU A N    1 
ATOM   4155 C  CA   . LEU A 1 263 ? 24.359  -25.616 -10.681 1.00 70.58  ? 624 LEU A CA   1 
ATOM   4156 C  C    . LEU A 1 263 ? 25.576  -25.076 -11.430 1.00 65.70  ? 624 LEU A C    1 
ATOM   4157 O  O    . LEU A 1 263 ? 26.163  -24.064 -11.031 1.00 67.69  ? 624 LEU A O    1 
ATOM   4158 C  CB   . LEU A 1 263 ? 24.814  -26.428 -9.463  1.00 65.74  ? 624 LEU A CB   1 
ATOM   4159 C  CG   . LEU A 1 263 ? 23.702  -26.884 -8.515  1.00 67.88  ? 624 LEU A CG   1 
ATOM   4160 C  CD1  . LEU A 1 263 ? 24.244  -27.839 -7.458  1.00 65.32  ? 624 LEU A CD1  1 
ATOM   4161 C  CD2  . LEU A 1 263 ? 23.042  -25.681 -7.856  1.00 60.36  ? 624 LEU A CD2  1 
ATOM   4162 H  H    . LEU A 1 263 ? 23.431  -27.249 -11.283 1.00 76.15  ? 624 LEU A H    1 
ATOM   4163 H  HA   . LEU A 1 263 ? 23.849  -24.858 -10.358 1.00 84.69  ? 624 LEU A HA   1 
ATOM   4164 H  HB2  . LEU A 1 263 ? 25.270  -27.224 -9.779  1.00 78.89  ? 624 LEU A HB2  1 
ATOM   4165 H  HB3  . LEU A 1 263 ? 25.431  -25.886 -8.947  1.00 78.89  ? 624 LEU A HB3  1 
ATOM   4166 H  HG   . LEU A 1 263 ? 23.025  -27.355 -9.026  1.00 81.46  ? 624 LEU A HG   1 
ATOM   4167 H  HD11 . LEU A 1 263 ? 23.517  -28.109 -6.875  1.00 78.39  ? 624 LEU A HD11 1 
ATOM   4168 H  HD12 . LEU A 1 263 ? 24.621  -28.616 -7.899  1.00 78.39  ? 624 LEU A HD12 1 
ATOM   4169 H  HD13 . LEU A 1 263 ? 24.930  -27.384 -6.945  1.00 78.39  ? 624 LEU A HD13 1 
ATOM   4170 H  HD21 . LEU A 1 263 ? 22.342  -25.992 -7.261  1.00 72.44  ? 624 LEU A HD21 1 
ATOM   4171 H  HD22 . LEU A 1 263 ? 23.710  -25.191 -7.353  1.00 72.44  ? 624 LEU A HD22 1 
ATOM   4172 H  HD23 . LEU A 1 263 ? 22.662  -25.113 -8.545  1.00 72.44  ? 624 LEU A HD23 1 
ATOM   4173 N  N    . THR A 1 264 ? 25.930  -25.751 -12.519 1.00 68.15  ? 625 THR A N    1 
ATOM   4174 C  CA   . THR A 1 264 ? 27.116  -25.425 -13.303 1.00 70.22  ? 625 THR A CA   1 
ATOM   4175 C  C    . THR A 1 264 ? 26.774  -24.852 -14.683 1.00 70.37  ? 625 THR A C    1 
ATOM   4176 O  O    . THR A 1 264 ? 27.660  -24.679 -15.525 1.00 71.73  ? 625 THR A O    1 
ATOM   4177 C  CB   . THR A 1 264 ? 27.986  -26.674 -13.488 1.00 77.15  ? 625 THR A CB   1 
ATOM   4178 O  OG1  . THR A 1 264 ? 27.225  -27.681 -14.166 1.00 76.45  ? 625 THR A OG1  1 
ATOM   4179 C  CG2  . THR A 1 264 ? 28.436  -27.211 -12.132 1.00 82.38  ? 625 THR A CG2  1 
ATOM   4180 H  H    . THR A 1 264 ? 25.488  -26.419 -12.831 1.00 81.78  ? 625 THR A H    1 
ATOM   4181 H  HA   . THR A 1 264 ? 27.639  -24.763 -12.824 1.00 84.26  ? 625 THR A HA   1 
ATOM   4182 H  HB   . THR A 1 264 ? 28.772  -26.451 -14.011 1.00 92.58  ? 625 THR A HB   1 
ATOM   4183 H  HG1  . THR A 1 264 ? 27.692  -28.371 -14.273 1.00 91.74  ? 625 THR A HG1  1 
ATOM   4184 H  HG21 . THR A 1 264 ? 28.986  -28.001 -12.254 1.00 98.85  ? 625 THR A HG21 1 
ATOM   4185 H  HG22 . THR A 1 264 ? 28.952  -26.536 -11.663 1.00 98.85  ? 625 THR A HG22 1 
ATOM   4186 H  HG23 . THR A 1 264 ? 27.663  -27.445 -11.595 1.00 98.85  ? 625 THR A HG23 1 
ATOM   4187 N  N    . SER A 1 265 ? 25.495  -24.559 -14.916 1.00 64.52  ? 626 SER A N    1 
ATOM   4188 C  CA   . SER A 1 265 ? 25.066  -23.998 -16.195 1.00 70.71  ? 626 SER A CA   1 
ATOM   4189 C  C    . SER A 1 265 ? 24.908  -22.484 -16.114 1.00 66.80  ? 626 SER A C    1 
ATOM   4190 O  O    . SER A 1 265 ? 24.715  -21.928 -15.035 1.00 62.63  ? 626 SER A O    1 
ATOM   4191 C  CB   . SER A 1 265 ? 23.753  -24.636 -16.653 1.00 69.41  ? 626 SER A CB   1 
ATOM   4192 O  OG   . SER A 1 265 ? 23.906  -26.030 -16.849 1.00 68.30  ? 626 SER A OG   1 
ATOM   4193 H  H    . SER A 1 265 ? 24.858  -24.676 -14.350 1.00 77.43  ? 626 SER A H    1 
ATOM   4194 H  HA   . SER A 1 265 ? 25.741  -24.191 -16.865 1.00 84.85  ? 626 SER A HA   1 
ATOM   4195 H  HB2  . SER A 1 265 ? 23.076  -24.485 -15.975 1.00 83.29  ? 626 SER A HB2  1 
ATOM   4196 H  HB3  . SER A 1 265 ? 23.479  -24.228 -17.490 1.00 83.29  ? 626 SER A HB3  1 
ATOM   4197 H  HG   . SER A 1 265 ? 24.142  -26.397 -16.131 1.00 81.95  ? 626 SER A HG   1 
ATOM   4198 N  N    . GLU A 1 266 ? 24.999  -21.830 -17.267 1.00 63.91  ? 627 GLU A N    1 
ATOM   4199 C  CA   . GLU A 1 266 ? 24.839  -20.382 -17.371 1.00 66.48  ? 627 GLU A CA   1 
ATOM   4200 C  C    . GLU A 1 266 ? 23.471  -19.941 -16.856 1.00 67.38  ? 627 GLU A C    1 
ATOM   4201 O  O    . GLU A 1 266 ? 22.438  -20.424 -17.325 1.00 60.24  ? 627 GLU A O    1 
ATOM   4202 C  CB   . GLU A 1 266 ? 25.027  -19.941 -18.829 1.00 78.46  ? 627 GLU A CB   1 
ATOM   4203 C  CG   . GLU A 1 266 ? 24.634  -18.498 -19.131 1.00 95.48  ? 627 GLU A CG   1 
ATOM   4204 C  CD   . GLU A 1 266 ? 25.465  -17.484 -18.371 1.00 123.18 ? 627 GLU A CD   1 
ATOM   4205 O  OE1  . GLU A 1 266 ? 26.524  -17.861 -17.825 1.00 135.17 ? 627 GLU A OE1  1 
ATOM   4206 O  OE2  . GLU A 1 266 ? 25.061  -16.302 -18.322 1.00 127.42 ? 627 GLU A OE2  1 
ATOM   4207 H  H    . GLU A 1 266 ? 25.158  -22.212 -18.022 1.00 76.69  ? 627 GLU A H    1 
ATOM   4208 H  HA   . GLU A 1 266 ? 25.519  -19.947 -16.833 1.00 79.78  ? 627 GLU A HA   1 
ATOM   4209 H  HB2  . GLU A 1 266 ? 25.963  -20.042 -19.062 1.00 94.15  ? 627 GLU A HB2  1 
ATOM   4210 H  HB3  . GLU A 1 266 ? 24.487  -20.514 -19.395 1.00 94.15  ? 627 GLU A HB3  1 
ATOM   4211 H  HG2  . GLU A 1 266 ? 24.752  -18.332 -20.079 1.00 114.58 ? 627 GLU A HG2  1 
ATOM   4212 H  HG3  . GLU A 1 266 ? 23.704  -18.367 -18.885 1.00 114.58 ? 627 GLU A HG3  1 
ATOM   4213 N  N    . ASP A 1 267 ? 23.473  -19.024 -15.890 1.00 65.26  ? 628 ASP A N    1 
ATOM   4214 C  CA   . ASP A 1 267 ? 22.241  -18.556 -15.257 1.00 68.68  ? 628 ASP A CA   1 
ATOM   4215 C  C    . ASP A 1 267 ? 21.417  -19.735 -14.735 1.00 54.52  ? 628 ASP A C    1 
ATOM   4216 O  O    . ASP A 1 267 ? 20.196  -19.645 -14.583 1.00 51.47  ? 628 ASP A O    1 
ATOM   4217 C  CB   . ASP A 1 267 ? 21.426  -17.708 -16.239 1.00 72.91  ? 628 ASP A CB   1 
ATOM   4218 C  CG   . ASP A 1 267 ? 21.679  -16.219 -16.074 1.00 99.88  ? 628 ASP A CG   1 
ATOM   4219 O  OD1  . ASP A 1 267 ? 22.745  -15.840 -15.543 1.00 93.41  ? 628 ASP A OD1  1 
ATOM   4220 O  OD2  . ASP A 1 267 ? 20.806  -15.423 -16.479 1.00 123.75 ? 628 ASP A OD2  1 
ATOM   4221 H  H    . ASP A 1 267 ? 24.184  -18.652 -15.580 1.00 78.31  ? 628 ASP A H    1 
ATOM   4222 H  HA   . ASP A 1 267 ? 22.471  -17.996 -14.499 1.00 82.41  ? 628 ASP A HA   1 
ATOM   4223 H  HB2  . ASP A 1 267 ? 21.666  -17.956 -17.145 1.00 87.49  ? 628 ASP A HB2  1 
ATOM   4224 H  HB3  . ASP A 1 267 ? 20.481  -17.871 -16.089 1.00 87.49  ? 628 ASP A HB3  1 
ATOM   4225 N  N    . MET A 1 268 ? 22.114  -20.835 -14.460 1.00 61.22  ? 629 MET A N    1 
ATOM   4226 C  CA   . MET A 1 268 ? 21.516  -22.041 -13.901 1.00 59.07  ? 629 MET A CA   1 
ATOM   4227 C  C    . MET A 1 268 ? 20.249  -22.449 -14.637 1.00 59.92  ? 629 MET A C    1 
ATOM   4228 O  O    . MET A 1 268 ? 19.262  -22.845 -14.014 1.00 47.62  ? 629 MET A O    1 
ATOM   4229 C  CB   . MET A 1 268 ? 21.208  -21.833 -12.420 1.00 53.07  ? 629 MET A CB   1 
ATOM   4230 C  CG   . MET A 1 268 ? 22.248  -21.010 -11.698 1.00 56.42  ? 629 MET A CG   1 
ATOM   4231 S  SD   . MET A 1 268 ? 22.023  -21.081 -9.908  1.00 75.09  ? 629 MET A SD   1 
ATOM   4232 C  CE   . MET A 1 268 ? 22.712  -22.688 -9.592  1.00 58.05  ? 629 MET A CE   1 
ATOM   4233 H  H    . MET A 1 268 ? 22.961  -20.906 -14.593 1.00 73.46  ? 629 MET A H    1 
ATOM   4234 H  HA   . MET A 1 268 ? 22.159  -22.764 -13.969 1.00 70.88  ? 629 MET A HA   1 
ATOM   4235 H  HB2  . MET A 1 268 ? 20.357  -21.374 -12.338 1.00 63.68  ? 629 MET A HB2  1 
ATOM   4236 H  HB3  . MET A 1 268 ? 21.159  -22.698 -11.985 1.00 63.68  ? 629 MET A HB3  1 
ATOM   4237 H  HG2  . MET A 1 268 ? 23.131  -21.354 -11.907 1.00 67.71  ? 629 MET A HG2  1 
ATOM   4238 H  HG3  . MET A 1 268 ? 22.174  -20.084 -11.977 1.00 67.71  ? 629 MET A HG3  1 
ATOM   4239 H  HE1  . MET A 1 268 ? 22.660  -22.872 -8.641  1.00 69.65  ? 629 MET A HE1  1 
ATOM   4240 H  HE2  . MET A 1 268 ? 22.206  -23.351 -10.086 1.00 69.65  ? 629 MET A HE2  1 
ATOM   4241 H  HE3  . MET A 1 268 ? 23.638  -22.696 -9.880  1.00 69.65  ? 629 MET A HE3  1 
ATOM   4242 N  N    . THR A 1 269 ? 20.286  -22.334 -15.962 1.00 54.83  ? 630 THR A N    1 
ATOM   4243 C  CA   . THR A 1 269 ? 19.142  -22.659 -16.799 1.00 55.31  ? 630 THR A CA   1 
ATOM   4244 C  C    . THR A 1 269 ? 19.575  -23.512 -17.985 1.00 56.13  ? 630 THR A C    1 
ATOM   4245 O  O    . THR A 1 269 ? 20.593  -23.236 -18.617 1.00 51.04  ? 630 THR A O    1 
ATOM   4246 C  CB   . THR A 1 269 ? 18.438  -21.386 -17.327 1.00 70.70  ? 630 THR A CB   1 
ATOM   4247 O  OG1  . THR A 1 269 ? 18.028  -20.565 -16.227 1.00 64.04  ? 630 THR A OG1  1 
ATOM   4248 C  CG2  . THR A 1 269 ? 17.215  -21.745 -18.175 1.00 53.39  ? 630 THR A CG2  1 
ATOM   4249 H  H    . THR A 1 269 ? 20.974  -22.066 -16.404 1.00 65.80  ? 630 THR A H    1 
ATOM   4250 H  HA   . THR A 1 269 ? 18.500  -23.167 -16.279 1.00 66.37  ? 630 THR A HA   1 
ATOM   4251 H  HB   . THR A 1 269 ? 19.056  -20.888 -17.884 1.00 84.84  ? 630 THR A HB   1 
ATOM   4252 H  HG1  . THR A 1 269 ? 18.697  -20.340 -15.772 1.00 76.85  ? 630 THR A HG1  1 
ATOM   4253 H  HG21 . THR A 1 269 ? 16.786  -20.936 -18.497 1.00 64.07  ? 630 THR A HG21 1 
ATOM   4254 H  HG22 . THR A 1 269 ? 17.485  -22.283 -18.936 1.00 64.07  ? 630 THR A HG22 1 
ATOM   4255 H  HG23 . THR A 1 269 ? 16.579  -22.248 -17.643 1.00 64.07  ? 630 THR A HG23 1 
ATOM   4256 N  N    . VAL A 1 270 ? 18.810  -24.561 -18.264 1.00 48.01  ? 631 VAL A N    1 
ATOM   4257 C  CA   . VAL A 1 270 ? 18.982  -25.323 -19.488 1.00 68.92  ? 631 VAL A CA   1 
ATOM   4258 C  C    . VAL A 1 270 ? 17.645  -25.332 -20.200 1.00 71.56  ? 631 VAL A C    1 
ATOM   4259 O  O    . VAL A 1 270 ? 16.589  -25.365 -19.569 1.00 49.78  ? 631 VAL A O    1 
ATOM   4260 C  CB   . VAL A 1 270 ? 19.470  -26.772 -19.236 1.00 68.02  ? 631 VAL A CB   1 
ATOM   4261 C  CG1  . VAL A 1 270 ? 20.708  -26.776 -18.342 1.00 63.82  ? 631 VAL A CG1  1 
ATOM   4262 C  CG2  . VAL A 1 270 ? 18.365  -27.625 -18.630 1.00 81.86  ? 631 VAL A CG2  1 
ATOM   4263 H  H    . VAL A 1 270 ? 18.181  -24.852 -17.755 1.00 57.61  ? 631 VAL A H    1 
ATOM   4264 H  HA   . VAL A 1 270 ? 19.629  -24.877 -20.056 1.00 82.71  ? 631 VAL A HA   1 
ATOM   4265 H  HB   . VAL A 1 270 ? 19.718  -27.169 -20.086 1.00 81.62  ? 631 VAL A HB   1 
ATOM   4266 H  HG11 . VAL A 1 270 ? 20.991  -27.693 -18.200 1.00 76.59  ? 631 VAL A HG11 1 
ATOM   4267 H  HG12 . VAL A 1 270 ? 21.414  -26.275 -18.778 1.00 76.59  ? 631 VAL A HG12 1 
ATOM   4268 H  HG13 . VAL A 1 270 ? 20.485  -26.364 -17.492 1.00 76.59  ? 631 VAL A HG13 1 
ATOM   4269 H  HG21 . VAL A 1 270 ? 18.704  -28.523 -18.486 1.00 98.24  ? 631 VAL A HG21 1 
ATOM   4270 H  HG22 . VAL A 1 270 ? 18.092  -27.235 -17.785 1.00 98.24  ? 631 VAL A HG22 1 
ATOM   4271 H  HG23 . VAL A 1 270 ? 17.613  -27.649 -19.242 1.00 98.24  ? 631 VAL A HG23 1 
ATOM   4272 N  N    . SER A 1 271 ? 17.708  -25.281 -21.520 1.00 51.33  ? 632 SER A N    1 
ATOM   4273 C  CA   . SER A 1 271 ? 16.530  -25.299 -22.366 1.00 52.81  ? 632 SER A CA   1 
ATOM   4274 C  C    . SER A 1 271 ? 16.838  -26.168 -23.573 1.00 65.95  ? 632 SER A C    1 
ATOM   4275 O  O    . SER A 1 271 ? 17.660  -25.800 -24.407 1.00 50.20  ? 632 SER A O    1 
ATOM   4276 C  CB   . SER A 1 271 ? 16.150  -23.881 -22.795 1.00 69.89  ? 632 SER A CB   1 
ATOM   4277 O  OG   . SER A 1 271 ? 15.178  -23.902 -23.824 1.00 102.10 ? 632 SER A OG   1 
ATOM   4278 H  H    . SER A 1 271 ? 18.445  -25.234 -21.961 1.00 61.59  ? 632 SER A H    1 
ATOM   4279 H  HA   . SER A 1 271 ? 15.785  -25.689 -21.882 1.00 63.37  ? 632 SER A HA   1 
ATOM   4280 H  HB2  . SER A 1 271 ? 15.788  -23.407 -22.030 1.00 83.87  ? 632 SER A HB2  1 
ATOM   4281 H  HB3  . SER A 1 271 ? 16.943  -23.428 -23.120 1.00 83.87  ? 632 SER A HB3  1 
ATOM   4282 H  HG   . SER A 1 271 ? 14.981  -23.117 -24.048 1.00 122.52 ? 632 SER A HG   1 
ATOM   4283 N  N    . GLN A 1 272 ? 16.207  -27.332 -23.657 1.00 60.80  ? 633 GLN A N    1 
ATOM   4284 C  CA   . GLN A 1 272 ? 16.487  -28.243 -24.759 1.00 71.82  ? 633 GLN A CA   1 
ATOM   4285 C  C    . GLN A 1 272 ? 15.386  -29.272 -24.959 1.00 58.48  ? 633 GLN A C    1 
ATOM   4286 O  O    . GLN A 1 272 ? 14.467  -29.378 -24.157 1.00 44.57  ? 633 GLN A O    1 
ATOM   4287 C  CB   . GLN A 1 272 ? 17.819  -28.963 -24.521 1.00 68.29  ? 633 GLN A CB   1 
ATOM   4288 C  CG   . GLN A 1 272 ? 17.857  -29.830 -23.271 1.00 75.21  ? 633 GLN A CG   1 
ATOM   4289 C  CD   . GLN A 1 272 ? 19.087  -30.726 -23.216 1.00 86.16  ? 633 GLN A CD   1 
ATOM   4290 O  OE1  . GLN A 1 272 ? 20.153  -30.313 -22.757 1.00 69.17  ? 633 GLN A OE1  1 
ATOM   4291 N  NE2  . GLN A 1 272 ? 18.942  -31.960 -23.684 1.00 87.06  ? 633 GLN A NE2  1 
ATOM   4292 H  H    . GLN A 1 272 ? 15.620  -27.616 -23.096 1.00 72.96  ? 633 GLN A H    1 
ATOM   4293 H  HA   . GLN A 1 272 ? 16.567  -27.729 -25.578 1.00 86.18  ? 633 GLN A HA   1 
ATOM   4294 H  HB2  . GLN A 1 272 ? 18.001  -29.537 -25.282 1.00 81.94  ? 633 GLN A HB2  1 
ATOM   4295 H  HB3  . GLN A 1 272 ? 18.520  -28.299 -24.439 1.00 81.94  ? 633 GLN A HB3  1 
ATOM   4296 H  HG2  . GLN A 1 272 ? 17.867  -29.257 -22.488 1.00 90.25  ? 633 GLN A HG2  1 
ATOM   4297 H  HG3  . GLN A 1 272 ? 17.071  -30.399 -23.256 1.00 90.25  ? 633 GLN A HG3  1 
ATOM   4298 H  HE21 . GLN A 1 272 ? 18.182  -32.214 -23.996 1.00 104.47 ? 633 GLN A HE21 1 
ATOM   4299 H  HE22 . GLN A 1 272 ? 19.607  -32.504 -23.675 1.00 104.47 ? 633 GLN A HE22 1 
ATOM   4300 N  N    . ARG A 1 273 ? 15.484  -30.005 -26.060 1.00 45.93  ? 634 ARG A N    1 
ATOM   4301 C  CA   . ARG A 1 273 ? 14.761  -31.254 -26.231 1.00 70.14  ? 634 ARG A CA   1 
ATOM   4302 C  C    . ARG A 1 273 ? 15.487  -32.329 -25.426 1.00 59.93  ? 634 ARG A C    1 
ATOM   4303 O  O    . ARG A 1 273 ? 16.707  -32.468 -25.533 1.00 69.19  ? 634 ARG A O    1 
ATOM   4304 C  CB   . ARG A 1 273 ? 14.687  -31.655 -27.710 1.00 62.95  ? 634 ARG A CB   1 
ATOM   4305 C  CG   . ARG A 1 273 ? 14.077  -30.607 -28.641 1.00 79.02  ? 634 ARG A CG   1 
ATOM   4306 C  CD   . ARG A 1 273 ? 13.281  -31.270 -29.762 1.00 70.96  ? 634 ARG A CD   1 
ATOM   4307 N  NE   . ARG A 1 273 ? 12.200  -32.075 -29.199 1.00 85.76  ? 634 ARG A NE   1 
ATOM   4308 C  CZ   . ARG A 1 273 ? 10.952  -31.652 -29.015 1.00 89.95  ? 634 ARG A CZ   1 
ATOM   4309 N  NH1  . ARG A 1 273 ? 10.590  -30.426 -29.381 1.00 103.60 ? 634 ARG A NH1  1 
ATOM   4310 N  NH2  . ARG A 1 273 ? 10.056  -32.465 -28.469 1.00 49.98  ? 634 ARG A NH2  1 
ATOM   4311 H  H    . ARG A 1 273 ? 15.972  -29.794 -26.736 1.00 55.12  ? 634 ARG A H    1 
ATOM   4312 H  HA   . ARG A 1 273 ? 13.859  -31.162 -25.887 1.00 84.17  ? 634 ARG A HA   1 
ATOM   4313 H  HB2  . ARG A 1 273 ? 15.587  -31.836 -28.025 1.00 75.54  ? 634 ARG A HB2  1 
ATOM   4314 H  HB3  . ARG A 1 273 ? 14.150  -32.459 -27.784 1.00 75.54  ? 634 ARG A HB3  1 
ATOM   4315 H  HG2  . ARG A 1 273 ? 13.476  -30.038 -28.134 1.00 94.82  ? 634 ARG A HG2  1 
ATOM   4316 H  HG3  . ARG A 1 273 ? 14.786  -30.079 -29.040 1.00 94.82  ? 634 ARG A HG3  1 
ATOM   4317 H  HD2  . ARG A 1 273 ? 12.893  -30.588 -30.332 1.00 85.15  ? 634 ARG A HD2  1 
ATOM   4318 H  HD3  . ARG A 1 273 ? 13.864  -31.851 -30.274 1.00 85.15  ? 634 ARG A HD3  1 
ATOM   4319 H  HE   . ARG A 1 273 ? 12.384  -32.883 -28.969 1.00 102.92 ? 634 ARG A HE   1 
ATOM   4320 H  HH11 . ARG A 1 273 ? 11.168  -29.893 -29.730 1.00 124.32 ? 634 ARG A HH11 1 
ATOM   4321 H  HH12 . ARG A 1 273 ? 9.780   -30.164 -29.263 1.00 124.32 ? 634 ARG A HH12 1 
ATOM   4322 H  HH21 . ARG A 1 273 ? 10.284  -33.262 -28.238 1.00 59.97  ? 634 ARG A HH21 1 
ATOM   4323 H  HH22 . ARG A 1 273 ? 9.245   -32.201 -28.361 1.00 59.97  ? 634 ARG A HH22 1 
ATOM   4324 N  N    . PHE A 1 274 ? 14.742  -33.078 -24.621 1.00 64.18  ? 635 PHE A N    1 
ATOM   4325 C  CA   . PHE A 1 274 ? 15.317  -34.145 -23.806 1.00 59.02  ? 635 PHE A CA   1 
ATOM   4326 C  C    . PHE A 1 274 ? 14.872  -35.495 -24.329 1.00 60.31  ? 635 PHE A C    1 
ATOM   4327 O  O    . PHE A 1 274 ? 13.693  -35.688 -24.631 1.00 47.77  ? 635 PHE A O    1 
ATOM   4328 C  CB   . PHE A 1 274 ? 14.894  -34.009 -22.342 1.00 70.67  ? 635 PHE A CB   1 
ATOM   4329 C  CG   . PHE A 1 274 ? 15.460  -32.806 -21.652 1.00 45.11  ? 635 PHE A CG   1 
ATOM   4330 C  CD1  . PHE A 1 274 ? 14.748  -31.623 -21.595 1.00 54.33  ? 635 PHE A CD1  1 
ATOM   4331 C  CD2  . PHE A 1 274 ? 16.709  -32.863 -21.053 1.00 60.70  ? 635 PHE A CD2  1 
ATOM   4332 C  CE1  . PHE A 1 274 ? 15.272  -30.515 -20.951 1.00 51.82  ? 635 PHE A CE1  1 
ATOM   4333 C  CE2  . PHE A 1 274 ? 17.237  -31.762 -20.413 1.00 59.33  ? 635 PHE A CE2  1 
ATOM   4334 C  CZ   . PHE A 1 274 ? 16.520  -30.586 -20.361 1.00 55.44  ? 635 PHE A CZ   1 
ATOM   4335 H  H    . PHE A 1 274 ? 13.892  -32.987 -24.526 1.00 77.02  ? 635 PHE A H    1 
ATOM   4336 H  HA   . PHE A 1 274 ? 16.285  -34.101 -23.852 1.00 70.83  ? 635 PHE A HA   1 
ATOM   4337 H  HB2  . PHE A 1 274 ? 13.927  -33.945 -22.301 1.00 84.81  ? 635 PHE A HB2  1 
ATOM   4338 H  HB3  . PHE A 1 274 ? 15.191  -34.795 -21.857 1.00 84.81  ? 635 PHE A HB3  1 
ATOM   4339 H  HD1  . PHE A 1 274 ? 13.908  -31.571 -21.990 1.00 65.20  ? 635 PHE A HD1  1 
ATOM   4340 H  HD2  . PHE A 1 274 ? 17.198  -33.654 -21.085 1.00 72.84  ? 635 PHE A HD2  1 
ATOM   4341 H  HE1  . PHE A 1 274 ? 14.787  -29.722 -20.918 1.00 62.18  ? 635 PHE A HE1  1 
ATOM   4342 H  HE2  . PHE A 1 274 ? 18.077  -31.812 -20.016 1.00 71.20  ? 635 PHE A HE2  1 
ATOM   4343 H  HZ   . PHE A 1 274 ? 16.875  -29.843 -19.930 1.00 66.52  ? 635 PHE A HZ   1 
ATOM   4344 N  N    . GLN A 1 275 ? 15.811  -36.430 -24.422 1.00 52.27  ? 636 GLN A N    1 
ATOM   4345 C  CA   . GLN A 1 275 ? 15.480  -37.799 -24.782 1.00 68.87  ? 636 GLN A CA   1 
ATOM   4346 C  C    . GLN A 1 275 ? 14.781  -38.470 -23.605 1.00 66.33  ? 636 GLN A C    1 
ATOM   4347 O  O    . GLN A 1 275 ? 15.225  -38.354 -22.464 1.00 64.09  ? 636 GLN A O    1 
ATOM   4348 C  CB   . GLN A 1 275 ? 16.738  -38.579 -25.183 1.00 62.03  ? 636 GLN A CB   1 
ATOM   4349 C  CG   . GLN A 1 275 ? 16.555  -39.460 -26.414 1.00 78.60  ? 636 GLN A CG   1 
ATOM   4350 C  CD   . GLN A 1 275 ? 17.753  -40.353 -26.686 1.00 97.45  ? 636 GLN A CD   1 
ATOM   4351 O  OE1  . GLN A 1 275 ? 18.887  -40.011 -26.351 1.00 97.50  ? 636 GLN A OE1  1 
ATOM   4352 N  NE2  . GLN A 1 275 ? 17.503  -41.507 -27.294 1.00 116.47 ? 636 GLN A NE2  1 
ATOM   4353 H  H    . GLN A 1 275 ? 16.648  -36.295 -24.281 1.00 62.72  ? 636 GLN A H    1 
ATOM   4354 H  HA   . GLN A 1 275 ? 14.870  -37.794 -25.537 1.00 82.64  ? 636 GLN A HA   1 
ATOM   4355 H  HB2  . GLN A 1 275 ? 17.449  -37.947 -25.374 1.00 74.44  ? 636 GLN A HB2  1 
ATOM   4356 H  HB3  . GLN A 1 275 ? 16.998  -39.152 -24.445 1.00 74.44  ? 636 GLN A HB3  1 
ATOM   4357 H  HG2  . GLN A 1 275 ? 15.781  -40.030 -26.282 1.00 94.32  ? 636 GLN A HG2  1 
ATOM   4358 H  HG3  . GLN A 1 275 ? 16.422  -38.894 -27.190 1.00 94.32  ? 636 GLN A HG3  1 
ATOM   4359 H  HE21 . GLN A 1 275 ? 16.697  -41.713 -27.511 1.00 139.77 ? 636 GLN A HE21 1 
ATOM   4360 H  HE22 . GLN A 1 275 ? 18.148  -42.049 -27.470 1.00 139.77 ? 636 GLN A HE22 1 
ATOM   4361 N  N    . LEU A 1 276 ? 13.674  -39.151 -23.885 1.00 64.41  ? 637 LEU A N    1 
ATOM   4362 C  CA   . LEU A 1 276 ? 12.951  -39.903 -22.866 1.00 61.41  ? 637 LEU A CA   1 
ATOM   4363 C  C    . LEU A 1 276 ? 13.470  -41.332 -22.785 1.00 66.07  ? 637 LEU A C    1 
ATOM   4364 O  O    . LEU A 1 276 ? 13.807  -41.934 -23.807 1.00 74.63  ? 637 LEU A O    1 
ATOM   4365 C  CB   . LEU A 1 276 ? 11.452  -39.918 -23.171 1.00 54.34  ? 637 LEU A CB   1 
ATOM   4366 C  CG   . LEU A 1 276 ? 10.726  -38.578 -23.102 1.00 61.19  ? 637 LEU A CG   1 
ATOM   4367 C  CD1  . LEU A 1 276 ? 9.392   -38.674 -23.818 1.00 61.10  ? 637 LEU A CD1  1 
ATOM   4368 C  CD2  . LEU A 1 276 ? 10.526  -38.153 -21.659 1.00 53.32  ? 637 LEU A CD2  1 
ATOM   4369 H  H    . LEU A 1 276 ? 13.319  -39.194 -24.667 1.00 77.30  ? 637 LEU A H    1 
ATOM   4370 H  HA   . LEU A 1 276 ? 13.082  -39.482 -22.003 1.00 73.70  ? 637 LEU A HA   1 
ATOM   4371 H  HB2  . LEU A 1 276 ? 11.329  -40.265 -24.068 1.00 65.20  ? 637 LEU A HB2  1 
ATOM   4372 H  HB3  . LEU A 1 276 ? 11.020  -40.511 -22.536 1.00 65.20  ? 637 LEU A HB3  1 
ATOM   4373 H  HG   . LEU A 1 276 ? 11.261  -37.901 -23.546 1.00 73.43  ? 637 LEU A HG   1 
ATOM   4374 H  HD11 . LEU A 1 276 ? 8.943   -37.816 -23.766 1.00 73.32  ? 637 LEU A HD11 1 
ATOM   4375 H  HD12 . LEU A 1 276 ? 9.549   -38.910 -24.746 1.00 73.32  ? 637 LEU A HD12 1 
ATOM   4376 H  HD13 . LEU A 1 276 ? 8.853   -39.357 -23.389 1.00 73.32  ? 637 LEU A HD13 1 
ATOM   4377 H  HD21 . LEU A 1 276 ? 10.064  -37.300 -21.643 1.00 63.98  ? 637 LEU A HD21 1 
ATOM   4378 H  HD22 . LEU A 1 276 ? 9.997   -38.826 -21.203 1.00 63.98  ? 637 LEU A HD22 1 
ATOM   4379 H  HD23 . LEU A 1 276 ? 11.393  -38.068 -21.232 1.00 63.98  ? 637 LEU A HD23 1 
ATOM   4380 N  N    . SER A 1 277 ? 13.538  -41.866 -21.568 1.00 64.62  ? 638 SER A N    1 
ATOM   4381 C  CA   . SER A 1 277 ? 13.872  -43.272 -21.359 1.00 63.87  ? 638 SER A CA   1 
ATOM   4382 C  C    . SER A 1 277 ? 12.573  -44.051 -21.192 1.00 64.19  ? 638 SER A C    1 
ATOM   4383 O  O    . SER A 1 277 ? 11.522  -43.452 -20.963 1.00 64.42  ? 638 SER A O    1 
ATOM   4384 C  CB   . SER A 1 277 ? 14.777  -43.448 -20.136 1.00 65.88  ? 638 SER A CB   1 
ATOM   4385 O  OG   . SER A 1 277 ? 14.108  -43.075 -18.944 1.00 94.25  ? 638 SER A OG   1 
ATOM   4386 H  H    . SER A 1 277 ? 13.394  -41.431 -20.841 1.00 77.54  ? 638 SER A H    1 
ATOM   4387 H  HA   . SER A 1 277 ? 14.338  -43.614 -22.138 1.00 76.64  ? 638 SER A HA   1 
ATOM   4388 H  HB2  . SER A 1 277 ? 15.040  -44.379 -20.071 1.00 79.06  ? 638 SER A HB2  1 
ATOM   4389 H  HB3  . SER A 1 277 ? 15.563  -42.889 -20.244 1.00 79.06  ? 638 SER A HB3  1 
ATOM   4390 H  HG   . SER A 1 277 ? 14.618  -43.177 -18.285 1.00 113.11 ? 638 SER A HG   1 
ATOM   4391 N  N    . ASN A 1 278 ? 12.645  -45.376 -21.314 1.00 72.18  ? 639 ASN A N    1 
ATOM   4392 C  CA   . ASN A 1 278 ? 11.459  -46.229 -21.221 1.00 80.67  ? 639 ASN A CA   1 
ATOM   4393 C  C    . ASN A 1 278 ? 10.383  -45.793 -22.217 1.00 80.05  ? 639 ASN A C    1 
ATOM   4394 O  O    . ASN A 1 278 ? 9.184   -45.915 -21.959 1.00 69.50  ? 639 ASN A O    1 
ATOM   4395 C  CB   . ASN A 1 278 ? 10.900  -46.218 -19.791 1.00 91.65  ? 639 ASN A CB   1 
ATOM   4396 C  CG   . ASN A 1 278 ? 11.634  -47.173 -18.868 1.00 111.96 ? 639 ASN A CG   1 
ATOM   4397 O  OD1  . ASN A 1 278 ? 12.703  -46.856 -18.347 1.00 114.63 ? 639 ASN A OD1  1 
ATOM   4398 N  ND2  . ASN A 1 278 ? 11.053  -48.348 -18.653 1.00 121.17 ? 639 ASN A ND2  1 
ATOM   4399 H  H    . ASN A 1 278 ? 13.374  -45.809 -21.453 1.00 86.61  ? 639 ASN A H    1 
ATOM   4400 H  HA   . ASN A 1 278 ? 11.712  -47.141 -21.435 1.00 96.81  ? 639 ASN A HA   1 
ATOM   4401 H  HB2  . ASN A 1 278 ? 10.984  -45.324 -19.425 1.00 109.98 ? 639 ASN A HB2  1 
ATOM   4402 H  HB3  . ASN A 1 278 ? 9.967   -46.481 -19.814 1.00 109.98 ? 639 ASN A HB3  1 
ATOM   4403 H  HD21 . ASN A 1 278 ? 11.428  -48.926 -18.138 1.00 145.41 ? 639 ASN A HD21 1 
ATOM   4404 H  HD22 . ASN A 1 278 ? 10.302  -48.532 -19.030 1.00 145.41 ? 639 ASN A HD22 1 
ATOM   4405 N  N    . SER A 1 279 ? 10.826  -45.290 -23.364 1.00 70.69  ? 640 SER A N    1 
ATOM   4406 C  CA   . SER A 1 279 ? 9.917   -44.741 -24.362 1.00 70.97  ? 640 SER A CA   1 
ATOM   4407 C  C    . SER A 1 279 ? 10.256  -45.273 -25.751 1.00 72.15  ? 640 SER A C    1 
ATOM   4408 O  O    . SER A 1 279 ? 10.979  -46.259 -25.890 1.00 75.83  ? 640 SER A O    1 
ATOM   4409 C  CB   . SER A 1 279 ? 9.980   -43.211 -24.343 1.00 61.30  ? 640 SER A CB   1 
ATOM   4410 O  OG   . SER A 1 279 ? 8.799   -42.645 -24.877 1.00 63.55  ? 640 SER A OG   1 
ATOM   4411 H  H    . SER A 1 279 ? 11.655  -45.255 -23.590 1.00 84.83  ? 640 SER A H    1 
ATOM   4412 H  HA   . SER A 1 279 ? 9.010   -45.010 -24.148 1.00 85.17  ? 640 SER A HA   1 
ATOM   4413 H  HB2  . SER A 1 279 ? 10.085  -42.912 -23.426 1.00 73.56  ? 640 SER A HB2  1 
ATOM   4414 H  HB3  . SER A 1 279 ? 10.737  -42.921 -24.875 1.00 73.56  ? 640 SER A HB3  1 
ATOM   4415 H  HG   . SER A 1 279 ? 8.134   -42.888 -24.425 1.00 76.26  ? 640 SER A HG   1 
ATOM   4416 N  N    . GLY A 1 280 ? 9.728   -44.619 -26.779 1.00 70.03  ? 641 GLY A N    1 
ATOM   4417 C  CA   . GLY A 1 280 ? 10.043  -44.994 -28.143 1.00 75.75  ? 641 GLY A CA   1 
ATOM   4418 C  C    . GLY A 1 280 ? 11.402  -44.457 -28.541 1.00 75.90  ? 641 GLY A C    1 
ATOM   4419 O  O    . GLY A 1 280 ? 12.034  -43.727 -27.776 1.00 84.81  ? 641 GLY A O    1 
ATOM   4420 H  H    . GLY A 1 280 ? 9.185   -43.956 -26.710 1.00 84.04  ? 641 GLY A H    1 
ATOM   4421 H  HA2  . GLY A 1 280 ? 10.052  -45.960 -28.226 1.00 90.89  ? 641 GLY A HA2  1 
ATOM   4422 H  HA3  . GLY A 1 280 ? 9.375   -44.633 -28.746 1.00 90.89  ? 641 GLY A HA3  1 
ATOM   4423 N  N    . PRO A 1 281 ? 11.871  -44.825 -29.739 1.00 78.00  ? 642 PRO A N    1 
ATOM   4424 C  CA   . PRO A 1 281 ? 13.086  -44.209 -30.272 1.00 69.63  ? 642 PRO A CA   1 
ATOM   4425 C  C    . PRO A 1 281 ? 12.745  -42.828 -30.819 1.00 81.82  ? 642 PRO A C    1 
ATOM   4426 O  O    . PRO A 1 281 ? 11.700  -42.680 -31.456 1.00 102.95 ? 642 PRO A O    1 
ATOM   4427 C  CB   . PRO A 1 281 ? 13.513  -45.178 -31.374 1.00 78.57  ? 642 PRO A CB   1 
ATOM   4428 C  CG   . PRO A 1 281 ? 12.217  -45.734 -31.881 1.00 80.98  ? 642 PRO A CG   1 
ATOM   4429 C  CD   . PRO A 1 281 ? 11.262  -45.762 -30.700 1.00 72.09  ? 642 PRO A CD   1 
ATOM   4430 H  HA   . PRO A 1 281 ? 13.775  -44.144 -29.593 1.00 83.56  ? 642 PRO A HA   1 
ATOM   4431 H  HB2  . PRO A 1 281 ? 13.982  -44.698 -32.074 1.00 94.28  ? 642 PRO A HB2  1 
ATOM   4432 H  HB3  . PRO A 1 281 ? 14.069  -45.880 -31.000 1.00 94.28  ? 642 PRO A HB3  1 
ATOM   4433 H  HG2  . PRO A 1 281 ? 11.872  -45.159 -32.581 1.00 97.17  ? 642 PRO A HG2  1 
ATOM   4434 H  HG3  . PRO A 1 281 ? 12.362  -46.631 -32.220 1.00 97.17  ? 642 PRO A HG3  1 
ATOM   4435 H  HD2  . PRO A 1 281 ? 10.384  -45.448 -30.967 1.00 86.51  ? 642 PRO A HD2  1 
ATOM   4436 H  HD3  . PRO A 1 281 ? 11.220  -46.654 -30.321 1.00 86.51  ? 642 PRO A HD3  1 
ATOM   4437 N  N    . ASN A 1 282 ? 13.588  -41.837 -30.547 1.00 89.41  ? 643 ASN A N    1 
ATOM   4438 C  CA   . ASN A 1 282 ? 13.341  -40.461 -30.974 1.00 81.36  ? 643 ASN A CA   1 
ATOM   4439 C  C    . ASN A 1 282 ? 12.216  -39.805 -30.170 1.00 82.54  ? 643 ASN A C    1 
ATOM   4440 O  O    . ASN A 1 282 ? 11.773  -38.699 -30.497 1.00 66.53  ? 643 ASN A O    1 
ATOM   4441 C  CB   . ASN A 1 282 ? 13.005  -40.413 -32.469 1.00 89.37  ? 643 ASN A CB   1 
ATOM   4442 C  CG   . ASN A 1 282 ? 13.537  -39.166 -33.154 1.00 105.26 ? 643 ASN A CG   1 
ATOM   4443 O  OD1  . ASN A 1 282 ? 13.832  -38.157 -32.508 1.00 95.44  ? 643 ASN A OD1  1 
ATOM   4444 N  ND2  . ASN A 1 282 ? 13.655  -39.229 -34.476 1.00 113.53 ? 643 ASN A ND2  1 
ATOM   4445 H  H    . ASN A 1 282 ? 14.322  -41.937 -30.110 1.00 107.29 ? 643 ASN A H    1 
ATOM   4446 H  HA   . ASN A 1 282 ? 14.147  -39.941 -30.834 1.00 97.64  ? 643 ASN A HA   1 
ATOM   4447 H  HB2  . ASN A 1 282 ? 13.399  -41.185 -32.905 1.00 107.24 ? 643 ASN A HB2  1 
ATOM   4448 H  HB3  . ASN A 1 282 ? 12.042  -40.427 -32.577 1.00 107.24 ? 643 ASN A HB3  1 
ATOM   4449 H  HD21 . ASN A 1 282 ? 13.951  -38.551 -34.914 1.00 136.23 ? 643 ASN A HD21 1 
ATOM   4450 H  HD22 . ASN A 1 282 ? 13.436  -39.949 -34.893 1.00 136.23 ? 643 ASN A HD22 1 
ATOM   4451 N  N    . SER A 1 283 ? 11.753  -40.491 -29.125 1.00 58.64  ? 644 SER A N    1 
ATOM   4452 C  CA   . SER A 1 283 ? 10.755  -39.932 -28.221 1.00 57.67  ? 644 SER A CA   1 
ATOM   4453 C  C    . SER A 1 283 ? 11.402  -38.884 -27.330 1.00 57.72  ? 644 SER A C    1 
ATOM   4454 O  O    . SER A 1 283 ? 12.353  -39.186 -26.609 1.00 61.13  ? 644 SER A O    1 
ATOM   4455 C  CB   . SER A 1 283 ? 10.119  -41.027 -27.367 1.00 67.99  ? 644 SER A CB   1 
ATOM   4456 O  OG   . SER A 1 283 ? 9.260   -41.843 -28.142 1.00 64.83  ? 644 SER A OG   1 
ATOM   4457 H  H    . SER A 1 283 ? 12.005  -41.287 -28.919 1.00 70.36  ? 644 SER A H    1 
ATOM   4458 H  HA   . SER A 1 283 ? 10.056  -39.503 -28.739 1.00 69.20  ? 644 SER A HA   1 
ATOM   4459 H  HB2  . SER A 1 283 ? 10.822  -41.579 -26.990 1.00 81.59  ? 644 SER A HB2  1 
ATOM   4460 H  HB3  . SER A 1 283 ? 9.605   -40.614 -26.656 1.00 81.59  ? 644 SER A HB3  1 
ATOM   4461 H  HG   . SER A 1 283 ? 8.646   -41.377 -28.476 1.00 77.80  ? 644 SER A HG   1 
ATOM   4462 N  N    . THR A 1 284 ? 10.890  -37.657 -27.376 1.00 60.37  ? 645 THR A N    1 
ATOM   4463 C  CA   . THR A 1 284 ? 11.511  -36.560 -26.641 1.00 54.48  ? 645 THR A CA   1 
ATOM   4464 C  C    . THR A 1 284 ? 10.506  -35.615 -26.002 1.00 56.18  ? 645 THR A C    1 
ATOM   4465 O  O    . THR A 1 284 ? 9.306   -35.658 -26.294 1.00 50.09  ? 645 THR A O    1 
ATOM   4466 C  CB   . THR A 1 284 ? 12.440  -35.729 -27.556 1.00 63.67  ? 645 THR A CB   1 
ATOM   4467 O  OG1  . THR A 1 284 ? 11.670  -35.103 -28.589 1.00 61.05  ? 645 THR A OG1  1 
ATOM   4468 C  CG2  . THR A 1 284 ? 13.514  -36.613 -28.183 1.00 64.68  ? 645 THR A CG2  1 
ATOM   4469 H  H    . THR A 1 284 ? 10.190  -37.434 -27.823 1.00 72.45  ? 645 THR A H    1 
ATOM   4470 H  HA   . THR A 1 284 ? 12.055  -36.934 -25.930 1.00 65.38  ? 645 THR A HA   1 
ATOM   4471 H  HB   . THR A 1 284 ? 12.880  -35.046 -27.027 1.00 76.40  ? 645 THR A HB   1 
ATOM   4472 H  HG1  . THR A 1 284 ? 12.172  -34.651 -29.088 1.00 73.26  ? 645 THR A HG1  1 
ATOM   4473 H  HG21 . THR A 1 284 ? 14.089  -36.081 -28.754 1.00 77.62  ? 645 THR A HG21 1 
ATOM   4474 H  HG22 . THR A 1 284 ? 14.052  -37.024 -27.488 1.00 77.62  ? 645 THR A HG22 1 
ATOM   4475 H  HG23 . THR A 1 284 ? 13.100  -37.311 -28.715 1.00 77.62  ? 645 THR A HG23 1 
ATOM   4476 N  N    . ILE A 1 285 ? 11.020  -34.761 -25.122 1.00 46.11  ? 646 ILE A N    1 
ATOM   4477 C  CA   . ILE A 1 285 ? 10.210  -33.768 -24.432 1.00 40.57  ? 646 ILE A CA   1 
ATOM   4478 C  C    . ILE A 1 285 ? 10.999  -32.460 -24.363 1.00 42.78  ? 646 ILE A C    1 
ATOM   4479 O  O    . ILE A 1 285 ? 12.189  -32.455 -24.046 1.00 55.82  ? 646 ILE A O    1 
ATOM   4480 C  CB   . ILE A 1 285 ? 9.800   -34.265 -23.021 1.00 41.73  ? 646 ILE A CB   1 
ATOM   4481 C  CG1  . ILE A 1 285 ? 8.743   -33.355 -22.400 1.00 43.04  ? 646 ILE A CG1  1 
ATOM   4482 C  CG2  . ILE A 1 285 ? 11.001  -34.384 -22.108 1.00 48.01  ? 646 ILE A CG2  1 
ATOM   4483 C  CD1  . ILE A 1 285 ? 7.996   -34.017 -21.253 1.00 46.54  ? 646 ILE A CD1  1 
ATOM   4484 H  H    . ILE A 1 285 ? 11.852  -34.738 -24.905 1.00 55.34  ? 646 ILE A H    1 
ATOM   4485 H  HA   . ILE A 1 285 ? 9.401   -33.607 -24.943 1.00 48.68  ? 646 ILE A HA   1 
ATOM   4486 H  HB   . ILE A 1 285 ? 9.411   -35.149 -23.118 1.00 50.07  ? 646 ILE A HB   1 
ATOM   4487 H  HG12 . ILE A 1 285 ? 9.175   -32.557 -22.057 1.00 51.65  ? 646 ILE A HG12 1 
ATOM   4488 H  HG13 . ILE A 1 285 ? 8.094   -33.114 -23.081 1.00 51.65  ? 646 ILE A HG13 1 
ATOM   4489 H  HG21 . ILE A 1 285 ? 10.705  -34.696 -21.238 1.00 57.61  ? 646 ILE A HG21 1 
ATOM   4490 H  HG22 . ILE A 1 285 ? 11.627  -35.018 -22.492 1.00 57.61  ? 646 ILE A HG22 1 
ATOM   4491 H  HG23 . ILE A 1 285 ? 11.420  -33.514 -22.023 1.00 57.61  ? 646 ILE A HG23 1 
ATOM   4492 H  HD11 . ILE A 1 285 ? 7.342   -33.394 -20.902 1.00 55.85  ? 646 ILE A HD11 1 
ATOM   4493 H  HD12 . ILE A 1 285 ? 7.552   -34.813 -21.584 1.00 55.85  ? 646 ILE A HD12 1 
ATOM   4494 H  HD13 . ILE A 1 285 ? 8.632   -34.256 -20.561 1.00 55.85  ? 646 ILE A HD13 1 
ATOM   4495 N  N    . LYS A 1 286 ? 10.334  -31.360 -24.705 1.00 39.27  ? 647 LYS A N    1 
ATOM   4496 C  CA   . LYS A 1 286 ? 10.967  -30.042 -24.753 1.00 40.39  ? 647 LYS A CA   1 
ATOM   4497 C  C    . LYS A 1 286 ? 10.590  -29.231 -23.518 1.00 36.18  ? 647 LYS A C    1 
ATOM   4498 O  O    . LYS A 1 286 ? 9.397   -29.042 -23.228 1.00 34.59  ? 647 LYS A O    1 
ATOM   4499 C  CB   . LYS A 1 286 ? 10.551  -29.296 -26.021 1.00 44.79  ? 647 LYS A CB   1 
ATOM   4500 C  CG   . LYS A 1 286 ? 11.280  -27.980 -26.260 1.00 50.44  ? 647 LYS A CG   1 
ATOM   4501 C  CD   . LYS A 1 286 ? 10.711  -27.279 -27.488 1.00 70.18  ? 647 LYS A CD   1 
ATOM   4502 C  CE   . LYS A 1 286 ? 11.641  -26.204 -28.032 1.00 67.53  ? 647 LYS A CE   1 
ATOM   4503 N  NZ   . LYS A 1 286 ? 11.155  -25.684 -29.344 1.00 79.22  ? 647 LYS A NZ   1 
ATOM   4504 H  H    . LYS A 1 286 ? 9.500   -31.350 -24.917 1.00 47.12  ? 647 LYS A H    1 
ATOM   4505 H  HA   . LYS A 1 286 ? 11.931  -30.150 -24.765 1.00 48.46  ? 647 LYS A HA   1 
ATOM   4506 H  HB2  . LYS A 1 286 ? 10.722  -29.868 -26.786 1.00 53.74  ? 647 LYS A HB2  1 
ATOM   4507 H  HB3  . LYS A 1 286 ? 9.603   -29.100 -25.966 1.00 53.74  ? 647 LYS A HB3  1 
ATOM   4508 H  HG2  . LYS A 1 286 ? 11.162  -27.399 -25.492 1.00 60.53  ? 647 LYS A HG2  1 
ATOM   4509 H  HG3  . LYS A 1 286 ? 12.222  -28.153 -26.413 1.00 60.53  ? 647 LYS A HG3  1 
ATOM   4510 H  HD2  . LYS A 1 286 ? 10.568  -27.934 -28.188 1.00 84.22  ? 647 LYS A HD2  1 
ATOM   4511 H  HD3  . LYS A 1 286 ? 9.871   -26.856 -27.250 1.00 84.22  ? 647 LYS A HD3  1 
ATOM   4512 H  HE2  . LYS A 1 286 ? 11.678  -25.465 -27.406 1.00 81.04  ? 647 LYS A HE2  1 
ATOM   4513 H  HE3  . LYS A 1 286 ? 12.525  -26.581 -28.162 1.00 81.04  ? 647 LYS A HE3  1 
ATOM   4514 H  HZ1  . LYS A 1 286 ? 11.710  -25.058 -29.647 1.00 95.06  ? 647 LYS A HZ1  1 
ATOM   4515 H  HZ2  . LYS A 1 286 ? 11.115  -26.346 -29.937 1.00 95.06  ? 647 LYS A HZ2  1 
ATOM   4516 H  HZ3  . LYS A 1 286 ? 10.344  -25.331 -29.250 1.00 95.06  ? 647 LYS A HZ3  1 
ATOM   4517 N  N    . MET A 1 287 ? 11.611  -28.762 -22.804 1.00 39.08  ? 648 MET A N    1 
ATOM   4518 C  CA   . MET A 1 287 ? 11.427  -28.023 -21.556 1.00 50.00  ? 648 MET A CA   1 
ATOM   4519 C  C    . MET A 1 287 ? 12.453  -26.916 -21.371 1.00 45.34  ? 648 MET A C    1 
ATOM   4520 O  O    . MET A 1 287 ? 13.524  -26.940 -21.972 1.00 42.89  ? 648 MET A O    1 
ATOM   4521 C  CB   . MET A 1 287 ? 11.536  -28.952 -20.351 1.00 47.38  ? 648 MET A CB   1 
ATOM   4522 C  CG   . MET A 1 287 ? 10.658  -30.174 -20.375 1.00 54.32  ? 648 MET A CG   1 
ATOM   4523 S  SD   . MET A 1 287 ? 10.833  -31.060 -18.813 1.00 58.17  ? 648 MET A SD   1 
ATOM   4524 C  CE   . MET A 1 287 ? 10.941  -32.746 -19.375 1.00 72.13  ? 648 MET A CE   1 
ATOM   4525 H  H    . MET A 1 287 ? 12.436  -28.861 -23.027 1.00 46.90  ? 648 MET A H    1 
ATOM   4526 H  HA   . MET A 1 287 ? 10.540  -27.632 -21.552 1.00 60.00  ? 648 MET A HA   1 
ATOM   4527 H  HB2  . MET A 1 287 ? 12.454  -29.258 -20.284 1.00 56.86  ? 648 MET A HB2  1 
ATOM   4528 H  HB3  . MET A 1 287 ? 11.306  -28.447 -19.555 1.00 56.86  ? 648 MET A HB3  1 
ATOM   4529 H  HG2  . MET A 1 287 ? 9.731   -29.908 -20.480 1.00 65.19  ? 648 MET A HG2  1 
ATOM   4530 H  HG3  . MET A 1 287 ? 10.932  -30.760 -21.098 1.00 65.19  ? 648 MET A HG3  1 
ATOM   4531 H  HE1  . MET A 1 287 ? 11.040  -33.328 -18.606 1.00 86.55  ? 648 MET A HE1  1 
ATOM   4532 H  HE2  . MET A 1 287 ? 10.131  -32.970 -19.858 1.00 86.55  ? 648 MET A HE2  1 
ATOM   4533 H  HE3  . MET A 1 287 ? 11.710  -32.835 -19.959 1.00 86.55  ? 648 MET A HE3  1 
ATOM   4534 N  N    . LYS A 1 288 ? 12.111  -25.957 -20.515 1.00 39.32  ? 649 LYS A N    1 
ATOM   4535 C  CA   . LYS A 1 288 ? 13.086  -25.031 -19.951 1.00 42.32  ? 649 LYS A CA   1 
ATOM   4536 C  C    . LYS A 1 288 ? 13.114  -25.254 -18.442 1.00 41.13  ? 649 LYS A C    1 
ATOM   4537 O  O    . LYS A 1 288 ? 12.069  -25.369 -17.810 1.00 36.77  ? 649 LYS A O    1 
ATOM   4538 C  CB   . LYS A 1 288 ? 12.740  -23.575 -20.267 1.00 43.60  ? 649 LYS A CB   1 
ATOM   4539 C  CG   . LYS A 1 288 ? 12.483  -23.280 -21.738 1.00 46.67  ? 649 LYS A CG   1 
ATOM   4540 C  CD   . LYS A 1 288 ? 12.530  -21.782 -22.003 1.00 66.36  ? 649 LYS A CD   1 
ATOM   4541 C  CE   . LYS A 1 288 ? 12.098  -21.449 -23.421 1.00 66.23  ? 649 LYS A CE   1 
ATOM   4542 N  NZ   . LYS A 1 288 ? 12.337  -20.015 -23.746 1.00 78.92  ? 649 LYS A NZ   1 
ATOM   4543 H  H    . LYS A 1 288 ? 11.307  -25.822 -20.241 1.00 47.19  ? 649 LYS A H    1 
ATOM   4544 H  HA   . LYS A 1 288 ? 13.966  -25.225 -20.310 1.00 50.78  ? 649 LYS A HA   1 
ATOM   4545 H  HB2  . LYS A 1 288 ? 11.939  -23.335 -19.776 1.00 52.32  ? 649 LYS A HB2  1 
ATOM   4546 H  HB3  . LYS A 1 288 ? 13.478  -23.014 -19.981 1.00 52.32  ? 649 LYS A HB3  1 
ATOM   4547 H  HG2  . LYS A 1 288 ? 13.166  -23.708 -22.277 1.00 56.01  ? 649 LYS A HG2  1 
ATOM   4548 H  HG3  . LYS A 1 288 ? 11.604  -23.608 -21.983 1.00 56.01  ? 649 LYS A HG3  1 
ATOM   4549 H  HD2  . LYS A 1 288 ? 11.930  -21.330 -21.390 1.00 79.63  ? 649 LYS A HD2  1 
ATOM   4550 H  HD3  . LYS A 1 288 ? 13.438  -21.464 -21.880 1.00 79.63  ? 649 LYS A HD3  1 
ATOM   4551 H  HE2  . LYS A 1 288 ? 12.607  -21.990 -24.045 1.00 79.47  ? 649 LYS A HE2  1 
ATOM   4552 H  HE3  . LYS A 1 288 ? 11.150  -21.629 -23.517 1.00 79.47  ? 649 LYS A HE3  1 
ATOM   4553 H  HZ1  . LYS A 1 288 ? 12.077  -19.845 -24.580 1.00 94.70  ? 649 LYS A HZ1  1 
ATOM   4554 H  HZ2  . LYS A 1 288 ? 11.877  -19.497 -23.188 1.00 94.70  ? 649 LYS A HZ2  1 
ATOM   4555 H  HZ3  . LYS A 1 288 ? 13.203  -19.826 -23.669 1.00 94.70  ? 649 LYS A HZ3  1 
ATOM   4556 N  N    . ILE A 1 289 ? 14.313  -25.326 -17.874 1.00 40.86  ? 650 ILE A N    1 
ATOM   4557 C  CA   . ILE A 1 289 ? 14.474  -25.644 -16.465 1.00 50.94  ? 650 ILE A CA   1 
ATOM   4558 C  C    . ILE A 1 289 ? 15.495  -24.702 -15.840 1.00 47.53  ? 650 ILE A C    1 
ATOM   4559 O  O    . ILE A 1 289 ? 16.649  -24.661 -16.267 1.00 46.41  ? 650 ILE A O    1 
ATOM   4560 C  CB   . ILE A 1 289 ? 14.924  -27.105 -16.269 1.00 50.31  ? 650 ILE A CB   1 
ATOM   4561 C  CG1  . ILE A 1 289 ? 14.069  -28.044 -17.133 1.00 44.13  ? 650 ILE A CG1  1 
ATOM   4562 C  CG2  . ILE A 1 289 ? 14.842  -27.489 -14.796 1.00 51.30  ? 650 ILE A CG2  1 
ATOM   4563 C  CD1  . ILE A 1 289 ? 14.519  -29.495 -17.125 1.00 54.25  ? 650 ILE A CD1  1 
ATOM   4564 H  H    . ILE A 1 289 ? 15.054  -25.192 -18.290 1.00 49.03  ? 650 ILE A H    1 
ATOM   4565 H  HA   . ILE A 1 289 ? 13.627  -25.522 -16.009 1.00 61.13  ? 650 ILE A HA   1 
ATOM   4566 H  HB   . ILE A 1 289 ? 15.847  -27.182 -16.555 1.00 60.38  ? 650 ILE A HB   1 
ATOM   4567 H  HG12 . ILE A 1 289 ? 13.155  -28.018 -16.808 1.00 52.96  ? 650 ILE A HG12 1 
ATOM   4568 H  HG13 . ILE A 1 289 ? 14.098  -27.733 -18.051 1.00 52.96  ? 650 ILE A HG13 1 
ATOM   4569 H  HG21 . ILE A 1 289 ? 15.128  -28.410 -14.694 1.00 61.56  ? 650 ILE A HG21 1 
ATOM   4570 H  HG22 . ILE A 1 289 ? 15.422  -26.903 -14.285 1.00 61.56  ? 650 ILE A HG22 1 
ATOM   4571 H  HG23 . ILE A 1 289 ? 13.925  -27.392 -14.495 1.00 61.56  ? 650 ILE A HG23 1 
ATOM   4572 H  HD11 . ILE A 1 289 ? 13.927  -30.012 -17.693 1.00 65.10  ? 650 ILE A HD11 1 
ATOM   4573 H  HD12 . ILE A 1 289 ? 15.427  -29.545 -17.461 1.00 65.10  ? 650 ILE A HD12 1 
ATOM   4574 H  HD13 . ILE A 1 289 ? 14.484  -29.831 -16.216 1.00 65.10  ? 650 ILE A HD13 1 
ATOM   4575 N  N    . ALA A 1 290 ? 15.061  -23.951 -14.829 1.00 42.64  ? 651 ALA A N    1 
ATOM   4576 C  CA   . ALA A 1 290 ? 15.909  -22.962 -14.180 1.00 49.34  ? 651 ALA A CA   1 
ATOM   4577 C  C    . ALA A 1 290 ? 15.894  -23.143 -12.672 1.00 48.73  ? 651 ALA A C    1 
ATOM   4578 O  O    . ALA A 1 290 ? 14.866  -23.451 -12.076 1.00 47.48  ? 651 ALA A O    1 
ATOM   4579 C  CB   . ALA A 1 290 ? 15.462  -21.564 -14.540 1.00 49.22  ? 651 ALA A CB   1 
ATOM   4580 H  H    . ALA A 1 290 ? 14.269  -24.000 -14.499 1.00 51.17  ? 651 ALA A H    1 
ATOM   4581 H  HA   . ALA A 1 290 ? 16.821  -23.075 -14.488 1.00 59.21  ? 651 ALA A HA   1 
ATOM   4582 H  HB1  . ALA A 1 290 ? 16.040  -20.924 -14.097 1.00 59.07  ? 651 ALA A HB1  1 
ATOM   4583 H  HB2  . ALA A 1 290 ? 15.520  -21.452 -15.502 1.00 59.07  ? 651 ALA A HB2  1 
ATOM   4584 H  HB3  . ALA A 1 290 ? 14.545  -21.440 -14.248 1.00 59.07  ? 651 ALA A HB3  1 
ATOM   4585 N  N    . LEU A 1 291 ? 17.059  -22.945 -12.071 1.00 43.81  ? 652 LEU A N    1 
ATOM   4586 C  CA   . LEU A 1 291 ? 17.234  -23.051 -10.637 1.00 53.11  ? 652 LEU A CA   1 
ATOM   4587 C  C    . LEU A 1 291 ? 17.616  -21.689 -10.088 1.00 46.01  ? 652 LEU A C    1 
ATOM   4588 O  O    . LEU A 1 291 ? 18.404  -20.973 -10.697 1.00 53.42  ? 652 LEU A O    1 
ATOM   4589 C  CB   . LEU A 1 291 ? 18.309  -24.082 -10.315 1.00 53.48  ? 652 LEU A CB   1 
ATOM   4590 C  CG   . LEU A 1 291 ? 18.318  -24.667 -8.912  1.00 60.89  ? 652 LEU A CG   1 
ATOM   4591 C  CD1  . LEU A 1 291 ? 17.126  -25.588 -8.701  1.00 50.66  ? 652 LEU A CD1  1 
ATOM   4592 C  CD2  . LEU A 1 291 ? 19.622  -25.403 -8.698  1.00 68.62  ? 652 LEU A CD2  1 
ATOM   4593 H  H    . LEU A 1 291 ? 17.783  -22.742 -12.489 1.00 52.58  ? 652 LEU A H    1 
ATOM   4594 H  HA   . LEU A 1 291 ? 16.401  -23.331 -10.226 1.00 63.73  ? 652 LEU A HA   1 
ATOM   4595 H  HB2  . LEU A 1 291 ? 18.208  -24.824 -10.932 1.00 64.18  ? 652 LEU A HB2  1 
ATOM   4596 H  HB3  . LEU A 1 291 ? 19.175  -23.667 -10.456 1.00 64.18  ? 652 LEU A HB3  1 
ATOM   4597 H  HG   . LEU A 1 291 ? 18.265  -23.947 -8.265  1.00 73.07  ? 652 LEU A HG   1 
ATOM   4598 H  HD11 . LEU A 1 291 ? 17.159  -25.945 -7.800  1.00 60.80  ? 652 LEU A HD11 1 
ATOM   4599 H  HD12 . LEU A 1 291 ? 16.309  -25.081 -8.827  1.00 60.80  ? 652 LEU A HD12 1 
ATOM   4600 H  HD13 . LEU A 1 291 ? 17.169  -26.312 -9.346  1.00 60.80  ? 652 LEU A HD13 1 
ATOM   4601 H  HD21 . LEU A 1 291 ? 19.629  -25.777 -7.803  1.00 82.34  ? 652 LEU A HD21 1 
ATOM   4602 H  HD22 . LEU A 1 291 ? 19.695  -26.114 -9.354  1.00 82.34  ? 652 LEU A HD22 1 
ATOM   4603 H  HD23 . LEU A 1 291 ? 20.358  -24.780 -8.802  1.00 82.34  ? 652 LEU A HD23 1 
ATOM   4604 N  N    . ARG A 1 292 ? 17.049  -21.330 -8.944  1.00 57.08  ? 653 ARG A N    1 
ATOM   4605 C  CA   . ARG A 1 292 ? 17.391  -20.079 -8.287  1.00 47.15  ? 653 ARG A CA   1 
ATOM   4606 C  C    . ARG A 1 292 ? 17.642  -20.345 -6.808  1.00 52.52  ? 653 ARG A C    1 
ATOM   4607 O  O    . ARG A 1 292 ? 16.788  -20.900 -6.117  1.00 48.37  ? 653 ARG A O    1 
ATOM   4608 C  CB   . ARG A 1 292 ? 16.278  -19.046 -8.487  1.00 55.79  ? 653 ARG A CB   1 
ATOM   4609 C  CG   . ARG A 1 292 ? 16.222  -18.453 -9.902  1.00 51.58  ? 653 ARG A CG   1 
ATOM   4610 C  CD   . ARG A 1 292 ? 17.394  -17.526 -10.152 1.00 50.80  ? 653 ARG A CD   1 
ATOM   4611 N  NE   . ARG A 1 292 ? 17.343  -16.848 -11.448 1.00 57.65  ? 653 ARG A NE   1 
ATOM   4612 C  CZ   . ARG A 1 292 ? 17.737  -17.384 -12.601 1.00 50.90  ? 653 ARG A CZ   1 
ATOM   4613 N  NH1  . ARG A 1 292 ? 18.194  -18.627 -12.646 1.00 54.77  ? 653 ARG A NH1  1 
ATOM   4614 N  NH2  . ARG A 1 292 ? 17.668  -16.674 -13.717 1.00 66.56  ? 653 ARG A NH2  1 
ATOM   4615 H  H    . ARG A 1 292 ? 16.460  -21.797 -8.526  1.00 68.49  ? 653 ARG A H    1 
ATOM   4616 H  HA   . ARG A 1 292 ? 18.207  -19.726 -8.675  1.00 56.58  ? 653 ARG A HA   1 
ATOM   4617 H  HB2  . ARG A 1 292 ? 15.424  -19.469 -8.310  1.00 66.94  ? 653 ARG A HB2  1 
ATOM   4618 H  HB3  . ARG A 1 292 ? 16.416  -18.314 -7.865  1.00 66.94  ? 653 ARG A HB3  1 
ATOM   4619 H  HG2  . ARG A 1 292 ? 16.257  -19.171 -10.553 1.00 61.89  ? 653 ARG A HG2  1 
ATOM   4620 H  HG3  . ARG A 1 292 ? 15.403  -17.944 -10.005 1.00 61.89  ? 653 ARG A HG3  1 
ATOM   4621 H  HD2  . ARG A 1 292 ? 17.407  -16.845 -9.461  1.00 60.97  ? 653 ARG A HD2  1 
ATOM   4622 H  HD3  . ARG A 1 292 ? 18.215  -18.043 -10.119 1.00 60.97  ? 653 ARG A HD3  1 
ATOM   4623 H  HE   . ARG A 1 292 ? 17.036  -16.045 -11.467 1.00 69.18  ? 653 ARG A HE   1 
ATOM   4624 H  HH11 . ARG A 1 292 ? 18.247  -19.093 -11.924 1.00 65.73  ? 653 ARG A HH11 1 
ATOM   4625 H  HH12 . ARG A 1 292 ? 18.443  -18.967 -13.395 1.00 65.73  ? 653 ARG A HH12 1 
ATOM   4626 H  HH21 . ARG A 1 292 ? 17.366  -15.869 -13.697 1.00 79.87  ? 653 ARG A HH21 1 
ATOM   4627 H  HH22 . ARG A 1 292 ? 17.912  -17.023 -14.464 1.00 79.87  ? 653 ARG A HH22 1 
ATOM   4628 N  N    . VAL A 1 293 ? 18.831  -19.971 -6.340  1.00 51.44  ? 654 VAL A N    1 
ATOM   4629 C  CA   . VAL A 1 293 ? 19.225  -20.196 -4.956  1.00 60.42  ? 654 VAL A CA   1 
ATOM   4630 C  C    . VAL A 1 293 ? 18.704  -19.069 -4.066  1.00 60.33  ? 654 VAL A C    1 
ATOM   4631 O  O    . VAL A 1 293 ? 18.831  -17.888 -4.394  1.00 58.32  ? 654 VAL A O    1 
ATOM   4632 C  CB   . VAL A 1 293 ? 20.764  -20.317 -4.827  1.00 57.21  ? 654 VAL A CB   1 
ATOM   4633 C  CG1  . VAL A 1 293 ? 21.194  -20.339 -3.370  1.00 59.78  ? 654 VAL A CG1  1 
ATOM   4634 C  CG2  . VAL A 1 293 ? 21.246  -21.576 -5.529  1.00 57.32  ? 654 VAL A CG2  1 
ATOM   4635 H  H    . VAL A 1 293 ? 19.433  -19.579 -6.812  1.00 61.73  ? 654 VAL A H    1 
ATOM   4636 H  HA   . VAL A 1 293 ? 18.832  -21.028 -4.647  1.00 72.50  ? 654 VAL A HA   1 
ATOM   4637 H  HB   . VAL A 1 293 ? 21.181  -19.553 -5.255  1.00 68.65  ? 654 VAL A HB   1 
ATOM   4638 H  HG11 . VAL A 1 293 ? 22.160  -20.415 -3.327  1.00 71.74  ? 654 VAL A HG11 1 
ATOM   4639 H  HG12 . VAL A 1 293 ? 20.908  -19.516 -2.944  1.00 71.74  ? 654 VAL A HG12 1 
ATOM   4640 H  HG13 . VAL A 1 293 ? 20.782  -21.100 -2.931  1.00 71.74  ? 654 VAL A HG13 1 
ATOM   4641 H  HG21 . VAL A 1 293 ? 22.209  -21.637 -5.439  1.00 68.79  ? 654 VAL A HG21 1 
ATOM   4642 H  HG22 . VAL A 1 293 ? 20.825  -22.347 -5.117  1.00 68.79  ? 654 VAL A HG22 1 
ATOM   4643 H  HG23 . VAL A 1 293 ? 21.002  -21.527 -6.466  1.00 68.79  ? 654 VAL A HG23 1 
ATOM   4644 N  N    . LEU A 1 294 ? 18.114  -19.451 -2.939  1.00 69.77  ? 655 LEU A N    1 
ATOM   4645 C  CA   . LEU A 1 294 ? 17.470  -18.502 -2.039  1.00 60.72  ? 655 LEU A CA   1 
ATOM   4646 C  C    . LEU A 1 294 ? 18.498  -17.875 -1.107  1.00 63.24  ? 655 LEU A C    1 
ATOM   4647 O  O    . LEU A 1 294 ? 19.213  -18.578 -0.396  1.00 97.30  ? 655 LEU A O    1 
ATOM   4648 C  CB   . LEU A 1 294 ? 16.363  -19.197 -1.250  1.00 58.26  ? 655 LEU A CB   1 
ATOM   4649 C  CG   . LEU A 1 294 ? 15.295  -19.802 -2.159  1.00 61.90  ? 655 LEU A CG   1 
ATOM   4650 C  CD1  . LEU A 1 294 ? 14.348  -20.695 -1.381  1.00 84.64  ? 655 LEU A CD1  1 
ATOM   4651 C  CD2  . LEU A 1 294 ? 14.528  -18.703 -2.885  1.00 65.42  ? 655 LEU A CD2  1 
ATOM   4652 H  H    . LEU A 1 294 ? 18.072  -20.267 -2.669  1.00 83.72  ? 655 LEU A H    1 
ATOM   4653 H  HA   . LEU A 1 294 ? 17.067  -17.792 -2.563  1.00 72.87  ? 655 LEU A HA   1 
ATOM   4654 H  HB2  . LEU A 1 294 ? 16.751  -19.914 -0.723  1.00 69.91  ? 655 LEU A HB2  1 
ATOM   4655 H  HB3  . LEU A 1 294 ? 15.933  -18.551 -0.668  1.00 69.91  ? 655 LEU A HB3  1 
ATOM   4656 H  HG   . LEU A 1 294 ? 15.732  -20.349 -2.830  1.00 74.28  ? 655 LEU A HG   1 
ATOM   4657 H  HD11 . LEU A 1 294 ? 13.686  -21.059 -1.990  1.00 101.57 ? 655 LEU A HD11 1 
ATOM   4658 H  HD12 . LEU A 1 294 ? 14.855  -21.415 -0.975  1.00 101.57 ? 655 LEU A HD12 1 
ATOM   4659 H  HD13 . LEU A 1 294 ? 13.911  -20.169 -0.694  1.00 101.57 ? 655 LEU A HD13 1 
ATOM   4660 H  HD21 . LEU A 1 294 ? 13.857  -19.110 -3.455  1.00 78.50  ? 655 LEU A HD21 1 
ATOM   4661 H  HD22 . LEU A 1 294 ? 14.101  -18.129 -2.229  1.00 78.50  ? 655 LEU A HD22 1 
ATOM   4662 H  HD23 . LEU A 1 294 ? 15.149  -18.187 -3.422  1.00 78.50  ? 655 LEU A HD23 1 
ATOM   4663 N  N    . HIS A 1 295 ? 18.562  -16.546 -1.125  1.00 72.70  ? 656 HIS A N    1 
ATOM   4664 C  CA   . HIS A 1 295 ? 19.646  -15.817 -0.485  1.00 84.61  ? 656 HIS A CA   1 
ATOM   4665 C  C    . HIS A 1 295 ? 19.172  -14.643 0.364   1.00 74.00  ? 656 HIS A C    1 
ATOM   4666 O  O    . HIS A 1 295 ? 18.348  -13.840 -0.070  1.00 69.43  ? 656 HIS A O    1 
ATOM   4667 C  CB   . HIS A 1 295 ? 20.614  -15.302 -1.546  1.00 95.59  ? 656 HIS A CB   1 
ATOM   4668 C  CG   . HIS A 1 295 ? 21.826  -14.635 -0.980  1.00 91.65  ? 656 HIS A CG   1 
ATOM   4669 N  ND1  . HIS A 1 295 ? 22.681  -15.266 -0.103  1.00 106.00 ? 656 HIS A ND1  1 
ATOM   4670 C  CD2  . HIS A 1 295 ? 22.329  -13.392 -1.167  1.00 95.40  ? 656 HIS A CD2  1 
ATOM   4671 C  CE1  . HIS A 1 295 ? 23.658  -14.441 0.226   1.00 100.12 ? 656 HIS A CE1  1 
ATOM   4672 N  NE2  . HIS A 1 295 ? 23.468  -13.297 -0.406  1.00 107.23 ? 656 HIS A NE2  1 
ATOM   4673 H  H    . HIS A 1 295 ? 17.981  -16.041 -1.508  1.00 87.24  ? 656 HIS A H    1 
ATOM   4674 H  HA   . HIS A 1 295 ? 20.134  -16.425 0.093   1.00 101.53 ? 656 HIS A HA   1 
ATOM   4675 H  HB2  . HIS A 1 295 ? 20.912  -16.050 -2.087  1.00 114.71 ? 656 HIS A HB2  1 
ATOM   4676 H  HB3  . HIS A 1 295 ? 20.152  -14.656 -2.104  1.00 114.71 ? 656 HIS A HB3  1 
ATOM   4677 H  HD1  . HIS A 1 295 ? 22.592  -16.072 0.185   1.00 127.20 ? 656 HIS A HD1  1 
ATOM   4678 H  HD2  . HIS A 1 295 ? 21.970  -12.727 -1.710  1.00 114.49 ? 656 HIS A HD2  1 
ATOM   4679 H  HE1  . HIS A 1 295 ? 24.360  -14.633 0.805   1.00 120.14 ? 656 HIS A HE1  1 
ATOM   4680 H  HE2  . HIS A 1 295 ? 23.975  -12.605 -0.349  1.00 128.67 ? 656 HIS A HE2  1 
ATOM   4681 N  N    . LEU A 1 296 ? 19.713  -14.558 1.576   1.00 78.99  ? 657 LEU A N    1 
ATOM   4682 C  CA   . LEU A 1 296 ? 19.516  -13.407 2.448   1.00 73.02  ? 657 LEU A CA   1 
ATOM   4683 C  C    . LEU A 1 296 ? 20.714  -12.469 2.352   1.00 80.47  ? 657 LEU A C    1 
ATOM   4684 O  O    . LEU A 1 296 ? 21.811  -12.815 2.794   1.00 90.06  ? 657 LEU A O    1 
ATOM   4685 C  CB   . LEU A 1 296 ? 19.324  -13.857 3.898   1.00 72.84  ? 657 LEU A CB   1 
ATOM   4686 C  CG   . LEU A 1 296 ? 19.243  -12.754 4.956   1.00 89.81  ? 657 LEU A CG   1 
ATOM   4687 C  CD1  . LEU A 1 296 ? 18.007  -11.890 4.758   1.00 78.21  ? 657 LEU A CD1  1 
ATOM   4688 C  CD2  . LEU A 1 296 ? 19.262  -13.362 6.351   1.00 85.15  ? 657 LEU A CD2  1 
ATOM   4689 H  H    . LEU A 1 296 ? 20.209  -15.170 1.922   1.00 94.78  ? 657 LEU A H    1 
ATOM   4690 H  HA   . LEU A 1 296 ? 18.724  -12.922 2.169   1.00 87.63  ? 657 LEU A HA   1 
ATOM   4691 H  HB2  . LEU A 1 296 ? 18.499  -14.364 3.950   1.00 87.40  ? 657 LEU A HB2  1 
ATOM   4692 H  HB3  . LEU A 1 296 ? 20.068  -14.430 4.138   1.00 87.40  ? 657 LEU A HB3  1 
ATOM   4693 H  HG   . LEU A 1 296 ? 20.022  -12.181 4.872   1.00 107.78 ? 657 LEU A HG   1 
ATOM   4694 H  HD11 . LEU A 1 296 ? 17.988  -11.204 5.444   1.00 93.85  ? 657 LEU A HD11 1 
ATOM   4695 H  HD12 . LEU A 1 296 ? 18.046  -11.480 3.880   1.00 93.85  ? 657 LEU A HD12 1 
ATOM   4696 H  HD13 . LEU A 1 296 ? 17.217  -12.450 4.828   1.00 93.85  ? 657 LEU A HD13 1 
ATOM   4697 H  HD21 . LEU A 1 296 ? 19.211  -12.650 7.007   1.00 102.18 ? 657 LEU A HD21 1 
ATOM   4698 H  HD22 . LEU A 1 296 ? 18.501  -13.956 6.446   1.00 102.18 ? 657 LEU A HD22 1 
ATOM   4699 H  HD23 . LEU A 1 296 ? 20.087  -13.860 6.466   1.00 102.18 ? 657 LEU A HD23 1 
ATOM   4700 N  N    . GLU A 1 297 ? 20.505  -11.288 1.777   1.00 82.60  ? 658 GLU A N    1 
ATOM   4701 C  CA   . GLU A 1 297 ? 21.564  -10.285 1.673   1.00 110.01 ? 658 GLU A CA   1 
ATOM   4702 C  C    . GLU A 1 297 ? 21.258  -9.084  2.563   1.00 117.49 ? 658 GLU A C    1 
ATOM   4703 O  O    . GLU A 1 297 ? 20.193  -9.015  3.177   1.00 119.40 ? 658 GLU A O    1 
ATOM   4704 C  CB   . GLU A 1 297 ? 21.737  -9.835  0.221   1.00 116.35 ? 658 GLU A CB   1 
ATOM   4705 C  CG   . GLU A 1 297 ? 20.571  -9.019  -0.315  1.00 110.31 ? 658 GLU A CG   1 
ATOM   4706 C  CD   . GLU A 1 297 ? 20.212  -9.361  -1.752  1.00 122.38 ? 658 GLU A CD   1 
ATOM   4707 O  OE1  . GLU A 1 297 ? 20.228  -10.558 -2.114  1.00 136.79 ? 658 GLU A OE1  1 
ATOM   4708 O  OE2  . GLU A 1 297 ? 19.908  -8.425  -2.522  1.00 115.35 ? 658 GLU A OE2  1 
ATOM   4709 H  H    . GLU A 1 297 ? 19.755  -11.041 1.436   1.00 99.12  ? 658 GLU A H    1 
ATOM   4710 H  HA   . GLU A 1 297 ? 22.401  -10.675 1.970   1.00 132.01 ? 658 GLU A HA   1 
ATOM   4711 H  HB2  . GLU A 1 297 ? 22.535  -9.287  0.157   1.00 139.61 ? 658 GLU A HB2  1 
ATOM   4712 H  HB3  . GLU A 1 297 ? 21.832  -10.620 -0.340  1.00 139.61 ? 658 GLU A HB3  1 
ATOM   4713 H  HG2  . GLU A 1 297 ? 19.790  -9.188  0.236   1.00 132.37 ? 658 GLU A HG2  1 
ATOM   4714 H  HG3  . GLU A 1 297 ? 20.803  -8.078  -0.280  1.00 132.37 ? 658 GLU A HG3  1 
ATOM   4715 N  N    . LYS A 1 298 ? 22.193  -8.138  2.620   1.00 132.02 ? 659 LYS A N    1 
ATOM   4716 C  CA   . LYS A 1 298 ? 22.049  -6.956  3.465   1.00 130.21 ? 659 LYS A CA   1 
ATOM   4717 C  C    . LYS A 1 298 ? 21.506  -5.765  2.681   1.00 135.61 ? 659 LYS A C    1 
ATOM   4718 O  O    . LYS A 1 298 ? 21.241  -4.705  3.251   1.00 130.87 ? 659 LYS A O    1 
ATOM   4719 C  CB   . LYS A 1 298 ? 23.391  -6.593  4.101   1.00 129.01 ? 659 LYS A CB   1 
ATOM   4720 C  CG   . LYS A 1 298 ? 23.845  -7.572  5.169   1.00 135.36 ? 659 LYS A CG   1 
ATOM   4721 C  CD   . LYS A 1 298 ? 25.049  -7.048  5.934   1.00 138.91 ? 659 LYS A CD   1 
ATOM   4722 C  CE   . LYS A 1 298 ? 25.334  -7.897  7.163   1.00 130.09 ? 659 LYS A CE   1 
ATOM   4723 N  NZ   . LYS A 1 298 ? 26.790  -7.991  7.454   1.00 133.31 ? 659 LYS A NZ   1 
ATOM   4724 H  H    . LYS A 1 298 ? 22.928  -8.159  2.173   1.00 158.42 ? 659 LYS A H    1 
ATOM   4725 H  HA   . LYS A 1 298 ? 21.423  -7.154  4.179   1.00 156.25 ? 659 LYS A HA   1 
ATOM   4726 H  HB2  . LYS A 1 298 ? 24.070  -6.573  3.409   1.00 154.81 ? 659 LYS A HB2  1 
ATOM   4727 H  HB3  . LYS A 1 298 ? 23.315  -5.718  4.513   1.00 154.81 ? 659 LYS A HB3  1 
ATOM   4728 H  HG2  . LYS A 1 298 ? 23.122  -7.713  5.801   1.00 162.43 ? 659 LYS A HG2  1 
ATOM   4729 H  HG3  . LYS A 1 298 ? 24.093  -8.410  4.750   1.00 162.43 ? 659 LYS A HG3  1 
ATOM   4730 H  HD2  . LYS A 1 298 ? 25.830  -7.072  5.359   1.00 166.69 ? 659 LYS A HD2  1 
ATOM   4731 H  HD3  . LYS A 1 298 ? 24.873  -6.139  6.225   1.00 166.69 ? 659 LYS A HD3  1 
ATOM   4732 H  HE2  . LYS A 1 298 ? 24.897  -7.499  7.932   1.00 156.11 ? 659 LYS A HE2  1 
ATOM   4733 H  HE3  . LYS A 1 298 ? 24.997  -8.794  7.014   1.00 156.11 ? 659 LYS A HE3  1 
ATOM   4734 H  HZ1  . LYS A 1 298 ? 26.924  -8.493  8.177   1.00 159.97 ? 659 LYS A HZ1  1 
ATOM   4735 H  HZ2  . LYS A 1 298 ? 27.215  -8.359  6.764   1.00 159.97 ? 659 LYS A HZ2  1 
ATOM   4736 H  HZ3  . LYS A 1 298 ? 27.124  -7.179  7.600   1.00 159.97 ? 659 LYS A HZ3  1 
ATOM   4737 N  N    . ARG B 1 3   ? -10.600 -7.699  42.153  1.00 83.20  ? 364 ARG B N    1 
ATOM   4738 C  CA   . ARG B 1 3   ? -11.723 -6.972  41.571  1.00 85.90  ? 364 ARG B CA   1 
ATOM   4739 C  C    . ARG B 1 3   ? -12.476 -7.834  40.559  1.00 66.38  ? 364 ARG B C    1 
ATOM   4740 O  O    . ARG B 1 3   ? -11.869 -8.597  39.816  1.00 65.24  ? 364 ARG B O    1 
ATOM   4741 C  CB   . ARG B 1 3   ? -11.233 -5.685  40.900  1.00 78.52  ? 364 ARG B CB   1 
ATOM   4742 C  CG   . ARG B 1 3   ? -11.615 -4.411  41.643  1.00 76.20  ? 364 ARG B CG   1 
ATOM   4743 C  CD   . ARG B 1 3   ? -11.218 -3.174  40.855  1.00 103.42 ? 364 ARG B CD   1 
ATOM   4744 N  NE   . ARG B 1 3   ? -11.918 -1.979  41.318  1.00 119.31 ? 364 ARG B NE   1 
ATOM   4745 C  CZ   . ARG B 1 3   ? -11.827 -0.784  40.741  1.00 128.08 ? 364 ARG B CZ   1 
ATOM   4746 N  NH1  . ARG B 1 3   ? -11.062 -0.612  39.669  1.00 111.71 ? 364 ARG B NH1  1 
ATOM   4747 N  NH2  . ARG B 1 3   ? -12.504 0.243   41.236  1.00 133.08 ? 364 ARG B NH2  1 
ATOM   4748 H  HA   . ARG B 1 3   ? -12.341 -6.727  42.277  1.00 103.08 ? 364 ARG B HA   1 
ATOM   4749 H  HB2  . ARG B 1 3   ? -10.265 -5.713  40.841  1.00 94.23  ? 364 ARG B HB2  1 
ATOM   4750 H  HB3  . ARG B 1 3   ? -11.614 -5.633  40.010  1.00 94.23  ? 364 ARG B HB3  1 
ATOM   4751 H  HG2  . ARG B 1 3   ? -12.575 -4.393  41.777  1.00 91.44  ? 364 ARG B HG2  1 
ATOM   4752 H  HG3  . ARG B 1 3   ? -11.156 -4.388  42.498  1.00 91.44  ? 364 ARG B HG3  1 
ATOM   4753 H  HD2  . ARG B 1 3   ? -10.265 -3.024  40.956  1.00 124.10 ? 364 ARG B HD2  1 
ATOM   4754 H  HD3  . ARG B 1 3   ? -11.438 -3.309  39.920  1.00 124.10 ? 364 ARG B HD3  1 
ATOM   4755 H  HE   . ARG B 1 3   ? -12.423 -2.053  42.010  1.00 143.17 ? 364 ARG B HE   1 
ATOM   4756 H  HH11 . ARG B 1 3   ? -10.622 -1.276  39.344  1.00 134.06 ? 364 ARG B HH11 1 
ATOM   4757 H  HH12 . ARG B 1 3   ? -11.007 0.162   39.300  1.00 134.06 ? 364 ARG B HH12 1 
ATOM   4758 H  HH21 . ARG B 1 3   ? -13.000 0.137   41.930  1.00 159.70 ? 364 ARG B HH21 1 
ATOM   4759 H  HH22 . ARG B 1 3   ? -12.445 1.016   40.864  1.00 159.70 ? 364 ARG B HH22 1 
ATOM   4760 N  N    . ILE B 1 4   ? -13.801 -7.705  40.542  1.00 74.37  ? 365 ILE B N    1 
ATOM   4761 C  CA   . ILE B 1 4   ? -14.637 -8.406  39.569  1.00 63.67  ? 365 ILE B CA   1 
ATOM   4762 C  C    . ILE B 1 4   ? -14.451 -7.828  38.175  1.00 70.61  ? 365 ILE B C    1 
ATOM   4763 O  O    . ILE B 1 4   ? -14.379 -6.617  38.015  1.00 59.59  ? 365 ILE B O    1 
ATOM   4764 C  CB   . ILE B 1 4   ? -16.132 -8.315  39.927  1.00 82.13  ? 365 ILE B CB   1 
ATOM   4765 C  CG1  . ILE B 1 4   ? -16.424 -9.148  41.168  1.00 91.50  ? 365 ILE B CG1  1 
ATOM   4766 C  CG2  . ILE B 1 4   ? -17.000 -8.790  38.755  1.00 72.56  ? 365 ILE B CG2  1 
ATOM   4767 C  CD1  . ILE B 1 4   ? -17.840 -9.006  41.694  1.00 105.27 ? 365 ILE B CD1  1 
ATOM   4768 H  H    . ILE B 1 4   ? -14.245 -7.212  41.089  1.00 89.25  ? 365 ILE B H    1 
ATOM   4769 H  HA   . ILE B 1 4   ? -14.385 -9.342  39.546  1.00 76.40  ? 365 ILE B HA   1 
ATOM   4770 H  HB   . ILE B 1 4   ? -16.349 -7.388  40.117  1.00 98.55  ? 365 ILE B HB   1 
ATOM   4771 H  HG12 . ILE B 1 4   ? -16.281 -10.084 40.956  1.00 109.80 ? 365 ILE B HG12 1 
ATOM   4772 H  HG13 . ILE B 1 4   ? -15.818 -8.877  41.875  1.00 109.80 ? 365 ILE B HG13 1 
ATOM   4773 H  HG21 . ILE B 1 4   ? -17.934 -8.723  39.007  1.00 87.07  ? 365 ILE B HG21 1 
ATOM   4774 H  HG22 . ILE B 1 4   ? -16.823 -8.229  37.984  1.00 87.07  ? 365 ILE B HG22 1 
ATOM   4775 H  HG23 . ILE B 1 4   ? -16.777 -9.712  38.552  1.00 87.07  ? 365 ILE B HG23 1 
ATOM   4776 H  HD11 . ILE B 1 4   ? -17.942 -9.565  42.480  1.00 126.32 ? 365 ILE B HD11 1 
ATOM   4777 H  HD12 . ILE B 1 4   ? -17.999 -8.077  41.925  1.00 126.32 ? 365 ILE B HD12 1 
ATOM   4778 H  HD13 . ILE B 1 4   ? -18.462 -9.286  41.004  1.00 126.32 ? 365 ILE B HD13 1 
ATOM   4779 N  N    . THR B 1 5   ? -14.416 -8.699  37.172  1.00 57.52  ? 366 THR B N    1 
ATOM   4780 C  CA   . THR B 1 5   ? -14.322 -8.278  35.777  1.00 59.04  ? 366 THR B CA   1 
ATOM   4781 C  C    . THR B 1 5   ? -15.518 -8.777  34.980  1.00 60.94  ? 366 THR B C    1 
ATOM   4782 O  O    . THR B 1 5   ? -15.821 -9.970  35.000  1.00 68.55  ? 366 THR B O    1 
ATOM   4783 C  CB   . THR B 1 5   ? -13.039 -8.807  35.108  1.00 74.36  ? 366 THR B CB   1 
ATOM   4784 O  OG1  . THR B 1 5   ? -13.068 -10.241 35.081  1.00 68.42  ? 366 THR B OG1  1 
ATOM   4785 C  CG2  . THR B 1 5   ? -11.799 -8.326  35.859  1.00 74.43  ? 366 THR B CG2  1 
ATOM   4786 H  H    . THR B 1 5   ? -14.445 -9.552  37.274  1.00 69.03  ? 366 THR B H    1 
ATOM   4787 H  HA   . THR B 1 5   ? -14.310 -7.309  35.735  1.00 70.85  ? 366 THR B HA   1 
ATOM   4788 H  HB   . THR B 1 5   ? -12.991 -8.472  34.199  1.00 89.23  ? 366 THR B HB   1 
ATOM   4789 H  HG1  . THR B 1 5   ? -13.736 -10.507 34.645  1.00 82.10  ? 366 THR B HG1  1 
ATOM   4790 H  HG21 . THR B 1 5   ? -10.998 -8.666  35.428  1.00 89.31  ? 366 THR B HG21 1 
ATOM   4791 H  HG22 . THR B 1 5   ? -11.768 -7.357  35.861  1.00 89.31  ? 366 THR B HG22 1 
ATOM   4792 H  HG23 . THR B 1 5   ? -11.823 -8.644  36.775  1.00 89.31  ? 366 THR B HG23 1 
ATOM   4793 N  N    . VAL B 1 6   ? -16.192 -7.867  34.281  1.00 57.37  ? 367 VAL B N    1 
ATOM   4794 C  CA   . VAL B 1 6   ? -17.208 -8.253  33.307  1.00 53.53  ? 367 VAL B CA   1 
ATOM   4795 C  C    . VAL B 1 6   ? -16.819 -7.768  31.911  1.00 57.60  ? 367 VAL B C    1 
ATOM   4796 O  O    . VAL B 1 6   ? -16.915 -6.577  31.613  1.00 63.24  ? 367 VAL B O    1 
ATOM   4797 C  CB   . VAL B 1 6   ? -18.592 -7.697  33.665  1.00 56.06  ? 367 VAL B CB   1 
ATOM   4798 C  CG1  . VAL B 1 6   ? -19.613 -8.085  32.587  1.00 61.43  ? 367 VAL B CG1  1 
ATOM   4799 C  CG2  . VAL B 1 6   ? -19.024 -8.216  35.033  1.00 55.10  ? 367 VAL B CG2  1 
ATOM   4800 H  H    . VAL B 1 6   ? -16.080 -7.017  34.353  1.00 68.85  ? 367 VAL B H    1 
ATOM   4801 H  HA   . VAL B 1 6   ? -17.271 -9.221  33.282  1.00 64.24  ? 367 VAL B HA   1 
ATOM   4802 H  HB   . VAL B 1 6   ? -18.547 -6.729  33.708  1.00 67.27  ? 367 VAL B HB   1 
ATOM   4803 H  HG11 . VAL B 1 6   ? -20.480 -7.725  32.830  1.00 73.72  ? 367 VAL B HG11 1 
ATOM   4804 H  HG12 . VAL B 1 6   ? -19.328 -7.716  31.736  1.00 73.72  ? 367 VAL B HG12 1 
ATOM   4805 H  HG13 . VAL B 1 6   ? -19.659 -9.052  32.530  1.00 73.72  ? 367 VAL B HG13 1 
ATOM   4806 H  HG21 . VAL B 1 6   ? -19.899 -7.856  35.245  1.00 66.11  ? 367 VAL B HG21 1 
ATOM   4807 H  HG22 . VAL B 1 6   ? -19.062 -9.185  35.005  1.00 66.11  ? 367 VAL B HG22 1 
ATOM   4808 H  HG23 . VAL B 1 6   ? -18.378 -7.929  35.697  1.00 66.11  ? 367 VAL B HG23 1 
ATOM   4809 N  N    . PRO B 1 7   ? -16.391 -8.691  31.042  1.00 56.21  ? 368 PRO B N    1 
ATOM   4810 C  CA   . PRO B 1 7   ? -15.980 -8.241  29.711  1.00 62.59  ? 368 PRO B CA   1 
ATOM   4811 C  C    . PRO B 1 7   ? -17.175 -7.829  28.862  1.00 61.82  ? 368 PRO B C    1 
ATOM   4812 O  O    . PRO B 1 7   ? -18.191 -8.523  28.863  1.00 62.73  ? 368 PRO B O    1 
ATOM   4813 C  CB   . PRO B 1 7   ? -15.272 -9.466  29.126  1.00 60.02  ? 368 PRO B CB   1 
ATOM   4814 C  CG   . PRO B 1 7   ? -15.879 -10.633 29.836  1.00 63.71  ? 368 PRO B CG   1 
ATOM   4815 C  CD   . PRO B 1 7   ? -16.302 -10.154 31.192  1.00 55.15  ? 368 PRO B CD   1 
ATOM   4816 H  HA   . PRO B 1 7   ? -15.354 -7.502  29.778  1.00 75.11  ? 368 PRO B HA   1 
ATOM   4817 H  HB2  . PRO B 1 7   ? -15.440 -9.517  28.172  1.00 72.02  ? 368 PRO B HB2  1 
ATOM   4818 H  HB3  . PRO B 1 7   ? -14.320 -9.411  29.306  1.00 72.02  ? 368 PRO B HB3  1 
ATOM   4819 H  HG2  . PRO B 1 7   ? -16.648 -10.948 29.335  1.00 76.45  ? 368 PRO B HG2  1 
ATOM   4820 H  HG3  . PRO B 1 7   ? -15.219 -11.338 29.918  1.00 76.45  ? 368 PRO B HG3  1 
ATOM   4821 H  HD2  . PRO B 1 7   ? -17.170 -10.522 31.424  1.00 66.18  ? 368 PRO B HD2  1 
ATOM   4822 H  HD3  . PRO B 1 7   ? -15.632 -10.385 31.855  1.00 66.18  ? 368 PRO B HD3  1 
ATOM   4823 N  N    . LEU B 1 8   ? -17.056 -6.690  28.186  1.00 55.71  ? 369 LEU B N    1 
ATOM   4824 C  CA   . LEU B 1 8   ? -18.033 -6.269  27.194  1.00 53.63  ? 369 LEU B CA   1 
ATOM   4825 C  C    . LEU B 1 8   ? -17.499 -6.656  25.825  1.00 55.43  ? 369 LEU B C    1 
ATOM   4826 O  O    . LEU B 1 8   ? -16.506 -6.099  25.358  1.00 68.60  ? 369 LEU B O    1 
ATOM   4827 C  CB   . LEU B 1 8   ? -18.295 -4.766  27.287  1.00 52.86  ? 369 LEU B CB   1 
ATOM   4828 C  CG   . LEU B 1 8   ? -18.680 -4.296  28.693  1.00 53.32  ? 369 LEU B CG   1 
ATOM   4829 C  CD1  . LEU B 1 8   ? -18.958 -2.802  28.723  1.00 65.70  ? 369 LEU B CD1  1 
ATOM   4830 C  CD2  . LEU B 1 8   ? -19.881 -5.069  29.198  1.00 56.63  ? 369 LEU B CD2  1 
ATOM   4831 H  H    . LEU B 1 8   ? -16.405 -6.137  28.287  1.00 66.86  ? 369 LEU B H    1 
ATOM   4832 H  HA   . LEU B 1 8   ? -18.870 -6.738  27.342  1.00 64.35  ? 369 LEU B HA   1 
ATOM   4833 H  HB2  . LEU B 1 8   ? -17.491 -4.291  27.024  1.00 63.44  ? 369 LEU B HB2  1 
ATOM   4834 H  HB3  . LEU B 1 8   ? -19.023 -4.537  26.687  1.00 63.44  ? 369 LEU B HB3  1 
ATOM   4835 H  HG   . LEU B 1 8   ? -17.940 -4.472  29.295  1.00 63.99  ? 369 LEU B HG   1 
ATOM   4836 H  HD11 . LEU B 1 8   ? -19.197 -2.544  29.627  1.00 78.84  ? 369 LEU B HD11 1 
ATOM   4837 H  HD12 . LEU B 1 8   ? -18.159 -2.327  28.444  1.00 78.84  ? 369 LEU B HD12 1 
ATOM   4838 H  HD13 . LEU B 1 8   ? -19.690 -2.605  28.118  1.00 78.84  ? 369 LEU B HD13 1 
ATOM   4839 H  HD21 . LEU B 1 8   ? -20.107 -4.756  30.088  1.00 67.96  ? 369 LEU B HD21 1 
ATOM   4840 H  HD22 . LEU B 1 8   ? -20.628 -4.922  28.596  1.00 67.96  ? 369 LEU B HD22 1 
ATOM   4841 H  HD23 . LEU B 1 8   ? -19.660 -6.013  29.226  1.00 67.96  ? 369 LEU B HD23 1 
ATOM   4842 N  N    . VAL B 1 9   ? -18.161 -7.622  25.200  1.00 51.99  ? 370 VAL B N    1 
ATOM   4843 C  CA   . VAL B 1 9   ? -17.659 -8.260  23.989  1.00 58.24  ? 370 VAL B CA   1 
ATOM   4844 C  C    . VAL B 1 9   ? -18.637 -8.139  22.819  1.00 59.70  ? 370 VAL B C    1 
ATOM   4845 O  O    . VAL B 1 9   ? -19.850 -8.209  23.005  1.00 59.41  ? 370 VAL B O    1 
ATOM   4846 C  CB   . VAL B 1 9   ? -17.369 -9.746  24.249  1.00 58.47  ? 370 VAL B CB   1 
ATOM   4847 C  CG1  . VAL B 1 9   ? -16.700 -10.386 23.047  1.00 73.46  ? 370 VAL B CG1  1 
ATOM   4848 C  CG2  . VAL B 1 9   ? -16.496 -9.901  25.492  1.00 72.88  ? 370 VAL B CG2  1 
ATOM   4849 H  H    . VAL B 1 9   ? -18.919 -7.933  25.464  1.00 62.39  ? 370 VAL B H    1 
ATOM   4850 H  HA   . VAL B 1 9   ? -16.827 -7.833  23.729  1.00 69.88  ? 370 VAL B HA   1 
ATOM   4851 H  HB   . VAL B 1 9   ? -18.207 -10.208 24.409  1.00 70.16  ? 370 VAL B HB   1 
ATOM   4852 H  HG11 . VAL B 1 9   ? -16.531 -11.321 23.241  1.00 88.15  ? 370 VAL B HG11 1 
ATOM   4853 H  HG12 . VAL B 1 9   ? -17.289 -10.309 22.280  1.00 88.15  ? 370 VAL B HG12 1 
ATOM   4854 H  HG13 . VAL B 1 9   ? -15.864 -9.928  22.870  1.00 88.15  ? 370 VAL B HG13 1 
ATOM   4855 H  HG21 . VAL B 1 9   ? -16.324 -10.844 25.640  1.00 87.45  ? 370 VAL B HG21 1 
ATOM   4856 H  HG22 . VAL B 1 9   ? -15.660 -9.430  25.351  1.00 87.45  ? 370 VAL B HG22 1 
ATOM   4857 H  HG23 . VAL B 1 9   ? -16.963 -9.526  26.254  1.00 87.45  ? 370 VAL B HG23 1 
ATOM   4858 N  N    . SER B 1 10  ? -18.095 -7.975  21.613  1.00 54.35  ? 371 SER B N    1 
ATOM   4859 C  CA   . SER B 1 10  ? -18.916 -7.824  20.413  1.00 55.35  ? 371 SER B CA   1 
ATOM   4860 C  C    . SER B 1 10  ? -18.208 -8.352  19.158  1.00 59.72  ? 371 SER B C    1 
ATOM   4861 O  O    . SER B 1 10  ? -17.041 -8.736  19.204  1.00 61.41  ? 371 SER B O    1 
ATOM   4862 C  CB   . SER B 1 10  ? -19.301 -6.355  20.225  1.00 59.53  ? 371 SER B CB   1 
ATOM   4863 O  OG   . SER B 1 10  ? -20.241 -5.939  21.203  1.00 68.99  ? 371 SER B OG   1 
ATOM   4864 H  H    . SER B 1 10  ? -17.249 -7.947  21.462  1.00 65.22  ? 371 SER B H    1 
ATOM   4865 H  HA   . SER B 1 10  ? -19.734 -8.333  20.528  1.00 66.42  ? 371 SER B HA   1 
ATOM   4866 H  HB2  . SER B 1 10  ? -18.503 -5.809  20.303  1.00 71.44  ? 371 SER B HB2  1 
ATOM   4867 H  HB3  . SER B 1 10  ? -19.693 -6.243  19.345  1.00 71.44  ? 371 SER B HB3  1 
ATOM   4868 H  HG   . SER B 1 10  ? -19.915 -6.030  21.972  1.00 82.78  ? 371 SER B HG   1 
ATOM   4869 N  N    . GLU B 1 11  ? -18.928 -8.371  18.041  1.00 48.16  ? 372 GLU B N    1 
ATOM   4870 C  CA   . GLU B 1 11  ? -18.412 -8.931  16.794  1.00 47.64  ? 372 GLU B CA   1 
ATOM   4871 C  C    . GLU B 1 11  ? -17.605 -7.899  16.022  1.00 57.90  ? 372 GLU B C    1 
ATOM   4872 O  O    . GLU B 1 11  ? -18.113 -6.826  15.681  1.00 60.28  ? 372 GLU B O    1 
ATOM   4873 C  CB   . GLU B 1 11  ? -19.553 -9.444  15.916  1.00 59.85  ? 372 GLU B CB   1 
ATOM   4874 C  CG   . GLU B 1 11  ? -20.549 -10.351 16.621  1.00 86.77  ? 372 GLU B CG   1 
ATOM   4875 C  CD   . GLU B 1 11  ? -20.134 -11.806 16.603  1.00 91.33  ? 372 GLU B CD   1 
ATOM   4876 O  OE1  . GLU B 1 11  ? -18.915 -12.079 16.590  1.00 96.81  ? 372 GLU B OE1  1 
ATOM   4877 O  OE2  . GLU B 1 11  ? -21.029 -12.677 16.598  1.00 113.48 ? 372 GLU B OE2  1 
ATOM   4878 H  H    . GLU B 1 11  ? -19.728 -8.062  17.977  1.00 57.79  ? 372 GLU B H    1 
ATOM   4879 H  HA   . GLU B 1 11  ? -17.829 -9.678  17.000  1.00 57.16  ? 372 GLU B HA   1 
ATOM   4880 H  HB2  . GLU B 1 11  ? -20.045 -8.682  15.572  1.00 71.81  ? 372 GLU B HB2  1 
ATOM   4881 H  HB3  . GLU B 1 11  ? -19.172 -9.945  15.178  1.00 71.81  ? 372 GLU B HB3  1 
ATOM   4882 H  HG2  . GLU B 1 11  ? -20.628 -10.073 17.546  1.00 104.13 ? 372 GLU B HG2  1 
ATOM   4883 H  HG3  . GLU B 1 11  ? -21.409 -10.280 16.178  1.00 104.13 ? 372 GLU B HG3  1 
ATOM   4884 N  N    . VAL B 1 12  ? -16.347 -8.229  15.750  1.00 56.83  ? 373 VAL B N    1 
ATOM   4885 C  CA   . VAL B 1 12  ? -15.498 -7.397  14.906  1.00 53.49  ? 373 VAL B CA   1 
ATOM   4886 C  C    . VAL B 1 12  ? -14.946 -8.236  13.766  1.00 52.66  ? 373 VAL B C    1 
ATOM   4887 O  O    . VAL B 1 12  ? -14.529 -9.378  13.977  1.00 60.26  ? 373 VAL B O    1 
ATOM   4888 C  CB   . VAL B 1 12  ? -14.324 -6.778  15.688  1.00 63.95  ? 373 VAL B CB   1 
ATOM   4889 C  CG1  . VAL B 1 12  ? -13.555 -5.808  14.795  1.00 58.98  ? 373 VAL B CG1  1 
ATOM   4890 C  CG2  . VAL B 1 12  ? -14.825 -6.071  16.946  1.00 55.99  ? 373 VAL B CG2  1 
ATOM   4891 H  H    . VAL B 1 12  ? -15.958 -8.938  16.045  1.00 68.19  ? 373 VAL B H    1 
ATOM   4892 H  HA   . VAL B 1 12  ? -16.027 -6.678  14.529  1.00 64.19  ? 373 VAL B HA   1 
ATOM   4893 H  HB   . VAL B 1 12  ? -13.717 -7.484  15.960  1.00 76.74  ? 373 VAL B HB   1 
ATOM   4894 H  HG11 . VAL B 1 12  ? -12.821 -5.428  15.302  1.00 70.77  ? 373 VAL B HG11 1 
ATOM   4895 H  HG12 . VAL B 1 12  ? -13.213 -6.291  14.027  1.00 70.77  ? 373 VAL B HG12 1 
ATOM   4896 H  HG13 . VAL B 1 12  ? -14.156 -5.105  14.503  1.00 70.77  ? 373 VAL B HG13 1 
ATOM   4897 H  HG21 . VAL B 1 12  ? -14.067 -5.692  17.418  1.00 67.19  ? 373 VAL B HG21 1 
ATOM   4898 H  HG22 . VAL B 1 12  ? -15.441 -5.368  16.689  1.00 67.19  ? 373 VAL B HG22 1 
ATOM   4899 H  HG23 . VAL B 1 12  ? -15.277 -6.717  17.512  1.00 67.19  ? 373 VAL B HG23 1 
ATOM   4900 N  N    . GLN B 1 13  ? -14.951 -7.672  12.560  1.00 51.55  ? 374 GLN B N    1 
ATOM   4901 C  CA   . GLN B 1 13  ? -14.306 -8.323  11.428  1.00 49.00  ? 374 GLN B CA   1 
ATOM   4902 C  C    . GLN B 1 13  ? -12.801 -8.143  11.550  1.00 49.90  ? 374 GLN B C    1 
ATOM   4903 O  O    . GLN B 1 13  ? -12.293 -7.025  11.461  1.00 55.88  ? 374 GLN B O    1 
ATOM   4904 C  CB   . GLN B 1 13  ? -14.805 -7.758  10.089  1.00 52.07  ? 374 GLN B CB   1 
ATOM   4905 C  CG   . GLN B 1 13  ? -13.992 -8.255  8.887   1.00 63.81  ? 374 GLN B CG   1 
ATOM   4906 C  CD   . GLN B 1 13  ? -14.569 -7.824  7.551   1.00 66.32  ? 374 GLN B CD   1 
ATOM   4907 O  OE1  . GLN B 1 13  ? -15.690 -8.191  7.200   1.00 62.26  ? 374 GLN B OE1  1 
ATOM   4908 N  NE2  . GLN B 1 13  ? -13.797 -7.049  6.792   1.00 70.63  ? 374 GLN B NE2  1 
ATOM   4909 H  H    . GLN B 1 13  ? -15.319 -6.918  12.374  1.00 61.86  ? 374 GLN B H    1 
ATOM   4910 H  HA   . GLN B 1 13  ? -14.503 -9.272  11.450  1.00 58.79  ? 374 GLN B HA   1 
ATOM   4911 H  HB2  . GLN B 1 13  ? -15.727 -8.027  9.958   1.00 62.48  ? 374 GLN B HB2  1 
ATOM   4912 H  HB3  . GLN B 1 13  ? -14.742 -6.790  10.113  1.00 62.48  ? 374 GLN B HB3  1 
ATOM   4913 H  HG2  . GLN B 1 13  ? -13.090 -7.902  8.950   1.00 76.58  ? 374 GLN B HG2  1 
ATOM   4914 H  HG3  . GLN B 1 13  ? -13.968 -9.224  8.903   1.00 76.58  ? 374 GLN B HG3  1 
ATOM   4915 H  HE21 . GLN B 1 13  ? -13.015 -6.819  7.068   1.00 84.75  ? 374 GLN B HE21 1 
ATOM   4916 H  HE22 . GLN B 1 13  ? -14.079 -6.779  6.026   1.00 84.75  ? 374 GLN B HE22 1 
ATOM   4917 N  N    . ILE B 1 14  ? -12.097 -9.250  11.756  1.00 53.23  ? 375 ILE B N    1 
ATOM   4918 C  CA   . ILE B 1 14  ? -10.648 -9.222  11.924  1.00 64.56  ? 375 ILE B CA   1 
ATOM   4919 C  C    . ILE B 1 14  ? -9.968  -9.087  10.566  1.00 62.24  ? 375 ILE B C    1 
ATOM   4920 O  O    . ILE B 1 14  ? -9.008  -8.334  10.404  1.00 61.78  ? 375 ILE B O    1 
ATOM   4921 C  CB   . ILE B 1 14  ? -10.139 -10.499 12.635  1.00 62.56  ? 375 ILE B CB   1 
ATOM   4922 C  CG1  . ILE B 1 14  ? -10.887 -10.723 13.956  1.00 57.04  ? 375 ILE B CG1  1 
ATOM   4923 C  CG2  . ILE B 1 14  ? -8.637  -10.423 12.885  1.00 70.42  ? 375 ILE B CG2  1 
ATOM   4924 C  CD1  . ILE B 1 14  ? -10.738 -9.591  14.966  1.00 53.21  ? 375 ILE B CD1  1 
ATOM   4925 H  H    . ILE B 1 14  ? -12.438 -10.038 11.803  1.00 63.88  ? 375 ILE B H    1 
ATOM   4926 H  HA   . ILE B 1 14  ? -10.403 -8.455  12.465  1.00 77.47  ? 375 ILE B HA   1 
ATOM   4927 H  HB   . ILE B 1 14  ? -10.311 -11.258 12.056  1.00 75.08  ? 375 ILE B HB   1 
ATOM   4928 H  HG12 . ILE B 1 14  ? -11.832 -10.824 13.764  1.00 68.45  ? 375 ILE B HG12 1 
ATOM   4929 H  HG13 . ILE B 1 14  ? -10.549 -11.533 14.370  1.00 68.45  ? 375 ILE B HG13 1 
ATOM   4930 H  HG21 . ILE B 1 14  ? -8.350  -11.235 13.331  1.00 84.50  ? 375 ILE B HG21 1 
ATOM   4931 H  HG22 . ILE B 1 14  ? -8.180  -10.332 12.035  1.00 84.50  ? 375 ILE B HG22 1 
ATOM   4932 H  HG23 . ILE B 1 14  ? -8.450  -9.654  13.446  1.00 84.50  ? 375 ILE B HG23 1 
ATOM   4933 H  HD11 . ILE B 1 14  ? -11.239 -9.814  15.765  1.00 63.86  ? 375 ILE B HD11 1 
ATOM   4934 H  HD12 . ILE B 1 14  ? -9.799  -9.484  15.183  1.00 63.86  ? 375 ILE B HD12 1 
ATOM   4935 H  HD13 . ILE B 1 14  ? -11.083 -8.773  14.575  1.00 63.86  ? 375 ILE B HD13 1 
ATOM   4936 N  N    . ALA B 1 15  ? -10.477 -9.823  9.587   1.00 58.20  ? 376 ALA B N    1 
ATOM   4937 C  CA   . ALA B 1 15  ? -9.928  -9.779  8.245   1.00 68.01  ? 376 ALA B CA   1 
ATOM   4938 C  C    . ALA B 1 15  ? -10.948 -10.312 7.253   1.00 63.91  ? 376 ALA B C    1 
ATOM   4939 O  O    . ALA B 1 15  ? -12.053 -10.705 7.637   1.00 55.57  ? 376 ALA B O    1 
ATOM   4940 C  CB   . ALA B 1 15  ? -8.643  -10.575 8.177   1.00 59.28  ? 376 ALA B CB   1 
ATOM   4941 H  H    . ALA B 1 15  ? -11.144 -10.358 9.677   1.00 69.84  ? 376 ALA B H    1 
ATOM   4942 H  HA   . ALA B 1 15  ? -9.728  -8.859  8.011   1.00 81.61  ? 376 ALA B HA   1 
ATOM   4943 H  HB1  . ALA B 1 15  ? -8.293  -10.532 7.273   1.00 71.14  ? 376 ALA B HB1  1 
ATOM   4944 H  HB2  . ALA B 1 15  ? -8.003  -10.194 8.798   1.00 71.14  ? 376 ALA B HB2  1 
ATOM   4945 H  HB3  . ALA B 1 15  ? -8.829  -11.496 8.417   1.00 71.14  ? 376 ALA B HB3  1 
ATOM   4946 N  N    . GLN B 1 16  ? -10.565 -10.331 5.981   1.00 50.01  ? 377 GLN B N    1 
ATOM   4947 C  CA   . GLN B 1 16  ? -11.469 -10.717 4.907   1.00 58.14  ? 377 GLN B CA   1 
ATOM   4948 C  C    . GLN B 1 16  ? -10.714 -11.449 3.810   1.00 49.42  ? 377 GLN B C    1 
ATOM   4949 O  O    . GLN B 1 16  ? -9.777  -10.908 3.230   1.00 62.07  ? 377 GLN B O    1 
ATOM   4950 C  CB   . GLN B 1 16  ? -12.155 -9.485  4.329   1.00 63.05  ? 377 GLN B CB   1 
ATOM   4951 C  CG   . GLN B 1 16  ? -13.424 -9.781  3.565   1.00 78.38  ? 377 GLN B CG   1 
ATOM   4952 C  CD   . GLN B 1 16  ? -13.989 -8.543  2.900   1.00 99.60  ? 377 GLN B CD   1 
ATOM   4953 O  OE1  . GLN B 1 16  ? -13.291 -7.850  2.158   1.00 75.86  ? 377 GLN B OE1  1 
ATOM   4954 N  NE2  . GLN B 1 16  ? -15.256 -8.250  3.172   1.00 111.73 ? 377 GLN B NE2  1 
ATOM   4955 H  H    . GLN B 1 16  ? -9.775  -10.121 5.711   1.00 60.01  ? 377 GLN B H    1 
ATOM   4956 H  HA   . GLN B 1 16  ? -12.151 -11.311 5.258   1.00 69.77  ? 377 GLN B HA   1 
ATOM   4957 H  HB2  . GLN B 1 16  ? -12.382 -8.885  5.056   1.00 75.66  ? 377 GLN B HB2  1 
ATOM   4958 H  HB3  . GLN B 1 16  ? -11.542 -9.044  3.721   1.00 75.66  ? 377 GLN B HB3  1 
ATOM   4959 H  HG2  . GLN B 1 16  ? -13.235 -10.436 2.875   1.00 94.06  ? 377 GLN B HG2  1 
ATOM   4960 H  HG3  . GLN B 1 16  ? -14.092 -10.126 4.179   1.00 94.06  ? 377 GLN B HG3  1 
ATOM   4961 H  HE21 . GLN B 1 16  ? -15.709 -8.754  3.701   1.00 134.07 ? 377 GLN B HE21 1 
ATOM   4962 H  HE22 . GLN B 1 16  ? -15.622 -7.557  2.819   1.00 134.07 ? 377 GLN B HE22 1 
ATOM   4963 N  N    . LEU B 1 17  ? -11.114 -12.686 3.545   1.00 58.95  ? 378 LEU B N    1 
ATOM   4964 C  CA   . LEU B 1 17  ? -10.533 -13.448 2.454   1.00 61.95  ? 378 LEU B CA   1 
ATOM   4965 C  C    . LEU B 1 17  ? -11.263 -13.078 1.179   1.00 52.59  ? 378 LEU B C    1 
ATOM   4966 O  O    . LEU B 1 17  ? -12.491 -12.977 1.175   1.00 53.36  ? 378 LEU B O    1 
ATOM   4967 C  CB   . LEU B 1 17  ? -10.627 -14.952 2.708   1.00 53.23  ? 378 LEU B CB   1 
ATOM   4968 C  CG   . LEU B 1 17  ? -10.055 -15.451 4.038   1.00 65.60  ? 378 LEU B CG   1 
ATOM   4969 C  CD1  . LEU B 1 17  ? -10.226 -16.956 4.158   1.00 70.37  ? 378 LEU B CD1  1 
ATOM   4970 C  CD2  . LEU B 1 17  ? -8.591  -15.064 4.164   1.00 54.74  ? 378 LEU B CD2  1 
ATOM   4971 H  H    . LEU B 1 17  ? -11.722 -13.107 3.984   1.00 70.75  ? 378 LEU B H    1 
ATOM   4972 H  HA   . LEU B 1 17  ? -9.598  -13.210 2.354   1.00 74.34  ? 378 LEU B HA   1 
ATOM   4973 H  HB2  . LEU B 1 17  ? -11.562 -15.207 2.683   1.00 63.88  ? 378 LEU B HB2  1 
ATOM   4974 H  HB3  . LEU B 1 17  ? -10.149 -15.411 1.999   1.00 63.88  ? 378 LEU B HB3  1 
ATOM   4975 H  HG   . LEU B 1 17  ? -10.541 -15.034 4.767   1.00 78.72  ? 378 LEU B HG   1 
ATOM   4976 H  HD11 . LEU B 1 17  ? -9.858  -17.248 5.006   1.00 84.45  ? 378 LEU B HD11 1 
ATOM   4977 H  HD12 . LEU B 1 17  ? -11.171 -17.170 4.116   1.00 84.45  ? 378 LEU B HD12 1 
ATOM   4978 H  HD13 . LEU B 1 17  ? -9.756  -17.386 3.427   1.00 84.45  ? 378 LEU B HD13 1 
ATOM   4979 H  HD21 . LEU B 1 17  ? -8.251  -15.389 5.012   1.00 65.69  ? 378 LEU B HD21 1 
ATOM   4980 H  HD22 . LEU B 1 17  ? -8.095  -15.464 3.433   1.00 65.69  ? 378 LEU B HD22 1 
ATOM   4981 H  HD23 . LEU B 1 17  ? -8.516  -14.097 4.126   1.00 65.69  ? 378 LEU B HD23 1 
ATOM   4982 N  N    . ARG B 1 18  ? -10.493 -12.849 0.119   1.00 51.92  ? 379 ARG B N    1 
ATOM   4983 C  CA   . ARG B 1 18  ? -11.033 -12.584 -1.210  1.00 48.58  ? 379 ARG B CA   1 
ATOM   4984 C  C    . ARG B 1 18  ? -10.419 -13.553 -2.208  1.00 43.29  ? 379 ARG B C    1 
ATOM   4985 O  O    . ARG B 1 18  ? -9.194  -13.668 -2.291  1.00 46.27  ? 379 ARG B O    1 
ATOM   4986 C  CB   . ARG B 1 18  ? -10.748 -11.146 -1.647  1.00 61.59  ? 379 ARG B CB   1 
ATOM   4987 C  CG   . ARG B 1 18  ? -11.392 -10.081 -0.779  1.00 68.04  ? 379 ARG B CG   1 
ATOM   4988 C  CD   . ARG B 1 18  ? -10.933 -8.691  -1.192  1.00 93.71  ? 379 ARG B CD   1 
ATOM   4989 N  NE   . ARG B 1 18  ? -11.685 -7.637  -0.515  1.00 116.62 ? 379 ARG B NE   1 
ATOM   4990 C  CZ   . ARG B 1 18  ? -12.863 -7.171  -0.923  1.00 117.23 ? 379 ARG B CZ   1 
ATOM   4991 N  NH1  . ARG B 1 18  ? -13.442 -7.666  -2.009  1.00 113.44 ? 379 ARG B NH1  1 
ATOM   4992 N  NH2  . ARG B 1 18  ? -13.468 -6.209  -0.239  1.00 116.90 ? 379 ARG B NH2  1 
ATOM   4993 H  H    . ARG B 1 18  ? -9.633  -12.842 0.146   1.00 62.31  ? 379 ARG B H    1 
ATOM   4994 H  HA   . ARG B 1 18  ? -11.994 -12.718 -1.202  1.00 58.29  ? 379 ARG B HA   1 
ATOM   4995 H  HB2  . ARG B 1 18  ? -9.789  -11.000 -1.628  1.00 73.91  ? 379 ARG B HB2  1 
ATOM   4996 H  HB3  . ARG B 1 18  ? -11.078 -11.026 -2.551  1.00 73.91  ? 379 ARG B HB3  1 
ATOM   4997 H  HG2  . ARG B 1 18  ? -12.356 -10.127 -0.875  1.00 81.65  ? 379 ARG B HG2  1 
ATOM   4998 H  HG3  . ARG B 1 18  ? -11.138 -10.224 0.147   1.00 81.65  ? 379 ARG B HG3  1 
ATOM   4999 H  HD2  . ARG B 1 18  ? -9.996  -8.585  -0.967  1.00 112.46 ? 379 ARG B HD2  1 
ATOM   5000 H  HD3  . ARG B 1 18  ? -11.061 -8.586  -2.148  1.00 112.46 ? 379 ARG B HD3  1 
ATOM   5001 H  HE   . ARG B 1 18  ? -11.343 -7.295  0.196   1.00 139.94 ? 379 ARG B HE   1 
ATOM   5002 H  HH11 . ARG B 1 18  ? -13.054 -8.290  -2.456  1.00 136.12 ? 379 ARG B HH11 1 
ATOM   5003 H  HH12 . ARG B 1 18  ? -14.203 -7.361  -2.267  1.00 136.12 ? 379 ARG B HH12 1 
ATOM   5004 H  HH21 . ARG B 1 18  ? -13.098 -5.885  0.467   1.00 140.28 ? 379 ARG B HH21 1 
ATOM   5005 H  HH22 . ARG B 1 18  ? -14.230 -5.908  -0.501  1.00 140.28 ? 379 ARG B HH22 1 
ATOM   5006 N  N    . PHE B 1 19  ? -11.274 -14.257 -2.946  1.00 42.30  ? 380 PHE B N    1 
ATOM   5007 C  CA   . PHE B 1 19  ? -10.825 -15.159 -4.004  1.00 45.26  ? 380 PHE B CA   1 
ATOM   5008 C  C    . PHE B 1 19  ? -11.507 -14.785 -5.311  1.00 48.01  ? 380 PHE B C    1 
ATOM   5009 O  O    . PHE B 1 19  ? -12.732 -14.684 -5.357  1.00 52.71  ? 380 PHE B O    1 
ATOM   5010 C  CB   . PHE B 1 19  ? -11.138 -16.617 -3.671  1.00 60.91  ? 380 PHE B CB   1 
ATOM   5011 C  CG   . PHE B 1 19  ? -10.529 -17.096 -2.396  1.00 54.45  ? 380 PHE B CG   1 
ATOM   5012 C  CD1  . PHE B 1 19  ? -9.226  -17.563 -2.370  1.00 49.96  ? 380 PHE B CD1  1 
ATOM   5013 C  CD2  . PHE B 1 19  ? -11.264 -17.096 -1.222  1.00 43.69  ? 380 PHE B CD2  1 
ATOM   5014 C  CE1  . PHE B 1 19  ? -8.663  -18.015 -1.195  1.00 48.07  ? 380 PHE B CE1  1 
ATOM   5015 C  CE2  . PHE B 1 19  ? -10.710 -17.549 -0.043  1.00 43.59  ? 380 PHE B CE2  1 
ATOM   5016 C  CZ   . PHE B 1 19  ? -9.403  -18.008 -0.030  1.00 45.36  ? 380 PHE B CZ   1 
ATOM   5017 H  H    . PHE B 1 19  ? -12.129 -14.230 -2.853  1.00 50.75  ? 380 PHE B H    1 
ATOM   5018 H  HA   . PHE B 1 19  ? -9.866  -15.069 -4.121  1.00 54.31  ? 380 PHE B HA   1 
ATOM   5019 H  HB2  . PHE B 1 19  ? -12.099 -16.720 -3.597  1.00 73.10  ? 380 PHE B HB2  1 
ATOM   5020 H  HB3  . PHE B 1 19  ? -10.803 -17.179 -4.388  1.00 73.10  ? 380 PHE B HB3  1 
ATOM   5021 H  HD1  . PHE B 1 19  ? -8.724  -17.570 -3.153  1.00 59.96  ? 380 PHE B HD1  1 
ATOM   5022 H  HD2  . PHE B 1 19  ? -12.142 -16.789 -1.229  1.00 52.43  ? 380 PHE B HD2  1 
ATOM   5023 H  HE1  . PHE B 1 19  ? -7.786  -18.324 -1.188  1.00 57.68  ? 380 PHE B HE1  1 
ATOM   5024 H  HE2  . PHE B 1 19  ? -11.210 -17.542 0.741   1.00 52.31  ? 380 PHE B HE2  1 
ATOM   5025 H  HZ   . PHE B 1 19  ? -9.024  -18.312 0.763   1.00 54.43  ? 380 PHE B HZ   1 
ATOM   5026 N  N    . PRO B 1 20  ? -10.723 -14.601 -6.386  1.00 43.34  ? 381 PRO B N    1 
ATOM   5027 C  CA   . PRO B 1 20  ? -11.338 -14.190 -7.650  1.00 46.19  ? 381 PRO B CA   1 
ATOM   5028 C  C    . PRO B 1 20  ? -12.320 -15.222 -8.197  1.00 48.58  ? 381 PRO B C    1 
ATOM   5029 O  O    . PRO B 1 20  ? -12.135 -16.427 -8.021  1.00 48.72  ? 381 PRO B O    1 
ATOM   5030 C  CB   . PRO B 1 20  ? -10.138 -14.029 -8.588  1.00 42.70  ? 381 PRO B CB   1 
ATOM   5031 C  CG   . PRO B 1 20  ? -9.088  -14.904 -8.025  1.00 55.31  ? 381 PRO B CG   1 
ATOM   5032 C  CD   . PRO B 1 20  ? -9.284  -14.879 -6.536  1.00 47.53  ? 381 PRO B CD   1 
ATOM   5033 H  HA   . PRO B 1 20  ? -11.787 -13.336 -7.548  1.00 55.43  ? 381 PRO B HA   1 
ATOM   5034 H  HB2  . PRO B 1 20  ? -10.381 -14.316 -9.482  1.00 51.24  ? 381 PRO B HB2  1 
ATOM   5035 H  HB3  . PRO B 1 20  ? -9.848  -13.103 -8.591  1.00 51.24  ? 381 PRO B HB3  1 
ATOM   5036 H  HG2  . PRO B 1 20  ? -9.198  -15.805 -8.368  1.00 66.37  ? 381 PRO B HG2  1 
ATOM   5037 H  HG3  . PRO B 1 20  ? -8.214  -14.555 -8.259  1.00 66.37  ? 381 PRO B HG3  1 
ATOM   5038 H  HD2  . PRO B 1 20  ? -9.064  -15.742 -6.151  1.00 57.04  ? 381 PRO B HD2  1 
ATOM   5039 H  HD3  . PRO B 1 20  ? -8.758  -14.167 -6.138  1.00 57.04  ? 381 PRO B HD3  1 
ATOM   5040 N  N    . VAL B 1 21  ? -13.362 -14.725 -8.851  1.00 55.53  ? 382 VAL B N    1 
ATOM   5041 C  CA   . VAL B 1 21  ? -14.354 -15.559 -9.517  1.00 43.30  ? 382 VAL B CA   1 
ATOM   5042 C  C    . VAL B 1 21  ? -14.400 -15.113 -10.982 1.00 50.78  ? 382 VAL B C    1 
ATOM   5043 O  O    . VAL B 1 21  ? -14.170 -13.941 -11.275 1.00 47.41  ? 382 VAL B O    1 
ATOM   5044 C  CB   . VAL B 1 21  ? -15.731 -15.436 -8.819  1.00 61.31  ? 382 VAL B CB   1 
ATOM   5045 C  CG1  . VAL B 1 21  ? -16.868 -15.962 -9.686  1.00 51.98  ? 382 VAL B CG1  1 
ATOM   5046 C  CG2  . VAL B 1 21  ? -15.695 -16.168 -7.483  1.00 64.40  ? 382 VAL B CG2  1 
ATOM   5047 H  H    . VAL B 1 21  ? -13.521 -13.883 -8.925  1.00 66.64  ? 382 VAL B H    1 
ATOM   5048 H  HA   . VAL B 1 21  ? -14.073 -16.487 -9.485  1.00 51.96  ? 382 VAL B HA   1 
ATOM   5049 H  HB   . VAL B 1 21  ? -15.906 -14.500 -8.638  1.00 73.57  ? 382 VAL B HB   1 
ATOM   5050 H  HG11 . VAL B 1 21  ? -17.704 -15.862 -9.205  1.00 62.37  ? 382 VAL B HG11 1 
ATOM   5051 H  HG12 . VAL B 1 21  ? -16.898 -15.451 -10.511 1.00 62.37  ? 382 VAL B HG12 1 
ATOM   5052 H  HG13 . VAL B 1 21  ? -16.709 -16.898 -9.882  1.00 62.37  ? 382 VAL B HG13 1 
ATOM   5053 H  HG21 . VAL B 1 21  ? -16.561 -16.085 -7.055  1.00 77.28  ? 382 VAL B HG21 1 
ATOM   5054 H  HG22 . VAL B 1 21  ? -15.492 -17.103 -7.641  1.00 77.28  ? 382 VAL B HG22 1 
ATOM   5055 H  HG23 . VAL B 1 21  ? -15.010 -15.769 -6.924  1.00 77.28  ? 382 VAL B HG23 1 
ATOM   5056 N  N    . PRO B 1 22  ? -14.669 -16.040 -11.915 1.00 56.90  ? 383 PRO B N    1 
ATOM   5057 C  CA   . PRO B 1 22  ? -14.623 -15.622 -13.324 1.00 58.29  ? 383 PRO B CA   1 
ATOM   5058 C  C    . PRO B 1 22  ? -15.684 -14.581 -13.719 1.00 43.07  ? 383 PRO B C    1 
ATOM   5059 O  O    . PRO B 1 22  ? -16.788 -14.590 -13.174 1.00 54.17  ? 383 PRO B O    1 
ATOM   5060 C  CB   . PRO B 1 22  ? -14.862 -16.935 -14.085 1.00 43.36  ? 383 PRO B CB   1 
ATOM   5061 C  CG   . PRO B 1 22  ? -14.523 -18.019 -13.123 1.00 58.63  ? 383 PRO B CG   1 
ATOM   5062 C  CD   . PRO B 1 22  ? -14.931 -17.484 -11.785 1.00 50.08  ? 383 PRO B CD   1 
ATOM   5063 H  HA   . PRO B 1 22  ? -13.743 -15.281 -13.544 1.00 69.94  ? 383 PRO B HA   1 
ATOM   5064 H  HB2  . PRO B 1 22  ? -15.793 -16.993 -14.351 1.00 52.03  ? 383 PRO B HB2  1 
ATOM   5065 H  HB3  . PRO B 1 22  ? -14.281 -16.972 -14.861 1.00 52.03  ? 383 PRO B HB3  1 
ATOM   5066 H  HG2  . PRO B 1 22  ? -15.025 -18.820 -13.341 1.00 70.36  ? 383 PRO B HG2  1 
ATOM   5067 H  HG3  . PRO B 1 22  ? -13.569 -18.193 -13.148 1.00 70.36  ? 383 PRO B HG3  1 
ATOM   5068 H  HD2  . PRO B 1 22  ? -15.874 -17.645 -11.629 1.00 60.09  ? 383 PRO B HD2  1 
ATOM   5069 H  HD3  . PRO B 1 22  ? -14.381 -17.867 -11.084 1.00 60.09  ? 383 PRO B HD3  1 
ATOM   5070 N  N    . LYS B 1 23  ? -15.307 -13.674 -14.622 1.00 53.25  ? 384 LYS B N    1 
ATOM   5071 C  CA   . LYS B 1 23  ? -16.235 -12.801 -15.350 1.00 61.79  ? 384 LYS B CA   1 
ATOM   5072 C  C    . LYS B 1 23  ? -17.265 -13.602 -16.127 1.00 54.86  ? 384 LYS B C    1 
ATOM   5073 O  O    . LYS B 1 23  ? -18.447 -13.271 -16.157 1.00 64.34  ? 384 LYS B O    1 
ATOM   5074 C  CB   . LYS B 1 23  ? -15.468 -11.931 -16.348 1.00 71.71  ? 384 LYS B CB   1 
ATOM   5075 C  CG   . LYS B 1 23  ? -15.462 -10.439 -16.094 1.00 83.13  ? 384 LYS B CG   1 
ATOM   5076 C  CD   . LYS B 1 23  ? -14.606 -9.744  -17.150 1.00 96.59  ? 384 LYS B CD   1 
ATOM   5077 C  CE   . LYS B 1 23  ? -14.937 -8.270  -17.288 1.00 103.36 ? 384 LYS B CE   1 
ATOM   5078 N  NZ   . LYS B 1 23  ? -13.836 -7.521  -17.958 1.00 105.00 ? 384 LYS B NZ   1 
ATOM   5079 H  H    . LYS B 1 23  ? -14.485 -13.541 -14.838 1.00 63.90  ? 384 LYS B H    1 
ATOM   5080 H  HA   . LYS B 1 23  ? -16.698 -12.222 -14.725 1.00 74.14  ? 384 LYS B HA   1 
ATOM   5081 H  HB2  . LYS B 1 23  ? -14.543 -12.223 -16.354 1.00 86.05  ? 384 LYS B HB2  1 
ATOM   5082 H  HB3  . LYS B 1 23  ? -15.852 -12.070 -17.227 1.00 86.05  ? 384 LYS B HB3  1 
ATOM   5083 H  HG2  . LYS B 1 23  ? -16.367 -10.094 -16.153 1.00 99.76  ? 384 LYS B HG2  1 
ATOM   5084 H  HG3  . LYS B 1 23  ? -15.083 -10.258 -15.220 1.00 99.76  ? 384 LYS B HG3  1 
ATOM   5085 H  HD2  . LYS B 1 23  ? -13.671 -9.821  -16.902 1.00 115.91 ? 384 LYS B HD2  1 
ATOM   5086 H  HD3  . LYS B 1 23  ? -14.757 -10.168 -18.010 1.00 115.91 ? 384 LYS B HD3  1 
ATOM   5087 H  HE2  . LYS B 1 23  ? -15.741 -8.171  -17.822 1.00 124.04 ? 384 LYS B HE2  1 
ATOM   5088 H  HE3  . LYS B 1 23  ? -15.071 -7.889  -16.406 1.00 124.04 ? 384 LYS B HE3  1 
ATOM   5089 H  HZ1  . LYS B 1 23  ? -14.052 -6.661  -18.027 1.00 126.01 ? 384 LYS B HZ1  1 
ATOM   5090 H  HZ2  . LYS B 1 23  ? -13.086 -7.594  -17.483 1.00 126.01 ? 384 LYS B HZ2  1 
ATOM   5091 H  HZ3  . LYS B 1 23  ? -13.696 -7.851  -18.772 1.00 126.01 ? 384 LYS B HZ3  1 
ATOM   5092 N  N    . GLY B 1 24  ? -16.782 -14.635 -16.803 1.00 67.23  ? 385 GLY B N    1 
ATOM   5093 C  CA   . GLY B 1 24  ? -17.635 -15.510 -17.574 1.00 66.06  ? 385 GLY B CA   1 
ATOM   5094 C  C    . GLY B 1 24  ? -16.854 -16.704 -18.067 1.00 62.17  ? 385 GLY B C    1 
ATOM   5095 O  O    . GLY B 1 24  ? -15.697 -16.904 -17.697 1.00 48.83  ? 385 GLY B O    1 
ATOM   5096 H  H    . GLY B 1 24  ? -15.950 -14.849 -16.829 1.00 80.68  ? 385 GLY B H    1 
ATOM   5097 H  HA2  . GLY B 1 24  ? -18.371 -15.822 -17.024 1.00 79.27  ? 385 GLY B HA2  1 
ATOM   5098 H  HA3  . GLY B 1 24  ? -17.994 -15.033 -18.338 1.00 79.27  ? 385 GLY B HA3  1 
ATOM   5099 N  N    . VAL B 1 25  ? -17.500 -17.507 -18.900 1.00 53.22  ? 386 VAL B N    1 
ATOM   5100 C  CA   . VAL B 1 25  ? -16.834 -18.615 -19.556 1.00 39.98  ? 386 VAL B CA   1 
ATOM   5101 C  C    . VAL B 1 25  ? -16.910 -18.370 -21.052 1.00 45.96  ? 386 VAL B C    1 
ATOM   5102 O  O    . VAL B 1 25  ? -17.981 -18.082 -21.587 1.00 44.95  ? 386 VAL B O    1 
ATOM   5103 C  CB   . VAL B 1 25  ? -17.474 -19.973 -19.194 1.00 47.32  ? 386 VAL B CB   1 
ATOM   5104 C  CG1  . VAL B 1 25  ? -16.876 -21.100 -20.033 1.00 44.32  ? 386 VAL B CG1  1 
ATOM   5105 C  CG2  . VAL B 1 25  ? -17.302 -20.264 -17.708 1.00 58.39  ? 386 VAL B CG2  1 
ATOM   5106 H  H    . VAL B 1 25  ? -18.332 -17.429 -19.102 1.00 63.86  ? 386 VAL B H    1 
ATOM   5107 H  HA   . VAL B 1 25  ? -15.901 -18.634 -19.294 1.00 47.98  ? 386 VAL B HA   1 
ATOM   5108 H  HB   . VAL B 1 25  ? -18.425 -19.933 -19.383 1.00 56.78  ? 386 VAL B HB   1 
ATOM   5109 H  HG11 . VAL B 1 25  ? -17.298 -21.937 -19.783 1.00 53.18  ? 386 VAL B HG11 1 
ATOM   5110 H  HG12 . VAL B 1 25  ? -17.039 -20.915 -20.971 1.00 53.18  ? 386 VAL B HG12 1 
ATOM   5111 H  HG13 . VAL B 1 25  ? -15.922 -21.146 -19.865 1.00 53.18  ? 386 VAL B HG13 1 
ATOM   5112 H  HG21 . VAL B 1 25  ? -17.711 -21.120 -17.505 1.00 70.07  ? 386 VAL B HG21 1 
ATOM   5113 H  HG22 . VAL B 1 25  ? -16.355 -20.291 -17.500 1.00 70.07  ? 386 VAL B HG22 1 
ATOM   5114 H  HG23 . VAL B 1 25  ? -17.734 -19.561 -17.198 1.00 70.07  ? 386 VAL B HG23 1 
ATOM   5115 N  N    . LEU B 1 26  ? -15.761 -18.452 -21.711 1.00 41.35  ? 387 LEU B N    1 
ATOM   5116 C  CA   . LEU B 1 26  ? -15.710 -18.377 -23.162 1.00 43.77  ? 387 LEU B CA   1 
ATOM   5117 C  C    . LEU B 1 26  ? -15.782 -19.773 -23.753 1.00 40.28  ? 387 LEU B C    1 
ATOM   5118 O  O    . LEU B 1 26  ? -14.879 -20.580 -23.560 1.00 36.27  ? 387 LEU B O    1 
ATOM   5119 C  CB   . LEU B 1 26  ? -14.435 -17.679 -23.633 1.00 42.03  ? 387 LEU B CB   1 
ATOM   5120 C  CG   . LEU B 1 26  ? -14.365 -17.435 -25.146 1.00 42.64  ? 387 LEU B CG   1 
ATOM   5121 C  CD1  . LEU B 1 26  ? -15.392 -16.396 -25.549 1.00 50.38  ? 387 LEU B CD1  1 
ATOM   5122 C  CD2  . LEU B 1 26  ? -12.977 -17.000 -25.568 1.00 44.47  ? 387 LEU B CD2  1 
ATOM   5123 H  H    . LEU B 1 26  ? -14.993 -18.552 -21.337 1.00 49.62  ? 387 LEU B H    1 
ATOM   5124 H  HA   . LEU B 1 26  ? -16.471 -17.869 -23.483 1.00 52.53  ? 387 LEU B HA   1 
ATOM   5125 H  HB2  . LEU B 1 26  ? -14.371 -16.818 -23.192 1.00 50.43  ? 387 LEU B HB2  1 
ATOM   5126 H  HB3  . LEU B 1 26  ? -13.673 -18.228 -23.388 1.00 50.43  ? 387 LEU B HB3  1 
ATOM   5127 H  HG   . LEU B 1 26  ? -14.575 -18.260 -25.610 1.00 51.17  ? 387 LEU B HG   1 
ATOM   5128 H  HD11 . LEU B 1 26  ? -15.337 -16.252 -26.506 1.00 60.46  ? 387 LEU B HD11 1 
ATOM   5129 H  HD12 . LEU B 1 26  ? -16.276 -16.718 -25.313 1.00 60.46  ? 387 LEU B HD12 1 
ATOM   5130 H  HD13 . LEU B 1 26  ? -15.205 -15.569 -25.078 1.00 60.46  ? 387 LEU B HD13 1 
ATOM   5131 H  HD21 . LEU B 1 26  ? -12.970 -16.855 -26.527 1.00 53.37  ? 387 LEU B HD21 1 
ATOM   5132 H  HD22 . LEU B 1 26  ? -12.751 -16.178 -25.106 1.00 53.37  ? 387 LEU B HD22 1 
ATOM   5133 H  HD23 . LEU B 1 26  ? -12.344 -17.697 -25.333 1.00 53.37  ? 387 LEU B HD23 1 
ATOM   5134 N  N    . ARG B 1 27  ? -16.865 -20.059 -24.465 1.00 45.03  ? 388 ARG B N    1 
ATOM   5135 C  CA   . ARG B 1 27  ? -16.975 -21.317 -25.189 1.00 46.75  ? 388 ARG B CA   1 
ATOM   5136 C  C    . ARG B 1 27  ? -16.508 -21.114 -26.627 1.00 40.26  ? 388 ARG B C    1 
ATOM   5137 O  O    . ARG B 1 27  ? -17.029 -20.267 -27.347 1.00 45.85  ? 388 ARG B O    1 
ATOM   5138 C  CB   . ARG B 1 27  ? -18.403 -21.843 -25.155 1.00 44.29  ? 388 ARG B CB   1 
ATOM   5139 C  CG   . ARG B 1 27  ? -18.531 -23.260 -25.671 1.00 50.75  ? 388 ARG B CG   1 
ATOM   5140 C  CD   . ARG B 1 27  ? -19.939 -23.767 -25.505 1.00 64.20  ? 388 ARG B CD   1 
ATOM   5141 N  NE   . ARG B 1 27  ? -20.204 -24.186 -24.134 1.00 55.87  ? 388 ARG B NE   1 
ATOM   5142 C  CZ   . ARG B 1 27  ? -21.404 -24.170 -23.560 1.00 59.63  ? 388 ARG B CZ   1 
ATOM   5143 N  NH1  . ARG B 1 27  ? -22.464 -23.737 -24.230 1.00 53.54  ? 388 ARG B NH1  1 
ATOM   5144 N  NH2  . ARG B 1 27  ? -21.542 -24.580 -22.307 1.00 55.60  ? 388 ARG B NH2  1 
ATOM   5145 H  H    . ARG B 1 27  ? -17.548 -19.543 -24.545 1.00 54.04  ? 388 ARG B H    1 
ATOM   5146 H  HA   . ARG B 1 27  ? -16.398 -21.977 -24.773 1.00 56.10  ? 388 ARG B HA   1 
ATOM   5147 H  HB2  . ARG B 1 27  ? -18.721 -21.829 -24.239 1.00 53.15  ? 388 ARG B HB2  1 
ATOM   5148 H  HB3  . ARG B 1 27  ? -18.961 -21.273 -25.707 1.00 53.15  ? 388 ARG B HB3  1 
ATOM   5149 H  HG2  . ARG B 1 27  ? -18.308 -23.280 -26.614 1.00 60.90  ? 388 ARG B HG2  1 
ATOM   5150 H  HG3  . ARG B 1 27  ? -17.936 -23.839 -25.170 1.00 60.90  ? 388 ARG B HG3  1 
ATOM   5151 H  HD2  . ARG B 1 27  ? -20.562 -23.059 -25.732 1.00 77.05  ? 388 ARG B HD2  1 
ATOM   5152 H  HD3  . ARG B 1 27  ? -20.074 -24.531 -26.087 1.00 77.05  ? 388 ARG B HD3  1 
ATOM   5153 H  HE   . ARG B 1 27  ? -19.540 -24.463 -23.664 1.00 67.04  ? 388 ARG B HE   1 
ATOM   5154 H  HH11 . ARG B 1 27  ? -22.380 -23.471 -25.044 1.00 64.25  ? 388 ARG B HH11 1 
ATOM   5155 H  HH12 . ARG B 1 27  ? -23.237 -23.727 -23.852 1.00 64.25  ? 388 ARG B HH12 1 
ATOM   5156 H  HH21 . ARG B 1 27  ? -20.856 -24.858 -21.868 1.00 66.72  ? 388 ARG B HH21 1 
ATOM   5157 H  HH22 . ARG B 1 27  ? -22.315 -24.565 -21.933 1.00 66.72  ? 388 ARG B HH22 1 
ATOM   5158 N  N    . ILE B 1 28  ? -15.511 -21.897 -27.021 1.00 43.78  ? 389 ILE B N    1 
ATOM   5159 C  CA   . ILE B 1 28  ? -14.832 -21.722 -28.299 1.00 55.68  ? 389 ILE B CA   1 
ATOM   5160 C  C    . ILE B 1 28  ? -15.120 -22.888 -29.223 1.00 54.03  ? 389 ILE B C    1 
ATOM   5161 O  O    . ILE B 1 28  ? -14.697 -24.005 -28.958 1.00 40.83  ? 389 ILE B O    1 
ATOM   5162 C  CB   . ILE B 1 28  ? -13.306 -21.615 -28.112 1.00 51.35  ? 389 ILE B CB   1 
ATOM   5163 C  CG1  . ILE B 1 28  ? -12.960 -20.479 -27.150 1.00 52.39  ? 389 ILE B CG1  1 
ATOM   5164 C  CG2  . ILE B 1 28  ? -12.615 -21.393 -29.449 1.00 49.95  ? 389 ILE B CG2  1 
ATOM   5165 C  CD1  . ILE B 1 28  ? -11.609 -20.625 -26.517 1.00 46.35  ? 389 ILE B CD1  1 
ATOM   5166 H  H    . ILE B 1 28  ? -15.203 -22.551 -26.555 1.00 52.54  ? 389 ILE B H    1 
ATOM   5167 H  HA   . ILE B 1 28  ? -15.147 -20.909 -28.723 1.00 66.81  ? 389 ILE B HA   1 
ATOM   5168 H  HB   . ILE B 1 28  ? -12.983 -22.447 -27.733 1.00 61.62  ? 389 ILE B HB   1 
ATOM   5169 H  HG12 . ILE B 1 28  ? -12.971 -19.641 -27.638 1.00 62.87  ? 389 ILE B HG12 1 
ATOM   5170 H  HG13 . ILE B 1 28  ? -13.621 -20.457 -26.440 1.00 62.87  ? 389 ILE B HG13 1 
ATOM   5171 H  HG21 . ILE B 1 28  ? -11.658 -21.330 -29.303 1.00 59.94  ? 389 ILE B HG21 1 
ATOM   5172 H  HG22 . ILE B 1 28  ? -12.811 -22.142 -30.034 1.00 59.94  ? 389 ILE B HG22 1 
ATOM   5173 H  HG23 . ILE B 1 28  ? -12.945 -20.571 -29.843 1.00 59.94  ? 389 ILE B HG23 1 
ATOM   5174 H  HD11 . ILE B 1 28  ? -11.456 -19.874 -25.922 1.00 55.61  ? 389 ILE B HD11 1 
ATOM   5175 H  HD12 . ILE B 1 28  ? -11.584 -21.455 -26.015 1.00 55.61  ? 389 ILE B HD12 1 
ATOM   5176 H  HD13 . ILE B 1 28  ? -10.934 -20.639 -27.213 1.00 55.61  ? 389 ILE B HD13 1 
ATOM   5177 N  N    . HIS B 1 29  ? -15.840 -22.630 -30.304 1.00 47.44  ? 390 HIS B N    1 
ATOM   5178 C  CA   . HIS B 1 29  ? -16.054 -23.645 -31.327 1.00 52.76  ? 390 HIS B CA   1 
ATOM   5179 C  C    . HIS B 1 29  ? -14.984 -23.508 -32.400 1.00 41.43  ? 390 HIS B C    1 
ATOM   5180 O  O    . HIS B 1 29  ? -14.976 -22.549 -33.173 1.00 46.60  ? 390 HIS B O    1 
ATOM   5181 C  CB   . HIS B 1 29  ? -17.444 -23.525 -31.937 1.00 63.61  ? 390 HIS B CB   1 
ATOM   5182 C  CG   . HIS B 1 29  ? -18.555 -23.712 -30.951 1.00 52.30  ? 390 HIS B CG   1 
ATOM   5183 N  ND1  . HIS B 1 29  ? -19.242 -24.901 -30.821 1.00 63.99  ? 390 HIS B ND1  1 
ATOM   5184 C  CD2  . HIS B 1 29  ? -19.103 -22.862 -30.051 1.00 72.99  ? 390 HIS B CD2  1 
ATOM   5185 C  CE1  . HIS B 1 29  ? -20.163 -24.774 -29.883 1.00 59.04  ? 390 HIS B CE1  1 
ATOM   5186 N  NE2  . HIS B 1 29  ? -20.099 -23.547 -29.399 1.00 59.49  ? 390 HIS B NE2  1 
ATOM   5187 H  H    . HIS B 1 29  ? -16.217 -21.875 -30.471 1.00 56.93  ? 390 HIS B H    1 
ATOM   5188 H  HA   . HIS B 1 29  ? -15.972 -24.524 -30.927 1.00 63.31  ? 390 HIS B HA   1 
ATOM   5189 H  HB2  . HIS B 1 29  ? -17.540 -22.641 -32.327 1.00 76.33  ? 390 HIS B HB2  1 
ATOM   5190 H  HB3  . HIS B 1 29  ? -17.543 -24.200 -32.627 1.00 76.33  ? 390 HIS B HB3  1 
ATOM   5191 H  HD1  . HIS B 1 29  ? -19.094 -25.613 -31.280 1.00 76.79  ? 390 HIS B HD1  1 
ATOM   5192 H  HD2  . HIS B 1 29  ? -18.851 -21.979 -29.901 1.00 87.58  ? 390 HIS B HD2  1 
ATOM   5193 H  HE1  . HIS B 1 29  ? -20.755 -25.437 -29.608 1.00 70.84  ? 390 HIS B HE1  1 
ATOM   5194 H  HE2  . HIS B 1 29  ? -20.600 -23.229 -28.777 1.00 71.38  ? 390 HIS B HE2  1 
ATOM   5195 N  N    . PHE B 1 30  ? -14.068 -24.467 -32.399 1.00 39.57  ? 391 PHE B N    1 
ATOM   5196 C  CA   . PHE B 1 30  ? -12.972 -24.536 -33.344 1.00 38.47  ? 391 PHE B CA   1 
ATOM   5197 C  C    . PHE B 1 30  ? -13.451 -25.388 -34.515 1.00 40.18  ? 391 PHE B C    1 
ATOM   5198 O  O    . PHE B 1 30  ? -13.261 -26.602 -34.526 1.00 47.86  ? 391 PHE B O    1 
ATOM   5199 C  CB   . PHE B 1 30  ? -11.737 -25.138 -32.668 1.00 39.82  ? 391 PHE B CB   1 
ATOM   5200 C  CG   . PHE B 1 30  ? -10.470 -24.989 -33.452 1.00 35.92  ? 391 PHE B CG   1 
ATOM   5201 C  CD1  . PHE B 1 30  ? -9.912  -23.740 -33.659 1.00 54.35  ? 391 PHE B CD1  1 
ATOM   5202 C  CD2  . PHE B 1 30  ? -9.811  -26.101 -33.947 1.00 40.87  ? 391 PHE B CD2  1 
ATOM   5203 C  CE1  . PHE B 1 30  ? -8.733  -23.600 -34.369 1.00 49.69  ? 391 PHE B CE1  1 
ATOM   5204 C  CE2  . PHE B 1 30  ? -8.632  -25.966 -34.655 1.00 48.25  ? 391 PHE B CE2  1 
ATOM   5205 C  CZ   . PHE B 1 30  ? -8.094  -24.712 -34.867 1.00 40.13  ? 391 PHE B CZ   1 
ATOM   5206 H  H    . PHE B 1 30  ? -14.064 -25.114 -31.833 1.00 47.49  ? 391 PHE B H    1 
ATOM   5207 H  HA   . PHE B 1 30  ? -12.755 -23.648 -33.667 1.00 46.17  ? 391 PHE B HA   1 
ATOM   5208 H  HB2  . PHE B 1 30  ? -11.607 -24.701 -31.812 1.00 47.78  ? 391 PHE B HB2  1 
ATOM   5209 H  HB3  . PHE B 1 30  ? -11.888 -26.087 -32.531 1.00 47.78  ? 391 PHE B HB3  1 
ATOM   5210 H  HD1  . PHE B 1 30  ? -10.341 -22.985 -33.327 1.00 65.22  ? 391 PHE B HD1  1 
ATOM   5211 H  HD2  . PHE B 1 30  ? -10.170 -26.948 -33.809 1.00 49.05  ? 391 PHE B HD2  1 
ATOM   5212 H  HE1  . PHE B 1 30  ? -8.373  -22.754 -34.510 1.00 59.63  ? 391 PHE B HE1  1 
ATOM   5213 H  HE2  . PHE B 1 30  ? -8.203  -26.720 -34.991 1.00 57.90  ? 391 PHE B HE2  1 
ATOM   5214 H  HZ   . PHE B 1 30  ? -7.302  -24.619 -35.344 1.00 48.15  ? 391 PHE B HZ   1 
ATOM   5215 N  N    . ILE B 1 31  ? -14.112 -24.748 -35.477 1.00 43.94  ? 392 ILE B N    1 
ATOM   5216 C  CA   . ILE B 1 31  ? -14.893 -25.476 -36.475 1.00 49.93  ? 392 ILE B CA   1 
ATOM   5217 C  C    . ILE B 1 31  ? -14.058 -25.945 -37.667 1.00 54.52  ? 392 ILE B C    1 
ATOM   5218 O  O    . ILE B 1 31  ? -13.888 -27.148 -37.877 1.00 51.49  ? 392 ILE B O    1 
ATOM   5219 C  CB   . ILE B 1 31  ? -16.064 -24.616 -37.009 1.00 60.33  ? 392 ILE B CB   1 
ATOM   5220 C  CG1  . ILE B 1 31  ? -16.837 -23.971 -35.854 1.00 64.29  ? 392 ILE B CG1  1 
ATOM   5221 C  CG2  . ILE B 1 31  ? -17.004 -25.467 -37.874 1.00 55.53  ? 392 ILE B CG2  1 
ATOM   5222 C  CD1  . ILE B 1 31  ? -17.797 -22.887 -36.297 1.00 69.97  ? 392 ILE B CD1  1 
ATOM   5223 H  H    . ILE B 1 31  ? -14.126 -23.894 -35.573 1.00 52.73  ? 392 ILE B H    1 
ATOM   5224 H  HA   . ILE B 1 31  ? -15.273 -26.263 -36.055 1.00 59.91  ? 392 ILE B HA   1 
ATOM   5225 H  HB   . ILE B 1 31  ? -15.696 -23.909 -37.562 1.00 72.40  ? 392 ILE B HB   1 
ATOM   5226 H  HG12 . ILE B 1 31  ? -17.352 -24.657 -35.400 1.00 77.15  ? 392 ILE B HG12 1 
ATOM   5227 H  HG13 . ILE B 1 31  ? -16.203 -23.573 -35.237 1.00 77.15  ? 392 ILE B HG13 1 
ATOM   5228 H  HG21 . ILE B 1 31  ? -17.728 -24.908 -38.197 1.00 66.64  ? 392 ILE B HG21 1 
ATOM   5229 H  HG22 . ILE B 1 31  ? -16.504 -25.826 -38.624 1.00 66.64  ? 392 ILE B HG22 1 
ATOM   5230 H  HG23 . ILE B 1 31  ? -17.359 -26.191 -37.336 1.00 66.64  ? 392 ILE B HG23 1 
ATOM   5231 H  HD11 . ILE B 1 31  ? -18.248 -22.527 -35.517 1.00 83.97  ? 392 ILE B HD11 1 
ATOM   5232 H  HD12 . ILE B 1 31  ? -17.296 -22.186 -36.743 1.00 83.97  ? 392 ILE B HD12 1 
ATOM   5233 H  HD13 . ILE B 1 31  ? -18.446 -23.271 -36.907 1.00 83.97  ? 392 ILE B HD13 1 
ATOM   5234 N  N    . GLU B 1 32  ? -13.550 -25.003 -38.455 1.00 52.19  ? 393 GLU B N    1 
ATOM   5235 C  CA   . GLU B 1 32  ? -12.884 -25.350 -39.705 1.00 59.69  ? 393 GLU B CA   1 
ATOM   5236 C  C    . GLU B 1 32  ? -11.988 -24.230 -40.210 1.00 54.37  ? 393 GLU B C    1 
ATOM   5237 O  O    . GLU B 1 32  ? -12.099 -23.080 -39.779 1.00 55.55  ? 393 GLU B O    1 
ATOM   5238 C  CB   . GLU B 1 32  ? -13.924 -25.684 -40.778 1.00 62.29  ? 393 GLU B CB   1 
ATOM   5239 C  CG   . GLU B 1 32  ? -14.825 -24.500 -41.104 1.00 66.96  ? 393 GLU B CG   1 
ATOM   5240 C  CD   . GLU B 1 32  ? -15.997 -24.857 -41.998 1.00 62.90  ? 393 GLU B CD   1 
ATOM   5241 O  OE1  . GLU B 1 32  ? -17.114 -24.369 -41.718 1.00 63.70  ? 393 GLU B OE1  1 
ATOM   5242 O  OE2  . GLU B 1 32  ? -15.803 -25.608 -42.977 1.00 63.07  ? 393 GLU B OE2  1 
ATOM   5243 H  H    . GLU B 1 32  ? -13.578 -24.159 -38.289 1.00 62.63  ? 393 GLU B H    1 
ATOM   5244 H  HA   . GLU B 1 32  ? -12.334 -26.136 -39.564 1.00 71.63  ? 393 GLU B HA   1 
ATOM   5245 H  HB2  . GLU B 1 32  ? -13.466 -25.948 -41.591 1.00 74.75  ? 393 GLU B HB2  1 
ATOM   5246 H  HB3  . GLU B 1 32  ? -14.484 -26.410 -40.461 1.00 74.75  ? 393 GLU B HB3  1 
ATOM   5247 H  HG2  . GLU B 1 32  ? -15.181 -24.139 -40.277 1.00 80.35  ? 393 GLU B HG2  1 
ATOM   5248 H  HG3  . GLU B 1 32  ? -14.300 -23.823 -41.559 1.00 80.35  ? 393 GLU B HG3  1 
ATOM   5249 N  N    . ALA B 1 33  ? -11.105 -24.590 -41.134 1.00 54.70  ? 394 ALA B N    1 
ATOM   5250 C  CA   . ALA B 1 33  ? -10.247 -23.633 -41.811 1.00 50.41  ? 394 ALA B CA   1 
ATOM   5251 C  C    . ALA B 1 33  ? -10.422 -23.793 -43.314 1.00 63.06  ? 394 ALA B C    1 
ATOM   5252 O  O    . ALA B 1 33  ? -10.992 -24.779 -43.786 1.00 61.15  ? 394 ALA B O    1 
ATOM   5253 C  CB   . ALA B 1 33  ? -8.800  -23.832 -41.414 1.00 48.22  ? 394 ALA B CB   1 
ATOM   5254 H  H    . ALA B 1 33  ? -10.983 -25.402 -41.391 1.00 65.63  ? 394 ALA B H    1 
ATOM   5255 H  HA   . ALA B 1 33  ? -10.512 -22.733 -41.565 1.00 60.49  ? 394 ALA B HA   1 
ATOM   5256 H  HB1  . ALA B 1 33  ? -8.253  -23.181 -41.881 1.00 57.86  ? 394 ALA B HB1  1 
ATOM   5257 H  HB2  . ALA B 1 33  ? -8.716  -23.710 -40.456 1.00 57.86  ? 394 ALA B HB2  1 
ATOM   5258 H  HB3  . ALA B 1 33  ? -8.527  -24.730 -41.659 1.00 57.86  ? 394 ALA B HB3  1 
ATOM   5259 N  N    . GLN B 1 34  ? -9.923  -22.820 -44.061 1.00 55.99  ? 395 GLN B N    1 
ATOM   5260 C  CA   . GLN B 1 34  ? -10.110 -22.798 -45.500 1.00 74.98  ? 395 GLN B CA   1 
ATOM   5261 C  C    . GLN B 1 34  ? -8.893  -22.178 -46.169 1.00 61.05  ? 395 GLN B C    1 
ATOM   5262 O  O    . GLN B 1 34  ? -8.353  -21.183 -45.690 1.00 67.73  ? 395 GLN B O    1 
ATOM   5263 C  CB   . GLN B 1 34  ? -11.387 -22.022 -45.829 1.00 75.22  ? 395 GLN B CB   1 
ATOM   5264 C  CG   . GLN B 1 34  ? -11.841 -22.075 -47.254 1.00 82.66  ? 395 GLN B CG   1 
ATOM   5265 C  CD   . GLN B 1 34  ? -13.204 -21.434 -47.422 1.00 95.89  ? 395 GLN B CD   1 
ATOM   5266 O  OE1  . GLN B 1 34  ? -14.223 -22.122 -47.475 1.00 104.71 ? 395 GLN B OE1  1 
ATOM   5267 N  NE2  . GLN B 1 34  ? -13.231 -20.109 -47.488 1.00 94.14  ? 395 GLN B NE2  1 
ATOM   5268 H  H    . GLN B 1 34  ? -9.469  -22.157 -43.755 1.00 67.18  ? 395 GLN B H    1 
ATOM   5269 H  HA   . GLN B 1 34  ? -10.210 -23.706 -45.826 1.00 89.98  ? 395 GLN B HA   1 
ATOM   5270 H  HB2  . GLN B 1 34  ? -12.107 -22.374 -45.283 1.00 90.26  ? 395 GLN B HB2  1 
ATOM   5271 H  HB3  . GLN B 1 34  ? -11.242 -21.089 -45.607 1.00 90.26  ? 395 GLN B HB3  1 
ATOM   5272 H  HG2  . GLN B 1 34  ? -11.208 -21.595 -47.811 1.00 99.20  ? 395 GLN B HG2  1 
ATOM   5273 H  HG3  . GLN B 1 34  ? -11.903 -23.001 -47.537 1.00 99.20  ? 395 GLN B HG3  1 
ATOM   5274 H  HE21 . GLN B 1 34  ? -12.498 -19.661 -47.436 1.00 112.97 ? 395 GLN B HE21 1 
ATOM   5275 H  HE22 . GLN B 1 34  ? -13.980 -19.698 -47.583 1.00 112.97 ? 395 GLN B HE22 1 
ATOM   5276 N  N    . ASP B 1 35  ? -8.442  -22.800 -47.252 1.00 79.00  ? 396 ASP B N    1 
ATOM   5277 C  CA   . ASP B 1 35  ? -7.405  -22.232 -48.107 1.00 74.52  ? 396 ASP B CA   1 
ATOM   5278 C  C    . ASP B 1 35  ? -6.047  -22.097 -47.407 1.00 71.91  ? 396 ASP B C    1 
ATOM   5279 O  O    . ASP B 1 35  ? -5.323  -21.135 -47.635 1.00 64.17  ? 396 ASP B O    1 
ATOM   5280 C  CB   . ASP B 1 35  ? -7.860  -20.861 -48.625 1.00 85.29  ? 396 ASP B CB   1 
ATOM   5281 C  CG   . ASP B 1 35  ? -7.043  -20.379 -49.812 1.00 100.99 ? 396 ASP B CG   1 
ATOM   5282 O  OD1  . ASP B 1 35  ? -6.356  -21.211 -50.443 1.00 117.66 ? 396 ASP B OD1  1 
ATOM   5283 O  OD2  . ASP B 1 35  ? -7.090  -19.168 -50.116 1.00 96.16  ? 396 ASP B OD2  1 
ATOM   5284 H  H    . ASP B 1 35  ? -8.726  -23.567 -47.518 1.00 94.81  ? 396 ASP B H    1 
ATOM   5285 H  HA   . ASP B 1 35  ? -7.283  -22.812 -48.875 1.00 89.43  ? 396 ASP B HA   1 
ATOM   5286 H  HB2  . ASP B 1 35  ? -8.787  -20.921 -48.904 1.00 102.35 ? 396 ASP B HB2  1 
ATOM   5287 H  HB3  . ASP B 1 35  ? -7.769  -20.208 -47.913 1.00 102.35 ? 396 ASP B HB3  1 
ATOM   5288 N  N    . LEU B 1 36  ? -5.690  -23.064 -46.567 1.00 62.78  ? 397 LEU B N    1 
ATOM   5289 C  CA   . LEU B 1 36  ? -4.412  -23.008 -45.857 1.00 66.75  ? 397 LEU B CA   1 
ATOM   5290 C  C    . LEU B 1 36  ? -3.234  -23.247 -46.795 1.00 59.28  ? 397 LEU B C    1 
ATOM   5291 O  O    . LEU B 1 36  ? -3.380  -23.884 -47.833 1.00 68.23  ? 397 LEU B O    1 
ATOM   5292 C  CB   . LEU B 1 36  ? -4.371  -24.040 -44.730 1.00 57.62  ? 397 LEU B CB   1 
ATOM   5293 C  CG   . LEU B 1 36  ? -5.377  -23.883 -43.589 1.00 54.55  ? 397 LEU B CG   1 
ATOM   5294 C  CD1  . LEU B 1 36  ? -5.232  -25.041 -42.618 1.00 54.57  ? 397 LEU B CD1  1 
ATOM   5295 C  CD2  . LEU B 1 36  ? -5.198  -22.553 -42.868 1.00 51.86  ? 397 LEU B CD2  1 
ATOM   5296 H  H    . LEU B 1 36  ? -6.165  -23.759 -46.390 1.00 75.34  ? 397 LEU B H    1 
ATOM   5297 H  HA   . LEU B 1 36  ? -4.308  -22.128 -45.463 1.00 80.09  ? 397 LEU B HA   1 
ATOM   5298 H  HB2  . LEU B 1 36  ? -4.519  -24.915 -45.121 1.00 69.14  ? 397 LEU B HB2  1 
ATOM   5299 H  HB3  . LEU B 1 36  ? -3.486  -24.015 -44.334 1.00 69.14  ? 397 LEU B HB3  1 
ATOM   5300 H  HG   . LEU B 1 36  ? -6.275  -23.908 -43.954 1.00 65.47  ? 397 LEU B HG   1 
ATOM   5301 H  HD11 . LEU B 1 36  ? -5.874  -24.931 -41.899 1.00 65.48  ? 397 LEU B HD11 1 
ATOM   5302 H  HD12 . LEU B 1 36  ? -5.401  -25.871 -43.090 1.00 65.48  ? 397 LEU B HD12 1 
ATOM   5303 H  HD13 . LEU B 1 36  ? -4.331  -25.041 -42.260 1.00 65.48  ? 397 LEU B HD13 1 
ATOM   5304 H  HD21 . LEU B 1 36  ? -5.851  -22.491 -42.154 1.00 62.23  ? 397 LEU B HD21 1 
ATOM   5305 H  HD22 . LEU B 1 36  ? -4.301  -22.512 -42.501 1.00 62.23  ? 397 LEU B HD22 1 
ATOM   5306 H  HD23 . LEU B 1 36  ? -5.330  -21.831 -43.501 1.00 62.23  ? 397 LEU B HD23 1 
ATOM   5307 N  N    . GLN B 1 37  ? -2.064  -22.742 -46.415 1.00 77.66  ? 398 GLN B N    1 
ATOM   5308 C  CA   . GLN B 1 37  ? -0.823  -23.059 -47.115 1.00 73.89  ? 398 GLN B CA   1 
ATOM   5309 C  C    . GLN B 1 37  ? -0.547  -24.561 -47.131 1.00 82.15  ? 398 GLN B C    1 
ATOM   5310 O  O    . GLN B 1 37  ? -0.932  -25.281 -46.211 1.00 79.12  ? 398 GLN B O    1 
ATOM   5311 C  CB   . GLN B 1 37  ? 0.362   -22.354 -46.459 1.00 73.68  ? 398 GLN B CB   1 
ATOM   5312 C  CG   . GLN B 1 37  ? 0.441   -20.863 -46.692 1.00 82.45  ? 398 GLN B CG   1 
ATOM   5313 C  CD   . GLN B 1 37  ? 1.700   -20.272 -46.092 1.00 88.91  ? 398 GLN B CD   1 
ATOM   5314 O  OE1  . GLN B 1 37  ? 2.464   -19.586 -46.770 1.00 83.90  ? 398 GLN B OE1  1 
ATOM   5315 N  NE2  . GLN B 1 37  ? 1.929   -20.548 -44.813 1.00 87.23  ? 398 GLN B NE2  1 
ATOM   5316 H  H    . GLN B 1 37  ? -1.962  -22.208 -45.748 1.00 93.19  ? 398 GLN B H    1 
ATOM   5317 H  HA   . GLN B 1 37  ? -0.888  -22.753 -48.033 1.00 88.66  ? 398 GLN B HA   1 
ATOM   5318 H  HB2  . GLN B 1 37  ? 0.312   -22.497 -45.501 1.00 88.42  ? 398 GLN B HB2  1 
ATOM   5319 H  HB3  . GLN B 1 37  ? 1.180   -22.746 -46.803 1.00 88.42  ? 398 GLN B HB3  1 
ATOM   5320 H  HG2  . GLN B 1 37  ? 0.447   -20.688 -47.646 1.00 98.94  ? 398 GLN B HG2  1 
ATOM   5321 H  HG3  . GLN B 1 37  ? -0.324  -20.434 -46.277 1.00 98.94  ? 398 GLN B HG3  1 
ATOM   5322 H  HE21 . GLN B 1 37  ? 1.377   -21.039 -44.373 1.00 104.68 ? 398 GLN B HE21 1 
ATOM   5323 H  HE22 . GLN B 1 37  ? 2.631   -20.237 -44.425 1.00 104.68 ? 398 GLN B HE22 1 
ATOM   5324 N  N    . GLY B 1 38  ? 0.139   -25.017 -48.176 1.00 88.48  ? 399 GLY B N    1 
ATOM   5325 C  CA   . GLY B 1 38  ? 0.579   -26.398 -48.272 1.00 88.20  ? 399 GLY B CA   1 
ATOM   5326 C  C    . GLY B 1 38  ? 2.005   -26.549 -47.773 1.00 95.38  ? 399 GLY B C    1 
ATOM   5327 O  O    . GLY B 1 38  ? 2.644   -25.560 -47.417 1.00 95.98  ? 399 GLY B O    1 
ATOM   5328 H  H    . GLY B 1 38  ? 0.363   -24.535 -48.851 1.00 106.18 ? 399 GLY B H    1 
ATOM   5329 H  HA2  . GLY B 1 38  ? -0.000  -26.965 -47.739 1.00 105.84 ? 399 GLY B HA2  1 
ATOM   5330 H  HA3  . GLY B 1 38  ? 0.539   -26.691 -49.196 1.00 105.84 ? 399 GLY B HA3  1 
ATOM   5331 N  N    . LYS B 1 39  ? 2.505   -27.783 -47.765 1.00 102.85 ? 400 LYS B N    1 
ATOM   5332 C  CA   . LYS B 1 39  ? 3.801   -28.098 -47.162 1.00 98.95  ? 400 LYS B CA   1 
ATOM   5333 C  C    . LYS B 1 39  ? 4.964   -27.265 -47.701 1.00 108.49 ? 400 LYS B C    1 
ATOM   5334 O  O    . LYS B 1 39  ? 5.940   -27.036 -46.987 1.00 112.88 ? 400 LYS B O    1 
ATOM   5335 C  CB   . LYS B 1 39  ? 4.122   -29.583 -47.352 1.00 107.34 ? 400 LYS B CB   1 
ATOM   5336 C  CG   . LYS B 1 39  ? 3.398   -30.503 -46.381 1.00 114.01 ? 400 LYS B CG   1 
ATOM   5337 C  CD   . LYS B 1 39  ? 3.991   -31.905 -46.399 1.00 123.07 ? 400 LYS B CD   1 
ATOM   5338 C  CE   . LYS B 1 39  ? 2.996   -32.936 -45.892 1.00 127.34 ? 400 LYS B CE   1 
ATOM   5339 N  NZ   . LYS B 1 39  ? 3.659   -34.143 -45.324 1.00 123.87 ? 400 LYS B NZ   1 
ATOM   5340 H  H    . LYS B 1 39  ? 2.107   -28.465 -48.106 1.00 123.42 ? 400 LYS B H    1 
ATOM   5341 H  HA   . LYS B 1 39  ? 3.743   -27.933 -46.208 1.00 118.74 ? 400 LYS B HA   1 
ATOM   5342 H  HB2  . LYS B 1 39  ? 3.869   -29.844 -48.251 1.00 128.80 ? 400 LYS B HB2  1 
ATOM   5343 H  HB3  . LYS B 1 39  ? 5.075   -29.714 -47.228 1.00 128.80 ? 400 LYS B HB3  1 
ATOM   5344 H  HG2  . LYS B 1 39  ? 3.480   -30.149 -45.482 1.00 136.81 ? 400 LYS B HG2  1 
ATOM   5345 H  HG3  . LYS B 1 39  ? 2.463   -30.565 -46.634 1.00 136.81 ? 400 LYS B HG3  1 
ATOM   5346 H  HD2  . LYS B 1 39  ? 4.234   -32.138 -47.308 1.00 147.68 ? 400 LYS B HD2  1 
ATOM   5347 H  HD3  . LYS B 1 39  ? 4.773   -31.929 -45.825 1.00 147.68 ? 400 LYS B HD3  1 
ATOM   5348 H  HE2  . LYS B 1 39  ? 2.453   -32.536 -45.195 1.00 152.81 ? 400 LYS B HE2  1 
ATOM   5349 H  HE3  . LYS B 1 39  ? 2.433   -33.222 -46.629 1.00 152.81 ? 400 LYS B HE3  1 
ATOM   5350 H  HZ1  . LYS B 1 39  ? 3.045   -34.721 -45.039 1.00 148.64 ? 400 LYS B HZ1  1 
ATOM   5351 H  HZ2  . LYS B 1 39  ? 4.160   -34.536 -45.946 1.00 148.64 ? 400 LYS B HZ2  1 
ATOM   5352 H  HZ3  . LYS B 1 39  ? 4.177   -33.911 -44.639 1.00 148.64 ? 400 LYS B HZ3  1 
ATOM   5353 N  N    . ASP B 1 40  ? 4.873   -26.814 -48.948 1.00 117.66 ? 401 ASP B N    1 
ATOM   5354 C  CA   . ASP B 1 40  ? 5.941   -25.998 -49.520 1.00 134.39 ? 401 ASP B CA   1 
ATOM   5355 C  C    . ASP B 1 40  ? 5.473   -25.169 -50.714 1.00 142.09 ? 401 ASP B C    1 
ATOM   5356 O  O    . ASP B 1 40  ? 4.558   -25.559 -51.441 1.00 138.97 ? 401 ASP B O    1 
ATOM   5357 C  CB   . ASP B 1 40  ? 7.117   -26.887 -49.935 1.00 140.04 ? 401 ASP B CB   1 
ATOM   5358 C  CG   . ASP B 1 40  ? 8.327   -26.085 -50.383 1.00 137.85 ? 401 ASP B CG   1 
ATOM   5359 O  OD1  . ASP B 1 40  ? 8.540   -24.974 -49.855 1.00 141.43 ? 401 ASP B OD1  1 
ATOM   5360 O  OD2  . ASP B 1 40  ? 9.068   -26.569 -51.264 1.00 137.73 ? 401 ASP B OD2  1 
ATOM   5361 H  H    . ASP B 1 40  ? 4.213   -26.965 -49.479 1.00 141.19 ? 401 ASP B H    1 
ATOM   5362 H  HA   . ASP B 1 40  ? 6.260   -25.383 -48.841 1.00 161.26 ? 401 ASP B HA   1 
ATOM   5363 H  HB2  . ASP B 1 40  ? 7.383   -27.434 -49.180 1.00 168.05 ? 401 ASP B HB2  1 
ATOM   5364 H  HB3  . ASP B 1 40  ? 6.842   -27.452 -50.674 1.00 168.05 ? 401 ASP B HB3  1 
ATOM   5365 N  N    . THR B 1 41  ? 6.118   -24.020 -50.902 1.00 144.49 ? 402 THR B N    1 
ATOM   5366 C  CA   . THR B 1 41  ? 5.816   -23.122 -52.010 1.00 144.50 ? 402 THR B CA   1 
ATOM   5367 C  C    . THR B 1 41  ? 6.489   -23.598 -53.295 1.00 130.87 ? 402 THR B C    1 
ATOM   5368 O  O    . THR B 1 41  ? 6.448   -22.917 -54.321 1.00 131.14 ? 402 THR B O    1 
ATOM   5369 C  CB   . THR B 1 41  ? 6.272   -21.680 -51.702 1.00 141.06 ? 402 THR B CB   1 
ATOM   5370 O  OG1  . THR B 1 41  ? 7.697   -21.645 -51.552 1.00 128.06 ? 402 THR B OG1  1 
ATOM   5371 C  CG2  . THR B 1 41  ? 5.613   -21.170 -50.423 1.00 129.05 ? 402 THR B CG2  1 
ATOM   5372 H  H    . THR B 1 41  ? 6.747   -23.735 -50.389 1.00 173.39 ? 402 THR B H    1 
ATOM   5373 H  HA   . THR B 1 41  ? 4.857   -23.111 -52.157 1.00 173.39 ? 402 THR B HA   1 
ATOM   5374 H  HB   . THR B 1 41  ? 6.011   -21.098 -52.433 1.00 169.27 ? 402 THR B HB   1 
ATOM   5375 H  HG1  . THR B 1 41  ? 7.949   -20.862 -51.384 1.00 153.67 ? 402 THR B HG1  1 
ATOM   5376 H  HG21 . THR B 1 41  ? 5.906   -20.264 -50.239 1.00 154.86 ? 402 THR B HG21 1 
ATOM   5377 H  HG22 . THR B 1 41  ? 4.648   -21.175 -50.523 1.00 154.86 ? 402 THR B HG22 1 
ATOM   5378 H  HG23 . THR B 1 41  ? 5.856   -21.738 -49.676 1.00 154.86 ? 402 THR B HG23 1 
ATOM   5379 N  N    . GLY B 1 49  ? 2.704   -30.754 -51.859 1.00 87.05  ? 410 GLY B N    1 
ATOM   5380 C  CA   . GLY B 1 49  ? 2.189   -31.584 -50.786 1.00 102.22 ? 410 GLY B CA   1 
ATOM   5381 C  C    . GLY B 1 49  ? 1.151   -30.849 -49.960 1.00 93.52  ? 410 GLY B C    1 
ATOM   5382 O  O    . GLY B 1 49  ? 1.120   -29.619 -49.945 1.00 103.44 ? 410 GLY B O    1 
ATOM   5383 H  HA2  . GLY B 1 49  ? 1.781   -32.382 -51.158 1.00 122.67 ? 410 GLY B HA2  1 
ATOM   5384 H  HA3  . GLY B 1 49  ? 2.916   -31.852 -50.203 1.00 122.67 ? 410 GLY B HA3  1 
ATOM   5385 N  N    . LYS B 1 50  ? 0.300   -31.606 -49.273 1.00 77.64  ? 411 LYS B N    1 
ATOM   5386 C  CA   . LYS B 1 50  ? -0.766  -31.027 -48.460 1.00 79.08  ? 411 LYS B CA   1 
ATOM   5387 C  C    . LYS B 1 50  ? -0.408  -31.042 -46.978 1.00 68.20  ? 411 LYS B C    1 
ATOM   5388 O  O    . LYS B 1 50  ? 0.259   -31.954 -46.495 1.00 84.07  ? 411 LYS B O    1 
ATOM   5389 C  CB   . LYS B 1 50  ? -2.078  -31.780 -48.682 1.00 64.65  ? 411 LYS B CB   1 
ATOM   5390 C  CG   . LYS B 1 50  ? -2.867  -31.309 -49.887 1.00 87.82  ? 411 LYS B CG   1 
ATOM   5391 C  CD   . LYS B 1 50  ? -4.208  -32.016 -49.976 1.00 99.66  ? 411 LYS B CD   1 
ATOM   5392 C  CE   . LYS B 1 50  ? -4.904  -31.722 -51.293 1.00 110.51 ? 411 LYS B CE   1 
ATOM   5393 N  NZ   . LYS B 1 50  ? -6.190  -32.460 -51.417 1.00 121.49 ? 411 LYS B NZ   1 
ATOM   5394 H  H    . LYS B 1 50  ? 0.319   -32.466 -49.261 1.00 93.17  ? 411 LYS B H    1 
ATOM   5395 H  HA   . LYS B 1 50  ? -0.901  -30.105 -48.727 1.00 94.89  ? 411 LYS B HA   1 
ATOM   5396 H  HB2  . LYS B 1 50  ? -1.879  -32.721 -48.808 1.00 77.58  ? 411 LYS B HB2  1 
ATOM   5397 H  HB3  . LYS B 1 50  ? -2.638  -31.666 -47.899 1.00 77.58  ? 411 LYS B HB3  1 
ATOM   5398 H  HG2  . LYS B 1 50  ? -3.030  -30.355 -49.811 1.00 105.38 ? 411 LYS B HG2  1 
ATOM   5399 H  HG3  . LYS B 1 50  ? -2.366  -31.502 -50.694 1.00 105.38 ? 411 LYS B HG3  1 
ATOM   5400 H  HD2  . LYS B 1 50  ? -4.069  -32.974 -49.912 1.00 119.59 ? 411 LYS B HD2  1 
ATOM   5401 H  HD3  . LYS B 1 50  ? -4.779  -31.711 -49.254 1.00 119.59 ? 411 LYS B HD3  1 
ATOM   5402 H  HE2  . LYS B 1 50  ? -5.094  -30.772 -51.348 1.00 132.61 ? 411 LYS B HE2  1 
ATOM   5403 H  HE3  . LYS B 1 50  ? -4.329  -31.992 -52.025 1.00 132.61 ? 411 LYS B HE3  1 
ATOM   5404 H  HZ1  . LYS B 1 50  ? -6.576  -32.270 -52.196 1.00 145.78 ? 411 LYS B HZ1  1 
ATOM   5405 H  HZ2  . LYS B 1 50  ? -6.043  -33.337 -51.374 1.00 145.78 ? 411 LYS B HZ2  1 
ATOM   5406 H  HZ3  . LYS B 1 50  ? -6.740  -32.226 -50.757 1.00 145.78 ? 411 LYS B HZ3  1 
ATOM   5407 N  N    . SER B 1 51  ? -0.869  -30.025 -46.262 1.00 63.28  ? 412 SER B N    1 
ATOM   5408 C  CA   . SER B 1 51  ? -0.582  -29.895 -44.840 1.00 55.40  ? 412 SER B CA   1 
ATOM   5409 C  C    . SER B 1 51  ? -1.424  -30.844 -43.995 1.00 66.02  ? 412 SER B C    1 
ATOM   5410 O  O    . SER B 1 51  ? -2.415  -31.402 -44.465 1.00 61.38  ? 412 SER B O    1 
ATOM   5411 C  CB   . SER B 1 51  ? -0.820  -28.452 -44.386 1.00 67.64  ? 412 SER B CB   1 
ATOM   5412 O  OG   . SER B 1 51  ? 0.134   -27.573 -44.954 1.00 73.02  ? 412 SER B OG   1 
ATOM   5413 H  H    . SER B 1 51  ? -1.356  -29.391 -46.579 1.00 75.94  ? 412 SER B H    1 
ATOM   5414 H  HA   . SER B 1 51  ? 0.353   -30.107 -44.687 1.00 66.48  ? 412 SER B HA   1 
ATOM   5415 H  HB2  . SER B 1 51  ? -1.707  -28.177 -44.665 1.00 81.16  ? 412 SER B HB2  1 
ATOM   5416 H  HB3  . SER B 1 51  ? -0.750  -28.411 -43.419 1.00 81.16  ? 412 SER B HB3  1 
ATOM   5417 H  HG   . SER B 1 51  ? -0.010  -26.787 -44.696 1.00 87.63  ? 412 SER B HG   1 
ATOM   5418 N  N    . ASP B 1 52  ? -1.011  -31.010 -42.741 1.00 63.43  ? 413 ASP B N    1 
ATOM   5419 C  CA   . ASP B 1 52  ? -1.737  -31.803 -41.756 1.00 50.62  ? 413 ASP B CA   1 
ATOM   5420 C  C    . ASP B 1 52  ? -2.094  -30.884 -40.585 1.00 65.35  ? 413 ASP B C    1 
ATOM   5421 O  O    . ASP B 1 52  ? -1.435  -30.913 -39.547 1.00 47.96  ? 413 ASP B O    1 
ATOM   5422 C  CB   . ASP B 1 52  ? -0.887  -32.990 -41.294 1.00 49.00  ? 413 ASP B CB   1 
ATOM   5423 C  CG   . ASP B 1 52  ? -0.366  -33.820 -42.459 1.00 66.84  ? 413 ASP B CG   1 
ATOM   5424 O  OD1  . ASP B 1 52  ? -1.188  -34.223 -43.308 1.00 56.68  ? 413 ASP B OD1  1 
ATOM   5425 O  OD2  . ASP B 1 52  ? 0.860   -34.062 -42.536 1.00 63.77  ? 413 ASP B OD2  1 
ATOM   5426 H  H    . ASP B 1 52  ? -0.290  -30.660 -42.428 1.00 76.12  ? 413 ASP B H    1 
ATOM   5427 H  HA   . ASP B 1 52  ? -2.557  -32.142 -42.148 1.00 60.74  ? 413 ASP B HA   1 
ATOM   5428 H  HB2  . ASP B 1 52  ? -0.123  -32.659 -40.796 1.00 58.80  ? 413 ASP B HB2  1 
ATOM   5429 H  HB3  . ASP B 1 52  ? -1.427  -33.567 -40.731 1.00 58.80  ? 413 ASP B HB3  1 
ATOM   5430 N  N    . PRO B 1 53  ? -3.132  -30.049 -40.759 1.00 49.30  ? 414 PRO B N    1 
ATOM   5431 C  CA   . PRO B 1 53  ? -3.268  -28.908 -39.855 1.00 50.72  ? 414 PRO B CA   1 
ATOM   5432 C  C    . PRO B 1 53  ? -3.868  -29.225 -38.488 1.00 51.52  ? 414 PRO B C    1 
ATOM   5433 O  O    . PRO B 1 53  ? -4.728  -30.093 -38.357 1.00 45.00  ? 414 PRO B O    1 
ATOM   5434 C  CB   . PRO B 1 53  ? -4.199  -27.962 -40.632 1.00 49.97  ? 414 PRO B CB   1 
ATOM   5435 C  CG   . PRO B 1 53  ? -4.213  -28.482 -42.050 1.00 47.29  ? 414 PRO B CG   1 
ATOM   5436 C  CD   . PRO B 1 53  ? -4.071  -29.946 -41.887 1.00 53.49  ? 414 PRO B CD   1 
ATOM   5437 H  HA   . PRO B 1 53  ? -2.408  -28.477 -39.732 1.00 60.87  ? 414 PRO B HA   1 
ATOM   5438 H  HB2  . PRO B 1 53  ? -5.089  -27.992 -40.248 1.00 59.96  ? 414 PRO B HB2  1 
ATOM   5439 H  HB3  . PRO B 1 53  ? -3.844  -27.060 -40.603 1.00 59.96  ? 414 PRO B HB3  1 
ATOM   5440 H  HG2  . PRO B 1 53  ? -5.056  -28.259 -42.476 1.00 56.75  ? 414 PRO B HG2  1 
ATOM   5441 H  HG3  . PRO B 1 53  ? -3.465  -28.113 -42.546 1.00 56.75  ? 414 PRO B HG3  1 
ATOM   5442 H  HD2  . PRO B 1 53  ? -4.924  -30.348 -41.660 1.00 64.19  ? 414 PRO B HD2  1 
ATOM   5443 H  HD3  . PRO B 1 53  ? -3.689  -30.342 -42.686 1.00 64.19  ? 414 PRO B HD3  1 
ATOM   5444 N  N    . TYR B 1 54  ? -3.398  -28.504 -37.479 1.00 49.13  ? 415 TYR B N    1 
ATOM   5445 C  CA   . TYR B 1 54  ? -4.036  -28.496 -36.170 1.00 48.25  ? 415 TYR B CA   1 
ATOM   5446 C  C    . TYR B 1 54  ? -3.819  -27.127 -35.557 1.00 45.69  ? 415 TYR B C    1 
ATOM   5447 O  O    . TYR B 1 54  ? -3.032  -26.329 -36.069 1.00 42.28  ? 415 TYR B O    1 
ATOM   5448 C  CB   . TYR B 1 54  ? -3.478  -29.594 -35.268 1.00 35.97  ? 415 TYR B CB   1 
ATOM   5449 C  CG   . TYR B 1 54  ? -2.044  -29.386 -34.872 1.00 43.81  ? 415 TYR B CG   1 
ATOM   5450 C  CD1  . TYR B 1 54  ? -1.016  -29.808 -35.690 1.00 40.12  ? 415 TYR B CD1  1 
ATOM   5451 C  CD2  . TYR B 1 54  ? -1.718  -28.774 -33.671 1.00 46.91  ? 415 TYR B CD2  1 
ATOM   5452 C  CE1  . TYR B 1 54  ? 0.300   -29.624 -35.332 1.00 42.82  ? 415 TYR B CE1  1 
ATOM   5453 C  CE2  . TYR B 1 54  ? -0.406  -28.581 -33.306 1.00 39.25  ? 415 TYR B CE2  1 
ATOM   5454 C  CZ   . TYR B 1 54  ? 0.599   -29.011 -34.138 1.00 48.26  ? 415 TYR B CZ   1 
ATOM   5455 O  OH   . TYR B 1 54  ? 1.913   -28.827 -33.782 1.00 44.06  ? 415 TYR B OH   1 
ATOM   5456 H  H    . TYR B 1 54  ? -2.700  -28.003 -37.527 1.00 58.95  ? 415 TYR B H    1 
ATOM   5457 H  HA   . TYR B 1 54  ? -4.990  -28.639 -36.275 1.00 57.90  ? 415 TYR B HA   1 
ATOM   5458 H  HB2  . TYR B 1 54  ? -4.008  -29.630 -34.456 1.00 43.17  ? 415 TYR B HB2  1 
ATOM   5459 H  HB3  . TYR B 1 54  ? -3.536  -30.442 -35.736 1.00 43.17  ? 415 TYR B HB3  1 
ATOM   5460 H  HD1  . TYR B 1 54  ? -1.216  -30.223 -36.498 1.00 48.14  ? 415 TYR B HD1  1 
ATOM   5461 H  HD2  . TYR B 1 54  ? -2.398  -28.482 -33.107 1.00 56.29  ? 415 TYR B HD2  1 
ATOM   5462 H  HE1  . TYR B 1 54  ? 0.983   -29.912 -35.894 1.00 51.38  ? 415 TYR B HE1  1 
ATOM   5463 H  HE2  . TYR B 1 54  ? -0.201  -28.168 -32.498 1.00 47.10  ? 415 TYR B HE2  1 
ATOM   5464 H  HH   . TYR B 1 54  ? 2.418   -29.134 -34.379 1.00 52.87  ? 415 TYR B HH   1 
ATOM   5465 N  N    . GLY B 1 55  ? -4.529  -26.857 -34.467 1.00 38.83  ? 416 GLY B N    1 
ATOM   5466 C  CA   . GLY B 1 55  ? -4.458  -25.571 -33.812 1.00 38.76  ? 416 GLY B CA   1 
ATOM   5467 C  C    . GLY B 1 55  ? -4.086  -25.688 -32.350 1.00 39.35  ? 416 GLY B C    1 
ATOM   5468 O  O    . GLY B 1 55  ? -4.316  -26.721 -31.715 1.00 37.38  ? 416 GLY B O    1 
ATOM   5469 H  H    . GLY B 1 55  ? -5.064  -27.414 -34.088 1.00 46.59  ? 416 GLY B H    1 
ATOM   5470 H  HA2  . GLY B 1 55  ? -3.795  -25.019 -34.254 1.00 46.51  ? 416 GLY B HA2  1 
ATOM   5471 H  HA3  . GLY B 1 55  ? -5.319  -25.128 -33.875 1.00 46.51  ? 416 GLY B HA3  1 
ATOM   5472 N  N    . ILE B 1 56  ? -3.472  -24.623 -31.847 1.00 42.82  ? 417 ILE B N    1 
ATOM   5473 C  CA   . ILE B 1 56  ? -3.276  -24.405 -30.421 1.00 41.82  ? 417 ILE B CA   1 
ATOM   5474 C  C    . ILE B 1 56  ? -4.067  -23.170 -30.047 1.00 41.14  ? 417 ILE B C    1 
ATOM   5475 O  O    . ILE B 1 56  ? -3.898  -22.114 -30.657 1.00 41.01  ? 417 ILE B O    1 
ATOM   5476 C  CB   . ILE B 1 56  ? -1.797  -24.202 -30.051 1.00 40.30  ? 417 ILE B CB   1 
ATOM   5477 C  CG1  . ILE B 1 56  ? -0.965  -25.410 -30.472 1.00 36.23  ? 417 ILE B CG1  1 
ATOM   5478 C  CG2  . ILE B 1 56  ? -1.641  -23.933 -28.552 1.00 34.35  ? 417 ILE B CG2  1 
ATOM   5479 C  CD1  . ILE B 1 56  ? -1.477  -26.707 -29.962 1.00 42.21  ? 417 ILE B CD1  1 
ATOM   5480 H  H    . ILE B 1 56  ? -3.150  -23.990 -32.332 1.00 51.38  ? 417 ILE B H    1 
ATOM   5481 H  HA   . ILE B 1 56  ? -3.622  -25.162 -29.922 1.00 50.18  ? 417 ILE B HA   1 
ATOM   5482 H  HB   . ILE B 1 56  ? -1.469  -23.426 -30.533 1.00 48.36  ? 417 ILE B HB   1 
ATOM   5483 H  HG12 . ILE B 1 56  ? -0.953  -25.457 -31.441 1.00 43.47  ? 417 ILE B HG12 1 
ATOM   5484 H  HG13 . ILE B 1 56  ? -0.062  -25.297 -30.138 1.00 43.47  ? 417 ILE B HG13 1 
ATOM   5485 H  HG21 . ILE B 1 56  ? -0.700  -23.809 -28.350 1.00 41.22  ? 417 ILE B HG21 1 
ATOM   5486 H  HG22 . ILE B 1 56  ? -2.138  -23.132 -28.322 1.00 41.22  ? 417 ILE B HG22 1 
ATOM   5487 H  HG23 . ILE B 1 56  ? -1.989  -24.692 -28.058 1.00 41.22  ? 417 ILE B HG23 1 
ATOM   5488 H  HD11 . ILE B 1 56  ? -0.896  -27.419 -30.273 1.00 50.65  ? 417 ILE B HD11 1 
ATOM   5489 H  HD12 . ILE B 1 56  ? -1.484  -26.685 -28.992 1.00 50.65  ? 417 ILE B HD12 1 
ATOM   5490 H  HD13 . ILE B 1 56  ? -2.377  -26.845 -30.297 1.00 50.65  ? 417 ILE B HD13 1 
ATOM   5491 N  N    . ILE B 1 57  ? -4.939  -23.318 -29.058 1.00 34.21  ? 418 ILE B N    1 
ATOM   5492 C  CA   . ILE B 1 57  ? -5.856  -22.263 -28.667 1.00 36.43  ? 418 ILE B CA   1 
ATOM   5493 C  C    . ILE B 1 57  ? -5.485  -21.850 -27.256 1.00 40.70  ? 418 ILE B C    1 
ATOM   5494 O  O    . ILE B 1 57  ? -5.336  -22.703 -26.378 1.00 34.12  ? 418 ILE B O    1 
ATOM   5495 C  CB   . ILE B 1 57  ? -7.334  -22.726 -28.729 1.00 35.62  ? 418 ILE B CB   1 
ATOM   5496 C  CG1  . ILE B 1 57  ? -7.748  -23.078 -30.162 1.00 43.05  ? 418 ILE B CG1  1 
ATOM   5497 C  CG2  . ILE B 1 57  ? -8.260  -21.644 -28.227 1.00 39.96  ? 418 ILE B CG2  1 
ATOM   5498 C  CD1  . ILE B 1 57  ? -7.380  -24.479 -30.594 1.00 44.35  ? 418 ILE B CD1  1 
ATOM   5499 H  H    . ILE B 1 57  ? -5.019  -24.035 -28.591 1.00 41.06  ? 418 ILE B H    1 
ATOM   5500 H  HA   . ILE B 1 57  ? -5.745  -21.499 -29.255 1.00 43.72  ? 418 ILE B HA   1 
ATOM   5501 H  HB   . ILE B 1 57  ? -7.439  -23.512 -28.170 1.00 42.75  ? 418 ILE B HB   1 
ATOM   5502 H  HG12 . ILE B 1 57  ? -8.711  -22.990 -30.238 1.00 51.66  ? 418 ILE B HG12 1 
ATOM   5503 H  HG13 . ILE B 1 57  ? -7.315  -22.459 -30.771 1.00 51.66  ? 418 ILE B HG13 1 
ATOM   5504 H  HG21 . ILE B 1 57  ? -9.175  -21.964 -28.278 1.00 47.96  ? 418 ILE B HG21 1 
ATOM   5505 H  HG22 . ILE B 1 57  ? -8.033  -21.436 -27.307 1.00 47.96  ? 418 ILE B HG22 1 
ATOM   5506 H  HG23 . ILE B 1 57  ? -8.154  -20.855 -28.781 1.00 47.96  ? 418 ILE B HG23 1 
ATOM   5507 H  HD11 . ILE B 1 57  ? -7.677  -24.615 -31.508 1.00 53.22  ? 418 ILE B HD11 1 
ATOM   5508 H  HD12 . ILE B 1 57  ? -6.417  -24.583 -30.540 1.00 53.22  ? 418 ILE B HD12 1 
ATOM   5509 H  HD13 . ILE B 1 57  ? -7.816  -25.115 -30.006 1.00 53.22  ? 418 ILE B HD13 1 
ATOM   5510 N  N    . ARG B 1 58  ? -5.337  -20.547 -27.042 1.00 48.09  ? 419 ARG B N    1 
ATOM   5511 C  CA   . ARG B 1 58  ? -4.874  -20.038 -25.761 1.00 37.14  ? 419 ARG B CA   1 
ATOM   5512 C  C    . ARG B 1 58  ? -5.748  -18.916 -25.216 1.00 42.32  ? 419 ARG B C    1 
ATOM   5513 O  O    . ARG B 1 58  ? -5.965  -17.906 -25.880 1.00 42.06  ? 419 ARG B O    1 
ATOM   5514 C  CB   . ARG B 1 58  ? -3.432  -19.554 -25.892 1.00 44.90  ? 419 ARG B CB   1 
ATOM   5515 C  CG   . ARG B 1 58  ? -2.489  -20.623 -26.415 1.00 60.31  ? 419 ARG B CG   1 
ATOM   5516 C  CD   . ARG B 1 58  ? -1.041  -20.186 -26.337 1.00 62.63  ? 419 ARG B CD   1 
ATOM   5517 N  NE   . ARG B 1 58  ? -0.695  -19.260 -27.405 1.00 85.39  ? 419 ARG B NE   1 
ATOM   5518 C  CZ   . ARG B 1 58  ? -0.211  -19.618 -28.590 1.00 91.42  ? 419 ARG B CZ   1 
ATOM   5519 N  NH1  . ARG B 1 58  ? 0.004   -20.897 -28.882 1.00 82.50  ? 419 ARG B NH1  1 
ATOM   5520 N  NH2  . ARG B 1 58  ? 0.063   -18.685 -29.488 1.00 83.43  ? 419 ARG B NH2  1 
ATOM   5521 H  H    . ARG B 1 58  ? -5.500  -19.936 -27.625 1.00 57.71  ? 419 ARG B H    1 
ATOM   5522 H  HA   . ARG B 1 58  ? -4.885  -20.762 -25.115 1.00 44.56  ? 419 ARG B HA   1 
ATOM   5523 H  HB2  . ARG B 1 58  ? -3.407  -18.805 -26.509 1.00 53.88  ? 419 ARG B HB2  1 
ATOM   5524 H  HB3  . ARG B 1 58  ? -3.113  -19.275 -25.020 1.00 53.88  ? 419 ARG B HB3  1 
ATOM   5525 H  HG2  . ARG B 1 58  ? -2.592  -21.427 -25.882 1.00 72.37  ? 419 ARG B HG2  1 
ATOM   5526 H  HG3  . ARG B 1 58  ? -2.700  -20.807 -27.344 1.00 72.37  ? 419 ARG B HG3  1 
ATOM   5527 H  HD2  . ARG B 1 58  ? -0.888  -19.741 -25.489 1.00 75.16  ? 419 ARG B HD2  1 
ATOM   5528 H  HD3  . ARG B 1 58  ? -0.468  -20.965 -26.415 1.00 75.16  ? 419 ARG B HD3  1 
ATOM   5529 H  HE   . ARG B 1 58  ? -0.812  -18.420 -27.259 1.00 102.47 ? 419 ARG B HE   1 
ATOM   5530 H  HH11 . ARG B 1 58  ? -0.173  -21.506 -28.301 1.00 99.00  ? 419 ARG B HH11 1 
ATOM   5531 H  HH12 . ARG B 1 58  ? 0.319   -21.115 -29.652 1.00 99.00  ? 419 ARG B HH12 1 
ATOM   5532 H  HH21 . ARG B 1 58  ? -0.073  -17.856 -29.303 1.00 100.11 ? 419 ARG B HH21 1 
ATOM   5533 H  HH22 . ARG B 1 58  ? 0.380   -18.907 -30.256 1.00 100.11 ? 419 ARG B HH22 1 
ATOM   5534 N  N    . VAL B 1 59  ? -6.253  -19.114 -24.000 1.00 40.44  ? 420 VAL B N    1 
ATOM   5535 C  CA   . VAL B 1 59  ? -6.907  -18.048 -23.244 1.00 34.20  ? 420 VAL B CA   1 
ATOM   5536 C  C    . VAL B 1 59  ? -6.168  -17.892 -21.926 1.00 43.52  ? 420 VAL B C    1 
ATOM   5537 O  O    . VAL B 1 59  ? -6.317  -18.713 -21.019 1.00 37.04  ? 420 VAL B O    1 
ATOM   5538 C  CB   . VAL B 1 59  ? -8.395  -18.347 -22.980 1.00 43.51  ? 420 VAL B CB   1 
ATOM   5539 C  CG1  . VAL B 1 59  ? -9.061  -17.176 -22.255 1.00 48.74  ? 420 VAL B CG1  1 
ATOM   5540 C  CG2  . VAL B 1 59  ? -9.117  -18.654 -24.282 1.00 44.18  ? 420 VAL B CG2  1 
ATOM   5541 H  H    . VAL B 1 59  ? -6.230  -19.867 -23.586 1.00 48.53  ? 420 VAL B H    1 
ATOM   5542 H  HA   . VAL B 1 59  ? -6.842  -17.215 -23.736 1.00 41.03  ? 420 VAL B HA   1 
ATOM   5543 H  HB   . VAL B 1 59  ? -8.463  -19.128 -22.409 1.00 52.21  ? 420 VAL B HB   1 
ATOM   5544 H  HG11 . VAL B 1 59  ? -9.995  -17.390 -22.101 1.00 58.48  ? 420 VAL B HG11 1 
ATOM   5545 H  HG12 . VAL B 1 59  ? -8.611  -17.032 -21.408 1.00 58.48  ? 420 VAL B HG12 1 
ATOM   5546 H  HG13 . VAL B 1 59  ? -8.990  -16.382 -22.807 1.00 58.48  ? 420 VAL B HG13 1 
ATOM   5547 H  HG21 . VAL B 1 59  ? -10.050 -18.838 -24.090 1.00 53.01  ? 420 VAL B HG21 1 
ATOM   5548 H  HG22 . VAL B 1 59  ? -9.045  -17.886 -24.871 1.00 53.01  ? 420 VAL B HG22 1 
ATOM   5549 H  HG23 . VAL B 1 59  ? -8.705  -19.428 -24.696 1.00 53.01  ? 420 VAL B HG23 1 
ATOM   5550 N  N    . GLY B 1 60  ? -5.361  -16.844 -21.819 1.00 60.00  ? 421 GLY B N    1 
ATOM   5551 C  CA   . GLY B 1 60  ? -4.496  -16.693 -20.666 1.00 58.15  ? 421 GLY B CA   1 
ATOM   5552 C  C    . GLY B 1 60  ? -3.462  -17.797 -20.705 1.00 65.49  ? 421 GLY B C    1 
ATOM   5553 O  O    . GLY B 1 60  ? -2.704  -17.906 -21.668 1.00 79.55  ? 421 GLY B O    1 
ATOM   5554 H  H    . GLY B 1 60  ? -5.297  -16.212 -22.398 1.00 72.00  ? 421 GLY B H    1 
ATOM   5555 H  HA2  . GLY B 1 60  ? -4.049  -15.833 -20.690 1.00 69.79  ? 421 GLY B HA2  1 
ATOM   5556 H  HA3  . GLY B 1 60  ? -5.011  -16.765 -19.847 1.00 69.79  ? 421 GLY B HA3  1 
ATOM   5557 N  N    . ASN B 1 61  ? -3.443  -18.630 -19.672 1.00 57.85  ? 422 ASN B N    1 
ATOM   5558 C  CA   . ASN B 1 61  ? -2.535  -19.768 -19.633 1.00 58.14  ? 422 ASN B CA   1 
ATOM   5559 C  C    . ASN B 1 61  ? -3.293  -21.091 -19.737 1.00 41.22  ? 422 ASN B C    1 
ATOM   5560 O  O    . ASN B 1 61  ? -2.740  -22.160 -19.483 1.00 37.37  ? 422 ASN B O    1 
ATOM   5561 C  CB   . ASN B 1 61  ? -1.686  -19.711 -18.363 1.00 68.14  ? 422 ASN B CB   1 
ATOM   5562 C  CG   . ASN B 1 61  ? -0.680  -18.565 -18.391 1.00 86.12  ? 422 ASN B CG   1 
ATOM   5563 O  OD1  . ASN B 1 61  ? -0.199  -18.165 -19.458 1.00 76.46  ? 422 ASN B OD1  1 
ATOM   5564 N  ND2  . ASN B 1 61  ? -0.366  -18.026 -17.219 1.00 74.63  ? 422 ASN B ND2  1 
ATOM   5565 H  H    . ASN B 1 61  ? -3.948  -18.557 -18.980 1.00 69.42  ? 422 ASN B H    1 
ATOM   5566 H  HA   . ASN B 1 61  ? -1.934  -19.712 -20.392 1.00 69.77  ? 422 ASN B HA   1 
ATOM   5567 H  HB2  . ASN B 1 61  ? -2.268  -19.583 -17.597 1.00 81.76  ? 422 ASN B HB2  1 
ATOM   5568 H  HB3  . ASN B 1 61  ? -1.194  -20.542 -18.273 1.00 81.76  ? 422 ASN B HB3  1 
ATOM   5569 H  HD21 . ASN B 1 61  ? 0.197   -17.377 -17.181 1.00 89.56  ? 422 ASN B HD21 1 
ATOM   5570 H  HD22 . ASN B 1 61  ? -0.724  -18.327 -16.497 1.00 89.56  ? 422 ASN B HD22 1 
ATOM   5571 N  N    . GLN B 1 62  ? -4.560  -21.007 -20.136 1.00 33.76  ? 423 GLN B N    1 
ATOM   5572 C  CA   . GLN B 1 62  ? -5.314  -22.187 -20.528 1.00 46.84  ? 423 GLN B CA   1 
ATOM   5573 C  C    . GLN B 1 62  ? -5.004  -22.494 -21.990 1.00 44.00  ? 423 GLN B C    1 
ATOM   5574 O  O    . GLN B 1 62  ? -5.211  -21.659 -22.861 1.00 39.53  ? 423 GLN B O    1 
ATOM   5575 C  CB   . GLN B 1 62  ? -6.813  -21.973 -20.325 1.00 35.12  ? 423 GLN B CB   1 
ATOM   5576 C  CG   . GLN B 1 62  ? -7.214  -21.681 -18.883 1.00 46.91  ? 423 GLN B CG   1 
ATOM   5577 C  CD   . GLN B 1 62  ? -8.606  -21.093 -18.780 1.00 37.46  ? 423 GLN B CD   1 
ATOM   5578 O  OE1  . GLN B 1 62  ? -9.576  -21.801 -18.514 1.00 41.15  ? 423 GLN B OE1  1 
ATOM   5579 N  NE2  . GLN B 1 62  ? -8.709  -19.785 -18.989 1.00 38.26  ? 423 GLN B NE2  1 
ATOM   5580 H  H    . GLN B 1 62  ? -5.006  -20.273 -20.187 1.00 40.52  ? 423 GLN B H    1 
ATOM   5581 H  HA   . GLN B 1 62  ? -5.035  -22.943 -19.988 1.00 56.21  ? 423 GLN B HA   1 
ATOM   5582 H  HB2  . GLN B 1 62  ? -7.096  -21.220 -20.868 1.00 42.14  ? 423 GLN B HB2  1 
ATOM   5583 H  HB3  . GLN B 1 62  ? -7.282  -22.774 -20.606 1.00 42.14  ? 423 GLN B HB3  1 
ATOM   5584 H  HG2  . GLN B 1 62  ? -7.198  -22.508 -18.376 1.00 56.30  ? 423 GLN B HG2  1 
ATOM   5585 H  HG3  . GLN B 1 62  ? -6.589  -21.045 -18.502 1.00 56.30  ? 423 GLN B HG3  1 
ATOM   5586 H  HE21 . GLN B 1 62  ? -8.008  -19.322 -19.171 1.00 45.92  ? 423 GLN B HE21 1 
ATOM   5587 H  HE22 . GLN B 1 62  ? -9.478  -19.402 -18.943 1.00 45.92  ? 423 GLN B HE22 1 
ATOM   5588 N  N    . ILE B 1 63  ? -4.497  -23.695 -22.235 1.00 34.03  ? 424 ILE B N    1 
ATOM   5589 C  CA   . ILE B 1 63  ? -4.055  -24.113 -23.554 1.00 38.93  ? 424 ILE B CA   1 
ATOM   5590 C  C    . ILE B 1 63  ? -4.883  -25.294 -24.020 1.00 43.74  ? 424 ILE B C    1 
ATOM   5591 O  O    . ILE B 1 63  ? -5.100  -26.234 -23.258 1.00 35.16  ? 424 ILE B O    1 
ATOM   5592 C  CB   . ILE B 1 63  ? -2.569  -24.523 -23.553 1.00 34.43  ? 424 ILE B CB   1 
ATOM   5593 C  CG1  . ILE B 1 63  ? -1.717  -23.515 -22.776 1.00 45.85  ? 424 ILE B CG1  1 
ATOM   5594 C  CG2  . ILE B 1 63  ? -2.056  -24.680 -24.981 1.00 36.36  ? 424 ILE B CG2  1 
ATOM   5595 C  CD1  . ILE B 1 63  ? -1.707  -22.119 -23.345 1.00 55.23  ? 424 ILE B CD1  1 
ATOM   5596 H  H    . ILE B 1 63  ? -4.396  -24.301 -21.634 1.00 40.84  ? 424 ILE B H    1 
ATOM   5597 H  HA   . ILE B 1 63  ? -4.175  -23.384 -24.183 1.00 46.72  ? 424 ILE B HA   1 
ATOM   5598 H  HB   . ILE B 1 63  ? -2.495  -25.383 -23.111 1.00 41.32  ? 424 ILE B HB   1 
ATOM   5599 H  HG12 . ILE B 1 63  ? -2.056  -23.459 -21.869 1.00 55.02  ? 424 ILE B HG12 1 
ATOM   5600 H  HG13 . ILE B 1 63  ? -0.800  -23.831 -22.762 1.00 55.02  ? 424 ILE B HG13 1 
ATOM   5601 H  HG21 . ILE B 1 63  ? -1.122  -24.937 -24.955 1.00 43.63  ? 424 ILE B HG21 1 
ATOM   5602 H  HG22 . ILE B 1 63  ? -2.576  -25.365 -25.429 1.00 43.63  ? 424 ILE B HG22 1 
ATOM   5603 H  HG23 . ILE B 1 63  ? -2.154  -23.834 -25.446 1.00 43.63  ? 424 ILE B HG23 1 
ATOM   5604 H  HD11 . ILE B 1 63  ? -1.145  -21.556 -22.789 1.00 66.28  ? 424 ILE B HD11 1 
ATOM   5605 H  HD12 . ILE B 1 63  ? -1.356  -22.149 -24.248 1.00 66.28  ? 424 ILE B HD12 1 
ATOM   5606 H  HD13 . ILE B 1 63  ? -2.614  -21.776 -23.353 1.00 66.28  ? 424 ILE B HD13 1 
ATOM   5607 N  N    . PHE B 1 64  ? -5.343  -25.240 -25.265 1.00 30.25  ? 425 PHE B N    1 
ATOM   5608 C  CA   . PHE B 1 64  ? -6.047  -26.359 -25.883 1.00 29.78  ? 425 PHE B CA   1 
ATOM   5609 C  C    . PHE B 1 64  ? -5.374  -26.755 -27.198 1.00 35.79  ? 425 PHE B C    1 
ATOM   5610 O  O    . PHE B 1 64  ? -4.836  -25.904 -27.914 1.00 36.10  ? 425 PHE B O    1 
ATOM   5611 C  CB   . PHE B 1 64  ? -7.514  -26.000 -26.123 1.00 30.36  ? 425 PHE B CB   1 
ATOM   5612 C  CG   . PHE B 1 64  ? -8.195  -25.420 -24.915 1.00 35.30  ? 425 PHE B CG   1 
ATOM   5613 C  CD1  . PHE B 1 64  ? -8.698  -26.245 -23.924 1.00 44.81  ? 425 PHE B CD1  1 
ATOM   5614 C  CD2  . PHE B 1 64  ? -8.320  -24.048 -24.767 1.00 36.66  ? 425 PHE B CD2  1 
ATOM   5615 C  CE1  . PHE B 1 64  ? -9.319  -25.712 -22.806 1.00 43.07  ? 425 PHE B CE1  1 
ATOM   5616 C  CE2  . PHE B 1 64  ? -8.939  -23.510 -23.656 1.00 39.56  ? 425 PHE B CE2  1 
ATOM   5617 C  CZ   . PHE B 1 64  ? -9.441  -24.345 -22.673 1.00 42.36  ? 425 PHE B CZ   1 
ATOM   5618 H  H    . PHE B 1 64  ? -5.259  -24.556 -25.781 1.00 36.30  ? 425 PHE B H    1 
ATOM   5619 H  HA   . PHE B 1 64  ? -6.016  -27.123 -25.286 1.00 35.74  ? 425 PHE B HA   1 
ATOM   5620 H  HB2  . PHE B 1 64  ? -7.563  -25.345 -26.836 1.00 36.43  ? 425 PHE B HB2  1 
ATOM   5621 H  HB3  . PHE B 1 64  ? -7.995  -26.803 -26.379 1.00 36.43  ? 425 PHE B HB3  1 
ATOM   5622 H  HD1  . PHE B 1 64  ? -8.618  -27.167 -24.010 1.00 53.78  ? 425 PHE B HD1  1 
ATOM   5623 H  HD2  . PHE B 1 64  ? -7.985  -23.482 -25.424 1.00 43.99  ? 425 PHE B HD2  1 
ATOM   5624 H  HE1  . PHE B 1 64  ? -9.656  -26.276 -22.148 1.00 51.69  ? 425 PHE B HE1  1 
ATOM   5625 H  HE2  . PHE B 1 64  ? -9.019  -22.587 -23.569 1.00 47.47  ? 425 PHE B HE2  1 
ATOM   5626 H  HZ   . PHE B 1 64  ? -9.858  -23.985 -21.924 1.00 50.83  ? 425 PHE B HZ   1 
ATOM   5627 N  N    . GLN B 1 65  ? -5.401  -28.054 -27.497 1.00 30.53  ? 426 GLN B N    1 
ATOM   5628 C  CA   . GLN B 1 65  ? -4.804  -28.600 -28.710 1.00 37.00  ? 426 GLN B CA   1 
ATOM   5629 C  C    . GLN B 1 65  ? -5.845  -29.393 -29.485 1.00 43.97  ? 426 GLN B C    1 
ATOM   5630 O  O    . GLN B 1 65  ? -6.401  -30.358 -28.971 1.00 47.36  ? 426 GLN B O    1 
ATOM   5631 C  CB   . GLN B 1 65  ? -3.611  -29.499 -28.374 1.00 35.54  ? 426 GLN B CB   1 
ATOM   5632 C  CG   . GLN B 1 65  ? -2.864  -30.020 -29.591 1.00 48.36  ? 426 GLN B CG   1 
ATOM   5633 C  CD   . GLN B 1 65  ? -1.649  -30.856 -29.221 1.00 45.49  ? 426 GLN B CD   1 
ATOM   5634 O  OE1  . GLN B 1 65  ? -1.381  -31.095 -28.047 1.00 48.45  ? 426 GLN B OE1  1 
ATOM   5635 N  NE2  . GLN B 1 65  ? -0.907  -31.301 -30.228 1.00 45.52  ? 426 GLN B NE2  1 
ATOM   5636 H  H    . GLN B 1 65  ? -5.769  -28.650 -26.998 1.00 36.64  ? 426 GLN B H    1 
ATOM   5637 H  HA   . GLN B 1 65  ? -4.492  -27.874 -29.271 1.00 44.40  ? 426 GLN B HA   1 
ATOM   5638 H  HB2  . GLN B 1 65  ? -2.983  -28.993 -27.835 1.00 42.65  ? 426 GLN B HB2  1 
ATOM   5639 H  HB3  . GLN B 1 65  ? -3.930  -30.266 -27.873 1.00 42.65  ? 426 GLN B HB3  1 
ATOM   5640 H  HG2  . GLN B 1 65  ? -3.461  -30.576 -30.115 1.00 58.03  ? 426 GLN B HG2  1 
ATOM   5641 H  HG3  . GLN B 1 65  ? -2.559  -29.267 -30.121 1.00 58.03  ? 426 GLN B HG3  1 
ATOM   5642 H  HE21 . GLN B 1 65  ? -1.124  -31.113 -31.038 1.00 54.63  ? 426 GLN B HE21 1 
ATOM   5643 H  HE22 . GLN B 1 65  ? -0.210  -31.778 -30.069 1.00 54.63  ? 426 GLN B HE22 1 
ATOM   5644 N  N    . SER B 1 66  ? -6.109  -28.981 -30.719 1.00 37.64  ? 427 SER B N    1 
ATOM   5645 C  CA   . SER B 1 66  ? -7.068  -29.683 -31.561 1.00 38.96  ? 427 SER B CA   1 
ATOM   5646 C  C    . SER B 1 66  ? -6.453  -30.944 -32.138 1.00 41.24  ? 427 SER B C    1 
ATOM   5647 O  O    . SER B 1 66  ? -5.238  -31.140 -32.072 1.00 38.96  ? 427 SER B O    1 
ATOM   5648 C  CB   . SER B 1 66  ? -7.533  -28.799 -32.707 1.00 51.50  ? 427 SER B CB   1 
ATOM   5649 O  OG   . SER B 1 66  ? -6.581  -28.859 -33.751 1.00 40.42  ? 427 SER B OG   1 
ATOM   5650 H  H    . SER B 1 66  ? -5.746  -28.297 -31.093 1.00 45.16  ? 427 SER B H    1 
ATOM   5651 H  HA   . SER B 1 66  ? -7.841  -29.932 -31.031 1.00 46.75  ? 427 SER B HA   1 
ATOM   5652 H  HB2  . SER B 1 66  ? -8.389  -29.118 -33.033 1.00 61.80  ? 427 SER B HB2  1 
ATOM   5653 H  HB3  . SER B 1 66  ? -7.611  -27.883 -32.396 1.00 61.80  ? 427 SER B HB3  1 
ATOM   5654 H  HG   . SER B 1 66  ? -6.826  -28.375 -34.392 1.00 48.50  ? 427 SER B HG   1 
ATOM   5655 N  N    . ARG B 1 67  ? -7.294  -31.785 -32.728 1.00 45.40  ? 428 ARG B N    1 
ATOM   5656 C  CA   . ARG B 1 67  ? -6.802  -32.941 -33.462 1.00 51.29  ? 428 ARG B CA   1 
ATOM   5657 C  C    . ARG B 1 67  ? -6.126  -32.523 -34.764 1.00 45.41  ? 428 ARG B C    1 
ATOM   5658 O  O    . ARG B 1 67  ? -6.372  -31.434 -35.293 1.00 41.81  ? 428 ARG B O    1 
ATOM   5659 C  CB   . ARG B 1 67  ? -7.936  -33.919 -33.771 1.00 57.96  ? 428 ARG B CB   1 
ATOM   5660 C  CG   . ARG B 1 67  ? -8.024  -35.090 -32.811 1.00 85.53  ? 428 ARG B CG   1 
ATOM   5661 C  CD   . ARG B 1 67  ? -9.274  -35.014 -31.963 1.00 92.01  ? 428 ARG B CD   1 
ATOM   5662 N  NE   . ARG B 1 67  ? -9.176  -35.844 -30.767 1.00 105.52 ? 428 ARG B NE   1 
ATOM   5663 C  CZ   . ARG B 1 67  ? -10.134 -35.948 -29.851 1.00 115.20 ? 428 ARG B CZ   1 
ATOM   5664 N  NH1  . ARG B 1 67  ? -11.266 -35.275 -29.995 1.00 114.54 ? 428 ARG B NH1  1 
ATOM   5665 N  NH2  . ARG B 1 67  ? -9.961  -36.726 -28.791 1.00 115.71 ? 428 ARG B NH2  1 
ATOM   5666 H  H    . ARG B 1 67  ? -8.150  -31.708 -32.718 1.00 54.48  ? 428 ARG B H    1 
ATOM   5667 H  HA   . ARG B 1 67  ? -6.146  -33.404 -32.918 1.00 61.55  ? 428 ARG B HA   1 
ATOM   5668 H  HB2  . ARG B 1 67  ? -8.779  -33.441 -33.732 1.00 69.55  ? 428 ARG B HB2  1 
ATOM   5669 H  HB3  . ARG B 1 67  ? -7.804  -34.277 -34.663 1.00 69.55  ? 428 ARG B HB3  1 
ATOM   5670 H  HG2  . ARG B 1 67  ? -8.049  -35.918 -33.316 1.00 102.64 ? 428 ARG B HG2  1 
ATOM   5671 H  HG3  . ARG B 1 67  ? -7.255  -35.079 -32.220 1.00 102.64 ? 428 ARG B HG3  1 
ATOM   5672 H  HD2  . ARG B 1 67  ? -9.413  -34.095 -31.682 1.00 110.42 ? 428 ARG B HD2  1 
ATOM   5673 H  HD3  . ARG B 1 67  ? -10.032 -35.322 -32.484 1.00 110.42 ? 428 ARG B HD3  1 
ATOM   5674 H  HE   . ARG B 1 67  ? -8.473  -36.330 -30.671 1.00 126.62 ? 428 ARG B HE   1 
ATOM   5675 H  HH11 . ARG B 1 67  ? -11.382 -34.769 -30.681 1.00 137.45 ? 428 ARG B HH11 1 
ATOM   5676 H  HH12 . ARG B 1 67  ? -11.885 -35.343 -29.402 1.00 137.45 ? 428 ARG B HH12 1 
ATOM   5677 H  HH21 . ARG B 1 67  ? -9.228  -37.165 -28.694 1.00 138.85 ? 428 ARG B HH21 1 
ATOM   5678 H  HH22 . ARG B 1 67  ? -10.583 -36.792 -28.200 1.00 138.85 ? 428 ARG B HH22 1 
ATOM   5679 N  N    . VAL B 1 68  ? -5.269  -33.409 -35.258 1.00 38.86  ? 429 VAL B N    1 
ATOM   5680 C  CA   . VAL B 1 68  ? -4.648  -33.272 -36.572 1.00 47.06  ? 429 VAL B CA   1 
ATOM   5681 C  C    . VAL B 1 68  ? -5.568  -33.845 -37.639 1.00 49.21  ? 429 VAL B C    1 
ATOM   5682 O  O    . VAL B 1 68  ? -6.074  -34.957 -37.495 1.00 69.00  ? 429 VAL B O    1 
ATOM   5683 C  CB   . VAL B 1 68  ? -3.291  -34.008 -36.638 1.00 41.66  ? 429 VAL B CB   1 
ATOM   5684 C  CG1  . VAL B 1 68  ? -2.755  -34.068 -38.082 1.00 54.00  ? 429 VAL B CG1  1 
ATOM   5685 C  CG2  . VAL B 1 68  ? -2.282  -33.354 -35.718 1.00 49.90  ? 429 VAL B CG2  1 
ATOM   5686 H  H    . VAL B 1 68  ? -5.023  -34.118 -34.838 1.00 46.64  ? 429 VAL B H    1 
ATOM   5687 H  HA   . VAL B 1 68  ? -4.499  -32.333 -36.764 1.00 56.48  ? 429 VAL B HA   1 
ATOM   5688 H  HB   . VAL B 1 68  ? -3.418  -34.921 -36.334 1.00 49.99  ? 429 VAL B HB   1 
ATOM   5689 H  HG11 . VAL B 1 68  ? -1.905  -34.536 -38.084 1.00 64.80  ? 429 VAL B HG11 1 
ATOM   5690 H  HG12 . VAL B 1 68  ? -3.395  -34.542 -38.637 1.00 64.80  ? 429 VAL B HG12 1 
ATOM   5691 H  HG13 . VAL B 1 68  ? -2.636  -33.164 -38.412 1.00 64.80  ? 429 VAL B HG13 1 
ATOM   5692 H  HG21 . VAL B 1 68  ? -1.442  -33.834 -35.779 1.00 59.88  ? 429 VAL B HG21 1 
ATOM   5693 H  HG22 . VAL B 1 68  ? -2.158  -32.432 -35.992 1.00 59.88  ? 429 VAL B HG22 1 
ATOM   5694 H  HG23 . VAL B 1 68  ? -2.618  -33.387 -34.808 1.00 59.88  ? 429 VAL B HG23 1 
ATOM   5695 N  N    . ILE B 1 69  ? -5.773  -33.085 -38.708 1.00 47.85  ? 430 ILE B N    1 
ATOM   5696 C  CA   . ILE B 1 69  ? -6.508  -33.575 -39.869 1.00 52.98  ? 430 ILE B CA   1 
ATOM   5697 C  C    . ILE B 1 69  ? -5.520  -33.708 -41.012 1.00 48.74  ? 430 ILE B C    1 
ATOM   5698 O  O    . ILE B 1 69  ? -4.902  -32.733 -41.423 1.00 61.13  ? 430 ILE B O    1 
ATOM   5699 C  CB   . ILE B 1 69  ? -7.666  -32.640 -40.252 1.00 52.33  ? 430 ILE B CB   1 
ATOM   5700 C  CG1  . ILE B 1 69  ? -8.709  -32.649 -39.131 1.00 52.00  ? 430 ILE B CG1  1 
ATOM   5701 C  CG2  . ILE B 1 69  ? -8.287  -33.065 -41.601 1.00 57.98  ? 430 ILE B CG2  1 
ATOM   5702 C  CD1  . ILE B 1 69  ? -9.826  -31.655 -39.302 1.00 56.91  ? 430 ILE B CD1  1 
ATOM   5703 H  H    . ILE B 1 69  ? -5.494  -32.276 -38.787 1.00 57.42  ? 430 ILE B H    1 
ATOM   5704 H  HA   . ILE B 1 69  ? -6.873  -34.452 -39.675 1.00 63.58  ? 430 ILE B HA   1 
ATOM   5705 H  HB   . ILE B 1 69  ? -7.319  -31.739 -40.343 1.00 62.80  ? 430 ILE B HB   1 
ATOM   5706 H  HG12 . ILE B 1 69  ? -9.107  -33.533 -39.085 1.00 62.40  ? 430 ILE B HG12 1 
ATOM   5707 H  HG13 . ILE B 1 69  ? -8.264  -32.449 -38.293 1.00 62.40  ? 430 ILE B HG13 1 
ATOM   5708 H  HG21 . ILE B 1 69  ? -9.013  -32.460 -41.818 1.00 69.57  ? 430 ILE B HG21 1 
ATOM   5709 H  HG22 . ILE B 1 69  ? -7.604  -33.024 -42.289 1.00 69.57  ? 430 ILE B HG22 1 
ATOM   5710 H  HG23 . ILE B 1 69  ? -8.623  -33.972 -41.521 1.00 69.57  ? 430 ILE B HG23 1 
ATOM   5711 H  HD11 . ILE B 1 69  ? -10.434 -31.732 -38.550 1.00 68.29  ? 430 ILE B HD11 1 
ATOM   5712 H  HD12 . ILE B 1 69  ? -9.451  -30.761 -39.334 1.00 68.29  ? 430 ILE B HD12 1 
ATOM   5713 H  HD13 . ILE B 1 69  ? -10.296 -31.848 -40.128 1.00 68.29  ? 430 ILE B HD13 1 
ATOM   5714 N  N    . LYS B 1 70  ? -5.361  -34.926 -41.509 1.00 60.73  ? 431 LYS B N    1 
ATOM   5715 C  CA   . LYS B 1 70  ? -4.294  -35.215 -42.453 1.00 78.38  ? 431 LYS B CA   1 
ATOM   5716 C  C    . LYS B 1 70  ? -4.614  -34.761 -43.874 1.00 74.14  ? 431 LYS B C    1 
ATOM   5717 O  O    . LYS B 1 70  ? -5.743  -34.906 -44.352 1.00 60.66  ? 431 LYS B O    1 
ATOM   5718 C  CB   . LYS B 1 70  ? -3.980  -36.712 -42.433 1.00 84.45  ? 431 LYS B CB   1 
ATOM   5719 C  CG   . LYS B 1 70  ? -3.237  -37.137 -41.173 1.00 98.56  ? 431 LYS B CG   1 
ATOM   5720 C  CD   . LYS B 1 70  ? -3.000  -38.635 -41.120 1.00 113.55 ? 431 LYS B CD   1 
ATOM   5721 C  CE   . LYS B 1 70  ? -2.225  -39.019 -39.867 1.00 113.29 ? 431 LYS B CE   1 
ATOM   5722 N  NZ   . LYS B 1 70  ? -2.116  -40.494 -39.700 1.00 116.93 ? 431 LYS B NZ   1 
ATOM   5723 H  H    . LYS B 1 70  ? -5.856  -35.601 -41.316 1.00 72.88  ? 431 LYS B H    1 
ATOM   5724 H  HA   . LYS B 1 70  ? -3.495  -34.745 -42.170 1.00 94.06  ? 431 LYS B HA   1 
ATOM   5725 H  HB2  . LYS B 1 70  ? -4.812  -37.210 -42.473 1.00 101.34 ? 431 LYS B HB2  1 
ATOM   5726 H  HB3  . LYS B 1 70  ? -3.425  -36.930 -43.198 1.00 101.34 ? 431 LYS B HB3  1 
ATOM   5727 H  HG2  . LYS B 1 70  ? -2.374  -36.695 -41.150 1.00 118.27 ? 431 LYS B HG2  1 
ATOM   5728 H  HG3  . LYS B 1 70  ? -3.760  -36.887 -40.396 1.00 118.27 ? 431 LYS B HG3  1 
ATOM   5729 H  HD2  . LYS B 1 70  ? -3.853  -39.095 -41.105 1.00 136.25 ? 431 LYS B HD2  1 
ATOM   5730 H  HD3  . LYS B 1 70  ? -2.483  -38.907 -41.894 1.00 136.25 ? 431 LYS B HD3  1 
ATOM   5731 H  HE2  . LYS B 1 70  ? -1.328  -38.655 -39.924 1.00 135.95 ? 431 LYS B HE2  1 
ATOM   5732 H  HE3  . LYS B 1 70  ? -2.681  -38.661 -39.089 1.00 135.95 ? 431 LYS B HE3  1 
ATOM   5733 H  HZ1  . LYS B 1 70  ? -1.659  -40.683 -38.961 1.00 140.31 ? 431 LYS B HZ1  1 
ATOM   5734 H  HZ2  . LYS B 1 70  ? -2.928  -40.854 -39.639 1.00 140.31 ? 431 LYS B HZ2  1 
ATOM   5735 H  HZ3  . LYS B 1 70  ? -1.694  -40.848 -40.400 1.00 140.31 ? 431 LYS B HZ3  1 
ATOM   5736 N  N    . GLU B 1 71  ? -3.598  -34.186 -44.515 1.00 71.95  ? 432 GLU B N    1 
ATOM   5737 C  CA   . GLU B 1 71  ? -3.615  -33.842 -45.939 1.00 76.63  ? 432 GLU B CA   1 
ATOM   5738 C  C    . GLU B 1 71  ? -4.909  -33.182 -46.377 1.00 73.53  ? 432 GLU B C    1 
ATOM   5739 O  O    . GLU B 1 71  ? -5.684  -33.739 -47.158 1.00 73.27  ? 432 GLU B O    1 
ATOM   5740 C  CB   . GLU B 1 71  ? -3.352  -35.090 -46.777 1.00 65.89  ? 432 GLU B CB   1 
ATOM   5741 C  CG   . GLU B 1 71  ? -1.945  -35.625 -46.592 1.00 84.22  ? 432 GLU B CG   1 
ATOM   5742 C  CD   . GLU B 1 71  ? -1.657  -36.828 -47.458 1.00 100.79 ? 432 GLU B CD   1 
ATOM   5743 O  OE1  . GLU B 1 71  ? -2.538  -37.214 -48.255 1.00 106.21 ? 432 GLU B OE1  1 
ATOM   5744 O  OE2  . GLU B 1 71  ? -0.546  -37.387 -47.340 1.00 118.38 ? 432 GLU B OE2  1 
ATOM   5745 H  H    . GLU B 1 71  ? -2.858  -33.977 -44.131 1.00 86.35  ? 432 GLU B H    1 
ATOM   5746 H  HA   . GLU B 1 71  ? -2.895  -33.216 -46.113 1.00 91.96  ? 432 GLU B HA   1 
ATOM   5747 H  HB2  . GLU B 1 71  ? -3.975  -35.786 -46.515 1.00 79.07  ? 432 GLU B HB2  1 
ATOM   5748 H  HB3  . GLU B 1 71  ? -3.471  -34.874 -47.715 1.00 79.07  ? 432 GLU B HB3  1 
ATOM   5749 H  HG2  . GLU B 1 71  ? -1.310  -34.929 -46.823 1.00 101.07 ? 432 GLU B HG2  1 
ATOM   5750 H  HG3  . GLU B 1 71  ? -1.827  -35.887 -45.665 1.00 101.07 ? 432 GLU B HG3  1 
ATOM   5751 N  N    . ASN B 1 72  ? -5.119  -31.975 -45.872 1.00 66.45  ? 433 ASN B N    1 
ATOM   5752 C  CA   . ASN B 1 72  ? -6.348  -31.252 -46.111 1.00 59.77  ? 433 ASN B CA   1 
ATOM   5753 C  C    . ASN B 1 72  ? -6.149  -29.776 -45.815 1.00 67.20  ? 433 ASN B C    1 
ATOM   5754 O  O    . ASN B 1 72  ? -5.909  -29.402 -44.671 1.00 54.98  ? 433 ASN B O    1 
ATOM   5755 C  CB   . ASN B 1 72  ? -7.469  -31.825 -45.246 1.00 58.58  ? 433 ASN B CB   1 
ATOM   5756 C  CG   . ASN B 1 72  ? -8.838  -31.377 -45.699 1.00 71.24  ? 433 ASN B CG   1 
ATOM   5757 O  OD1  . ASN B 1 72  ? -8.968  -30.405 -46.443 1.00 66.74  ? 433 ASN B OD1  1 
ATOM   5758 N  ND2  . ASN B 1 72  ? -9.871  -32.082 -45.252 1.00 83.34  ? 433 ASN B ND2  1 
ATOM   5759 H  H    . ASN B 1 72  ? -4.554  -31.551 -45.381 1.00 79.75  ? 433 ASN B H    1 
ATOM   5760 H  HA   . ASN B 1 72  ? -6.601  -31.346 -47.043 1.00 71.73  ? 433 ASN B HA   1 
ATOM   5761 H  HB2  . ASN B 1 72  ? -7.440  -32.794 -45.291 1.00 70.30  ? 433 ASN B HB2  1 
ATOM   5762 H  HB3  . ASN B 1 72  ? -7.344  -31.531 -44.330 1.00 70.30  ? 433 ASN B HB3  1 
ATOM   5763 H  HD21 . ASN B 1 72  ? -10.671 -31.866 -45.482 1.00 100.00 ? 433 ASN B HD21 1 
ATOM   5764 H  HD22 . ASN B 1 72  ? -9.740  -32.755 -44.733 1.00 100.00 ? 433 ASN B HD22 1 
ATOM   5765 N  N    . LEU B 1 73  ? -6.249  -28.942 -46.843 1.00 59.10  ? 434 LEU B N    1 
ATOM   5766 C  CA   . LEU B 1 73  ? -6.050  -27.504 -46.684 1.00 64.38  ? 434 LEU B CA   1 
ATOM   5767 C  C    . LEU B 1 73  ? -7.338  -26.792 -46.281 1.00 58.00  ? 434 LEU B C    1 
ATOM   5768 O  O    . LEU B 1 73  ? -7.349  -25.577 -46.084 1.00 62.95  ? 434 LEU B O    1 
ATOM   5769 C  CB   . LEU B 1 73  ? -5.501  -26.905 -47.981 1.00 67.70  ? 434 LEU B CB   1 
ATOM   5770 C  CG   . LEU B 1 73  ? -4.169  -27.493 -48.456 1.00 67.97  ? 434 LEU B CG   1 
ATOM   5771 C  CD1  . LEU B 1 73  ? -3.688  -26.809 -49.736 1.00 73.81  ? 434 LEU B CD1  1 
ATOM   5772 C  CD2  . LEU B 1 73  ? -3.108  -27.392 -47.370 1.00 70.03  ? 434 LEU B CD2  1 
ATOM   5773 H  H    . LEU B 1 73  ? -6.433  -29.184 -47.647 1.00 70.92  ? 434 LEU B H    1 
ATOM   5774 H  HA   . LEU B 1 73  ? -5.394  -27.354 -45.985 1.00 77.25  ? 434 LEU B HA   1 
ATOM   5775 H  HB2  . LEU B 1 73  ? -6.151  -27.048 -48.686 1.00 81.24  ? 434 LEU B HB2  1 
ATOM   5776 H  HB3  . LEU B 1 73  ? -5.370  -25.953 -47.849 1.00 81.24  ? 434 LEU B HB3  1 
ATOM   5777 H  HG   . LEU B 1 73  ? -4.298  -28.433 -48.655 1.00 81.57  ? 434 LEU B HG   1 
ATOM   5778 H  HD11 . LEU B 1 73  ? -2.845  -27.205 -50.007 1.00 88.57  ? 434 LEU B HD11 1 
ATOM   5779 H  HD12 . LEU B 1 73  ? -4.353  -26.937 -50.430 1.00 88.57  ? 434 LEU B HD12 1 
ATOM   5780 H  HD13 . LEU B 1 73  ? -3.569  -25.862 -49.562 1.00 88.57  ? 434 LEU B HD13 1 
ATOM   5781 H  HD21 . LEU B 1 73  ? -2.279  -27.773 -47.703 1.00 84.03  ? 434 LEU B HD21 1 
ATOM   5782 H  HD22 . LEU B 1 73  ? -2.976  -26.459 -47.144 1.00 84.03  ? 434 LEU B HD22 1 
ATOM   5783 H  HD23 . LEU B 1 73  ? -3.407  -27.884 -46.590 1.00 84.03  ? 434 LEU B HD23 1 
ATOM   5784 N  N    . SER B 1 74  ? -8.421  -27.556 -46.175 1.00 65.06  ? 435 SER B N    1 
ATOM   5785 C  CA   . SER B 1 74  ? -9.695  -27.048 -45.677 1.00 68.10  ? 435 SER B CA   1 
ATOM   5786 C  C    . SER B 1 74  ? -10.191 -27.972 -44.575 1.00 71.45  ? 435 SER B C    1 
ATOM   5787 O  O    . SER B 1 74  ? -11.270 -28.554 -44.676 1.00 72.01  ? 435 SER B O    1 
ATOM   5788 C  CB   . SER B 1 74  ? -10.727 -26.947 -46.803 1.00 76.69  ? 435 SER B CB   1 
ATOM   5789 O  OG   . SER B 1 74  ? -10.340 -25.978 -47.760 1.00 86.90  ? 435 SER B OG   1 
ATOM   5790 H  H    . SER B 1 74  ? -8.443  -28.389 -46.389 1.00 78.07  ? 435 SER B H    1 
ATOM   5791 H  HA   . SER B 1 74  ? -9.565  -26.164 -45.301 1.00 81.72  ? 435 SER B HA   1 
ATOM   5792 H  HB2  . SER B 1 74  ? -10.802 -27.810 -47.241 1.00 92.03  ? 435 SER B HB2  1 
ATOM   5793 H  HB3  . SER B 1 74  ? -11.583 -26.692 -46.425 1.00 92.03  ? 435 SER B HB3  1 
ATOM   5794 H  HG   . SER B 1 74  ? -10.914 -25.933 -48.371 1.00 104.28 ? 435 SER B HG   1 
ATOM   5795 N  N    . PRO B 1 75  ? -9.394  -28.109 -43.511 1.00 63.83  ? 436 PRO B N    1 
ATOM   5796 C  CA   . PRO B 1 75  ? -9.706  -29.078 -42.461 1.00 57.82  ? 436 PRO B CA   1 
ATOM   5797 C  C    . PRO B 1 75  ? -10.974 -28.706 -41.709 1.00 62.74  ? 436 PRO B C    1 
ATOM   5798 O  O    . PRO B 1 75  ? -11.268 -27.521 -41.541 1.00 50.52  ? 436 PRO B O    1 
ATOM   5799 C  CB   . PRO B 1 75  ? -8.477  -29.009 -41.551 1.00 63.00  ? 436 PRO B CB   1 
ATOM   5800 C  CG   . PRO B 1 75  ? -7.984  -27.620 -41.710 1.00 67.12  ? 436 PRO B CG   1 
ATOM   5801 C  CD   . PRO B 1 75  ? -8.253  -27.252 -43.146 1.00 61.88  ? 436 PRO B CD   1 
ATOM   5802 H  HA   . PRO B 1 75  ? -9.792  -29.971 -42.830 1.00 69.38  ? 436 PRO B HA   1 
ATOM   5803 H  HB2  . PRO B 1 75  ? -8.736  -29.181 -40.633 1.00 75.60  ? 436 PRO B HB2  1 
ATOM   5804 H  HB3  . PRO B 1 75  ? -7.810  -29.648 -41.849 1.00 75.60  ? 436 PRO B HB3  1 
ATOM   5805 H  HG2  . PRO B 1 75  ? -8.471  -27.033 -41.110 1.00 80.55  ? 436 PRO B HG2  1 
ATOM   5806 H  HG3  . PRO B 1 75  ? -7.033  -27.589 -41.521 1.00 80.55  ? 436 PRO B HG3  1 
ATOM   5807 H  HD2  . PRO B 1 75  ? -8.497  -26.316 -43.215 1.00 74.26  ? 436 PRO B HD2  1 
ATOM   5808 H  HD3  . PRO B 1 75  ? -7.483  -27.461 -43.698 1.00 74.26  ? 436 PRO B HD3  1 
ATOM   5809 N  N    . LYS B 1 76  ? -11.714 -29.716 -41.267 1.00 56.09  ? 437 LYS B N    1 
ATOM   5810 C  CA   . LYS B 1 76  ? -12.916 -29.498 -40.477 1.00 57.47  ? 437 LYS B CA   1 
ATOM   5811 C  C    . LYS B 1 76  ? -12.820 -30.258 -39.141 1.00 59.05  ? 437 LYS B C    1 
ATOM   5812 O  O    . LYS B 1 76  ? -13.062 -31.463 -39.072 1.00 69.22  ? 437 LYS B O    1 
ATOM   5813 C  CB   . LYS B 1 76  ? -14.139 -29.910 -41.298 1.00 54.49  ? 437 LYS B CB   1 
ATOM   5814 C  CG   . LYS B 1 76  ? -14.224 -29.125 -42.617 1.00 61.19  ? 437 LYS B CG   1 
ATOM   5815 C  CD   . LYS B 1 76  ? -15.336 -29.589 -43.532 1.00 82.20  ? 437 LYS B CD   1 
ATOM   5816 C  CE   . LYS B 1 76  ? -15.337 -28.786 -44.832 1.00 85.53  ? 437 LYS B CE   1 
ATOM   5817 N  NZ   . LYS B 1 76  ? -14.029 -28.833 -45.555 1.00 81.54  ? 437 LYS B NZ   1 
ATOM   5818 H  H    . LYS B 1 76  ? -11.538 -30.544 -41.414 1.00 67.31  ? 437 LYS B H    1 
ATOM   5819 H  HA   . LYS B 1 76  ? -12.995 -28.552 -40.277 1.00 68.97  ? 437 LYS B HA   1 
ATOM   5820 H  HB2  . LYS B 1 76  ? -14.079 -30.855 -41.510 1.00 65.39  ? 437 LYS B HB2  1 
ATOM   5821 H  HB3  . LYS B 1 76  ? -14.943 -29.731 -40.786 1.00 65.39  ? 437 LYS B HB3  1 
ATOM   5822 H  HG2  . LYS B 1 76  ? -14.378 -28.189 -42.414 1.00 73.43  ? 437 LYS B HG2  1 
ATOM   5823 H  HG3  . LYS B 1 76  ? -13.386 -29.225 -43.095 1.00 73.43  ? 437 LYS B HG3  1 
ATOM   5824 H  HD2  . LYS B 1 76  ? -15.205 -30.525 -43.750 1.00 98.64  ? 437 LYS B HD2  1 
ATOM   5825 H  HD3  . LYS B 1 76  ? -16.191 -29.460 -43.092 1.00 98.64  ? 437 LYS B HD3  1 
ATOM   5826 H  HE2  . LYS B 1 76  ? -16.018 -29.146 -45.423 1.00 102.63 ? 437 LYS B HE2  1 
ATOM   5827 H  HE3  . LYS B 1 76  ? -15.533 -27.858 -44.629 1.00 102.63 ? 437 LYS B HE3  1 
ATOM   5828 H  HZ1  . LYS B 1 76  ? -14.077 -28.353 -46.303 1.00 97.85  ? 437 LYS B HZ1  1 
ATOM   5829 H  HZ2  . LYS B 1 76  ? -13.385 -28.500 -45.039 1.00 97.85  ? 437 LYS B HZ2  1 
ATOM   5830 H  HZ3  . LYS B 1 76  ? -13.827 -29.674 -45.763 1.00 97.85  ? 437 LYS B HZ3  1 
ATOM   5831 N  N    . TRP B 1 77  ? -12.439 -29.537 -38.089 1.00 63.12  ? 438 TRP B N    1 
ATOM   5832 C  CA   . TRP B 1 77  ? -12.229 -30.126 -36.764 1.00 56.43  ? 438 TRP B CA   1 
ATOM   5833 C  C    . TRP B 1 77  ? -13.532 -30.317 -35.984 1.00 48.66  ? 438 TRP B C    1 
ATOM   5834 O  O    . TRP B 1 77  ? -13.744 -31.353 -35.354 1.00 58.02  ? 438 TRP B O    1 
ATOM   5835 C  CB   . TRP B 1 77  ? -11.294 -29.253 -35.934 1.00 50.40  ? 438 TRP B CB   1 
ATOM   5836 C  CG   . TRP B 1 77  ? -9.908  -29.061 -36.482 1.00 50.76  ? 438 TRP B CG   1 
ATOM   5837 C  CD1  . TRP B 1 77  ? -8.862  -29.928 -36.392 1.00 42.68  ? 438 TRP B CD1  1 
ATOM   5838 C  CD2  . TRP B 1 77  ? -9.409  -27.902 -37.163 1.00 39.66  ? 438 TRP B CD2  1 
ATOM   5839 N  NE1  . TRP B 1 77  ? -7.746  -29.387 -36.985 1.00 41.01  ? 438 TRP B NE1  1 
ATOM   5840 C  CE2  . TRP B 1 77  ? -8.058  -28.144 -37.466 1.00 41.19  ? 438 TRP B CE2  1 
ATOM   5841 C  CE3  . TRP B 1 77  ? -9.977  -26.683 -37.543 1.00 52.61  ? 438 TRP B CE3  1 
ATOM   5842 C  CZ2  . TRP B 1 77  ? -7.269  -27.218 -38.138 1.00 43.79  ? 438 TRP B CZ2  1 
ATOM   5843 C  CZ3  . TRP B 1 77  ? -9.190  -25.766 -38.207 1.00 41.37  ? 438 TRP B CZ3  1 
ATOM   5844 C  CH2  . TRP B 1 77  ? -7.851  -26.037 -38.496 1.00 41.05  ? 438 TRP B CH2  1 
ATOM   5845 H  H    . TRP B 1 77  ? -12.293 -28.690 -38.116 1.00 75.74  ? 438 TRP B H    1 
ATOM   5846 H  HA   . TRP B 1 77  ? -11.813 -30.996 -36.868 1.00 67.71  ? 438 TRP B HA   1 
ATOM   5847 H  HB2  . TRP B 1 77  ? -11.695 -28.374 -35.847 1.00 60.48  ? 438 TRP B HB2  1 
ATOM   5848 H  HB3  . TRP B 1 77  ? -11.204 -29.654 -35.055 1.00 60.48  ? 438 TRP B HB3  1 
ATOM   5849 H  HD1  . TRP B 1 77  ? -8.898  -30.767 -35.991 1.00 51.21  ? 438 TRP B HD1  1 
ATOM   5850 H  HE1  . TRP B 1 77  ? -6.979  -29.770 -37.049 1.00 49.21  ? 438 TRP B HE1  1 
ATOM   5851 H  HE3  . TRP B 1 77  ? -10.867 -26.494 -37.352 1.00 63.13  ? 438 TRP B HE3  1 
ATOM   5852 H  HZ2  . TRP B 1 77  ? -6.377  -27.395 -38.333 1.00 52.55  ? 438 TRP B HZ2  1 
ATOM   5853 H  HZ3  . TRP B 1 77  ? -9.558  -24.953 -38.469 1.00 49.65  ? 438 TRP B HZ3  1 
ATOM   5854 H  HH2  . TRP B 1 77  ? -7.347  -25.401 -38.950 1.00 49.26  ? 438 TRP B HH2  1 
ATOM   5855 N  N    . ASN B 1 78  ? -14.386 -29.300 -36.019 1.00 43.27  ? 439 ASN B N    1 
ATOM   5856 C  CA   . ASN B 1 78  ? -15.648 -29.306 -35.286 1.00 45.02  ? 439 ASN B CA   1 
ATOM   5857 C  C    . ASN B 1 78  ? -15.447 -29.641 -33.809 1.00 54.86  ? 439 ASN B C    1 
ATOM   5858 O  O    . ASN B 1 78  ? -16.161 -30.474 -33.253 1.00 48.42  ? 439 ASN B O    1 
ATOM   5859 C  CB   . ASN B 1 78  ? -16.634 -30.294 -35.909 1.00 47.03  ? 439 ASN B CB   1 
ATOM   5860 C  CG   . ASN B 1 78  ? -16.990 -29.939 -37.340 1.00 66.62  ? 439 ASN B CG   1 
ATOM   5861 O  OD1  . ASN B 1 78  ? -17.620 -28.913 -37.598 1.00 63.79  ? 439 ASN B OD1  1 
ATOM   5862 N  ND2  . ASN B 1 78  ? -16.594 -30.790 -38.278 1.00 74.72  ? 439 ASN B ND2  1 
ATOM   5863 H  H    . ASN B 1 78  ? -14.254 -28.579 -36.470 1.00 51.93  ? 439 ASN B H    1 
ATOM   5864 H  HA   . ASN B 1 78  ? -16.043 -28.421 -35.338 1.00 54.03  ? 439 ASN B HA   1 
ATOM   5865 H  HB2  . ASN B 1 78  ? -16.237 -31.180 -35.910 1.00 56.44  ? 439 ASN B HB2  1 
ATOM   5866 H  HB3  . ASN B 1 78  ? -17.452 -30.297 -35.388 1.00 56.44  ? 439 ASN B HB3  1 
ATOM   5867 H  HD21 . ASN B 1 78  ? -16.772 -30.633 -39.104 1.00 89.66  ? 439 ASN B HD21 1 
ATOM   5868 H  HD22 . ASN B 1 78  ? -16.161 -31.500 -38.059 1.00 89.66  ? 439 ASN B HD22 1 
ATOM   5869 N  N    . GLU B 1 79  ? -14.469 -28.990 -33.187 1.00 43.76  ? 440 GLU B N    1 
ATOM   5870 C  CA   . GLU B 1 79  ? -14.199 -29.179 -31.762 1.00 37.37  ? 440 GLU B CA   1 
ATOM   5871 C  C    . GLU B 1 79  ? -14.662 -27.976 -30.971 1.00 44.40  ? 440 GLU B C    1 
ATOM   5872 O  O    . GLU B 1 79  ? -14.863 -26.895 -31.520 1.00 43.01  ? 440 GLU B O    1 
ATOM   5873 C  CB   . GLU B 1 79  ? -12.711 -29.424 -31.519 1.00 40.91  ? 440 GLU B CB   1 
ATOM   5874 C  CG   . GLU B 1 79  ? -12.262 -30.814 -31.918 1.00 44.17  ? 440 GLU B CG   1 
ATOM   5875 C  CD   . GLU B 1 79  ? -10.766 -30.983 -31.838 1.00 42.94  ? 440 GLU B CD   1 
ATOM   5876 O  OE1  . GLU B 1 79  ? -10.194 -30.719 -30.761 1.00 50.45  ? 440 GLU B OE1  1 
ATOM   5877 O  OE2  . GLU B 1 79  ? -10.155 -31.360 -32.860 1.00 51.48  ? 440 GLU B OE2  1 
ATOM   5878 H  H    . GLU B 1 79  ? -13.942 -28.429 -33.569 1.00 52.52  ? 440 GLU B H    1 
ATOM   5879 H  HA   . GLU B 1 79  ? -14.689 -29.955 -31.446 1.00 44.84  ? 440 GLU B HA   1 
ATOM   5880 H  HB2  . GLU B 1 79  ? -12.198 -28.784 -32.037 1.00 49.09  ? 440 GLU B HB2  1 
ATOM   5881 H  HB3  . GLU B 1 79  ? -12.524 -29.309 -30.574 1.00 49.09  ? 440 GLU B HB3  1 
ATOM   5882 H  HG2  . GLU B 1 79  ? -12.670 -31.462 -31.322 1.00 53.01  ? 440 GLU B HG2  1 
ATOM   5883 H  HG3  . GLU B 1 79  ? -12.536 -30.985 -32.833 1.00 53.01  ? 440 GLU B HG3  1 
ATOM   5884 N  N    . VAL B 1 80  ? -14.831 -28.163 -29.672 1.00 44.98  ? 441 VAL B N    1 
ATOM   5885 C  CA   . VAL B 1 80  ? -15.278 -27.076 -28.827 1.00 38.43  ? 441 VAL B CA   1 
ATOM   5886 C  C    . VAL B 1 80  ? -14.540 -27.122 -27.495 1.00 40.52  ? 441 VAL B C    1 
ATOM   5887 O  O    . VAL B 1 80  ? -14.340 -28.190 -26.915 1.00 39.77  ? 441 VAL B O    1 
ATOM   5888 C  CB   . VAL B 1 80  ? -16.812 -27.131 -28.633 1.00 50.30  ? 441 VAL B CB   1 
ATOM   5889 C  CG1  . VAL B 1 80  ? -17.246 -28.496 -28.137 1.00 52.58  ? 441 VAL B CG1  1 
ATOM   5890 C  CG2  . VAL B 1 80  ? -17.284 -26.030 -27.711 1.00 42.61  ? 441 VAL B CG2  1 
ATOM   5891 H  H    . VAL B 1 80  ? -14.694 -28.905 -29.259 1.00 53.98  ? 441 VAL B H    1 
ATOM   5892 H  HA   . VAL B 1 80  ? -15.062 -26.234 -29.258 1.00 46.11  ? 441 VAL B HA   1 
ATOM   5893 H  HB   . VAL B 1 80  ? -17.235 -26.988 -29.495 1.00 60.36  ? 441 VAL B HB   1 
ATOM   5894 H  HG11 . VAL B 1 80  ? -18.210 -28.500 -28.025 1.00 63.09  ? 441 VAL B HG11 1 
ATOM   5895 H  HG12 . VAL B 1 80  ? -16.986 -29.166 -28.788 1.00 63.09  ? 441 VAL B HG12 1 
ATOM   5896 H  HG13 . VAL B 1 80  ? -16.814 -28.675 -27.287 1.00 63.09  ? 441 VAL B HG13 1 
ATOM   5897 H  HG21 . VAL B 1 80  ? -18.247 -26.093 -27.611 1.00 51.13  ? 441 VAL B HG21 1 
ATOM   5898 H  HG22 . VAL B 1 80  ? -16.854 -26.136 -26.848 1.00 51.13  ? 441 VAL B HG22 1 
ATOM   5899 H  HG23 . VAL B 1 80  ? -17.046 -25.172 -28.096 1.00 51.13  ? 441 VAL B HG23 1 
ATOM   5900 N  N    . TYR B 1 81  ? -14.105 -25.950 -27.045 1.00 42.40  ? 442 TYR B N    1 
ATOM   5901 C  CA   . TYR B 1 81  ? -13.385 -25.821 -25.790 1.00 37.06  ? 442 TYR B CA   1 
ATOM   5902 C  C    . TYR B 1 81  ? -14.079 -24.796 -24.898 1.00 41.66  ? 442 TYR B C    1 
ATOM   5903 O  O    . TYR B 1 81  ? -14.877 -23.983 -25.370 1.00 38.75  ? 442 TYR B O    1 
ATOM   5904 C  CB   . TYR B 1 81  ? -11.925 -25.425 -26.047 1.00 36.49  ? 442 TYR B CB   1 
ATOM   5905 C  CG   . TYR B 1 81  ? -11.290 -26.207 -27.169 1.00 44.25  ? 442 TYR B CG   1 
ATOM   5906 C  CD1  . TYR B 1 81  ? -10.775 -27.484 -26.956 1.00 40.19  ? 442 TYR B CD1  1 
ATOM   5907 C  CD2  . TYR B 1 81  ? -11.214 -25.675 -28.447 1.00 46.80  ? 442 TYR B CD2  1 
ATOM   5908 C  CE1  . TYR B 1 81  ? -10.205 -28.207 -27.994 1.00 40.95  ? 442 TYR B CE1  1 
ATOM   5909 C  CE2  . TYR B 1 81  ? -10.649 -26.382 -29.480 1.00 47.47  ? 442 TYR B CE2  1 
ATOM   5910 C  CZ   . TYR B 1 81  ? -10.142 -27.644 -29.254 1.00 41.16  ? 442 TYR B CZ   1 
ATOM   5911 O  OH   . TYR B 1 81  ? -9.582  -28.331 -30.303 1.00 50.83  ? 442 TYR B OH   1 
ATOM   5912 H  H    . TYR B 1 81  ? -14.218 -25.204 -27.457 1.00 50.89  ? 442 TYR B H    1 
ATOM   5913 H  HA   . TYR B 1 81  ? -13.390 -26.675 -25.330 1.00 44.47  ? 442 TYR B HA   1 
ATOM   5914 H  HB2  . TYR B 1 81  ? -11.891 -24.484 -26.282 1.00 43.78  ? 442 TYR B HB2  1 
ATOM   5915 H  HB3  . TYR B 1 81  ? -11.409 -25.584 -25.242 1.00 43.78  ? 442 TYR B HB3  1 
ATOM   5916 H  HD1  . TYR B 1 81  ? -10.820 -27.861 -26.107 1.00 48.23  ? 442 TYR B HD1  1 
ATOM   5917 H  HD2  . TYR B 1 81  ? -11.555 -24.825 -28.608 1.00 56.16  ? 442 TYR B HD2  1 
ATOM   5918 H  HE1  . TYR B 1 81  ? -9.862  -29.058 -27.842 1.00 49.14  ? 442 TYR B HE1  1 
ATOM   5919 H  HE2  . TYR B 1 81  ? -10.605 -26.008 -30.331 1.00 56.96  ? 442 TYR B HE2  1 
ATOM   5920 H  HH   . TYR B 1 81  ? -9.314  -29.084 -30.043 1.00 61.00  ? 442 TYR B HH   1 
ATOM   5921 N  N    . GLU B 1 82  ? -13.778 -24.859 -23.605 1.00 37.87  ? 443 GLU B N    1 
ATOM   5922 C  CA   . GLU B 1 82  ? -14.340 -23.944 -22.618 1.00 41.95  ? 443 GLU B CA   1 
ATOM   5923 C  C    . GLU B 1 82  ? -13.222 -23.363 -21.763 1.00 36.39  ? 443 GLU B C    1 
ATOM   5924 O  O    . GLU B 1 82  ? -12.437 -24.106 -21.185 1.00 36.66  ? 443 GLU B O    1 
ATOM   5925 C  CB   . GLU B 1 82  ? -15.363 -24.664 -21.737 1.00 43.80  ? 443 GLU B CB   1 
ATOM   5926 C  CG   . GLU B 1 82  ? -16.598 -25.143 -22.490 1.00 48.82  ? 443 GLU B CG   1 
ATOM   5927 C  CD   . GLU B 1 82  ? -17.641 -25.771 -21.582 1.00 56.30  ? 443 GLU B CD   1 
ATOM   5928 O  OE1  . GLU B 1 82  ? -17.253 -26.506 -20.649 1.00 53.59  ? 443 GLU B OE1  1 
ATOM   5929 O  OE2  . GLU B 1 82  ? -18.851 -25.529 -21.803 1.00 55.50  ? 443 GLU B OE2  1 
ATOM   5930 H  H    . GLU B 1 82  ? -13.237 -25.437 -23.268 1.00 45.44  ? 443 GLU B H    1 
ATOM   5931 H  HA   . GLU B 1 82  ? -14.788 -23.214 -23.073 1.00 50.34  ? 443 GLU B HA   1 
ATOM   5932 H  HB2  . GLU B 1 82  ? -14.940 -25.441 -21.338 1.00 52.57  ? 443 GLU B HB2  1 
ATOM   5933 H  HB3  . GLU B 1 82  ? -15.657 -24.057 -21.040 1.00 52.57  ? 443 GLU B HB3  1 
ATOM   5934 H  HG2  . GLU B 1 82  ? -17.008 -24.386 -22.937 1.00 58.58  ? 443 GLU B HG2  1 
ATOM   5935 H  HG3  . GLU B 1 82  ? -16.331 -25.808 -23.143 1.00 58.58  ? 443 GLU B HG3  1 
ATOM   5936 N  N    . ALA B 1 83  ? -13.156 -22.037 -21.697 1.00 40.07  ? 444 ALA B N    1 
ATOM   5937 C  CA   . ALA B 1 83  ? -12.121 -21.341 -20.944 1.00 37.28  ? 444 ALA B CA   1 
ATOM   5938 C  C    . ALA B 1 83  ? -12.718 -20.388 -19.913 1.00 37.39  ? 444 ALA B C    1 
ATOM   5939 O  O    . ALA B 1 83  ? -13.697 -19.693 -20.189 1.00 41.95  ? 444 ALA B O    1 
ATOM   5940 C  CB   . ALA B 1 83  ? -11.223 -20.578 -21.882 1.00 35.43  ? 444 ALA B CB   1 
ATOM   5941 H  H    . ALA B 1 83  ? -13.712 -21.509 -22.088 1.00 48.08  ? 444 ALA B H    1 
ATOM   5942 H  HA   . ALA B 1 83  ? -11.580 -21.993 -20.473 1.00 44.73  ? 444 ALA B HA   1 
ATOM   5943 H  HB1  . ALA B 1 83  ? -10.542 -20.122 -21.364 1.00 42.51  ? 444 ALA B HB1  1 
ATOM   5944 H  HB2  . ALA B 1 83  ? -10.809 -21.202 -22.499 1.00 42.51  ? 444 ALA B HB2  1 
ATOM   5945 H  HB3  . ALA B 1 83  ? -11.755 -19.932 -22.372 1.00 42.51  ? 444 ALA B HB3  1 
ATOM   5946 N  N    . LEU B 1 84  ? -12.118 -20.357 -18.728 1.00 37.83  ? 445 LEU B N    1 
ATOM   5947 C  CA   . LEU B 1 84  ? -12.481 -19.381 -17.710 1.00 38.19  ? 445 LEU B CA   1 
ATOM   5948 C  C    . LEU B 1 84  ? -11.895 -18.029 -18.072 1.00 45.43  ? 445 LEU B C    1 
ATOM   5949 O  O    . LEU B 1 84  ? -10.754 -17.946 -18.510 1.00 39.43  ? 445 LEU B O    1 
ATOM   5950 C  CB   . LEU B 1 84  ? -11.978 -19.807 -16.331 1.00 34.63  ? 445 LEU B CB   1 
ATOM   5951 C  CG   . LEU B 1 84  ? -12.425 -21.175 -15.814 1.00 31.43  ? 445 LEU B CG   1 
ATOM   5952 C  CD1  . LEU B 1 84  ? -11.815 -21.443 -14.430 1.00 45.71  ? 445 LEU B CD1  1 
ATOM   5953 C  CD2  . LEU B 1 84  ? -13.947 -21.276 -15.773 1.00 45.94  ? 445 LEU B CD2  1 
ATOM   5954 H  H    . LEU B 1 84  ? -11.492 -20.896 -18.488 1.00 45.40  ? 445 LEU B H    1 
ATOM   5955 H  HA   . LEU B 1 84  ? -13.447 -19.297 -17.672 1.00 45.83  ? 445 LEU B HA   1 
ATOM   5956 H  HB2  . LEU B 1 84  ? -11.008 -19.814 -16.354 1.00 41.56  ? 445 LEU B HB2  1 
ATOM   5957 H  HB3  . LEU B 1 84  ? -12.276 -19.147 -15.685 1.00 41.56  ? 445 LEU B HB3  1 
ATOM   5958 H  HG   . LEU B 1 84  ? -12.099 -21.859 -16.419 1.00 37.72  ? 445 LEU B HG   1 
ATOM   5959 H  HD11 . LEU B 1 84  ? -12.109 -22.313 -14.119 1.00 54.85  ? 445 LEU B HD11 1 
ATOM   5960 H  HD12 . LEU B 1 84  ? -10.848 -21.427 -14.503 1.00 54.85  ? 445 LEU B HD12 1 
ATOM   5961 H  HD13 . LEU B 1 84  ? -12.112 -20.754 -13.816 1.00 54.85  ? 445 LEU B HD13 1 
ATOM   5962 H  HD21 . LEU B 1 84  ? -14.196 -22.153 -15.441 1.00 55.13  ? 445 LEU B HD21 1 
ATOM   5963 H  HD22 . LEU B 1 84  ? -14.292 -20.588 -15.182 1.00 55.13  ? 445 LEU B HD22 1 
ATOM   5964 H  HD23 . LEU B 1 84  ? -14.295 -21.149 -16.669 1.00 55.13  ? 445 LEU B HD23 1 
ATOM   5965 N  N    . VAL B 1 85  ? -12.682 -16.974 -17.903 1.00 35.58  ? 446 VAL B N    1 
ATOM   5966 C  CA   . VAL B 1 85  ? -12.185 -15.620 -18.089 1.00 49.69  ? 446 VAL B CA   1 
ATOM   5967 C  C    . VAL B 1 85  ? -12.383 -14.812 -16.813 1.00 39.49  ? 446 VAL B C    1 
ATOM   5968 O  O    . VAL B 1 85  ? -13.508 -14.656 -16.331 1.00 45.55  ? 446 VAL B O    1 
ATOM   5969 C  CB   . VAL B 1 85  ? -12.888 -14.909 -19.261 1.00 49.20  ? 446 VAL B CB   1 
ATOM   5970 C  CG1  . VAL B 1 85  ? -12.260 -13.535 -19.508 1.00 47.60  ? 446 VAL B CG1  1 
ATOM   5971 C  CG2  . VAL B 1 85  ? -12.820 -15.771 -20.524 1.00 52.94  ? 446 VAL B CG2  1 
ATOM   5972 H  H    . VAL B 1 85  ? -13.511 -17.017 -17.680 1.00 42.69  ? 446 VAL B H    1 
ATOM   5973 H  HA   . VAL B 1 85  ? -11.235 -15.653 -18.282 1.00 59.63  ? 446 VAL B HA   1 
ATOM   5974 H  HB   . VAL B 1 85  ? -13.822 -14.777 -19.037 1.00 59.04  ? 446 VAL B HB   1 
ATOM   5975 H  HG11 . VAL B 1 85  ? -12.717 -13.108 -20.249 1.00 57.12  ? 446 VAL B HG11 1 
ATOM   5976 H  HG12 . VAL B 1 85  ? -12.353 -12.997 -18.706 1.00 57.12  ? 446 VAL B HG12 1 
ATOM   5977 H  HG13 . VAL B 1 85  ? -11.321 -13.651 -19.722 1.00 57.12  ? 446 VAL B HG13 1 
ATOM   5978 H  HG21 . VAL B 1 85  ? -13.267 -15.306 -21.248 1.00 63.53  ? 446 VAL B HG21 1 
ATOM   5979 H  HG22 . VAL B 1 85  ? -11.889 -15.923 -20.753 1.00 63.53  ? 446 VAL B HG22 1 
ATOM   5980 H  HG23 . VAL B 1 85  ? -13.261 -16.618 -20.352 1.00 63.53  ? 446 VAL B HG23 1 
ATOM   5981 N  N    . TYR B 1 86  ? -11.273 -14.315 -16.274 1.00 46.63  ? 447 TYR B N    1 
ATOM   5982 C  CA   . TYR B 1 86  ? -11.282 -13.426 -15.116 1.00 45.15  ? 447 TYR B CA   1 
ATOM   5983 C  C    . TYR B 1 86  ? -11.107 -11.993 -15.593 1.00 56.35  ? 447 TYR B C    1 
ATOM   5984 O  O    . TYR B 1 86  ? -10.739 -11.763 -16.744 1.00 65.07  ? 447 TYR B O    1 
ATOM   5985 C  CB   . TYR B 1 86  ? -10.172 -13.802 -14.138 1.00 46.23  ? 447 TYR B CB   1 
ATOM   5986 C  CG   . TYR B 1 86  ? -10.365 -15.157 -13.499 1.00 43.19  ? 447 TYR B CG   1 
ATOM   5987 C  CD1  . TYR B 1 86  ? -11.002 -15.278 -12.271 1.00 41.51  ? 447 TYR B CD1  1 
ATOM   5988 C  CD2  . TYR B 1 86  ? -9.920  -16.314 -14.121 1.00 50.74  ? 447 TYR B CD2  1 
ATOM   5989 C  CE1  . TYR B 1 86  ? -11.186 -16.510 -11.680 1.00 40.17  ? 447 TYR B CE1  1 
ATOM   5990 C  CE2  . TYR B 1 86  ? -10.100 -17.556 -13.534 1.00 42.09  ? 447 TYR B CE2  1 
ATOM   5991 C  CZ   . TYR B 1 86  ? -10.737 -17.645 -12.313 1.00 37.85  ? 447 TYR B CZ   1 
ATOM   5992 O  OH   . TYR B 1 86  ? -10.925 -18.872 -11.715 1.00 53.40  ? 447 TYR B OH   1 
ATOM   5993 H  H    . TYR B 1 86  ? -10.483 -14.483 -16.570 1.00 55.96  ? 447 TYR B H    1 
ATOM   5994 H  HA   . TYR B 1 86  ? -12.135 -13.498 -14.659 1.00 54.18  ? 447 TYR B HA   1 
ATOM   5995 H  HB2  . TYR B 1 86  ? -9.326  -13.816 -14.614 1.00 55.48  ? 447 TYR B HB2  1 
ATOM   5996 H  HB3  . TYR B 1 86  ? -10.141 -13.141 -13.429 1.00 55.48  ? 447 TYR B HB3  1 
ATOM   5997 H  HD1  . TYR B 1 86  ? -11.309 -14.513 -11.839 1.00 49.81  ? 447 TYR B HD1  1 
ATOM   5998 H  HD2  . TYR B 1 86  ? -9.492  -16.255 -14.944 1.00 60.88  ? 447 TYR B HD2  1 
ATOM   5999 H  HE1  . TYR B 1 86  ? -11.614 -16.573 -10.857 1.00 48.20  ? 447 TYR B HE1  1 
ATOM   6000 H  HE2  . TYR B 1 86  ? -9.796  -18.324 -13.962 1.00 50.51  ? 447 TYR B HE2  1 
ATOM   6001 H  HH   . TYR B 1 86  ? -10.608 -19.479 -12.200 1.00 64.08  ? 447 TYR B HH   1 
ATOM   6002 N  N    . GLU B 1 87  ? -11.375 -11.029 -14.721 1.00 52.76  ? 448 GLU B N    1 
ATOM   6003 C  CA   . GLU B 1 87  ? -11.205 -9.629  -15.088 1.00 60.55  ? 448 GLU B CA   1 
ATOM   6004 C  C    . GLU B 1 87  ? -9.725  -9.333  -15.271 1.00 78.76  ? 448 GLU B C    1 
ATOM   6005 O  O    . GLU B 1 87  ? -8.922  -9.500  -14.357 1.00 76.08  ? 448 GLU B O    1 
ATOM   6006 C  CB   . GLU B 1 87  ? -11.816 -8.705  -14.045 1.00 55.45  ? 448 GLU B CB   1 
ATOM   6007 C  CG   . GLU B 1 87  ? -11.801 -7.235  -14.455 1.00 82.53  ? 448 GLU B CG   1 
ATOM   6008 C  CD   . GLU B 1 87  ? -13.166 -6.569  -14.373 1.00 104.74 ? 448 GLU B CD   1 
ATOM   6009 O  OE1  . GLU B 1 87  ? -14.014 -7.016  -13.570 1.00 100.07 ? 448 GLU B OE1  1 
ATOM   6010 O  OE2  . GLU B 1 87  ? -13.391 -5.590  -15.116 1.00 114.51 ? 448 GLU B OE2  1 
ATOM   6011 H  H    . GLU B 1 87  ? -11.654 -11.157 -13.918 1.00 63.31  ? 448 GLU B H    1 
ATOM   6012 H  HA   . GLU B 1 87  ? -11.652 -9.466  -15.934 1.00 72.66  ? 448 GLU B HA   1 
ATOM   6013 H  HB2  . GLU B 1 87  ? -12.739 -8.964  -13.899 1.00 66.54  ? 448 GLU B HB2  1 
ATOM   6014 H  HB3  . GLU B 1 87  ? -11.314 -8.789  -13.220 1.00 66.54  ? 448 GLU B HB3  1 
ATOM   6015 H  HG2  . GLU B 1 87  ? -11.198 -6.752  -13.868 1.00 99.04  ? 448 GLU B HG2  1 
ATOM   6016 H  HG3  . GLU B 1 87  ? -11.492 -7.168  -15.372 1.00 99.04  ? 448 GLU B HG3  1 
ATOM   6017 N  N    . HIS B 1 88  ? -9.381  -8.894  -16.474 1.00 82.90  ? 449 HIS B N    1 
ATOM   6018 C  CA   . HIS B 1 88  ? -7.997  -8.777  -16.893 1.00 77.99  ? 449 HIS B CA   1 
ATOM   6019 C  C    . HIS B 1 88  ? -7.911  -7.678  -17.939 1.00 98.41  ? 449 HIS B C    1 
ATOM   6020 O  O    . HIS B 1 88  ? -8.786  -7.581  -18.798 1.00 81.23  ? 449 HIS B O    1 
ATOM   6021 C  CB   . HIS B 1 88  ? -7.504  -10.106 -17.464 1.00 91.46  ? 449 HIS B CB   1 
ATOM   6022 C  CG   . HIS B 1 88  ? -6.096  -10.446 -17.092 1.00 98.39  ? 449 HIS B CG   1 
ATOM   6023 N  ND1  . HIS B 1 88  ? -5.726  -10.776 -15.806 1.00 124.11 ? 449 HIS B ND1  1 
ATOM   6024 C  CD2  . HIS B 1 88  ? -4.971  -10.525 -17.840 1.00 98.38  ? 449 HIS B CD2  1 
ATOM   6025 C  CE1  . HIS B 1 88  ? -4.431  -11.036 -15.776 1.00 123.11 ? 449 HIS B CE1  1 
ATOM   6026 N  NE2  . HIS B 1 88  ? -3.949  -10.890 -16.998 1.00 116.14 ? 449 HIS B NE2  1 
ATOM   6027 H  H    . HIS B 1 88  ? -9.945  -8.652  -17.076 1.00 99.48  ? 449 HIS B H    1 
ATOM   6028 H  HA   . HIS B 1 88  ? -7.442  -8.535  -16.136 1.00 93.59  ? 449 HIS B HA   1 
ATOM   6029 H  HB2  . HIS B 1 88  ? -8.077  -10.817 -17.137 1.00 109.75 ? 449 HIS B HB2  1 
ATOM   6030 H  HB3  . HIS B 1 88  ? -7.552  -10.066 -18.432 1.00 109.75 ? 449 HIS B HB3  1 
ATOM   6031 H  HD1  . HIS B 1 88  ? -6.254  -10.806 -15.128 1.00 148.93 ? 449 HIS B HD1  1 
ATOM   6032 H  HD2  . HIS B 1 88  ? -4.902  -10.359 -18.752 1.00 118.05 ? 449 HIS B HD2  1 
ATOM   6033 H  HE1  . HIS B 1 88  ? -3.941  -11.279 -15.024 1.00 147.74 ? 449 HIS B HE1  1 
ATOM   6034 H  HE2  . HIS B 1 88  ? -3.128  -11.005 -17.228 1.00 139.37 ? 449 HIS B HE2  1 
ATOM   6035 N  N    . PRO B 1 89  ? -6.868  -6.837  -17.873 1.00 111.63 ? 450 PRO B N    1 
ATOM   6036 C  CA   . PRO B 1 89  ? -6.773  -5.781  -18.881 1.00 108.62 ? 450 PRO B CA   1 
ATOM   6037 C  C    . PRO B 1 89  ? -6.200  -6.299  -20.195 1.00 85.49  ? 450 PRO B C    1 
ATOM   6038 O  O    . PRO B 1 89  ? -5.176  -6.986  -20.186 1.00 88.92  ? 450 PRO B O    1 
ATOM   6039 C  CB   . PRO B 1 89  ? -5.834  -4.768  -18.229 1.00 107.91 ? 450 PRO B CB   1 
ATOM   6040 C  CG   . PRO B 1 89  ? -4.918  -5.611  -17.409 1.00 105.59 ? 450 PRO B CG   1 
ATOM   6041 C  CD   . PRO B 1 89  ? -5.739  -6.789  -16.925 1.00 106.32 ? 450 PRO B CD   1 
ATOM   6042 H  HA   . PRO B 1 89  ? -7.640  -5.373  -19.036 1.00 130.34 ? 450 PRO B HA   1 
ATOM   6043 H  HB2  . PRO B 1 89  ? -5.343  -4.285  -18.911 1.00 129.49 ? 450 PRO B HB2  1 
ATOM   6044 H  HB3  . PRO B 1 89  ? -6.341  -4.161  -17.668 1.00 129.49 ? 450 PRO B HB3  1 
ATOM   6045 H  HG2  . PRO B 1 89  ? -4.180  -5.916  -17.960 1.00 126.70 ? 450 PRO B HG2  1 
ATOM   6046 H  HG3  . PRO B 1 89  ? -4.589  -5.094  -16.657 1.00 126.70 ? 450 PRO B HG3  1 
ATOM   6047 H  HD2  . PRO B 1 89  ? -5.220  -7.607  -16.976 1.00 127.58 ? 450 PRO B HD2  1 
ATOM   6048 H  HD3  . PRO B 1 89  ? -6.062  -6.628  -16.024 1.00 127.58 ? 450 PRO B HD3  1 
ATOM   6049 N  N    . GLY B 1 90  ? -6.871  -5.985  -21.300 1.00 83.71  ? 451 GLY B N    1 
ATOM   6050 C  CA   . GLY B 1 90  ? -6.379  -6.306  -22.628 1.00 69.02  ? 451 GLY B CA   1 
ATOM   6051 C  C    . GLY B 1 90  ? -6.075  -7.777  -22.848 1.00 83.62  ? 451 GLY B C    1 
ATOM   6052 O  O    . GLY B 1 90  ? -5.016  -8.124  -23.376 1.00 88.47  ? 451 GLY B O    1 
ATOM   6053 H  H    . GLY B 1 90  ? -7.629  -5.579  -21.302 1.00 100.45 ? 451 GLY B H    1 
ATOM   6054 H  HA2  . GLY B 1 90  ? -7.039  -6.034  -23.284 1.00 82.82  ? 451 GLY B HA2  1 
ATOM   6055 H  HA3  . GLY B 1 90  ? -5.565  -5.803  -22.793 1.00 82.82  ? 451 GLY B HA3  1 
ATOM   6056 N  N    . GLN B 1 91  ? -7.003  -8.644  -22.453 1.00 67.86  ? 452 GLN B N    1 
ATOM   6057 C  CA   . GLN B 1 91  ? -6.810  -10.083 -22.600 1.00 55.80  ? 452 GLN B CA   1 
ATOM   6058 C  C    . GLN B 1 91  ? -7.216  -10.539 -23.995 1.00 67.48  ? 452 GLN B C    1 
ATOM   6059 O  O    . GLN B 1 91  ? -8.109  -9.955  -24.611 1.00 61.21  ? 452 GLN B O    1 
ATOM   6060 C  CB   . GLN B 1 91  ? -7.606  -10.846 -21.547 1.00 57.46  ? 452 GLN B CB   1 
ATOM   6061 C  CG   . GLN B 1 91  ? -7.134  -12.275 -21.354 1.00 94.29  ? 452 GLN B CG   1 
ATOM   6062 C  CD   . GLN B 1 91  ? -7.595  -12.870 -20.040 1.00 85.99  ? 452 GLN B CD   1 
ATOM   6063 O  OE1  . GLN B 1 91  ? -8.623  -12.475 -19.487 1.00 93.68  ? 452 GLN B OE1  1 
ATOM   6064 N  NE2  . GLN B 1 91  ? -6.820  -13.816 -19.522 1.00 73.23  ? 452 GLN B NE2  1 
ATOM   6065 H  H    . GLN B 1 91  ? -7.754  -8.424  -22.096 1.00 81.43  ? 452 GLN B H    1 
ATOM   6066 H  HA   . GLN B 1 91  ? -5.871  -10.291 -22.477 1.00 66.96  ? 452 GLN B HA   1 
ATOM   6067 H  HB2  . GLN B 1 91  ? -7.522  -10.387 -20.697 1.00 68.95  ? 452 GLN B HB2  1 
ATOM   6068 H  HB3  . GLN B 1 91  ? -8.538  -10.874 -21.817 1.00 68.95  ? 452 GLN B HB3  1 
ATOM   6069 H  HG2  . GLN B 1 91  ? -7.487  -12.824 -22.072 1.00 113.15 ? 452 GLN B HG2  1 
ATOM   6070 H  HG3  . GLN B 1 91  ? -6.165  -12.292 -21.368 1.00 113.15 ? 452 GLN B HG3  1 
ATOM   6071 H  HE21 . GLN B 1 91  ? -6.104  -14.057 -19.932 1.00 87.88  ? 452 GLN B HE21 1 
ATOM   6072 H  HE22 . GLN B 1 91  ? -7.035  -14.188 -18.777 1.00 87.88  ? 452 GLN B HE22 1 
ATOM   6073 N  N    . GLU B 1 92  ? -6.563  -11.592 -24.477 1.00 61.05  ? 453 GLU B N    1 
ATOM   6074 C  CA   . GLU B 1 92  ? -6.725  -12.034 -25.855 1.00 61.67  ? 453 GLU B CA   1 
ATOM   6075 C  C    . GLU B 1 92  ? -7.007  -13.525 -25.946 1.00 55.21  ? 453 GLU B C    1 
ATOM   6076 O  O    . GLU B 1 92  ? -6.434  -14.327 -25.206 1.00 58.52  ? 453 GLU B O    1 
ATOM   6077 C  CB   . GLU B 1 92  ? -5.465  -11.724 -26.675 1.00 70.79  ? 453 GLU B CB   1 
ATOM   6078 C  CG   . GLU B 1 92  ? -4.841  -10.347 -26.453 1.00 85.30  ? 453 GLU B CG   1 
ATOM   6079 C  CD   . GLU B 1 92  ? -5.347  -9.307  -27.430 1.00 101.65 ? 453 GLU B CD   1 
ATOM   6080 O  OE1  . GLU B 1 92  ? -4.535  -8.469  -27.879 1.00 111.86 ? 453 GLU B OE1  1 
ATOM   6081 O  OE2  . GLU B 1 92  ? -6.554  -9.325  -27.746 1.00 105.35 ? 453 GLU B OE2  1 
ATOM   6082 H  H    . GLU B 1 92  ? -6.015  -12.072 -24.019 1.00 73.26  ? 453 GLU B H    1 
ATOM   6083 H  HA   . GLU B 1 92  ? -7.471  -11.560 -26.255 1.00 74.00  ? 453 GLU B HA   1 
ATOM   6084 H  HB2  . GLU B 1 92  ? -4.790  -12.385 -26.458 1.00 84.95  ? 453 GLU B HB2  1 
ATOM   6085 H  HB3  . GLU B 1 92  ? -5.691  -11.790 -27.616 1.00 84.95  ? 453 GLU B HB3  1 
ATOM   6086 H  HG2  . GLU B 1 92  ? -5.054  -10.045 -25.557 1.00 102.36 ? 453 GLU B HG2  1 
ATOM   6087 H  HG3  . GLU B 1 92  ? -3.880  -10.416 -26.560 1.00 102.36 ? 453 GLU B HG3  1 
ATOM   6088 N  N    . LEU B 1 93  ? -7.904  -13.886 -26.854 1.00 54.66  ? 454 LEU B N    1 
ATOM   6089 C  CA   . LEU B 1 93  ? -7.958  -15.239 -27.374 1.00 38.70  ? 454 LEU B CA   1 
ATOM   6090 C  C    . LEU B 1 93  ? -6.866  -15.336 -28.434 1.00 51.18  ? 454 LEU B C    1 
ATOM   6091 O  O    . LEU B 1 93  ? -6.886  -14.588 -29.414 1.00 61.25  ? 454 LEU B O    1 
ATOM   6092 C  CB   . LEU B 1 93  ? -9.336  -15.559 -27.958 1.00 50.94  ? 454 LEU B CB   1 
ATOM   6093 C  CG   . LEU B 1 93  ? -9.443  -16.875 -28.733 1.00 51.17  ? 454 LEU B CG   1 
ATOM   6094 C  CD1  . LEU B 1 93  ? -9.150  -18.071 -27.837 1.00 56.15  ? 454 LEU B CD1  1 
ATOM   6095 C  CD2  . LEU B 1 93  ? -10.817 -17.010 -29.362 1.00 48.06  ? 454 LEU B CD2  1 
ATOM   6096 H  H    . LEU B 1 93  ? -8.497  -13.359 -27.187 1.00 65.60  ? 454 LEU B H    1 
ATOM   6097 H  HA   . LEU B 1 93  ? -7.763  -15.872 -26.665 1.00 46.44  ? 454 LEU B HA   1 
ATOM   6098 H  HB2  . LEU B 1 93  ? -9.975  -15.599 -27.230 1.00 61.13  ? 454 LEU B HB2  1 
ATOM   6099 H  HB3  . LEU B 1 93  ? -9.584  -14.845 -28.566 1.00 61.13  ? 454 LEU B HB3  1 
ATOM   6100 H  HG   . LEU B 1 93  ? -8.788  -16.872 -29.448 1.00 61.40  ? 454 LEU B HG   1 
ATOM   6101 H  HD11 . LEU B 1 93  ? -9.228  -18.884 -28.361 1.00 67.38  ? 454 LEU B HD11 1 
ATOM   6102 H  HD12 . LEU B 1 93  ? -8.250  -17.988 -27.485 1.00 67.38  ? 454 LEU B HD12 1 
ATOM   6103 H  HD13 . LEU B 1 93  ? -9.791  -18.083 -27.109 1.00 67.38  ? 454 LEU B HD13 1 
ATOM   6104 H  HD21 . LEU B 1 93  ? -10.862 -17.849 -29.846 1.00 57.67  ? 454 LEU B HD21 1 
ATOM   6105 H  HD22 . LEU B 1 93  ? -11.488 -16.996 -28.660 1.00 57.67  ? 454 LEU B HD22 1 
ATOM   6106 H  HD23 . LEU B 1 93  ? -10.960 -16.268 -29.970 1.00 57.67  ? 454 LEU B HD23 1 
ATOM   6107 N  N    . GLU B 1 94  ? -5.897  -16.222 -28.212 1.00 49.03  ? 455 GLU B N    1 
ATOM   6108 C  CA   . GLU B 1 94  ? -4.788  -16.412 -29.148 1.00 44.26  ? 455 GLU B CA   1 
ATOM   6109 C  C    . GLU B 1 94  ? -4.873  -17.792 -29.778 1.00 50.51  ? 455 GLU B C    1 
ATOM   6110 O  O    . GLU B 1 94  ? -5.042  -18.788 -29.076 1.00 40.22  ? 455 GLU B O    1 
ATOM   6111 C  CB   . GLU B 1 94  ? -3.436  -16.249 -28.443 1.00 61.68  ? 455 GLU B CB   1 
ATOM   6112 C  CG   . GLU B 1 94  ? -3.305  -14.983 -27.601 1.00 85.25  ? 455 GLU B CG   1 
ATOM   6113 C  CD   . GLU B 1 94  ? -2.007  -14.927 -26.803 1.00 99.64  ? 455 GLU B CD   1 
ATOM   6114 O  OE1  . GLU B 1 94  ? -1.512  -15.995 -26.378 1.00 101.25 ? 455 GLU B OE1  1 
ATOM   6115 O  OE2  . GLU B 1 94  ? -1.481  -13.811 -26.600 1.00 93.60  ? 455 GLU B OE2  1 
ATOM   6116 H  H    . GLU B 1 94  ? -5.858  -16.730 -27.519 1.00 58.83  ? 455 GLU B H    1 
ATOM   6117 H  HA   . GLU B 1 94  ? -4.846  -15.749 -29.854 1.00 53.11  ? 455 GLU B HA   1 
ATOM   6118 H  HB2  . GLU B 1 94  ? -3.300  -17.008 -27.854 1.00 74.02  ? 455 GLU B HB2  1 
ATOM   6119 H  HB3  . GLU B 1 94  ? -2.737  -16.228 -29.115 1.00 74.02  ? 455 GLU B HB3  1 
ATOM   6120 H  HG2  . GLU B 1 94  ? -3.329  -14.210 -28.187 1.00 102.30 ? 455 GLU B HG2  1 
ATOM   6121 H  HG3  . GLU B 1 94  ? -4.044  -14.944 -26.973 1.00 102.30 ? 455 GLU B HG3  1 
ATOM   6122 N  N    . ILE B 1 95  ? -4.756  -17.845 -31.100 1.00 49.23  ? 456 ILE B N    1 
ATOM   6123 C  CA   . ILE B 1 95  ? -4.764  -19.112 -31.824 1.00 45.18  ? 456 ILE B CA   1 
ATOM   6124 C  C    . ILE B 1 95  ? -3.624  -19.174 -32.826 1.00 52.00  ? 456 ILE B C    1 
ATOM   6125 O  O    . ILE B 1 95  ? -3.363  -18.208 -33.525 1.00 42.10  ? 456 ILE B O    1 
ATOM   6126 C  CB   . ILE B 1 95  ? -6.089  -19.325 -32.564 1.00 54.73  ? 456 ILE B CB   1 
ATOM   6127 C  CG1  . ILE B 1 95  ? -7.238  -19.396 -31.559 1.00 52.60  ? 456 ILE B CG1  1 
ATOM   6128 C  CG2  . ILE B 1 95  ? -6.032  -20.598 -33.401 1.00 56.66  ? 456 ILE B CG2  1 
ATOM   6129 C  CD1  . ILE B 1 95  ? -8.604  -19.452 -32.197 1.00 52.64  ? 456 ILE B CD1  1 
ATOM   6130 H  H    . ILE B 1 95  ? -4.670  -17.155 -31.606 1.00 59.08  ? 456 ILE B H    1 
ATOM   6131 H  HA   . ILE B 1 95  ? -4.651  -19.839 -31.192 1.00 54.22  ? 456 ILE B HA   1 
ATOM   6132 H  HB   . ILE B 1 95  ? -6.239  -18.571 -33.155 1.00 65.68  ? 456 ILE B HB   1 
ATOM   6133 H  HG12 . ILE B 1 95  ? -7.130  -20.194 -31.018 1.00 63.12  ? 456 ILE B HG12 1 
ATOM   6134 H  HG13 . ILE B 1 95  ? -7.206  -18.609 -30.993 1.00 63.12  ? 456 ILE B HG13 1 
ATOM   6135 H  HG21 . ILE B 1 95  ? -6.880  -20.712 -33.860 1.00 67.99  ? 456 ILE B HG21 1 
ATOM   6136 H  HG22 . ILE B 1 95  ? -5.314  -20.518 -34.048 1.00 67.99  ? 456 ILE B HG22 1 
ATOM   6137 H  HG23 . ILE B 1 95  ? -5.868  -21.354 -32.816 1.00 67.99  ? 456 ILE B HG23 1 
ATOM   6138 H  HD11 . ILE B 1 95  ? -9.276  -19.495 -31.499 1.00 63.17  ? 456 ILE B HD11 1 
ATOM   6139 H  HD12 . ILE B 1 95  ? -8.734  -18.654 -32.733 1.00 63.17  ? 456 ILE B HD12 1 
ATOM   6140 H  HD13 . ILE B 1 95  ? -8.658  -20.241 -32.758 1.00 63.17  ? 456 ILE B HD13 1 
ATOM   6141 N  N    . GLU B 1 96  ? -2.948  -20.316 -32.876 1.00 46.98  ? 457 GLU B N    1 
ATOM   6142 C  CA   . GLU B 1 96  ? -1.939  -20.586 -33.893 1.00 44.98  ? 457 GLU B CA   1 
ATOM   6143 C  C    . GLU B 1 96  ? -2.246  -21.914 -34.554 1.00 53.15  ? 457 GLU B C    1 
ATOM   6144 O  O    . GLU B 1 96  ? -2.653  -22.865 -33.886 1.00 45.35  ? 457 GLU B O    1 
ATOM   6145 C  CB   . GLU B 1 96  ? -0.531  -20.629 -33.301 1.00 53.02  ? 457 GLU B CB   1 
ATOM   6146 C  CG   . GLU B 1 96  ? 0.058   -19.282 -32.950 1.00 64.69  ? 457 GLU B CG   1 
ATOM   6147 C  CD   . GLU B 1 96  ? 1.511   -19.392 -32.531 1.00 79.23  ? 457 GLU B CD   1 
ATOM   6148 O  OE1  . GLU B 1 96  ? 1.762   -19.764 -31.366 1.00 61.43  ? 457 GLU B OE1  1 
ATOM   6149 O  OE2  . GLU B 1 96  ? 2.402   -19.122 -33.368 1.00 65.70  ? 457 GLU B OE2  1 
ATOM   6150 H  H    . GLU B 1 96  ? -3.058  -20.964 -32.320 1.00 56.37  ? 457 GLU B H    1 
ATOM   6151 H  HA   . GLU B 1 96  ? -1.967  -19.892 -34.570 1.00 53.98  ? 457 GLU B HA   1 
ATOM   6152 H  HB2  . GLU B 1 96  ? -0.555  -21.158 -32.488 1.00 63.62  ? 457 GLU B HB2  1 
ATOM   6153 H  HB3  . GLU B 1 96  ? 0.061   -21.048 -33.944 1.00 63.62  ? 457 GLU B HB3  1 
ATOM   6154 H  HG2  . GLU B 1 96  ? 0.010   -18.701 -33.726 1.00 77.63  ? 457 GLU B HG2  1 
ATOM   6155 H  HG3  . GLU B 1 96  ? -0.442  -18.897 -32.213 1.00 77.63  ? 457 GLU B HG3  1 
ATOM   6156 N  N    . LEU B 1 97  ? -2.042  -21.976 -35.865 1.00 48.98  ? 458 LEU B N    1 
ATOM   6157 C  CA   . LEU B 1 97  ? -2.224  -23.211 -36.610 1.00 42.00  ? 458 LEU B CA   1 
ATOM   6158 C  C    . LEU B 1 97  ? -0.868  -23.737 -37.041 1.00 42.64  ? 458 LEU B C    1 
ATOM   6159 O  O    . LEU B 1 97  ? 0.044   -22.962 -37.338 1.00 43.92  ? 458 LEU B O    1 
ATOM   6160 C  CB   . LEU B 1 97  ? -3.133  -22.983 -37.821 1.00 43.55  ? 458 LEU B CB   1 
ATOM   6161 C  CG   . LEU B 1 97  ? -4.548  -22.496 -37.488 1.00 44.03  ? 458 LEU B CG   1 
ATOM   6162 C  CD1  . LEU B 1 97  ? -5.335  -22.204 -38.761 1.00 53.07  ? 458 LEU B CD1  1 
ATOM   6163 C  CD2  . LEU B 1 97  ? -5.292  -23.515 -36.627 1.00 53.32  ? 458 LEU B CD2  1 
ATOM   6164 H  H    . LEU B 1 97  ? -1.796  -21.309 -36.349 1.00 58.77  ? 458 LEU B H    1 
ATOM   6165 H  HA   . LEU B 1 97  ? -2.641  -23.873 -36.037 1.00 50.40  ? 458 LEU B HA   1 
ATOM   6166 H  HB2  . LEU B 1 97  ? -2.722  -22.318 -38.394 1.00 52.26  ? 458 LEU B HB2  1 
ATOM   6167 H  HB3  . LEU B 1 97  ? -3.219  -23.820 -38.304 1.00 52.26  ? 458 LEU B HB3  1 
ATOM   6168 H  HG   . LEU B 1 97  ? -4.484  -21.670 -36.983 1.00 52.83  ? 458 LEU B HG   1 
ATOM   6169 H  HD11 . LEU B 1 97  ? -6.224  -21.898 -38.520 1.00 63.68  ? 458 LEU B HD11 1 
ATOM   6170 H  HD12 . LEU B 1 97  ? -4.874  -21.516 -39.267 1.00 63.68  ? 458 LEU B HD12 1 
ATOM   6171 H  HD13 . LEU B 1 97  ? -5.396  -23.017 -39.287 1.00 63.68  ? 458 LEU B HD13 1 
ATOM   6172 H  HD21 . LEU B 1 97  ? -6.181  -23.176 -36.435 1.00 63.98  ? 458 LEU B HD21 1 
ATOM   6173 H  HD22 . LEU B 1 97  ? -5.354  -24.352 -37.112 1.00 63.98  ? 458 LEU B HD22 1 
ATOM   6174 H  HD23 . LEU B 1 97  ? -4.802  -23.646 -35.800 1.00 63.98  ? 458 LEU B HD23 1 
ATOM   6175 N  N    . PHE B 1 98  ? -0.736  -25.059 -37.056 1.00 39.13  ? 459 PHE B N    1 
ATOM   6176 C  CA   . PHE B 1 98  ? 0.504   -25.696 -37.460 1.00 40.37  ? 459 PHE B CA   1 
ATOM   6177 C  C    . PHE B 1 98  ? 0.243   -26.906 -38.352 1.00 41.43  ? 459 PHE B C    1 
ATOM   6178 O  O    . PHE B 1 98  ? -0.831  -27.504 -38.309 1.00 44.50  ? 459 PHE B O    1 
ATOM   6179 C  CB   . PHE B 1 98  ? 1.310   -26.129 -36.236 1.00 39.25  ? 459 PHE B CB   1 
ATOM   6180 C  CG   . PHE B 1 98  ? 1.714   -24.996 -35.335 1.00 45.26  ? 459 PHE B CG   1 
ATOM   6181 C  CD1  . PHE B 1 98  ? 2.933   -24.363 -35.501 1.00 43.93  ? 459 PHE B CD1  1 
ATOM   6182 C  CD2  . PHE B 1 98  ? 0.880   -24.576 -34.305 1.00 36.88  ? 459 PHE B CD2  1 
ATOM   6183 C  CE1  . PHE B 1 98  ? 3.312   -23.323 -34.664 1.00 63.30  ? 459 PHE B CE1  1 
ATOM   6184 C  CE2  . PHE B 1 98  ? 1.258   -23.539 -33.465 1.00 58.60  ? 459 PHE B CE2  1 
ATOM   6185 C  CZ   . PHE B 1 98  ? 2.473   -22.912 -33.646 1.00 63.26  ? 459 PHE B CZ   1 
ATOM   6186 H  H    . PHE B 1 98  ? -1.357  -25.611 -36.833 1.00 46.96  ? 459 PHE B H    1 
ATOM   6187 H  HA   . PHE B 1 98  ? 1.037   -25.061 -37.963 1.00 48.45  ? 459 PHE B HA   1 
ATOM   6188 H  HB2  . PHE B 1 98  ? 0.774   -26.746 -35.713 1.00 47.09  ? 459 PHE B HB2  1 
ATOM   6189 H  HB3  . PHE B 1 98  ? 2.119   -26.571 -36.536 1.00 47.09  ? 459 PHE B HB3  1 
ATOM   6190 H  HD1  . PHE B 1 98  ? 3.503   -24.635 -36.184 1.00 52.72  ? 459 PHE B HD1  1 
ATOM   6191 H  HD2  . PHE B 1 98  ? 0.060   -24.995 -34.178 1.00 44.25  ? 459 PHE B HD2  1 
ATOM   6192 H  HE1  . PHE B 1 98  ? 4.133   -22.903 -34.788 1.00 75.96  ? 459 PHE B HE1  1 
ATOM   6193 H  HE2  . PHE B 1 98  ? 0.690   -23.263 -32.782 1.00 70.31  ? 459 PHE B HE2  1 
ATOM   6194 H  HZ   . PHE B 1 98  ? 2.726   -22.215 -33.085 1.00 75.92  ? 459 PHE B HZ   1 
ATOM   6195 N  N    . ASP B 1 99  ? 1.240   -27.240 -39.163 1.00 44.12  ? 460 ASP B N    1 
ATOM   6196 C  CA   . ASP B 1 99  ? 1.246   -28.456 -39.962 1.00 45.00  ? 460 ASP B CA   1 
ATOM   6197 C  C    . ASP B 1 99  ? 2.041   -29.529 -39.237 1.00 44.85  ? 460 ASP B C    1 
ATOM   6198 O  O    . ASP B 1 99  ? 3.255   -29.406 -39.081 1.00 57.23  ? 460 ASP B O    1 
ATOM   6199 C  CB   . ASP B 1 99  ? 1.857   -28.190 -41.346 1.00 53.89  ? 460 ASP B CB   1 
ATOM   6200 C  CG   . ASP B 1 99  ? 2.141   -29.469 -42.123 1.00 56.76  ? 460 ASP B CG   1 
ATOM   6201 O  OD1  . ASP B 1 99  ? 1.366   -30.440 -41.990 1.00 66.59  ? 460 ASP B OD1  1 
ATOM   6202 O  OD2  . ASP B 1 99  ? 3.144   -29.503 -42.872 1.00 62.31  ? 460 ASP B OD2  1 
ATOM   6203 H  H    . ASP B 1 99  ? 1.947   -26.762 -39.269 1.00 52.94  ? 460 ASP B H    1 
ATOM   6204 H  HA   . ASP B 1 99  ? 0.337   -28.772 -40.081 1.00 54.00  ? 460 ASP B HA   1 
ATOM   6205 H  HB2  . ASP B 1 99  ? 1.238   -27.654 -41.866 1.00 64.67  ? 460 ASP B HB2  1 
ATOM   6206 H  HB3  . ASP B 1 99  ? 2.695   -27.715 -41.234 1.00 64.67  ? 460 ASP B HB3  1 
ATOM   6207 N  N    . GLU B 1 100 ? 1.361   -30.574 -38.781 1.00 52.52  ? 461 GLU B N    1 
ATOM   6208 C  CA   . GLU B 1 100 ? 2.061   -31.683 -38.151 1.00 48.03  ? 461 GLU B CA   1 
ATOM   6209 C  C    . GLU B 1 100 ? 3.058   -32.282 -39.131 1.00 51.60  ? 461 GLU B C    1 
ATOM   6210 O  O    . GLU B 1 100 ? 2.705   -32.624 -40.263 1.00 62.59  ? 461 GLU B O    1 
ATOM   6211 C  CB   . GLU B 1 100 ? 1.087   -32.756 -37.678 1.00 50.13  ? 461 GLU B CB   1 
ATOM   6212 C  CG   . GLU B 1 100 ? 1.740   -33.803 -36.796 1.00 69.84  ? 461 GLU B CG   1 
ATOM   6213 C  CD   . GLU B 1 100 ? 1.098   -35.163 -36.931 1.00 95.50  ? 461 GLU B CD   1 
ATOM   6214 O  OE1  . GLU B 1 100 ? 0.653   -35.713 -35.902 1.00 102.47 ? 461 GLU B OE1  1 
ATOM   6215 O  OE2  . GLU B 1 100 ? 1.046   -35.684 -38.066 1.00 114.01 ? 461 GLU B OE2  1 
ATOM   6216 H  H    . GLU B 1 100 ? 0.507   -30.664 -38.823 1.00 63.03  ? 461 GLU B H    1 
ATOM   6217 H  HA   . GLU B 1 100 ? 2.550   -31.357 -37.380 1.00 57.63  ? 461 GLU B HA   1 
ATOM   6218 H  HB2  . GLU B 1 100 ? 0.378   -32.335 -37.168 1.00 60.15  ? 461 GLU B HB2  1 
ATOM   6219 H  HB3  . GLU B 1 100 ? 0.715   -33.207 -38.452 1.00 60.15  ? 461 GLU B HB3  1 
ATOM   6220 H  HG2  . GLU B 1 100 ? 2.674   -33.886 -37.043 1.00 83.81  ? 461 GLU B HG2  1 
ATOM   6221 H  HG3  . GLU B 1 100 ? 1.665   -33.526 -35.869 1.00 83.81  ? 461 GLU B HG3  1 
ATOM   6222 N  N    . ASP B 1 101 ? 4.304   -32.394 -38.684 1.00 72.30  ? 462 ASP B N    1 
ATOM   6223 C  CA   . ASP B 1 101 ? 5.394   -32.913 -39.499 1.00 70.46  ? 462 ASP B CA   1 
ATOM   6224 C  C    . ASP B 1 101 ? 6.206   -33.927 -38.702 1.00 72.18  ? 462 ASP B C    1 
ATOM   6225 O  O    . ASP B 1 101 ? 6.055   -34.022 -37.483 1.00 86.29  ? 462 ASP B O    1 
ATOM   6226 C  CB   . ASP B 1 101 ? 6.302   -31.773 -39.972 1.00 81.90  ? 462 ASP B CB   1 
ATOM   6227 C  CG   . ASP B 1 101 ? 5.792   -31.097 -41.231 1.00 102.92 ? 462 ASP B CG   1 
ATOM   6228 O  OD1  . ASP B 1 101 ? 5.409   -31.812 -42.183 1.00 117.98 ? 462 ASP B OD1  1 
ATOM   6229 O  OD2  . ASP B 1 101 ? 5.783   -29.847 -41.271 1.00 82.98  ? 462 ASP B OD2  1 
ATOM   6230 H  H    . ASP B 1 101 ? 4.548   -32.169 -37.890 1.00 86.76  ? 462 ASP B H    1 
ATOM   6231 H  HA   . ASP B 1 101 ? 5.029   -33.358 -40.280 1.00 84.55  ? 462 ASP B HA   1 
ATOM   6232 H  HB2  . ASP B 1 101 ? 6.356   -31.102 -39.273 1.00 98.28  ? 462 ASP B HB2  1 
ATOM   6233 H  HB3  . ASP B 1 101 ? 7.184   -32.129 -40.159 1.00 98.28  ? 462 ASP B HB3  1 
ATOM   6234 N  N    . PRO B 1 102 ? 7.073   -34.689 -39.386 1.00 68.15  ? 463 PRO B N    1 
ATOM   6235 C  CA   . PRO B 1 102 ? 7.983   -35.586 -38.668 1.00 75.76  ? 463 PRO B CA   1 
ATOM   6236 C  C    . PRO B 1 102 ? 9.008   -34.787 -37.871 1.00 83.02  ? 463 PRO B C    1 
ATOM   6237 O  O    . PRO B 1 102 ? 9.349   -35.149 -36.743 1.00 94.03  ? 463 PRO B O    1 
ATOM   6238 C  CB   . PRO B 1 102 ? 8.660   -36.389 -39.787 1.00 85.18  ? 463 PRO B CB   1 
ATOM   6239 C  CG   . PRO B 1 102 ? 7.887   -36.089 -41.035 1.00 84.94  ? 463 PRO B CG   1 
ATOM   6240 C  CD   . PRO B 1 102 ? 7.291   -34.741 -40.840 1.00 80.72  ? 463 PRO B CD   1 
ATOM   6241 H  HA   . PRO B 1 102 ? 7.494   -36.182 -38.080 1.00 90.91  ? 463 PRO B HA   1 
ATOM   6242 H  HB2  . PRO B 1 102 ? 9.582   -36.102 -39.880 1.00 102.22 ? 463 PRO B HB2  1 
ATOM   6243 H  HB3  . PRO B 1 102 ? 8.617   -37.336 -39.579 1.00 102.22 ? 463 PRO B HB3  1 
ATOM   6244 H  HG2  . PRO B 1 102 ? 8.488   -36.088 -41.796 1.00 101.93 ? 463 PRO B HG2  1 
ATOM   6245 H  HG3  . PRO B 1 102 ? 7.191   -36.755 -41.152 1.00 101.93 ? 463 PRO B HG3  1 
ATOM   6246 H  HD2  . PRO B 1 102 ? 7.914   -34.050 -41.115 1.00 96.87  ? 463 PRO B HD2  1 
ATOM   6247 H  HD3  . PRO B 1 102 ? 6.447   -34.671 -41.312 1.00 96.87  ? 463 PRO B HD3  1 
ATOM   6248 N  N    . ASP B 1 103 ? 9.480   -33.697 -38.469 1.00 70.74  ? 464 ASP B N    1 
ATOM   6249 C  CA   . ASP B 1 103 ? 10.450  -32.813 -37.834 1.00 93.98  ? 464 ASP B CA   1 
ATOM   6250 C  C    . ASP B 1 103 ? 9.711   -31.637 -37.186 1.00 83.70  ? 464 ASP B C    1 
ATOM   6251 O  O    . ASP B 1 103 ? 8.685   -31.834 -36.538 1.00 75.14  ? 464 ASP B O    1 
ATOM   6252 C  CB   . ASP B 1 103 ? 11.481  -32.333 -38.865 1.00 112.30 ? 464 ASP B CB   1 
ATOM   6253 C  CG   . ASP B 1 103 ? 12.749  -31.789 -38.224 1.00 125.36 ? 464 ASP B CG   1 
ATOM   6254 O  OD1  . ASP B 1 103 ? 13.125  -32.267 -37.133 1.00 126.85 ? 464 ASP B OD1  1 
ATOM   6255 O  OD2  . ASP B 1 103 ? 13.369  -30.881 -38.818 1.00 122.54 ? 464 ASP B OD2  1 
ATOM   6256 H  H    . ASP B 1 103 ? 9.249   -33.444 -39.258 1.00 84.89  ? 464 ASP B H    1 
ATOM   6257 H  HA   . ASP B 1 103 ? 10.919  -33.299 -37.138 1.00 112.77 ? 464 ASP B HA   1 
ATOM   6258 H  HB2  . ASP B 1 103 ? 11.729  -33.079 -39.433 1.00 134.76 ? 464 ASP B HB2  1 
ATOM   6259 H  HB3  . ASP B 1 103 ? 11.088  -31.625 -39.399 1.00 134.76 ? 464 ASP B HB3  1 
ATOM   6260 N  N    . LYS B 1 104 ? 10.223  -30.421 -37.355 1.00 76.31  ? 465 LYS B N    1 
ATOM   6261 C  CA   . LYS B 1 104 ? 9.578   -29.240 -36.797 1.00 72.32  ? 465 LYS B CA   1 
ATOM   6262 C  C    . LYS B 1 104 ? 8.268   -28.955 -37.521 1.00 77.36  ? 465 LYS B C    1 
ATOM   6263 O  O    . LYS B 1 104 ? 8.212   -28.975 -38.749 1.00 83.06  ? 465 LYS B O    1 
ATOM   6264 C  CB   . LYS B 1 104 ? 10.509  -28.028 -36.889 1.00 80.51  ? 465 LYS B CB   1 
ATOM   6265 C  CG   . LYS B 1 104 ? 9.994   -26.788 -36.168 1.00 95.31  ? 465 LYS B CG   1 
ATOM   6266 C  CD   . LYS B 1 104 ? 11.031  -25.669 -36.176 1.00 109.82 ? 465 LYS B CD   1 
ATOM   6267 C  CE   . LYS B 1 104 ? 10.499  -24.395 -35.534 1.00 115.76 ? 465 LYS B CE   1 
ATOM   6268 N  NZ   . LYS B 1 104 ? 9.575   -23.647 -36.434 1.00 116.00 ? 465 LYS B NZ   1 
ATOM   6269 H  H    . LYS B 1 104 ? 10.946  -30.254 -37.791 1.00 91.57  ? 465 LYS B H    1 
ATOM   6270 H  HA   . LYS B 1 104 ? 9.379   -29.398 -35.861 1.00 86.78  ? 465 LYS B HA   1 
ATOM   6271 H  HB2  . LYS B 1 104 ? 11.365  -28.263 -36.497 1.00 96.61  ? 465 LYS B HB2  1 
ATOM   6272 H  HB3  . LYS B 1 104 ? 10.629  -27.798 -37.823 1.00 96.61  ? 465 LYS B HB3  1 
ATOM   6273 H  HG2  . LYS B 1 104 ? 9.196   -26.466 -36.616 1.00 114.37 ? 465 LYS B HG2  1 
ATOM   6274 H  HG3  . LYS B 1 104 ? 9.795   -27.012 -35.246 1.00 114.37 ? 465 LYS B HG3  1 
ATOM   6275 H  HD2  . LYS B 1 104 ? 11.812  -25.956 -35.678 1.00 131.78 ? 465 LYS B HD2  1 
ATOM   6276 H  HD3  . LYS B 1 104 ? 11.274  -25.467 -37.093 1.00 131.78 ? 465 LYS B HD3  1 
ATOM   6277 H  HE2  . LYS B 1 104 ? 10.013  -24.625 -34.727 1.00 138.91 ? 465 LYS B HE2  1 
ATOM   6278 H  HE3  . LYS B 1 104 ? 11.245  -23.813 -35.318 1.00 138.91 ? 465 LYS B HE3  1 
ATOM   6279 H  HZ1  . LYS B 1 104 ? 9.285   -22.910 -36.028 1.00 139.19 ? 465 LYS B HZ1  1 
ATOM   6280 H  HZ2  . LYS B 1 104 ? 10.000  -23.417 -37.182 1.00 139.19 ? 465 LYS B HZ2  1 
ATOM   6281 H  HZ3  . LYS B 1 104 ? 8.876   -24.156 -36.643 1.00 139.19 ? 465 LYS B HZ3  1 
ATOM   6282 N  N    . ASP B 1 105 ? 7.214   -28.701 -36.752 1.00 71.87  ? 466 ASP B N    1 
ATOM   6283 C  CA   . ASP B 1 105 ? 5.914   -28.365 -37.317 1.00 50.85  ? 466 ASP B CA   1 
ATOM   6284 C  C    . ASP B 1 105 ? 5.927   -26.945 -37.871 1.00 62.35  ? 466 ASP B C    1 
ATOM   6285 O  O    . ASP B 1 105 ? 6.383   -26.014 -37.209 1.00 73.93  ? 466 ASP B O    1 
ATOM   6286 C  CB   . ASP B 1 105 ? 4.815   -28.512 -36.261 1.00 48.36  ? 466 ASP B CB   1 
ATOM   6287 C  CG   . ASP B 1 105 ? 4.581   -29.961 -35.857 1.00 53.84  ? 466 ASP B CG   1 
ATOM   6288 O  OD1  . ASP B 1 105 ? 5.319   -30.849 -36.338 1.00 50.50  ? 466 ASP B OD1  1 
ATOM   6289 O  OD2  . ASP B 1 105 ? 3.666   -30.210 -35.045 1.00 57.40  ? 466 ASP B OD2  1 
ATOM   6290 H  H    . ASP B 1 105 ? 7.228   -28.718 -35.892 1.00 86.24  ? 466 ASP B H    1 
ATOM   6291 H  HA   . ASP B 1 105 ? 5.717   -28.973 -38.047 1.00 61.02  ? 466 ASP B HA   1 
ATOM   6292 H  HB2  . ASP B 1 105 ? 5.070   -28.016 -35.468 1.00 58.04  ? 466 ASP B HB2  1 
ATOM   6293 H  HB3  . ASP B 1 105 ? 3.984   -28.162 -36.619 1.00 58.04  ? 466 ASP B HB3  1 
ATOM   6294 N  N    . ASP B 1 106 ? 5.418   -26.786 -39.087 1.00 60.08  ? 467 ASP B N    1 
ATOM   6295 C  CA   . ASP B 1 106 ? 5.426   -25.492 -39.753 1.00 58.00  ? 467 ASP B CA   1 
ATOM   6296 C  C    . ASP B 1 106 ? 4.198   -24.667 -39.378 1.00 47.00  ? 467 ASP B C    1 
ATOM   6297 O  O    . ASP B 1 106 ? 3.106   -25.199 -39.198 1.00 53.11  ? 467 ASP B O    1 
ATOM   6298 C  CB   . ASP B 1 106 ? 5.507   -25.685 -41.270 1.00 76.26  ? 467 ASP B CB   1 
ATOM   6299 C  CG   . ASP B 1 106 ? 6.863   -26.199 -41.717 1.00 98.37  ? 467 ASP B CG   1 
ATOM   6300 O  OD1  . ASP B 1 106 ? 7.175   -27.376 -41.435 1.00 108.64 ? 467 ASP B OD1  1 
ATOM   6301 O  OD2  . ASP B 1 106 ? 7.618   -25.428 -42.347 1.00 103.36 ? 467 ASP B OD2  1 
ATOM   6302 H  H    . ASP B 1 106 ? 5.060   -27.416 -39.549 1.00 72.10  ? 467 ASP B H    1 
ATOM   6303 H  HA   . ASP B 1 106 ? 6.214   -25.000 -39.473 1.00 69.60  ? 467 ASP B HA   1 
ATOM   6304 H  HB2  . ASP B 1 106 ? 4.835   -26.329 -41.543 1.00 91.52  ? 467 ASP B HB2  1 
ATOM   6305 H  HB3  . ASP B 1 106 ? 5.349   -24.833 -41.706 1.00 91.52  ? 467 ASP B HB3  1 
ATOM   6306 N  N    . PHE B 1 107 ? 4.407   -23.360 -39.262 1.00 56.78  ? 468 PHE B N    1 
ATOM   6307 C  CA   . PHE B 1 107 ? 3.382   -22.408 -38.843 1.00 51.35  ? 468 PHE B CA   1 
ATOM   6308 C  C    . PHE B 1 107 ? 2.468   -22.058 -40.021 1.00 60.84  ? 468 PHE B C    1 
ATOM   6309 O  O    . PHE B 1 107 ? 2.954   -21.758 -41.112 1.00 55.33  ? 468 PHE B O    1 
ATOM   6310 C  CB   . PHE B 1 107 ? 4.074   -21.162 -38.275 1.00 48.88  ? 468 PHE B CB   1 
ATOM   6311 C  CG   . PHE B 1 107 ? 3.160   -20.000 -38.016 1.00 49.00  ? 468 PHE B CG   1 
ATOM   6312 C  CD1  . PHE B 1 107 ? 2.266   -20.021 -36.956 1.00 48.94  ? 468 PHE B CD1  1 
ATOM   6313 C  CD2  . PHE B 1 107 ? 3.230   -18.865 -38.804 1.00 59.87  ? 468 PHE B CD2  1 
ATOM   6314 C  CE1  . PHE B 1 107 ? 1.438   -18.940 -36.712 1.00 66.55  ? 468 PHE B CE1  1 
ATOM   6315 C  CE2  . PHE B 1 107 ? 2.407   -17.779 -38.561 1.00 71.23  ? 468 PHE B CE2  1 
ATOM   6316 C  CZ   . PHE B 1 107 ? 1.513   -17.816 -37.514 1.00 70.30  ? 468 PHE B CZ   1 
ATOM   6317 H  H    . PHE B 1 107 ? 5.164   -22.987 -39.427 1.00 68.14  ? 468 PHE B H    1 
ATOM   6318 H  HA   . PHE B 1 107 ? 2.841   -22.805 -38.143 1.00 61.62  ? 468 PHE B HA   1 
ATOM   6319 H  HB2  . PHE B 1 107 ? 4.494   -21.398 -37.433 1.00 58.65  ? 468 PHE B HB2  1 
ATOM   6320 H  HB3  . PHE B 1 107 ? 4.750   -20.869 -38.905 1.00 58.65  ? 468 PHE B HB3  1 
ATOM   6321 H  HD1  . PHE B 1 107 ? 2.212   -20.774 -36.414 1.00 58.72  ? 468 PHE B HD1  1 
ATOM   6322 H  HD2  . PHE B 1 107 ? 3.833   -18.834 -39.512 1.00 71.84  ? 468 PHE B HD2  1 
ATOM   6323 H  HE1  . PHE B 1 107 ? 0.836   -18.966 -36.004 1.00 79.86  ? 468 PHE B HE1  1 
ATOM   6324 H  HE2  . PHE B 1 107 ? 2.458   -17.026 -39.104 1.00 85.48  ? 468 PHE B HE2  1 
ATOM   6325 H  HZ   . PHE B 1 107 ? 0.956   -17.089 -37.350 1.00 84.36  ? 468 PHE B HZ   1 
ATOM   6326 N  N    . LEU B 1 108 ? 1.153   -22.112 -39.801 1.00 50.10  ? 469 LEU B N    1 
ATOM   6327 C  CA   . LEU B 1 108 ? 0.172   -21.898 -40.873 1.00 51.52  ? 469 LEU B CA   1 
ATOM   6328 C  C    . LEU B 1 108 ? -0.682  -20.650 -40.680 1.00 65.35  ? 469 LEU B C    1 
ATOM   6329 O  O    . LEU B 1 108 ? -1.617  -20.422 -41.449 1.00 58.49  ? 469 LEU B O    1 
ATOM   6330 C  CB   . LEU B 1 108 ? -0.758  -23.108 -40.999 1.00 51.16  ? 469 LEU B CB   1 
ATOM   6331 C  CG   . LEU B 1 108 ? -0.121  -24.439 -41.388 1.00 50.94  ? 469 LEU B CG   1 
ATOM   6332 C  CD1  . LEU B 1 108 ? -1.180  -25.528 -41.422 1.00 50.89  ? 469 LEU B CD1  1 
ATOM   6333 C  CD2  . LEU B 1 108 ? 0.586   -24.326 -42.742 1.00 55.43  ? 469 LEU B CD2  1 
ATOM   6334 H  H    . LEU B 1 108 ? 0.799   -22.273 -39.034 1.00 60.13  ? 469 LEU B H    1 
ATOM   6335 H  HA   . LEU B 1 108 ? 0.648   -21.802 -41.713 1.00 61.82  ? 469 LEU B HA   1 
ATOM   6336 H  HB2  . LEU B 1 108 ? -1.196  -23.241 -40.143 1.00 61.39  ? 469 LEU B HB2  1 
ATOM   6337 H  HB3  . LEU B 1 108 ? -1.427  -22.905 -41.671 1.00 61.39  ? 469 LEU B HB3  1 
ATOM   6338 H  HG   . LEU B 1 108 ? 0.541   -24.682 -40.722 1.00 61.13  ? 469 LEU B HG   1 
ATOM   6339 H  HD11 . LEU B 1 108 ? -0.761  -26.367 -41.670 1.00 61.07  ? 469 LEU B HD11 1 
ATOM   6340 H  HD12 . LEU B 1 108 ? -1.580  -25.606 -40.542 1.00 61.07  ? 469 LEU B HD12 1 
ATOM   6341 H  HD13 . LEU B 1 108 ? -1.857  -25.290 -42.074 1.00 61.07  ? 469 LEU B HD13 1 
ATOM   6342 H  HD21 . LEU B 1 108 ? 0.980   -25.183 -42.964 1.00 66.52  ? 469 LEU B HD21 1 
ATOM   6343 H  HD22 . LEU B 1 108 ? -0.064  -24.075 -43.417 1.00 66.52  ? 469 LEU B HD22 1 
ATOM   6344 H  HD23 . LEU B 1 108 ? 1.277   -23.649 -42.680 1.00 66.52  ? 469 LEU B HD23 1 
ATOM   6345 N  N    . GLY B 1 109 ? -0.377  -19.856 -39.655 1.00 52.52  ? 470 GLY B N    1 
ATOM   6346 C  CA   . GLY B 1 109 ? -1.072  -18.598 -39.432 1.00 52.45  ? 470 GLY B CA   1 
ATOM   6347 C  C    . GLY B 1 109 ? -1.593  -18.450 -38.016 1.00 61.20  ? 470 GLY B C    1 
ATOM   6348 O  O    . GLY B 1 109 ? -1.825  -19.444 -37.330 1.00 53.95  ? 470 GLY B O    1 
ATOM   6349 H  H    . GLY B 1 109 ? 0.233   -20.027 -39.073 1.00 63.02  ? 470 GLY B H    1 
ATOM   6350 H  HA2  . GLY B 1 109 ? -0.468  -17.861 -39.613 1.00 62.94  ? 470 GLY B HA2  1 
ATOM   6351 H  HA3  . GLY B 1 109 ? -1.824  -18.534 -40.042 1.00 62.94  ? 470 GLY B HA3  1 
ATOM   6352 N  N    . SER B 1 110 ? -1.782  -17.207 -37.583 1.00 51.16  ? 471 SER B N    1 
ATOM   6353 C  CA   . SER B 1 110 ? -2.210  -16.930 -36.214 1.00 60.01  ? 471 SER B CA   1 
ATOM   6354 C  C    . SER B 1 110 ? -3.443  -16.040 -36.180 1.00 56.19  ? 471 SER B C    1 
ATOM   6355 O  O    . SER B 1 110 ? -3.875  -15.499 -37.199 1.00 59.89  ? 471 SER B O    1 
ATOM   6356 C  CB   . SER B 1 110 ? -1.080  -16.269 -35.420 1.00 72.56  ? 471 SER B CB   1 
ATOM   6357 O  OG   . SER B 1 110 ? -0.656  -15.069 -36.039 1.00 74.02  ? 471 SER B OG   1 
ATOM   6358 H  H    . SER B 1 110 ? -1.668  -16.503 -38.064 1.00 61.40  ? 471 SER B H    1 
ATOM   6359 H  HA   . SER B 1 110 ? -2.433  -17.767 -35.777 1.00 72.01  ? 471 SER B HA   1 
ATOM   6360 H  HB2  . SER B 1 110 ? -1.399  -16.067 -34.526 1.00 87.08  ? 471 SER B HB2  1 
ATOM   6361 H  HB3  . SER B 1 110 ? -0.329  -16.882 -35.372 1.00 87.08  ? 471 SER B HB3  1 
ATOM   6362 H  HG   . SER B 1 110 ? -0.036  -14.719 -35.593 1.00 88.83  ? 471 SER B HG   1 
ATOM   6363 N  N    . LEU B 1 111 ? -3.992  -15.878 -34.986 1.00 54.55  ? 472 LEU B N    1 
ATOM   6364 C  CA   . LEU B 1 111 ? -5.198  -15.096 -34.795 1.00 52.58  ? 472 LEU B CA   1 
ATOM   6365 C  C    . LEU B 1 111 ? -5.231  -14.608 -33.354 1.00 55.65  ? 472 LEU B C    1 
ATOM   6366 O  O    . LEU B 1 111 ? -4.989  -15.381 -32.426 1.00 50.74  ? 472 LEU B O    1 
ATOM   6367 C  CB   . LEU B 1 111 ? -6.428  -15.937 -35.127 1.00 55.33  ? 472 LEU B CB   1 
ATOM   6368 C  CG   . LEU B 1 111 ? -7.789  -15.252 -35.178 1.00 63.54  ? 472 LEU B CG   1 
ATOM   6369 C  CD1  . LEU B 1 111 ? -7.795  -14.102 -36.184 1.00 86.21  ? 472 LEU B CD1  1 
ATOM   6370 C  CD2  . LEU B 1 111 ? -8.846  -16.286 -35.532 1.00 67.35  ? 472 LEU B CD2  1 
ATOM   6371 H  H    . LEU B 1 111 ? -3.679  -16.218 -34.260 1.00 65.46  ? 472 LEU B H    1 
ATOM   6372 H  HA   . LEU B 1 111 ? -5.183  -14.325 -35.383 1.00 63.09  ? 472 LEU B HA   1 
ATOM   6373 H  HB2  . LEU B 1 111 ? -6.285  -16.340 -35.998 1.00 66.39  ? 472 LEU B HB2  1 
ATOM   6374 H  HB3  . LEU B 1 111 ? -6.494  -16.641 -34.463 1.00 66.39  ? 472 LEU B HB3  1 
ATOM   6375 H  HG   . LEU B 1 111 ? -7.998  -14.892 -34.303 1.00 76.25  ? 472 LEU B HG   1 
ATOM   6376 H  HD11 . LEU B 1 111 ? -8.674  -13.692 -36.188 1.00 103.45 ? 472 LEU B HD11 1 
ATOM   6377 H  HD12 . LEU B 1 111 ? -7.127  -13.450 -35.921 1.00 103.45 ? 472 LEU B HD12 1 
ATOM   6378 H  HD13 . LEU B 1 111 ? -7.588  -14.452 -37.065 1.00 103.45 ? 472 LEU B HD13 1 
ATOM   6379 H  HD21 . LEU B 1 111 ? -9.712  -15.852 -35.565 1.00 80.82  ? 472 LEU B HD21 1 
ATOM   6380 H  HD22 . LEU B 1 111 ? -8.634  -16.670 -36.397 1.00 80.82  ? 472 LEU B HD22 1 
ATOM   6381 H  HD23 . LEU B 1 111 ? -8.848  -16.979 -34.853 1.00 80.82  ? 472 LEU B HD23 1 
ATOM   6382 N  N    . MET B 1 112 ? -5.507  -13.320 -33.181 1.00 56.73  ? 473 MET B N    1 
ATOM   6383 C  CA   . MET B 1 112 ? -5.487  -12.689 -31.872 1.00 63.25  ? 473 MET B CA   1 
ATOM   6384 C  C    . MET B 1 112 ? -6.716  -11.805 -31.755 1.00 68.68  ? 473 MET B C    1 
ATOM   6385 O  O    . MET B 1 112 ? -6.842  -10.805 -32.463 1.00 64.10  ? 473 MET B O    1 
ATOM   6386 C  CB   . MET B 1 112 ? -4.201  -11.881 -31.683 1.00 77.83  ? 473 MET B CB   1 
ATOM   6387 C  CG   . MET B 1 112 ? -3.917  -11.466 -30.247 1.00 100.03 ? 473 MET B CG   1 
ATOM   6388 S  SD   . MET B 1 112 ? -2.206  -10.947 -29.993 1.00 151.17 ? 473 MET B SD   1 
ATOM   6389 C  CE   . MET B 1 112 ? -1.326  -12.492 -30.250 1.00 78.94  ? 473 MET B CE   1 
ATOM   6390 H  H    . MET B 1 112 ? -5.713  -12.783 -33.821 1.00 68.08  ? 473 MET B H    1 
ATOM   6391 H  HA   . MET B 1 112 ? -5.519  -13.374 -31.186 1.00 75.90  ? 473 MET B HA   1 
ATOM   6392 H  HB2  . MET B 1 112 ? -3.452  -12.416 -31.988 1.00 93.39  ? 473 MET B HB2  1 
ATOM   6393 H  HB3  . MET B 1 112 ? -4.263  -11.072 -32.216 1.00 93.39  ? 473 MET B HB3  1 
ATOM   6394 H  HG2  . MET B 1 112 ? -4.494  -10.721 -30.013 1.00 120.03 ? 473 MET B HG2  1 
ATOM   6395 H  HG3  . MET B 1 112 ? -4.093  -12.218 -29.660 1.00 120.03 ? 473 MET B HG3  1 
ATOM   6396 H  HE1  . MET B 1 112 ? -0.375  -12.336 -30.138 1.00 94.73  ? 473 MET B HE1  1 
ATOM   6397 H  HE2  . MET B 1 112 ? -1.634  -13.143 -29.600 1.00 94.73  ? 473 MET B HE2  1 
ATOM   6398 H  HE3  . MET B 1 112 ? -1.505  -12.811 -31.149 1.00 94.73  ? 473 MET B HE3  1 
ATOM   6399 N  N    . ILE B 1 113 ? -7.623  -12.192 -30.866 1.00 53.05  ? 474 ILE B N    1 
ATOM   6400 C  CA   . ILE B 1 113 ? -8.932  -11.561 -30.769 1.00 65.44  ? 474 ILE B CA   1 
ATOM   6401 C  C    . ILE B 1 113 ? -9.133  -10.946 -29.389 1.00 60.21  ? 474 ILE B C    1 
ATOM   6402 O  O    . ILE B 1 113 ? -8.875  -11.590 -28.375 1.00 55.29  ? 474 ILE B O    1 
ATOM   6403 C  CB   . ILE B 1 113 ? -10.051 -12.581 -31.053 1.00 59.90  ? 474 ILE B CB   1 
ATOM   6404 C  CG1  . ILE B 1 113 ? -9.867  -13.177 -32.455 1.00 76.52  ? 474 ILE B CG1  1 
ATOM   6405 C  CG2  . ILE B 1 113 ? -11.421 -11.925 -30.928 1.00 65.95  ? 474 ILE B CG2  1 
ATOM   6406 C  CD1  . ILE B 1 113 ? -10.776 -14.350 -32.761 1.00 69.73  ? 474 ILE B CD1  1 
ATOM   6407 H  H    . ILE B 1 113 ? -7.502  -12.828 -30.300 1.00 63.66  ? 474 ILE B H    1 
ATOM   6408 H  HA   . ILE B 1 113 ? -8.993  -10.852 -31.428 1.00 78.53  ? 474 ILE B HA   1 
ATOM   6409 H  HB   . ILE B 1 113 ? -9.990  -13.297 -30.402 1.00 71.88  ? 474 ILE B HB   1 
ATOM   6410 H  HG12 . ILE B 1 113 ? -10.046 -12.487 -33.112 1.00 91.82  ? 474 ILE B HG12 1 
ATOM   6411 H  HG13 . ILE B 1 113 ? -8.951  -13.484 -32.544 1.00 91.82  ? 474 ILE B HG13 1 
ATOM   6412 H  HG21 . ILE B 1 113 ? -12.105 -12.587 -31.112 1.00 79.13  ? 474 ILE B HG21 1 
ATOM   6413 H  HG22 . ILE B 1 113 ? -11.525 -11.582 -30.027 1.00 79.13  ? 474 ILE B HG22 1 
ATOM   6414 H  HG23 . ILE B 1 113 ? -11.482 -11.199 -31.568 1.00 79.13  ? 474 ILE B HG23 1 
ATOM   6415 H  HD11 . ILE B 1 113 ? -10.594 -14.663 -33.660 1.00 83.68  ? 474 ILE B HD11 1 
ATOM   6416 H  HD12 . ILE B 1 113 ? -10.602 -15.059 -32.122 1.00 83.68  ? 474 ILE B HD12 1 
ATOM   6417 H  HD13 . ILE B 1 113 ? -11.699 -14.060 -32.691 1.00 83.68  ? 474 ILE B HD13 1 
ATOM   6418 N  N    . ASP B 1 114 ? -9.599  -9.701  -29.362 1.00 69.26  ? 475 ASP B N    1 
ATOM   6419 C  CA   . ASP B 1 114 ? -9.855  -9.001  -28.106 1.00 73.48  ? 475 ASP B CA   1 
ATOM   6420 C  C    . ASP B 1 114 ? -11.095 -9.548  -27.414 1.00 59.28  ? 475 ASP B C    1 
ATOM   6421 O  O    . ASP B 1 114 ? -12.204 -9.455  -27.940 1.00 70.62  ? 475 ASP B O    1 
ATOM   6422 C  CB   . ASP B 1 114 ? -10.022 -7.499  -28.347 1.00 103.43 ? 475 ASP B CB   1 
ATOM   6423 C  CG   . ASP B 1 114 ? -8.708  -6.804  -28.647 1.00 117.90 ? 475 ASP B CG   1 
ATOM   6424 O  OD1  . ASP B 1 114 ? -8.008  -6.422  -27.684 1.00 132.76 ? 475 ASP B OD1  1 
ATOM   6425 O  OD2  . ASP B 1 114 ? -8.379  -6.635  -29.841 1.00 119.30 ? 475 ASP B OD2  1 
ATOM   6426 H  H    . ASP B 1 114 ? -9.776  -9.236  -30.063 1.00 83.11  ? 475 ASP B H    1 
ATOM   6427 H  HA   . ASP B 1 114 ? -9.098  -9.129  -27.513 1.00 88.17  ? 475 ASP B HA   1 
ATOM   6428 H  HB2  . ASP B 1 114 ? -10.612 -7.364  -29.105 1.00 124.11 ? 475 ASP B HB2  1 
ATOM   6429 H  HB3  . ASP B 1 114 ? -10.402 -7.091  -27.553 1.00 124.11 ? 475 ASP B HB3  1 
ATOM   6430 N  N    . LEU B 1 115 ? -10.903 -10.100 -26.222 1.00 52.83  ? 476 LEU B N    1 
ATOM   6431 C  CA   . LEU B 1 115 ? -12.000 -10.703 -25.475 1.00 60.87  ? 476 LEU B CA   1 
ATOM   6432 C  C    . LEU B 1 115 ? -13.090 -9.696  -25.100 1.00 72.77  ? 476 LEU B C    1 
ATOM   6433 O  O    . LEU B 1 115 ? -14.272 -10.022 -25.179 1.00 76.87  ? 476 LEU B O    1 
ATOM   6434 C  CB   . LEU B 1 115 ? -11.465 -11.383 -24.213 1.00 59.80  ? 476 LEU B CB   1 
ATOM   6435 C  CG   . LEU B 1 115 ? -10.714 -12.695 -24.455 1.00 63.44  ? 476 LEU B CG   1 
ATOM   6436 C  CD1  . LEU B 1 115 ? -10.098 -13.198 -23.169 1.00 57.61  ? 476 LEU B CD1  1 
ATOM   6437 C  CD2  . LEU B 1 115 ? -11.625 -13.760 -25.039 1.00 60.16  ? 476 LEU B CD2  1 
ATOM   6438 H  H    . LEU B 1 115 ? -10.143 -10.139 -25.822 1.00 63.40  ? 476 LEU B H    1 
ATOM   6439 H  HA   . LEU B 1 115 ? -12.410 -11.387 -26.027 1.00 73.05  ? 476 LEU B HA   1 
ATOM   6440 H  HB2  . LEU B 1 115 ? -10.855 -10.773 -23.769 1.00 71.76  ? 476 LEU B HB2  1 
ATOM   6441 H  HB3  . LEU B 1 115 ? -12.214 -11.577 -23.627 1.00 71.76  ? 476 LEU B HB3  1 
ATOM   6442 H  HG   . LEU B 1 115 ? -9.996  -12.535 -25.088 1.00 76.13  ? 476 LEU B HG   1 
ATOM   6443 H  HD11 . LEU B 1 115 ? -9.629  -14.028 -23.348 1.00 69.13  ? 476 LEU B HD11 1 
ATOM   6444 H  HD12 . LEU B 1 115 ? -9.477  -12.532 -22.835 1.00 69.13  ? 476 LEU B HD12 1 
ATOM   6445 H  HD13 . LEU B 1 115 ? -10.803 -13.349 -22.520 1.00 69.13  ? 476 LEU B HD13 1 
ATOM   6446 H  HD21 . LEU B 1 115 ? -11.113 -14.573 -25.176 1.00 72.19  ? 476 LEU B HD21 1 
ATOM   6447 H  HD22 . LEU B 1 115 ? -12.352 -13.928 -24.419 1.00 72.19  ? 476 LEU B HD22 1 
ATOM   6448 H  HD23 . LEU B 1 115 ? -11.978 -13.444 -25.885 1.00 72.19  ? 476 LEU B HD23 1 
ATOM   6449 N  N    . ILE B 1 116 ? -12.706 -8.482  -24.708 1.00 66.97  ? 477 ILE B N    1 
ATOM   6450 C  CA   . ILE B 1 116 ? -13.697 -7.470  -24.333 1.00 81.36  ? 477 ILE B CA   1 
ATOM   6451 C  C    . ILE B 1 116 ? -14.715 -7.268  -25.451 1.00 83.98  ? 477 ILE B C    1 
ATOM   6452 O  O    . ILE B 1 116 ? -15.894 -7.039  -25.194 1.00 82.15  ? 477 ILE B O    1 
ATOM   6453 C  CB   . ILE B 1 116 ? -13.046 -6.102  -23.981 1.00 100.96 ? 477 ILE B CB   1 
ATOM   6454 C  CG1  . ILE B 1 116 ? -12.298 -5.506  -25.181 1.00 105.43 ? 477 ILE B CG1  1 
ATOM   6455 C  CG2  . ILE B 1 116 ? -12.115 -6.253  -22.783 1.00 91.54  ? 477 ILE B CG2  1 
ATOM   6456 C  CD1  . ILE B 1 116 ? -11.922 -4.051  -25.003 1.00 104.96 ? 477 ILE B CD1  1 
ATOM   6457 H  H    . ILE B 1 116 ? -11.889 -8.219  -24.650 1.00 80.36  ? 477 ILE B H    1 
ATOM   6458 H  HA   . ILE B 1 116 ? -14.176 -7.780  -23.549 1.00 97.63  ? 477 ILE B HA   1 
ATOM   6459 H  HB   . ILE B 1 116 ? -13.755 -5.488  -23.735 1.00 121.16 ? 477 ILE B HB   1 
ATOM   6460 H  HG12 . ILE B 1 116 ? -11.480 -6.008  -25.321 1.00 126.52 ? 477 ILE B HG12 1 
ATOM   6461 H  HG13 . ILE B 1 116 ? -12.862 -5.572  -25.967 1.00 126.52 ? 477 ILE B HG13 1 
ATOM   6462 H  HG21 . ILE B 1 116 ? -11.720 -5.390  -22.580 1.00 109.85 ? 477 ILE B HG21 1 
ATOM   6463 H  HG22 . ILE B 1 116 ? -12.628 -6.569  -22.023 1.00 109.85 ? 477 ILE B HG22 1 
ATOM   6464 H  HG23 . ILE B 1 116 ? -11.420 -6.892  -23.002 1.00 109.85 ? 477 ILE B HG23 1 
ATOM   6465 H  HD11 . ILE B 1 116 ? -11.455 -3.746  -25.797 1.00 125.95 ? 477 ILE B HD11 1 
ATOM   6466 H  HD12 . ILE B 1 116 ? -12.730 -3.530  -24.874 1.00 125.95 ? 477 ILE B HD12 1 
ATOM   6467 H  HD13 . ILE B 1 116 ? -11.346 -3.966  -24.227 1.00 125.95 ? 477 ILE B HD13 1 
ATOM   6468 N  N    . GLU B 1 117 ? -14.265 -7.374  -26.694 1.00 79.32  ? 478 GLU B N    1 
ATOM   6469 C  CA   . GLU B 1 117 ? -15.165 -7.211  -27.817 1.00 70.77  ? 478 GLU B CA   1 
ATOM   6470 C  C    . GLU B 1 117 ? -16.069 -8.432  -27.938 1.00 69.87  ? 478 GLU B C    1 
ATOM   6471 O  O    . GLU B 1 117 ? -17.249 -8.303  -28.268 1.00 75.88  ? 478 GLU B O    1 
ATOM   6472 C  CB   . GLU B 1 117 ? -14.378 -6.972  -29.107 1.00 101.60 ? 478 GLU B CB   1 
ATOM   6473 C  CG   . GLU B 1 117 ? -13.628 -5.645  -29.098 1.00 118.90 ? 478 GLU B CG   1 
ATOM   6474 C  CD   . GLU B 1 117 ? -12.846 -5.393  -30.369 1.00 136.29 ? 478 GLU B CD   1 
ATOM   6475 O  OE1  . GLU B 1 117 ? -12.745 -6.317  -31.203 1.00 147.16 ? 478 GLU B OE1  1 
ATOM   6476 O  OE2  . GLU B 1 117 ? -12.332 -4.266  -30.533 1.00 143.18 ? 478 GLU B OE2  1 
ATOM   6477 H  H    . GLU B 1 117 ? -13.449 -7.539  -26.909 1.00 95.18  ? 478 GLU B H    1 
ATOM   6478 H  HA   . GLU B 1 117 ? -15.728 -6.436  -27.662 1.00 84.93  ? 478 GLU B HA   1 
ATOM   6479 H  HB2  . GLU B 1 117 ? -13.728 -7.684  -29.218 1.00 121.92 ? 478 GLU B HB2  1 
ATOM   6480 H  HB3  . GLU B 1 117 ? -14.993 -6.965  -29.857 1.00 121.92 ? 478 GLU B HB3  1 
ATOM   6481 H  HG2  . GLU B 1 117 ? -14.268 -4.923  -28.993 1.00 142.68 ? 478 GLU B HG2  1 
ATOM   6482 H  HG3  . GLU B 1 117 ? -13.003 -5.642  -28.357 1.00 142.68 ? 478 GLU B HG3  1 
ATOM   6483 N  N    . VAL B 1 118 ? -15.522 -9.610  -27.651 1.00 61.82  ? 479 VAL B N    1 
ATOM   6484 C  CA   . VAL B 1 118 ? -16.313 -10.833 -27.679 1.00 72.15  ? 479 VAL B CA   1 
ATOM   6485 C  C    . VAL B 1 118 ? -17.396 -10.745 -26.615 1.00 78.37  ? 479 VAL B C    1 
ATOM   6486 O  O    . VAL B 1 118 ? -18.548 -11.110 -26.853 1.00 75.50  ? 479 VAL B O    1 
ATOM   6487 C  CB   . VAL B 1 118 ? -15.444 -12.084 -27.441 1.00 65.02  ? 479 VAL B CB   1 
ATOM   6488 C  CG1  . VAL B 1 118 ? -16.301 -13.349 -27.426 1.00 66.08  ? 479 VAL B CG1  1 
ATOM   6489 C  CG2  . VAL B 1 118 ? -14.361 -12.184 -28.500 1.00 60.43  ? 479 VAL B CG2  1 
ATOM   6490 H  H    . VAL B 1 118 ? -14.697 -9.726  -27.438 1.00 74.19  ? 479 VAL B H    1 
ATOM   6491 H  HA   . VAL B 1 118 ? -16.741 -10.919 -28.545 1.00 86.58  ? 479 VAL B HA   1 
ATOM   6492 H  HB   . VAL B 1 118 ? -15.010 -12.006 -26.576 1.00 78.02  ? 479 VAL B HB   1 
ATOM   6493 H  HG11 . VAL B 1 118 ? -15.728 -14.117 -27.274 1.00 79.30  ? 479 VAL B HG11 1 
ATOM   6494 H  HG12 . VAL B 1 118 ? -16.955 -13.279 -26.713 1.00 79.30  ? 479 VAL B HG12 1 
ATOM   6495 H  HG13 . VAL B 1 118 ? -16.751 -13.436 -28.281 1.00 79.30  ? 479 VAL B HG13 1 
ATOM   6496 H  HG21 . VAL B 1 118 ? -13.827 -12.976 -28.331 1.00 72.52  ? 479 VAL B HG21 1 
ATOM   6497 H  HG22 . VAL B 1 118 ? -14.779 -12.246 -29.373 1.00 72.52  ? 479 VAL B HG22 1 
ATOM   6498 H  HG23 . VAL B 1 118 ? -13.802 -11.392 -28.456 1.00 72.52  ? 479 VAL B HG23 1 
ATOM   6499 N  N    . GLU B 1 119 ? -17.010 -10.250 -25.443 1.00 64.15  ? 480 GLU B N    1 
ATOM   6500 C  CA   . GLU B 1 119 ? -17.945 -10.052 -24.347 1.00 73.77  ? 480 GLU B CA   1 
ATOM   6501 C  C    . GLU B 1 119 ? -19.068 -9.133  -24.801 1.00 69.71  ? 480 GLU B C    1 
ATOM   6502 O  O    . GLU B 1 119 ? -20.244 -9.432  -24.601 1.00 83.65  ? 480 GLU B O    1 
ATOM   6503 C  CB   . GLU B 1 119 ? -17.237 -9.462  -23.120 1.00 69.07  ? 480 GLU B CB   1 
ATOM   6504 C  CG   . GLU B 1 119 ? -16.107 -10.328 -22.585 1.00 88.74  ? 480 GLU B CG   1 
ATOM   6505 C  CD   . GLU B 1 119 ? -15.320 -9.665  -21.469 1.00 106.53 ? 480 GLU B CD   1 
ATOM   6506 O  OE1  . GLU B 1 119 ? -15.860 -8.739  -20.828 1.00 102.79 ? 480 GLU B OE1  1 
ATOM   6507 O  OE2  . GLU B 1 119 ? -14.161 -10.077 -21.236 1.00 93.51  ? 480 GLU B OE2  1 
ATOM   6508 H  H    . GLU B 1 119 ? -16.203 -10.019 -25.257 1.00 76.98  ? 480 GLU B H    1 
ATOM   6509 H  HA   . GLU B 1 119 ? -18.332 -10.905 -24.095 1.00 88.53  ? 480 GLU B HA   1 
ATOM   6510 H  HB2  . GLU B 1 119 ? -16.862 -8.601  -23.361 1.00 82.89  ? 480 GLU B HB2  1 
ATOM   6511 H  HB3  . GLU B 1 119 ? -17.887 -9.350  -22.409 1.00 82.89  ? 480 GLU B HB3  1 
ATOM   6512 H  HG2  . GLU B 1 119 ? -16.481 -11.152 -22.237 1.00 106.49 ? 480 GLU B HG2  1 
ATOM   6513 H  HG3  . GLU B 1 119 ? -15.492 -10.524 -23.308 1.00 106.49 ? 480 GLU B HG3  1 
ATOM   6514 N  N    . LYS B 1 120 ? -18.700 -8.019  -25.424 1.00 68.50  ? 481 LYS B N    1 
ATOM   6515 C  CA   . LYS B 1 120 ? -19.681 -7.049  -25.893 1.00 81.14  ? 481 LYS B CA   1 
ATOM   6516 C  C    . LYS B 1 120 ? -20.605 -7.674  -26.927 1.00 85.61  ? 481 LYS B C    1 
ATOM   6517 O  O    . LYS B 1 120 ? -21.824 -7.522  -26.857 1.00 89.68  ? 481 LYS B O    1 
ATOM   6518 C  CB   . LYS B 1 120 ? -18.984 -5.819  -26.486 1.00 89.68  ? 481 LYS B CB   1 
ATOM   6519 C  CG   . LYS B 1 120 ? -19.870 -4.948  -27.376 1.00 101.31 ? 481 LYS B CG   1 
ATOM   6520 C  CD   . LYS B 1 120 ? -21.139 -4.480  -26.670 1.00 121.83 ? 481 LYS B CD   1 
ATOM   6521 C  CE   . LYS B 1 120 ? -22.223 -4.110  -27.668 1.00 125.63 ? 481 LYS B CE   1 
ATOM   6522 N  NZ   . LYS B 1 120 ? -23.542 -3.911  -27.009 1.00 118.70 ? 481 LYS B NZ   1 
ATOM   6523 H  H    . LYS B 1 120 ? -17.884 -7.801  -25.588 1.00 82.20  ? 481 LYS B H    1 
ATOM   6524 H  HA   . LYS B 1 120 ? -20.222 -6.756  -25.143 1.00 97.37  ? 481 LYS B HA   1 
ATOM   6525 H  HB2  . LYS B 1 120 ? -18.664 -5.264  -25.757 1.00 107.62 ? 481 LYS B HB2  1 
ATOM   6526 H  HB3  . LYS B 1 120 ? -18.232 -6.117  -27.022 1.00 107.62 ? 481 LYS B HB3  1 
ATOM   6527 H  HG2  . LYS B 1 120 ? -19.370 -4.162  -27.647 1.00 121.57 ? 481 LYS B HG2  1 
ATOM   6528 H  HG3  . LYS B 1 120 ? -20.133 -5.459  -28.157 1.00 121.57 ? 481 LYS B HG3  1 
ATOM   6529 H  HD2  . LYS B 1 120 ? -21.474 -5.195  -26.107 1.00 146.20 ? 481 LYS B HD2  1 
ATOM   6530 H  HD3  . LYS B 1 120 ? -20.937 -3.696  -26.135 1.00 146.20 ? 481 LYS B HD3  1 
ATOM   6531 H  HE2  . LYS B 1 120 ? -21.979 -3.283  -28.112 1.00 150.76 ? 481 LYS B HE2  1 
ATOM   6532 H  HE3  . LYS B 1 120 ? -22.315 -4.824  -28.319 1.00 150.76 ? 481 LYS B HE3  1 
ATOM   6533 H  HZ1  . LYS B 1 120 ? -24.156 -3.696  -27.617 1.00 142.44 ? 481 LYS B HZ1  1 
ATOM   6534 H  HZ2  . LYS B 1 120 ? -23.792 -4.659  -26.598 1.00 142.44 ? 481 LYS B HZ2  1 
ATOM   6535 H  HZ3  . LYS B 1 120 ? -23.486 -3.255  -26.410 1.00 142.44 ? 481 LYS B HZ3  1 
ATOM   6536 N  N    . GLU B 1 121 ? -20.019 -8.381  -27.885 1.00 77.23  ? 482 GLU B N    1 
ATOM   6537 C  CA   . GLU B 1 121 ? -20.794 -8.978  -28.964 1.00 87.51  ? 482 GLU B CA   1 
ATOM   6538 C  C    . GLU B 1 121 ? -21.545 -10.224 -28.496 1.00 88.43  ? 482 GLU B C    1 
ATOM   6539 O  O    . GLU B 1 121 ? -22.557 -10.593 -29.088 1.00 76.31  ? 482 GLU B O    1 
ATOM   6540 C  CB   . GLU B 1 121 ? -19.881 -9.313  -30.146 1.00 81.43  ? 482 GLU B CB   1 
ATOM   6541 C  CG   . GLU B 1 121 ? -19.261 -8.076  -30.790 1.00 94.10  ? 482 GLU B CG   1 
ATOM   6542 C  CD   . GLU B 1 121 ? -18.487 -8.389  -32.053 1.00 119.23 ? 482 GLU B CD   1 
ATOM   6543 O  OE1  . GLU B 1 121 ? -19.100 -8.897  -33.015 1.00 126.50 ? 482 GLU B OE1  1 
ATOM   6544 O  OE2  . GLU B 1 121 ? -17.267 -8.118  -32.086 1.00 123.58 ? 482 GLU B OE2  1 
ATOM   6545 H  H    . GLU B 1 121 ? -19.173 -8.530  -27.933 1.00 92.67  ? 482 GLU B H    1 
ATOM   6546 H  HA   . GLU B 1 121 ? -21.451 -8.334  -29.270 1.00 105.01 ? 482 GLU B HA   1 
ATOM   6547 H  HB2  . GLU B 1 121 ? -19.159 -9.881  -29.836 1.00 97.71  ? 482 GLU B HB2  1 
ATOM   6548 H  HB3  . GLU B 1 121 ? -20.399 -9.775  -30.823 1.00 97.71  ? 482 GLU B HB3  1 
ATOM   6549 H  HG2  . GLU B 1 121 ? -19.969 -7.453  -31.020 1.00 112.92 ? 482 GLU B HG2  1 
ATOM   6550 H  HG3  . GLU B 1 121 ? -18.651 -7.665  -30.159 1.00 112.92 ? 482 GLU B HG3  1 
ATOM   6551 N  N    . ARG B 1 122 ? -21.038 -10.865 -27.443 1.00 78.96  ? 483 ARG B N    1 
ATOM   6552 C  CA   . ARG B 1 122 ? -21.704 -11.999 -26.788 1.00 69.52  ? 483 ARG B CA   1 
ATOM   6553 C  C    . ARG B 1 122 ? -21.681 -13.286 -27.609 1.00 78.78  ? 483 ARG B C    1 
ATOM   6554 O  O    . ARG B 1 122 ? -21.454 -14.368 -27.063 1.00 71.10  ? 483 ARG B O    1 
ATOM   6555 C  CB   . ARG B 1 122 ? -23.157 -11.650 -26.458 1.00 70.25  ? 483 ARG B CB   1 
ATOM   6556 C  CG   . ARG B 1 122 ? -23.323 -10.416 -25.602 1.00 88.87  ? 483 ARG B CG   1 
ATOM   6557 C  CD   . ARG B 1 122 ? -22.919 -10.701 -24.170 1.00 106.20 ? 483 ARG B CD   1 
ATOM   6558 N  NE   . ARG B 1 122 ? -23.015 -9.514  -23.329 1.00 102.52 ? 483 ARG B NE   1 
ATOM   6559 C  CZ   . ARG B 1 122 ? -22.976 -9.537  -22.002 1.00 93.68  ? 483 ARG B CZ   1 
ATOM   6560 N  NH1  . ARG B 1 122 ? -22.846 -10.690 -21.362 1.00 81.66  ? 483 ARG B NH1  1 
ATOM   6561 N  NH2  . ARG B 1 122 ? -23.073 -8.408  -21.315 1.00 108.62 ? 483 ARG B NH2  1 
ATOM   6562 H  H    . ARG B 1 122 ? -20.288 -10.658 -27.078 1.00 94.75  ? 483 ARG B H    1 
ATOM   6563 H  HA   . ARG B 1 122 ? -21.250 -12.179 -25.951 1.00 83.42  ? 483 ARG B HA   1 
ATOM   6564 H  HB2  . ARG B 1 122 ? -23.636 -11.500 -27.288 1.00 84.30  ? 483 ARG B HB2  1 
ATOM   6565 H  HB3  . ARG B 1 122 ? -23.554 -12.396 -25.981 1.00 84.30  ? 483 ARG B HB3  1 
ATOM   6566 H  HG2  . ARG B 1 122 ? -22.757 -9.706  -25.944 1.00 106.65 ? 483 ARG B HG2  1 
ATOM   6567 H  HG3  . ARG B 1 122 ? -24.253 -10.141 -25.609 1.00 106.65 ? 483 ARG B HG3  1 
ATOM   6568 H  HD2  . ARG B 1 122 ? -23.506 -11.380 -23.802 1.00 127.44 ? 483 ARG B HD2  1 
ATOM   6569 H  HD3  . ARG B 1 122 ? -22.000 -11.009 -24.153 1.00 127.44 ? 483 ARG B HD3  1 
ATOM   6570 H  HE   . ARG B 1 122 ? -23.053 -8.748  -23.717 1.00 123.03 ? 483 ARG B HE   1 
ATOM   6571 H  HH11 . ARG B 1 122 ? -22.784 -11.424 -21.806 1.00 97.99  ? 483 ARG B HH11 1 
ATOM   6572 H  HH12 . ARG B 1 122 ? -22.821 -10.704 -20.502 1.00 97.99  ? 483 ARG B HH12 1 
ATOM   6573 H  HH21 . ARG B 1 122 ? -23.158 -7.659  -21.729 1.00 130.34 ? 483 ARG B HH21 1 
ATOM   6574 H  HH22 . ARG B 1 122 ? -23.048 -8.424  -20.456 1.00 130.34 ? 483 ARG B HH22 1 
ATOM   6575 N  N    . LEU B 1 123 ? -21.943 -13.170 -28.908 1.00 73.82  ? 484 LEU B N    1 
ATOM   6576 C  CA   . LEU B 1 123 ? -21.921 -14.312 -29.814 1.00 77.24  ? 484 LEU B CA   1 
ATOM   6577 C  C    . LEU B 1 123 ? -21.309 -13.902 -31.147 1.00 69.71  ? 484 LEU B C    1 
ATOM   6578 O  O    . LEU B 1 123 ? -21.729 -12.920 -31.748 1.00 73.48  ? 484 LEU B O    1 
ATOM   6579 C  CB   . LEU B 1 123 ? -23.331 -14.870 -30.021 1.00 78.07  ? 484 LEU B CB   1 
ATOM   6580 C  CG   . LEU B 1 123 ? -23.573 -15.750 -31.253 1.00 83.05  ? 484 LEU B CG   1 
ATOM   6581 C  CD1  . LEU B 1 123 ? -22.636 -16.946 -31.299 1.00 78.07  ? 484 LEU B CD1  1 
ATOM   6582 C  CD2  . LEU B 1 123 ? -25.013 -16.219 -31.262 1.00 90.04  ? 484 LEU B CD2  1 
ATOM   6583 H  H    . LEU B 1 123 ? -22.139 -12.427 -29.294 1.00 88.59  ? 484 LEU B H    1 
ATOM   6584 H  HA   . LEU B 1 123 ? -21.371 -15.013 -29.430 1.00 92.69  ? 484 LEU B HA   1 
ATOM   6585 H  HB2  . LEU B 1 123 ? -23.560 -15.402 -29.243 1.00 93.68  ? 484 LEU B HB2  1 
ATOM   6586 H  HB3  . LEU B 1 123 ? -23.943 -14.120 -30.084 1.00 93.68  ? 484 LEU B HB3  1 
ATOM   6587 H  HG   . LEU B 1 123 ? -23.425 -15.221 -32.053 1.00 99.66  ? 484 LEU B HG   1 
ATOM   6588 H  HD11 . LEU B 1 123 ? -22.829 -17.467 -32.094 1.00 93.69  ? 484 LEU B HD11 1 
ATOM   6589 H  HD12 . LEU B 1 123 ? -21.720 -16.627 -31.327 1.00 93.69  ? 484 LEU B HD12 1 
ATOM   6590 H  HD13 . LEU B 1 123 ? -22.775 -17.486 -30.506 1.00 93.69  ? 484 LEU B HD13 1 
ATOM   6591 H  HD21 . LEU B 1 123 ? -25.159 -16.774 -32.043 1.00 108.05 ? 484 LEU B HD21 1 
ATOM   6592 H  HD22 . LEU B 1 123 ? -25.183 -16.730 -30.455 1.00 108.05 ? 484 LEU B HD22 1 
ATOM   6593 H  HD23 . LEU B 1 123 ? -25.596 -15.444 -31.293 1.00 108.05 ? 484 LEU B HD23 1 
ATOM   6594 N  N    . LEU B 1 124 ? -20.297 -14.653 -31.571 1.00 81.42  ? 485 LEU B N    1 
ATOM   6595 C  CA   . LEU B 1 124 ? -19.643 -14.472 -32.862 1.00 91.18  ? 485 LEU B CA   1 
ATOM   6596 C  C    . LEU B 1 124 ? -19.662 -15.782 -33.626 1.00 86.00  ? 485 LEU B C    1 
ATOM   6597 O  O    . LEU B 1 124 ? -19.416 -16.837 -33.051 1.00 75.12  ? 485 LEU B O    1 
ATOM   6598 C  CB   . LEU B 1 124 ? -18.197 -14.008 -32.687 1.00 83.36  ? 485 LEU B CB   1 
ATOM   6599 C  CG   . LEU B 1 124 ? -17.976 -12.508 -32.517 1.00 99.67  ? 485 LEU B CG   1 
ATOM   6600 C  CD1  . LEU B 1 124 ? -16.631 -12.239 -31.864 1.00 96.73  ? 485 LEU B CD1  1 
ATOM   6601 C  CD2  . LEU B 1 124 ? -18.063 -11.820 -33.868 1.00 119.01 ? 485 LEU B CD2  1 
ATOM   6602 H  H    . LEU B 1 124 ? -19.961 -15.297 -31.111 1.00 97.71  ? 485 LEU B H    1 
ATOM   6603 H  HA   . LEU B 1 124 ? -20.122 -13.805 -33.379 1.00 109.42 ? 485 LEU B HA   1 
ATOM   6604 H  HB2  . LEU B 1 124 ? -17.832 -14.442 -31.899 1.00 100.03 ? 485 LEU B HB2  1 
ATOM   6605 H  HB3  . LEU B 1 124 ? -17.693 -14.285 -33.468 1.00 100.03 ? 485 LEU B HB3  1 
ATOM   6606 H  HG   . LEU B 1 124 ? -18.670 -12.145 -31.945 1.00 119.60 ? 485 LEU B HG   1 
ATOM   6607 H  HD11 . LEU B 1 124 ? -16.513 -11.281 -31.767 1.00 116.07 ? 485 LEU B HD11 1 
ATOM   6608 H  HD12 . LEU B 1 124 ? -16.612 -12.665 -30.993 1.00 116.07 ? 485 LEU B HD12 1 
ATOM   6609 H  HD13 . LEU B 1 124 ? -15.929 -12.604 -32.427 1.00 116.07 ? 485 LEU B HD13 1 
ATOM   6610 H  HD21 . LEU B 1 124 ? -17.921 -10.868 -33.747 1.00 142.81 ? 485 LEU B HD21 1 
ATOM   6611 H  HD22 . LEU B 1 124 ? -17.380 -12.185 -34.452 1.00 142.81 ? 485 LEU B HD22 1 
ATOM   6612 H  HD23 . LEU B 1 124 ? -18.942 -11.978 -34.247 1.00 142.81 ? 485 LEU B HD23 1 
ATOM   6613 N  N    . ASP B 1 125 ? -19.965 -15.709 -34.915 1.00 78.82  ? 486 ASP B N    1 
ATOM   6614 C  CA   . ASP B 1 125 ? -19.845 -16.857 -35.805 1.00 71.09  ? 486 ASP B CA   1 
ATOM   6615 C  C    . ASP B 1 125 ? -19.341 -16.331 -37.145 1.00 81.26  ? 486 ASP B C    1 
ATOM   6616 O  O    . ASP B 1 125 ? -20.128 -15.917 -37.994 1.00 80.10  ? 486 ASP B O    1 
ATOM   6617 C  CB   . ASP B 1 125 ? -21.182 -17.592 -35.957 1.00 77.82  ? 486 ASP B CB   1 
ATOM   6618 C  CG   . ASP B 1 125 ? -21.019 -18.993 -36.523 1.00 87.33  ? 486 ASP B CG   1 
ATOM   6619 O  OD1  . ASP B 1 125 ? -19.926 -19.306 -37.032 1.00 92.76  ? 486 ASP B OD1  1 
ATOM   6620 O  OD2  . ASP B 1 125 ? -21.986 -19.782 -36.462 1.00 100.20 ? 486 ASP B OD2  1 
ATOM   6621 H  H    . ASP B 1 125 ? -20.246 -14.996 -35.305 1.00 94.58  ? 486 ASP B H    1 
ATOM   6622 H  HA   . ASP B 1 125 ? -19.189 -17.477 -35.450 1.00 85.31  ? 486 ASP B HA   1 
ATOM   6623 H  HB2  . ASP B 1 125 ? -21.602 -17.667 -35.086 1.00 93.38  ? 486 ASP B HB2  1 
ATOM   6624 H  HB3  . ASP B 1 125 ? -21.753 -17.089 -36.559 1.00 93.38  ? 486 ASP B HB3  1 
ATOM   6625 N  N    . GLU B 1 126 ? -18.022 -16.335 -37.314 1.00 85.53  ? 487 GLU B N    1 
ATOM   6626 C  CA   . GLU B 1 126 ? -17.390 -15.622 -38.416 1.00 87.38  ? 487 GLU B CA   1 
ATOM   6627 C  C    . GLU B 1 126 ? -16.184 -16.337 -39.001 1.00 86.79  ? 487 GLU B C    1 
ATOM   6628 O  O    . GLU B 1 126 ? -15.582 -17.210 -38.368 1.00 67.42  ? 487 GLU B O    1 
ATOM   6629 C  CB   . GLU B 1 126 ? -16.938 -14.237 -37.954 1.00 81.81  ? 487 GLU B CB   1 
ATOM   6630 C  CG   . GLU B 1 126 ? -18.049 -13.306 -37.531 1.00 103.97 ? 487 GLU B CG   1 
ATOM   6631 C  CD   . GLU B 1 126 ? -17.529 -11.926 -37.176 1.00 127.07 ? 487 GLU B CD   1 
ATOM   6632 O  OE1  . GLU B 1 126 ? -16.293 -11.734 -37.197 1.00 119.15 ? 487 GLU B OE1  1 
ATOM   6633 O  OE2  . GLU B 1 126 ? -18.352 -11.036 -36.877 1.00 146.39 ? 487 GLU B OE2  1 
ATOM   6634 H  H    . GLU B 1 126 ? -17.469 -16.747 -36.801 1.00 102.64 ? 487 GLU B H    1 
ATOM   6635 H  HA   . GLU B 1 126 ? -18.040 -15.503 -39.126 1.00 104.86 ? 487 GLU B HA   1 
ATOM   6636 H  HB2  . GLU B 1 126 ? -16.342 -14.345 -37.196 1.00 98.17  ? 487 GLU B HB2  1 
ATOM   6637 H  HB3  . GLU B 1 126 ? -16.461 -13.810 -38.683 1.00 98.17  ? 487 GLU B HB3  1 
ATOM   6638 H  HG2  . GLU B 1 126 ? -18.682 -13.212 -38.260 1.00 124.77 ? 487 GLU B HG2  1 
ATOM   6639 H  HG3  . GLU B 1 126 ? -18.492 -13.672 -36.749 1.00 124.77 ? 487 GLU B HG3  1 
ATOM   6640 N  N    . TRP B 1 127 ? -15.841 -15.928 -40.218 1.00 73.89  ? 488 TRP B N    1 
ATOM   6641 C  CA   . TRP B 1 127 ? -14.578 -16.276 -40.848 1.00 72.57  ? 488 TRP B CA   1 
ATOM   6642 C  C    . TRP B 1 127 ? -13.549 -15.200 -40.527 1.00 71.87  ? 488 TRP B C    1 
ATOM   6643 O  O    . TRP B 1 127 ? -13.831 -14.008 -40.637 1.00 74.67  ? 488 TRP B O    1 
ATOM   6644 C  CB   . TRP B 1 127 ? -14.747 -16.418 -42.364 1.00 76.20  ? 488 TRP B CB   1 
ATOM   6645 C  CG   . TRP B 1 127 ? -15.441 -17.671 -42.755 1.00 76.52  ? 488 TRP B CG   1 
ATOM   6646 C  CD1  . TRP B 1 127 ? -16.768 -17.827 -43.005 1.00 79.41  ? 488 TRP B CD1  1 
ATOM   6647 C  CD2  . TRP B 1 127 ? -14.844 -18.958 -42.929 1.00 74.15  ? 488 TRP B CD2  1 
ATOM   6648 N  NE1  . TRP B 1 127 ? -17.038 -19.134 -43.333 1.00 79.01  ? 488 TRP B NE1  1 
ATOM   6649 C  CE2  . TRP B 1 127 ? -15.871 -19.850 -43.292 1.00 88.96  ? 488 TRP B CE2  1 
ATOM   6650 C  CE3  . TRP B 1 127 ? -13.538 -19.445 -42.815 1.00 71.06  ? 488 TRP B CE3  1 
ATOM   6651 C  CZ2  . TRP B 1 127 ? -15.634 -21.199 -43.545 1.00 88.26  ? 488 TRP B CZ2  1 
ATOM   6652 C  CZ3  . TRP B 1 127 ? -13.305 -20.786 -43.067 1.00 73.08  ? 488 TRP B CZ3  1 
ATOM   6653 C  CH2  . TRP B 1 127 ? -14.348 -21.646 -43.428 1.00 83.47  ? 488 TRP B CH2  1 
ATOM   6654 H  H    . TRP B 1 127 ? -16.342 -15.432 -40.712 1.00 88.67  ? 488 TRP B H    1 
ATOM   6655 H  HA   . TRP B 1 127 ? -14.262 -17.121 -40.493 1.00 87.08  ? 488 TRP B HA   1 
ATOM   6656 H  HB2  . TRP B 1 127 ? -15.270 -15.671 -42.695 1.00 91.44  ? 488 TRP B HB2  1 
ATOM   6657 H  HB3  . TRP B 1 127 ? -13.871 -16.419 -42.780 1.00 91.44  ? 488 TRP B HB3  1 
ATOM   6658 H  HD1  . TRP B 1 127 ? -17.401 -17.147 -42.964 1.00 95.30  ? 488 TRP B HD1  1 
ATOM   6659 H  HE1  . TRP B 1 127 ? -17.813 -19.451 -43.530 1.00 94.82  ? 488 TRP B HE1  1 
ATOM   6660 H  HE3  . TRP B 1 127 ? -12.840 -18.878 -42.578 1.00 85.28  ? 488 TRP B HE3  1 
ATOM   6661 H  HZ2  . TRP B 1 127 ? -16.325 -21.774 -43.784 1.00 105.92 ? 488 TRP B HZ2  1 
ATOM   6662 H  HZ3  . TRP B 1 127 ? -12.440 -21.120 -42.995 1.00 87.70  ? 488 TRP B HZ3  1 
ATOM   6663 H  HH2  . TRP B 1 127 ? -14.162 -22.543 -43.590 1.00 100.17 ? 488 TRP B HH2  1 
ATOM   6664 N  N    . PHE B 1 128 ? -12.360 -15.631 -40.123 1.00 69.34  ? 489 PHE B N    1 
ATOM   6665 C  CA   . PHE B 1 128 ? -11.268 -14.719 -39.812 1.00 79.51  ? 489 PHE B CA   1 
ATOM   6666 C  C    . PHE B 1 128 ? -10.107 -14.942 -40.763 1.00 76.90  ? 489 PHE B C    1 
ATOM   6667 O  O    . PHE B 1 128 ? -9.668  -16.073 -40.951 1.00 80.88  ? 489 PHE B O    1 
ATOM   6668 C  CB   . PHE B 1 128 ? -10.793 -14.916 -38.372 1.00 77.05  ? 489 PHE B CB   1 
ATOM   6669 C  CG   . PHE B 1 128 ? -11.832 -14.600 -37.342 1.00 84.49  ? 489 PHE B CG   1 
ATOM   6670 C  CD1  . PHE B 1 128 ? -12.698 -15.582 -36.889 1.00 78.53  ? 489 PHE B CD1  1 
ATOM   6671 C  CD2  . PHE B 1 128 ? -11.938 -13.324 -36.818 1.00 84.68  ? 489 PHE B CD2  1 
ATOM   6672 C  CE1  . PHE B 1 128 ? -13.656 -15.294 -35.938 1.00 81.01  ? 489 PHE B CE1  1 
ATOM   6673 C  CE2  . PHE B 1 128 ? -12.892 -13.030 -35.866 1.00 75.56  ? 489 PHE B CE2  1 
ATOM   6674 C  CZ   . PHE B 1 128 ? -13.752 -14.016 -35.425 1.00 74.35  ? 489 PHE B CZ   1 
ATOM   6675 H  H    . PHE B 1 128 ? -12.158 -16.460 -40.020 1.00 83.20  ? 489 PHE B H    1 
ATOM   6676 H  HA   . PHE B 1 128 ? -11.574 -13.804 -39.911 1.00 95.41  ? 489 PHE B HA   1 
ATOM   6677 H  HB2  . PHE B 1 128 ? -10.531 -15.843 -38.254 1.00 92.46  ? 489 PHE B HB2  1 
ATOM   6678 H  HB3  . PHE B 1 128 ? -10.032 -14.337 -38.212 1.00 92.46  ? 489 PHE B HB3  1 
ATOM   6679 H  HD1  . PHE B 1 128 ? -12.637 -16.444 -37.233 1.00 94.23  ? 489 PHE B HD1  1 
ATOM   6680 H  HD2  . PHE B 1 128 ? -11.361 -12.657 -37.112 1.00 101.62 ? 489 PHE B HD2  1 
ATOM   6681 H  HE1  . PHE B 1 128 ? -14.234 -15.960 -35.642 1.00 97.22  ? 489 PHE B HE1  1 
ATOM   6682 H  HE2  . PHE B 1 128 ? -12.955 -12.168 -35.522 1.00 90.67  ? 489 PHE B HE2  1 
ATOM   6683 H  HZ   . PHE B 1 128 ? -14.396 -13.820 -34.784 1.00 89.22  ? 489 PHE B HZ   1 
ATOM   6684 N  N    . THR B 1 129 ? -9.602  -13.867 -41.355 1.00 73.50  ? 490 THR B N    1 
ATOM   6685 C  CA   . THR B 1 129 ? -8.405  -13.962 -42.175 1.00 81.78  ? 490 THR B CA   1 
ATOM   6686 C  C    . THR B 1 129 ? -7.194  -14.154 -41.268 1.00 79.50  ? 490 THR B C    1 
ATOM   6687 O  O    . THR B 1 129 ? -6.895  -13.309 -40.428 1.00 82.20  ? 490 THR B O    1 
ATOM   6688 C  CB   . THR B 1 129 ? -8.219  -12.712 -43.058 1.00 77.33  ? 490 THR B CB   1 
ATOM   6689 O  OG1  . THR B 1 129 ? -9.263  -12.665 -44.037 1.00 89.42  ? 490 THR B OG1  1 
ATOM   6690 C  CG2  . THR B 1 129 ? -6.875  -12.743 -43.775 1.00 76.12  ? 490 THR B CG2  1 
ATOM   6691 H  H    . THR B 1 129 ? -9.933  -13.075 -41.298 1.00 88.20  ? 490 THR B H    1 
ATOM   6692 H  HA   . THR B 1 129 ? -8.475  -14.735 -42.756 1.00 98.13  ? 490 THR B HA   1 
ATOM   6693 H  HB   . THR B 1 129 ? -8.256  -11.916 -42.505 1.00 92.80  ? 490 THR B HB   1 
ATOM   6694 H  HG1  . THR B 1 129 ? -9.171  -11.987 -44.523 1.00 107.30 ? 490 THR B HG1  1 
ATOM   6695 H  HG21 . THR B 1 129 ? -6.775  -11.951 -44.325 1.00 91.34  ? 490 THR B HG21 1 
ATOM   6696 H  HG22 . THR B 1 129 ? -6.154  -12.770 -43.127 1.00 91.34  ? 490 THR B HG22 1 
ATOM   6697 H  HG23 . THR B 1 129 ? -6.820  -13.529 -44.341 1.00 91.34  ? 490 THR B HG23 1 
ATOM   6698 N  N    . LEU B 1 130 ? -6.508  -15.279 -41.433 1.00 64.76  ? 491 LEU B N    1 
ATOM   6699 C  CA   . LEU B 1 130 ? -5.341  -15.590 -40.619 1.00 75.46  ? 491 LEU B CA   1 
ATOM   6700 C  C    . LEU B 1 130 ? -4.227  -14.576 -40.816 1.00 71.01  ? 491 LEU B C    1 
ATOM   6701 O  O    . LEU B 1 130 ? -3.895  -14.218 -41.941 1.00 67.68  ? 491 LEU B O    1 
ATOM   6702 C  CB   . LEU B 1 130 ? -4.822  -16.985 -40.948 1.00 63.52  ? 491 LEU B CB   1 
ATOM   6703 C  CG   . LEU B 1 130 ? -5.760  -18.126 -40.570 1.00 58.11  ? 491 LEU B CG   1 
ATOM   6704 C  CD1  . LEU B 1 130 ? -5.257  -19.424 -41.173 1.00 57.38  ? 491 LEU B CD1  1 
ATOM   6705 C  CD2  . LEU B 1 130 ? -5.888  -18.239 -39.048 1.00 58.90  ? 491 LEU B CD2  1 
ATOM   6706 H  H    . LEU B 1 130 ? -6.700  -15.884 -42.014 1.00 77.71  ? 491 LEU B H    1 
ATOM   6707 H  HA   . LEU B 1 130 ? -5.597  -15.577 -39.683 1.00 90.55  ? 491 LEU B HA   1 
ATOM   6708 H  HB2  . LEU B 1 130 ? -4.666  -17.039 -41.904 1.00 76.23  ? 491 LEU B HB2  1 
ATOM   6709 H  HB3  . LEU B 1 130 ? -3.987  -17.124 -40.474 1.00 76.23  ? 491 LEU B HB3  1 
ATOM   6710 H  HG   . LEU B 1 130 ? -6.641  -17.946 -40.934 1.00 69.73  ? 491 LEU B HG   1 
ATOM   6711 H  HD11 . LEU B 1 130 ? -5.862  -20.141 -40.926 1.00 68.85  ? 491 LEU B HD11 1 
ATOM   6712 H  HD12 . LEU B 1 130 ? -5.228  -19.334 -42.138 1.00 68.85  ? 491 LEU B HD12 1 
ATOM   6713 H  HD13 . LEU B 1 130 ? -4.368  -19.607 -40.830 1.00 68.85  ? 491 LEU B HD13 1 
ATOM   6714 H  HD21 . LEU B 1 130 ? -6.489  -18.971 -38.835 1.00 70.68  ? 491 LEU B HD21 1 
ATOM   6715 H  HD22 . LEU B 1 130 ? -5.011  -18.410 -38.670 1.00 70.68  ? 491 LEU B HD22 1 
ATOM   6716 H  HD23 . LEU B 1 130 ? -6.243  -17.407 -38.698 1.00 70.68  ? 491 LEU B HD23 1 
ATOM   6717 N  N    . ASP B 1 131 ? -3.643  -14.126 -39.711 1.00 72.58  ? 492 ASP B N    1 
ATOM   6718 C  CA   . ASP B 1 131 ? -2.535  -13.183 -39.762 1.00 63.08  ? 492 ASP B CA   1 
ATOM   6719 C  C    . ASP B 1 131 ? -1.212  -13.915 -39.936 1.00 65.65  ? 492 ASP B C    1 
ATOM   6720 O  O    . ASP B 1 131 ? -1.114  -15.116 -39.662 1.00 58.29  ? 492 ASP B O    1 
ATOM   6721 C  CB   . ASP B 1 131 ? -2.491  -12.326 -38.491 1.00 74.90  ? 492 ASP B CB   1 
ATOM   6722 C  CG   . ASP B 1 131 ? -3.777  -11.558 -38.261 1.00 101.27 ? 492 ASP B CG   1 
ATOM   6723 O  OD1  . ASP B 1 131 ? -4.481  -11.260 -39.249 1.00 118.12 ? 492 ASP B OD1  1 
ATOM   6724 O  OD2  . ASP B 1 131 ? -4.081  -11.249 -37.089 1.00 119.67 ? 492 ASP B OD2  1 
ATOM   6725 H  H    . ASP B 1 131 ? -3.873  -14.354 -38.914 1.00 87.10  ? 492 ASP B H    1 
ATOM   6726 H  HA   . ASP B 1 131 ? -2.656  -12.591 -40.522 1.00 75.69  ? 492 ASP B HA   1 
ATOM   6727 H  HB2  . ASP B 1 131 ? -2.345  -12.904 -37.726 1.00 89.88  ? 492 ASP B HB2  1 
ATOM   6728 H  HB3  . ASP B 1 131 ? -1.768  -11.685 -38.567 1.00 89.88  ? 492 ASP B HB3  1 
ATOM   6729 N  N    . GLU B 1 132 ? -0.207  -13.176 -40.406 1.00 67.73  ? 493 GLU B N    1 
ATOM   6730 C  CA   . GLU B 1 132 ? 1.177   -13.646 -40.468 1.00 71.27  ? 493 GLU B CA   1 
ATOM   6731 C  C    . GLU B 1 132 ? 1.386   -14.727 -41.525 1.00 72.79  ? 493 GLU B C    1 
ATOM   6732 O  O    . GLU B 1 132 ? 2.411   -15.411 -41.523 1.00 66.41  ? 493 GLU B O    1 
ATOM   6733 C  CB   . GLU B 1 132 ? 1.621   -14.157 -39.089 1.00 68.47  ? 493 GLU B CB   1 
ATOM   6734 C  CG   . GLU B 1 132 ? 1.422   -13.133 -37.979 1.00 80.56  ? 493 GLU B CG   1 
ATOM   6735 C  CD   . GLU B 1 132 ? 2.142   -11.831 -38.264 1.00 91.04  ? 493 GLU B CD   1 
ATOM   6736 O  OE1  . GLU B 1 132 ? 3.264   -11.886 -38.807 1.00 101.13 ? 493 GLU B OE1  1 
ATOM   6737 O  OE2  . GLU B 1 132 ? 1.583   -10.755 -37.961 1.00 106.18 ? 493 GLU B OE2  1 
ATOM   6738 H  H    . GLU B 1 132 ? -0.306  -12.376 -40.704 1.00 81.28  ? 493 GLU B H    1 
ATOM   6739 H  HA   . GLU B 1 132 ? 1.747   -12.896 -40.700 1.00 85.53  ? 493 GLU B HA   1 
ATOM   6740 H  HB2  . GLU B 1 132 ? 1.103   -14.946 -38.864 1.00 82.17  ? 493 GLU B HB2  1 
ATOM   6741 H  HB3  . GLU B 1 132 ? 2.564   -14.380 -39.124 1.00 82.17  ? 493 GLU B HB3  1 
ATOM   6742 H  HG2  . GLU B 1 132 ? 0.476   -12.941 -37.890 1.00 96.67  ? 493 GLU B HG2  1 
ATOM   6743 H  HG3  . GLU B 1 132 ? 1.769   -13.494 -37.148 1.00 96.67  ? 493 GLU B HG3  1 
ATOM   6744 N  N    . VAL B 1 133 ? 0.414   -14.876 -42.420 1.00 76.53  ? 494 VAL B N    1 
ATOM   6745 C  CA   . VAL B 1 133 ? 0.561   -15.734 -43.590 1.00 64.54  ? 494 VAL B CA   1 
ATOM   6746 C  C    . VAL B 1 133 ? -0.142  -15.076 -44.778 1.00 70.38  ? 494 VAL B C    1 
ATOM   6747 O  O    . VAL B 1 133 ? -1.037  -14.250 -44.589 1.00 82.97  ? 494 VAL B O    1 
ATOM   6748 C  CB   . VAL B 1 133 ? -0.016  -17.156 -43.368 1.00 62.14  ? 494 VAL B CB   1 
ATOM   6749 C  CG1  . VAL B 1 133 ? 0.913   -17.996 -42.496 1.00 58.90  ? 494 VAL B CG1  1 
ATOM   6750 C  CG2  . VAL B 1 133 ? -1.409  -17.090 -42.759 1.00 68.54  ? 494 VAL B CG2  1 
ATOM   6751 H  H    . VAL B 1 133 ? -0.351  -14.485 -42.371 1.00 91.83  ? 494 VAL B H    1 
ATOM   6752 H  HA   . VAL B 1 133 ? 1.503   -15.821 -43.805 1.00 77.45  ? 494 VAL B HA   1 
ATOM   6753 H  HB   . VAL B 1 133 ? -0.092  -17.598 -44.228 1.00 74.57  ? 494 VAL B HB   1 
ATOM   6754 H  HG11 . VAL B 1 133 ? 0.524   -18.876 -42.377 1.00 70.67  ? 494 VAL B HG11 1 
ATOM   6755 H  HG12 . VAL B 1 133 ? 1.775   -18.071 -42.935 1.00 70.67  ? 494 VAL B HG12 1 
ATOM   6756 H  HG13 . VAL B 1 133 ? 1.018   -17.560 -41.635 1.00 70.67  ? 494 VAL B HG13 1 
ATOM   6757 H  HG21 . VAL B 1 133 ? -1.741  -17.993 -42.633 1.00 82.25  ? 494 VAL B HG21 1 
ATOM   6758 H  HG22 . VAL B 1 133 ? -1.359  -16.633 -41.905 1.00 82.25  ? 494 VAL B HG22 1 
ATOM   6759 H  HG23 . VAL B 1 133 ? -1.994  -16.604 -43.362 1.00 82.25  ? 494 VAL B HG23 1 
ATOM   6760 N  N    . PRO B 1 134 ? 0.263   -15.436 -46.008 1.00 75.42  ? 495 PRO B N    1 
ATOM   6761 C  CA   . PRO B 1 134 ? -0.316  -14.791 -47.194 1.00 76.68  ? 495 PRO B CA   1 
ATOM   6762 C  C    . PRO B 1 134 ? -1.712  -15.299 -47.529 1.00 75.26  ? 495 PRO B C    1 
ATOM   6763 O  O    . PRO B 1 134 ? -2.342  -14.788 -48.455 1.00 92.75  ? 495 PRO B O    1 
ATOM   6764 C  CB   . PRO B 1 134 ? 0.658   -15.167 -48.324 1.00 76.25  ? 495 PRO B CB   1 
ATOM   6765 C  CG   . PRO B 1 134 ? 1.758   -15.973 -47.702 1.00 72.98  ? 495 PRO B CG   1 
ATOM   6766 C  CD   . PRO B 1 134 ? 1.259   -16.455 -46.373 1.00 69.19  ? 495 PRO B CD   1 
ATOM   6767 H  HA   . PRO B 1 134 ? -0.334  -13.828 -47.086 1.00 92.01  ? 495 PRO B HA   1 
ATOM   6768 H  HB2  . PRO B 1 134 ? 0.190   -15.694 -48.991 1.00 91.50  ? 495 PRO B HB2  1 
ATOM   6769 H  HB3  . PRO B 1 134 ? 1.016   -14.359 -48.722 1.00 91.50  ? 495 PRO B HB3  1 
ATOM   6770 H  HG2  . PRO B 1 134 ? 1.967   -16.726 -48.276 1.00 87.58  ? 495 PRO B HG2  1 
ATOM   6771 H  HG3  . PRO B 1 134 ? 2.540   -15.411 -47.585 1.00 87.58  ? 495 PRO B HG3  1 
ATOM   6772 H  HD2  . PRO B 1 134 ? 0.838   -17.325 -46.463 1.00 83.03  ? 495 PRO B HD2  1 
ATOM   6773 H  HD3  . PRO B 1 134 ? 1.981   -16.473 -45.725 1.00 83.03  ? 495 PRO B HD3  1 
ATOM   6774 N  N    . LYS B 1 135 ? -2.186  -16.289 -46.781 1.00 80.06  ? 496 LYS B N    1 
ATOM   6775 C  CA   . LYS B 1 135 ? -3.327  -17.081 -47.215 1.00 76.78  ? 496 LYS B CA   1 
ATOM   6776 C  C    . LYS B 1 135 ? -3.865  -17.954 -46.088 1.00 69.15  ? 496 LYS B C    1 
ATOM   6777 O  O    . LYS B 1 135 ? -3.098  -18.623 -45.399 1.00 70.47  ? 496 LYS B O    1 
ATOM   6778 C  CB   . LYS B 1 135 ? -2.903  -17.949 -48.402 1.00 74.19  ? 496 LYS B CB   1 
ATOM   6779 C  CG   . LYS B 1 135 ? -4.022  -18.607 -49.182 1.00 108.56 ? 496 LYS B CG   1 
ATOM   6780 C  CD   . LYS B 1 135 ? -3.472  -19.471 -50.330 1.00 90.09  ? 496 LYS B CD   1 
ATOM   6781 C  CE   . LYS B 1 135 ? -2.630  -20.643 -49.824 1.00 94.56  ? 496 LYS B CE   1 
ATOM   6782 N  NZ   . LYS B 1 135 ? -2.068  -21.474 -50.923 1.00 104.09 ? 496 LYS B NZ   1 
ATOM   6783 H  H    . LYS B 1 135 ? -1.864  -16.522 -46.018 1.00 96.08  ? 496 LYS B H    1 
ATOM   6784 H  HA   . LYS B 1 135 ? -4.037  -16.488 -47.508 1.00 92.14  ? 496 LYS B HA   1 
ATOM   6785 H  HB2  . LYS B 1 135 ? -2.407  -17.394 -49.024 1.00 89.03  ? 496 LYS B HB2  1 
ATOM   6786 H  HB3  . LYS B 1 135 ? -2.328  -18.657 -48.072 1.00 89.03  ? 496 LYS B HB3  1 
ATOM   6787 H  HG2  . LYS B 1 135 ? -4.533  -19.179 -48.588 1.00 130.28 ? 496 LYS B HG2  1 
ATOM   6788 H  HG3  . LYS B 1 135 ? -4.593  -17.922 -49.563 1.00 130.28 ? 496 LYS B HG3  1 
ATOM   6789 H  HD2  . LYS B 1 135 ? -4.214  -19.832 -50.840 1.00 108.11 ? 496 LYS B HD2  1 
ATOM   6790 H  HD3  . LYS B 1 135 ? -2.911  -18.922 -50.901 1.00 108.11 ? 496 LYS B HD3  1 
ATOM   6791 H  HE2  . LYS B 1 135 ? -1.889  -20.297 -49.302 1.00 113.47 ? 496 LYS B HE2  1 
ATOM   6792 H  HE3  . LYS B 1 135 ? -3.185  -21.215 -49.271 1.00 113.47 ? 496 LYS B HE3  1 
ATOM   6793 H  HZ1  . LYS B 1 135 ? -1.587  -22.142 -50.584 1.00 124.90 ? 496 LYS B HZ1  1 
ATOM   6794 H  HZ2  . LYS B 1 135 ? -2.728  -21.813 -51.415 1.00 124.90 ? 496 LYS B HZ2  1 
ATOM   6795 H  HZ3  . LYS B 1 135 ? -1.545  -20.976 -51.444 1.00 124.90 ? 496 LYS B HZ3  1 
ATOM   6796 N  N    . GLY B 1 136 ? -5.183  -17.942 -45.908 1.00 70.97  ? 497 GLY B N    1 
ATOM   6797 C  CA   . GLY B 1 136 ? -5.834  -18.823 -44.956 1.00 67.41  ? 497 GLY B CA   1 
ATOM   6798 C  C    . GLY B 1 136 ? -6.907  -18.127 -44.144 1.00 68.31  ? 497 GLY B C    1 
ATOM   6799 O  O    . GLY B 1 136 ? -6.751  -16.974 -43.744 1.00 76.05  ? 497 GLY B O    1 
ATOM   6800 H  H    . GLY B 1 136 ? -5.724  -17.426 -46.332 1.00 85.16  ? 497 GLY B H    1 
ATOM   6801 H  HA2  . GLY B 1 136 ? -6.242  -19.564 -45.430 1.00 80.89  ? 497 GLY B HA2  1 
ATOM   6802 H  HA3  . GLY B 1 136 ? -5.171  -19.180 -44.343 1.00 80.89  ? 497 GLY B HA3  1 
ATOM   6803 N  N    . LYS B 1 137 ? -8.001  -18.843 -43.909 1.00 79.66  ? 498 LYS B N    1 
ATOM   6804 C  CA   . LYS B 1 137 ? -9.105  -18.339 -43.107 1.00 66.82  ? 498 LYS B CA   1 
ATOM   6805 C  C    . LYS B 1 137 ? -9.492  -19.369 -42.058 1.00 67.37  ? 498 LYS B C    1 
ATOM   6806 O  O    . LYS B 1 137 ? -9.340  -20.575 -42.271 1.00 62.60  ? 498 LYS B O    1 
ATOM   6807 C  CB   . LYS B 1 137 ? -10.310 -17.997 -43.990 1.00 91.58  ? 498 LYS B CB   1 
ATOM   6808 C  CG   . LYS B 1 137 ? -10.164 -16.697 -44.770 1.00 84.92  ? 498 LYS B CG   1 
ATOM   6809 C  CD   . LYS B 1 137 ? -11.284 -16.529 -45.789 1.00 109.61 ? 498 LYS B CD   1 
ATOM   6810 C  CE   . LYS B 1 137 ? -11.622 -15.061 -46.020 1.00 121.20 ? 498 LYS B CE   1 
ATOM   6811 N  NZ   . LYS B 1 137 ? -10.418 -14.233 -46.311 1.00 122.07 ? 498 LYS B NZ   1 
ATOM   6812 H  H    . LYS B 1 137 ? -8.128  -19.638 -44.210 1.00 95.59  ? 498 LYS B H    1 
ATOM   6813 H  HA   . LYS B 1 137 ? -8.825  -17.531 -42.650 1.00 80.19  ? 498 LYS B HA   1 
ATOM   6814 H  HB2  . LYS B 1 137 ? -10.439 -18.713 -44.631 1.00 109.89 ? 498 LYS B HB2  1 
ATOM   6815 H  HB3  . LYS B 1 137 ? -11.095 -17.916 -43.426 1.00 109.89 ? 498 LYS B HB3  1 
ATOM   6816 H  HG2  . LYS B 1 137 ? -10.199 -15.948 -44.154 1.00 101.90 ? 498 LYS B HG2  1 
ATOM   6817 H  HG3  . LYS B 1 137 ? -9.319  -16.702 -45.245 1.00 101.90 ? 498 LYS B HG3  1 
ATOM   6818 H  HD2  . LYS B 1 137 ? -11.006 -16.913 -46.635 1.00 131.54 ? 498 LYS B HD2  1 
ATOM   6819 H  HD3  . LYS B 1 137 ? -12.081 -16.976 -45.464 1.00 131.54 ? 498 LYS B HD3  1 
ATOM   6820 H  HE2  . LYS B 1 137 ? -12.224 -14.991 -46.777 1.00 145.44 ? 498 LYS B HE2  1 
ATOM   6821 H  HE3  . LYS B 1 137 ? -12.046 -14.705 -45.224 1.00 145.44 ? 498 LYS B HE3  1 
ATOM   6822 H  HZ1  . LYS B 1 137 ? -10.657 -13.385 -46.440 1.00 146.48 ? 498 LYS B HZ1  1 
ATOM   6823 H  HZ2  . LYS B 1 137 ? -9.850  -14.273 -45.628 1.00 146.48 ? 498 LYS B HZ2  1 
ATOM   6824 H  HZ3  . LYS B 1 137 ? -10.012 -14.534 -47.044 1.00 146.48 ? 498 LYS B HZ3  1 
ATOM   6825 N  N    . LEU B 1 138 ? -9.984  -18.876 -40.924 1.00 62.34  ? 499 LEU B N    1 
ATOM   6826 C  CA   . LEU B 1 138 ? -10.422 -19.717 -39.818 1.00 59.57  ? 499 LEU B CA   1 
ATOM   6827 C  C    . LEU B 1 138 ? -11.860 -19.369 -39.432 1.00 61.93  ? 499 LEU B C    1 
ATOM   6828 O  O    . LEU B 1 138 ? -12.185 -18.204 -39.207 1.00 66.99  ? 499 LEU B O    1 
ATOM   6829 C  CB   . LEU B 1 138 ? -9.480  -19.543 -38.619 1.00 56.19  ? 499 LEU B CB   1 
ATOM   6830 C  CG   . LEU B 1 138 ? -9.711  -20.397 -37.369 1.00 58.07  ? 499 LEU B CG   1 
ATOM   6831 C  CD1  . LEU B 1 138 ? -9.575  -21.870 -37.685 1.00 52.28  ? 499 LEU B CD1  1 
ATOM   6832 C  CD2  . LEU B 1 138 ? -8.729  -20.012 -36.268 1.00 50.47  ? 499 LEU B CD2  1 
ATOM   6833 H  H    . LEU B 1 138 ? -10.075 -18.035 -40.770 1.00 74.81  ? 499 LEU B H    1 
ATOM   6834 H  HA   . LEU B 1 138 ? -10.397 -20.647 -40.092 1.00 71.48  ? 499 LEU B HA   1 
ATOM   6835 H  HB2  . LEU B 1 138 ? -8.578  -19.730 -38.922 1.00 67.43  ? 499 LEU B HB2  1 
ATOM   6836 H  HB3  . LEU B 1 138 ? -9.530  -18.616 -38.336 1.00 67.43  ? 499 LEU B HB3  1 
ATOM   6837 H  HG   . LEU B 1 138 ? -10.610 -20.241 -37.040 1.00 69.68  ? 499 LEU B HG   1 
ATOM   6838 H  HD11 . LEU B 1 138 ? -9.727  -22.382 -36.875 1.00 62.74  ? 499 LEU B HD11 1 
ATOM   6839 H  HD12 . LEU B 1 138 ? -10.232 -22.111 -38.356 1.00 62.74  ? 499 LEU B HD12 1 
ATOM   6840 H  HD13 . LEU B 1 138 ? -8.681  -22.040 -38.021 1.00 62.74  ? 499 LEU B HD13 1 
ATOM   6841 H  HD21 . LEU B 1 138 ? -8.895  -20.566 -35.489 1.00 60.56  ? 499 LEU B HD21 1 
ATOM   6842 H  HD22 . LEU B 1 138 ? -7.825  -20.154 -36.589 1.00 60.56  ? 499 LEU B HD22 1 
ATOM   6843 H  HD23 . LEU B 1 138 ? -8.858  -19.078 -36.043 1.00 60.56  ? 499 LEU B HD23 1 
ATOM   6844 N  N    . HIS B 1 139 ? -12.713 -20.387 -39.363 1.00 61.04  ? 500 HIS B N    1 
ATOM   6845 C  CA   . HIS B 1 139 ? -14.107 -20.216 -38.963 1.00 71.36  ? 500 HIS B CA   1 
ATOM   6846 C  C    . HIS B 1 139 ? -14.311 -20.576 -37.485 1.00 65.51  ? 500 HIS B C    1 
ATOM   6847 O  O    . HIS B 1 139 ? -14.183 -21.738 -37.107 1.00 57.46  ? 500 HIS B O    1 
ATOM   6848 C  CB   . HIS B 1 139 ? -15.010 -21.079 -39.847 1.00 65.01  ? 500 HIS B CB   1 
ATOM   6849 C  CG   . HIS B 1 139 ? -16.456 -21.047 -39.463 1.00 78.51  ? 500 HIS B CG   1 
ATOM   6850 N  ND1  . HIS B 1 139 ? -17.348 -22.019 -39.859 1.00 81.23  ? 500 HIS B ND1  1 
ATOM   6851 C  CD2  . HIS B 1 139 ? -17.166 -20.161 -38.724 1.00 90.40  ? 500 HIS B CD2  1 
ATOM   6852 C  CE1  . HIS B 1 139 ? -18.546 -21.737 -39.375 1.00 73.98  ? 500 HIS B CE1  1 
ATOM   6853 N  NE2  . HIS B 1 139 ? -18.462 -20.616 -38.684 1.00 74.56  ? 500 HIS B NE2  1 
ATOM   6854 H  H    . HIS B 1 139 ? -12.505 -21.201 -39.546 1.00 73.25  ? 500 HIS B H    1 
ATOM   6855 H  HA   . HIS B 1 139 ? -14.362 -19.288 -39.085 1.00 85.63  ? 500 HIS B HA   1 
ATOM   6856 H  HB2  . HIS B 1 139 ? -14.940 -20.766 -40.762 1.00 78.02  ? 500 HIS B HB2  1 
ATOM   6857 H  HB3  . HIS B 1 139 ? -14.710 -22.000 -39.792 1.00 78.02  ? 500 HIS B HB3  1 
ATOM   6858 H  HD1  . HIS B 1 139 ? -17.155 -22.705 -40.341 1.00 97.47  ? 500 HIS B HD1  1 
ATOM   6859 H  HD2  . HIS B 1 139 ? -16.837 -19.392 -38.317 1.00 108.47 ? 500 HIS B HD2  1 
ATOM   6860 H  HE1  . HIS B 1 139 ? -19.317 -22.241 -39.502 1.00 88.77  ? 500 HIS B HE1  1 
ATOM   6861 H  HE2  . HIS B 1 139 ? -19.114 -20.231 -38.276 1.00 89.47  ? 500 HIS B HE2  1 
ATOM   6862 N  N    . LEU B 1 140 ? -14.627 -19.575 -36.663 1.00 59.39  ? 501 LEU B N    1 
ATOM   6863 C  CA   . LEU B 1 140 ? -14.905 -19.789 -35.240 1.00 57.70  ? 501 LEU B CA   1 
ATOM   6864 C  C    . LEU B 1 140 ? -16.325 -19.387 -34.882 1.00 60.23  ? 501 LEU B C    1 
ATOM   6865 O  O    . LEU B 1 140 ? -16.890 -18.474 -35.484 1.00 63.10  ? 501 LEU B O    1 
ATOM   6866 C  CB   . LEU B 1 140 ? -13.938 -18.989 -34.362 1.00 54.70  ? 501 LEU B CB   1 
ATOM   6867 C  CG   . LEU B 1 140 ? -12.448 -19.194 -34.601 1.00 65.26  ? 501 LEU B CG   1 
ATOM   6868 C  CD1  . LEU B 1 140 ? -11.663 -18.174 -33.799 1.00 56.20  ? 501 LEU B CD1  1 
ATOM   6869 C  CD2  . LEU B 1 140 ? -12.037 -20.611 -34.240 1.00 50.19  ? 501 LEU B CD2  1 
ATOM   6870 H  H    . LEU B 1 140 ? -14.687 -18.753 -36.907 1.00 71.27  ? 501 LEU B H    1 
ATOM   6871 H  HA   . LEU B 1 140 ? -14.795 -20.730 -35.032 1.00 69.24  ? 501 LEU B HA   1 
ATOM   6872 H  HB2  . LEU B 1 140 ? -14.121 -18.046 -34.495 1.00 65.64  ? 501 LEU B HB2  1 
ATOM   6873 H  HB3  . LEU B 1 140 ? -14.112 -19.220 -33.436 1.00 65.64  ? 501 LEU B HB3  1 
ATOM   6874 H  HG   . LEU B 1 140 ? -12.254 -19.053 -35.541 1.00 78.31  ? 501 LEU B HG   1 
ATOM   6875 H  HD11 . LEU B 1 140 ? -10.716 -18.310 -33.956 1.00 67.44  ? 501 LEU B HD11 1 
ATOM   6876 H  HD12 . LEU B 1 140 ? -11.922 -17.283 -34.083 1.00 67.44  ? 501 LEU B HD12 1 
ATOM   6877 H  HD13 . LEU B 1 140 ? -11.863 -18.292 -32.857 1.00 67.44  ? 501 LEU B HD13 1 
ATOM   6878 H  HD21 . LEU B 1 140 ? -11.086 -20.714 -34.400 1.00 60.22  ? 501 LEU B HD21 1 
ATOM   6879 H  HD22 . LEU B 1 140 ? -12.234 -20.767 -33.303 1.00 60.22  ? 501 LEU B HD22 1 
ATOM   6880 H  HD23 . LEU B 1 140 ? -12.536 -21.234 -34.791 1.00 60.22  ? 501 LEU B HD23 1 
ATOM   6881 N  N    . ARG B 1 141 ? -16.894 -20.085 -33.903 1.00 57.50  ? 502 ARG B N    1 
ATOM   6882 C  CA   . ARG B 1 141 ? -18.098 -19.630 -33.234 1.00 58.95  ? 502 ARG B CA   1 
ATOM   6883 C  C    . ARG B 1 141 ? -17.734 -19.413 -31.766 1.00 59.77  ? 502 ARG B C    1 
ATOM   6884 O  O    . ARG B 1 141 ? -17.285 -20.340 -31.083 1.00 56.59  ? 502 ARG B O    1 
ATOM   6885 C  CB   . ARG B 1 141 ? -19.252 -20.627 -33.381 1.00 65.70  ? 502 ARG B CB   1 
ATOM   6886 C  CG   . ARG B 1 141 ? -20.610 -20.055 -32.999 1.00 66.84  ? 502 ARG B CG   1 
ATOM   6887 C  CD   . ARG B 1 141 ? -21.698 -21.121 -32.997 1.00 74.35  ? 502 ARG B CD   1 
ATOM   6888 N  NE   . ARG B 1 141 ? -22.897 -20.665 -32.288 1.00 112.51 ? 502 ARG B NE   1 
ATOM   6889 C  CZ   . ARG B 1 141 ? -23.438 -21.262 -31.225 1.00 114.81 ? 502 ARG B CZ   1 
ATOM   6890 N  NH1  . ARG B 1 141 ? -22.915 -22.373 -30.715 1.00 99.30  ? 502 ARG B NH1  1 
ATOM   6891 N  NH2  . ARG B 1 141 ? -24.524 -20.745 -30.665 1.00 113.86 ? 502 ARG B NH2  1 
ATOM   6892 H  H    . ARG B 1 141 ? -16.595 -20.836 -33.608 1.00 69.00  ? 502 ARG B H    1 
ATOM   6893 H  HA   . ARG B 1 141 ? -18.376 -18.780 -33.611 1.00 70.74  ? 502 ARG B HA   1 
ATOM   6894 H  HB2  . ARG B 1 141 ? -19.300 -20.914 -34.306 1.00 78.84  ? 502 ARG B HB2  1 
ATOM   6895 H  HB3  . ARG B 1 141 ? -19.080 -21.390 -32.808 1.00 78.84  ? 502 ARG B HB3  1 
ATOM   6896 H  HG2  . ARG B 1 141 ? -20.557 -19.676 -32.108 1.00 80.21  ? 502 ARG B HG2  1 
ATOM   6897 H  HG3  . ARG B 1 141 ? -20.859 -19.371 -33.639 1.00 80.21  ? 502 ARG B HG3  1 
ATOM   6898 H  HD2  . ARG B 1 141 ? -21.946 -21.327 -33.912 1.00 89.21  ? 502 ARG B HD2  1 
ATOM   6899 H  HD3  . ARG B 1 141 ? -21.366 -21.916 -32.552 1.00 89.21  ? 502 ARG B HD3  1 
ATOM   6900 H  HE   . ARG B 1 141 ? -23.283 -19.955 -32.582 1.00 135.01 ? 502 ARG B HE   1 
ATOM   6901 H  HH11 . ARG B 1 141 ? -22.211 -22.717 -31.068 1.00 119.17 ? 502 ARG B HH11 1 
ATOM   6902 H  HH12 . ARG B 1 141 ? -23.280 -22.745 -30.031 1.00 119.17 ? 502 ARG B HH12 1 
ATOM   6903 H  HH21 . ARG B 1 141 ? -24.874 -20.028 -30.987 1.00 136.64 ? 502 ARG B HH21 1 
ATOM   6904 H  HH22 . ARG B 1 141 ? -24.880 -21.128 -29.983 1.00 136.64 ? 502 ARG B HH22 1 
ATOM   6905 N  N    . LEU B 1 142 ? -17.890 -18.176 -31.303 1.00 57.40  ? 503 LEU B N    1 
ATOM   6906 C  CA   . LEU B 1 142 ? -17.552 -17.815 -29.929 1.00 62.37  ? 503 LEU B CA   1 
ATOM   6907 C  C    . LEU B 1 142 ? -18.810 -17.498 -29.138 1.00 58.91  ? 503 LEU B C    1 
ATOM   6908 O  O    . LEU B 1 142 ? -19.684 -16.784 -29.625 1.00 68.28  ? 503 LEU B O    1 
ATOM   6909 C  CB   . LEU B 1 142 ? -16.603 -16.617 -29.912 1.00 56.21  ? 503 LEU B CB   1 
ATOM   6910 C  CG   . LEU B 1 142 ? -15.286 -16.789 -30.668 1.00 65.80  ? 503 LEU B CG   1 
ATOM   6911 C  CD1  . LEU B 1 142 ? -14.434 -15.545 -30.518 1.00 54.06  ? 503 LEU B CD1  1 
ATOM   6912 C  CD2  . LEU B 1 142 ? -14.532 -18.011 -30.176 1.00 53.52  ? 503 LEU B CD2  1 
ATOM   6913 H  H    . LEU B 1 142 ? -18.194 -17.521 -31.769 1.00 68.88  ? 503 LEU B H    1 
ATOM   6914 H  HA   . LEU B 1 142 ? -17.105 -18.563 -29.503 1.00 74.84  ? 503 LEU B HA   1 
ATOM   6915 H  HB2  . LEU B 1 142 ? -17.064 -15.858 -30.304 1.00 67.45  ? 503 LEU B HB2  1 
ATOM   6916 H  HB3  . LEU B 1 142 ? -16.382 -16.417 -28.989 1.00 67.45  ? 503 LEU B HB3  1 
ATOM   6917 H  HG   . LEU B 1 142 ? -15.476 -16.912 -31.611 1.00 78.96  ? 503 LEU B HG   1 
ATOM   6918 H  HD11 . LEU B 1 142 ? -13.604 -15.671 -31.003 1.00 64.87  ? 503 LEU B HD11 1 
ATOM   6919 H  HD12 . LEU B 1 142 ? -14.917 -14.786 -30.881 1.00 64.87  ? 503 LEU B HD12 1 
ATOM   6920 H  HD13 . LEU B 1 142 ? -14.249 -15.400 -29.577 1.00 64.87  ? 503 LEU B HD13 1 
ATOM   6921 H  HD21 . LEU B 1 142 ? -13.704 -18.092 -30.674 1.00 64.23  ? 503 LEU B HD21 1 
ATOM   6922 H  HD22 . LEU B 1 142 ? -14.342 -17.905 -29.231 1.00 64.23  ? 503 LEU B HD22 1 
ATOM   6923 H  HD23 . LEU B 1 142 ? -15.082 -18.798 -30.318 1.00 64.23  ? 503 LEU B HD23 1 
ATOM   6924 N  N    . GLU B 1 143 ? -18.897 -18.039 -27.924 1.00 58.96  ? 504 GLU B N    1 
ATOM   6925 C  CA   . GLU B 1 143 ? -20.026 -17.777 -27.033 1.00 56.53  ? 504 GLU B CA   1 
ATOM   6926 C  C    . GLU B 1 143 ? -19.525 -17.289 -25.680 1.00 52.74  ? 504 GLU B C    1 
ATOM   6927 O  O    . GLU B 1 143 ? -18.725 -17.954 -25.025 1.00 49.69  ? 504 GLU B O    1 
ATOM   6928 C  CB   . GLU B 1 143 ? -20.887 -19.034 -26.853 1.00 74.60  ? 504 GLU B CB   1 
ATOM   6929 C  CG   . GLU B 1 143 ? -21.448 -19.605 -28.155 1.00 75.86  ? 504 GLU B CG   1 
ATOM   6930 C  CD   . GLU B 1 143 ? -22.383 -20.783 -27.931 1.00 92.11  ? 504 GLU B CD   1 
ATOM   6931 O  OE1  . GLU B 1 143 ? -21.930 -21.818 -27.395 1.00 73.25  ? 504 GLU B OE1  1 
ATOM   6932 O  OE2  . GLU B 1 143 ? -23.574 -20.672 -28.292 1.00 112.36 ? 504 GLU B OE2  1 
ATOM   6933 H  H    . GLU B 1 143 ? -18.308 -18.568 -27.590 1.00 70.76  ? 504 GLU B H    1 
ATOM   6934 H  HA   . GLU B 1 143 ? -20.582 -17.083 -27.419 1.00 67.83  ? 504 GLU B HA   1 
ATOM   6935 H  HB2  . GLU B 1 143 ? -20.346 -19.724 -26.438 1.00 89.52  ? 504 GLU B HB2  1 
ATOM   6936 H  HB3  . GLU B 1 143 ? -21.638 -18.817 -26.279 1.00 89.52  ? 504 GLU B HB3  1 
ATOM   6937 H  HG2  . GLU B 1 143 ? -21.946 -18.911 -28.615 1.00 91.04  ? 504 GLU B HG2  1 
ATOM   6938 H  HG3  . GLU B 1 143 ? -20.712 -19.908 -28.710 1.00 91.04  ? 504 GLU B HG3  1 
ATOM   6939 N  N    . TRP B 1 144 ? -19.986 -16.110 -25.282 1.00 58.31  ? 505 TRP B N    1 
ATOM   6940 C  CA   . TRP B 1 144 ? -19.670 -15.551 -23.977 1.00 53.29  ? 505 TRP B CA   1 
ATOM   6941 C  C    . TRP B 1 144 ? -20.763 -15.919 -22.993 1.00 57.13  ? 505 TRP B C    1 
ATOM   6942 O  O    . TRP B 1 144 ? -21.896 -15.460 -23.117 1.00 56.85  ? 505 TRP B O    1 
ATOM   6943 C  CB   . TRP B 1 144 ? -19.515 -14.035 -24.066 1.00 57.69  ? 505 TRP B CB   1 
ATOM   6944 C  CG   . TRP B 1 144 ? -19.235 -13.389 -22.754 1.00 55.48  ? 505 TRP B CG   1 
ATOM   6945 C  CD1  . TRP B 1 144 ? -20.119 -12.704 -21.973 1.00 68.63  ? 505 TRP B CD1  1 
ATOM   6946 C  CD2  . TRP B 1 144 ? -17.984 -13.367 -22.059 1.00 53.80  ? 505 TRP B CD2  1 
ATOM   6947 N  NE1  . TRP B 1 144 ? -19.495 -12.254 -20.836 1.00 75.52  ? 505 TRP B NE1  1 
ATOM   6948 C  CE2  . TRP B 1 144 ? -18.184 -12.648 -20.863 1.00 51.94  ? 505 TRP B CE2  1 
ATOM   6949 C  CE3  . TRP B 1 144 ? -16.714 -13.883 -22.333 1.00 62.18  ? 505 TRP B CE3  1 
ATOM   6950 C  CZ2  . TRP B 1 144 ? -17.161 -12.432 -19.941 1.00 60.07  ? 505 TRP B CZ2  1 
ATOM   6951 C  CZ3  . TRP B 1 144 ? -15.699 -13.669 -21.415 1.00 79.27  ? 505 TRP B CZ3  1 
ATOM   6952 C  CH2  . TRP B 1 144 ? -15.929 -12.949 -20.235 1.00 75.46  ? 505 TRP B CH2  1 
ATOM   6953 H  H    . TRP B 1 144 ? -20.494 -15.606 -25.760 1.00 69.97  ? 505 TRP B H    1 
ATOM   6954 H  HA   . TRP B 1 144 ? -18.833 -15.926 -23.660 1.00 63.94  ? 505 TRP B HA   1 
ATOM   6955 H  HB2  . TRP B 1 144 ? -18.778 -13.830 -24.662 1.00 69.22  ? 505 TRP B HB2  1 
ATOM   6956 H  HB3  . TRP B 1 144 ? -20.337 -13.656 -24.415 1.00 69.22  ? 505 TRP B HB3  1 
ATOM   6957 H  HD1  . TRP B 1 144 ? -21.014 -12.562 -22.182 1.00 82.36  ? 505 TRP B HD1  1 
ATOM   6958 H  HE1  . TRP B 1 144 ? -19.868 -11.800 -20.208 1.00 90.62  ? 505 TRP B HE1  1 
ATOM   6959 H  HE3  . TRP B 1 144 ? -16.554 -14.361 -23.114 1.00 74.61  ? 505 TRP B HE3  1 
ATOM   6960 H  HZ2  . TRP B 1 144 ? -17.311 -11.955 -19.156 1.00 72.09  ? 505 TRP B HZ2  1 
ATOM   6961 H  HZ3  . TRP B 1 144 ? -14.850 -14.008 -21.586 1.00 95.13  ? 505 TRP B HZ3  1 
ATOM   6962 H  HH2  . TRP B 1 144 ? -15.228 -12.821 -19.637 1.00 90.55  ? 505 TRP B HH2  1 
ATOM   6963 N  N    . LEU B 1 145 ? -20.414 -16.746 -22.011 1.00 50.78  ? 506 LEU B N    1 
ATOM   6964 C  CA   . LEU B 1 145 ? -21.383 -17.254 -21.050 1.00 55.94  ? 506 LEU B CA   1 
ATOM   6965 C  C    . LEU B 1 145 ? -21.273 -16.518 -19.718 1.00 76.59  ? 506 LEU B C    1 
ATOM   6966 O  O    . LEU B 1 145 ? -20.189 -16.404 -19.141 1.00 55.60  ? 506 LEU B O    1 
ATOM   6967 C  CB   . LEU B 1 145 ? -21.187 -18.759 -20.838 1.00 48.77  ? 506 LEU B CB   1 
ATOM   6968 C  CG   . LEU B 1 145 ? -21.113 -19.622 -22.104 1.00 55.61  ? 506 LEU B CG   1 
ATOM   6969 C  CD1  . LEU B 1 145 ? -21.015 -21.092 -21.727 1.00 54.38  ? 506 LEU B CD1  1 
ATOM   6970 C  CD2  . LEU B 1 145 ? -22.308 -19.377 -23.012 1.00 57.78  ? 506 LEU B CD2  1 
ATOM   6971 H  H    . LEU B 1 145 ? -19.612 -17.031 -21.881 1.00 60.94  ? 506 LEU B H    1 
ATOM   6972 H  HA   . LEU B 1 145 ? -22.278 -17.113 -21.398 1.00 67.13  ? 506 LEU B HA   1 
ATOM   6973 H  HB2  . LEU B 1 145 ? -20.360 -18.891 -20.350 1.00 58.52  ? 506 LEU B HB2  1 
ATOM   6974 H  HB3  . LEU B 1 145 ? -21.929 -19.090 -20.308 1.00 58.52  ? 506 LEU B HB3  1 
ATOM   6975 H  HG   . LEU B 1 145 ? -20.311 -19.387 -22.597 1.00 66.74  ? 506 LEU B HG   1 
ATOM   6976 H  HD11 . LEU B 1 145 ? -20.969 -21.623 -22.538 1.00 65.26  ? 506 LEU B HD11 1 
ATOM   6977 H  HD12 . LEU B 1 145 ? -20.216 -21.229 -21.195 1.00 65.26  ? 506 LEU B HD12 1 
ATOM   6978 H  HD13 . LEU B 1 145 ? -21.801 -21.339 -21.214 1.00 65.26  ? 506 LEU B HD13 1 
ATOM   6979 H  HD21 . LEU B 1 145 ? -22.227 -19.938 -23.799 1.00 69.33  ? 506 LEU B HD21 1 
ATOM   6980 H  HD22 . LEU B 1 145 ? -23.121 -19.598 -22.530 1.00 69.33  ? 506 LEU B HD22 1 
ATOM   6981 H  HD23 . LEU B 1 145 ? -22.321 -18.442 -23.271 1.00 69.33  ? 506 LEU B HD23 1 
ATOM   6982 N  N    . THR B 1 146 ? -22.412 -16.028 -19.244 1.00 55.40  ? 507 THR B N    1 
ATOM   6983 C  CA   . THR B 1 146 ? -22.499 -15.289 -17.992 1.00 53.23  ? 507 THR B CA   1 
ATOM   6984 C  C    . THR B 1 146 ? -22.852 -16.231 -16.845 1.00 57.62  ? 507 THR B C    1 
ATOM   6985 O  O    . THR B 1 146 ? -23.520 -17.242 -17.054 1.00 63.19  ? 507 THR B O    1 
ATOM   6986 C  CB   . THR B 1 146 ? -23.560 -14.165 -18.095 1.00 60.88  ? 507 THR B CB   1 
ATOM   6987 O  OG1  . THR B 1 146 ? -23.097 -13.155 -18.996 1.00 70.56  ? 507 THR B OG1  1 
ATOM   6988 C  CG2  . THR B 1 146 ? -23.837 -13.524 -16.739 1.00 80.74  ? 507 THR B CG2  1 
ATOM   6989 H  H    . THR B 1 146 ? -23.170 -16.114 -19.642 1.00 66.48  ? 507 THR B H    1 
ATOM   6990 H  HA   . THR B 1 146 ? -21.640 -14.882 -17.799 1.00 63.88  ? 507 THR B HA   1 
ATOM   6991 H  HB   . THR B 1 146 ? -24.390 -14.538 -18.431 1.00 73.05  ? 507 THR B HB   1 
ATOM   6992 H  HG1  . THR B 1 146 ? -23.667 -12.541 -19.058 1.00 84.67  ? 507 THR B HG1  1 
ATOM   6993 H  HG21 . THR B 1 146 ? -24.504 -12.825 -16.833 1.00 96.89  ? 507 THR B HG21 1 
ATOM   6994 H  HG22 . THR B 1 146 ? -24.167 -14.192 -16.118 1.00 96.89  ? 507 THR B HG22 1 
ATOM   6995 H  HG23 . THR B 1 146 ? -23.023 -13.137 -16.383 1.00 96.89  ? 507 THR B HG23 1 
ATOM   6996 N  N    . LEU B 1 147 ? -22.409 -15.895 -15.636 1.00 60.88  ? 508 LEU B N    1 
ATOM   6997 C  CA   . LEU B 1 147 ? -22.739 -16.682 -14.453 1.00 49.20  ? 508 LEU B CA   1 
ATOM   6998 C  C    . LEU B 1 147 ? -24.092 -16.256 -13.873 1.00 52.06  ? 508 LEU B C    1 
ATOM   6999 O  O    . LEU B 1 147 ? -24.321 -15.077 -13.608 1.00 55.43  ? 508 LEU B O    1 
ATOM   7000 C  CB   . LEU B 1 147 ? -21.643 -16.545 -13.392 1.00 47.13  ? 508 LEU B CB   1 
ATOM   7001 C  CG   . LEU B 1 147 ? -20.365 -17.365 -13.591 1.00 62.52  ? 508 LEU B CG   1 
ATOM   7002 C  CD1  . LEU B 1 147 ? -19.708 -17.076 -14.930 1.00 56.51  ? 508 LEU B CD1  1 
ATOM   7003 C  CD2  . LEU B 1 147 ? -19.389 -17.090 -12.453 1.00 57.04  ? 508 LEU B CD2  1 
ATOM   7004 H  H    . LEU B 1 147 ? -21.912 -15.212 -15.475 1.00 73.05  ? 508 LEU B H    1 
ATOM   7005 H  HA   . LEU B 1 147 ? -22.801 -17.618 -14.703 1.00 59.04  ? 508 LEU B HA   1 
ATOM   7006 H  HB2  . LEU B 1 147 ? -21.380 -15.612 -13.351 1.00 56.55  ? 508 LEU B HB2  1 
ATOM   7007 H  HB3  . LEU B 1 147 ? -22.019 -16.807 -12.536 1.00 56.55  ? 508 LEU B HB3  1 
ATOM   7008 H  HG   . LEU B 1 147 ? -20.591 -18.308 -13.567 1.00 75.03  ? 508 LEU B HG   1 
ATOM   7009 H  HD11 . LEU B 1 147 ? -18.906 -17.616 -15.011 1.00 67.81  ? 508 LEU B HD11 1 
ATOM   7010 H  HD12 . LEU B 1 147 ? -20.329 -17.298 -15.641 1.00 67.81  ? 508 LEU B HD12 1 
ATOM   7011 H  HD13 . LEU B 1 147 ? -19.479 -16.134 -14.973 1.00 67.81  ? 508 LEU B HD13 1 
ATOM   7012 H  HD21 . LEU B 1 147 ? -18.586 -17.616 -12.593 1.00 68.45  ? 508 LEU B HD21 1 
ATOM   7013 H  HD22 . LEU B 1 147 ? -19.170 -16.145 -12.447 1.00 68.45  ? 508 LEU B HD22 1 
ATOM   7014 H  HD23 . LEU B 1 147 ? -19.805 -17.339 -11.613 1.00 68.45  ? 508 LEU B HD23 1 
ATOM   7015 N  N    . MET B 1 148 ? -24.985 -17.224 -13.692 1.00 67.08  ? 509 MET B N    1 
ATOM   7016 C  CA   . MET B 1 148 ? -26.322 -16.969 -13.165 1.00 58.43  ? 509 MET B CA   1 
ATOM   7017 C  C    . MET B 1 148 ? -26.393 -17.340 -11.682 1.00 57.62  ? 509 MET B C    1 
ATOM   7018 O  O    . MET B 1 148 ? -26.129 -18.489 -11.334 1.00 65.06  ? 509 MET B O    1 
ATOM   7019 C  CB   . MET B 1 148 ? -27.364 -17.779 -13.934 1.00 57.49  ? 509 MET B CB   1 
ATOM   7020 C  CG   . MET B 1 148 ? -27.501 -17.435 -15.415 1.00 87.62  ? 509 MET B CG   1 
ATOM   7021 S  SD   . MET B 1 148 ? -28.256 -15.834 -15.763 1.00 105.32 ? 509 MET B SD   1 
ATOM   7022 C  CE   . MET B 1 148 ? -29.711 -15.856 -14.709 1.00 95.89  ? 509 MET B CE   1 
ATOM   7023 H  H    . MET B 1 148 ? -24.838 -18.052 -13.870 1.00 80.49  ? 509 MET B H    1 
ATOM   7024 H  HA   . MET B 1 148 ? -26.532 -16.028 -13.269 1.00 70.12  ? 509 MET B HA   1 
ATOM   7025 H  HB2  . MET B 1 148 ? -27.128 -18.718 -13.874 1.00 68.99  ? 509 MET B HB2  1 
ATOM   7026 H  HB3  . MET B 1 148 ? -28.230 -17.635 -13.521 1.00 68.99  ? 509 MET B HB3  1 
ATOM   7027 H  HG2  . MET B 1 148 ? -26.616 -17.433 -15.814 1.00 105.14 ? 509 MET B HG2  1 
ATOM   7028 H  HG3  . MET B 1 148 ? -28.047 -18.114 -15.840 1.00 105.14 ? 509 MET B HG3  1 
ATOM   7029 H  HE1  . MET B 1 148 ? -30.197 -15.025 -14.824 1.00 115.07 ? 509 MET B HE1  1 
ATOM   7030 H  HE2  . MET B 1 148 ? -30.273 -16.605 -14.963 1.00 115.07 ? 509 MET B HE2  1 
ATOM   7031 H  HE3  . MET B 1 148 ? -29.430 -15.951 -13.786 1.00 115.07 ? 509 MET B HE3  1 
ATOM   7032 N  N    . PRO B 1 149 ? -26.771 -16.387 -10.808 1.00 66.43  ? 510 PRO B N    1 
ATOM   7033 C  CA   . PRO B 1 149 ? -26.914 -16.746 -9.387  1.00 64.56  ? 510 PRO B CA   1 
ATOM   7034 C  C    . PRO B 1 149 ? -28.222 -17.478 -9.078  1.00 68.07  ? 510 PRO B C    1 
ATOM   7035 O  O    . PRO B 1 149 ? -28.618 -17.547 -7.916  1.00 68.71  ? 510 PRO B O    1 
ATOM   7036 C  CB   . PRO B 1 149 ? -26.883 -15.386 -8.665  1.00 75.22  ? 510 PRO B CB   1 
ATOM   7037 C  CG   . PRO B 1 149 ? -26.538 -14.360 -9.709  1.00 90.08  ? 510 PRO B CG   1 
ATOM   7038 C  CD   . PRO B 1 149 ? -26.953 -14.941 -11.020 1.00 64.40  ? 510 PRO B CD   1 
ATOM   7039 H  HA   . PRO B 1 149 ? -26.162 -17.285 -9.095  1.00 77.47  ? 510 PRO B HA   1 
ATOM   7040 H  HB2  . PRO B 1 149 ? -27.756 -15.203 -8.284  1.00 90.26  ? 510 PRO B HB2  1 
ATOM   7041 H  HB3  . PRO B 1 149 ? -26.207 -15.404 -7.970  1.00 90.26  ? 510 PRO B HB3  1 
ATOM   7042 H  HG2  . PRO B 1 149 ? -27.025 -13.541 -9.531  1.00 108.09 ? 510 PRO B HG2  1 
ATOM   7043 H  HG3  . PRO B 1 149 ? -25.582 -14.196 -9.697  1.00 108.09 ? 510 PRO B HG3  1 
ATOM   7044 H  HD2  . PRO B 1 149 ? -27.884 -14.738 -11.202 1.00 77.28  ? 510 PRO B HD2  1 
ATOM   7045 H  HD3  . PRO B 1 149 ? -26.372 -14.625 -11.730 1.00 77.28  ? 510 PRO B HD3  1 
ATOM   7046 N  N    . ASN B 1 150 ? -28.891 -17.988 -10.107 1.00 61.03  ? 511 ASN B N    1 
ATOM   7047 C  CA   . ASN B 1 150 ? -30.104 -18.779 -9.931  1.00 61.21  ? 511 ASN B CA   1 
ATOM   7048 C  C    . ASN B 1 150 ? -30.185 -19.811 -11.047 1.00 61.60  ? 511 ASN B C    1 
ATOM   7049 O  O    . ASN B 1 150 ? -29.384 -19.773 -11.973 1.00 59.98  ? 511 ASN B O    1 
ATOM   7050 C  CB   . ASN B 1 150 ? -31.344 -17.887 -9.927  1.00 68.28  ? 511 ASN B CB   1 
ATOM   7051 C  CG   . ASN B 1 150 ? -31.566 -17.198 -11.258 1.00 89.92  ? 511 ASN B CG   1 
ATOM   7052 O  OD1  . ASN B 1 150 ? -32.065 -17.802 -12.206 1.00 78.56  ? 511 ASN B OD1  1 
ATOM   7053 N  ND2  . ASN B 1 150 ? -31.183 -15.929 -11.340 1.00 74.06  ? 511 ASN B ND2  1 
ATOM   7054 H  H    . ASN B 1 150 ? -28.659 -17.887 -10.929 1.00 73.24  ? 511 ASN B H    1 
ATOM   7055 H  HA   . ASN B 1 150 ? -30.062 -19.249 -9.083  1.00 73.45  ? 511 ASN B HA   1 
ATOM   7056 H  HB2  . ASN B 1 150 ? -32.125 -18.430 -9.736  1.00 81.94  ? 511 ASN B HB2  1 
ATOM   7057 H  HB3  . ASN B 1 150 ? -31.240 -17.203 -9.247  1.00 81.94  ? 511 ASN B HB3  1 
ATOM   7058 H  HD21 . ASN B 1 150 ? -31.288 -15.495 -12.075 1.00 88.87  ? 511 ASN B HD21 1 
ATOM   7059 H  HD22 . ASN B 1 150 ? -30.829 -15.542 -10.658 1.00 88.87  ? 511 ASN B HD22 1 
ATOM   7060 N  N    . ALA B 1 151 ? -31.148 -20.723 -10.963 1.00 62.73  ? 512 ALA B N    1 
ATOM   7061 C  CA   . ALA B 1 151 ? -31.213 -21.847 -11.892 1.00 69.08  ? 512 ALA B CA   1 
ATOM   7062 C  C    . ALA B 1 151 ? -32.172 -21.607 -13.055 1.00 65.95  ? 512 ALA B C    1 
ATOM   7063 O  O    . ALA B 1 151 ? -32.396 -22.507 -13.864 1.00 76.79  ? 512 ALA B O    1 
ATOM   7064 C  CB   . ALA B 1 151 ? -31.619 -23.111 -11.148 1.00 62.75  ? 512 ALA B CB   1 
ATOM   7065 H  H    . ALA B 1 151 ? -31.777 -20.715 -10.377 1.00 75.28  ? 512 ALA B H    1 
ATOM   7066 H  HA   . ALA B 1 151 ? -30.329 -21.994 -12.264 1.00 82.90  ? 512 ALA B HA   1 
ATOM   7067 H  HB1  . ALA B 1 151 ? -31.658 -23.848 -11.777 1.00 75.30  ? 512 ALA B HB1  1 
ATOM   7068 H  HB2  . ALA B 1 151 ? -30.962 -23.297 -10.460 1.00 75.30  ? 512 ALA B HB2  1 
ATOM   7069 H  HB3  . ALA B 1 151 ? -32.491 -22.973 -10.746 1.00 75.30  ? 512 ALA B HB3  1 
ATOM   7070 N  N    . SER B 1 152 ? -32.715 -20.396 -13.145 1.00 68.34  ? 513 SER B N    1 
ATOM   7071 C  CA   . SER B 1 152 ? -33.877 -20.131 -13.995 1.00 96.72  ? 513 SER B CA   1 
ATOM   7072 C  C    . SER B 1 152 ? -33.675 -20.580 -15.439 1.00 86.10  ? 513 SER B C    1 
ATOM   7073 O  O    . SER B 1 152 ? -34.562 -21.201 -16.025 1.00 99.72  ? 513 SER B O    1 
ATOM   7074 C  CB   . SER B 1 152 ? -34.237 -18.638 -13.961 1.00 78.60  ? 513 SER B CB   1 
ATOM   7075 O  OG   . SER B 1 152 ? -33.149 -17.829 -14.369 1.00 98.93  ? 513 SER B OG   1 
ATOM   7076 H  H    . SER B 1 152 ? -32.427 -19.704 -12.721 1.00 82.01  ? 513 SER B H    1 
ATOM   7077 H  HA   . SER B 1 152 ? -34.635 -20.623 -13.641 1.00 116.06 ? 513 SER B HA   1 
ATOM   7078 H  HB2  . SER B 1 152 ? -34.985 -18.483 -14.559 1.00 94.32  ? 513 SER B HB2  1 
ATOM   7079 H  HB3  . SER B 1 152 ? -34.485 -18.397 -13.055 1.00 94.32  ? 513 SER B HB3  1 
ATOM   7080 H  HG   . SER B 1 152 ? -32.493 -17.951 -13.858 1.00 118.72 ? 513 SER B HG   1 
ATOM   7081 N  N    . ASN B 1 153 ? -32.507 -20.288 -16.003 1.00 84.67  ? 514 ASN B N    1 
ATOM   7082 C  CA   . ASN B 1 153 ? -32.260 -20.563 -17.415 1.00 78.25  ? 514 ASN B CA   1 
ATOM   7083 C  C    . ASN B 1 153 ? -31.582 -21.903 -17.657 1.00 76.05  ? 514 ASN B C    1 
ATOM   7084 O  O    . ASN B 1 153 ? -31.032 -22.121 -18.727 1.00 66.86  ? 514 ASN B O    1 
ATOM   7085 C  CB   . ASN B 1 153 ? -31.399 -19.453 -18.027 1.00 87.23  ? 514 ASN B CB   1 
ATOM   7086 C  CG   . ASN B 1 153 ? -32.011 -18.076 -17.859 1.00 123.09 ? 514 ASN B CG   1 
ATOM   7087 O  OD1  . ASN B 1 153 ? -31.353 -17.146 -17.393 1.00 144.26 ? 514 ASN B OD1  1 
ATOM   7088 N  ND2  . ASN B 1 153 ? -33.276 -17.938 -18.237 1.00 112.31 ? 514 ASN B ND2  1 
ATOM   7089 H  H    . ASN B 1 153 ? -31.842 -19.930 -15.591 1.00 101.61 ? 514 ASN B H    1 
ATOM   7090 H  HA   . ASN B 1 153 ? -33.109 -20.572 -17.884 1.00 93.90  ? 514 ASN B HA   1 
ATOM   7091 H  HB2  . ASN B 1 153 ? -30.531 -19.451 -17.594 1.00 104.68 ? 514 ASN B HB2  1 
ATOM   7092 H  HB3  . ASN B 1 153 ? -31.295 -19.621 -18.977 1.00 104.68 ? 514 ASN B HB3  1 
ATOM   7093 H  HD21 . ASN B 1 153 ? -33.667 -17.175 -18.161 1.00 134.77 ? 514 ASN B HD21 1 
ATOM   7094 H  HD22 . ASN B 1 153 ? -33.705 -18.610 -18.558 1.00 134.77 ? 514 ASN B HD22 1 
ATOM   7095 N  N    . LEU B 1 154 ? -31.619 -22.801 -16.678 1.00 66.27  ? 515 LEU B N    1 
ATOM   7096 C  CA   . LEU B 1 154 ? -30.835 -24.036 -16.759 1.00 63.66  ? 515 LEU B CA   1 
ATOM   7097 C  C    . LEU B 1 154 ? -31.435 -25.088 -17.691 1.00 79.43  ? 515 LEU B C    1 
ATOM   7098 O  O    . LEU B 1 154 ? -30.702 -25.867 -18.302 1.00 74.83  ? 515 LEU B O    1 
ATOM   7099 C  CB   . LEU B 1 154 ? -30.668 -24.650 -15.370 1.00 64.19  ? 515 LEU B CB   1 
ATOM   7100 C  CG   . LEU B 1 154 ? -29.925 -25.990 -15.297 1.00 64.19  ? 515 LEU B CG   1 
ATOM   7101 C  CD1  . LEU B 1 154 ? -28.440 -25.845 -15.650 1.00 56.32  ? 515 LEU B CD1  1 
ATOM   7102 C  CD2  . LEU B 1 154 ? -30.091 -26.591 -13.912 1.00 66.83  ? 515 LEU B CD2  1 
ATOM   7103 H  H    . LEU B 1 154 ? -32.086 -22.722 -15.959 1.00 79.53  ? 515 LEU B H    1 
ATOM   7104 H  HA   . LEU B 1 154 ? -29.951 -23.819 -17.093 1.00 76.39  ? 515 LEU B HA   1 
ATOM   7105 H  HB2  . LEU B 1 154 ? -30.179 -24.020 -14.818 1.00 77.02  ? 515 LEU B HB2  1 
ATOM   7106 H  HB3  . LEU B 1 154 ? -31.550 -24.789 -14.992 1.00 77.02  ? 515 LEU B HB3  1 
ATOM   7107 H  HG   . LEU B 1 154 ? -30.323 -26.603 -15.936 1.00 77.03  ? 515 LEU B HG   1 
ATOM   7108 H  HD11 . LEU B 1 154 ? -28.016 -26.715 -15.590 1.00 67.59  ? 515 LEU B HD11 1 
ATOM   7109 H  HD12 . LEU B 1 154 ? -28.363 -25.500 -16.553 1.00 67.59  ? 515 LEU B HD12 1 
ATOM   7110 H  HD13 . LEU B 1 154 ? -28.026 -25.231 -15.024 1.00 67.59  ? 515 LEU B HD13 1 
ATOM   7111 H  HD21 . LEU B 1 154 ? -29.619 -27.437 -13.876 1.00 80.19  ? 515 LEU B HD21 1 
ATOM   7112 H  HD22 . LEU B 1 154 ? -29.723 -25.978 -13.256 1.00 80.19  ? 515 LEU B HD22 1 
ATOM   7113 H  HD23 . LEU B 1 154 ? -31.036 -26.731 -13.740 1.00 80.19  ? 515 LEU B HD23 1 
ATOM   7114 N  N    . ASP B 1 155 ? -32.760 -25.137 -17.777 1.00 69.53  ? 516 ASP B N    1 
ATOM   7115 C  CA   . ASP B 1 155 ? -33.414 -26.157 -18.591 1.00 84.29  ? 516 ASP B CA   1 
ATOM   7116 C  C    . ASP B 1 155 ? -32.947 -26.069 -20.042 1.00 79.91  ? 516 ASP B C    1 
ATOM   7117 O  O    . ASP B 1 155 ? -32.776 -27.092 -20.710 1.00 72.14  ? 516 ASP B O    1 
ATOM   7118 C  CB   . ASP B 1 155 ? -34.944 -26.031 -18.514 1.00 95.34  ? 516 ASP B CB   1 
ATOM   7119 C  CG   . ASP B 1 155 ? -35.470 -24.743 -19.137 1.00 97.65  ? 516 ASP B CG   1 
ATOM   7120 O  OD1  . ASP B 1 155 ? -34.801 -23.695 -19.013 1.00 88.42  ? 516 ASP B OD1  1 
ATOM   7121 O  OD2  . ASP B 1 155 ? -36.569 -24.778 -19.738 1.00 101.70 ? 516 ASP B OD2  1 
ATOM   7122 H  H    . ASP B 1 155 ? -33.299 -24.599 -17.378 1.00 83.44  ? 516 ASP B H    1 
ATOM   7123 H  HA   . ASP B 1 155 ? -33.170 -27.033 -18.253 1.00 101.15 ? 516 ASP B HA   1 
ATOM   7124 H  HB2  . ASP B 1 155 ? -35.346 -26.778 -18.986 1.00 114.41 ? 516 ASP B HB2  1 
ATOM   7125 H  HB3  . ASP B 1 155 ? -35.215 -26.045 -17.583 1.00 114.41 ? 516 ASP B HB3  1 
ATOM   7126 N  N    . LYS B 1 156 ? -32.703 -24.849 -20.511 1.00 76.30  ? 517 LYS B N    1 
ATOM   7127 C  CA   . LYS B 1 156 ? -32.378 -24.634 -21.915 1.00 89.35  ? 517 LYS B CA   1 
ATOM   7128 C  C    . LYS B 1 156 ? -30.884 -24.740 -22.218 1.00 87.91  ? 517 LYS B C    1 
ATOM   7129 O  O    . LYS B 1 156 ? -30.509 -25.071 -23.342 1.00 69.19  ? 517 LYS B O    1 
ATOM   7130 C  CB   . LYS B 1 156 ? -32.896 -23.272 -22.379 1.00 102.21 ? 517 LYS B CB   1 
ATOM   7131 C  CG   . LYS B 1 156 ? -32.229 -22.073 -21.731 1.00 115.96 ? 517 LYS B CG   1 
ATOM   7132 C  CD   . LYS B 1 156 ? -32.542 -20.813 -22.518 1.00 128.47 ? 517 LYS B CD   1 
ATOM   7133 C  CE   . LYS B 1 156 ? -31.712 -19.632 -22.053 1.00 132.99 ? 517 LYS B CE   1 
ATOM   7134 N  NZ   . LYS B 1 156 ? -31.853 -18.487 -22.993 1.00 135.79 ? 517 LYS B NZ   1 
ATOM   7135 H  H    . LYS B 1 156 ? -32.720 -24.131 -20.038 1.00 91.56  ? 517 LYS B H    1 
ATOM   7136 H  HA   . LYS B 1 156 ? -32.830 -25.312 -22.441 1.00 107.23 ? 517 LYS B HA   1 
ATOM   7137 H  HB2  . LYS B 1 156 ? -32.758 -23.200 -23.337 1.00 122.66 ? 517 LYS B HB2  1 
ATOM   7138 H  HB3  . LYS B 1 156 ? -33.844 -23.220 -22.183 1.00 122.66 ? 517 LYS B HB3  1 
ATOM   7139 H  HG2  . LYS B 1 156 ? -32.565 -21.964 -20.828 1.00 139.16 ? 517 LYS B HG2  1 
ATOM   7140 H  HG3  . LYS B 1 156 ? -31.268 -22.201 -21.723 1.00 139.16 ? 517 LYS B HG3  1 
ATOM   7141 H  HD2  . LYS B 1 156 ? -32.350 -20.967 -23.456 1.00 154.17 ? 517 LYS B HD2  1 
ATOM   7142 H  HD3  . LYS B 1 156 ? -33.479 -20.589 -22.401 1.00 154.17 ? 517 LYS B HD3  1 
ATOM   7143 H  HE2  . LYS B 1 156 ? -32.017 -19.349 -21.177 1.00 159.59 ? 517 LYS B HE2  1 
ATOM   7144 H  HE3  . LYS B 1 156 ? -30.777 -19.888 -22.020 1.00 159.59 ? 517 LYS B HE3  1 
ATOM   7145 H  HZ1  . LYS B 1 156 ? -31.362 -17.800 -22.711 1.00 162.95 ? 517 LYS B HZ1  1 
ATOM   7146 H  HZ2  . LYS B 1 156 ? -31.577 -18.725 -23.805 1.00 162.95 ? 517 LYS B HZ2  1 
ATOM   7147 H  HZ3  . LYS B 1 156 ? -32.705 -18.234 -23.039 1.00 162.95 ? 517 LYS B HZ3  1 
ATOM   7148 N  N    . VAL B 1 157 ? -30.021 -24.457 -21.246 1.00 65.66  ? 518 VAL B N    1 
ATOM   7149 C  CA   . VAL B 1 157 ? -28.597 -24.589 -21.518 1.00 76.79  ? 518 VAL B CA   1 
ATOM   7150 C  C    . VAL B 1 157 ? -28.304 -26.072 -21.675 1.00 75.74  ? 518 VAL B C    1 
ATOM   7151 O  O    . VAL B 1 157 ? -27.525 -26.464 -22.540 1.00 75.66  ? 518 VAL B O    1 
ATOM   7152 C  CB   . VAL B 1 157 ? -27.692 -23.957 -20.419 1.00 67.74  ? 518 VAL B CB   1 
ATOM   7153 C  CG1  . VAL B 1 157 ? -28.131 -22.534 -20.123 1.00 62.53  ? 518 VAL B CG1  1 
ATOM   7154 C  CG2  . VAL B 1 157 ? -27.676 -24.790 -19.153 1.00 82.41  ? 518 VAL B CG2  1 
ATOM   7155 H  H    . VAL B 1 157 ? -30.225 -24.197 -20.452 1.00 78.79  ? 518 VAL B H    1 
ATOM   7156 H  HA   . VAL B 1 157 ? -28.395 -24.152 -22.360 1.00 92.14  ? 518 VAL B HA   1 
ATOM   7157 H  HB   . VAL B 1 157 ? -26.782 -23.918 -20.755 1.00 81.29  ? 518 VAL B HB   1 
ATOM   7158 H  HG11 . VAL B 1 157 ? -27.554 -22.162 -19.438 1.00 75.04  ? 518 VAL B HG11 1 
ATOM   7159 H  HG12 . VAL B 1 157 ? -28.062 -22.007 -20.935 1.00 75.04  ? 518 VAL B HG12 1 
ATOM   7160 H  HG13 . VAL B 1 157 ? -29.049 -22.546 -19.812 1.00 75.04  ? 518 VAL B HG13 1 
ATOM   7161 H  HG21 . VAL B 1 157 ? -27.102 -24.359 -18.500 1.00 98.89  ? 518 VAL B HG21 1 
ATOM   7162 H  HG22 . VAL B 1 157 ? -28.580 -24.855 -18.807 1.00 98.89  ? 518 VAL B HG22 1 
ATOM   7163 H  HG23 . VAL B 1 157 ? -27.336 -25.674 -19.361 1.00 98.89  ? 518 VAL B HG23 1 
ATOM   7164 N  N    . LEU B 1 158 ? -28.963 -26.898 -20.867 1.00 61.79  ? 519 LEU B N    1 
ATOM   7165 C  CA   . LEU B 1 158 ? -28.714 -28.334 -20.891 1.00 61.21  ? 519 LEU B CA   1 
ATOM   7166 C  C    . LEU B 1 158 ? -29.155 -28.964 -22.207 1.00 85.32  ? 519 LEU B C    1 
ATOM   7167 O  O    . LEU B 1 158 ? -28.446 -29.802 -22.765 1.00 70.46  ? 519 LEU B O    1 
ATOM   7168 C  CB   . LEU B 1 158 ? -29.422 -29.031 -19.732 1.00 64.44  ? 519 LEU B CB   1 
ATOM   7169 C  CG   . LEU B 1 158 ? -28.789 -28.839 -18.351 1.00 67.52  ? 519 LEU B CG   1 
ATOM   7170 C  CD1  . LEU B 1 158 ? -29.701 -29.417 -17.288 1.00 69.96  ? 519 LEU B CD1  1 
ATOM   7171 C  CD2  . LEU B 1 158 ? -27.402 -29.476 -18.271 1.00 63.67  ? 519 LEU B CD2  1 
ATOM   7172 H  H    . LEU B 1 158 ? -29.557 -26.652 -20.296 1.00 74.15  ? 519 LEU B H    1 
ATOM   7173 H  HA   . LEU B 1 158 ? -27.761 -28.488 -20.793 1.00 73.45  ? 519 LEU B HA   1 
ATOM   7174 H  HB2  . LEU B 1 158 ? -30.331 -28.696 -19.683 1.00 77.33  ? 519 LEU B HB2  1 
ATOM   7175 H  HB3  . LEU B 1 158 ? -29.439 -29.984 -19.913 1.00 77.33  ? 519 LEU B HB3  1 
ATOM   7176 H  HG   . LEU B 1 158 ? -28.692 -27.889 -18.177 1.00 81.03  ? 519 LEU B HG   1 
ATOM   7177 H  HD11 . LEU B 1 158 ? -29.291 -29.291 -16.418 1.00 83.95  ? 519 LEU B HD11 1 
ATOM   7178 H  HD12 . LEU B 1 158 ? -30.555 -28.959 -17.322 1.00 83.95  ? 519 LEU B HD12 1 
ATOM   7179 H  HD13 . LEU B 1 158 ? -29.825 -30.364 -17.461 1.00 83.95  ? 519 LEU B HD13 1 
ATOM   7180 H  HD21 . LEU B 1 158 ? -27.039 -29.331 -17.384 1.00 76.40  ? 519 LEU B HD21 1 
ATOM   7181 H  HD22 . LEU B 1 158 ? -27.481 -30.427 -18.446 1.00 76.40  ? 519 LEU B HD22 1 
ATOM   7182 H  HD23 . LEU B 1 158 ? -26.827 -29.064 -18.935 1.00 76.40  ? 519 LEU B HD23 1 
ATOM   7183 N  N    . THR B 1 159 ? -30.321 -28.567 -22.705 1.00 73.90  ? 520 THR B N    1 
ATOM   7184 C  CA   . THR B 1 159 ? -30.834 -29.155 -23.933 1.00 70.37  ? 520 THR B CA   1 
ATOM   7185 C  C    . THR B 1 159 ? -29.994 -28.675 -25.124 1.00 72.69  ? 520 THR B C    1 
ATOM   7186 O  O    . THR B 1 159 ? -29.719 -29.442 -26.048 1.00 79.13  ? 520 THR B O    1 
ATOM   7187 C  CB   . THR B 1 159 ? -32.329 -28.825 -24.139 1.00 87.85  ? 520 THR B CB   1 
ATOM   7188 O  OG1  . THR B 1 159 ? -32.866 -29.653 -25.178 1.00 96.87  ? 520 THR B OG1  1 
ATOM   7189 C  CG2  . THR B 1 159 ? -32.534 -27.363 -24.494 1.00 90.99  ? 520 THR B CG2  1 
ATOM   7190 H  H    . THR B 1 159 ? -30.828 -27.967 -22.355 1.00 88.67  ? 520 THR B H    1 
ATOM   7191 H  HA   . THR B 1 159 ? -30.747 -30.120 -23.879 1.00 84.44  ? 520 THR B HA   1 
ATOM   7192 H  HB   . THR B 1 159 ? -32.808 -29.003 -23.314 1.00 105.42 ? 520 THR B HB   1 
ATOM   7193 H  HG1  . THR B 1 159 ? -33.679 -29.478 -25.294 1.00 116.25 ? 520 THR B HG1  1 
ATOM   7194 H  HG21 . THR B 1 159 ? -33.479 -27.181 -24.618 1.00 109.19 ? 520 THR B HG21 1 
ATOM   7195 H  HG22 . THR B 1 159 ? -32.195 -26.798 -23.782 1.00 109.19 ? 520 THR B HG22 1 
ATOM   7196 H  HG23 . THR B 1 159 ? -32.063 -27.152 -25.315 1.00 109.19 ? 520 THR B HG23 1 
ATOM   7197 N  N    . ASP B 1 160 ? -29.569 -27.413 -25.079 1.00 75.29  ? 521 ASP B N    1 
ATOM   7198 C  CA   . ASP B 1 160 ? -28.672 -26.855 -26.088 1.00 87.41  ? 521 ASP B CA   1 
ATOM   7199 C  C    . ASP B 1 160 ? -27.361 -27.631 -26.141 1.00 84.57  ? 521 ASP B C    1 
ATOM   7200 O  O    . ASP B 1 160 ? -26.764 -27.798 -27.204 1.00 75.28  ? 521 ASP B O    1 
ATOM   7201 C  CB   . ASP B 1 160 ? -28.386 -25.380 -25.797 1.00 68.23  ? 521 ASP B CB   1 
ATOM   7202 C  CG   . ASP B 1 160 ? -29.556 -24.479 -26.133 1.00 87.21  ? 521 ASP B CG   1 
ATOM   7203 O  OD1  . ASP B 1 160 ? -30.679 -24.995 -26.318 1.00 90.02  ? 521 ASP B OD1  1 
ATOM   7204 O  OD2  . ASP B 1 160 ? -29.353 -23.249 -26.205 1.00 101.26 ? 521 ASP B OD2  1 
ATOM   7205 H  H    . ASP B 1 160 ? -29.790 -26.853 -24.465 1.00 90.35  ? 521 ASP B H    1 
ATOM   7206 H  HA   . ASP B 1 160 ? -29.095 -26.915 -26.959 1.00 104.90 ? 521 ASP B HA   1 
ATOM   7207 H  HB2  . ASP B 1 160 ? -28.188 -25.277 -24.853 1.00 81.87  ? 521 ASP B HB2  1 
ATOM   7208 H  HB3  . ASP B 1 160 ? -27.626 -25.095 -26.328 1.00 81.87  ? 521 ASP B HB3  1 
ATOM   7209 N  N    . ILE B 1 161 ? -26.919 -28.097 -24.981 1.00 61.23  ? 522 ILE B N    1 
ATOM   7210 C  CA   . ILE B 1 161 ? -25.687 -28.863 -24.879 1.00 76.44  ? 522 ILE B CA   1 
ATOM   7211 C  C    . ILE B 1 161 ? -25.869 -30.238 -25.514 1.00 71.87  ? 522 ILE B C    1 
ATOM   7212 O  O    . ILE B 1 161 ? -24.953 -30.752 -26.157 1.00 66.48  ? 522 ILE B O    1 
ATOM   7213 C  CB   . ILE B 1 161 ? -25.234 -28.990 -23.400 1.00 78.08  ? 522 ILE B CB   1 
ATOM   7214 C  CG1  . ILE B 1 161 ? -24.551 -27.690 -22.962 1.00 53.37  ? 522 ILE B CG1  1 
ATOM   7215 C  CG2  . ILE B 1 161 ? -24.278 -30.170 -23.208 1.00 73.34  ? 522 ILE B CG2  1 
ATOM   7216 C  CD1  . ILE B 1 161 ? -24.150 -27.631 -21.485 1.00 55.05  ? 522 ILE B CD1  1 
ATOM   7217 H  H    . ILE B 1 161 ? -27.320 -27.981 -24.229 1.00 73.47  ? 522 ILE B H    1 
ATOM   7218 H  HA   . ILE B 1 161 ? -24.988 -28.399 -25.366 1.00 91.73  ? 522 ILE B HA   1 
ATOM   7219 H  HB   . ILE B 1 161 ? -26.018 -29.132 -22.846 1.00 93.70  ? 522 ILE B HB   1 
ATOM   7220 H  HG12 . ILE B 1 161 ? -23.745 -27.574 -23.488 1.00 64.05  ? 522 ILE B HG12 1 
ATOM   7221 H  HG13 . ILE B 1 161 ? -25.157 -26.952 -23.129 1.00 64.05  ? 522 ILE B HG13 1 
ATOM   7222 H  HG21 . ILE B 1 161 ? -24.018 -30.216 -22.274 1.00 88.01  ? 522 ILE B HG21 1 
ATOM   7223 H  HG22 . ILE B 1 161 ? -24.730 -30.988 -23.467 1.00 88.01  ? 522 ILE B HG22 1 
ATOM   7224 H  HG23 . ILE B 1 161 ? -23.494 -30.034 -23.763 1.00 88.01  ? 522 ILE B HG23 1 
ATOM   7225 H  HD11 . ILE B 1 161 ? -23.728 -26.776 -21.306 1.00 66.06  ? 522 ILE B HD11 1 
ATOM   7226 H  HD12 . ILE B 1 161 ? -24.945 -27.729 -20.938 1.00 66.06  ? 522 ILE B HD12 1 
ATOM   7227 H  HD13 . ILE B 1 161 ? -23.529 -28.352 -21.297 1.00 66.06  ? 522 ILE B HD13 1 
ATOM   7228 N  N    . LYS B 1 162 ? -27.046 -30.833 -25.342 1.00 70.07  ? 523 LYS B N    1 
ATOM   7229 C  CA   . LYS B 1 162 ? -27.339 -32.109 -25.990 1.00 85.25  ? 523 LYS B CA   1 
ATOM   7230 C  C    . LYS B 1 162 ? -27.631 -31.893 -27.474 1.00 101.31 ? 523 LYS B C    1 
ATOM   7231 O  O    . LYS B 1 162 ? -27.572 -32.830 -28.268 1.00 102.36 ? 523 LYS B O    1 
ATOM   7232 C  CB   . LYS B 1 162 ? -28.517 -32.813 -25.312 1.00 85.83  ? 523 LYS B CB   1 
ATOM   7233 C  CG   . LYS B 1 162 ? -28.319 -33.062 -23.819 1.00 118.04 ? 523 LYS B CG   1 
ATOM   7234 C  CD   . LYS B 1 162 ? -27.095 -33.926 -23.527 1.00 121.47 ? 523 LYS B CD   1 
ATOM   7235 C  CE   . LYS B 1 162 ? -26.920 -34.148 -22.030 1.00 114.23 ? 523 LYS B CE   1 
ATOM   7236 N  NZ   . LYS B 1 162 ? -25.817 -35.102 -21.718 1.00 105.73 ? 523 LYS B NZ   1 
ATOM   7237 H  H    . LYS B 1 162 ? -27.687 -30.523 -24.859 1.00 84.08  ? 523 LYS B H    1 
ATOM   7238 H  HA   . LYS B 1 162 ? -26.562 -32.686 -25.918 1.00 102.30 ? 523 LYS B HA   1 
ATOM   7239 H  HB2  . LYS B 1 162 ? -29.310 -32.264 -25.417 1.00 102.99 ? 523 LYS B HB2  1 
ATOM   7240 H  HB3  . LYS B 1 162 ? -28.654 -33.673 -25.739 1.00 102.99 ? 523 LYS B HB3  1 
ATOM   7241 H  HG2  . LYS B 1 162 ? -28.200 -32.211 -23.369 1.00 141.65 ? 523 LYS B HG2  1 
ATOM   7242 H  HG3  . LYS B 1 162 ? -29.100 -33.518 -23.468 1.00 141.65 ? 523 LYS B HG3  1 
ATOM   7243 H  HD2  . LYS B 1 162 ? -27.203 -34.791 -23.953 1.00 145.77 ? 523 LYS B HD2  1 
ATOM   7244 H  HD3  . LYS B 1 162 ? -26.301 -33.483 -23.865 1.00 145.77 ? 523 LYS B HD3  1 
ATOM   7245 H  HE2  . LYS B 1 162 ? -26.713 -33.300 -21.606 1.00 137.08 ? 523 LYS B HE2  1 
ATOM   7246 H  HE3  . LYS B 1 162 ? -27.742 -34.510 -21.665 1.00 137.08 ? 523 LYS B HE3  1 
ATOM   7247 H  HZ1  . LYS B 1 162 ? -25.745 -35.206 -20.837 1.00 126.88 ? 523 LYS B HZ1  1 
ATOM   7248 H  HZ2  . LYS B 1 162 ? -25.985 -35.893 -22.090 1.00 126.88 ? 523 LYS B HZ2  1 
ATOM   7249 H  HZ3  . LYS B 1 162 ? -25.046 -34.790 -22.036 1.00 126.88 ? 523 LYS B HZ3  1 
ATOM   7250 N  N    . ALA B 1 163 ? -27.940 -30.651 -27.841 1.00 104.14 ? 524 ALA B N    1 
ATOM   7251 C  CA   . ALA B 1 163 ? -28.187 -30.292 -29.234 1.00 96.79  ? 524 ALA B CA   1 
ATOM   7252 C  C    . ALA B 1 163 ? -26.874 -30.013 -29.963 1.00 94.53  ? 524 ALA B C    1 
ATOM   7253 O  O    . ALA B 1 163 ? -26.867 -29.649 -31.142 1.00 90.74  ? 524 ALA B O    1 
ATOM   7254 C  CB   . ALA B 1 163 ? -29.103 -29.080 -29.311 1.00 103.76 ? 524 ALA B CB   1 
ATOM   7255 H  H    . ALA B 1 163 ? -28.012 -29.991 -27.294 1.00 124.97 ? 524 ALA B H    1 
ATOM   7256 H  HA   . ALA B 1 163 ? -28.628 -31.032 -29.679 1.00 116.15 ? 524 ALA B HA   1 
ATOM   7257 H  HB1  . ALA B 1 163 ? -29.255 -28.858 -30.242 1.00 124.51 ? 524 ALA B HB1  1 
ATOM   7258 H  HB2  . ALA B 1 163 ? -29.945 -29.293 -28.879 1.00 124.51 ? 524 ALA B HB2  1 
ATOM   7259 H  HB3  . ALA B 1 163 ? -28.678 -28.335 -28.857 1.00 124.51 ? 524 ALA B HB3  1 
ATOM   7260 N  N    . ASP B 1 164 ? -25.766 -30.201 -29.253 1.00 89.11  ? 525 ASP B N    1 
ATOM   7261 C  CA   . ASP B 1 164 ? -24.443 -29.889 -29.771 1.00 84.89  ? 525 ASP B CA   1 
ATOM   7262 C  C    . ASP B 1 164 ? -23.642 -31.172 -29.943 1.00 80.92  ? 525 ASP B C    1 
ATOM   7263 O  O    . ASP B 1 164 ? -23.413 -31.903 -28.978 1.00 89.80  ? 525 ASP B O    1 
ATOM   7264 C  CB   . ASP B 1 164 ? -23.725 -28.917 -28.830 1.00 96.06  ? 525 ASP B CB   1 
ATOM   7265 C  CG   . ASP B 1 164 ? -22.435 -28.373 -29.416 1.00 107.56 ? 525 ASP B CG   1 
ATOM   7266 O  OD1  . ASP B 1 164 ? -21.585 -29.173 -29.857 1.00 113.06 ? 525 ASP B OD1  1 
ATOM   7267 O  OD2  . ASP B 1 164 ? -22.272 -27.135 -29.436 1.00 103.98 ? 525 ASP B OD2  1 
ATOM   7268 H  H    . ASP B 1 164 ? -25.757 -30.515 -28.452 1.00 106.94 ? 525 ASP B H    1 
ATOM   7269 H  HA   . ASP B 1 164 ? -24.529 -29.465 -30.639 1.00 101.86 ? 525 ASP B HA   1 
ATOM   7270 H  HB2  . ASP B 1 164 ? -24.310 -28.167 -28.645 1.00 115.28 ? 525 ASP B HB2  1 
ATOM   7271 H  HB3  . ASP B 1 164 ? -23.507 -29.379 -28.006 1.00 115.28 ? 525 ASP B HB3  1 
ATOM   7272 N  N    . LYS B 1 165 ? -23.224 -31.438 -31.178 1.00 84.84  ? 526 LYS B N    1 
ATOM   7273 C  CA   . LYS B 1 165 ? -22.459 -32.641 -31.491 1.00 97.13  ? 526 LYS B CA   1 
ATOM   7274 C  C    . LYS B 1 165 ? -21.049 -32.304 -31.975 1.00 81.01  ? 526 LYS B C    1 
ATOM   7275 O  O    . LYS B 1 165 ? -20.402 -33.120 -32.631 1.00 81.59  ? 526 LYS B O    1 
ATOM   7276 C  CB   . LYS B 1 165 ? -23.197 -33.486 -32.540 1.00 91.59  ? 526 LYS B CB   1 
ATOM   7277 C  CG   . LYS B 1 165 ? -24.638 -33.839 -32.156 1.00 92.97  ? 526 LYS B CG   1 
ATOM   7278 C  CD   . LYS B 1 165 ? -24.719 -34.550 -30.799 1.00 116.85 ? 526 LYS B CD   1 
ATOM   7279 C  CE   . LYS B 1 165 ? -26.137 -34.589 -30.253 1.00 114.81 ? 526 LYS B CE   1 
ATOM   7280 N  NZ   . LYS B 1 165 ? -26.944 -35.703 -30.814 1.00 113.72 ? 526 LYS B NZ   1 
ATOM   7281 H  H    . LYS B 1 165 ? -23.372 -30.933 -31.858 1.00 101.81 ? 526 LYS B H    1 
ATOM   7282 H  HA   . LYS B 1 165 ? -22.376 -33.176 -30.686 1.00 116.55 ? 526 LYS B HA   1 
ATOM   7283 H  HB2  . LYS B 1 165 ? -23.226 -32.991 -33.374 1.00 109.91 ? 526 LYS B HB2  1 
ATOM   7284 H  HB3  . LYS B 1 165 ? -22.713 -34.316 -32.668 1.00 109.91 ? 526 LYS B HB3  1 
ATOM   7285 H  HG2  . LYS B 1 165 ? -25.162 -33.024 -32.101 1.00 111.57 ? 526 LYS B HG2  1 
ATOM   7286 H  HG3  . LYS B 1 165 ? -25.011 -34.431 -32.829 1.00 111.57 ? 526 LYS B HG3  1 
ATOM   7287 H  HD2  . LYS B 1 165 ? -24.409 -35.463 -30.901 1.00 140.22 ? 526 LYS B HD2  1 
ATOM   7288 H  HD3  . LYS B 1 165 ? -24.162 -34.078 -30.160 1.00 140.22 ? 526 LYS B HD3  1 
ATOM   7289 H  HE2  . LYS B 1 165 ? -26.101 -34.701 -29.290 1.00 137.77 ? 526 LYS B HE2  1 
ATOM   7290 H  HE3  . LYS B 1 165 ? -26.583 -33.756 -30.473 1.00 137.77 ? 526 LYS B HE3  1 
ATOM   7291 H  HZ1  . LYS B 1 165 ? -27.764 -35.689 -30.468 1.00 136.46 ? 526 LYS B HZ1  1 
ATOM   7292 H  HZ2  . LYS B 1 165 ? -27.001 -35.621 -31.698 1.00 136.46 ? 526 LYS B HZ2  1 
ATOM   7293 H  HZ3  . LYS B 1 165 ? -26.562 -36.483 -30.620 1.00 136.46 ? 526 LYS B HZ3  1 
ATOM   7294 N  N    . ASP B 1 166 ? -20.578 -31.100 -31.655 1.00 74.30  ? 527 ASP B N    1 
ATOM   7295 C  CA   . ASP B 1 166 ? -19.161 -30.795 -31.807 1.00 72.05  ? 527 ASP B CA   1 
ATOM   7296 C  C    . ASP B 1 166 ? -18.404 -31.635 -30.789 1.00 65.61  ? 527 ASP B C    1 
ATOM   7297 O  O    . ASP B 1 166 ? -18.921 -31.930 -29.711 1.00 69.30  ? 527 ASP B O    1 
ATOM   7298 C  CB   . ASP B 1 166 ? -18.864 -29.307 -31.599 1.00 78.64  ? 527 ASP B CB   1 
ATOM   7299 C  CG   . ASP B 1 166 ? -19.327 -28.441 -32.758 1.00 92.43  ? 527 ASP B CG   1 
ATOM   7300 O  OD1  . ASP B 1 166 ? -19.485 -28.966 -33.880 1.00 91.28  ? 527 ASP B OD1  1 
ATOM   7301 O  OD2  . ASP B 1 166 ? -19.520 -27.224 -32.543 1.00 89.94  ? 527 ASP B OD2  1 
ATOM   7302 H  H    . ASP B 1 166 ? -21.053 -30.451 -31.352 1.00 89.15  ? 527 ASP B H    1 
ATOM   7303 H  HA   . ASP B 1 166 ? -18.867 -31.048 -32.697 1.00 86.46  ? 527 ASP B HA   1 
ATOM   7304 H  HB2  . ASP B 1 166 ? -19.320 -29.004 -30.798 1.00 94.37  ? 527 ASP B HB2  1 
ATOM   7305 H  HB3  . ASP B 1 166 ? -17.907 -29.187 -31.501 1.00 94.37  ? 527 ASP B HB3  1 
ATOM   7306 N  N    . GLN B 1 167 ? -17.183 -32.022 -31.131 1.00 67.70  ? 528 GLN B N    1 
ATOM   7307 C  CA   . GLN B 1 167 ? -16.373 -32.854 -30.249 1.00 73.78  ? 528 GLN B CA   1 
ATOM   7308 C  C    . GLN B 1 167 ? -15.814 -32.044 -29.073 1.00 51.62  ? 528 GLN B C    1 
ATOM   7309 O  O    . GLN B 1 167 ? -15.121 -31.042 -29.266 1.00 52.17  ? 528 GLN B O    1 
ATOM   7310 C  CB   . GLN B 1 167 ? -15.244 -33.510 -31.053 1.00 71.70  ? 528 GLN B CB   1 
ATOM   7311 C  CG   . GLN B 1 167 ? -14.064 -34.028 -30.238 1.00 91.24  ? 528 GLN B CG   1 
ATOM   7312 C  CD   . GLN B 1 167 ? -14.452 -35.104 -29.243 1.00 114.37 ? 528 GLN B CD   1 
ATOM   7313 O  OE1  . GLN B 1 167 ? -14.113 -35.024 -28.062 1.00 133.34 ? 528 GLN B OE1  1 
ATOM   7314 N  NE2  . GLN B 1 167 ? -15.151 -36.127 -29.720 1.00 98.77  ? 528 GLN B NE2  1 
ATOM   7315 H  H    . GLN B 1 167 ? -16.797 -31.817 -31.872 1.00 81.24  ? 528 GLN B H    1 
ATOM   7316 H  HA   . GLN B 1 167 ? -16.930 -33.560 -29.885 1.00 88.54  ? 528 GLN B HA   1 
ATOM   7317 H  HB2  . GLN B 1 167 ? -15.613 -34.264 -31.539 1.00 86.04  ? 528 GLN B HB2  1 
ATOM   7318 H  HB3  . GLN B 1 167 ? -14.897 -32.858 -31.682 1.00 86.04  ? 528 GLN B HB3  1 
ATOM   7319 H  HG2  . GLN B 1 167 ? -13.405 -34.404 -30.843 1.00 109.49 ? 528 GLN B HG2  1 
ATOM   7320 H  HG3  . GLN B 1 167 ? -13.676 -33.290 -29.743 1.00 109.49 ? 528 GLN B HG3  1 
ATOM   7321 H  HE21 . GLN B 1 167 ? -15.360 -36.154 -30.554 1.00 118.53 ? 528 GLN B HE21 1 
ATOM   7322 H  HE22 . GLN B 1 167 ? -15.395 -36.763 -29.195 1.00 118.53 ? 528 GLN B HE22 1 
ATOM   7323 N  N    . ALA B 1 168 ? -16.141 -32.482 -27.858 1.00 67.70  ? 529 ALA B N    1 
ATOM   7324 C  CA   . ALA B 1 168 ? -15.574 -31.916 -26.633 1.00 62.07  ? 529 ALA B CA   1 
ATOM   7325 C  C    . ALA B 1 168 ? -14.835 -33.019 -25.887 1.00 64.85  ? 529 ALA B C    1 
ATOM   7326 O  O    . ALA B 1 168 ? -15.417 -34.057 -25.575 1.00 72.83  ? 529 ALA B O    1 
ATOM   7327 C  CB   . ALA B 1 168 ? -16.660 -31.309 -25.755 1.00 55.21  ? 529 ALA B CB   1 
ATOM   7328 H  H    . ALA B 1 168 ? -16.700 -33.119 -27.714 1.00 81.25  ? 529 ALA B H    1 
ATOM   7329 H  HA   . ALA B 1 168 ? -14.938 -31.220 -26.862 1.00 74.48  ? 529 ALA B HA   1 
ATOM   7330 H  HB1  . ALA B 1 168 ? -16.251 -30.944 -24.955 1.00 66.25  ? 529 ALA B HB1  1 
ATOM   7331 H  HB2  . ALA B 1 168 ? -17.107 -30.604 -26.249 1.00 66.25  ? 529 ALA B HB2  1 
ATOM   7332 H  HB3  . ALA B 1 168 ? -17.296 -32.001 -25.517 1.00 66.25  ? 529 ALA B HB3  1 
ATOM   7333 N  N    . ASN B 1 169 ? -13.554 -32.796 -25.613 1.00 62.30  ? 530 ASN B N    1 
ATOM   7334 C  CA   . ASN B 1 169 ? -12.699 -33.827 -25.029 1.00 49.67  ? 530 ASN B CA   1 
ATOM   7335 C  C    . ASN B 1 169 ? -13.132 -34.257 -23.628 1.00 62.76  ? 530 ASN B C    1 
ATOM   7336 O  O    . ASN B 1 169 ? -12.850 -35.381 -23.209 1.00 69.00  ? 530 ASN B O    1 
ATOM   7337 C  CB   . ASN B 1 169 ? -11.250 -33.340 -24.986 1.00 56.28  ? 530 ASN B CB   1 
ATOM   7338 C  CG   . ASN B 1 169 ? -10.628 -33.245 -26.367 1.00 52.12  ? 530 ASN B CG   1 
ATOM   7339 O  OD1  . ASN B 1 169 ? -10.977 -34.007 -27.269 1.00 59.50  ? 530 ASN B OD1  1 
ATOM   7340 N  ND2  . ASN B 1 169 ? -9.698  -32.312 -26.537 1.00 67.24  ? 530 ASN B ND2  1 
ATOM   7341 H  H    . ASN B 1 169 ? -13.151 -32.049 -25.757 1.00 74.76  ? 530 ASN B H    1 
ATOM   7342 H  HA   . ASN B 1 169 ? -12.729 -34.612 -25.598 1.00 59.60  ? 530 ASN B HA   1 
ATOM   7343 H  HB2  . ASN B 1 169 ? -11.224 -32.459 -24.583 1.00 67.54  ? 530 ASN B HB2  1 
ATOM   7344 H  HB3  . ASN B 1 169 ? -10.723 -33.962 -24.461 1.00 67.54  ? 530 ASN B HB3  1 
ATOM   7345 H  HD21 . ASN B 1 169 ? -9.316  -32.220 -27.303 1.00 80.68  ? 530 ASN B HD21 1 
ATOM   7346 H  HD22 . ASN B 1 169 ? -9.477  -31.801 -25.883 1.00 80.68  ? 530 ASN B HD22 1 
ATOM   7347 N  N    . ASP B 1 170 ? -13.811 -33.365 -22.911 1.00 65.34  ? 531 ASP B N    1 
ATOM   7348 C  CA   . ASP B 1 170 ? -14.310 -33.672 -21.572 1.00 70.37  ? 531 ASP B CA   1 
ATOM   7349 C  C    . ASP B 1 170 ? -15.720 -33.116 -21.367 1.00 66.56  ? 531 ASP B C    1 
ATOM   7350 O  O    . ASP B 1 170 ? -16.117 -32.791 -20.248 1.00 64.98  ? 531 ASP B O    1 
ATOM   7351 C  CB   . ASP B 1 170 ? -13.353 -33.124 -20.505 1.00 81.10  ? 531 ASP B CB   1 
ATOM   7352 C  CG   . ASP B 1 170 ? -12.962 -31.675 -20.750 1.00 102.06 ? 531 ASP B CG   1 
ATOM   7353 O  OD1  . ASP B 1 170 ? -13.708 -30.960 -21.454 1.00 110.97 ? 531 ASP B OD1  1 
ATOM   7354 O  OD2  . ASP B 1 170 ? -11.907 -31.250 -20.231 1.00 94.09  ? 531 ASP B OD2  1 
ATOM   7355 H  H    . ASP B 1 170 ? -13.996 -32.569 -23.179 1.00 78.41  ? 531 ASP B H    1 
ATOM   7356 H  HA   . ASP B 1 170 ? -14.352 -34.636 -21.467 1.00 84.44  ? 531 ASP B HA   1 
ATOM   7357 H  HB2  . ASP B 1 170 ? -13.784 -33.175 -19.637 1.00 97.32  ? 531 ASP B HB2  1 
ATOM   7358 H  HB3  . ASP B 1 170 ? -12.542 -33.657 -20.504 1.00 97.32  ? 531 ASP B HB3  1 
ATOM   7359 N  N    . GLY B 1 171 ? -16.471 -33.010 -22.460 1.00 64.55  ? 532 GLY B N    1 
ATOM   7360 C  CA   . GLY B 1 171 ? -17.856 -32.578 -22.403 1.00 57.62  ? 532 GLY B CA   1 
ATOM   7361 C  C    . GLY B 1 171 ? -17.997 -31.080 -22.215 1.00 52.24  ? 532 GLY B C    1 
ATOM   7362 O  O    . GLY B 1 171 ? -17.015 -30.384 -21.963 1.00 55.37  ? 532 GLY B O    1 
ATOM   7363 H  H    . GLY B 1 171 ? -16.194 -33.187 -23.255 1.00 77.46  ? 532 GLY B H    1 
ATOM   7364 H  HA2  . GLY B 1 171 ? -18.305 -32.826 -23.226 1.00 69.15  ? 532 GLY B HA2  1 
ATOM   7365 H  HA3  . GLY B 1 171 ? -18.302 -33.022 -21.665 1.00 69.15  ? 532 GLY B HA3  1 
ATOM   7366 N  N    . LEU B 1 172 ? -19.228 -30.590 -22.343 1.00 46.78  ? 533 LEU B N    1 
ATOM   7367 C  CA   . LEU B 1 172 ? -19.537 -29.177 -22.138 1.00 50.82  ? 533 LEU B CA   1 
ATOM   7368 C  C    . LEU B 1 172 ? -20.112 -28.942 -20.738 1.00 59.11  ? 533 LEU B C    1 
ATOM   7369 O  O    . LEU B 1 172 ? -20.545 -29.884 -20.074 1.00 58.41  ? 533 LEU B O    1 
ATOM   7370 C  CB   . LEU B 1 172 ? -20.520 -28.693 -23.198 1.00 60.40  ? 533 LEU B CB   1 
ATOM   7371 C  CG   . LEU B 1 172 ? -20.050 -28.796 -24.652 1.00 57.16  ? 533 LEU B CG   1 
ATOM   7372 C  CD1  . LEU B 1 172 ? -21.184 -28.426 -25.572 1.00 49.44  ? 533 LEU B CD1  1 
ATOM   7373 C  CD2  . LEU B 1 172 ? -18.869 -27.890 -24.895 1.00 61.80  ? 533 LEU B CD2  1 
ATOM   7374 H  H    . LEU B 1 172 ? -19.913 -31.065 -22.553 1.00 56.14  ? 533 LEU B H    1 
ATOM   7375 H  HA   . LEU B 1 172 ? -18.722 -28.658 -22.221 1.00 60.98  ? 533 LEU B HA   1 
ATOM   7376 H  HB2  . LEU B 1 172 ? -21.334 -29.215 -23.121 1.00 72.48  ? 533 LEU B HB2  1 
ATOM   7377 H  HB3  . LEU B 1 172 ? -20.720 -27.759 -23.025 1.00 72.48  ? 533 LEU B HB3  1 
ATOM   7378 H  HG   . LEU B 1 172 ? -19.784 -29.709 -24.843 1.00 68.59  ? 533 LEU B HG   1 
ATOM   7379 H  HD11 . LEU B 1 172 ? -20.879 -28.493 -26.490 1.00 59.32  ? 533 LEU B HD11 1 
ATOM   7380 H  HD12 . LEU B 1 172 ? -21.923 -29.036 -25.422 1.00 59.32  ? 533 LEU B HD12 1 
ATOM   7381 H  HD13 . LEU B 1 172 ? -21.461 -27.516 -25.380 1.00 59.32  ? 533 LEU B HD13 1 
ATOM   7382 H  HD21 . LEU B 1 172 ? -18.592 -27.975 -25.821 1.00 74.16  ? 533 LEU B HD21 1 
ATOM   7383 H  HD22 . LEU B 1 172 ? -19.130 -26.975 -24.710 1.00 74.16  ? 533 LEU B HD22 1 
ATOM   7384 H  HD23 . LEU B 1 172 ? -18.144 -28.153 -24.307 1.00 74.16  ? 533 LEU B HD23 1 
ATOM   7385 N  N    . SER B 1 173 ? -20.135 -27.681 -20.312 1.00 48.38  ? 534 SER B N    1 
ATOM   7386 C  CA   . SER B 1 173 ? -20.541 -27.326 -18.952 1.00 49.95  ? 534 SER B CA   1 
ATOM   7387 C  C    . SER B 1 173 ? -21.767 -26.436 -18.921 1.00 50.25  ? 534 SER B C    1 
ATOM   7388 O  O    . SER B 1 173 ? -21.868 -25.478 -19.685 1.00 52.25  ? 534 SER B O    1 
ATOM   7389 C  CB   . SER B 1 173 ? -19.401 -26.614 -18.226 1.00 43.78  ? 534 SER B CB   1 
ATOM   7390 O  OG   . SER B 1 173 ? -18.245 -27.426 -18.183 1.00 46.80  ? 534 SER B OG   1 
ATOM   7391 H  H    . SER B 1 173 ? -19.916 -27.005 -20.796 1.00 58.06  ? 534 SER B H    1 
ATOM   7392 H  HA   . SER B 1 173 ? -20.748 -28.137 -18.462 1.00 59.94  ? 534 SER B HA   1 
ATOM   7393 H  HB2  . SER B 1 173 ? -19.191 -25.793 -18.698 1.00 52.53  ? 534 SER B HB2  1 
ATOM   7394 H  HB3  . SER B 1 173 ? -19.680 -26.414 -17.319 1.00 52.53  ? 534 SER B HB3  1 
ATOM   7395 H  HG   . SER B 1 173 ? -17.992 -27.608 -18.963 1.00 56.16  ? 534 SER B HG   1 
ATOM   7396 N  N    . SER B 1 174 ? -22.682 -26.741 -18.009 1.00 53.31  ? 535 SER B N    1 
ATOM   7397 C  CA   . SER B 1 174 ? -23.855 -25.910 -17.794 1.00 52.62  ? 535 SER B CA   1 
ATOM   7398 C  C    . SER B 1 174 ? -23.699 -25.028 -16.553 1.00 51.80  ? 535 SER B C    1 
ATOM   7399 O  O    . SER B 1 174 ? -24.534 -24.164 -16.300 1.00 48.30  ? 535 SER B O    1 
ATOM   7400 C  CB   . SER B 1 174 ? -25.107 -26.779 -17.660 1.00 51.76  ? 535 SER B CB   1 
ATOM   7401 O  OG   . SER B 1 174 ? -25.008 -27.653 -16.551 1.00 49.15  ? 535 SER B OG   1 
ATOM   7402 H  H    . SER B 1 174 ? -22.645 -27.432 -17.498 1.00 63.97  ? 535 SER B H    1 
ATOM   7403 H  HA   . SER B 1 174 ? -23.975 -25.329 -18.561 1.00 63.14  ? 535 SER B HA   1 
ATOM   7404 H  HB2  . SER B 1 174 ? -25.878 -26.203 -17.538 1.00 62.11  ? 535 SER B HB2  1 
ATOM   7405 H  HB3  . SER B 1 174 ? -25.212 -27.306 -18.467 1.00 62.11  ? 535 SER B HB3  1 
ATOM   7406 H  HG   . SER B 1 174 ? -24.344 -28.159 -16.643 1.00 58.98  ? 535 SER B HG   1 
ATOM   7407 N  N    . ALA B 1 175 ? -22.638 -25.242 -15.780 1.00 47.03  ? 536 ALA B N    1 
ATOM   7408 C  CA   . ALA B 1 175 ? -22.423 -24.442 -14.578 1.00 51.42  ? 536 ALA B CA   1 
ATOM   7409 C  C    . ALA B 1 175 ? -20.993 -24.501 -14.067 1.00 43.38  ? 536 ALA B C    1 
ATOM   7410 O  O    . ALA B 1 175 ? -20.192 -25.336 -14.499 1.00 45.50  ? 536 ALA B O    1 
ATOM   7411 C  CB   . ALA B 1 175 ? -23.376 -24.889 -13.477 1.00 49.45  ? 536 ALA B CB   1 
ATOM   7412 H  H    . ALA B 1 175 ? -22.033 -25.836 -15.927 1.00 56.44  ? 536 ALA B H    1 
ATOM   7413 H  HA   . ALA B 1 175 ? -22.624 -23.516 -14.783 1.00 61.71  ? 536 ALA B HA   1 
ATOM   7414 H  HB1  . ALA B 1 175 ? -23.221 -24.349 -12.687 1.00 59.34  ? 536 ALA B HB1  1 
ATOM   7415 H  HB2  . ALA B 1 175 ? -24.289 -24.773 -13.783 1.00 59.34  ? 536 ALA B HB2  1 
ATOM   7416 H  HB3  . ALA B 1 175 ? -23.210 -25.824 -13.277 1.00 59.34  ? 536 ALA B HB3  1 
ATOM   7417 N  N    . LEU B 1 176 ? -20.684 -23.585 -13.150 1.00 47.56  ? 537 LEU B N    1 
ATOM   7418 C  CA   . LEU B 1 176 ? -19.445 -23.630 -12.384 1.00 46.94  ? 537 LEU B CA   1 
ATOM   7419 C  C    . LEU B 1 176 ? -19.790 -23.870 -10.929 1.00 42.57  ? 537 LEU B C    1 
ATOM   7420 O  O    . LEU B 1 176 ? -20.791 -23.368 -10.440 1.00 39.99  ? 537 LEU B O    1 
ATOM   7421 C  CB   . LEU B 1 176 ? -18.643 -22.335 -12.511 1.00 50.19  ? 537 LEU B CB   1 
ATOM   7422 C  CG   . LEU B 1 176 ? -18.074 -21.988 -13.885 1.00 55.43  ? 537 LEU B CG   1 
ATOM   7423 C  CD1  . LEU B 1 176 ? -17.463 -20.602 -13.849 1.00 44.77  ? 537 LEU B CD1  1 
ATOM   7424 C  CD2  . LEU B 1 176 ? -17.043 -23.013 -14.324 1.00 55.74  ? 537 LEU B CD2  1 
ATOM   7425 H  H    . LEU B 1 176 ? -21.186 -22.916 -12.952 1.00 57.07  ? 537 LEU B H    1 
ATOM   7426 H  HA   . LEU B 1 176 ? -18.896 -24.366 -12.697 1.00 56.33  ? 537 LEU B HA   1 
ATOM   7427 H  HB2  . LEU B 1 176 ? -19.218 -21.599 -12.249 1.00 60.23  ? 537 LEU B HB2  1 
ATOM   7428 H  HB3  . LEU B 1 176 ? -17.892 -22.385 -11.898 1.00 60.23  ? 537 LEU B HB3  1 
ATOM   7429 H  HG   . LEU B 1 176 ? -18.794 -21.985 -14.536 1.00 66.51  ? 537 LEU B HG   1 
ATOM   7430 H  HD11 . LEU B 1 176 ? -17.105 -20.392 -14.726 1.00 53.73  ? 537 LEU B HD11 1 
ATOM   7431 H  HD12 . LEU B 1 176 ? -18.150 -19.960 -13.610 1.00 53.73  ? 537 LEU B HD12 1 
ATOM   7432 H  HD13 . LEU B 1 176 ? -16.752 -20.587 -13.189 1.00 53.73  ? 537 LEU B HD13 1 
ATOM   7433 H  HD21 . LEU B 1 176 ? -16.703 -22.764 -15.198 1.00 66.88  ? 537 LEU B HD21 1 
ATOM   7434 H  HD22 . LEU B 1 176 ? -16.318 -23.028 -13.679 1.00 66.88  ? 537 LEU B HD22 1 
ATOM   7435 H  HD23 . LEU B 1 176 ? -17.464 -23.886 -14.369 1.00 66.88  ? 537 LEU B HD23 1 
ATOM   7436 N  N    . LEU B 1 177 ? -18.962 -24.651 -10.252 1.00 39.00  ? 538 LEU B N    1 
ATOM   7437 C  CA   . LEU B 1 177 ? -19.070 -24.814 -8.814  1.00 38.50  ? 538 LEU B CA   1 
ATOM   7438 C  C    . LEU B 1 177 ? -17.918 -24.079 -8.167  1.00 42.16  ? 538 LEU B C    1 
ATOM   7439 O  O    . LEU B 1 177 ? -16.760 -24.327 -8.499  1.00 35.58  ? 538 LEU B O    1 
ATOM   7440 C  CB   . LEU B 1 177 ? -19.040 -26.288 -8.421  1.00 36.65  ? 538 LEU B CB   1 
ATOM   7441 C  CG   . LEU B 1 177 ? -19.311 -26.580 -6.943  1.00 44.90  ? 538 LEU B CG   1 
ATOM   7442 C  CD1  . LEU B 1 177 ? -20.796 -26.443 -6.659  1.00 51.56  ? 538 LEU B CD1  1 
ATOM   7443 C  CD2  . LEU B 1 177 ? -18.821 -27.962 -6.570  1.00 47.35  ? 538 LEU B CD2  1 
ATOM   7444 H  H    . LEU B 1 177 ? -18.322 -25.102 -10.608 1.00 46.80  ? 538 LEU B H    1 
ATOM   7445 H  HA   . LEU B 1 177 ? -19.903 -24.426 -8.502  1.00 46.20  ? 538 LEU B HA   1 
ATOM   7446 H  HB2  . LEU B 1 177 ? -19.714 -26.757 -8.939  1.00 43.98  ? 538 LEU B HB2  1 
ATOM   7447 H  HB3  . LEU B 1 177 ? -18.163 -26.644 -8.633  1.00 43.98  ? 538 LEU B HB3  1 
ATOM   7448 H  HG   . LEU B 1 177 ? -18.836 -25.933 -6.397  1.00 53.88  ? 538 LEU B HG   1 
ATOM   7449 H  HD11 . LEU B 1 177 ? -20.956 -26.630 -5.721  1.00 61.87  ? 538 LEU B HD11 1 
ATOM   7450 H  HD12 . LEU B 1 177 ? -21.075 -25.538 -6.869  1.00 61.87  ? 538 LEU B HD12 1 
ATOM   7451 H  HD13 . LEU B 1 177 ? -21.283 -27.075 -7.210  1.00 61.87  ? 538 LEU B HD13 1 
ATOM   7452 H  HD21 . LEU B 1 177 ? -19.005 -28.119 -5.631  1.00 56.82  ? 538 LEU B HD21 1 
ATOM   7453 H  HD22 . LEU B 1 177 ? -19.286 -28.618 -7.113  1.00 56.82  ? 538 LEU B HD22 1 
ATOM   7454 H  HD23 . LEU B 1 177 ? -17.867 -28.013 -6.734  1.00 56.82  ? 538 LEU B HD23 1 
ATOM   7455 N  N    . ILE B 1 178 ? -18.237 -23.173 -7.251  1.00 39.41  ? 539 ILE B N    1 
ATOM   7456 C  CA   . ILE B 1 178 ? -17.213 -22.496 -6.472  1.00 43.08  ? 539 ILE B CA   1 
ATOM   7457 C  C    . ILE B 1 178 ? -17.241 -23.049 -5.047  1.00 40.90  ? 539 ILE B C    1 
ATOM   7458 O  O    . ILE B 1 178 ? -18.265 -23.001 -4.365  1.00 39.64  ? 539 ILE B O    1 
ATOM   7459 C  CB   . ILE B 1 178 ? -17.418 -20.978 -6.479  1.00 42.20  ? 539 ILE B CB   1 
ATOM   7460 C  CG1  . ILE B 1 178 ? -17.505 -20.478 -7.925  1.00 44.70  ? 539 ILE B CG1  1 
ATOM   7461 C  CG2  . ILE B 1 178 ? -16.265 -20.294 -5.755  1.00 42.86  ? 539 ILE B CG2  1 
ATOM   7462 C  CD1  . ILE B 1 178 ? -17.842 -19.019 -8.049  1.00 68.31  ? 539 ILE B CD1  1 
ATOM   7463 H  H    . ILE B 1 178 ? -19.041 -22.932 -7.062  1.00 47.29  ? 539 ILE B H    1 
ATOM   7464 H  HA   . ILE B 1 178 ? -16.342 -22.686 -6.855  1.00 51.70  ? 539 ILE B HA   1 
ATOM   7465 H  HB   . ILE B 1 178 ? -18.247 -20.769 -6.021  1.00 50.63  ? 539 ILE B HB   1 
ATOM   7466 H  HG12 . ILE B 1 178 ? -16.648 -20.621 -8.356  1.00 53.65  ? 539 ILE B HG12 1 
ATOM   7467 H  HG13 . ILE B 1 178 ? -18.193 -20.981 -8.388  1.00 53.65  ? 539 ILE B HG13 1 
ATOM   7468 H  HG21 . ILE B 1 178 ? -16.410 -19.335 -5.768  1.00 51.43  ? 539 ILE B HG21 1 
ATOM   7469 H  HG22 . ILE B 1 178 ? -16.235 -20.613 -4.839  1.00 51.43  ? 539 ILE B HG22 1 
ATOM   7470 H  HG23 . ILE B 1 178 ? -15.436 -20.511 -6.208  1.00 51.43  ? 539 ILE B HG23 1 
ATOM   7471 H  HD11 . ILE B 1 178 ? -17.878 -18.783 -8.989  1.00 81.97  ? 539 ILE B HD11 1 
ATOM   7472 H  HD12 . ILE B 1 178 ? -18.704 -18.858 -7.634  1.00 81.97  ? 539 ILE B HD12 1 
ATOM   7473 H  HD13 . ILE B 1 178 ? -17.157 -18.498 -7.603  1.00 81.97  ? 539 ILE B HD13 1 
ATOM   7474 N  N    . LEU B 1 179 ? -16.106 -23.591 -4.622  1.00 34.74  ? 540 LEU B N    1 
ATOM   7475 C  CA   . LEU B 1 179 ? -16.004 -24.304 -3.357  1.00 36.87  ? 540 LEU B CA   1 
ATOM   7476 C  C    . LEU B 1 179 ? -14.949 -23.666 -2.475  1.00 38.48  ? 540 LEU B C    1 
ATOM   7477 O  O    . LEU B 1 179 ? -13.757 -23.737 -2.772  1.00 39.14  ? 540 LEU B O    1 
ATOM   7478 C  CB   . LEU B 1 179 ? -15.667 -25.779 -3.605  1.00 40.32  ? 540 LEU B CB   1 
ATOM   7479 C  CG   . LEU B 1 179 ? -15.795 -26.788 -2.455  1.00 55.15  ? 540 LEU B CG   1 
ATOM   7480 C  CD1  . LEU B 1 179 ? -15.581 -28.193 -2.992  1.00 65.20  ? 540 LEU B CD1  1 
ATOM   7481 C  CD2  . LEU B 1 179 ? -14.822 -26.533 -1.319  1.00 61.24  ? 540 LEU B CD2  1 
ATOM   7482 H  H    . LEU B 1 179 ? -15.366 -23.558 -5.058  1.00 41.69  ? 540 LEU B H    1 
ATOM   7483 H  HA   . LEU B 1 179 ? -16.855 -24.259 -2.894  1.00 44.24  ? 540 LEU B HA   1 
ATOM   7484 H  HB2  . LEU B 1 179 ? -16.245 -26.095 -4.317  1.00 48.38  ? 540 LEU B HB2  1 
ATOM   7485 H  HB3  . LEU B 1 179 ? -14.746 -25.821 -3.909  1.00 48.38  ? 540 LEU B HB3  1 
ATOM   7486 H  HG   . LEU B 1 179 ? -16.694 -26.740 -2.094  1.00 66.18  ? 540 LEU B HG   1 
ATOM   7487 H  HD11 . LEU B 1 179 ? -15.664 -28.826 -2.262  1.00 78.23  ? 540 LEU B HD11 1 
ATOM   7488 H  HD12 . LEU B 1 179 ? -16.252 -28.378 -3.668  1.00 78.23  ? 540 LEU B HD12 1 
ATOM   7489 H  HD13 . LEU B 1 179 ? -14.695 -28.250 -3.382  1.00 78.23  ? 540 LEU B HD13 1 
ATOM   7490 H  HD21 . LEU B 1 179 ? -14.957 -27.203 -0.631  1.00 73.49  ? 540 LEU B HD21 1 
ATOM   7491 H  HD22 . LEU B 1 179 ? -13.916 -26.588 -1.662  1.00 73.49  ? 540 LEU B HD22 1 
ATOM   7492 H  HD23 . LEU B 1 179 ? -14.985 -25.648 -0.957  1.00 73.49  ? 540 LEU B HD23 1 
ATOM   7493 N  N    . TYR B 1 180 ? -15.400 -23.047 -1.389  1.00 38.67  ? 541 TYR B N    1 
ATOM   7494 C  CA   . TYR B 1 180 ? -14.499 -22.554 -0.361  1.00 35.47  ? 541 TYR B CA   1 
ATOM   7495 C  C    . TYR B 1 180 ? -14.395 -23.584 0.768   1.00 37.63  ? 541 TYR B C    1 
ATOM   7496 O  O    . TYR B 1 180 ? -15.389 -23.936 1.404   1.00 49.59  ? 541 TYR B O    1 
ATOM   7497 C  CB   . TYR B 1 180 ? -14.966 -21.204 0.193   1.00 41.43  ? 541 TYR B CB   1 
ATOM   7498 C  CG   . TYR B 1 180 ? -14.194 -20.808 1.437   1.00 49.68  ? 541 TYR B CG   1 
ATOM   7499 C  CD1  . TYR B 1 180 ? -12.855 -20.462 1.347   1.00 40.61  ? 541 TYR B CD1  1 
ATOM   7500 C  CD2  . TYR B 1 180 ? -14.791 -20.802 2.695   1.00 54.62  ? 541 TYR B CD2  1 
ATOM   7501 C  CE1  . TYR B 1 180 ? -12.129 -20.117 2.457   1.00 45.82  ? 541 TYR B CE1  1 
ATOM   7502 C  CE2  . TYR B 1 180 ? -14.063 -20.451 3.829   1.00 39.53  ? 541 TYR B CE2  1 
ATOM   7503 C  CZ   . TYR B 1 180 ? -12.733 -20.109 3.694   1.00 76.80  ? 541 TYR B CZ   1 
ATOM   7504 O  OH   . TYR B 1 180 ? -11.983 -19.758 4.785   1.00 48.14  ? 541 TYR B OH   1 
ATOM   7505 H  H    . TYR B 1 180 ? -16.231 -22.900 -1.225  1.00 46.40  ? 541 TYR B H    1 
ATOM   7506 H  HA   . TYR B 1 180 ? -13.616 -22.434 -0.743  1.00 42.56  ? 541 TYR B HA   1 
ATOM   7507 H  HB2  . TYR B 1 180 ? -14.829 -20.518 -0.479  1.00 49.72  ? 541 TYR B HB2  1 
ATOM   7508 H  HB3  . TYR B 1 180 ? -15.906 -21.262 0.426   1.00 49.72  ? 541 TYR B HB3  1 
ATOM   7509 H  HD1  . TYR B 1 180 ? -12.439 -20.467 0.516   1.00 48.73  ? 541 TYR B HD1  1 
ATOM   7510 H  HD2  . TYR B 1 180 ? -15.688 -21.035 2.778   1.00 65.55  ? 541 TYR B HD2  1 
ATOM   7511 H  HE1  . TYR B 1 180 ? -11.232 -19.885 2.374   1.00 54.98  ? 541 TYR B HE1  1 
ATOM   7512 H  HE2  . TYR B 1 180 ? -14.469 -20.445 4.667   1.00 47.43  ? 541 TYR B HE2  1 
ATOM   7513 H  HH   . TYR B 1 180 ? -12.454 -19.789 5.480   1.00 57.77  ? 541 TYR B HH   1 
ATOM   7514 N  N    . LEU B 1 181 ? -13.177 -24.066 0.982   1.00 36.46  ? 542 LEU B N    1 
ATOM   7515 C  CA   . LEU B 1 181 ? -12.881 -25.075 1.982   1.00 36.91  ? 542 LEU B CA   1 
ATOM   7516 C  C    . LEU B 1 181 ? -12.248 -24.418 3.199   1.00 61.80  ? 542 LEU B C    1 
ATOM   7517 O  O    . LEU B 1 181 ? -11.082 -24.022 3.165   1.00 45.51  ? 542 LEU B O    1 
ATOM   7518 C  CB   . LEU B 1 181 ? -11.944 -26.142 1.409   1.00 56.09  ? 542 LEU B CB   1 
ATOM   7519 C  CG   . LEU B 1 181 ? -11.445 -27.185 2.412   1.00 54.27  ? 542 LEU B CG   1 
ATOM   7520 C  CD1  . LEU B 1 181 ? -12.578 -28.115 2.828   1.00 55.69  ? 542 LEU B CD1  1 
ATOM   7521 C  CD2  . LEU B 1 181 ? -10.277 -27.966 1.841   1.00 50.17  ? 542 LEU B CD2  1 
ATOM   7522 H  H    . LEU B 1 181 ? -12.482 -23.812 0.543   1.00 43.75  ? 542 LEU B H    1 
ATOM   7523 H  HA   . LEU B 1 181 ? -13.705 -25.506 2.260   1.00 44.29  ? 542 LEU B HA   1 
ATOM   7524 H  HB2  . LEU B 1 181 ? -12.413 -26.616 0.705   1.00 67.30  ? 542 LEU B HB2  1 
ATOM   7525 H  HB3  . LEU B 1 181 ? -11.165 -25.699 1.039   1.00 67.30  ? 542 LEU B HB3  1 
ATOM   7526 H  HG   . LEU B 1 181 ? -11.133 -26.727 3.208   1.00 65.12  ? 542 LEU B HG   1 
ATOM   7527 H  HD11 . LEU B 1 181 ? -12.236 -28.765 3.461   1.00 66.83  ? 542 LEU B HD11 1 
ATOM   7528 H  HD12 . LEU B 1 181 ? -13.282 -27.589 3.239   1.00 66.83  ? 542 LEU B HD12 1 
ATOM   7529 H  HD13 . LEU B 1 181 ? -12.919 -28.567 2.041   1.00 66.83  ? 542 LEU B HD13 1 
ATOM   7530 H  HD21 . LEU B 1 181 ? -9.983  -28.618 2.497   1.00 60.21  ? 542 LEU B HD21 1 
ATOM   7531 H  HD22 . LEU B 1 181 ? -10.564 -28.417 1.032   1.00 60.21  ? 542 LEU B HD22 1 
ATOM   7532 H  HD23 . LEU B 1 181 ? -9.555  -27.351 1.640   1.00 60.21  ? 542 LEU B HD23 1 
ATOM   7533 N  N    . ASP B 1 182 ? -13.014 -24.313 4.276   1.00 44.20  ? 543 ASP B N    1 
ATOM   7534 C  CA   . ASP B 1 182 ? -12.558 -23.585 5.455   1.00 42.04  ? 543 ASP B CA   1 
ATOM   7535 C  C    . ASP B 1 182 ? -11.703 -24.422 6.387   1.00 41.45  ? 543 ASP B C    1 
ATOM   7536 O  O    . ASP B 1 182 ? -10.538 -24.113 6.624   1.00 44.39  ? 543 ASP B O    1 
ATOM   7537 C  CB   . ASP B 1 182 ? -13.743 -23.045 6.247   1.00 51.23  ? 543 ASP B CB   1 
ATOM   7538 C  CG   . ASP B 1 182 ? -13.304 -22.190 7.412   1.00 67.76  ? 543 ASP B CG   1 
ATOM   7539 O  OD1  . ASP B 1 182 ? -13.226 -22.718 8.542   1.00 64.87  ? 543 ASP B OD1  1 
ATOM   7540 O  OD2  . ASP B 1 182 ? -13.002 -20.999 7.189   1.00 58.25  ? 543 ASP B OD2  1 
ATOM   7541 H  H    . ASP B 1 182 ? -13.800 -24.654 4.352   1.00 53.04  ? 543 ASP B H    1 
ATOM   7542 H  HA   . ASP B 1 182 ? -12.025 -22.827 5.166   1.00 50.45  ? 543 ASP B HA   1 
ATOM   7543 H  HB2  . ASP B 1 182 ? -14.295 -22.500 5.664   1.00 61.48  ? 543 ASP B HB2  1 
ATOM   7544 H  HB3  . ASP B 1 182 ? -14.259 -23.789 6.595   1.00 61.48  ? 543 ASP B HB3  1 
ATOM   7545 N  N    . SER B 1 183 ? -12.296 -25.473 6.934   1.00 50.28  ? 544 SER B N    1 
ATOM   7546 C  CA   . SER B 1 183 ? -11.632 -26.255 7.959   1.00 66.53  ? 544 SER B CA   1 
ATOM   7547 C  C    . SER B 1 183 ? -12.434 -27.486 8.309   1.00 60.46  ? 544 SER B C    1 
ATOM   7548 O  O    . SER B 1 183 ? -13.502 -27.735 7.748   1.00 61.34  ? 544 SER B O    1 
ATOM   7549 C  CB   . SER B 1 183 ? -11.427 -25.414 9.214   1.00 72.61  ? 544 SER B CB   1 
ATOM   7550 O  OG   . SER B 1 183 ? -12.676 -24.967 9.702   1.00 56.12  ? 544 SER B OG   1 
ATOM   7551 H  H    . SER B 1 183 ? -13.083 -25.753 6.727   1.00 60.33  ? 544 SER B H    1 
ATOM   7552 H  HA   . SER B 1 183 ? -10.763 -26.539 7.635   1.00 79.84  ? 544 SER B HA   1 
ATOM   7553 H  HB2  . SER B 1 183 ? -10.995 -25.955 9.893   1.00 87.14  ? 544 SER B HB2  1 
ATOM   7554 H  HB3  . SER B 1 183 ? -10.876 -24.646 8.997   1.00 87.14  ? 544 SER B HB3  1 
ATOM   7555 H  HG   . SER B 1 183 ? -13.061 -24.499 9.120   1.00 67.35  ? 544 SER B HG   1 
ATOM   7556 N  N    . ALA B 1 184 ? -11.914 -28.246 9.263   1.00 53.77  ? 545 ALA B N    1 
ATOM   7557 C  CA   . ALA B 1 184 ? -12.601 -29.421 9.753   1.00 73.29  ? 545 ALA B CA   1 
ATOM   7558 C  C    . ALA B 1 184 ? -12.384 -29.538 11.255  1.00 70.06  ? 545 ALA B C    1 
ATOM   7559 O  O    . ALA B 1 184 ? -11.489 -28.904 11.829  1.00 56.73  ? 545 ALA B O    1 
ATOM   7560 C  CB   . ALA B 1 184 ? -12.123 -30.665 9.027   1.00 54.37  ? 545 ALA B CB   1 
ATOM   7561 H  H    . ALA B 1 184 ? -11.157 -28.098 9.643   1.00 64.53  ? 545 ALA B H    1 
ATOM   7562 H  HA   . ALA B 1 184 ? -13.552 -29.324 9.591   1.00 87.95  ? 545 ALA B HA   1 
ATOM   7563 H  HB1  . ALA B 1 184 ? -12.599 -31.435 9.375   1.00 65.24  ? 545 ALA B HB1  1 
ATOM   7564 H  HB2  . ALA B 1 184 ? -12.303 -30.566 8.079   1.00 65.24  ? 545 ALA B HB2  1 
ATOM   7565 H  HB3  . ALA B 1 184 ? -11.170 -30.770 9.175   1.00 65.24  ? 545 ALA B HB3  1 
ATOM   7566 N  N    . ARG B 1 185 ? -13.213 -30.366 11.876  1.00 60.30  ? 546 ARG B N    1 
ATOM   7567 C  CA   . ARG B 1 185 ? -13.371 -30.371 13.322  1.00 55.57  ? 546 ARG B CA   1 
ATOM   7568 C  C    . ARG B 1 185 ? -13.563 -31.805 13.802  1.00 58.01  ? 546 ARG B C    1 
ATOM   7569 O  O    . ARG B 1 185 ? -14.344 -32.561 13.222  1.00 75.76  ? 546 ARG B O    1 
ATOM   7570 C  CB   . ARG B 1 185 ? -14.567 -29.486 13.705  1.00 61.83  ? 546 ARG B CB   1 
ATOM   7571 C  CG   . ARG B 1 185 ? -14.760 -29.213 15.186  1.00 103.49 ? 546 ARG B CG   1 
ATOM   7572 C  CD   . ARG B 1 185 ? -16.126 -28.568 15.447  1.00 114.93 ? 546 ARG B CD   1 
ATOM   7573 N  NE   . ARG B 1 185 ? -16.055 -27.117 15.618  1.00 116.79 ? 546 ARG B NE   1 
ATOM   7574 C  CZ   . ARG B 1 185 ? -17.115 -26.331 15.795  1.00 114.65 ? 546 ARG B CZ   1 
ATOM   7575 N  NH1  . ARG B 1 185 ? -18.337 -26.849 15.816  1.00 105.99 ? 546 ARG B NH1  1 
ATOM   7576 N  NH2  . ARG B 1 185 ? -16.957 -25.023 15.948  1.00 98.98  ? 546 ARG B NH2  1 
ATOM   7577 H  H    . ARG B 1 185 ? -13.704 -30.945 11.473  1.00 72.36  ? 546 ARG B H    1 
ATOM   7578 H  HA   . ARG B 1 185 ? -12.573 -30.010 13.738  1.00 66.69  ? 546 ARG B HA   1 
ATOM   7579 H  HB2  . ARG B 1 185 ? -14.462 -28.627 13.266  1.00 74.20  ? 546 ARG B HB2  1 
ATOM   7580 H  HB3  . ARG B 1 185 ? -15.376 -29.914 13.383  1.00 74.20  ? 546 ARG B HB3  1 
ATOM   7581 H  HG2  . ARG B 1 185 ? -14.718 -30.049 15.676  1.00 124.19 ? 546 ARG B HG2  1 
ATOM   7582 H  HG3  . ARG B 1 185 ? -14.071 -28.604 15.494  1.00 124.19 ? 546 ARG B HG3  1 
ATOM   7583 H  HD2  . ARG B 1 185 ? -16.710 -28.752 14.695  1.00 137.91 ? 546 ARG B HD2  1 
ATOM   7584 H  HD3  . ARG B 1 185 ? -16.503 -28.946 16.258  1.00 137.91 ? 546 ARG B HD3  1 
ATOM   7585 H  HE   . ARG B 1 185 ? -15.279 -26.748 15.603  1.00 140.15 ? 546 ARG B HE   1 
ATOM   7586 H  HH11 . ARG B 1 185 ? -18.447 -27.696 15.719  1.00 127.19 ? 546 ARG B HH11 1 
ATOM   7587 H  HH12 . ARG B 1 185 ? -19.019 -26.337 15.929  1.00 127.19 ? 546 ARG B HH12 1 
ATOM   7588 H  HH21 . ARG B 1 185 ? -16.168 -24.681 15.933  1.00 118.77 ? 546 ARG B HH21 1 
ATOM   7589 H  HH22 . ARG B 1 185 ? -17.643 -24.517 16.058  1.00 118.77 ? 546 ARG B HH22 1 
ATOM   7590 N  N    . ASN B 1 186 ? -12.822 -32.177 14.843  1.00 91.42  ? 547 ASN B N    1 
ATOM   7591 C  CA   . ASN B 1 186 ? -13.002 -33.458 15.527  1.00 77.49  ? 547 ASN B CA   1 
ATOM   7592 C  C    . ASN B 1 186 ? -12.822 -34.669 14.612  1.00 77.67  ? 547 ASN B C    1 
ATOM   7593 O  O    . ASN B 1 186 ? -13.647 -35.582 14.604  1.00 80.20  ? 547 ASN B O    1 
ATOM   7594 C  CB   . ASN B 1 186 ? -14.389 -33.507 16.185  1.00 80.05  ? 547 ASN B CB   1 
ATOM   7595 C  CG   . ASN B 1 186 ? -14.629 -32.337 17.122  1.00 80.30  ? 547 ASN B CG   1 
ATOM   7596 O  OD1  . ASN B 1 186 ? -13.726 -31.906 17.837  1.00 84.23  ? 547 ASN B OD1  1 
ATOM   7597 N  ND2  . ASN B 1 186 ? -15.849 -31.813 17.118  1.00 79.77  ? 547 ASN B ND2  1 
ATOM   7598 H  H    . ASN B 1 186 ? -12.195 -31.695 15.180  1.00 109.70 ? 547 ASN B H    1 
ATOM   7599 H  HA   . ASN B 1 186 ? -12.341 -33.525 16.234  1.00 92.99  ? 547 ASN B HA   1 
ATOM   7600 H  HB2  . ASN B 1 186 ? -15.069 -33.483 15.494  1.00 96.06  ? 547 ASN B HB2  1 
ATOM   7601 H  HB3  . ASN B 1 186 ? -14.467 -34.325 16.700  1.00 96.06  ? 547 ASN B HB3  1 
ATOM   7602 H  HD21 . ASN B 1 186 ? -16.033 -31.149 17.632  1.00 95.72  ? 547 ASN B HD21 1 
ATOM   7603 H  HD22 . ASN B 1 186 ? -16.455 -32.139 16.601  1.00 95.72  ? 547 ASN B HD22 1 
ATOM   7604 N  N    . LEU B 1 187 ? -11.733 -34.673 13.848  1.00 79.78  ? 548 LEU B N    1 
ATOM   7605 C  CA   . LEU B 1 187 ? -11.422 -35.792 12.964  1.00 75.70  ? 548 LEU B CA   1 
ATOM   7606 C  C    . LEU B 1 187 ? -10.883 -36.987 13.747  1.00 90.05  ? 548 LEU B C    1 
ATOM   7607 O  O    . LEU B 1 187 ? -10.270 -36.814 14.798  1.00 97.21  ? 548 LEU B O    1 
ATOM   7608 C  CB   . LEU B 1 187 ? -10.399 -35.374 11.912  1.00 75.22  ? 548 LEU B CB   1 
ATOM   7609 C  CG   . LEU B 1 187 ? -10.911 -34.620 10.686  1.00 78.52  ? 548 LEU B CG   1 
ATOM   7610 C  CD1  . LEU B 1 187 ? -9.730  -34.079 9.891   1.00 63.37  ? 548 LEU B CD1  1 
ATOM   7611 C  CD2  . LEU B 1 187 ? -11.776 -35.527 9.821   1.00 79.17  ? 548 LEU B CD2  1 
ATOM   7612 H  H    . LEU B 1 187 ? -11.156 -34.036 13.823  1.00 95.73  ? 548 LEU B H    1 
ATOM   7613 H  HA   . LEU B 1 187 ? -12.231 -36.070 12.506  1.00 90.84  ? 548 LEU B HA   1 
ATOM   7614 H  HB2  . LEU B 1 187 ? -9.743  -34.804 12.342  1.00 90.26  ? 548 LEU B HB2  1 
ATOM   7615 H  HB3  . LEU B 1 187 ? -9.959  -36.176 11.588  1.00 90.26  ? 548 LEU B HB3  1 
ATOM   7616 H  HG   . LEU B 1 187 ? -11.453 -33.869 10.976  1.00 94.22  ? 548 LEU B HG   1 
ATOM   7617 H  HD11 . LEU B 1 187 ? -10.064 -33.602 9.115   1.00 76.04  ? 548 LEU B HD11 1 
ATOM   7618 H  HD12 . LEU B 1 187 ? -9.219  -33.478 10.455  1.00 76.04  ? 548 LEU B HD12 1 
ATOM   7619 H  HD13 . LEU B 1 187 ? -9.173  -34.822 9.609   1.00 76.04  ? 548 LEU B HD13 1 
ATOM   7620 H  HD21 . LEU B 1 187 ? -12.087 -35.025 9.052   1.00 95.00  ? 548 LEU B HD21 1 
ATOM   7621 H  HD22 . LEU B 1 187 ? -11.245 -36.284 9.529   1.00 95.00  ? 548 LEU B HD22 1 
ATOM   7622 H  HD23 . LEU B 1 187 ? -12.532 -35.834 10.344  1.00 95.00  ? 548 LEU B HD23 1 
ATOM   7623 N  N    . PRO B 1 188 ? -11.099 -38.208 13.227  1.00 85.68  ? 549 PRO B N    1 
ATOM   7624 C  CA   . PRO B 1 188 ? -10.570 -39.415 13.869  1.00 88.13  ? 549 PRO B CA   1 
ATOM   7625 C  C    . PRO B 1 188 ? -9.048  -39.503 13.793  1.00 107.95 ? 549 PRO B C    1 
ATOM   7626 O  O    . PRO B 1 188 ? -8.431  -39.933 14.771  1.00 121.79 ? 549 PRO B O    1 
ATOM   7627 C  CB   . PRO B 1 188 ? -11.224 -40.549 13.074  1.00 89.35  ? 549 PRO B CB   1 
ATOM   7628 C  CG   . PRO B 1 188 ? -11.519 -39.960 11.749  1.00 97.39  ? 549 PRO B CG   1 
ATOM   7629 C  CD   . PRO B 1 188 ? -11.862 -38.528 12.009  1.00 87.99  ? 549 PRO B CD   1 
ATOM   7630 H  HA   . PRO B 1 188 ? -10.854 -39.461 14.796  1.00 105.76 ? 549 PRO B HA   1 
ATOM   7631 H  HB2  . PRO B 1 188 ? -10.604 -41.290 12.991  1.00 107.22 ? 549 PRO B HB2  1 
ATOM   7632 H  HB3  . PRO B 1 188 ? -12.040 -40.831 13.515  1.00 107.22 ? 549 PRO B HB3  1 
ATOM   7633 H  HG2  . PRO B 1 188 ? -10.735 -40.026 11.181  1.00 116.87 ? 549 PRO B HG2  1 
ATOM   7634 H  HG3  . PRO B 1 188 ? -12.271 -40.423 11.347  1.00 116.87 ? 549 PRO B HG3  1 
ATOM   7635 H  HD2  . PRO B 1 188 ? -11.570 -37.972 11.270  1.00 105.58 ? 549 PRO B HD2  1 
ATOM   7636 H  HD3  . PRO B 1 188 ? -12.814 -38.433 12.171  1.00 105.58 ? 549 PRO B HD3  1 
ATOM   7637 N  N    . ASN B 1 196 ? -3.275  -36.674 15.590  1.00 127.30 ? 557 ASN B N    1 
ATOM   7638 C  CA   . ASN B 1 196 ? -1.987  -37.050 15.021  1.00 115.12 ? 557 ASN B CA   1 
ATOM   7639 C  C    . ASN B 1 196 ? -1.990  -37.455 13.532  1.00 105.73 ? 557 ASN B C    1 
ATOM   7640 O  O    . ASN B 1 196 ? -0.952  -37.872 13.014  1.00 108.80 ? 557 ASN B O    1 
ATOM   7641 C  CB   . ASN B 1 196 ? -1.393  -38.190 15.855  1.00 125.50 ? 557 ASN B CB   1 
ATOM   7642 C  CG   . ASN B 1 196 ? -0.965  -37.735 17.241  1.00 146.10 ? 557 ASN B CG   1 
ATOM   7643 O  OD1  . ASN B 1 196 ? -0.642  -36.566 17.450  1.00 152.06 ? 557 ASN B OD1  1 
ATOM   7644 N  ND2  . ASN B 1 196 ? -0.956  -38.661 18.193  1.00 150.21 ? 557 ASN B ND2  1 
ATOM   7645 H  HA   . ASN B 1 196 ? -1.389  -36.291 15.107  1.00 138.14 ? 557 ASN B HA   1 
ATOM   7646 H  HB2  . ASN B 1 196 ? -2.060  -38.886 15.960  1.00 150.60 ? 557 ASN B HB2  1 
ATOM   7647 H  HB3  . ASN B 1 196 ? -0.612  -38.542 15.400  1.00 150.60 ? 557 ASN B HB3  1 
ATOM   7648 H  HD21 . ASN B 1 196 ? -0.721  -38.452 18.993  1.00 180.25 ? 557 ASN B HD21 1 
ATOM   7649 H  HD22 . ASN B 1 196 ? -1.185  -39.469 18.009  1.00 180.25 ? 557 ASN B HD22 1 
ATOM   7650 N  N    . PRO B 1 197 ? -3.136  -37.332 12.827  1.00 105.06 ? 558 PRO B N    1 
ATOM   7651 C  CA   . PRO B 1 197 ? -3.014  -37.578 11.385  1.00 91.91  ? 558 PRO B CA   1 
ATOM   7652 C  C    . PRO B 1 197 ? -2.528  -36.343 10.636  1.00 84.96  ? 558 PRO B C    1 
ATOM   7653 O  O    . PRO B 1 197 ? -2.400  -35.280 11.245  1.00 77.92  ? 558 PRO B O    1 
ATOM   7654 C  CB   . PRO B 1 197 ? -4.440  -37.935 10.971  1.00 82.75  ? 558 PRO B CB   1 
ATOM   7655 C  CG   . PRO B 1 197 ? -5.291  -37.144 11.900  1.00 91.48  ? 558 PRO B CG   1 
ATOM   7656 C  CD   . PRO B 1 197 ? -4.537  -37.067 13.211  1.00 106.42 ? 558 PRO B CD   1 
ATOM   7657 H  HA   . PRO B 1 197 ? -2.423  -38.326 11.209  1.00 110.29 ? 558 PRO B HA   1 
ATOM   7658 H  HB2  . PRO B 1 197 ? -4.592  -37.669 10.050  1.00 99.29  ? 558 PRO B HB2  1 
ATOM   7659 H  HB3  . PRO B 1 197 ? -4.589  -38.886 11.088  1.00 99.29  ? 558 PRO B HB3  1 
ATOM   7660 H  HG2  . PRO B 1 197 ? -5.428  -36.255 11.536  1.00 109.77 ? 558 PRO B HG2  1 
ATOM   7661 H  HG3  . PRO B 1 197 ? -6.140  -37.595 12.024  1.00 109.77 ? 558 PRO B HG3  1 
ATOM   7662 H  HD2  . PRO B 1 197 ? -4.619  -36.181 13.596  1.00 127.71 ? 558 PRO B HD2  1 
ATOM   7663 H  HD3  . PRO B 1 197 ? -4.854  -37.750 13.822  1.00 127.71 ? 558 PRO B HD3  1 
ATOM   7664 N  N    . ASN B 1 198 ? -2.251  -36.499 9.342   1.00 80.04  ? 559 ASN B N    1 
ATOM   7665 C  CA   . ASN B 1 198 ? -1.933  -35.382 8.458   1.00 65.11  ? 559 ASN B CA   1 
ATOM   7666 C  C    . ASN B 1 198 ? -3.047  -35.183 7.425   1.00 67.66  ? 559 ASN B C    1 
ATOM   7667 O  O    . ASN B 1 198 ? -2.977  -35.742 6.334   1.00 60.23  ? 559 ASN B O    1 
ATOM   7668 C  CB   . ASN B 1 198 ? -0.599  -35.620 7.739   1.00 64.93  ? 559 ASN B CB   1 
ATOM   7669 C  CG   . ASN B 1 198 ? 0.604   -35.454 8.655   1.00 88.32  ? 559 ASN B CG   1 
ATOM   7670 O  OD1  . ASN B 1 198 ? 0.465   -35.324 9.871   1.00 78.06  ? 559 ASN B OD1  1 
ATOM   7671 N  ND2  . ASN B 1 198 ? 1.797   -35.465 8.069   1.00 77.11  ? 559 ASN B ND2  1 
ATOM   7672 H  H    . ASN B 1 198 ? -2.241  -37.261 8.945   1.00 96.05  ? 559 ASN B H    1 
ATOM   7673 H  HA   . ASN B 1 198 ? -1.856  -34.570 8.983   1.00 78.13  ? 559 ASN B HA   1 
ATOM   7674 H  HB2  . ASN B 1 198 ? -0.586  -36.525 7.389   1.00 77.91  ? 559 ASN B HB2  1 
ATOM   7675 H  HB3  . ASN B 1 198 ? -0.513  -34.983 7.013   1.00 77.91  ? 559 ASN B HB3  1 
ATOM   7676 H  HD21 . ASN B 1 198 ? 2.509   -35.375 8.542   1.00 92.54  ? 559 ASN B HD21 1 
ATOM   7677 H  HD22 . ASN B 1 198 ? 1.856   -35.562 7.217   1.00 92.54  ? 559 ASN B HD22 1 
ATOM   7678 N  N    . PRO B 1 199 ? -4.084  -34.394 7.764   1.00 66.89  ? 560 PRO B N    1 
ATOM   7679 C  CA   . PRO B 1 199 ? -5.263  -34.323 6.890   1.00 61.78  ? 560 PRO B CA   1 
ATOM   7680 C  C    . PRO B 1 199 ? -5.070  -33.501 5.621   1.00 69.86  ? 560 PRO B C    1 
ATOM   7681 O  O    . PRO B 1 199 ? -4.513  -32.403 5.644   1.00 56.99  ? 560 PRO B O    1 
ATOM   7682 C  CB   . PRO B 1 199 ? -6.328  -33.666 7.786   1.00 67.84  ? 560 PRO B CB   1 
ATOM   7683 C  CG   . PRO B 1 199 ? -5.786  -33.752 9.181   1.00 64.51  ? 560 PRO B CG   1 
ATOM   7684 C  CD   . PRO B 1 199 ? -4.312  -33.683 9.032   1.00 74.57  ? 560 PRO B CD   1 
ATOM   7685 H  HA   . PRO B 1 199 ? -5.556  -35.216 6.650   1.00 74.14  ? 560 PRO B HA   1 
ATOM   7686 H  HB2  . PRO B 1 199 ? -6.449  -32.741 7.522   1.00 81.41  ? 560 PRO B HB2  1 
ATOM   7687 H  HB3  . PRO B 1 199 ? -7.162  -34.156 7.712   1.00 81.41  ? 560 PRO B HB3  1 
ATOM   7688 H  HG2  . PRO B 1 199 ? -6.113  -33.004 9.705   1.00 77.41  ? 560 PRO B HG2  1 
ATOM   7689 H  HG3  . PRO B 1 199 ? -6.051  -34.594 9.583   1.00 77.41  ? 560 PRO B HG3  1 
ATOM   7690 H  HD2  . PRO B 1 199 ? -4.020  -32.761 8.962   1.00 89.48  ? 560 PRO B HD2  1 
ATOM   7691 H  HD3  . PRO B 1 199 ? -3.874  -34.144 9.764   1.00 89.48  ? 560 PRO B HD3  1 
ATOM   7692 N  N    . VAL B 1 200 ? -5.550  -34.053 4.514   1.00 65.90  ? 561 VAL B N    1 
ATOM   7693 C  CA   . VAL B 1 200 ? -5.564  -33.359 3.238   1.00 59.55  ? 561 VAL B CA   1 
ATOM   7694 C  C    . VAL B 1 200 ? -6.872  -33.720 2.530   1.00 58.04  ? 561 VAL B C    1 
ATOM   7695 O  O    . VAL B 1 200 ? -7.346  -34.853 2.638   1.00 56.85  ? 561 VAL B O    1 
ATOM   7696 C  CB   . VAL B 1 200 ? -4.337  -33.732 2.380   1.00 62.60  ? 561 VAL B CB   1 
ATOM   7697 C  CG1  . VAL B 1 200 ? -4.341  -35.216 2.061   1.00 56.96  ? 561 VAL B CG1  1 
ATOM   7698 C  CG2  . VAL B 1 200 ? -4.289  -32.899 1.104   1.00 52.54  ? 561 VAL B CG2  1 
ATOM   7699 H  H    . VAL B 1 200 ? -5.879  -34.846 4.478   1.00 79.08  ? 561 VAL B H    1 
ATOM   7700 H  HA   . VAL B 1 200 ? -5.551  -32.401 3.391   1.00 71.46  ? 561 VAL B HA   1 
ATOM   7701 H  HB   . VAL B 1 200 ? -3.533  -33.541 2.888   1.00 75.12  ? 561 VAL B HB   1 
ATOM   7702 H  HG11 . VAL B 1 200 ? -3.562  -35.424 1.522   1.00 68.35  ? 561 VAL B HG11 1 
ATOM   7703 H  HG12 . VAL B 1 200 ? -4.313  -35.717 2.891   1.00 68.35  ? 561 VAL B HG12 1 
ATOM   7704 H  HG13 . VAL B 1 200 ? -5.150  -35.431 1.571   1.00 68.35  ? 561 VAL B HG13 1 
ATOM   7705 H  HG21 . VAL B 1 200 ? -3.509  -33.157 0.588   1.00 63.05  ? 561 VAL B HG21 1 
ATOM   7706 H  HG22 . VAL B 1 200 ? -5.095  -33.062 0.590   1.00 63.05  ? 561 VAL B HG22 1 
ATOM   7707 H  HG23 . VAL B 1 200 ? -4.233  -31.960 1.342   1.00 63.05  ? 561 VAL B HG23 1 
ATOM   7708 N  N    . VAL B 1 201 ? -7.460  -32.751 1.832   1.00 46.42  ? 562 VAL B N    1 
ATOM   7709 C  CA   . VAL B 1 201 ? -8.783  -32.921 1.231   1.00 48.97  ? 562 VAL B CA   1 
ATOM   7710 C  C    . VAL B 1 201 ? -8.710  -33.137 -0.275  1.00 52.18  ? 562 VAL B C    1 
ATOM   7711 O  O    . VAL B 1 201 ? -7.929  -32.496 -0.969  1.00 52.29  ? 562 VAL B O    1 
ATOM   7712 C  CB   . VAL B 1 201 ? -9.684  -31.700 1.495   1.00 51.61  ? 562 VAL B CB   1 
ATOM   7713 C  CG1  . VAL B 1 201 ? -11.087 -31.941 0.949   1.00 52.16  ? 562 VAL B CG1  1 
ATOM   7714 C  CG2  . VAL B 1 201 ? -9.741  -31.386 2.985   1.00 54.47  ? 562 VAL B CG2  1 
ATOM   7715 H  H    . VAL B 1 201 ? -7.110  -31.979 1.690   1.00 55.70  ? 562 VAL B H    1 
ATOM   7716 H  HA   . VAL B 1 201 ? -9.210  -33.698 1.624   1.00 58.77  ? 562 VAL B HA   1 
ATOM   7717 H  HB   . VAL B 1 201 ? -9.313  -30.928 1.040   1.00 61.93  ? 562 VAL B HB   1 
ATOM   7718 H  HG11 . VAL B 1 201 ? -11.634 -31.160 1.127   1.00 62.59  ? 562 VAL B HG11 1 
ATOM   7719 H  HG12 . VAL B 1 201 ? -11.031 -32.094 -0.007  1.00 62.59  ? 562 VAL B HG12 1 
ATOM   7720 H  HG13 . VAL B 1 201 ? -11.467 -32.718 1.387   1.00 62.59  ? 562 VAL B HG13 1 
ATOM   7721 H  HG21 . VAL B 1 201 ? -10.313 -30.616 3.124   1.00 65.37  ? 562 VAL B HG21 1 
ATOM   7722 H  HG22 . VAL B 1 201 ? -10.100 -32.155 3.455   1.00 65.37  ? 562 VAL B HG22 1 
ATOM   7723 H  HG23 . VAL B 1 201 ? -8.844  -31.194 3.301   1.00 65.37  ? 562 VAL B HG23 1 
ATOM   7724 N  N    . GLN B 1 202 ? -9.567  -34.026 -0.763  1.00 54.75  ? 563 GLN B N    1 
ATOM   7725 C  CA   . GLN B 1 202 ? -9.637  -34.380 -2.170  1.00 57.13  ? 563 GLN B CA   1 
ATOM   7726 C  C    . GLN B 1 202 ? -11.053 -34.106 -2.677  1.00 62.18  ? 563 GLN B C    1 
ATOM   7727 O  O    . GLN B 1 202 ? -12.008 -34.708 -2.196  1.00 52.98  ? 563 GLN B O    1 
ATOM   7728 C  CB   . GLN B 1 202 ? -9.258  -35.849 -2.347  1.00 72.84  ? 563 GLN B CB   1 
ATOM   7729 C  CG   . GLN B 1 202 ? -9.085  -36.315 -3.776  1.00 90.35  ? 563 GLN B CG   1 
ATOM   7730 C  CD   . GLN B 1 202 ? -8.522  -37.724 -3.847  1.00 112.52 ? 563 GLN B CD   1 
ATOM   7731 O  OE1  . GLN B 1 202 ? -7.401  -37.981 -3.402  1.00 111.71 ? 563 GLN B OE1  1 
ATOM   7732 N  NE2  . GLN B 1 202 ? -9.305  -38.649 -4.392  1.00 113.09 ? 563 GLN B NE2  1 
ATOM   7733 H  H    . GLN B 1 202 ? -10.137 -34.451 -0.279  1.00 65.70  ? 563 GLN B H    1 
ATOM   7734 H  HA   . GLN B 1 202 ? -9.014  -33.835 -2.676  1.00 68.56  ? 563 GLN B HA   1 
ATOM   7735 H  HB2  . GLN B 1 202 ? -8.419  -36.007 -1.887  1.00 87.40  ? 563 GLN B HB2  1 
ATOM   7736 H  HB3  . GLN B 1 202 ? -9.954  -36.395 -1.947  1.00 87.40  ? 563 GLN B HB3  1 
ATOM   7737 H  HG2  . GLN B 1 202 ? -9.947  -36.310 -4.220  1.00 108.42 ? 563 GLN B HG2  1 
ATOM   7738 H  HG3  . GLN B 1 202 ? -8.470  -35.720 -4.233  1.00 108.42 ? 563 GLN B HG3  1 
ATOM   7739 H  HE21 . GLN B 1 202 ? -10.085 -38.434 -4.682  1.00 135.71 ? 563 GLN B HE21 1 
ATOM   7740 H  HE22 . GLN B 1 202 ? -9.031  -39.462 -4.455  1.00 135.71 ? 563 GLN B HE22 1 
ATOM   7741 N  N    . MET B 1 203 ? -11.184 -33.190 -3.634  1.00 46.94  ? 564 MET B N    1 
ATOM   7742 C  CA   . MET B 1 203 ? -12.495 -32.769 -4.127  1.00 46.44  ? 564 MET B CA   1 
ATOM   7743 C  C    . MET B 1 203 ? -12.654 -33.068 -5.600  1.00 57.04  ? 564 MET B C    1 
ATOM   7744 O  O    . MET B 1 203 ? -11.746 -32.814 -6.390  1.00 37.76  ? 564 MET B O    1 
ATOM   7745 C  CB   . MET B 1 203 ? -12.701 -31.273 -3.890  1.00 50.27  ? 564 MET B CB   1 
ATOM   7746 C  CG   . MET B 1 203 ? -12.809 -30.884 -2.424  1.00 69.48  ? 564 MET B CG   1 
ATOM   7747 S  SD   . MET B 1 203 ? -12.035 -29.286 -2.105  1.00 57.16  ? 564 MET B SD   1 
ATOM   7748 C  CE   . MET B 1 203 ? -10.298 -29.713 -2.228  1.00 53.72  ? 564 MET B CE   1 
ATOM   7749 H  H    . MET B 1 203 ? -10.524 -32.795 -4.018  1.00 56.32  ? 564 MET B H    1 
ATOM   7750 H  HA   . MET B 1 203 ? -13.181 -33.245 -3.634  1.00 55.72  ? 564 MET B HA   1 
ATOM   7751 H  HB2  . MET B 1 203 ? -11.950 -30.791 -4.269  1.00 60.32  ? 564 MET B HB2  1 
ATOM   7752 H  HB3  . MET B 1 203 ? -13.521 -30.999 -4.330  1.00 60.32  ? 564 MET B HB3  1 
ATOM   7753 H  HG2  . MET B 1 203 ? -13.745 -30.823 -2.178  1.00 83.38  ? 564 MET B HG2  1 
ATOM   7754 H  HG3  . MET B 1 203 ? -12.362 -31.552 -1.882  1.00 83.38  ? 564 MET B HG3  1 
ATOM   7755 H  HE1  . MET B 1 203 ? -9.765  -28.918 -2.072  1.00 64.46  ? 564 MET B HE1  1 
ATOM   7756 H  HE2  . MET B 1 203 ? -10.091 -30.387 -1.561  1.00 64.46  ? 564 MET B HE2  1 
ATOM   7757 H  HE3  . MET B 1 203 ? -10.121 -30.061 -3.116  1.00 64.46  ? 564 MET B HE3  1 
ATOM   7758 N  N    . SER B 1 204 ? -13.820 -33.585 -5.970  1.00 49.12  ? 565 SER B N    1 
ATOM   7759 C  CA   . SER B 1 204 ? -14.085 -33.934 -7.356  1.00 57.29  ? 565 SER B CA   1 
ATOM   7760 C  C    . SER B 1 204 ? -15.566 -33.879 -7.690  1.00 56.60  ? 565 SER B C    1 
ATOM   7761 O  O    . SER B 1 204 ? -16.420 -34.062 -6.823  1.00 45.88  ? 565 SER B O    1 
ATOM   7762 C  CB   . SER B 1 204 ? -13.548 -35.333 -7.653  1.00 67.42  ? 565 SER B CB   1 
ATOM   7763 O  OG   . SER B 1 204 ? -14.158 -36.297 -6.812  1.00 69.89  ? 565 SER B OG   1 
ATOM   7764 H  H    . SER B 1 204 ? -14.475 -33.743 -5.436  1.00 58.94  ? 565 SER B H    1 
ATOM   7765 H  HA   . SER B 1 204 ? -13.623 -33.306 -7.933  1.00 68.75  ? 565 SER B HA   1 
ATOM   7766 H  HB2  . SER B 1 204 ? -13.740 -35.554 -8.578  1.00 80.91  ? 565 SER B HB2  1 
ATOM   7767 H  HB3  . SER B 1 204 ? -12.590 -35.342 -7.502  1.00 80.91  ? 565 SER B HB3  1 
ATOM   7768 H  HG   . SER B 1 204 ? -13.855 -37.061 -6.985  1.00 83.87  ? 565 SER B HG   1 
ATOM   7769 N  N    . VAL B 1 205 ? -15.857 -33.613 -8.959  1.00 50.28  ? 566 VAL B N    1 
ATOM   7770 C  CA   . VAL B 1 205 ? -17.201 -33.766 -9.492  1.00 55.11  ? 566 VAL B CA   1 
ATOM   7771 C  C    . VAL B 1 205 ? -17.113 -34.652 -10.728 1.00 71.38  ? 566 VAL B C    1 
ATOM   7772 O  O    . VAL B 1 205 ? -16.915 -34.170 -11.841 1.00 83.49  ? 566 VAL B O    1 
ATOM   7773 C  CB   . VAL B 1 205 ? -17.848 -32.419 -9.851  1.00 59.45  ? 566 VAL B CB   1 
ATOM   7774 C  CG1  . VAL B 1 205 ? -19.306 -32.620 -10.206 1.00 64.00  ? 566 VAL B CG1  1 
ATOM   7775 C  CG2  . VAL B 1 205 ? -17.724 -31.443 -8.697  1.00 54.84  ? 566 VAL B CG2  1 
ATOM   7776 H  H    . VAL B 1 205 ? -15.283 -33.339 -9.538  1.00 60.33  ? 566 VAL B H    1 
ATOM   7777 H  HA   . VAL B 1 205 ? -17.761 -34.209 -8.836  1.00 66.13  ? 566 VAL B HA   1 
ATOM   7778 H  HB   . VAL B 1 205 ? -17.396 -32.040 -10.621 1.00 71.34  ? 566 VAL B HB   1 
ATOM   7779 H  HG11 . VAL B 1 205 ? -19.698 -31.762 -10.429 1.00 76.80  ? 566 VAL B HG11 1 
ATOM   7780 H  HG12 . VAL B 1 205 ? -19.366 -33.220 -10.966 1.00 76.80  ? 566 VAL B HG12 1 
ATOM   7781 H  HG13 . VAL B 1 205 ? -19.765 -33.006 -9.443  1.00 76.80  ? 566 VAL B HG13 1 
ATOM   7782 H  HG21 . VAL B 1 205 ? -18.139 -30.603 -8.948  1.00 65.81  ? 566 VAL B HG21 1 
ATOM   7783 H  HG22 . VAL B 1 205 ? -18.172 -31.814 -7.921  1.00 65.81  ? 566 VAL B HG22 1 
ATOM   7784 H  HG23 . VAL B 1 205 ? -16.784 -31.303 -8.501  1.00 65.81  ? 566 VAL B HG23 1 
ATOM   7785 N  N    . GLY B 1 206 ? -17.246 -35.955 -10.517 1.00 73.80  ? 567 GLY B N    1 
ATOM   7786 C  CA   . GLY B 1 206 ? -17.126 -36.918 -11.593 1.00 77.74  ? 567 GLY B CA   1 
ATOM   7787 C  C    . GLY B 1 206 ? -15.712 -37.011 -12.135 1.00 84.98  ? 567 GLY B C    1 
ATOM   7788 O  O    . GLY B 1 206 ? -14.921 -37.845 -11.695 1.00 88.88  ? 567 GLY B O    1 
ATOM   7789 H  H    . GLY B 1 206 ? -17.408 -36.307 -9.750  1.00 88.56  ? 567 GLY B H    1 
ATOM   7790 H  HA2  . GLY B 1 206 ? -17.390 -37.794 -11.273 1.00 93.29  ? 567 GLY B HA2  1 
ATOM   7791 H  HA3  . GLY B 1 206 ? -17.716 -36.665 -12.320 1.00 93.29  ? 567 GLY B HA3  1 
ATOM   7792 N  N    . HIS B 1 207 ? -15.390 -36.137 -13.083 1.00 96.50  ? 568 HIS B N    1 
ATOM   7793 C  CA   . HIS B 1 207 ? -14.139 -36.234 -13.825 1.00 105.83 ? 568 HIS B CA   1 
ATOM   7794 C  C    . HIS B 1 207 ? -12.957 -35.612 -13.081 1.00 98.79  ? 568 HIS B C    1 
ATOM   7795 O  O    . HIS B 1 207 ? -12.106 -36.323 -12.549 1.00 93.93  ? 568 HIS B O    1 
ATOM   7796 C  CB   . HIS B 1 207 ? -14.297 -35.569 -15.195 1.00 118.91 ? 568 HIS B CB   1 
ATOM   7797 C  CG   . HIS B 1 207 ? -15.597 -35.886 -15.870 1.00 124.28 ? 568 HIS B CG   1 
ATOM   7798 N  ND1  . HIS B 1 207 ? -16.770 -35.237 -15.562 1.00 109.76 ? 568 HIS B ND1  1 
ATOM   7799 C  CD2  . HIS B 1 207 ? -15.901 -36.790 -16.832 1.00 132.58 ? 568 HIS B CD2  1 
ATOM   7800 C  CE1  . HIS B 1 207 ? -17.749 -35.725 -16.310 1.00 117.73 ? 568 HIS B CE1  1 
ATOM   7801 N  NE2  . HIS B 1 207 ? -17.247 -36.666 -17.085 1.00 136.06 ? 568 HIS B NE2  1 
ATOM   7802 H  H    . HIS B 1 207 ? -15.884 -35.473 -13.317 1.00 115.80 ? 568 HIS B H    1 
ATOM   7803 H  HA   . HIS B 1 207 ? -13.936 -37.171 -13.972 1.00 127.00 ? 568 HIS B HA   1 
ATOM   7804 H  HB2  . HIS B 1 207 ? -14.247 -34.607 -15.083 1.00 142.69 ? 568 HIS B HB2  1 
ATOM   7805 H  HB3  . HIS B 1 207 ? -13.580 -35.870 -15.774 1.00 142.69 ? 568 HIS B HB3  1 
ATOM   7806 H  HD1  . HIS B 1 207 ? -16.854 -34.612 -14.977 1.00 131.71 ? 568 HIS B HD1  1 
ATOM   7807 H  HD2  . HIS B 1 207 ? -15.313 -37.381 -17.243 1.00 159.09 ? 568 HIS B HD2  1 
ATOM   7808 H  HE1  . HIS B 1 207 ? -18.638 -35.452 -16.291 1.00 141.27 ? 568 HIS B HE1  1 
ATOM   7809 H  HE2  . HIS B 1 207 ? -17.691 -37.128 -17.658 1.00 163.27 ? 568 HIS B HE2  1 
ATOM   7810 N  N    . LYS B 1 208 ? -12.911 -34.285 -13.045 1.00 89.94  ? 569 LYS B N    1 
ATOM   7811 C  CA   . LYS B 1 208 ? -11.762 -33.568 -12.506 1.00 103.89 ? 569 LYS B CA   1 
ATOM   7812 C  C    . LYS B 1 208 ? -11.713 -33.633 -10.980 1.00 95.55  ? 569 LYS B C    1 
ATOM   7813 O  O    . LYS B 1 208 ? -12.754 -33.663 -10.322 1.00 102.49 ? 569 LYS B O    1 
ATOM   7814 C  CB   . LYS B 1 208 ? -11.796 -32.111 -12.970 1.00 123.57 ? 569 LYS B CB   1 
ATOM   7815 C  CG   . LYS B 1 208 ? -10.611 -31.270 -12.519 1.00 123.25 ? 569 LYS B CG   1 
ATOM   7816 C  CD   . LYS B 1 208 ? -9.296  -31.818 -13.050 1.00 111.32 ? 569 LYS B CD   1 
ATOM   7817 C  CE   . LYS B 1 208 ? -8.145  -30.879 -12.734 1.00 116.92 ? 569 LYS B CE   1 
ATOM   7818 N  NZ   . LYS B 1 208 ? -6.829  -31.466 -13.108 1.00 130.67 ? 569 LYS B NZ   1 
ATOM   7819 H  H    . LYS B 1 208 ? -13.540 -33.772 -13.330 1.00 107.92 ? 569 LYS B H    1 
ATOM   7820 H  HA   . LYS B 1 208 ? -10.949 -33.973 -12.848 1.00 124.66 ? 569 LYS B HA   1 
ATOM   7821 H  HB2  . LYS B 1 208 ? -11.815 -32.095 -13.940 1.00 148.29 ? 569 LYS B HB2  1 
ATOM   7822 H  HB3  . LYS B 1 208 ? -12.600 -31.694 -12.622 1.00 148.29 ? 569 LYS B HB3  1 
ATOM   7823 H  HG2  . LYS B 1 208 ? -10.717 -30.364 -12.850 1.00 147.90 ? 569 LYS B HG2  1 
ATOM   7824 H  HG3  . LYS B 1 208 ? -10.570 -31.270 -11.550 1.00 147.90 ? 569 LYS B HG3  1 
ATOM   7825 H  HD2  . LYS B 1 208 ? -9.113  -32.675 -12.633 1.00 133.58 ? 569 LYS B HD2  1 
ATOM   7826 H  HD3  . LYS B 1 208 ? -9.354  -31.917 -14.013 1.00 133.58 ? 569 LYS B HD3  1 
ATOM   7827 H  HE2  . LYS B 1 208 ? -8.261  -30.055 -13.232 1.00 140.30 ? 569 LYS B HE2  1 
ATOM   7828 H  HE3  . LYS B 1 208 ? -8.135  -30.696 -11.782 1.00 140.30 ? 569 LYS B HE3  1 
ATOM   7829 H  HZ1  . LYS B 1 208 ? -6.175  -30.894 -12.912 1.00 156.80 ? 569 LYS B HZ1  1 
ATOM   7830 H  HZ2  . LYS B 1 208 ? -6.696  -32.223 -12.660 1.00 156.80 ? 569 LYS B HZ2  1 
ATOM   7831 H  HZ3  . LYS B 1 208 ? -6.811  -31.639 -13.981 1.00 156.80 ? 569 LYS B HZ3  1 
ATOM   7832 N  N    . ALA B 1 209 ? -10.499 -33.657 -10.429 1.00 62.28  ? 570 ALA B N    1 
ATOM   7833 C  CA   . ALA B 1 209 ? -10.301 -33.682 -8.983  1.00 60.30  ? 570 ALA B CA   1 
ATOM   7834 C  C    . ALA B 1 209 ? -9.191  -32.732 -8.542  1.00 49.68  ? 570 ALA B C    1 
ATOM   7835 O  O    . ALA B 1 209 ? -8.121  -32.715 -9.133  1.00 44.12  ? 570 ALA B O    1 
ATOM   7836 C  CB   . ALA B 1 209 ? -9.987  -35.091 -8.519  1.00 54.60  ? 570 ALA B CB   1 
ATOM   7837 H  H    . ALA B 1 209 ? -9.766  -33.659 -10.879 1.00 74.74  ? 570 ALA B H    1 
ATOM   7838 H  HA   . ALA B 1 209 ? -11.122 -33.401 -8.549  1.00 72.36  ? 570 ALA B HA   1 
ATOM   7839 H  HB1  . ALA B 1 209 ? -9.860  -35.086 -7.557  1.00 65.52  ? 570 ALA B HB1  1 
ATOM   7840 H  HB2  . ALA B 1 209 ? -10.728 -35.672 -8.752  1.00 65.52  ? 570 ALA B HB2  1 
ATOM   7841 H  HB3  . ALA B 1 209 ? -9.178  -35.395 -8.959  1.00 65.52  ? 570 ALA B HB3  1 
ATOM   7842 N  N    . GLN B 1 210 ? -9.445  -31.963 -7.486  1.00 40.07  ? 571 GLN B N    1 
ATOM   7843 C  CA   . GLN B 1 210 ? -8.458  -31.025 -6.951  1.00 35.39  ? 571 GLN B CA   1 
ATOM   7844 C  C    . GLN B 1 210 ? -8.186  -31.365 -5.480  1.00 40.24  ? 571 GLN B C    1 
ATOM   7845 O  O    . GLN B 1 210 ? -9.014  -31.995 -4.820  1.00 48.61  ? 571 GLN B O    1 
ATOM   7846 C  CB   . GLN B 1 210 ? -8.952  -29.580 -7.122  1.00 38.16  ? 571 GLN B CB   1 
ATOM   7847 C  CG   . GLN B 1 210 ? -8.987  -29.122 -8.603  1.00 44.77  ? 571 GLN B CG   1 
ATOM   7848 C  CD   . GLN B 1 210 ? -9.746  -27.816 -8.832  1.00 34.75  ? 571 GLN B CD   1 
ATOM   7849 O  OE1  . GLN B 1 210 ? -10.720 -27.773 -9.589  1.00 40.15  ? 571 GLN B OE1  1 
ATOM   7850 N  NE2  . GLN B 1 210 ? -9.293  -26.748 -8.197  1.00 33.96  ? 571 GLN B NE2  1 
ATOM   7851 H  H    . GLN B 1 210 ? -10.189 -31.966 -7.055  1.00 48.08  ? 571 GLN B H    1 
ATOM   7852 H  HA   . GLN B 1 210 ? -7.628  -31.121 -7.443  1.00 42.46  ? 571 GLN B HA   1 
ATOM   7853 H  HB2  . GLN B 1 210 ? -9.851  -29.510 -6.766  1.00 45.79  ? 571 GLN B HB2  1 
ATOM   7854 H  HB3  . GLN B 1 210 ? -8.357  -28.985 -6.639  1.00 45.79  ? 571 GLN B HB3  1 
ATOM   7855 H  HG2  . GLN B 1 210 ? -8.076  -28.993 -8.911  1.00 53.73  ? 571 GLN B HG2  1 
ATOM   7856 H  HG3  . GLN B 1 210 ? -9.418  -29.811 -9.132  1.00 53.73  ? 571 GLN B HG3  1 
ATOM   7857 H  HE21 . GLN B 1 210 ? -8.604  -26.810 -7.686  1.00 40.75  ? 571 GLN B HE21 1 
ATOM   7858 H  HE22 . GLN B 1 210 ? -9.688  -25.990 -8.295  1.00 40.75  ? 571 GLN B HE22 1 
ATOM   7859 N  N    . GLU B 1 211 ? -7.018  -30.967 -4.984  1.00 40.68  ? 572 GLU B N    1 
ATOM   7860 C  CA   . GLU B 1 211 ? -6.610  -31.260 -3.610  1.00 58.43  ? 572 GLU B CA   1 
ATOM   7861 C  C    . GLU B 1 211 ? -6.186  -30.010 -2.853  1.00 44.70  ? 572 GLU B C    1 
ATOM   7862 O  O    . GLU B 1 211 ? -5.634  -29.075 -3.434  1.00 38.60  ? 572 GLU B O    1 
ATOM   7863 C  CB   . GLU B 1 211 ? -5.455  -32.266 -3.596  1.00 56.50  ? 572 GLU B CB   1 
ATOM   7864 C  CG   . GLU B 1 211 ? -5.892  -33.718 -3.550  1.00 80.81  ? 572 GLU B CG   1 
ATOM   7865 C  CD   . GLU B 1 211 ? -4.763  -34.651 -3.149  1.00 95.94  ? 572 GLU B CD   1 
ATOM   7866 O  OE1  . GLU B 1 211 ? -3.584  -34.267 -3.314  1.00 96.36  ? 572 GLU B OE1  1 
ATOM   7867 O  OE2  . GLU B 1 211 ? -5.054  -35.764 -2.661  1.00 100.54 ? 572 GLU B OE2  1 
ATOM   7868 H  H    . GLU B 1 211 ? -6.435  -30.519 -5.429  1.00 48.82  ? 572 GLU B H    1 
ATOM   7869 H  HA   . GLU B 1 211 ? -7.359  -31.657 -3.137  1.00 70.12  ? 572 GLU B HA   1 
ATOM   7870 H  HB2  . GLU B 1 211 ? -4.925  -32.142 -4.399  1.00 67.80  ? 572 GLU B HB2  1 
ATOM   7871 H  HB3  . GLU B 1 211 ? -4.907  -32.098 -2.813  1.00 67.80  ? 572 GLU B HB3  1 
ATOM   7872 H  HG2  . GLU B 1 211 ? -6.607  -33.814 -2.902  1.00 96.97  ? 572 GLU B HG2  1 
ATOM   7873 H  HG3  . GLU B 1 211 ? -6.203  -33.983 -4.430  1.00 96.97  ? 572 GLU B HG3  1 
ATOM   7874 N  N    . SER B 1 212 ? -6.418  -30.012 -1.546  1.00 39.65  ? 573 SER B N    1 
ATOM   7875 C  CA   . SER B 1 212 ? -5.961  -28.934 -0.686  1.00 37.49  ? 573 SER B CA   1 
ATOM   7876 C  C    . SER B 1 212 ? -4.500  -29.152 -0.320  1.00 42.70  ? 573 SER B C    1 
ATOM   7877 O  O    . SER B 1 212 ? -3.895  -30.143 -0.727  1.00 41.49  ? 573 SER B O    1 
ATOM   7878 C  CB   . SER B 1 212 ? -6.796  -28.870 0.585   1.00 48.75  ? 573 SER B CB   1 
ATOM   7879 O  OG   . SER B 1 212 ? -6.482  -29.976 1.415   1.00 44.08  ? 573 SER B OG   1 
ATOM   7880 H  H    . SER B 1 212 ? -6.843  -30.634 -1.131  1.00 47.58  ? 573 SER B H    1 
ATOM   7881 H  HA   . SER B 1 212 ? -6.041  -28.088 -1.153  1.00 44.99  ? 573 SER B HA   1 
ATOM   7882 H  HB2  . SER B 1 212 ? -6.595  -28.047 1.058   1.00 58.49  ? 573 SER B HB2  1 
ATOM   7883 H  HB3  . SER B 1 212 ? -7.737  -28.902 0.351   1.00 58.49  ? 573 SER B HB3  1 
ATOM   7884 H  HG   . SER B 1 212 ? -6.939  -29.946 2.119   1.00 52.89  ? 573 SER B HG   1 
ATOM   7885 N  N    . LYS B 1 213 ? -3.943  -28.230 0.459   1.00 43.68  ? 574 LYS B N    1 
ATOM   7886 C  CA   . LYS B 1 213 ? -2.629  -28.442 1.059   1.00 60.50  ? 574 LYS B CA   1 
ATOM   7887 C  C    . LYS B 1 213 ? -2.731  -29.477 2.172   1.00 51.03  ? 574 LYS B C    1 
ATOM   7888 O  O    . LYS B 1 213 ? -3.820  -29.761 2.663   1.00 46.82  ? 574 LYS B O    1 
ATOM   7889 C  CB   . LYS B 1 213 ? -2.061  -27.139 1.620   1.00 48.31  ? 574 LYS B CB   1 
ATOM   7890 C  CG   . LYS B 1 213 ? -1.996  -26.008 0.619   1.00 54.10  ? 574 LYS B CG   1 
ATOM   7891 C  CD   . LYS B 1 213 ? -1.007  -26.307 -0.499  1.00 63.03  ? 574 LYS B CD   1 
ATOM   7892 C  CE   . LYS B 1 213 ? -0.983  -25.191 -1.525  1.00 72.18  ? 574 LYS B CE   1 
ATOM   7893 N  NZ   . LYS B 1 213 ? -0.020  -25.475 -2.628  1.00 84.25  ? 574 LYS B NZ   1 
ATOM   7894 H  H    . LYS B 1 213 ? -4.303  -27.475 0.655   1.00 52.42  ? 574 LYS B H    1 
ATOM   7895 H  HA   . LYS B 1 213 ? -2.017  -28.777 0.385   1.00 72.61  ? 574 LYS B HA   1 
ATOM   7896 H  HB2  . LYS B 1 213 ? -2.620  -26.849 2.357   1.00 57.97  ? 574 LYS B HB2  1 
ATOM   7897 H  HB3  . LYS B 1 213 ? -1.159  -27.304 1.937   1.00 57.97  ? 574 LYS B HB3  1 
ATOM   7898 H  HG2  . LYS B 1 213 ? -2.873  -25.880 0.223   1.00 64.92  ? 574 LYS B HG2  1 
ATOM   7899 H  HG3  . LYS B 1 213 ? -1.710  -25.198 1.069   1.00 64.92  ? 574 LYS B HG3  1 
ATOM   7900 H  HD2  . LYS B 1 213 ? -0.117  -26.396 -0.125  1.00 75.64  ? 574 LYS B HD2  1 
ATOM   7901 H  HD3  . LYS B 1 213 ? -1.268  -27.127 -0.947  1.00 75.64  ? 574 LYS B HD3  1 
ATOM   7902 H  HE2  . LYS B 1 213 ? -1.867  -25.093 -1.912  1.00 86.61  ? 574 LYS B HE2  1 
ATOM   7903 H  HE3  . LYS B 1 213 ? -0.714  -24.365 -1.093  1.00 86.61  ? 574 LYS B HE3  1 
ATOM   7904 H  HZ1  . LYS B 1 213 ? -0.025  -24.807 -3.215  1.00 101.10 ? 574 LYS B HZ1  1 
ATOM   7905 H  HZ2  . LYS B 1 213 ? 0.801   -25.565 -2.298  1.00 101.10 ? 574 LYS B HZ2  1 
ATOM   7906 H  HZ3  . LYS B 1 213 ? -0.249  -26.228 -3.044  1.00 101.10 ? 574 LYS B HZ3  1 
ATOM   7907 N  N    . ILE B 1 214 ? -1.595  -30.044 2.556   1.00 48.97  ? 575 ILE B N    1 
ATOM   7908 C  CA   . ILE B 1 214 ? -1.540  -30.983 3.674   1.00 57.52  ? 575 ILE B CA   1 
ATOM   7909 C  C    . ILE B 1 214 ? -1.471  -30.231 4.996   1.00 57.60  ? 575 ILE B C    1 
ATOM   7910 O  O    . ILE B 1 214 ? -0.717  -29.261 5.123   1.00 54.44  ? 575 ILE B O    1 
ATOM   7911 C  CB   . ILE B 1 214 ? -0.309  -31.921 3.588   1.00 59.06  ? 575 ILE B CB   1 
ATOM   7912 C  CG1  . ILE B 1 214 ? -0.262  -32.644 2.242   1.00 55.53  ? 575 ILE B CG1  1 
ATOM   7913 C  CG2  . ILE B 1 214 ? -0.323  -32.949 4.728   1.00 55.45  ? 575 ILE B CG2  1 
ATOM   7914 C  CD1  . ILE B 1 214 ? 1.099   -33.226 1.918   1.00 60.20  ? 575 ILE B CD1  1 
ATOM   7915 H  H    . ILE B 1 214 ? -0.834  -29.902 2.183   1.00 58.76  ? 575 ILE B H    1 
ATOM   7916 H  HA   . ILE B 1 214 ? -2.341  -31.530 3.675   1.00 69.02  ? 575 ILE B HA   1 
ATOM   7917 H  HB   . ILE B 1 214 ? 0.492   -31.381 3.673   1.00 70.87  ? 575 ILE B HB   1 
ATOM   7918 H  HG12 . ILE B 1 214 ? -0.902  -33.373 2.255   1.00 66.64  ? 575 ILE B HG12 1 
ATOM   7919 H  HG13 . ILE B 1 214 ? -0.492  -32.016 1.540   1.00 66.64  ? 575 ILE B HG13 1 
ATOM   7920 H  HG21 . ILE B 1 214 ? 0.457   -33.520 4.647   1.00 66.54  ? 575 ILE B HG21 1 
ATOM   7921 H  HG22 . ILE B 1 214 ? -0.304  -32.480 5.576   1.00 66.54  ? 575 ILE B HG22 1 
ATOM   7922 H  HG23 . ILE B 1 214 ? -1.131  -33.482 4.662   1.00 66.54  ? 575 ILE B HG23 1 
ATOM   7923 H  HD11 . ILE B 1 214 ? 1.056   -33.667 1.055   1.00 72.24  ? 575 ILE B HD11 1 
ATOM   7924 H  HD12 . ILE B 1 214 ? 1.750   -32.508 1.890   1.00 72.24  ? 575 ILE B HD12 1 
ATOM   7925 H  HD13 . ILE B 1 214 ? 1.340   -33.866 2.606   1.00 72.24  ? 575 ILE B HD13 1 
ATOM   7926 N  N    . ARG B 1 215 ? -2.254  -30.684 5.971   1.00 49.55  ? 576 ARG B N    1 
ATOM   7927 C  CA   . ARG B 1 215 ? -2.085  -30.255 7.354   1.00 65.47  ? 576 ARG B CA   1 
ATOM   7928 C  C    . ARG B 1 215 ? -1.399  -31.329 8.149   1.00 60.21  ? 576 ARG B C    1 
ATOM   7929 O  O    . ARG B 1 215 ? -1.594  -32.511 7.887   1.00 74.00  ? 576 ARG B O    1 
ATOM   7930 C  CB   . ARG B 1 215 ? -3.419  -29.922 8.007   1.00 68.59  ? 576 ARG B CB   1 
ATOM   7931 C  CG   . ARG B 1 215 ? -3.920  -28.555 7.678   1.00 53.99  ? 576 ARG B CG   1 
ATOM   7932 C  CD   . ARG B 1 215 ? -2.977  -27.471 8.149   1.00 57.85  ? 576 ARG B CD   1 
ATOM   7933 N  NE   . ARG B 1 215 ? -3.332  -26.230 7.503   1.00 89.41  ? 576 ARG B NE   1 
ATOM   7934 C  CZ   . ARG B 1 215 ? -3.011  -25.931 6.254   1.00 74.83  ? 576 ARG B CZ   1 
ATOM   7935 N  NH1  . ARG B 1 215 ? -2.306  -26.777 5.516   1.00 79.92  ? 576 ARG B NH1  1 
ATOM   7936 N  NH2  . ARG B 1 215 ? -3.403  -24.779 5.755   1.00 51.72  ? 576 ARG B NH2  1 
ATOM   7937 H  H    . ARG B 1 215 ? -2.896  -31.245 5.855   1.00 59.46  ? 576 ARG B H    1 
ATOM   7938 H  HA   . ARG B 1 215 ? -1.530  -29.460 7.375   1.00 78.56  ? 576 ARG B HA   1 
ATOM   7939 H  HB2  . ARG B 1 215 ? -4.083  -30.562 7.708   1.00 82.30  ? 576 ARG B HB2  1 
ATOM   7940 H  HB3  . ARG B 1 215 ? -3.318  -29.977 8.971   1.00 82.30  ? 576 ARG B HB3  1 
ATOM   7941 H  HG2  . ARG B 1 215 ? -4.015  -28.475 6.716   1.00 64.79  ? 576 ARG B HG2  1 
ATOM   7942 H  HG3  . ARG B 1 215 ? -4.777  -28.418 8.110   1.00 64.79  ? 576 ARG B HG3  1 
ATOM   7943 H  HD2  . ARG B 1 215 ? -3.060  -27.358 9.109   1.00 69.42  ? 576 ARG B HD2  1 
ATOM   7944 H  HD3  . ARG B 1 215 ? -2.066  -27.699 7.907   1.00 69.42  ? 576 ARG B HD3  1 
ATOM   7945 H  HE   . ARG B 1 215 ? -3.857  -25.693 7.923   1.00 107.29 ? 576 ARG B HE   1 
ATOM   7946 H  HH11 . ARG B 1 215 ? -2.057  -27.531 5.845   1.00 95.90  ? 576 ARG B HH11 1 
ATOM   7947 H  HH12 . ARG B 1 215 ? -2.100  -26.573 4.706   1.00 95.90  ? 576 ARG B HH12 1 
ATOM   7948 H  HH21 . ARG B 1 215 ? -3.857  -24.232 6.240   1.00 62.06  ? 576 ARG B HH21 1 
ATOM   7949 H  HH22 . ARG B 1 215 ? -3.195  -24.567 4.948   1.00 62.06  ? 576 ARG B HH22 1 
ATOM   7950 N  N    . TYR B 1 216 ? -0.612  -30.910 9.135   1.00 60.50  ? 577 TYR B N    1 
ATOM   7951 C  CA   . TYR B 1 216 ? 0.231   -31.830 9.883   1.00 67.21  ? 577 TYR B CA   1 
ATOM   7952 C  C    . TYR B 1 216 ? -0.176  -31.950 11.347  1.00 80.60  ? 577 TYR B C    1 
ATOM   7953 O  O    . TYR B 1 216 ? -0.371  -30.948 12.036  1.00 70.35  ? 577 TYR B O    1 
ATOM   7954 C  CB   . TYR B 1 216 ? 1.691   -31.386 9.787   1.00 71.21  ? 577 TYR B CB   1 
ATOM   7955 C  CG   . TYR B 1 216 ? 2.239   -31.440 8.379   1.00 72.80  ? 577 TYR B CG   1 
ATOM   7956 C  CD1  . TYR B 1 216 ? 2.894   -32.573 7.913   1.00 75.91  ? 577 TYR B CD1  1 
ATOM   7957 C  CD2  . TYR B 1 216 ? 2.093   -30.364 7.512   1.00 75.23  ? 577 TYR B CD2  1 
ATOM   7958 C  CE1  . TYR B 1 216 ? 3.395   -32.631 6.624   1.00 75.25  ? 577 TYR B CE1  1 
ATOM   7959 C  CE2  . TYR B 1 216 ? 2.592   -30.411 6.218   1.00 53.80  ? 577 TYR B CE2  1 
ATOM   7960 C  CZ   . TYR B 1 216 ? 3.241   -31.547 5.782   1.00 60.37  ? 577 TYR B CZ   1 
ATOM   7961 O  OH   . TYR B 1 216 ? 3.734   -31.601 4.502   1.00 68.33  ? 577 TYR B OH   1 
ATOM   7962 H  H    . TYR B 1 216 ? -0.549  -30.091 9.390   1.00 72.60  ? 577 TYR B H    1 
ATOM   7963 H  HA   . TYR B 1 216 ? 0.162   -32.712 9.484   1.00 80.65  ? 577 TYR B HA   1 
ATOM   7964 H  HB2  . TYR B 1 216 ? 1.762   -30.470 10.100  1.00 85.46  ? 577 TYR B HB2  1 
ATOM   7965 H  HB3  . TYR B 1 216 ? 2.234   -31.968 10.341  1.00 85.46  ? 577 TYR B HB3  1 
ATOM   7966 H  HD1  . TYR B 1 216 ? 3.000   -33.305 8.478   1.00 91.09  ? 577 TYR B HD1  1 
ATOM   7967 H  HD2  . TYR B 1 216 ? 1.656   -29.597 7.805   1.00 90.27  ? 577 TYR B HD2  1 
ATOM   7968 H  HE1  . TYR B 1 216 ? 3.833   -33.395 6.326   1.00 90.29  ? 577 TYR B HE1  1 
ATOM   7969 H  HE2  . TYR B 1 216 ? 2.489   -29.683 5.648   1.00 64.56  ? 577 TYR B HE2  1 
ATOM   7970 H  HH   . TYR B 1 216 ? 3.573   -30.880 4.102   1.00 81.99  ? 577 TYR B HH   1 
ATOM   7971 N  N    . LYS B 1 217 ? -0.306  -33.194 11.797  1.00 82.15  ? 578 LYS B N    1 
ATOM   7972 C  CA   . LYS B 1 217 ? -0.492  -33.513 13.207  1.00 95.92  ? 578 LYS B CA   1 
ATOM   7973 C  C    . LYS B 1 217 ? -1.606  -32.692 13.841  1.00 93.27  ? 578 LYS B C    1 
ATOM   7974 O  O    . LYS B 1 217 ? -1.383  -31.947 14.800  1.00 75.18  ? 578 LYS B O    1 
ATOM   7975 C  CB   . LYS B 1 217 ? 0.819   -33.303 13.967  1.00 114.80 ? 578 LYS B CB   1 
ATOM   7976 C  CG   . LYS B 1 217 ? 1.984   -34.128 13.427  1.00 120.04 ? 578 LYS B CG   1 
ATOM   7977 C  CD   . LYS B 1 217 ? 1.702   -35.624 13.498  1.00 135.34 ? 578 LYS B CD   1 
ATOM   7978 C  CE   . LYS B 1 217 ? 2.750   -36.433 12.758  1.00 142.24 ? 578 LYS B CE   1 
ATOM   7979 N  NZ   . LYS B 1 217 ? 2.249   -37.803 12.457  1.00 146.56 ? 578 LYS B NZ   1 
ATOM   7980 H  H    . LYS B 1 217 ? -0.289  -33.889 11.290  1.00 98.58  ? 578 LYS B H    1 
ATOM   7981 H  HA   . LYS B 1 217 ? -0.734  -34.449 13.286  1.00 115.10 ? 578 LYS B HA   1 
ATOM   7982 H  HB2  . LYS B 1 217 ? 1.067   -32.367 13.909  1.00 137.76 ? 578 LYS B HB2  1 
ATOM   7983 H  HB3  . LYS B 1 217 ? 0.686   -33.551 14.895  1.00 137.76 ? 578 LYS B HB3  1 
ATOM   7984 H  HG2  . LYS B 1 217 ? 2.138   -33.893 12.498  1.00 144.05 ? 578 LYS B HG2  1 
ATOM   7985 H  HG3  . LYS B 1 217 ? 2.777   -33.944 13.955  1.00 144.05 ? 578 LYS B HG3  1 
ATOM   7986 H  HD2  . LYS B 1 217 ? 1.704   -35.904 14.427  1.00 162.40 ? 578 LYS B HD2  1 
ATOM   7987 H  HD3  . LYS B 1 217 ? 0.839   -35.805 13.095  1.00 162.40 ? 578 LYS B HD3  1 
ATOM   7988 H  HE2  . LYS B 1 217 ? 2.962   -35.995 11.919  1.00 170.69 ? 578 LYS B HE2  1 
ATOM   7989 H  HE3  . LYS B 1 217 ? 3.545   -36.512 13.308  1.00 170.69 ? 578 LYS B HE3  1 
ATOM   7990 H  HZ1  . LYS B 1 217 ? 2.049   -38.227 13.214  1.00 175.88 ? 578 LYS B HZ1  1 
ATOM   7991 H  HZ2  . LYS B 1 217 ? 1.519   -37.756 11.950  1.00 175.88 ? 578 LYS B HZ2  1 
ATOM   7992 H  HZ3  . LYS B 1 217 ? 2.873   -38.266 12.023  1.00 175.88 ? 578 LYS B HZ3  1 
ATOM   7993 N  N    . THR B 1 218 ? -2.801  -32.826 13.277  1.00 75.05  ? 579 THR B N    1 
ATOM   7994 C  CA   . THR B 1 218 ? -3.992  -32.233 13.859  1.00 73.46  ? 579 THR B CA   1 
ATOM   7995 C  C    . THR B 1 218 ? -5.245  -32.923 13.343  1.00 90.94  ? 579 THR B C    1 
ATOM   7996 O  O    . THR B 1 218 ? -5.286  -33.413 12.213  1.00 79.94  ? 579 THR B O    1 
ATOM   7997 C  CB   . THR B 1 218 ? -4.094  -30.723 13.560  1.00 83.65  ? 579 THR B CB   1 
ATOM   7998 O  OG1  . THR B 1 218 ? -5.224  -30.177 14.252  1.00 85.10  ? 579 THR B OG1  1 
ATOM   7999 C  CG2  . THR B 1 218 ? -4.250  -30.472 12.070  1.00 78.49  ? 579 THR B CG2  1 
ATOM   8000 H  H    . THR B 1 218 ? -2.948  -33.261 12.550  1.00 90.06  ? 579 THR B H    1 
ATOM   8001 H  HA   . THR B 1 218 ? -3.962  -32.346 14.822  1.00 88.15  ? 579 THR B HA   1 
ATOM   8002 H  HB   . THR B 1 218 ? -3.286  -30.280 13.862  1.00 100.38 ? 579 THR B HB   1 
ATOM   8003 H  HG1  . THR B 1 218 ? -5.287  -29.354 14.094  1.00 102.12 ? 579 THR B HG1  1 
ATOM   8004 H  HG21 . THR B 1 218 ? -4.313  -29.520 11.899  1.00 94.19  ? 579 THR B HG21 1 
ATOM   8005 H  HG22 . THR B 1 218 ? -3.484  -30.828 11.592  1.00 94.19  ? 579 THR B HG22 1 
ATOM   8006 H  HG23 . THR B 1 218 ? -5.054  -30.905 11.743  1.00 94.19  ? 579 THR B HG23 1 
ATOM   8007 N  N    . ASN B 1 219 ? -6.259  -32.954 14.197  1.00 87.88  ? 580 ASN B N    1 
ATOM   8008 C  CA   . ASN B 1 219 ? -7.583  -33.438 13.842  1.00 83.10  ? 580 ASN B CA   1 
ATOM   8009 C  C    . ASN B 1 219 ? -8.526  -32.258 13.685  1.00 69.14  ? 580 ASN B C    1 
ATOM   8010 O  O    . ASN B 1 219 ? -9.735  -32.432 13.543  1.00 69.06  ? 580 ASN B O    1 
ATOM   8011 C  CB   . ASN B 1 219 ? -8.111  -34.380 14.915  1.00 108.74 ? 580 ASN B CB   1 
ATOM   8012 C  CG   . ASN B 1 219 ? -8.136  -33.730 16.275  1.00 90.53  ? 580 ASN B CG   1 
ATOM   8013 O  OD1  . ASN B 1 219 ? -7.121  -33.207 16.740  1.00 103.87 ? 580 ASN B OD1  1 
ATOM   8014 N  ND2  . ASN B 1 219 ? -9.300  -33.724 16.909  1.00 110.38 ? 580 ASN B ND2  1 
ATOM   8015 H  H    . ASN B 1 219 ? -6.201  -32.692 15.014  1.00 105.45 ? 580 ASN B H    1 
ATOM   8016 H  HA   . ASN B 1 219 ? -7.540  -33.917 13.000  1.00 99.71  ? 580 ASN B HA   1 
ATOM   8017 H  HB2  . ASN B 1 219 ? -9.016  -34.644 14.689  1.00 130.48 ? 580 ASN B HB2  1 
ATOM   8018 H  HB3  . ASN B 1 219 ? -7.537  -35.161 14.963  1.00 130.48 ? 580 ASN B HB3  1 
ATOM   8019 H  HD21 . ASN B 1 219 ? -9.364  -33.365 17.688  1.00 132.46 ? 580 ASN B HD21 1 
ATOM   8020 H  HD22 . ASN B 1 219 ? -9.992  -34.080 16.542  1.00 132.46 ? 580 ASN B HD22 1 
ATOM   8021 N  N    . GLU B 1 220 ? -7.959  -31.056 13.744  1.00 75.64  ? 581 GLU B N    1 
ATOM   8022 C  CA   . GLU B 1 220 ? -8.714  -29.825 13.562  1.00 87.33  ? 581 GLU B CA   1 
ATOM   8023 C  C    . GLU B 1 220 ? -8.074  -28.988 12.452  1.00 68.76  ? 581 GLU B C    1 
ATOM   8024 O  O    . GLU B 1 220 ? -7.767  -27.812 12.651  1.00 65.17  ? 581 GLU B O    1 
ATOM   8025 C  CB   . GLU B 1 220 ? -8.765  -29.030 14.868  1.00 88.96  ? 581 GLU B CB   1 
ATOM   8026 C  CG   . GLU B 1 220 ? -9.118  -29.861 16.103  1.00 119.42 ? 581 GLU B CG   1 
ATOM   8027 C  CD   . GLU B 1 220 ? -10.539 -29.638 16.588  1.00 124.98 ? 581 GLU B CD   1 
ATOM   8028 O  OE1  . GLU B 1 220 ? -10.935 -28.466 16.765  1.00 133.06 ? 581 GLU B OE1  1 
ATOM   8029 O  OE2  . GLU B 1 220 ? -11.258 -30.639 16.801  1.00 104.60 ? 581 GLU B OE2  1 
ATOM   8030 H  H    . GLU B 1 220 ? -7.121  -30.928 13.891  1.00 90.77  ? 581 GLU B H    1 
ATOM   8031 H  HA   . GLU B 1 220 ? -9.623  -30.040 13.299  1.00 104.80 ? 581 GLU B HA   1 
ATOM   8032 H  HB2  . GLU B 1 220 ? -7.894  -28.630 15.022  1.00 106.75 ? 581 GLU B HB2  1 
ATOM   8033 H  HB3  . GLU B 1 220 ? -9.433  -28.333 14.781  1.00 106.75 ? 581 GLU B HB3  1 
ATOM   8034 H  HG2  . GLU B 1 220 ? -9.020  -30.801 15.887  1.00 143.31 ? 581 GLU B HG2  1 
ATOM   8035 H  HG3  . GLU B 1 220 ? -8.516  -29.623 16.825  1.00 143.31 ? 581 GLU B HG3  1 
ATOM   8036 N  N    . PRO B 1 221 ? -7.873  -29.594 11.272  1.00 66.69  ? 582 PRO B N    1 
ATOM   8037 C  CA   . PRO B 1 221 ? -7.168  -28.892 10.199  1.00 61.50  ? 582 PRO B CA   1 
ATOM   8038 C  C    . PRO B 1 221 ? -7.921  -27.664 9.711   1.00 56.61  ? 582 PRO B C    1 
ATOM   8039 O  O    . PRO B 1 221 ? -9.147  -27.697 9.598   1.00 50.79  ? 582 PRO B O    1 
ATOM   8040 C  CB   . PRO B 1 221 ? -7.074  -29.947 9.096   1.00 62.22  ? 582 PRO B CB   1 
ATOM   8041 C  CG   . PRO B 1 221 ? -8.248  -30.809 9.324   1.00 58.90  ? 582 PRO B CG   1 
ATOM   8042 C  CD   . PRO B 1 221 ? -8.409  -30.886 10.812  1.00 72.07  ? 582 PRO B CD   1 
ATOM   8043 H  HA   . PRO B 1 221 ? -6.276  -28.638 10.484  1.00 73.80  ? 582 PRO B HA   1 
ATOM   8044 H  HB2  . PRO B 1 221 ? -7.122  -29.520 8.227   1.00 74.66  ? 582 PRO B HB2  1 
ATOM   8045 H  HB3  . PRO B 1 221 ? -6.251  -30.451 9.191   1.00 74.66  ? 582 PRO B HB3  1 
ATOM   8046 H  HG2  . PRO B 1 221 ? -9.031  -30.407 8.916   1.00 70.68  ? 582 PRO B HG2  1 
ATOM   8047 H  HG3  . PRO B 1 221 ? -8.083  -31.690 8.952   1.00 70.68  ? 582 PRO B HG3  1 
ATOM   8048 H  HD2  . PRO B 1 221 ? -9.346  -30.968 11.049  1.00 86.49  ? 582 PRO B HD2  1 
ATOM   8049 H  HD3  . PRO B 1 221 ? -7.884  -31.618 11.172  1.00 86.49  ? 582 PRO B HD3  1 
ATOM   8050 N  N    . VAL B 1 222 ? -7.177  -26.595 9.443   1.00 56.26  ? 583 VAL B N    1 
ATOM   8051 C  CA   . VAL B 1 222 ? -7.715  -25.384 8.837   1.00 49.38  ? 583 VAL B CA   1 
ATOM   8052 C  C    . VAL B 1 222 ? -7.020  -25.188 7.486   1.00 46.06  ? 583 VAL B C    1 
ATOM   8053 O  O    . VAL B 1 222 ? -5.798  -25.291 7.412   1.00 55.47  ? 583 VAL B O    1 
ATOM   8054 C  CB   . VAL B 1 222 ? -7.487  -24.157 9.732   1.00 48.24  ? 583 VAL B CB   1 
ATOM   8055 C  CG1  . VAL B 1 222 ? -8.133  -22.931 9.125   1.00 52.68  ? 583 VAL B CG1  1 
ATOM   8056 C  CG2  . VAL B 1 222 ? -8.033  -24.408 11.156  1.00 53.21  ? 583 VAL B CG2  1 
ATOM   8057 H  H    . VAL B 1 222 ? -6.334  -26.548 9.608   1.00 67.52  ? 583 VAL B H    1 
ATOM   8058 H  HA   . VAL B 1 222 ? -8.668  -25.488 8.686   1.00 59.26  ? 583 VAL B HA   1 
ATOM   8059 H  HB   . VAL B 1 222 ? -6.534  -23.990 9.801   1.00 57.89  ? 583 VAL B HB   1 
ATOM   8060 H  HG11 . VAL B 1 222 ? -7.975  -22.171 9.707   1.00 63.21  ? 583 VAL B HG11 1 
ATOM   8061 H  HG12 . VAL B 1 222 ? -7.741  -22.767 8.253   1.00 63.21  ? 583 VAL B HG12 1 
ATOM   8062 H  HG13 . VAL B 1 222 ? -9.086  -23.088 9.036   1.00 63.21  ? 583 VAL B HG13 1 
ATOM   8063 H  HG21 . VAL B 1 222 ? -7.876  -23.618 11.697  1.00 63.85  ? 583 VAL B HG21 1 
ATOM   8064 H  HG22 . VAL B 1 222 ? -8.985  -24.588 11.101  1.00 63.85  ? 583 VAL B HG22 1 
ATOM   8065 H  HG23 . VAL B 1 222 ? -7.574  -25.170 11.541  1.00 63.85  ? 583 VAL B HG23 1 
ATOM   8066 N  N    . TRP B 1 223 ? -7.784  -24.918 6.429   1.00 42.58  ? 584 TRP B N    1 
ATOM   8067 C  CA   . TRP B 1 223 ? -7.205  -24.771 5.083   1.00 47.88  ? 584 TRP B CA   1 
ATOM   8068 C  C    . TRP B 1 223 ? -7.444  -23.392 4.490   1.00 41.41  ? 584 TRP B C    1 
ATOM   8069 O  O    . TRP B 1 223 ? -6.520  -22.772 3.967   1.00 44.10  ? 584 TRP B O    1 
ATOM   8070 C  CB   . TRP B 1 223 ? -7.771  -25.817 4.124   1.00 45.67  ? 584 TRP B CB   1 
ATOM   8071 C  CG   . TRP B 1 223 ? -7.343  -27.213 4.420   1.00 52.73  ? 584 TRP B CG   1 
ATOM   8072 C  CD1  . TRP B 1 223 ? -6.131  -27.766 4.158   1.00 43.58  ? 584 TRP B CD1  1 
ATOM   8073 C  CD2  . TRP B 1 223 ? -8.136  -28.243 5.014   1.00 49.16  ? 584 TRP B CD2  1 
ATOM   8074 N  NE1  . TRP B 1 223 ? -6.110  -29.079 4.561   1.00 46.50  ? 584 TRP B NE1  1 
ATOM   8075 C  CE2  . TRP B 1 223 ? -7.331  -29.397 5.091   1.00 55.94  ? 584 TRP B CE2  1 
ATOM   8076 C  CE3  . TRP B 1 223 ? -9.447  -28.302 5.498   1.00 49.57  ? 584 TRP B CE3  1 
ATOM   8077 C  CZ2  . TRP B 1 223 ? -7.788  -30.596 5.640   1.00 52.48  ? 584 TRP B CZ2  1 
ATOM   8078 C  CZ3  . TRP B 1 223 ? -9.904  -29.495 6.039   1.00 51.07  ? 584 TRP B CZ3  1 
ATOM   8079 C  CH2  . TRP B 1 223 ? -9.076  -30.626 6.102   1.00 59.95  ? 584 TRP B CH2  1 
ATOM   8080 H  H    . TRP B 1 223 ? -8.637  -24.814 6.458   1.00 51.10  ? 584 TRP B H    1 
ATOM   8081 H  HA   . TRP B 1 223 ? -6.247  -24.907 5.139   1.00 57.46  ? 584 TRP B HA   1 
ATOM   8082 H  HB2  . TRP B 1 223 ? -8.739  -25.789 4.170   1.00 54.80  ? 584 TRP B HB2  1 
ATOM   8083 H  HB3  . TRP B 1 223 ? -7.480  -25.603 3.224   1.00 54.80  ? 584 TRP B HB3  1 
ATOM   8084 H  HD1  . TRP B 1 223 ? -5.417  -27.320 3.763   1.00 52.30  ? 584 TRP B HD1  1 
ATOM   8085 H  HE1  . TRP B 1 223 ? -5.439  -29.613 4.493   1.00 55.80  ? 584 TRP B HE1  1 
ATOM   8086 H  HE3  . TRP B 1 223 ? -10.000 -27.555 5.462   1.00 59.48  ? 584 TRP B HE3  1 
ATOM   8087 H  HZ2  . TRP B 1 223 ? -7.243  -31.349 5.679   1.00 62.98  ? 584 TRP B HZ2  1 
ATOM   8088 H  HZ3  . TRP B 1 223 ? -10.774 -29.547 6.363   1.00 61.29  ? 584 TRP B HZ3  1 
ATOM   8089 H  HH2  . TRP B 1 223 ? -9.410  -31.413 6.467   1.00 71.95  ? 584 TRP B HH2  1 
ATOM   8090 N  N    . GLU B 1 224 ? -8.692  -22.935 4.561   1.00 41.79  ? 585 GLU B N    1 
ATOM   8091 C  CA   . GLU B 1 224 ? -9.110  -21.659 3.978   1.00 48.68  ? 585 GLU B CA   1 
ATOM   8092 C  C    . GLU B 1 224 ? -8.648  -21.541 2.531   1.00 44.48  ? 585 GLU B C    1 
ATOM   8093 O  O    . GLU B 1 224 ? -7.985  -20.577 2.147   1.00 42.24  ? 585 GLU B O    1 
ATOM   8094 C  CB   . GLU B 1 224 ? -8.580  -20.489 4.806   1.00 45.27  ? 585 GLU B CB   1 
ATOM   8095 C  CG   . GLU B 1 224 ? -9.059  -20.523 6.261   1.00 60.29  ? 585 GLU B CG   1 
ATOM   8096 C  CD   . GLU B 1 224 ? -8.527  -19.382 7.113   1.00 53.07  ? 585 GLU B CD   1 
ATOM   8097 O  OE1  . GLU B 1 224 ? -7.719  -18.566 6.616   1.00 69.41  ? 585 GLU B OE1  1 
ATOM   8098 O  OE2  . GLU B 1 224 ? -8.918  -19.308 8.300   1.00 71.58  ? 585 GLU B OE2  1 
ATOM   8099 H  H    . GLU B 1 224 ? -9.331  -23.356 4.953   1.00 50.15  ? 585 GLU B H    1 
ATOM   8100 H  HA   . GLU B 1 224 ? -10.079 -21.614 3.985   1.00 58.41  ? 585 GLU B HA   1 
ATOM   8101 H  HB2  . GLU B 1 224 ? -7.610  -20.518 4.809   1.00 54.32  ? 585 GLU B HB2  1 
ATOM   8102 H  HB3  . GLU B 1 224 ? -8.885  -19.658 4.410   1.00 54.32  ? 585 GLU B HB3  1 
ATOM   8103 H  HG2  . GLU B 1 224 ? -10.027 -20.474 6.272   1.00 72.35  ? 585 GLU B HG2  1 
ATOM   8104 H  HG3  . GLU B 1 224 ? -8.768  -21.355 6.665   1.00 72.35  ? 585 GLU B HG3  1 
ATOM   8105 N  N    . GLU B 1 225 ? -8.995  -22.548 1.739   1.00 37.34  ? 586 GLU B N    1 
ATOM   8106 C  CA   . GLU B 1 225 ? -8.656  -22.591 0.320   1.00 37.23  ? 586 GLU B CA   1 
ATOM   8107 C  C    . GLU B 1 225 ? -9.902  -22.560 -0.555  1.00 42.38  ? 586 GLU B C    1 
ATOM   8108 O  O    . GLU B 1 225 ? -10.959 -23.029 -0.144  1.00 33.00  ? 586 GLU B O    1 
ATOM   8109 C  CB   . GLU B 1 225 ? -7.851  -23.848 0.019   1.00 36.10  ? 586 GLU B CB   1 
ATOM   8110 C  CG   . GLU B 1 225 ? -6.408  -23.777 0.454   1.00 41.56  ? 586 GLU B CG   1 
ATOM   8111 C  CD   . GLU B 1 225 ? -5.678  -25.068 0.179   1.00 50.12  ? 586 GLU B CD   1 
ATOM   8112 O  OE1  . GLU B 1 225 ? -5.451  -25.374 -1.011  1.00 48.65  ? 586 GLU B OE1  1 
ATOM   8113 O  OE2  . GLU B 1 225 ? -5.344  -25.786 1.144   1.00 56.98  ? 586 GLU B OE2  1 
ATOM   8114 H  H    . GLU B 1 225 ? -9.438  -23.235 2.006   1.00 44.81  ? 586 GLU B H    1 
ATOM   8115 H  HA   . GLU B 1 225 ? -8.110  -21.820 0.099   1.00 44.68  ? 586 GLU B HA   1 
ATOM   8116 H  HB2  . GLU B 1 225 ? -8.261  -24.597 0.479   1.00 43.33  ? 586 GLU B HB2  1 
ATOM   8117 H  HB3  . GLU B 1 225 ? -7.864  -24.004 -0.938  1.00 43.33  ? 586 GLU B HB3  1 
ATOM   8118 H  HG2  . GLU B 1 225 ? -5.962  -23.067 -0.034  1.00 49.87  ? 586 GLU B HG2  1 
ATOM   8119 H  HG3  . GLU B 1 225 ? -6.369  -23.604 1.407   1.00 49.87  ? 586 GLU B HG3  1 
ATOM   8120 N  N    . ASN B 1 226 ? -9.760  -22.031 -1.771  1.00 41.05  ? 587 ASN B N    1 
ATOM   8121 C  CA   . ASN B 1 226 ? -10.873 -21.918 -2.703  1.00 37.13  ? 587 ASN B CA   1 
ATOM   8122 C  C    . ASN B 1 226 ? -10.611 -22.674 -4.010  1.00 36.90  ? 587 ASN B C    1 
ATOM   8123 O  O    . ASN B 1 226 ? -9.499  -22.674 -4.523  1.00 34.68  ? 587 ASN B O    1 
ATOM   8124 C  CB   . ASN B 1 226 ? -11.159 -20.446 -2.999  1.00 35.25  ? 587 ASN B CB   1 
ATOM   8125 C  CG   . ASN B 1 226 ? -12.558 -20.224 -3.530  1.00 50.75  ? 587 ASN B CG   1 
ATOM   8126 O  OD1  . ASN B 1 226 ? -13.534 -20.694 -2.946  1.00 48.77  ? 587 ASN B OD1  1 
ATOM   8127 N  ND2  . ASN B 1 226 ? -12.663 -19.514 -4.650  1.00 55.88  ? 587 ASN B ND2  1 
ATOM   8128 H  H    . ASN B 1 226 ? -9.018  -21.728 -2.080  1.00 49.26  ? 587 ASN B H    1 
ATOM   8129 H  HA   . ASN B 1 226 ? -11.666 -22.299 -2.293  1.00 44.56  ? 587 ASN B HA   1 
ATOM   8130 H  HB2  . ASN B 1 226 ? -11.064 -19.934 -2.180  1.00 42.30  ? 587 ASN B HB2  1 
ATOM   8131 H  HB3  . ASN B 1 226 ? -10.530 -20.128 -3.666  1.00 42.30  ? 587 ASN B HB3  1 
ATOM   8132 H  HD21 . ASN B 1 226 ? -13.438 -19.361 -4.991  1.00 67.06  ? 587 ASN B HD21 1 
ATOM   8133 H  HD22 . ASN B 1 226 ? -11.957 -19.208 -5.033  1.00 67.06  ? 587 ASN B HD22 1 
ATOM   8134 N  N    . PHE B 1 227 ? -11.646 -23.323 -4.529  1.00 35.45  ? 588 PHE B N    1 
ATOM   8135 C  CA   . PHE B 1 227 ? -11.538 -24.170 -5.710  1.00 33.60  ? 588 PHE B CA   1 
ATOM   8136 C  C    . PHE B 1 227 ? -12.707 -23.908 -6.639  1.00 43.96  ? 588 PHE B C    1 
ATOM   8137 O  O    . PHE B 1 227 ? -13.803 -23.570 -6.187  1.00 32.60  ? 588 PHE B O    1 
ATOM   8138 C  CB   . PHE B 1 227 ? -11.499 -25.652 -5.319  1.00 31.06  ? 588 PHE B CB   1 
ATOM   8139 C  CG   . PHE B 1 227 ? -10.463 -25.974 -4.285  1.00 51.40  ? 588 PHE B CG   1 
ATOM   8140 C  CD1  . PHE B 1 227 ? -10.783 -25.942 -2.937  1.00 39.74  ? 588 PHE B CD1  1 
ATOM   8141 C  CD2  . PHE B 1 227 ? -9.167  -26.299 -4.655  1.00 49.70  ? 588 PHE B CD2  1 
ATOM   8142 C  CE1  . PHE B 1 227 ? -9.832  -26.230 -1.978  1.00 45.88  ? 588 PHE B CE1  1 
ATOM   8143 C  CE2  . PHE B 1 227 ? -8.208  -26.591 -3.698  1.00 50.95  ? 588 PHE B CE2  1 
ATOM   8144 C  CZ   . PHE B 1 227 ? -8.545  -26.556 -2.356  1.00 51.60  ? 588 PHE B CZ   1 
ATOM   8145 H  H    . PHE B 1 227 ? -12.442 -23.288 -4.206  1.00 42.54  ? 588 PHE B H    1 
ATOM   8146 H  HA   . PHE B 1 227 ? -10.719 -23.958 -6.183  1.00 40.32  ? 588 PHE B HA   1 
ATOM   8147 H  HB2  . PHE B 1 227 ? -12.365 -25.904 -4.961  1.00 37.27  ? 588 PHE B HB2  1 
ATOM   8148 H  HB3  . PHE B 1 227 ? -11.304 -26.179 -6.110  1.00 37.27  ? 588 PHE B HB3  1 
ATOM   8149 H  HD1  . PHE B 1 227 ? -11.648 -25.723 -2.675  1.00 47.68  ? 588 PHE B HD1  1 
ATOM   8150 H  HD2  . PHE B 1 227 ? -8.938  -26.323 -5.556  1.00 59.64  ? 588 PHE B HD2  1 
ATOM   8151 H  HE1  . PHE B 1 227 ? -10.059 -26.208 -1.077  1.00 55.05  ? 588 PHE B HE1  1 
ATOM   8152 H  HE2  . PHE B 1 227 ? -7.342  -26.810 -3.957  1.00 61.14  ? 588 PHE B HE2  1 
ATOM   8153 H  HZ   . PHE B 1 227 ? -7.905  -26.752 -1.710  1.00 61.92  ? 588 PHE B HZ   1 
ATOM   8154 N  N    . THR B 1 228 ? -12.459 -24.064 -7.936  1.00 33.93  ? 589 THR B N    1 
ATOM   8155 C  CA   . THR B 1 228 ? -13.467 -23.839 -8.974  1.00 37.62  ? 589 THR B CA   1 
ATOM   8156 C  C    . THR B 1 228 ? -13.540 -25.051 -9.902  1.00 33.29  ? 589 THR B C    1 
ATOM   8157 O  O    . THR B 1 228 ? -12.508 -25.551 -10.360 1.00 30.61  ? 589 THR B O    1 
ATOM   8158 C  CB   . THR B 1 228 ? -13.152 -22.573 -9.798  1.00 51.27  ? 589 THR B CB   1 
ATOM   8159 O  OG1  . THR B 1 228 ? -13.108 -21.436 -8.929  1.00 39.68  ? 589 THR B OG1  1 
ATOM   8160 C  CG2  . THR B 1 228 ? -14.211 -22.335 -10.862 1.00 35.13  ? 589 THR B CG2  1 
ATOM   8161 H  H    . THR B 1 228 ? -11.695 -24.305 -8.250  1.00 40.72  ? 589 THR B H    1 
ATOM   8162 H  HA   . THR B 1 228 ? -14.335 -23.723 -8.556  1.00 45.14  ? 589 THR B HA   1 
ATOM   8163 H  HB   . THR B 1 228 ? -12.294 -22.678 -10.236 1.00 61.53  ? 589 THR B HB   1 
ATOM   8164 H  HG1  . THR B 1 228 ? -12.936 -20.743 -9.372  1.00 47.61  ? 589 THR B HG1  1 
ATOM   8165 H  HG21 . THR B 1 228 ? -13.997 -21.537 -11.369 1.00 42.15  ? 589 THR B HG21 1 
ATOM   8166 H  HG22 . THR B 1 228 ? -14.248 -23.093 -11.467 1.00 42.15  ? 589 THR B HG22 1 
ATOM   8167 H  HG23 . THR B 1 228 ? -15.079 -22.221 -10.446 1.00 42.15  ? 589 THR B HG23 1 
ATOM   8168 N  N    . PHE B 1 229 ? -14.758 -25.518 -10.163 1.00 34.26  ? 590 PHE B N    1 
ATOM   8169 C  CA   . PHE B 1 229 ? -14.994 -26.716 -10.969 1.00 37.36  ? 590 PHE B CA   1 
ATOM   8170 C  C    . PHE B 1 229 ? -15.959 -26.434 -12.104 1.00 45.17  ? 590 PHE B C    1 
ATOM   8171 O  O    . PHE B 1 229 ? -16.964 -25.742 -11.905 1.00 34.84  ? 590 PHE B O    1 
ATOM   8172 C  CB   . PHE B 1 229 ? -15.589 -27.848 -10.123 1.00 35.21  ? 590 PHE B CB   1 
ATOM   8173 C  CG   . PHE B 1 229 ? -14.664 -28.406 -9.074  1.00 39.85  ? 590 PHE B CG   1 
ATOM   8174 C  CD1  . PHE B 1 229 ? -14.657 -27.892 -7.789  1.00 40.79  ? 590 PHE B CD1  1 
ATOM   8175 C  CD2  . PHE B 1 229 ? -13.840 -29.481 -9.362  1.00 40.11  ? 590 PHE B CD2  1 
ATOM   8176 C  CE1  . PHE B 1 229 ? -13.821 -28.426 -6.816  1.00 35.09  ? 590 PHE B CE1  1 
ATOM   8177 C  CE2  . PHE B 1 229 ? -13.003 -30.016 -8.399  1.00 52.08  ? 590 PHE B CE2  1 
ATOM   8178 C  CZ   . PHE B 1 229 ? -12.992 -29.487 -7.126  1.00 43.10  ? 590 PHE B CZ   1 
ATOM   8179 H  H    . PHE B 1 229 ? -15.481 -25.151 -9.878  1.00 41.11  ? 590 PHE B H    1 
ATOM   8180 H  HA   . PHE B 1 229 ? -14.155 -27.022 -11.347 1.00 44.83  ? 590 PHE B HA   1 
ATOM   8181 H  HB2  . PHE B 1 229 ? -16.378 -27.513 -9.669  1.00 42.26  ? 590 PHE B HB2  1 
ATOM   8182 H  HB3  . PHE B 1 229 ? -15.838 -28.577 -10.712 1.00 42.26  ? 590 PHE B HB3  1 
ATOM   8183 H  HD1  . PHE B 1 229 ? -15.212 -27.176 -7.577  1.00 48.94  ? 590 PHE B HD1  1 
ATOM   8184 H  HD2  . PHE B 1 229 ? -13.841 -29.841 -10.220 1.00 48.13  ? 590 PHE B HD2  1 
ATOM   8185 H  HE1  . PHE B 1 229 ? -13.815 -28.065 -5.959  1.00 42.11  ? 590 PHE B HE1  1 
ATOM   8186 H  HE2  . PHE B 1 229 ? -12.448 -30.731 -8.610  1.00 62.49  ? 590 PHE B HE2  1 
ATOM   8187 H  HZ   . PHE B 1 229 ? -12.429 -29.845 -6.478  1.00 51.72  ? 590 PHE B HZ   1 
ATOM   8188 N  N    . PHE B 1 230 ? -15.675 -26.995 -13.280 1.00 36.04  ? 591 PHE B N    1 
ATOM   8189 C  CA   . PHE B 1 230 ? -16.653 -27.052 -14.366 1.00 38.49  ? 591 PHE B CA   1 
ATOM   8190 C  C    . PHE B 1 230 ? -17.686 -28.127 -14.051 1.00 42.04  ? 591 PHE B C    1 
ATOM   8191 O  O    . PHE B 1 230 ? -17.325 -29.241 -13.660 1.00 37.97  ? 591 PHE B O    1 
ATOM   8192 C  CB   . PHE B 1 230 ? -15.983 -27.361 -15.702 1.00 39.94  ? 591 PHE B CB   1 
ATOM   8193 C  CG   . PHE B 1 230 ? -15.244 -26.207 -16.293 1.00 46.73  ? 591 PHE B CG   1 
ATOM   8194 C  CD1  . PHE B 1 230 ? -15.915 -25.228 -17.004 1.00 44.24  ? 591 PHE B CD1  1 
ATOM   8195 C  CD2  . PHE B 1 230 ? -13.870 -26.109 -16.156 1.00 50.02  ? 591 PHE B CD2  1 
ATOM   8196 C  CE1  . PHE B 1 230 ? -15.225 -24.167 -17.561 1.00 46.96  ? 591 PHE B CE1  1 
ATOM   8197 C  CE2  . PHE B 1 230 ? -13.178 -25.052 -16.709 1.00 62.53  ? 591 PHE B CE2  1 
ATOM   8198 C  CZ   . PHE B 1 230 ? -13.855 -24.080 -17.414 1.00 60.90  ? 591 PHE B CZ   1 
ATOM   8199 H  H    . PHE B 1 230 ? -14.917 -27.352 -13.475 1.00 43.24  ? 591 PHE B H    1 
ATOM   8200 H  HA   . PHE B 1 230 ? -17.108 -26.198 -14.438 1.00 46.19  ? 591 PHE B HA   1 
ATOM   8201 H  HB2  . PHE B 1 230 ? -15.348 -28.083 -15.573 1.00 47.93  ? 591 PHE B HB2  1 
ATOM   8202 H  HB3  . PHE B 1 230 ? -16.664 -27.632 -16.337 1.00 47.93  ? 591 PHE B HB3  1 
ATOM   8203 H  HD1  . PHE B 1 230 ? -16.838 -25.284 -17.108 1.00 53.09  ? 591 PHE B HD1  1 
ATOM   8204 H  HD2  . PHE B 1 230 ? -13.408 -26.763 -15.683 1.00 60.02  ? 591 PHE B HD2  1 
ATOM   8205 H  HE1  . PHE B 1 230 ? -15.685 -23.512 -18.035 1.00 56.35  ? 591 PHE B HE1  1 
ATOM   8206 H  HE2  . PHE B 1 230 ? -12.255 -24.995 -16.607 1.00 75.03  ? 591 PHE B HE2  1 
ATOM   8207 H  HZ   . PHE B 1 230 ? -13.391 -23.365 -17.785 1.00 73.08  ? 591 PHE B HZ   1 
ATOM   8208 N  N    . ILE B 1 231 ? -18.962 -27.790 -14.212 1.00 47.87  ? 592 ILE B N    1 
ATOM   8209 C  CA   . ILE B 1 231 ? -20.049 -28.719 -13.934 1.00 40.47  ? 592 ILE B CA   1 
ATOM   8210 C  C    . ILE B 1 231 ? -20.824 -29.021 -15.210 1.00 39.79  ? 592 ILE B C    1 
ATOM   8211 O  O    . ILE B 1 231 ? -21.294 -28.107 -15.883 1.00 45.40  ? 592 ILE B O    1 
ATOM   8212 C  CB   . ILE B 1 231 ? -21.027 -28.156 -12.873 1.00 38.48  ? 592 ILE B CB   1 
ATOM   8213 C  CG1  . ILE B 1 231 ? -20.280 -27.769 -11.592 1.00 43.35  ? 592 ILE B CG1  1 
ATOM   8214 C  CG2  . ILE B 1 231 ? -22.121 -29.163 -12.565 1.00 42.72  ? 592 ILE B CG2  1 
ATOM   8215 C  CD1  . ILE B 1 231 ? -19.555 -28.918 -10.926 1.00 49.91  ? 592 ILE B CD1  1 
ATOM   8216 H  H    . ILE B 1 231 ? -19.226 -27.019 -14.485 1.00 57.45  ? 592 ILE B H    1 
ATOM   8217 H  HA   . ILE B 1 231 ? -19.680 -29.551 -13.597 1.00 48.57  ? 592 ILE B HA   1 
ATOM   8218 H  HB   . ILE B 1 231 ? -21.442 -27.358 -13.236 1.00 46.17  ? 592 ILE B HB   1 
ATOM   8219 H  HG12 . ILE B 1 231 ? -19.622 -27.090 -11.809 1.00 52.02  ? 592 ILE B HG12 1 
ATOM   8220 H  HG13 . ILE B 1 231 ? -20.919 -27.414 -10.955 1.00 52.02  ? 592 ILE B HG13 1 
ATOM   8221 H  HG21 . ILE B 1 231 ? -22.718 -28.785 -11.900 1.00 51.26  ? 592 ILE B HG21 1 
ATOM   8222 H  HG22 . ILE B 1 231 ? -22.612 -29.355 -13.380 1.00 51.26  ? 592 ILE B HG22 1 
ATOM   8223 H  HG23 . ILE B 1 231 ? -21.716 -29.975 -12.224 1.00 51.26  ? 592 ILE B HG23 1 
ATOM   8224 H  HD11 . ILE B 1 231 ? -19.111 -28.591 -10.128 1.00 59.89  ? 592 ILE B HD11 1 
ATOM   8225 H  HD12 . ILE B 1 231 ? -20.199 -29.603 -10.689 1.00 59.89  ? 592 ILE B HD12 1 
ATOM   8226 H  HD13 . ILE B 1 231 ? -18.900 -29.279 -11.544 1.00 59.89  ? 592 ILE B HD13 1 
ATOM   8227 N  N    . HIS B 1 232 ? -20.968 -30.304 -15.523 1.00 46.59  ? 593 HIS B N    1 
ATOM   8228 C  CA   . HIS B 1 232 ? -21.733 -30.721 -16.692 1.00 61.34  ? 593 HIS B CA   1 
ATOM   8229 C  C    . HIS B 1 232 ? -23.241 -30.592 -16.451 1.00 52.85  ? 593 HIS B C    1 
ATOM   8230 O  O    . HIS B 1 232 ? -23.942 -29.927 -17.216 1.00 52.51  ? 593 HIS B O    1 
ATOM   8231 C  CB   . HIS B 1 232 ? -21.383 -32.161 -17.074 1.00 56.93  ? 593 HIS B CB   1 
ATOM   8232 C  CG   . HIS B 1 232 ? -22.119 -32.659 -18.278 1.00 78.59  ? 593 HIS B CG   1 
ATOM   8233 N  ND1  . HIS B 1 232 ? -22.090 -32.006 -19.493 1.00 81.84  ? 593 HIS B ND1  1 
ATOM   8234 C  CD2  . HIS B 1 232 ? -22.911 -33.743 -18.453 1.00 78.54  ? 593 HIS B CD2  1 
ATOM   8235 C  CE1  . HIS B 1 232 ? -22.830 -32.668 -20.363 1.00 92.29  ? 593 HIS B CE1  1 
ATOM   8236 N  NE2  . HIS B 1 232 ? -23.339 -33.727 -19.758 1.00 89.26  ? 593 HIS B NE2  1 
ATOM   8237 H  H    . HIS B 1 232 ? -20.631 -30.955 -15.073 1.00 55.90  ? 593 HIS B H    1 
ATOM   8238 H  HA   . HIS B 1 232 ? -21.501 -30.149 -17.440 1.00 73.60  ? 593 HIS B HA   1 
ATOM   8239 H  HB2  . HIS B 1 232 ? -20.433 -32.212 -17.265 1.00 68.32  ? 593 HIS B HB2  1 
ATOM   8240 H  HB3  . HIS B 1 232 ? -21.601 -32.744 -16.330 1.00 68.32  ? 593 HIS B HB3  1 
ATOM   8241 H  HD1  . HIS B 1 232 ? -21.658 -31.282 -19.657 1.00 98.20  ? 593 HIS B HD1  1 
ATOM   8242 H  HD2  . HIS B 1 232 ? -23.124 -34.380 -17.810 1.00 94.25  ? 593 HIS B HD2  1 
ATOM   8243 H  HE1  . HIS B 1 232 ? -22.969 -32.431 -21.252 1.00 110.75 ? 593 HIS B HE1  1 
ATOM   8244 H  HE2  . HIS B 1 232 ? -23.855 -34.310 -20.122 1.00 107.11 ? 593 HIS B HE2  1 
ATOM   8245 N  N    . ASN B 1 233 ? -23.734 -31.229 -15.389 1.00 47.51  ? 594 ASN B N    1 
ATOM   8246 C  CA   . ASN B 1 233 ? -25.163 -31.217 -15.068 1.00 56.18  ? 594 ASN B CA   1 
ATOM   8247 C  C    . ASN B 1 233 ? -25.399 -31.223 -13.550 1.00 56.68  ? 594 ASN B C    1 
ATOM   8248 O  O    . ASN B 1 233 ? -25.245 -32.259 -12.905 1.00 61.91  ? 594 ASN B O    1 
ATOM   8249 C  CB   . ASN B 1 233 ? -25.865 -32.420 -15.713 1.00 61.45  ? 594 ASN B CB   1 
ATOM   8250 C  CG   . ASN B 1 233 ? -27.384 -32.317 -15.651 1.00 69.37  ? 594 ASN B CG   1 
ATOM   8251 O  OD1  . ASN B 1 233 ? -27.941 -31.679 -14.759 1.00 68.26  ? 594 ASN B OD1  1 
ATOM   8252 N  ND2  . ASN B 1 233 ? -28.060 -32.946 -16.606 1.00 62.96  ? 594 ASN B ND2  1 
ATOM   8253 H  H    . ASN B 1 233 ? -23.257 -31.680 -14.832 1.00 57.01  ? 594 ASN B H    1 
ATOM   8254 H  HA   . ASN B 1 233 ? -25.560 -30.410 -15.430 1.00 67.41  ? 594 ASN B HA   1 
ATOM   8255 H  HB2  . ASN B 1 233 ? -25.605 -32.474 -16.646 1.00 73.74  ? 594 ASN B HB2  1 
ATOM   8256 H  HB3  . ASN B 1 233 ? -25.599 -33.228 -15.247 1.00 73.74  ? 594 ASN B HB3  1 
ATOM   8257 H  HD21 . ASN B 1 233 ? -28.919 -32.918 -16.614 1.00 75.56  ? 594 ASN B HD21 1 
ATOM   8258 H  HD22 . ASN B 1 233 ? -27.638 -33.382 -17.215 1.00 75.56  ? 594 ASN B HD22 1 
ATOM   8259 N  N    . PRO B 1 234 ? -25.784 -30.067 -12.975 1.00 62.37  ? 595 PRO B N    1 
ATOM   8260 C  CA   . PRO B 1 234 ? -25.997 -29.982 -11.522 1.00 56.21  ? 595 PRO B CA   1 
ATOM   8261 C  C    . PRO B 1 234 ? -27.181 -30.818 -11.029 1.00 64.85  ? 595 PRO B C    1 
ATOM   8262 O  O    . PRO B 1 234 ? -27.231 -31.163 -9.846  1.00 59.51  ? 595 PRO B O    1 
ATOM   8263 C  CB   . PRO B 1 234 ? -26.273 -28.492 -11.275 1.00 64.32  ? 595 PRO B CB   1 
ATOM   8264 C  CG   . PRO B 1 234 ? -26.045 -27.793 -12.551 1.00 63.92  ? 595 PRO B CG   1 
ATOM   8265 C  CD   . PRO B 1 234 ? -26.059 -28.788 -13.653 1.00 49.00  ? 595 PRO B CD   1 
ATOM   8266 H  HA   . PRO B 1 234 ? -25.194 -30.245 -11.045 1.00 67.45  ? 595 PRO B HA   1 
ATOM   8267 H  HB2  . PRO B 1 234 ? -27.192 -28.379 -10.989 1.00 77.19  ? 595 PRO B HB2  1 
ATOM   8268 H  HB3  . PRO B 1 234 ? -25.665 -28.161 -10.596 1.00 77.19  ? 595 PRO B HB3  1 
ATOM   8269 H  HG2  . PRO B 1 234 ? -26.751 -27.141 -12.684 1.00 76.70  ? 595 PRO B HG2  1 
ATOM   8270 H  HG3  . PRO B 1 234 ? -25.184 -27.347 -12.517 1.00 76.70  ? 595 PRO B HG3  1 
ATOM   8271 H  HD2  . PRO B 1 234 ? -26.931 -28.812 -14.075 1.00 58.80  ? 595 PRO B HD2  1 
ATOM   8272 H  HD3  . PRO B 1 234 ? -25.359 -28.590 -14.295 1.00 58.80  ? 595 PRO B HD3  1 
ATOM   8273 N  N    . LYS B 1 235 ? -28.131 -31.116 -11.910 1.00 56.37  ? 596 LYS B N    1 
ATOM   8274 C  CA   . LYS B 1 235 ? -29.288 -31.925 -11.527 1.00 62.99  ? 596 LYS B CA   1 
ATOM   8275 C  C    . LYS B 1 235 ? -28.860 -33.334 -11.142 1.00 65.57  ? 596 LYS B C    1 
ATOM   8276 O  O    . LYS B 1 235 ? -29.514 -33.990 -10.333 1.00 77.14  ? 596 LYS B O    1 
ATOM   8277 C  CB   . LYS B 1 235 ? -30.311 -32.017 -12.664 1.00 62.03  ? 596 LYS B CB   1 
ATOM   8278 C  CG   . LYS B 1 235 ? -30.911 -30.704 -13.133 1.00 68.09  ? 596 LYS B CG   1 
ATOM   8279 C  CD   . LYS B 1 235 ? -31.990 -30.964 -14.192 1.00 76.53  ? 596 LYS B CD   1 
ATOM   8280 C  CE   . LYS B 1 235 ? -32.471 -29.682 -14.859 1.00 93.05  ? 596 LYS B CE   1 
ATOM   8281 N  NZ   . LYS B 1 235 ? -33.631 -29.900 -15.785 1.00 78.77  ? 596 LYS B NZ   1 
ATOM   8282 H  H    . LYS B 1 235 ? -28.130 -30.865 -12.733 1.00 67.65  ? 596 LYS B H    1 
ATOM   8283 H  HA   . LYS B 1 235 ? -29.722 -31.519 -10.760 1.00 75.58  ? 596 LYS B HA   1 
ATOM   8284 H  HB2  . LYS B 1 235 ? -29.879 -32.427 -13.429 1.00 74.44  ? 596 LYS B HB2  1 
ATOM   8285 H  HB3  . LYS B 1 235 ? -31.044 -32.580 -12.368 1.00 74.44  ? 596 LYS B HB3  1 
ATOM   8286 H  HG2  . LYS B 1 235 ? -31.321 -30.247 -12.381 1.00 81.71  ? 596 LYS B HG2  1 
ATOM   8287 H  HG3  . LYS B 1 235 ? -30.217 -30.153 -13.528 1.00 81.71  ? 596 LYS B HG3  1 
ATOM   8288 H  HD2  . LYS B 1 235 ? -31.625 -31.543 -14.880 1.00 91.83  ? 596 LYS B HD2  1 
ATOM   8289 H  HD3  . LYS B 1 235 ? -32.753 -31.389 -13.770 1.00 91.83  ? 596 LYS B HD3  1 
ATOM   8290 H  HE2  . LYS B 1 235 ? -32.750 -29.055 -14.173 1.00 111.66 ? 596 LYS B HE2  1 
ATOM   8291 H  HE3  . LYS B 1 235 ? -31.743 -29.304 -15.377 1.00 111.66 ? 596 LYS B HE3  1 
ATOM   8292 H  HZ1  . LYS B 1 235 ? -33.878 -29.128 -16.151 1.00 94.52  ? 596 LYS B HZ1  1 
ATOM   8293 H  HZ2  . LYS B 1 235 ? -33.401 -30.467 -16.432 1.00 94.52  ? 596 LYS B HZ2  1 
ATOM   8294 H  HZ3  . LYS B 1 235 ? -34.320 -30.240 -15.335 1.00 94.52  ? 596 LYS B HZ3  1 
ATOM   8295 N  N    . ARG B 1 236 ? -27.752 -33.786 -11.723 1.00 67.40  ? 597 ARG B N    1 
ATOM   8296 C  CA   . ARG B 1 236 ? -27.411 -35.204 -11.717 1.00 83.53  ? 597 ARG B CA   1 
ATOM   8297 C  C    . ARG B 1 236 ? -26.046 -35.512 -11.098 1.00 81.11  ? 597 ARG B C    1 
ATOM   8298 O  O    . ARG B 1 236 ? -25.785 -36.652 -10.714 1.00 85.74  ? 597 ARG B O    1 
ATOM   8299 C  CB   . ARG B 1 236 ? -27.476 -35.733 -13.154 1.00 82.67  ? 597 ARG B CB   1 
ATOM   8300 C  CG   . ARG B 1 236 ? -28.878 -35.637 -13.752 1.00 110.68 ? 597 ARG B CG   1 
ATOM   8301 C  CD   . ARG B 1 236 ? -28.898 -35.849 -15.256 1.00 122.58 ? 597 ARG B CD   1 
ATOM   8302 N  NE   . ARG B 1 236 ? -28.501 -37.199 -15.645 1.00 129.31 ? 597 ARG B NE   1 
ATOM   8303 C  CZ   . ARG B 1 236 ? -28.773 -37.747 -16.826 1.00 132.92 ? 597 ARG B CZ   1 
ATOM   8304 N  NH1  . ARG B 1 236 ? -29.455 -37.071 -17.743 1.00 126.06 ? 597 ARG B NH1  1 
ATOM   8305 N  NH2  . ARG B 1 236 ? -28.368 -38.981 -17.091 1.00 139.38 ? 597 ARG B NH2  1 
ATOM   8306 H  H    . ARG B 1 236 ? -27.179 -33.290 -12.128 1.00 80.87  ? 597 ARG B H    1 
ATOM   8307 H  HA   . ARG B 1 236 ? -28.080 -35.679 -11.199 1.00 100.24 ? 597 ARG B HA   1 
ATOM   8308 H  HB2  . ARG B 1 236 ? -26.876 -35.213 -13.711 1.00 99.20  ? 597 ARG B HB2  1 
ATOM   8309 H  HB3  . ARG B 1 236 ? -27.210 -36.666 -13.160 1.00 99.20  ? 597 ARG B HB3  1 
ATOM   8310 H  HG2  . ARG B 1 236 ? -29.441 -36.316 -13.347 1.00 132.82 ? 597 ARG B HG2  1 
ATOM   8311 H  HG3  . ARG B 1 236 ? -29.239 -34.756 -13.570 1.00 132.82 ? 597 ARG B HG3  1 
ATOM   8312 H  HD2  . ARG B 1 236 ? -29.797 -35.695 -15.584 1.00 147.09 ? 597 ARG B HD2  1 
ATOM   8313 H  HD3  . ARG B 1 236 ? -28.282 -35.225 -15.670 1.00 147.09 ? 597 ARG B HD3  1 
ATOM   8314 H  HE   . ARG B 1 236 ? -28.064 -37.670 -15.074 1.00 155.18 ? 597 ARG B HE   1 
ATOM   8315 H  HH11 . ARG B 1 236 ? -29.720 -36.270 -17.577 1.00 151.27 ? 597 ARG B HH11 1 
ATOM   8316 H  HH12 . ARG B 1 236 ? -29.629 -37.432 -18.503 1.00 151.27 ? 597 ARG B HH12 1 
ATOM   8317 H  HH21 . ARG B 1 236 ? -27.928 -39.425 -16.501 1.00 167.26 ? 597 ARG B HH21 1 
ATOM   8318 H  HH22 . ARG B 1 236 ? -28.546 -39.338 -17.853 1.00 167.26 ? 597 ARG B HH22 1 
ATOM   8319 N  N    . GLN B 1 237 ? -25.188 -34.502 -10.981 1.00 69.50  ? 598 GLN B N    1 
ATOM   8320 C  CA   . GLN B 1 237 ? -23.839 -34.711 -10.460 1.00 67.20  ? 598 GLN B CA   1 
ATOM   8321 C  C    . GLN B 1 237 ? -23.736 -34.451 -8.961  1.00 58.24  ? 598 GLN B C    1 
ATOM   8322 O  O    . GLN B 1 237 ? -24.524 -33.694 -8.390  1.00 59.81  ? 598 GLN B O    1 
ATOM   8323 C  CB   . GLN B 1 237 ? -22.840 -33.821 -11.198 1.00 61.43  ? 598 GLN B CB   1 
ATOM   8324 C  CG   . GLN B 1 237 ? -22.645 -34.192 -12.653 1.00 50.59  ? 598 GLN B CG   1 
ATOM   8325 C  CD   . GLN B 1 237 ? -21.502 -33.434 -13.286 1.00 49.28  ? 598 GLN B CD   1 
ATOM   8326 O  OE1  . GLN B 1 237 ? -21.696 -32.368 -13.871 1.00 62.05  ? 598 GLN B OE1  1 
ATOM   8327 N  NE2  . GLN B 1 237 ? -20.296 -33.979 -13.169 1.00 62.16  ? 598 GLN B NE2  1 
ATOM   8328 H  H    . GLN B 1 237 ? -25.361 -33.688 -11.195 1.00 83.40  ? 598 GLN B H    1 
ATOM   8329 H  HA   . GLN B 1 237 ? -23.584 -35.634 -10.618 1.00 80.65  ? 598 GLN B HA   1 
ATOM   8330 H  HB2  . GLN B 1 237 ? -23.156 -32.904 -11.165 1.00 73.71  ? 598 GLN B HB2  1 
ATOM   8331 H  HB3  . GLN B 1 237 ? -21.978 -33.887 -10.757 1.00 73.71  ? 598 GLN B HB3  1 
ATOM   8332 H  HG2  . GLN B 1 237 ? -22.450 -35.140 -12.717 1.00 60.70  ? 598 GLN B HG2  1 
ATOM   8333 H  HG3  . GLN B 1 237 ? -23.454 -33.984 -13.146 1.00 60.70  ? 598 GLN B HG3  1 
ATOM   8334 H  HE21 . GLN B 1 237 ? -20.200 -34.724 -12.750 1.00 74.59  ? 598 GLN B HE21 1 
ATOM   8335 H  HE22 . GLN B 1 237 ? -19.612 -33.588 -13.512 1.00 74.59  ? 598 GLN B HE22 1 
ATOM   8336 N  N    . ASP B 1 238 ? -22.749 -35.092 -8.340  1.00 57.24  ? 599 ASP B N    1 
ATOM   8337 C  CA   . ASP B 1 238 ? -22.475 -34.934 -6.919  1.00 60.54  ? 599 ASP B CA   1 
ATOM   8338 C  C    . ASP B 1 238 ? -21.079 -34.370 -6.708  1.00 60.64  ? 599 ASP B C    1 
ATOM   8339 O  O    . ASP B 1 238 ? -20.138 -34.762 -7.395  1.00 54.82  ? 599 ASP B O    1 
ATOM   8340 C  CB   . ASP B 1 238 ? -22.596 -36.277 -6.193  1.00 76.20  ? 599 ASP B CB   1 
ATOM   8341 C  CG   . ASP B 1 238 ? -23.941 -36.940 -6.405  1.00 88.78  ? 599 ASP B CG   1 
ATOM   8342 O  OD1  . ASP B 1 238 ? -24.966 -36.231 -6.370  1.00 92.42  ? 599 ASP B OD1  1 
ATOM   8343 O  OD2  . ASP B 1 238 ? -23.973 -38.172 -6.610  1.00 92.08  ? 599 ASP B OD2  1 
ATOM   8344 H  H    . ASP B 1 238 ? -22.212 -35.636 -8.733  1.00 68.69  ? 599 ASP B H    1 
ATOM   8345 H  HA   . ASP B 1 238 ? -23.117 -34.318 -6.533  1.00 72.65  ? 599 ASP B HA   1 
ATOM   8346 H  HB2  . ASP B 1 238 ? -21.910 -36.878 -6.523  1.00 91.44  ? 599 ASP B HB2  1 
ATOM   8347 H  HB3  . ASP B 1 238 ? -22.480 -36.133 -5.240  1.00 91.44  ? 599 ASP B HB3  1 
ATOM   8348 N  N    . LEU B 1 239 ? -20.949 -33.441 -5.766  1.00 53.13  ? 600 LEU B N    1 
ATOM   8349 C  CA   . LEU B 1 239 ? -19.639 -33.061 -5.258  1.00 51.88  ? 600 LEU B CA   1 
ATOM   8350 C  C    . LEU B 1 239 ? -19.175 -34.141 -4.290  1.00 61.19  ? 600 LEU B C    1 
ATOM   8351 O  O    . LEU B 1 239 ? -19.758 -34.314 -3.215  1.00 60.97  ? 600 LEU B O    1 
ATOM   8352 C  CB   . LEU B 1 239 ? -19.679 -31.696 -4.563  1.00 50.59  ? 600 LEU B CB   1 
ATOM   8353 C  CG   . LEU B 1 239 ? -18.446 -31.360 -3.716  1.00 43.98  ? 600 LEU B CG   1 
ATOM   8354 C  CD1  . LEU B 1 239 ? -17.198 -31.258 -4.571  1.00 46.11  ? 600 LEU B CD1  1 
ATOM   8355 C  CD2  . LEU B 1 239 ? -18.660 -30.081 -2.929  1.00 59.13  ? 600 LEU B CD2  1 
ATOM   8356 H  H    . LEU B 1 239 ? -21.604 -33.018 -5.406  1.00 63.76  ? 600 LEU B H    1 
ATOM   8357 H  HA   . LEU B 1 239 ? -19.008 -33.013 -5.993  1.00 62.26  ? 600 LEU B HA   1 
ATOM   8358 H  HB2  . LEU B 1 239 ? -19.764 -31.008 -5.241  1.00 60.71  ? 600 LEU B HB2  1 
ATOM   8359 H  HB3  . LEU B 1 239 ? -20.451 -31.672 -3.977  1.00 60.71  ? 600 LEU B HB3  1 
ATOM   8360 H  HG   . LEU B 1 239 ? -18.305 -32.077 -3.077  1.00 52.78  ? 600 LEU B HG   1 
ATOM   8361 H  HD11 . LEU B 1 239 ? -16.442 -31.045 -4.002  1.00 55.33  ? 600 LEU B HD11 1 
ATOM   8362 H  HD12 . LEU B 1 239 ? -17.050 -32.107 -5.015  1.00 55.33  ? 600 LEU B HD12 1 
ATOM   8363 H  HD13 . LEU B 1 239 ? -17.325 -30.557 -5.230  1.00 55.33  ? 600 LEU B HD13 1 
ATOM   8364 H  HD21 . LEU B 1 239 ? -17.865 -29.896 -2.405  1.00 70.95  ? 600 LEU B HD21 1 
ATOM   8365 H  HD22 . LEU B 1 239 ? -18.825 -29.353 -3.548  1.00 70.95  ? 600 LEU B HD22 1 
ATOM   8366 H  HD23 . LEU B 1 239 ? -19.424 -30.196 -2.342  1.00 70.95  ? 600 LEU B HD23 1 
ATOM   8367 N  N    . GLU B 1 240 ? -18.133 -34.867 -4.684  1.00 52.92  ? 601 GLU B N    1 
ATOM   8368 C  CA   . GLU B 1 240 ? -17.603 -35.952 -3.875  1.00 73.41  ? 601 GLU B CA   1 
ATOM   8369 C  C    . GLU B 1 240 ? -16.332 -35.492 -3.186  1.00 63.17  ? 601 GLU B C    1 
ATOM   8370 O  O    . GLU B 1 240 ? -15.368 -35.085 -3.832  1.00 65.06  ? 601 GLU B O    1 
ATOM   8371 C  CB   . GLU B 1 240 ? -17.343 -37.193 -4.731  1.00 68.84  ? 601 GLU B CB   1 
ATOM   8372 C  CG   . GLU B 1 240 ? -18.543 -37.591 -5.591  1.00 96.22  ? 601 GLU B CG   1 
ATOM   8373 C  CD   . GLU B 1 240 ? -18.735 -39.094 -5.716  1.00 112.13 ? 601 GLU B CD   1 
ATOM   8374 O  OE1  . GLU B 1 240 ? -18.501 -39.822 -4.727  1.00 123.56 ? 601 GLU B OE1  1 
ATOM   8375 O  OE2  . GLU B 1 240 ? -19.134 -39.547 -6.809  1.00 113.84 ? 601 GLU B OE2  1 
ATOM   8376 H  H    . GLU B 1 240 ? -17.713 -34.748 -5.425  1.00 63.50  ? 601 GLU B H    1 
ATOM   8377 H  HA   . GLU B 1 240 ? -18.250 -36.186 -3.192  1.00 88.10  ? 601 GLU B HA   1 
ATOM   8378 H  HB2  . GLU B 1 240 ? -16.596 -37.016 -5.324  1.00 82.61  ? 601 GLU B HB2  1 
ATOM   8379 H  HB3  . GLU B 1 240 ? -17.133 -37.940 -4.148  1.00 82.61  ? 601 GLU B HB3  1 
ATOM   8380 H  HG2  . GLU B 1 240 ? -19.347 -37.220 -5.196  1.00 115.46 ? 601 GLU B HG2  1 
ATOM   8381 H  HG3  . GLU B 1 240 ? -18.420 -37.232 -6.484  1.00 115.46 ? 601 GLU B HG3  1 
ATOM   8382 N  N    . VAL B 1 241 ? -16.359 -35.549 -1.861  1.00 62.22  ? 602 VAL B N    1 
ATOM   8383 C  CA   . VAL B 1 241 ? -15.264 -35.087 -1.029  1.00 58.91  ? 602 VAL B CA   1 
ATOM   8384 C  C    . VAL B 1 241 ? -14.713 -36.249 -0.223  1.00 60.12  ? 602 VAL B C    1 
ATOM   8385 O  O    . VAL B 1 241 ? -15.468 -36.962 0.431   1.00 66.42  ? 602 VAL B O    1 
ATOM   8386 C  CB   . VAL B 1 241 ? -15.721 -33.983 -0.067  1.00 50.34  ? 602 VAL B CB   1 
ATOM   8387 C  CG1  . VAL B 1 241 ? -14.527 -33.411 0.688   1.00 60.48  ? 602 VAL B CG1  1 
ATOM   8388 C  CG2  . VAL B 1 241 ? -16.477 -32.892 -0.831  1.00 52.92  ? 602 VAL B CG2  1 
ATOM   8389 H  H    . VAL B 1 241 ? -17.023 -35.860 -1.411  1.00 74.66  ? 602 VAL B H    1 
ATOM   8390 H  HA   . VAL B 1 241 ? -14.555 -34.736 -1.589  1.00 70.70  ? 602 VAL B HA   1 
ATOM   8391 H  HB   . VAL B 1 241 ? -16.330 -34.366 0.584   1.00 60.40  ? 602 VAL B HB   1 
ATOM   8392 H  HG11 . VAL B 1 241 ? -14.838 -32.716 1.289   1.00 72.57  ? 602 VAL B HG11 1 
ATOM   8393 H  HG12 . VAL B 1 241 ? -14.105 -34.122 1.195   1.00 72.57  ? 602 VAL B HG12 1 
ATOM   8394 H  HG13 . VAL B 1 241 ? -13.898 -33.040 0.050   1.00 72.57  ? 602 VAL B HG13 1 
ATOM   8395 H  HG21 . VAL B 1 241 ? -16.756 -32.205 -0.206  1.00 63.50  ? 602 VAL B HG21 1 
ATOM   8396 H  HG22 . VAL B 1 241 ? -15.888 -32.510 -1.501  1.00 63.50  ? 602 VAL B HG22 1 
ATOM   8397 H  HG23 . VAL B 1 241 ? -17.253 -33.286 -1.258  1.00 63.50  ? 602 VAL B HG23 1 
ATOM   8398 N  N    . GLU B 1 242 ? -13.400 -36.439 -0.277  1.00 76.22  ? 603 GLU B N    1 
ATOM   8399 C  CA   . GLU B 1 242 ? -12.754 -37.458 0.533   1.00 79.98  ? 603 GLU B CA   1 
ATOM   8400 C  C    . GLU B 1 242 ? -11.569 -36.864 1.275   1.00 81.97  ? 603 GLU B C    1 
ATOM   8401 O  O    . GLU B 1 242 ? -10.636 -36.341 0.667   1.00 71.11  ? 603 GLU B O    1 
ATOM   8402 C  CB   . GLU B 1 242 ? -12.295 -38.640 -0.323  1.00 80.00  ? 603 GLU B CB   1 
ATOM   8403 C  CG   . GLU B 1 242 ? -11.872 -39.846 0.516   1.00 121.93 ? 603 GLU B CG   1 
ATOM   8404 C  CD   . GLU B 1 242 ? -11.149 -40.912 -0.283  1.00 126.92 ? 603 GLU B CD   1 
ATOM   8405 O  OE1  . GLU B 1 242 ? -11.078 -40.786 -1.526  1.00 113.33 ? 603 GLU B OE1  1 
ATOM   8406 O  OE2  . GLU B 1 242 ? -10.649 -41.876 0.341   1.00 111.26 ? 603 GLU B OE2  1 
ATOM   8407 H  H    . GLU B 1 242 ? -12.862 -35.990 -0.776  1.00 91.47  ? 603 GLU B H    1 
ATOM   8408 H  HA   . GLU B 1 242 ? -13.386 -37.789 1.189   1.00 95.98  ? 603 GLU B HA   1 
ATOM   8409 H  HB2  . GLU B 1 242 ? -13.024 -38.916 -0.899  1.00 96.00  ? 603 GLU B HB2  1 
ATOM   8410 H  HB3  . GLU B 1 242 ? -11.534 -38.366 -0.859  1.00 96.00  ? 603 GLU B HB3  1 
ATOM   8411 H  HG2  . GLU B 1 242 ? -11.276 -39.546 1.220   1.00 146.31 ? 603 GLU B HG2  1 
ATOM   8412 H  HG3  . GLU B 1 242 ? -12.663 -40.251 0.905   1.00 146.31 ? 603 GLU B HG3  1 
ATOM   8413 N  N    . VAL B 1 243 ? -11.627 -36.941 2.600   1.00 69.27  ? 604 VAL B N    1 
ATOM   8414 C  CA   . VAL B 1 243 ? -10.510 -36.557 3.448   1.00 57.38  ? 604 VAL B CA   1 
ATOM   8415 C  C    . VAL B 1 243 ? -9.591  -37.755 3.622   1.00 75.97  ? 604 VAL B C    1 
ATOM   8416 O  O    . VAL B 1 243 ? -10.054 -38.877 3.848   1.00 75.28  ? 604 VAL B O    1 
ATOM   8417 C  CB   . VAL B 1 243 ? -10.974 -36.074 4.830   1.00 68.34  ? 604 VAL B CB   1 
ATOM   8418 C  CG1  . VAL B 1 243 ? -9.809  -35.472 5.598   1.00 64.21  ? 604 VAL B CG1  1 
ATOM   8419 C  CG2  . VAL B 1 243 ? -12.103 -35.067 4.691   1.00 55.25  ? 604 VAL B CG2  1 
ATOM   8420 H  H    . VAL B 1 243 ? -12.315 -37.217 3.037   1.00 83.12  ? 604 VAL B H    1 
ATOM   8421 H  HA   . VAL B 1 243 ? -10.010 -35.843 3.023   1.00 68.86  ? 604 VAL B HA   1 
ATOM   8422 H  HB   . VAL B 1 243 ? -11.308 -36.831 5.335   1.00 82.01  ? 604 VAL B HB   1 
ATOM   8423 H  HG11 . VAL B 1 243 ? -10.123 -35.173 6.465   1.00 77.06  ? 604 VAL B HG11 1 
ATOM   8424 H  HG12 . VAL B 1 243 ? -9.122  -36.147 5.709   1.00 77.06  ? 604 VAL B HG12 1 
ATOM   8425 H  HG13 . VAL B 1 243 ? -9.455  -34.720 5.097   1.00 77.06  ? 604 VAL B HG13 1 
ATOM   8426 H  HG21 . VAL B 1 243 ? -12.378 -34.777 5.575   1.00 66.30  ? 604 VAL B HG21 1 
ATOM   8427 H  HG22 . VAL B 1 243 ? -11.787 -34.307 4.177   1.00 66.30  ? 604 VAL B HG22 1 
ATOM   8428 H  HG23 . VAL B 1 243 ? -12.848 -35.489 4.234   1.00 66.30  ? 604 VAL B HG23 1 
ATOM   8429 N  N    . ARG B 1 244 ? -8.290  -37.507 3.527   1.00 62.56  ? 605 ARG B N    1 
ATOM   8430 C  CA   . ARG B 1 244 ? -7.298  -38.566 3.635   1.00 83.85  ? 605 ARG B CA   1 
ATOM   8431 C  C    . ARG B 1 244 ? -6.183  -38.187 4.603   1.00 76.97  ? 605 ARG B C    1 
ATOM   8432 O  O    . ARG B 1 244 ? -5.928  -37.005 4.842   1.00 73.54  ? 605 ARG B O    1 
ATOM   8433 C  CB   . ARG B 1 244 ? -6.713  -38.883 2.256   1.00 89.51  ? 605 ARG B CB   1 
ATOM   8434 C  CG   . ARG B 1 244 ? -7.690  -39.606 1.333   1.00 92.48  ? 605 ARG B CG   1 
ATOM   8435 C  CD   . ARG B 1 244 ? -7.011  -40.684 0.496   1.00 111.16 ? 605 ARG B CD   1 
ATOM   8436 N  NE   . ARG B 1 244 ? -7.753  -41.945 0.535   1.00 119.13 ? 605 ARG B NE   1 
ATOM   8437 C  CZ   . ARG B 1 244 ? -7.208  -43.151 0.693   1.00 118.11 ? 605 ARG B CZ   1 
ATOM   8438 N  NH1  . ARG B 1 244 ? -5.895  -43.298 0.830   1.00 110.98 ? 605 ARG B NH1  1 
ATOM   8439 N  NH2  . ARG B 1 244 ? -7.986  -44.223 0.715   1.00 131.60 ? 605 ARG B NH2  1 
ATOM   8440 H  H    . ARG B 1 244 ? -7.954  -36.726 3.398   1.00 75.08  ? 605 ARG B H    1 
ATOM   8441 H  HA   . ARG B 1 244 ? -7.727  -39.368 3.971   1.00 100.62 ? 605 ARG B HA   1 
ATOM   8442 H  HB2  . ARG B 1 244 ? -6.456  -38.052 1.826   1.00 107.41 ? 605 ARG B HB2  1 
ATOM   8443 H  HB3  . ARG B 1 244 ? -5.935  -39.450 2.369   1.00 107.41 ? 605 ARG B HB3  1 
ATOM   8444 H  HG2  . ARG B 1 244 ? -8.378  -40.029 1.868   1.00 110.97 ? 605 ARG B HG2  1 
ATOM   8445 H  HG3  . ARG B 1 244 ? -8.089  -38.961 0.727   1.00 110.97 ? 605 ARG B HG3  1 
ATOM   8446 H  HD2  . ARG B 1 244 ? -6.963  -40.389 -0.427  1.00 133.39 ? 605 ARG B HD2  1 
ATOM   8447 H  HD3  . ARG B 1 244 ? -6.120  -40.845 0.844   1.00 133.39 ? 605 ARG B HD3  1 
ATOM   8448 H  HE   . ARG B 1 244 ? -8.608  -41.905 0.450   1.00 142.95 ? 605 ARG B HE   1 
ATOM   8449 H  HH11 . ARG B 1 244 ? -5.381  -42.608 0.818   1.00 133.18 ? 605 ARG B HH11 1 
ATOM   8450 H  HH12 . ARG B 1 244 ? -5.558  -44.082 0.931   1.00 133.18 ? 605 ARG B HH12 1 
ATOM   8451 H  HH21 . ARG B 1 244 ? -8.837  -44.139 0.627   1.00 157.92 ? 605 ARG B HH21 1 
ATOM   8452 H  HH22 . ARG B 1 244 ? -7.640  -45.004 0.815   1.00 157.92 ? 605 ARG B HH22 1 
ATOM   8453 N  N    . ASP B 1 245 ? -5.530  -39.203 5.158   1.00 73.87  ? 606 ASP B N    1 
ATOM   8454 C  CA   . ASP B 1 245 ? -4.369  -39.006 6.021   1.00 71.08  ? 606 ASP B CA   1 
ATOM   8455 C  C    . ASP B 1 245 ? -3.084  -39.241 5.240   1.00 71.16  ? 606 ASP B C    1 
ATOM   8456 O  O    . ASP B 1 245 ? -2.706  -40.384 4.998   1.00 92.32  ? 606 ASP B O    1 
ATOM   8457 C  CB   . ASP B 1 245 ? -4.426  -39.950 7.220   1.00 86.04  ? 606 ASP B CB   1 
ATOM   8458 C  CG   . ASP B 1 245 ? -3.193  -39.856 8.093   1.00 108.07 ? 606 ASP B CG   1 
ATOM   8459 O  OD1  . ASP B 1 245 ? -2.616  -38.754 8.193   1.00 115.13 ? 606 ASP B OD1  1 
ATOM   8460 O  OD2  . ASP B 1 245 ? -2.797  -40.885 8.678   1.00 119.34 ? 606 ASP B OD2  1 
ATOM   8461 H  H    . ASP B 1 245 ? -5.743  -40.029 5.049   1.00 88.65  ? 606 ASP B H    1 
ATOM   8462 H  HA   . ASP B 1 245 ? -4.364  -38.094 6.350   1.00 85.30  ? 606 ASP B HA   1 
ATOM   8463 H  HB2  . ASP B 1 245 ? -5.197  -39.725 7.764   1.00 103.25 ? 606 ASP B HB2  1 
ATOM   8464 H  HB3  . ASP B 1 245 ? -4.499  -40.864 6.901   1.00 103.25 ? 606 ASP B HB3  1 
ATOM   8465 N  N    . GLU B 1 246 ? -2.406  -38.165 4.855   1.00 79.80  ? 607 GLU B N    1 
ATOM   8466 C  CA   . GLU B 1 246 ? -1.209  -38.285 4.029   1.00 79.63  ? 607 GLU B CA   1 
ATOM   8467 C  C    . GLU B 1 246 ? -0.093  -39.028 4.764   1.00 77.21  ? 607 GLU B C    1 
ATOM   8468 O  O    . GLU B 1 246 ? 0.766   -39.645 4.138   1.00 97.05  ? 607 GLU B O    1 
ATOM   8469 C  CB   . GLU B 1 246 ? -0.715  -36.906 3.590   1.00 72.85  ? 607 GLU B CB   1 
ATOM   8470 C  CG   . GLU B 1 246 ? 0.414   -36.959 2.565   1.00 102.32 ? 607 GLU B CG   1 
ATOM   8471 C  CD   . GLU B 1 246 ? 0.010   -37.676 1.288   1.00 119.43 ? 607 GLU B CD   1 
ATOM   8472 O  OE1  . GLU B 1 246 ? -1.189  -37.632 0.933   1.00 104.21 ? 607 GLU B OE1  1 
ATOM   8473 O  OE2  . GLU B 1 246 ? 0.890   -38.288 0.643   1.00 121.86 ? 607 GLU B OE2  1 
ATOM   8474 H  H    . GLU B 1 246 ? -2.617  -37.356 5.058   1.00 95.76  ? 607 GLU B H    1 
ATOM   8475 H  HA   . GLU B 1 246 ? -1.428  -38.791 3.231   1.00 95.56  ? 607 GLU B HA   1 
ATOM   8476 H  HB2  . GLU B 1 246 ? -1.454  -36.419 3.193   1.00 87.42  ? 607 GLU B HB2  1 
ATOM   8477 H  HB3  . GLU B 1 246 ? -0.387  -36.428 4.368   1.00 87.42  ? 607 GLU B HB3  1 
ATOM   8478 H  HG2  . GLU B 1 246 ? 0.673   -36.054 2.332   1.00 122.78 ? 607 GLU B HG2  1 
ATOM   8479 H  HG3  . GLU B 1 246 ? 1.168   -37.432 2.949   1.00 122.78 ? 607 GLU B HG3  1 
ATOM   8480 N  N    . GLN B 1 247 ? -0.110  -38.961 6.090   1.00 90.24  ? 608 GLN B N    1 
ATOM   8481 C  CA   . GLN B 1 247 ? 0.870   -39.668 6.908   1.00 105.41 ? 608 GLN B CA   1 
ATOM   8482 C  C    . GLN B 1 247 ? 0.769   -41.176 6.699   1.00 101.36 ? 608 GLN B C    1 
ATOM   8483 O  O    . GLN B 1 247 ? 1.702   -41.811 6.207   1.00 98.69  ? 608 GLN B O    1 
ATOM   8484 C  CB   . GLN B 1 247 ? 0.670   -39.334 8.389   1.00 104.28 ? 608 GLN B CB   1 
ATOM   8485 C  CG   . GLN B 1 247 ? 1.686   -39.974 9.330   1.00 110.00 ? 608 GLN B CG   1 
ATOM   8486 C  CD   . GLN B 1 247 ? 3.028   -39.271 9.307   1.00 113.21 ? 608 GLN B CD   1 
ATOM   8487 O  OE1  . GLN B 1 247 ? 3.277   -38.365 10.102  1.00 116.66 ? 608 GLN B OE1  1 
ATOM   8488 N  NE2  . GLN B 1 247 ? 3.901   -39.684 8.396   1.00 117.33 ? 608 GLN B NE2  1 
ATOM   8489 H  H    . GLN B 1 247 ? -0.683  -38.509 6.545   1.00 108.29 ? 608 GLN B H    1 
ATOM   8490 H  HA   . GLN B 1 247 ? 1.762   -39.386 6.652   1.00 126.50 ? 608 GLN B HA   1 
ATOM   8491 H  HB2  . GLN B 1 247 ? 0.732   -38.373 8.500   1.00 125.13 ? 608 GLN B HB2  1 
ATOM   8492 H  HB3  . GLN B 1 247 ? -0.211  -39.638 8.659   1.00 125.13 ? 608 GLN B HB3  1 
ATOM   8493 H  HG2  . GLN B 1 247 ? 1.343   -39.938 10.236  1.00 132.00 ? 608 GLN B HG2  1 
ATOM   8494 H  HG3  . GLN B 1 247 ? 1.826   -40.896 9.064   1.00 132.00 ? 608 GLN B HG3  1 
ATOM   8495 H  HE21 . GLN B 1 247 ? 3.691   -40.321 7.857   1.00 140.80 ? 608 GLN B HE21 1 
ATOM   8496 H  HE22 . GLN B 1 247 ? 4.676   -39.315 8.344   1.00 140.80 ? 608 GLN B HE22 1 
ATOM   8497 N  N    . HIS B 1 248 ? -0.376  -41.737 7.075   1.00 102.29 ? 609 HIS B N    1 
ATOM   8498 C  CA   . HIS B 1 248 ? -0.579  -43.180 7.041   1.00 115.05 ? 609 HIS B CA   1 
ATOM   8499 C  C    . HIS B 1 248 ? -1.367  -43.617 5.804   1.00 118.16 ? 609 HIS B C    1 
ATOM   8500 O  O    . HIS B 1 248 ? -1.712  -44.791 5.669   1.00 124.54 ? 609 HIS B O    1 
ATOM   8501 C  CB   . HIS B 1 248 ? -1.291  -43.628 8.320   1.00 125.42 ? 609 HIS B CB   1 
ATOM   8502 C  CG   . HIS B 1 248 ? -0.700  -43.045 9.567   1.00 134.59 ? 609 HIS B CG   1 
ATOM   8503 N  ND1  . HIS B 1 248 ? -1.292  -42.008 10.259  1.00 126.76 ? 609 HIS B ND1  1 
ATOM   8504 C  CD2  . HIS B 1 248 ? 0.439   -43.338 10.237  1.00 143.04 ? 609 HIS B CD2  1 
ATOM   8505 C  CE1  . HIS B 1 248 ? -0.549  -41.697 11.304  1.00 139.31 ? 609 HIS B CE1  1 
ATOM   8506 N  NE2  . HIS B 1 248 ? 0.509   -42.489 11.315  1.00 147.28 ? 609 HIS B NE2  1 
ATOM   8507 H  H    . HIS B 1 248 ? -1.059  -41.297 7.358   1.00 122.75 ? 609 HIS B H    1 
ATOM   8508 H  HA   . HIS B 1 248 ? 0.286   -43.617 7.013   1.00 138.07 ? 609 HIS B HA   1 
ATOM   8509 H  HB2  . HIS B 1 248 ? -2.220  -43.354 8.274   1.00 150.51 ? 609 HIS B HB2  1 
ATOM   8510 H  HB3  . HIS B 1 248 ? -1.235  -44.594 8.388   1.00 150.51 ? 609 HIS B HB3  1 
ATOM   8511 H  HD1  . HIS B 1 248 ? -2.033  -41.627 10.045  1.00 152.12 ? 609 HIS B HD1  1 
ATOM   8512 H  HD2  . HIS B 1 248 ? 1.057   -43.995 10.013  1.00 171.64 ? 609 HIS B HD2  1 
ATOM   8513 H  HE1  . HIS B 1 248 ? -0.738  -41.032 11.927  1.00 167.17 ? 609 HIS B HE1  1 
ATOM   8514 H  HE2  . HIS B 1 248 ? 1.138   -42.475 11.901  1.00 176.73 ? 609 HIS B HE2  1 
ATOM   8515 N  N    . GLN B 1 249 ? -1.636  -42.667 4.910   1.00 114.61 ? 610 GLN B N    1 
ATOM   8516 C  CA   . GLN B 1 249 ? -2.303  -42.934 3.633   1.00 117.87 ? 610 GLN B CA   1 
ATOM   8517 C  C    . GLN B 1 249 ? -3.539  -43.826 3.777   1.00 109.15 ? 610 GLN B C    1 
ATOM   8518 O  O    . GLN B 1 249 ? -3.525  -45.003 3.414   1.00 106.25 ? 610 GLN B O    1 
ATOM   8519 C  CB   . GLN B 1 249 ? -1.308  -43.551 2.646   1.00 126.17 ? 610 GLN B CB   1 
ATOM   8520 C  CG   . GLN B 1 249 ? -0.415  -42.509 1.969   1.00 129.20 ? 610 GLN B CG   1 
ATOM   8521 C  CD   . GLN B 1 249 ? 1.072   -42.787 2.117   1.00 134.95 ? 610 GLN B CD   1 
ATOM   8522 O  OE1  . GLN B 1 249 ? 1.521   -43.361 3.111   1.00 133.69 ? 610 GLN B OE1  1 
ATOM   8523 N  NE2  . GLN B 1 249 ? 1.848   -42.367 1.122   1.00 126.74 ? 610 GLN B NE2  1 
ATOM   8524 H  H    . GLN B 1 249 ? -1.436  -41.838 5.022   1.00 137.53 ? 610 GLN B H    1 
ATOM   8525 H  HA   . GLN B 1 249 ? -2.598  -42.089 3.259   1.00 141.44 ? 610 GLN B HA   1 
ATOM   8526 H  HB2  . GLN B 1 249 ? -0.735  -44.171 3.123   1.00 151.40 ? 610 GLN B HB2  1 
ATOM   8527 H  HB3  . GLN B 1 249 ? -1.799  -44.019 1.954   1.00 151.40 ? 610 GLN B HB3  1 
ATOM   8528 H  HG2  . GLN B 1 249 ? -0.621  -42.490 1.021   1.00 155.04 ? 610 GLN B HG2  1 
ATOM   8529 H  HG3  . GLN B 1 249 ? -0.595  -41.641 2.362   1.00 155.04 ? 610 GLN B HG3  1 
ATOM   8530 H  HE21 . GLN B 1 249 ? 1.500   -41.964 0.447   1.00 152.08 ? 610 GLN B HE21 1 
ATOM   8531 H  HE22 . GLN B 1 249 ? 2.697   -42.498 1.154   1.00 152.08 ? 610 GLN B HE22 1 
ATOM   8532 N  N    . CYS B 1 250 ? -4.606  -43.242 4.311   1.00 105.43 ? 611 CYS B N    1 
ATOM   8533 C  CA   . CYS B 1 250 ? -5.877  -43.938 4.483   1.00 101.88 ? 611 CYS B CA   1 
ATOM   8534 C  C    . CYS B 1 250 ? -6.994  -42.913 4.664   1.00 95.12  ? 611 CYS B C    1 
ATOM   8535 O  O    . CYS B 1 250 ? -6.727  -41.724 4.848   1.00 96.21  ? 611 CYS B O    1 
ATOM   8536 C  CB   . CYS B 1 250 ? -5.818  -44.894 5.676   1.00 114.85 ? 611 CYS B CB   1 
ATOM   8537 S  SG   . CYS B 1 250 ? -5.440  -44.103 7.257   1.00 106.13 ? 611 CYS B SG   1 
ATOM   8538 H  H    . CYS B 1 250 ? -4.620  -42.428 4.588   1.00 126.51 ? 611 CYS B H    1 
ATOM   8539 H  HA   . CYS B 1 250 ? -6.067  -44.457 3.686   1.00 122.26 ? 611 CYS B HA   1 
ATOM   8540 H  HB2  . CYS B 1 250 ? -6.680  -45.331 5.765   1.00 137.82 ? 611 CYS B HB2  1 
ATOM   8541 H  HB3  . CYS B 1 250 ? -5.132  -45.558 5.508   1.00 137.82 ? 611 CYS B HB3  1 
ATOM   8542 H  HG   . CYS B 1 250 ? -5.419  -44.939 8.117   1.00 127.36 ? 611 CYS B HG   1 
ATOM   8543 N  N    . SER B 1 251 ? -8.240  -43.375 4.620   1.00 87.59  ? 612 SER B N    1 
ATOM   8544 C  CA   . SER B 1 251 ? -9.393  -42.477 4.620   1.00 89.62  ? 612 SER B CA   1 
ATOM   8545 C  C    . SER B 1 251 ? -9.768  -41.995 6.024   1.00 90.30  ? 612 SER B C    1 
ATOM   8546 O  O    . SER B 1 251 ? -9.762  -42.769 6.980   1.00 102.29 ? 612 SER B O    1 
ATOM   8547 C  CB   . SER B 1 251 ? -10.594 -43.171 3.971   1.00 92.34  ? 612 SER B CB   1 
ATOM   8548 O  OG   . SER B 1 251 ? -11.653 -42.258 3.740   1.00 99.62  ? 612 SER B OG   1 
ATOM   8549 H  H    . SER B 1 251 ? -8.447  -44.209 4.590   1.00 105.11 ? 612 SER B H    1 
ATOM   8550 H  HA   . SER B 1 251 ? -9.179  -41.696 4.087   1.00 107.54 ? 612 SER B HA   1 
ATOM   8551 H  HB2  . SER B 1 251 ? -10.316 -43.552 3.123   1.00 110.81 ? 612 SER B HB2  1 
ATOM   8552 H  HB3  . SER B 1 251 ? -10.907 -43.874 4.562   1.00 110.81 ? 612 SER B HB3  1 
ATOM   8553 H  HG   . SER B 1 251 ? -12.302 -42.655 3.384   1.00 119.55 ? 612 SER B HG   1 
ATOM   8554 N  N    . LEU B 1 252 ? -10.093 -40.707 6.124   1.00 95.45  ? 613 LEU B N    1 
ATOM   8555 C  CA   . LEU B 1 252 ? -10.509 -40.075 7.378   1.00 72.67  ? 613 LEU B CA   1 
ATOM   8556 C  C    . LEU B 1 252 ? -11.963 -39.623 7.328   1.00 71.59  ? 613 LEU B C    1 
ATOM   8557 O  O    . LEU B 1 252 ? -12.463 -39.004 8.266   1.00 73.71  ? 613 LEU B O    1 
ATOM   8558 C  CB   . LEU B 1 252 ? -9.627  -38.863 7.684   1.00 69.83  ? 613 LEU B CB   1 
ATOM   8559 C  CG   . LEU B 1 252 ? -8.233  -39.109 8.246   1.00 84.04  ? 613 LEU B CG   1 
ATOM   8560 C  CD1  . LEU B 1 252 ? -7.379  -37.888 7.997   1.00 68.02  ? 613 LEU B CD1  1 
ATOM   8561 C  CD2  . LEU B 1 252 ? -8.306  -39.409 9.735   1.00 85.35  ? 613 LEU B CD2  1 
ATOM   8562 H  H    . LEU B 1 252 ? -10.081 -40.162 5.459   1.00 114.54 ? 613 LEU B H    1 
ATOM   8563 H  HA   . LEU B 1 252 ? -10.413 -40.712 8.104   1.00 87.20  ? 613 LEU B HA   1 
ATOM   8564 H  HB2  . LEU B 1 252 ? -9.515  -38.363 6.861   1.00 83.80  ? 613 LEU B HB2  1 
ATOM   8565 H  HB3  . LEU B 1 252 ? -10.097 -38.310 8.328   1.00 83.80  ? 613 LEU B HB3  1 
ATOM   8566 H  HG   . LEU B 1 252 ? -7.829  -39.867 7.796   1.00 100.85 ? 613 LEU B HG   1 
ATOM   8567 H  HD11 . LEU B 1 252 ? -6.491  -38.046 8.355   1.00 81.62  ? 613 LEU B HD11 1 
ATOM   8568 H  HD12 . LEU B 1 252 ? -7.326  -37.730 7.041   1.00 81.62  ? 613 LEU B HD12 1 
ATOM   8569 H  HD13 . LEU B 1 252 ? -7.783  -37.125 8.438   1.00 81.62  ? 613 LEU B HD13 1 
ATOM   8570 H  HD21 . LEU B 1 252 ? -7.408  -39.561 10.070  1.00 102.42 ? 613 LEU B HD21 1 
ATOM   8571 H  HD22 . LEU B 1 252 ? -8.705  -38.651 10.190  1.00 102.42 ? 613 LEU B HD22 1 
ATOM   8572 H  HD23 . LEU B 1 252 ? -8.849  -40.201 9.871   1.00 102.42 ? 613 LEU B HD23 1 
ATOM   8573 N  N    . GLY B 1 253 ? -12.636 -39.915 6.222   1.00 76.92  ? 614 GLY B N    1 
ATOM   8574 C  CA   . GLY B 1 253 ? -13.984 -39.428 6.009   1.00 85.78  ? 614 GLY B CA   1 
ATOM   8575 C  C    . GLY B 1 253 ? -14.309 -39.250 4.541   1.00 77.90  ? 614 GLY B C    1 
ATOM   8576 O  O    . GLY B 1 253 ? -13.422 -39.111 3.701   1.00 68.58  ? 614 GLY B O    1 
ATOM   8577 H  H    . GLY B 1 253 ? -12.329 -40.396 5.578   1.00 92.30  ? 614 GLY B H    1 
ATOM   8578 H  HA2  . GLY B 1 253 ? -14.618 -40.055 6.390   1.00 102.94 ? 614 GLY B HA2  1 
ATOM   8579 H  HA3  . GLY B 1 253 ? -14.093 -38.573 6.454   1.00 102.94 ? 614 GLY B HA3  1 
ATOM   8580 N  N    . ASN B 1 254 ? -15.601 -39.219 4.246   1.00 81.79  ? 615 ASN B N    1 
ATOM   8581 C  CA   . ASN B 1 254 ? -16.084 -39.354 2.884   1.00 88.28  ? 615 ASN B CA   1 
ATOM   8582 C  C    . ASN B 1 254 ? -17.472 -38.742 2.742   1.00 85.85  ? 615 ASN B C    1 
ATOM   8583 O  O    . ASN B 1 254 ? -18.432 -39.232 3.330   1.00 82.37  ? 615 ASN B O    1 
ATOM   8584 C  CB   . ASN B 1 254 ? -16.100 -40.835 2.497   1.00 106.03 ? 615 ASN B CB   1 
ATOM   8585 C  CG   . ASN B 1 254 ? -16.843 -41.097 1.207   1.00 108.18 ? 615 ASN B CG   1 
ATOM   8586 O  OD1  . ASN B 1 254 ? -18.053 -41.325 1.211   1.00 95.04  ? 615 ASN B OD1  1 
ATOM   8587 N  ND2  . ASN B 1 254 ? -16.119 -41.085 0.093   1.00 107.12 ? 615 ASN B ND2  1 
ATOM   8588 H  H    . ASN B 1 254 ? -16.226 -39.118 4.828   1.00 98.15  ? 615 ASN B H    1 
ATOM   8589 H  HA   . ASN B 1 254 ? -15.483 -38.889 2.282   1.00 105.94 ? 615 ASN B HA   1 
ATOM   8590 H  HB2  . ASN B 1 254 ? -15.186 -41.141 2.383   1.00 127.23 ? 615 ASN B HB2  1 
ATOM   8591 H  HB3  . ASN B 1 254 ? -16.534 -41.341 3.201   1.00 127.23 ? 615 ASN B HB3  1 
ATOM   8592 H  HD21 . ASN B 1 254 ? -16.496 -41.229 -0.666  1.00 128.55 ? 615 ASN B HD21 1 
ATOM   8593 H  HD22 . ASN B 1 254 ? -15.274 -40.934 0.132   1.00 128.55 ? 615 ASN B HD22 1 
ATOM   8594 N  N    . LEU B 1 255 ? -17.565 -37.668 1.963   1.00 77.95  ? 616 LEU B N    1 
ATOM   8595 C  CA   . LEU B 1 255 ? -18.807 -36.913 1.817   1.00 72.60  ? 616 LEU B CA   1 
ATOM   8596 C  C    . LEU B 1 255 ? -19.270 -36.825 0.364   1.00 72.12  ? 616 LEU B C    1 
ATOM   8597 O  O    . LEU B 1 255 ? -18.463 -36.658 -0.551  1.00 63.67  ? 616 LEU B O    1 
ATOM   8598 C  CB   . LEU B 1 255 ? -18.626 -35.503 2.389   1.00 76.22  ? 616 LEU B CB   1 
ATOM   8599 C  CG   . LEU B 1 255 ? -19.768 -34.503 2.192   1.00 84.11  ? 616 LEU B CG   1 
ATOM   8600 C  CD1  . LEU B 1 255 ? -20.970 -34.880 3.046   1.00 97.15  ? 616 LEU B CD1  1 
ATOM   8601 C  CD2  . LEU B 1 255 ? -19.295 -33.087 2.501   1.00 57.77  ? 616 LEU B CD2  1 
ATOM   8602 H  H    . LEU B 1 255 ? -16.912 -37.350 1.501   1.00 93.54  ? 616 LEU B H    1 
ATOM   8603 H  HA   . LEU B 1 255 ? -19.505 -37.355 2.327   1.00 87.12  ? 616 LEU B HA   1 
ATOM   8604 H  HB2  . LEU B 1 255 ? -18.482 -35.584 3.344   1.00 91.47  ? 616 LEU B HB2  1 
ATOM   8605 H  HB3  . LEU B 1 255 ? -17.836 -35.115 1.981   1.00 91.47  ? 616 LEU B HB3  1 
ATOM   8606 H  HG   . LEU B 1 255 ? -20.047 -34.526 1.263   1.00 100.93 ? 616 LEU B HG   1 
ATOM   8607 H  HD11 . LEU B 1 255 ? -21.676 -34.231 2.901   1.00 116.58 ? 616 LEU B HD11 1 
ATOM   8608 H  HD12 . LEU B 1 255 ? -21.275 -35.764 2.789   1.00 116.58 ? 616 LEU B HD12 1 
ATOM   8609 H  HD13 . LEU B 1 255 ? -20.706 -34.879 3.979   1.00 116.58 ? 616 LEU B HD13 1 
ATOM   8610 H  HD21 . LEU B 1 255 ? -20.034 -32.472 2.370   1.00 69.32  ? 616 LEU B HD21 1 
ATOM   8611 H  HD22 . LEU B 1 255 ? -18.993 -33.050 3.422   1.00 69.32  ? 616 LEU B HD22 1 
ATOM   8612 H  HD23 . LEU B 1 255 ? -18.566 -32.860 1.904   1.00 69.32  ? 616 LEU B HD23 1 
ATOM   8613 N  N    . LYS B 1 256 ? -20.580 -36.942 0.168   1.00 70.74  ? 617 LYS B N    1 
ATOM   8614 C  CA   . LYS B 1 256 ? -21.203 -36.714 -1.130  1.00 81.88  ? 617 LYS B CA   1 
ATOM   8615 C  C    . LYS B 1 256 ? -22.286 -35.660 -0.975  1.00 81.69  ? 617 LYS B C    1 
ATOM   8616 O  O    . LYS B 1 256 ? -23.082 -35.709 -0.038  1.00 84.97  ? 617 LYS B O    1 
ATOM   8617 C  CB   . LYS B 1 256 ? -21.792 -38.005 -1.701  1.00 72.84  ? 617 LYS B CB   1 
ATOM   8618 C  CG   . LYS B 1 256 ? -20.740 -38.999 -2.171  1.00 100.18 ? 617 LYS B CG   1 
ATOM   8619 C  CD   . LYS B 1 256 ? -21.359 -40.303 -2.654  1.00 103.26 ? 617 LYS B CD   1 
ATOM   8620 C  CE   . LYS B 1 256 ? -22.232 -40.097 -3.883  1.00 103.97 ? 617 LYS B CE   1 
ATOM   8621 N  NZ   . LYS B 1 256 ? -22.727 -41.388 -4.436  1.00 107.15 ? 617 LYS B NZ   1 
ATOM   8622 H  H    . LYS B 1 256 ? -21.139 -37.157 0.785   1.00 84.89  ? 617 LYS B H    1 
ATOM   8623 H  HA   . LYS B 1 256 ? -20.538 -36.380 -1.752  1.00 98.25  ? 617 LYS B HA   1 
ATOM   8624 H  HB2  . LYS B 1 256 ? -22.323 -38.437 -1.015  1.00 87.41  ? 617 LYS B HB2  1 
ATOM   8625 H  HB3  . LYS B 1 256 ? -22.353 -37.784 -2.461  1.00 87.41  ? 617 LYS B HB3  1 
ATOM   8626 H  HG2  . LYS B 1 256 ? -20.242 -38.610 -2.907  1.00 120.21 ? 617 LYS B HG2  1 
ATOM   8627 H  HG3  . LYS B 1 256 ? -20.143 -39.203 -1.434  1.00 120.21 ? 617 LYS B HG3  1 
ATOM   8628 H  HD2  . LYS B 1 256 ? -20.651 -40.924 -2.887  1.00 123.91 ? 617 LYS B HD2  1 
ATOM   8629 H  HD3  . LYS B 1 256 ? -21.911 -40.674 -1.949  1.00 123.91 ? 617 LYS B HD3  1 
ATOM   8630 H  HE2  . LYS B 1 256 ? -23.001 -39.557 -3.640  1.00 124.76 ? 617 LYS B HE2  1 
ATOM   8631 H  HE3  . LYS B 1 256 ? -21.714 -39.651 -4.571  1.00 124.76 ? 617 LYS B HE3  1 
ATOM   8632 H  HZ1  . LYS B 1 256 ? -23.234 -41.238 -5.152  1.00 128.58 ? 617 LYS B HZ1  1 
ATOM   8633 H  HZ2  . LYS B 1 256 ? -22.039 -41.901 -4.671  1.00 128.58 ? 617 LYS B HZ2  1 
ATOM   8634 H  HZ3  . LYS B 1 256 ? -23.211 -41.816 -3.823  1.00 128.58 ? 617 LYS B HZ3  1 
ATOM   8635 N  N    . VAL B 1 257 ? -22.302 -34.704 -1.895  1.00 65.99  ? 618 VAL B N    1 
ATOM   8636 C  CA   . VAL B 1 257 ? -23.216 -33.575 -1.816  1.00 61.36  ? 618 VAL B CA   1 
ATOM   8637 C  C    . VAL B 1 257 ? -23.870 -33.364 -3.169  1.00 67.69  ? 618 VAL B C    1 
ATOM   8638 O  O    . VAL B 1 257 ? -23.232 -32.836 -4.084  1.00 57.19  ? 618 VAL B O    1 
ATOM   8639 C  CB   . VAL B 1 257 ? -22.489 -32.284 -1.390  1.00 65.08  ? 618 VAL B CB   1 
ATOM   8640 C  CG1  . VAL B 1 257 ? -23.489 -31.163 -1.158  1.00 54.93  ? 618 VAL B CG1  1 
ATOM   8641 C  CG2  . VAL B 1 257 ? -21.667 -32.524 -0.139  1.00 73.06  ? 618 VAL B CG2  1 
ATOM   8642 H  H    . VAL B 1 257 ? -21.786 -34.686 -2.583  1.00 79.19  ? 618 VAL B H    1 
ATOM   8643 H  HA   . VAL B 1 257 ? -23.910 -33.766 -1.165  1.00 73.64  ? 618 VAL B HA   1 
ATOM   8644 H  HB   . VAL B 1 257 ? -21.887 -32.010 -2.099  1.00 78.09  ? 618 VAL B HB   1 
ATOM   8645 H  HG11 . VAL B 1 257 ? -23.010 -30.363 -0.892  1.00 65.92  ? 618 VAL B HG11 1 
ATOM   8646 H  HG12 . VAL B 1 257 ? -23.976 -30.999 -1.981  1.00 65.92  ? 618 VAL B HG12 1 
ATOM   8647 H  HG13 . VAL B 1 257 ? -24.104 -31.429 -0.457  1.00 65.92  ? 618 VAL B HG13 1 
ATOM   8648 H  HG21 . VAL B 1 257 ? -21.220 -31.700 0.108   1.00 87.68  ? 618 VAL B HG21 1 
ATOM   8649 H  HG22 . VAL B 1 257 ? -22.257 -32.809 0.576   1.00 87.68  ? 618 VAL B HG22 1 
ATOM   8650 H  HG23 . VAL B 1 257 ? -21.010 -33.215 -0.321  1.00 87.68  ? 618 VAL B HG23 1 
ATOM   8651 N  N    . PRO B 1 258 ? -25.138 -33.787 -3.311  1.00 63.42  ? 619 PRO B N    1 
ATOM   8652 C  CA   . PRO B 1 258 ? -25.816 -33.561 -4.590  1.00 64.66  ? 619 PRO B CA   1 
ATOM   8653 C  C    . PRO B 1 258 ? -25.933 -32.076 -4.887  1.00 66.95  ? 619 PRO B C    1 
ATOM   8654 O  O    . PRO B 1 258 ? -26.466 -31.323 -4.071  1.00 58.85  ? 619 PRO B O    1 
ATOM   8655 C  CB   . PRO B 1 258 ? -27.197 -34.199 -4.387  1.00 68.51  ? 619 PRO B CB   1 
ATOM   8656 C  CG   . PRO B 1 258 ? -27.042 -35.114 -3.220  1.00 76.60  ? 619 PRO B CG   1 
ATOM   8657 C  CD   . PRO B 1 258 ? -26.001 -34.492 -2.347  1.00 76.07  ? 619 PRO B CD   1 
ATOM   8658 H  HA   . PRO B 1 258 ? -25.349 -34.008 -5.313  1.00 77.60  ? 619 PRO B HA   1 
ATOM   8659 H  HB2  . PRO B 1 258 ? -27.851 -33.508 -4.196  1.00 82.21  ? 619 PRO B HB2  1 
ATOM   8660 H  HB3  . PRO B 1 258 ? -27.447 -34.696 -5.182  1.00 82.21  ? 619 PRO B HB3  1 
ATOM   8661 H  HG2  . PRO B 1 258 ? -27.886 -35.183 -2.747  1.00 91.92  ? 619 PRO B HG2  1 
ATOM   8662 H  HG3  . PRO B 1 258 ? -26.751 -35.987 -3.528  1.00 91.92  ? 619 PRO B HG3  1 
ATOM   8663 H  HD2  . PRO B 1 258 ? -26.407 -33.862 -1.732  1.00 91.29  ? 619 PRO B HD2  1 
ATOM   8664 H  HD3  . PRO B 1 258 ? -25.498 -35.176 -1.879  1.00 91.29  ? 619 PRO B HD3  1 
ATOM   8665 N  N    . LEU B 1 259 ? -25.430 -31.661 -6.042  1.00 52.23  ? 620 LEU B N    1 
ATOM   8666 C  CA   . LEU B 1 259 ? -25.436 -30.255 -6.401  1.00 60.22  ? 620 LEU B CA   1 
ATOM   8667 C  C    . LEU B 1 259 ? -26.863 -29.743 -6.587  1.00 53.10  ? 620 LEU B C    1 
ATOM   8668 O  O    . LEU B 1 259 ? -27.107 -28.541 -6.500  1.00 59.91  ? 620 LEU B O    1 
ATOM   8669 C  CB   . LEU B 1 259 ? -24.611 -30.028 -7.672  1.00 50.39  ? 620 LEU B CB   1 
ATOM   8670 C  CG   . LEU B 1 259 ? -23.142 -30.454 -7.571  1.00 65.48  ? 620 LEU B CG   1 
ATOM   8671 C  CD1  . LEU B 1 259 ? -22.380 -30.056 -8.818  1.00 43.70  ? 620 LEU B CD1  1 
ATOM   8672 C  CD2  . LEU B 1 259 ? -22.468 -29.860 -6.346  1.00 50.37  ? 620 LEU B CD2  1 
ATOM   8673 H  H    . LEU B 1 259 ? -25.079 -32.176 -6.635  1.00 62.68  ? 620 LEU B H    1 
ATOM   8674 H  HA   . LEU B 1 259 ? -25.027 -29.745 -5.684  1.00 72.26  ? 620 LEU B HA   1 
ATOM   8675 H  HB2  . LEU B 1 259 ? -25.014 -30.533 -8.396  1.00 60.46  ? 620 LEU B HB2  1 
ATOM   8676 H  HB3  . LEU B 1 259 ? -24.628 -29.082 -7.887  1.00 60.46  ? 620 LEU B HB3  1 
ATOM   8677 H  HG   . LEU B 1 259 ? -23.100 -31.420 -7.494  1.00 78.57  ? 620 LEU B HG   1 
ATOM   8678 H  HD11 . LEU B 1 259 ? -21.456 -30.337 -8.726  1.00 52.44  ? 620 LEU B HD11 1 
ATOM   8679 H  HD12 . LEU B 1 259 ? -22.783 -30.490 -9.586  1.00 52.44  ? 620 LEU B HD12 1 
ATOM   8680 H  HD13 . LEU B 1 259 ? -22.424 -29.092 -8.921  1.00 52.44  ? 620 LEU B HD13 1 
ATOM   8681 H  HD21 . LEU B 1 259 ? -21.544 -30.153 -6.320  1.00 60.45  ? 620 LEU B HD21 1 
ATOM   8682 H  HD22 . LEU B 1 259 ? -22.507 -28.892 -6.402  1.00 60.45  ? 620 LEU B HD22 1 
ATOM   8683 H  HD23 . LEU B 1 259 ? -22.934 -30.164 -5.551  1.00 60.45  ? 620 LEU B HD23 1 
ATOM   8684 N  N    . SER B 1 260 ? -27.807 -30.650 -6.826  1.00 54.86  ? 621 SER B N    1 
ATOM   8685 C  CA   . SER B 1 260 ? -29.191 -30.247 -7.061  1.00 57.57  ? 621 SER B CA   1 
ATOM   8686 C  C    . SER B 1 260 ? -29.767 -29.518 -5.852  1.00 58.63  ? 621 SER B C    1 
ATOM   8687 O  O    . SER B 1 260 ? -30.660 -28.684 -5.993  1.00 60.01  ? 621 SER B O    1 
ATOM   8688 C  CB   . SER B 1 260 ? -30.066 -31.457 -7.408  1.00 61.01  ? 621 SER B CB   1 
ATOM   8689 O  OG   . SER B 1 260 ? -30.059 -32.417 -6.368  1.00 69.91  ? 621 SER B OG   1 
ATOM   8690 H  H    . SER B 1 260 ? -27.673 -31.499 -6.858  1.00 65.83  ? 621 SER B H    1 
ATOM   8691 H  HA   . SER B 1 260 ? -29.216 -29.636 -7.815  1.00 69.08  ? 621 SER B HA   1 
ATOM   8692 H  HB2  . SER B 1 260 ? -30.977 -31.155 -7.549  1.00 73.21  ? 621 SER B HB2  1 
ATOM   8693 H  HB3  . SER B 1 260 ? -29.726 -31.868 -8.217  1.00 73.21  ? 621 SER B HB3  1 
ATOM   8694 H  HG   . SER B 1 260 ? -30.543 -33.071 -6.578  1.00 83.89  ? 621 SER B HG   1 
ATOM   8695 N  N    . GLN B 1 261 ? -29.246 -29.828 -4.668  1.00 68.53  ? 622 GLN B N    1 
ATOM   8696 C  CA   . GLN B 1 261 ? -29.694 -29.171 -3.446  1.00 61.49  ? 622 GLN B CA   1 
ATOM   8697 C  C    . GLN B 1 261 ? -29.449 -27.668 -3.538  1.00 57.24  ? 622 GLN B C    1 
ATOM   8698 O  O    . GLN B 1 261 ? -30.200 -26.871 -2.981  1.00 60.38  ? 622 GLN B O    1 
ATOM   8699 C  CB   . GLN B 1 261 ? -28.978 -29.756 -2.229  1.00 67.78  ? 622 GLN B CB   1 
ATOM   8700 C  CG   . GLN B 1 261 ? -29.312 -31.215 -1.958  1.00 87.54  ? 622 GLN B CG   1 
ATOM   8701 C  CD   . GLN B 1 261 ? -28.404 -31.834 -0.912  1.00 107.55 ? 622 GLN B CD   1 
ATOM   8702 O  OE1  . GLN B 1 261 ? -27.479 -31.190 -0.414  1.00 99.70  ? 622 GLN B OE1  1 
ATOM   8703 N  NE2  . GLN B 1 261 ? -28.662 -33.093 -0.578  1.00 113.19 ? 622 GLN B NE2  1 
ATOM   8704 H  H    . GLN B 1 261 ? -28.631 -30.417 -4.546  1.00 82.24  ? 622 GLN B H    1 
ATOM   8705 H  HA   . GLN B 1 261 ? -30.647 -29.316 -3.336  1.00 73.79  ? 622 GLN B HA   1 
ATOM   8706 H  HB2  . GLN B 1 261 ? -28.021 -29.692 -2.370  1.00 81.33  ? 622 GLN B HB2  1 
ATOM   8707 H  HB3  . GLN B 1 261 ? -29.229 -29.244 -1.444  1.00 81.33  ? 622 GLN B HB3  1 
ATOM   8708 H  HG2  . GLN B 1 261 ? -30.225 -31.276 -1.639  1.00 105.05 ? 622 GLN B HG2  1 
ATOM   8709 H  HG3  . GLN B 1 261 ? -29.212 -31.720 -2.780  1.00 105.05 ? 622 GLN B HG3  1 
ATOM   8710 H  HE21 . GLN B 1 261 ? -29.315 -33.512 -0.950  1.00 135.83 ? 622 GLN B HE21 1 
ATOM   8711 H  HE22 . GLN B 1 261 ? -28.176 -33.490 0.011   1.00 135.83 ? 622 GLN B HE22 1 
ATOM   8712 N  N    . LEU B 1 262 ? -28.407 -27.288 -4.270  1.00 54.09  ? 623 LEU B N    1 
ATOM   8713 C  CA   . LEU B 1 262 ? -28.044 -25.884 -4.413  1.00 52.22  ? 623 LEU B CA   1 
ATOM   8714 C  C    . LEU B 1 262 ? -29.006 -25.116 -5.313  1.00 61.27  ? 623 LEU B C    1 
ATOM   8715 O  O    . LEU B 1 262 ? -29.090 -23.895 -5.233  1.00 53.81  ? 623 LEU B O    1 
ATOM   8716 C  CB   . LEU B 1 262 ? -26.627 -25.756 -4.977  1.00 48.75  ? 623 LEU B CB   1 
ATOM   8717 C  CG   . LEU B 1 262 ? -25.487 -26.364 -4.160  1.00 49.02  ? 623 LEU B CG   1 
ATOM   8718 C  CD1  . LEU B 1 262 ? -24.169 -26.158 -4.876  1.00 44.09  ? 623 LEU B CD1  1 
ATOM   8719 C  CD2  . LEU B 1 262 ? -25.438 -25.756 -2.776  1.00 59.10  ? 623 LEU B CD2  1 
ATOM   8720 H  H    . LEU B 1 262 ? -27.890 -27.828 -4.696  1.00 64.90  ? 623 LEU B H    1 
ATOM   8721 H  HA   . LEU B 1 262 ? -28.056 -25.466 -3.538  1.00 62.67  ? 623 LEU B HA   1 
ATOM   8722 H  HB2  . LEU B 1 262 ? -26.611 -26.182 -5.849  1.00 58.50  ? 623 LEU B HB2  1 
ATOM   8723 H  HB3  . LEU B 1 262 ? -26.430 -24.812 -5.081  1.00 58.50  ? 623 LEU B HB3  1 
ATOM   8724 H  HG   . LEU B 1 262 ? -25.635 -27.318 -4.066  1.00 58.82  ? 623 LEU B HG   1 
ATOM   8725 H  HD11 . LEU B 1 262 ? -23.457 -26.548 -4.346  1.00 52.91  ? 623 LEU B HD11 1 
ATOM   8726 H  HD12 . LEU B 1 262 ? -24.210 -26.589 -5.744  1.00 52.91  ? 623 LEU B HD12 1 
ATOM   8727 H  HD13 . LEU B 1 262 ? -24.015 -25.206 -4.987  1.00 52.91  ? 623 LEU B HD13 1 
ATOM   8728 H  HD21 . LEU B 1 262 ? -24.708 -26.159 -2.280  1.00 70.92  ? 623 LEU B HD21 1 
ATOM   8729 H  HD22 . LEU B 1 262 ? -25.296 -24.800 -2.856  1.00 70.92  ? 623 LEU B HD22 1 
ATOM   8730 H  HD23 . LEU B 1 262 ? -26.280 -25.929 -2.326  1.00 70.92  ? 623 LEU B HD23 1 
ATOM   8731 N  N    . LEU B 1 263 ? -29.722 -25.828 -6.175  1.00 55.54  ? 624 LEU B N    1 
ATOM   8732 C  CA   . LEU B 1 263 ? -30.550 -25.180 -7.192  1.00 71.88  ? 624 LEU B CA   1 
ATOM   8733 C  C    . LEU B 1 263 ? -31.736 -24.407 -6.607  1.00 62.41  ? 624 LEU B C    1 
ATOM   8734 O  O    . LEU B 1 263 ? -32.327 -23.565 -7.285  1.00 72.44  ? 624 LEU B O    1 
ATOM   8735 C  CB   . LEU B 1 263 ? -31.057 -26.221 -8.189  1.00 64.59  ? 624 LEU B CB   1 
ATOM   8736 C  CG   . LEU B 1 263 ? -29.971 -26.994 -8.942  1.00 56.47  ? 624 LEU B CG   1 
ATOM   8737 C  CD1  . LEU B 1 263 ? -30.570 -28.195 -9.650  1.00 73.16  ? 624 LEU B CD1  1 
ATOM   8738 C  CD2  . LEU B 1 263 ? -29.256 -26.097 -9.943  1.00 60.90  ? 624 LEU B CD2  1 
ATOM   8739 H  H    . LEU B 1 263 ? -29.748 -26.687 -6.195  1.00 66.65  ? 624 LEU B H    1 
ATOM   8740 H  HA   . LEU B 1 263 ? -30.001 -24.547 -7.681  1.00 86.26  ? 624 LEU B HA   1 
ATOM   8741 H  HB2  . LEU B 1 263 ? -31.595 -26.870 -7.708  1.00 77.51  ? 624 LEU B HB2  1 
ATOM   8742 H  HB3  . LEU B 1 263 ? -31.607 -25.771 -8.850  1.00 77.51  ? 624 LEU B HB3  1 
ATOM   8743 H  HG   . LEU B 1 263 ? -29.314 -27.317 -8.306  1.00 67.76  ? 624 LEU B HG   1 
ATOM   8744 H  HD11 . LEU B 1 263 ? -29.865 -28.668 -10.119 1.00 87.79  ? 624 LEU B HD11 1 
ATOM   8745 H  HD12 . LEU B 1 263 ? -30.978 -28.778 -8.991  1.00 87.79  ? 624 LEU B HD12 1 
ATOM   8746 H  HD13 . LEU B 1 263 ? -31.240 -27.888 -10.280 1.00 87.79  ? 624 LEU B HD13 1 
ATOM   8747 H  HD21 . LEU B 1 263 ? -28.577 -26.615 -10.402 1.00 73.08  ? 624 LEU B HD21 1 
ATOM   8748 H  HD22 . LEU B 1 263 ? -29.903 -25.759 -10.582 1.00 73.08  ? 624 LEU B HD22 1 
ATOM   8749 H  HD23 . LEU B 1 263 ? -28.845 -25.359 -9.467  1.00 73.08  ? 624 LEU B HD23 1 
ATOM   8750 N  N    . THR B 1 264 ? -32.063 -24.688 -5.350  1.00 76.08  ? 625 THR B N    1 
ATOM   8751 C  CA   . THR B 1 264 ? -33.234 -24.108 -4.699  1.00 66.58  ? 625 THR B CA   1 
ATOM   8752 C  C    . THR B 1 264 ? -32.857 -23.253 -3.484  1.00 70.21  ? 625 THR B C    1 
ATOM   8753 O  O    . THR B 1 264 ? -33.728 -22.836 -2.713  1.00 69.02  ? 625 THR B O    1 
ATOM   8754 C  CB   . THR B 1 264 ? -34.208 -25.214 -4.257  1.00 69.72  ? 625 THR B CB   1 
ATOM   8755 O  OG1  . THR B 1 264 ? -33.482 -26.247 -3.581  1.00 69.38  ? 625 THR B OG1  1 
ATOM   8756 C  CG2  . THR B 1 264 ? -34.908 -25.817 -5.465  1.00 83.17  ? 625 THR B CG2  1 
ATOM   8757 H  H    . THR B 1 264 ? -31.615 -25.221 -4.844  1.00 91.29  ? 625 THR B H    1 
ATOM   8758 H  HA   . THR B 1 264 ? -33.696 -23.538 -5.333  1.00 79.89  ? 625 THR B HA   1 
ATOM   8759 H  HB   . THR B 1 264 ? -34.878 -24.842 -3.663  1.00 83.67  ? 625 THR B HB   1 
ATOM   8760 H  HG1  . THR B 1 264 ? -34.008 -26.855 -3.337  1.00 83.26  ? 625 THR B HG1  1 
ATOM   8761 H  HG21 . THR B 1 264 ? -35.520 -26.513 -5.179  1.00 99.81  ? 625 THR B HG21 1 
ATOM   8762 H  HG22 . THR B 1 264 ? -35.408 -25.131 -5.935  1.00 99.81  ? 625 THR B HG22 1 
ATOM   8763 H  HG23 . THR B 1 264 ? -34.254 -26.201 -6.070  1.00 99.81  ? 625 THR B HG23 1 
ATOM   8764 N  N    . SER B 1 265 ? -31.560 -22.995 -3.321  1.00 61.05  ? 626 SER B N    1 
ATOM   8765 C  CA   . SER B 1 265 ? -31.065 -22.147 -2.240  1.00 70.15  ? 626 SER B CA   1 
ATOM   8766 C  C    . SER B 1 265 ? -30.850 -20.717 -2.727  1.00 62.91  ? 626 SER B C    1 
ATOM   8767 O  O    . SER B 1 265 ? -30.657 -20.487 -3.917  1.00 58.73  ? 626 SER B O    1 
ATOM   8768 C  CB   . SER B 1 265 ? -29.758 -22.710 -1.677  1.00 79.89  ? 626 SER B CB   1 
ATOM   8769 O  OG   . SER B 1 265 ? -29.862 -24.104 -1.444  1.00 82.50  ? 626 SER B OG   1 
ATOM   8770 H  H    . SER B 1 265 ? -30.940 -23.305 -3.831  1.00 73.25  ? 626 SER B H    1 
ATOM   8771 H  HA   . SER B 1 265 ? -31.719 -22.128 -1.525  1.00 84.18  ? 626 SER B HA   1 
ATOM   8772 H  HB2  . SER B 1 265 ? -29.045 -22.549 -2.314  1.00 95.87  ? 626 SER B HB2  1 
ATOM   8773 H  HB3  . SER B 1 265 ? -29.559 -22.264 -0.838  1.00 95.87  ? 626 SER B HB3  1 
ATOM   8774 H  HG   . SER B 1 265 ? -29.138 -24.398 -1.135  1.00 99.00  ? 626 SER B HG   1 
ATOM   8775 N  N    . GLU B 1 266 ? -30.881 -19.759 -1.806  1.00 60.73  ? 627 GLU B N    1 
ATOM   8776 C  CA   . GLU B 1 266 ? -30.649 -18.361 -2.160  1.00 66.93  ? 627 GLU B CA   1 
ATOM   8777 C  C    . GLU B 1 266 ? -29.247 -18.184 -2.736  1.00 66.90  ? 627 GLU B C    1 
ATOM   8778 O  O    . GLU B 1 266 ? -28.258 -18.629 -2.144  1.00 54.56  ? 627 GLU B O    1 
ATOM   8779 C  CB   . GLU B 1 266 ? -30.846 -17.452 -0.939  1.00 75.26  ? 627 GLU B CB   1 
ATOM   8780 C  CG   . GLU B 1 266 ? -30.545 -15.965 -1.175  1.00 100.30 ? 627 GLU B CG   1 
ATOM   8781 C  CD   . GLU B 1 266 ? -31.570 -15.269 -2.059  1.00 123.53 ? 627 GLU B CD   1 
ATOM   8782 O  OE1  . GLU B 1 266 ? -32.413 -15.959 -2.669  1.00 140.21 ? 627 GLU B OE1  1 
ATOM   8783 O  OE2  . GLU B 1 266 ? -31.536 -14.021 -2.140  1.00 118.62 ? 627 GLU B OE2  1 
ATOM   8784 H  H    . GLU B 1 266 ? -31.034 -19.891 -0.970  1.00 72.87  ? 627 GLU B H    1 
ATOM   8785 H  HA   . GLU B 1 266 ? -31.289 -18.095 -2.839  1.00 80.31  ? 627 GLU B HA   1 
ATOM   8786 H  HB2  . GLU B 1 266 ? -31.770 -17.520 -0.650  1.00 90.31  ? 627 GLU B HB2  1 
ATOM   8787 H  HB3  . GLU B 1 266 ? -30.261 -17.759 -0.229  1.00 90.31  ? 627 GLU B HB3  1 
ATOM   8788 H  HG2  . GLU B 1 266 ? -30.531 -15.508 -0.320  1.00 120.36 ? 627 GLU B HG2  1 
ATOM   8789 H  HG3  . GLU B 1 266 ? -29.679 -15.885 -1.606  1.00 120.36 ? 627 GLU B HG3  1 
ATOM   8790 N  N    . ASP B 1 267 ? -29.176 -17.528 -3.892  1.00 59.88  ? 628 ASP B N    1 
ATOM   8791 C  CA   . ASP B 1 267 ? -27.931 -17.387 -4.648  1.00 61.39  ? 628 ASP B CA   1 
ATOM   8792 C  C    . ASP B 1 267 ? -27.235 -18.734 -4.812  1.00 54.31  ? 628 ASP B C    1 
ATOM   8793 O  O    . ASP B 1 267 ? -26.014 -18.802 -4.931  1.00 49.11  ? 628 ASP B O    1 
ATOM   8794 C  CB   . ASP B 1 267 ? -26.996 -16.375 -3.972  1.00 87.77  ? 628 ASP B CB   1 
ATOM   8795 C  CG   . ASP B 1 267 ? -27.194 -14.961 -4.488  1.00 106.58 ? 628 ASP B CG   1 
ATOM   8796 O  OD1  . ASP B 1 267 ? -28.314 -14.634 -4.935  1.00 103.18 ? 628 ASP B OD1  1 
ATOM   8797 O  OD2  . ASP B 1 267 ? -26.225 -14.175 -4.447  1.00 113.04 ? 628 ASP B OD2  1 
ATOM   8798 H  H    . ASP B 1 267 ? -29.849 -17.147 -4.267  1.00 71.86  ? 628 ASP B H    1 
ATOM   8799 H  HA   . ASP B 1 267 ? -28.140 -17.051 -5.533  1.00 73.67  ? 628 ASP B HA   1 
ATOM   8800 H  HB2  . ASP B 1 267 ? -27.168 -16.373 -3.017  1.00 105.32 ? 628 ASP B HB2  1 
ATOM   8801 H  HB3  . ASP B 1 267 ? -26.076 -16.631 -4.143  1.00 105.32 ? 628 ASP B HB3  1 
ATOM   8802 N  N    . MET B 1 268 ? -28.032 -19.799 -4.824  1.00 55.67  ? 629 MET B N    1 
ATOM   8803 C  CA   . MET B 1 268 ? -27.534 -21.155 -5.029  1.00 56.14  ? 629 MET B CA   1 
ATOM   8804 C  C    . MET B 1 268 ? -26.287 -21.414 -4.199  1.00 57.87  ? 629 MET B C    1 
ATOM   8805 O  O    . MET B 1 268 ? -25.302 -21.959 -4.700  1.00 50.84  ? 629 MET B O    1 
ATOM   8806 C  CB   . MET B 1 268 ? -27.224 -21.396 -6.511  1.00 55.10  ? 629 MET B CB   1 
ATOM   8807 C  CG   . MET B 1 268 ? -28.177 -20.717 -7.485  1.00 54.64  ? 629 MET B CG   1 
ATOM   8808 S  SD   . MET B 1 268 ? -27.891 -21.257 -9.192  1.00 62.50  ? 629 MET B SD   1 
ATOM   8809 C  CE   . MET B 1 268 ? -28.759 -22.798 -9.119  1.00 53.04  ? 629 MET B CE   1 
ATOM   8810 H  H    . MET B 1 268 ? -28.884 -19.760 -4.712  1.00 66.80  ? 629 MET B H    1 
ATOM   8811 H  HA   . MET B 1 268 ? -28.223 -21.784 -4.764  1.00 67.36  ? 629 MET B HA   1 
ATOM   8812 H  HB2  . MET B 1 268 ? -26.331 -21.067 -6.698  1.00 66.12  ? 629 MET B HB2  1 
ATOM   8813 H  HB3  . MET B 1 268 ? -27.262 -22.350 -6.683  1.00 66.12  ? 629 MET B HB3  1 
ATOM   8814 H  HG2  . MET B 1 268 ? -29.090 -20.939 -7.245  1.00 65.56  ? 629 MET B HG2  1 
ATOM   8815 H  HG3  . MET B 1 268 ? -28.044 -19.757 -7.444  1.00 65.56  ? 629 MET B HG3  1 
ATOM   8816 H  HE1  . MET B 1 268 ? -28.702 -23.233 -9.984  1.00 63.65  ? 629 MET B HE1  1 
ATOM   8817 H  HE2  . MET B 1 268 ? -28.351 -23.358 -8.440  1.00 63.65  ? 629 MET B HE2  1 
ATOM   8818 H  HE3  . MET B 1 268 ? -29.687 -22.627 -8.894  1.00 63.65  ? 629 MET B HE3  1 
ATOM   8819 N  N    . THR B 1 269 ? -26.330 -20.994 -2.937  1.00 57.50  ? 630 THR B N    1 
ATOM   8820 C  CA   . THR B 1 269 ? -25.180 -21.094 -2.053  1.00 54.13  ? 630 THR B CA   1 
ATOM   8821 C  C    . THR B 1 269 ? -25.573 -21.681 -0.700  1.00 54.87  ? 630 THR B C    1 
ATOM   8822 O  O    . THR B 1 269 ? -26.595 -21.309 -0.129  1.00 62.49  ? 630 THR B O    1 
ATOM   8823 C  CB   . THR B 1 269 ? -24.521 -19.711 -1.840  1.00 64.95  ? 630 THR B CB   1 
ATOM   8824 O  OG1  . THR B 1 269 ? -24.109 -19.170 -3.105  1.00 55.80  ? 630 THR B OG1  1 
ATOM   8825 C  CG2  . THR B 1 269 ? -23.311 -19.818 -0.923  1.00 62.23  ? 630 THR B CG2  1 
ATOM   8826 H  H    . THR B 1 269 ? -27.023 -20.644 -2.567  1.00 69.01  ? 630 THR B H    1 
ATOM   8827 H  HA   . THR B 1 269 ? -24.522 -21.682 -2.456  1.00 64.96  ? 630 THR B HA   1 
ATOM   8828 H  HB   . THR B 1 269 ? -25.163 -19.111 -1.429  1.00 77.95  ? 630 THR B HB   1 
ATOM   8829 H  HG1  . THR B 1 269 ? -24.773 -19.082 -3.610  1.00 66.96  ? 630 THR B HG1  1 
ATOM   8830 H  HG21 . THR B 1 269 ? -22.911 -18.944 -0.799  1.00 74.68  ? 630 THR B HG21 1 
ATOM   8831 H  HG22 . THR B 1 269 ? -23.581 -20.166 -0.058  1.00 74.68  ? 630 THR B HG22 1 
ATOM   8832 H  HG23 . THR B 1 269 ? -22.653 -20.415 -1.311  1.00 74.68  ? 630 THR B HG23 1 
ATOM   8833 N  N    . VAL B 1 270 ? -24.762 -22.610 -0.202  1.00 60.30  ? 631 VAL B N    1 
ATOM   8834 C  CA   . VAL B 1 270 ? -24.931 -23.120 1.152   1.00 57.26  ? 631 VAL B CA   1 
ATOM   8835 C  C    . VAL B 1 270 ? -23.593 -23.033 1.864   1.00 63.74  ? 631 VAL B C    1 
ATOM   8836 O  O    . VAL B 1 270 ? -22.543 -23.294 1.275   1.00 57.23  ? 631 VAL B O    1 
ATOM   8837 C  CB   . VAL B 1 270 ? -25.461 -24.575 1.178   1.00 63.71  ? 631 VAL B CB   1 
ATOM   8838 C  CG1  . VAL B 1 270 ? -26.798 -24.670 0.446   1.00 69.17  ? 631 VAL B CG1  1 
ATOM   8839 C  CG2  . VAL B 1 270 ? -24.459 -25.533 0.570   1.00 68.07  ? 631 VAL B CG2  1 
ATOM   8840 H  H    . VAL B 1 270 ? -24.105 -22.962 -0.631  1.00 72.36  ? 631 VAL B H    1 
ATOM   8841 H  HA   . VAL B 1 270 ? -25.564 -22.559 1.627   1.00 68.72  ? 631 VAL B HA   1 
ATOM   8842 H  HB   . VAL B 1 270 ? -25.606 -24.840 2.100   1.00 76.45  ? 631 VAL B HB   1 
ATOM   8843 H  HG11 . VAL B 1 270 ? -27.109 -25.588 0.476   1.00 83.00  ? 631 VAL B HG11 1 
ATOM   8844 H  HG12 . VAL B 1 270 ? -27.439 -24.089 0.884   1.00 83.00  ? 631 VAL B HG12 1 
ATOM   8845 H  HG13 . VAL B 1 270 ? -26.674 -24.392 -0.475  1.00 83.00  ? 631 VAL B HG13 1 
ATOM   8846 H  HG21 . VAL B 1 270 ? -24.823 -26.432 0.603   1.00 81.68  ? 631 VAL B HG21 1 
ATOM   8847 H  HG22 . VAL B 1 270 ? -24.295 -25.276 -0.350  1.00 81.68  ? 631 VAL B HG22 1 
ATOM   8848 H  HG23 . VAL B 1 270 ? -23.634 -25.491 1.079   1.00 81.68  ? 631 VAL B HG23 1 
ATOM   8849 N  N    . SER B 1 271 ? -23.645 -22.637 3.130   1.00 51.23  ? 632 SER B N    1 
ATOM   8850 C  CA   . SER B 1 271 ? -22.461 -22.509 3.959   1.00 60.30  ? 632 SER B CA   1 
ATOM   8851 C  C    . SER B 1 271 ? -22.757 -23.129 5.320   1.00 64.57  ? 632 SER B C    1 
ATOM   8852 O  O    . SER B 1 271 ? -23.545 -22.588 6.095   1.00 70.30  ? 632 SER B O    1 
ATOM   8853 C  CB   . SER B 1 271 ? -22.060 -21.037 4.099   1.00 58.24  ? 632 SER B CB   1 
ATOM   8854 O  OG   . SER B 1 271 ? -20.765 -20.909 4.662   1.00 86.49  ? 632 SER B OG   1 
ATOM   8855 H  H    . SER B 1 271 ? -24.374 -22.432 3.538   1.00 61.47  ? 632 SER B H    1 
ATOM   8856 H  HA   . SER B 1 271 ? -21.725 -22.993 3.553   1.00 72.36  ? 632 SER B HA   1 
ATOM   8857 H  HB2  . SER B 1 271 ? -22.063 -20.626 3.220   1.00 69.89  ? 632 SER B HB2  1 
ATOM   8858 H  HB3  . SER B 1 271 ? -22.700 -20.590 4.675   1.00 69.89  ? 632 SER B HB3  1 
ATOM   8859 H  HG   . SER B 1 271 ? -20.562 -20.097 4.731   1.00 103.79 ? 632 SER B HG   1 
ATOM   8860 N  N    . GLN B 1 272 ? -22.147 -24.275 5.603   1.00 62.95  ? 633 GLN B N    1 
ATOM   8861 C  CA   . GLN B 1 272 ? -22.433 -24.986 6.842   1.00 72.41  ? 633 GLN B CA   1 
ATOM   8862 C  C    . GLN B 1 272 ? -21.386 -26.047 7.162   1.00 81.66  ? 633 GLN B C    1 
ATOM   8863 O  O    . GLN B 1 272 ? -20.419 -26.233 6.422   1.00 51.32  ? 633 GLN B O    1 
ATOM   8864 C  CB   . GLN B 1 272 ? -23.814 -25.639 6.757   1.00 72.73  ? 633 GLN B CB   1 
ATOM   8865 C  CG   . GLN B 1 272 ? -23.885 -26.816 5.805   1.00 66.77  ? 633 GLN B CG   1 
ATOM   8866 C  CD   . GLN B 1 272 ? -25.288 -27.372 5.666   1.00 77.23  ? 633 GLN B CD   1 
ATOM   8867 O  OE1  . GLN B 1 272 ? -26.253 -26.628 5.484   1.00 90.60  ? 633 GLN B OE1  1 
ATOM   8868 N  NE2  . GLN B 1 272 ? -25.408 -28.691 5.757   1.00 86.47  ? 633 GLN B NE2  1 
ATOM   8869 H  H    . GLN B 1 272 ? -21.567 -24.659 5.097   1.00 75.54  ? 633 GLN B H    1 
ATOM   8870 H  HA   . GLN B 1 272 ? -22.448 -24.349 7.574   1.00 86.89  ? 633 GLN B HA   1 
ATOM   8871 H  HB2  . GLN B 1 272 ? -24.063 -25.957 7.639   1.00 87.28  ? 633 GLN B HB2  1 
ATOM   8872 H  HB3  . GLN B 1 272 ? -24.454 -24.976 6.455   1.00 87.28  ? 633 GLN B HB3  1 
ATOM   8873 H  HG2  . GLN B 1 272 ? -23.586 -26.531 4.927   1.00 80.12  ? 633 GLN B HG2  1 
ATOM   8874 H  HG3  . GLN B 1 272 ? -23.312 -27.525 6.137   1.00 80.12  ? 633 GLN B HG3  1 
ATOM   8875 H  HE21 . GLN B 1 272 ? -24.712 -29.178 5.888   1.00 103.76 ? 633 GLN B HE21 1 
ATOM   8876 H  HE22 . GLN B 1 272 ? -26.182 -29.058 5.685   1.00 103.76 ? 633 GLN B HE22 1 
ATOM   8877 N  N    . ARG B 1 273 ? -21.587 -26.731 8.284   1.00 59.82  ? 634 ARG B N    1 
ATOM   8878 C  CA   . ARG B 1 273 ? -20.794 -27.902 8.631   1.00 56.82  ? 634 ARG B CA   1 
ATOM   8879 C  C    . ARG B 1 273 ? -21.481 -29.163 8.133   1.00 74.98  ? 634 ARG B C    1 
ATOM   8880 O  O    . ARG B 1 273 ? -22.635 -29.429 8.471   1.00 87.27  ? 634 ARG B O    1 
ATOM   8881 C  CB   . ARG B 1 273 ? -20.579 -27.980 10.142  1.00 59.68  ? 634 ARG B CB   1 
ATOM   8882 C  CG   . ARG B 1 273 ? -19.561 -26.992 10.657  1.00 62.77  ? 634 ARG B CG   1 
ATOM   8883 C  CD   . ARG B 1 273 ? -19.290 -27.183 12.145  1.00 71.42  ? 634 ARG B CD   1 
ATOM   8884 N  NE   . ARG B 1 273 ? -18.384 -26.155 12.648  1.00 90.63  ? 634 ARG B NE   1 
ATOM   8885 C  CZ   . ARG B 1 273 ? -18.727 -24.883 12.829  1.00 108.84 ? 634 ARG B CZ   1 
ATOM   8886 N  NH1  . ARG B 1 273 ? -19.959 -24.475 12.550  1.00 111.41 ? 634 ARG B NH1  1 
ATOM   8887 N  NH2  . ARG B 1 273 ? -17.836 -24.014 13.285  1.00 115.84 ? 634 ARG B NH2  1 
ATOM   8888 H  H    . ARG B 1 273 ? -22.187 -26.534 8.867   1.00 71.78  ? 634 ARG B H    1 
ATOM   8889 H  HA   . ARG B 1 273 ? -19.925 -27.839 8.204   1.00 68.18  ? 634 ARG B HA   1 
ATOM   8890 H  HB2  . ARG B 1 273 ? -21.421 -27.800 10.588  1.00 71.61  ? 634 ARG B HB2  1 
ATOM   8891 H  HB3  . ARG B 1 273 ? -20.270 -28.871 10.369  1.00 71.61  ? 634 ARG B HB3  1 
ATOM   8892 H  HG2  . ARG B 1 273 ? -18.726 -27.115 10.178  1.00 75.33  ? 634 ARG B HG2  1 
ATOM   8893 H  HG3  . ARG B 1 273 ? -19.894 -26.091 10.522  1.00 75.33  ? 634 ARG B HG3  1 
ATOM   8894 H  HD2  . ARG B 1 273 ? -20.125 -27.120 12.635  1.00 85.70  ? 634 ARG B HD2  1 
ATOM   8895 H  HD3  . ARG B 1 273 ? -18.879 -28.050 12.289  1.00 85.70  ? 634 ARG B HD3  1 
ATOM   8896 H  HE   . ARG B 1 273 ? -17.567 -26.378 12.797  1.00 108.75 ? 634 ARG B HE   1 
ATOM   8897 H  HH11 . ARG B 1 273 ? -20.540 -25.035 12.252  1.00 133.69 ? 634 ARG B HH11 1 
ATOM   8898 H  HH12 . ARG B 1 273 ? -20.176 -23.652 12.668  1.00 133.69 ? 634 ARG B HH12 1 
ATOM   8899 H  HH21 . ARG B 1 273 ? -17.037 -24.273 13.468  1.00 139.01 ? 634 ARG B HH21 1 
ATOM   8900 H  HH22 . ARG B 1 273 ? -18.059 -23.192 13.403  1.00 139.01 ? 634 ARG B HH22 1 
ATOM   8901 N  N    . PHE B 1 274 ? -20.766 -29.928 7.317   1.00 75.42  ? 635 PHE B N    1 
ATOM   8902 C  CA   . PHE B 1 274 ? -21.275 -31.181 6.780   1.00 69.90  ? 635 PHE B CA   1 
ATOM   8903 C  C    . PHE B 1 274 ? -20.728 -32.343 7.593   1.00 77.29  ? 635 PHE B C    1 
ATOM   8904 O  O    . PHE B 1 274 ? -19.575 -32.316 8.018   1.00 77.05  ? 635 PHE B O    1 
ATOM   8905 C  CB   . PHE B 1 274 ? -20.884 -31.340 5.310   1.00 73.66  ? 635 PHE B CB   1 
ATOM   8906 C  CG   . PHE B 1 274 ? -21.400 -30.246 4.419   1.00 75.47  ? 635 PHE B CG   1 
ATOM   8907 C  CD1  . PHE B 1 274 ? -20.794 -29.000 4.406   1.00 56.06  ? 635 PHE B CD1  1 
ATOM   8908 C  CD2  . PHE B 1 274 ? -22.478 -30.471 3.578   1.00 86.32  ? 635 PHE B CD2  1 
ATOM   8909 C  CE1  . PHE B 1 274 ? -21.260 -27.993 3.578   1.00 69.22  ? 635 PHE B CE1  1 
ATOM   8910 C  CE2  . PHE B 1 274 ? -22.951 -29.469 2.749   1.00 68.14  ? 635 PHE B CE2  1 
ATOM   8911 C  CZ   . PHE B 1 274 ? -22.341 -28.228 2.749   1.00 64.44  ? 635 PHE B CZ   1 
ATOM   8912 H  H    . PHE B 1 274 ? -19.969 -29.739 7.057   1.00 90.50  ? 635 PHE B H    1 
ATOM   8913 H  HA   . PHE B 1 274 ? -22.243 -31.191 6.843   1.00 83.88  ? 635 PHE B HA   1 
ATOM   8914 H  HB2  . PHE B 1 274 ? -19.917 -31.344 5.244   1.00 88.39  ? 635 PHE B HB2  1 
ATOM   8915 H  HB3  . PHE B 1 274 ? -21.239 -32.181 4.982   1.00 88.39  ? 635 PHE B HB3  1 
ATOM   8916 H  HD1  . PHE B 1 274 ? -20.066 -28.837 4.962   1.00 67.27  ? 635 PHE B HD1  1 
ATOM   8917 H  HD2  . PHE B 1 274 ? -22.892 -31.304 3.575   1.00 103.58 ? 635 PHE B HD2  1 
ATOM   8918 H  HE1  . PHE B 1 274 ? -20.848 -27.160 3.581   1.00 83.06  ? 635 PHE B HE1  1 
ATOM   8919 H  HE2  . PHE B 1 274 ? -23.678 -29.630 2.192   1.00 81.77  ? 635 PHE B HE2  1 
ATOM   8920 H  HZ   . PHE B 1 274 ? -22.657 -27.553 2.193   1.00 77.33  ? 635 PHE B HZ   1 
ATOM   8921 N  N    . GLN B 1 275 ? -21.550 -33.365 7.795   1.00 80.10  ? 636 GLN B N    1 
ATOM   8922 C  CA   . GLN B 1 275 ? -21.134 -34.538 8.550   1.00 88.74  ? 636 GLN B CA   1 
ATOM   8923 C  C    . GLN B 1 275 ? -20.441 -35.535 7.629   1.00 90.27  ? 636 GLN B C    1 
ATOM   8924 O  O    . GLN B 1 275 ? -20.914 -35.815 6.525   1.00 68.43  ? 636 GLN B O    1 
ATOM   8925 C  CB   . GLN B 1 275 ? -22.337 -35.182 9.242   1.00 109.34 ? 636 GLN B CB   1 
ATOM   8926 C  CG   . GLN B 1 275 ? -22.917 -34.325 10.359  1.00 111.57 ? 636 GLN B CG   1 
ATOM   8927 C  CD   . GLN B 1 275 ? -24.076 -34.989 11.080  1.00 131.81 ? 636 GLN B CD   1 
ATOM   8928 O  OE1  . GLN B 1 275 ? -24.605 -36.008 10.631  1.00 121.92 ? 636 GLN B OE1  1 
ATOM   8929 N  NE2  . GLN B 1 275 ? -24.479 -34.411 12.207  1.00 137.65 ? 636 GLN B NE2  1 
ATOM   8930 H  H    . GLN B 1 275 ? -22.358 -33.404 7.503   1.00 96.12  ? 636 GLN B H    1 
ATOM   8931 H  HA   . GLN B 1 275 ? -20.501 -34.268 9.234   1.00 106.49 ? 636 GLN B HA   1 
ATOM   8932 H  HB2  . GLN B 1 275 ? -23.036 -35.329 8.585   1.00 131.20 ? 636 GLN B HB2  1 
ATOM   8933 H  HB3  . GLN B 1 275 ? -22.062 -36.029 9.627   1.00 131.20 ? 636 GLN B HB3  1 
ATOM   8934 H  HG2  . GLN B 1 275 ? -22.222 -34.147 11.011  1.00 133.88 ? 636 GLN B HG2  1 
ATOM   8935 H  HG3  . GLN B 1 275 ? -23.239 -33.491 9.981   1.00 133.88 ? 636 GLN B HG3  1 
ATOM   8936 H  HE21 . GLN B 1 275 ? -24.086 -33.700 12.489  1.00 165.18 ? 636 GLN B HE21 1 
ATOM   8937 H  HE22 . GLN B 1 275 ? -25.132 -34.747 12.654  1.00 165.18 ? 636 GLN B HE22 1 
ATOM   8938 N  N    . LEU B 1 276 ? -19.309 -36.061 8.084   1.00 69.73  ? 637 LEU B N    1 
ATOM   8939 C  CA   . LEU B 1 276 ? -18.520 -36.978 7.277   1.00 68.73  ? 637 LEU B CA   1 
ATOM   8940 C  C    . LEU B 1 276 ? -19.018 -38.412 7.420   1.00 83.44  ? 637 LEU B C    1 
ATOM   8941 O  O    . LEU B 1 276 ? -19.073 -38.959 8.521   1.00 81.01  ? 637 LEU B O    1 
ATOM   8942 C  CB   . LEU B 1 276 ? -17.046 -36.874 7.663   1.00 70.88  ? 637 LEU B CB   1 
ATOM   8943 C  CG   . LEU B 1 276 ? -16.371 -35.596 7.154   1.00 73.44  ? 637 LEU B CG   1 
ATOM   8944 C  CD1  . LEU B 1 276 ? -15.106 -35.284 7.936   1.00 75.56  ? 637 LEU B CD1  1 
ATOM   8945 C  CD2  . LEU B 1 276 ? -16.061 -35.721 5.672   1.00 70.54  ? 637 LEU B CD2  1 
ATOM   8946 H  H    . LEU B 1 276 ? -18.977 -35.901 8.861   1.00 83.67  ? 637 LEU B H    1 
ATOM   8947 H  HA   . LEU B 1 276 ? -18.603 -36.726 6.344   1.00 82.48  ? 637 LEU B HA   1 
ATOM   8948 H  HB2  . LEU B 1 276 ? -16.974 -36.883 8.631   1.00 85.06  ? 637 LEU B HB2  1 
ATOM   8949 H  HB3  . LEU B 1 276 ? -16.569 -37.631 7.290   1.00 85.06  ? 637 LEU B HB3  1 
ATOM   8950 H  HG   . LEU B 1 276 ? -16.982 -34.851 7.268   1.00 88.13  ? 637 LEU B HG   1 
ATOM   8951 H  HD11 . LEU B 1 276 ? -14.710 -34.472 7.585   1.00 90.67  ? 637 LEU B HD11 1 
ATOM   8952 H  HD12 . LEU B 1 276 ? -15.336 -35.164 8.871   1.00 90.67  ? 637 LEU B HD12 1 
ATOM   8953 H  HD13 . LEU B 1 276 ? -14.486 -36.024 7.840   1.00 90.67  ? 637 LEU B HD13 1 
ATOM   8954 H  HD21 . LEU B 1 276 ? -15.635 -34.904 5.369   1.00 84.64  ? 637 LEU B HD21 1 
ATOM   8955 H  HD22 . LEU B 1 276 ? -15.466 -36.475 5.537   1.00 84.64  ? 637 LEU B HD22 1 
ATOM   8956 H  HD23 . LEU B 1 276 ? -16.889 -35.862 5.187   1.00 84.64  ? 637 LEU B HD23 1 
ATOM   8957 N  N    . SER B 1 277 ? -19.401 -39.007 6.294   1.00 85.76  ? 638 SER B N    1 
ATOM   8958 C  CA   . SER B 1 277 ? -19.883 -40.380 6.279   1.00 86.82  ? 638 SER B CA   1 
ATOM   8959 C  C    . SER B 1 277 ? -18.710 -41.337 6.146   1.00 86.41  ? 638 SER B C    1 
ATOM   8960 O  O    . SER B 1 277 ? -17.667 -40.979 5.605   1.00 95.10  ? 638 SER B O    1 
ATOM   8961 C  CB   . SER B 1 277 ? -20.883 -40.588 5.142   1.00 94.45  ? 638 SER B CB   1 
ATOM   8962 O  OG   . SER B 1 277 ? -21.955 -39.667 5.249   1.00 98.77  ? 638 SER B OG   1 
ATOM   8963 H  H    . SER B 1 277 ? -19.390 -38.632 5.520   1.00 102.92 ? 638 SER B H    1 
ATOM   8964 H  HA   . SER B 1 277 ? -20.335 -40.569 7.117   1.00 104.19 ? 638 SER B HA   1 
ATOM   8965 H  HB2  . SER B 1 277 ? -20.431 -40.451 4.295   1.00 113.34 ? 638 SER B HB2  1 
ATOM   8966 H  HB3  . SER B 1 277 ? -21.234 -41.490 5.190   1.00 113.34 ? 638 SER B HB3  1 
ATOM   8967 H  HG   . SER B 1 277 ? -22.500 -39.786 4.621   1.00 118.52 ? 638 SER B HG   1 
ATOM   8968 N  N    . ASN B 1 278 ? -18.886 -42.551 6.655   1.00 110.17 ? 639 ASN B N    1 
ATOM   8969 C  CA   . ASN B 1 278 ? -17.814 -43.537 6.692   1.00 109.82 ? 639 ASN B CA   1 
ATOM   8970 C  C    . ASN B 1 278 ? -16.629 -43.014 7.504   1.00 103.60 ? 639 ASN B C    1 
ATOM   8971 O  O    . ASN B 1 278 ? -15.488 -43.426 7.293   1.00 96.72  ? 639 ASN B O    1 
ATOM   8972 C  CB   . ASN B 1 278 ? -17.374 -43.899 5.270   1.00 108.77 ? 639 ASN B CB   1 
ATOM   8973 C  CG   . ASN B 1 278 ? -16.801 -45.303 5.167   1.00 121.09 ? 639 ASN B CG   1 
ATOM   8974 O  OD1  . ASN B 1 278 ? -17.087 -46.171 5.993   1.00 139.54 ? 639 ASN B OD1  1 
ATOM   8975 N  ND2  . ASN B 1 278 ? -15.994 -45.534 4.140   1.00 114.24 ? 639 ASN B ND2  1 
ATOM   8976 H  H    . ASN B 1 278 ? -19.627 -42.831 6.990   1.00 132.20 ? 639 ASN B H    1 
ATOM   8977 H  HA   . ASN B 1 278 ? -18.140 -44.344 7.120   1.00 131.78 ? 639 ASN B HA   1 
ATOM   8978 H  HB2  . ASN B 1 278 ? -18.141 -43.844 4.678   1.00 130.53 ? 639 ASN B HB2  1 
ATOM   8979 H  HB3  . ASN B 1 278 ? -16.689 -43.274 4.983   1.00 130.53 ? 639 ASN B HB3  1 
ATOM   8980 H  HD21 . ASN B 1 278 ? -15.643 -46.312 4.035   1.00 137.09 ? 639 ASN B HD21 1 
ATOM   8981 H  HD22 . ASN B 1 278 ? -15.822 -44.906 3.578   1.00 137.09 ? 639 ASN B HD22 1 
ATOM   8982 N  N    . SER B 1 279 ? -16.916 -42.107 8.437   1.00 84.43  ? 640 SER B N    1 
ATOM   8983 C  CA   . SER B 1 279 ? -15.888 -41.464 9.251   1.00 84.86  ? 640 SER B CA   1 
ATOM   8984 C  C    . SER B 1 279 ? -16.136 -41.710 10.732  1.00 109.48 ? 640 SER B C    1 
ATOM   8985 O  O    . SER B 1 279 ? -16.747 -42.711 11.115  1.00 102.53 ? 640 SER B O    1 
ATOM   8986 C  CB   . SER B 1 279 ? -15.858 -39.957 8.980   1.00 95.93  ? 640 SER B CB   1 
ATOM   8987 O  OG   . SER B 1 279 ? -14.690 -39.358 9.516   1.00 86.76  ? 640 SER B OG   1 
ATOM   8988 H  H    . SER B 1 279 ? -17.714 -41.843 8.619   1.00 101.31 ? 640 SER B H    1 
ATOM   8989 H  HA   . SER B 1 279 ? -15.020 -41.832 9.022   1.00 101.83 ? 640 SER B HA   1 
ATOM   8990 H  HB2  . SER B 1 279 ? -15.875 -39.810 8.021   1.00 115.11 ? 640 SER B HB2  1 
ATOM   8991 H  HB3  . SER B 1 279 ? -16.637 -39.549 9.390   1.00 115.11 ? 640 SER B HB3  1 
ATOM   8992 H  HG   . SER B 1 279 ? -14.006 -39.701 9.169   1.00 104.11 ? 640 SER B HG   1 
ATOM   8993 N  N    . GLY B 1 280 ? -15.656 -40.794 11.566  1.00 96.35  ? 641 GLY B N    1 
ATOM   8994 C  CA   . GLY B 1 280 ? -15.980 -40.825 12.977  1.00 91.67  ? 641 GLY B CA   1 
ATOM   8995 C  C    . GLY B 1 280 ? -17.444 -40.462 13.144  1.00 97.80  ? 641 GLY B C    1 
ATOM   8996 O  O    . GLY B 1 280 ? -18.033 -39.857 12.245  1.00 88.14  ? 641 GLY B O    1 
ATOM   8997 H  H    . GLY B 1 280 ? -15.140 -40.145 11.336  1.00 115.62 ? 641 GLY B H    1 
ATOM   8998 H  HA2  . GLY B 1 280 ? -15.828 -41.713 13.336  1.00 110.00 ? 641 GLY B HA2  1 
ATOM   8999 H  HA3  . GLY B 1 280 ? -15.435 -40.186 13.461  1.00 110.00 ? 641 GLY B HA3  1 
ATOM   9000 N  N    . PRO B 1 281 ? -18.048 -40.841 14.284  1.00 96.94  ? 642 PRO B N    1 
ATOM   9001 C  CA   . PRO B 1 281 ? -19.461 -40.524 14.533  1.00 97.88  ? 642 PRO B CA   1 
ATOM   9002 C  C    . PRO B 1 281 ? -19.781 -39.026 14.488  1.00 93.49  ? 642 PRO B C    1 
ATOM   9003 O  O    . PRO B 1 281 ? -20.924 -38.666 14.204  1.00 92.82  ? 642 PRO B O    1 
ATOM   9004 C  CB   . PRO B 1 281 ? -19.700 -41.078 15.943  1.00 104.10 ? 642 PRO B CB   1 
ATOM   9005 C  CG   . PRO B 1 281 ? -18.693 -42.150 16.106  1.00 107.31 ? 642 PRO B CG   1 
ATOM   9006 C  CD   . PRO B 1 281 ? -17.486 -41.718 15.329  1.00 102.51 ? 642 PRO B CD   1 
ATOM   9007 H  HA   . PRO B 1 281 ? -20.029 -40.994 13.902  1.00 117.46 ? 642 PRO B HA   1 
ATOM   9008 H  HB2  . PRO B 1 281 ? -19.564 -40.376 16.598  1.00 124.92 ? 642 PRO B HB2  1 
ATOM   9009 H  HB3  . PRO B 1 281 ? -20.599 -41.439 16.005  1.00 124.92 ? 642 PRO B HB3  1 
ATOM   9010 H  HG2  . PRO B 1 281 ? -18.474 -42.248 17.046  1.00 128.77 ? 642 PRO B HG2  1 
ATOM   9011 H  HG3  . PRO B 1 281 ? -19.045 -42.982 15.751  1.00 128.77 ? 642 PRO B HG3  1 
ATOM   9012 H  HD2  . PRO B 1 281 ? -16.879 -41.220 15.897  1.00 123.02 ? 642 PRO B HD2  1 
ATOM   9013 H  HD3  . PRO B 1 281 ? -17.050 -42.485 14.928  1.00 123.02 ? 642 PRO B HD3  1 
ATOM   9014 N  N    . ASN B 1 282 ? -18.788 -38.180 14.764  1.00 90.90  ? 643 ASN B N    1 
ATOM   9015 C  CA   . ASN B 1 282 ? -18.999 -36.733 14.856  1.00 117.50 ? 643 ASN B CA   1 
ATOM   9016 C  C    . ASN B 1 282 ? -18.026 -35.907 14.000  1.00 103.87 ? 643 ASN B C    1 
ATOM   9017 O  O    . ASN B 1 282 ? -17.874 -34.701 14.203  1.00 79.41  ? 643 ASN B O    1 
ATOM   9018 C  CB   . ASN B 1 282 ? -18.888 -36.291 16.316  1.00 90.32  ? 643 ASN B CB   1 
ATOM   9019 C  CG   . ASN B 1 282 ? -19.608 -37.233 17.266  1.00 102.43 ? 643 ASN B CG   1 
ATOM   9020 O  OD1  . ASN B 1 282 ? -18.990 -38.098 17.888  1.00 100.66 ? 643 ASN B OD1  1 
ATOM   9021 N  ND2  . ASN B 1 282 ? -20.921 -37.074 17.377  1.00 97.60  ? 643 ASN B ND2  1 
ATOM   9022 H  H    . ASN B 1 282 ? -17.975 -38.422 14.904  1.00 109.08 ? 643 ASN B H    1 
ATOM   9023 H  HA   . ASN B 1 282 ? -19.898 -36.532 14.554  1.00 141.00 ? 643 ASN B HA   1 
ATOM   9024 H  HB2  . ASN B 1 282 ? -17.952 -36.266 16.570  1.00 108.38 ? 643 ASN B HB2  1 
ATOM   9025 H  HB3  . ASN B 1 282 ? -19.282 -35.410 16.411  1.00 108.38 ? 643 ASN B HB3  1 
ATOM   9026 H  HD21 . ASN B 1 282 ? -21.373 -37.583 17.902  1.00 117.12 ? 643 ASN B HD21 1 
ATOM   9027 H  HD22 . ASN B 1 282 ? -21.320 -36.462 16.924  1.00 117.12 ? 643 ASN B HD22 1 
ATOM   9028 N  N    . SER B 1 283 ? -17.369 -36.556 13.047  1.00 103.22 ? 644 SER B N    1 
ATOM   9029 C  CA   . SER B 1 283 ? -16.444 -35.864 12.157  1.00 97.47  ? 644 SER B CA   1 
ATOM   9030 C  C    . SER B 1 283 ? -17.209 -34.917 11.235  1.00 73.69  ? 644 SER B C    1 
ATOM   9031 O  O    . SER B 1 283 ? -18.187 -35.327 10.614  1.00 81.66  ? 644 SER B O    1 
ATOM   9032 C  CB   . SER B 1 283 ? -15.645 -36.876 11.338  1.00 105.25 ? 644 SER B CB   1 
ATOM   9033 O  OG   . SER B 1 283 ? -15.136 -37.903 12.170  1.00 119.43 ? 644 SER B OG   1 
ATOM   9034 H  H    . SER B 1 283 ? -17.441 -37.399 12.894  1.00 123.87 ? 644 SER B H    1 
ATOM   9035 H  HA   . SER B 1 283 ? -15.822 -35.339 12.685  1.00 116.96 ? 644 SER B HA   1 
ATOM   9036 H  HB2  . SER B 1 283 ? -16.226 -37.270 10.669  1.00 126.30 ? 644 SER B HB2  1 
ATOM   9037 H  HB3  . SER B 1 283 ? -14.905 -36.421 10.908  1.00 126.30 ? 644 SER B HB3  1 
ATOM   9038 H  HG   . SER B 1 283 ? -14.631 -37.575 12.755  1.00 143.31 ? 644 SER B HG   1 
ATOM   9039 N  N    . THR B 1 284 ? -16.777 -33.658 11.156  1.00 68.29  ? 645 THR B N    1 
ATOM   9040 C  CA   . THR B 1 284 ? -17.430 -32.677 10.282  1.00 81.78  ? 645 THR B CA   1 
ATOM   9041 C  C    . THR B 1 284 ? -16.435 -31.821 9.488   1.00 76.66  ? 645 THR B C    1 
ATOM   9042 O  O    . THR B 1 284 ? -15.286 -31.645 9.894   1.00 65.67  ? 645 THR B O    1 
ATOM   9043 C  CB   . THR B 1 284 ? -18.343 -31.727 11.086  1.00 72.81  ? 645 THR B CB   1 
ATOM   9044 O  OG1  . THR B 1 284 ? -17.542 -30.817 11.850  1.00 90.68  ? 645 THR B OG1  1 
ATOM   9045 C  CG2  . THR B 1 284 ? -19.254 -32.512 12.020  1.00 92.92  ? 645 THR B CG2  1 
ATOM   9046 H  H    . THR B 1 284 ? -16.108 -33.345 11.597  1.00 81.95  ? 645 THR B H    1 
ATOM   9047 H  HA   . THR B 1 284 ? -17.986 -33.151 9.645   1.00 98.13  ? 645 THR B HA   1 
ATOM   9048 H  HB   . THR B 1 284 ? -18.900 -31.224 10.472  1.00 87.37  ? 645 THR B HB   1 
ATOM   9049 H  HG1  . THR B 1 284 ? -18.035 -30.299 12.289  1.00 108.82 ? 645 THR B HG1  1 
ATOM   9050 H  HG21 . THR B 1 284 ? -19.821 -31.903 12.518  1.00 111.50 ? 645 THR B HG21 1 
ATOM   9051 H  HG22 . THR B 1 284 ? -19.813 -33.116 11.507  1.00 111.50 ? 645 THR B HG22 1 
ATOM   9052 H  HG23 . THR B 1 284 ? -18.722 -33.029 12.644  1.00 111.50 ? 645 THR B HG23 1 
ATOM   9053 N  N    . ILE B 1 285 ? -16.897 -31.285 8.358   1.00 57.91  ? 646 ILE B N    1 
ATOM   9054 C  CA   . ILE B 1 285 ? -16.077 -30.429 7.502   1.00 65.87  ? 646 ILE B CA   1 
ATOM   9055 C  C    . ILE B 1 285 ? -16.856 -29.168 7.110   1.00 55.98  ? 646 ILE B C    1 
ATOM   9056 O  O    . ILE B 1 285 ? -18.009 -29.245 6.683   1.00 51.86  ? 646 ILE B O    1 
ATOM   9057 C  CB   . ILE B 1 285 ? -15.611 -31.193 6.243   1.00 52.05  ? 646 ILE B CB   1 
ATOM   9058 C  CG1  . ILE B 1 285 ? -14.606 -30.362 5.449   1.00 62.13  ? 646 ILE B CG1  1 
ATOM   9059 C  CG2  . ILE B 1 285 ? -16.800 -31.592 5.364   1.00 68.17  ? 646 ILE B CG2  1 
ATOM   9060 C  CD1  . ILE B 1 285 ? -13.856 -31.176 4.432   1.00 61.20  ? 646 ILE B CD1  1 
ATOM   9061 H  H    . ILE B 1 285 ? -17.695 -31.405 8.061   1.00 69.49  ? 646 ILE B H    1 
ATOM   9062 H  HA   . ILE B 1 285 ? -15.288 -30.154 7.994   1.00 79.04  ? 646 ILE B HA   1 
ATOM   9063 H  HB   . ILE B 1 285 ? -15.167 -32.005 6.533   1.00 62.46  ? 646 ILE B HB   1 
ATOM   9064 H  HG12 . ILE B 1 285 ? -15.078 -29.657 4.980   1.00 74.55  ? 646 ILE B HG12 1 
ATOM   9065 H  HG13 . ILE B 1 285 ? -13.959 -29.977 6.062   1.00 74.55  ? 646 ILE B HG13 1 
ATOM   9066 H  HG21 . ILE B 1 285 ? -16.471 -32.068 4.585   1.00 81.81  ? 646 ILE B HG21 1 
ATOM   9067 H  HG22 . ILE B 1 285 ? -17.393 -32.165 5.876   1.00 81.81  ? 646 ILE B HG22 1 
ATOM   9068 H  HG23 . ILE B 1 285 ? -17.271 -30.791 5.087   1.00 81.81  ? 646 ILE B HG23 1 
ATOM   9069 H  HD11 . ILE B 1 285 ? -13.235 -30.599 3.961   1.00 73.44  ? 646 ILE B HD11 1 
ATOM   9070 H  HD12 . ILE B 1 285 ? -13.371 -31.882 4.888   1.00 73.44  ? 646 ILE B HD12 1 
ATOM   9071 H  HD13 . ILE B 1 285 ? -14.490 -31.561 3.806   1.00 73.44  ? 646 ILE B HD13 1 
ATOM   9072 N  N    . LYS B 1 286 ? -16.227 -28.007 7.283   1.00 50.99  ? 647 LYS B N    1 
ATOM   9073 C  CA   . LYS B 1 286 ? -16.900 -26.724 7.072   1.00 65.04  ? 647 LYS B CA   1 
ATOM   9074 C  C    . LYS B 1 286 ? -16.584 -26.142 5.697   1.00 50.46  ? 647 LYS B C    1 
ATOM   9075 O  O    . LYS B 1 286 ? -15.426 -25.863 5.394   1.00 56.62  ? 647 LYS B O    1 
ATOM   9076 C  CB   . LYS B 1 286 ? -16.489 -25.734 8.161   1.00 55.69  ? 647 LYS B CB   1 
ATOM   9077 C  CG   . LYS B 1 286 ? -17.187 -24.380 8.105   1.00 54.17  ? 647 LYS B CG   1 
ATOM   9078 C  CD   . LYS B 1 286 ? -16.643 -23.465 9.200   1.00 86.32  ? 647 LYS B CD   1 
ATOM   9079 C  CE   . LYS B 1 286 ? -17.091 -22.023 9.032   1.00 90.36  ? 647 LYS B CE   1 
ATOM   9080 N  NZ   . LYS B 1 286 ? -18.568 -21.891 9.073   1.00 108.76 ? 647 LYS B NZ   1 
ATOM   9081 H  H    . LYS B 1 286 ? -15.405 -27.934 7.523   1.00 61.19  ? 647 LYS B H    1 
ATOM   9082 H  HA   . LYS B 1 286 ? -17.859 -26.855 7.131   1.00 78.05  ? 647 LYS B HA   1 
ATOM   9083 H  HB2  . LYS B 1 286 ? -16.686 -26.128 9.026   1.00 66.82  ? 647 LYS B HB2  1 
ATOM   9084 H  HB3  . LYS B 1 286 ? -15.535 -25.573 8.087   1.00 66.82  ? 647 LYS B HB3  1 
ATOM   9085 H  HG2  . LYS B 1 286 ? -17.021 -23.965 7.245   1.00 65.00  ? 647 LYS B HG2  1 
ATOM   9086 H  HG3  . LYS B 1 286 ? -18.139 -24.500 8.248   1.00 65.00  ? 647 LYS B HG3  1 
ATOM   9087 H  HD2  . LYS B 1 286 ? -16.959 -23.779 10.062  1.00 103.58 ? 647 LYS B HD2  1 
ATOM   9088 H  HD3  . LYS B 1 286 ? -15.673 -23.483 9.175   1.00 103.58 ? 647 LYS B HD3  1 
ATOM   9089 H  HE2  . LYS B 1 286 ? -16.720 -21.488 9.751   1.00 108.44 ? 647 LYS B HE2  1 
ATOM   9090 H  HE3  . LYS B 1 286 ? -16.782 -21.692 8.174   1.00 108.44 ? 647 LYS B HE3  1 
ATOM   9091 H  HZ1  . LYS B 1 286 ? -18.934 -22.370 8.419   1.00 130.52 ? 647 LYS B HZ1  1 
ATOM   9092 H  HZ2  . LYS B 1 286 ? -18.877 -22.185 9.854   1.00 130.52 ? 647 LYS B HZ2  1 
ATOM   9093 H  HZ3  . LYS B 1 286 ? -18.799 -21.038 8.972   1.00 130.52 ? 647 LYS B HZ3  1 
ATOM   9094 N  N    . MET B 1 287 ? -17.621 -25.948 4.885   1.00 52.93  ? 648 MET B N    1 
ATOM   9095 C  CA   . MET B 1 287 ? -17.469 -25.443 3.519   1.00 44.64  ? 648 MET B CA   1 
ATOM   9096 C  C    . MET B 1 287 ? -18.476 -24.367 3.168   1.00 51.40  ? 648 MET B C    1 
ATOM   9097 O  O    . MET B 1 287 ? -19.564 -24.310 3.737   1.00 48.84  ? 648 MET B O    1 
ATOM   9098 C  CB   . MET B 1 287 ? -17.624 -26.572 2.508   1.00 43.95  ? 648 MET B CB   1 
ATOM   9099 C  CG   . MET B 1 287 ? -16.489 -27.564 2.481   1.00 48.21  ? 648 MET B CG   1 
ATOM   9100 S  SD   . MET B 1 287 ? -16.932 -28.899 1.365   1.00 56.29  ? 648 MET B SD   1 
ATOM   9101 C  CE   . MET B 1 287 ? -15.701 -30.108 1.761   1.00 65.99  ? 648 MET B CE   1 
ATOM   9102 H  H    . MET B 1 287 ? -18.438 -26.105 5.105   1.00 63.52  ? 648 MET B H    1 
ATOM   9103 H  HA   . MET B 1 287 ? -16.575 -25.077 3.421   1.00 53.57  ? 648 MET B HA   1 
ATOM   9104 H  HB2  . MET B 1 287 ? -18.435 -27.062 2.715   1.00 52.74  ? 648 MET B HB2  1 
ATOM   9105 H  HB3  . MET B 1 287 ? -17.695 -26.185 1.621   1.00 52.74  ? 648 MET B HB3  1 
ATOM   9106 H  HG2  . MET B 1 287 ? -15.683 -27.135 2.152   1.00 57.85  ? 648 MET B HG2  1 
ATOM   9107 H  HG3  . MET B 1 287 ? -16.349 -27.930 3.368   1.00 57.85  ? 648 MET B HG3  1 
ATOM   9108 H  HE1  . MET B 1 287 ? -15.841 -30.894 1.209   1.00 79.19  ? 648 MET B HE1  1 
ATOM   9109 H  HE2  . MET B 1 287 ? -14.823 -29.734 1.588   1.00 79.19  ? 648 MET B HE2  1 
ATOM   9110 H  HE3  . MET B 1 287 ? -15.781 -30.344 2.699   1.00 79.19  ? 648 MET B HE3  1 
ATOM   9111 N  N    . LYS B 1 288 ? -18.104 -23.531 2.203   1.00 44.58  ? 649 LYS B N    1 
ATOM   9112 C  CA   . LYS B 1 288 ? -19.041 -22.626 1.547   1.00 46.72  ? 649 LYS B CA   1 
ATOM   9113 C  C    . LYS B 1 288 ? -19.051 -22.974 0.059   1.00 54.33  ? 649 LYS B C    1 
ATOM   9114 O  O    . LYS B 1 288 ? -18.017 -22.934 -0.608  1.00 48.51  ? 649 LYS B O    1 
ATOM   9115 C  CB   . LYS B 1 288 ? -18.655 -21.162 1.774   1.00 48.10  ? 649 LYS B CB   1 
ATOM   9116 C  CG   . LYS B 1 288 ? -19.620 -20.157 1.165   1.00 51.39  ? 649 LYS B CG   1 
ATOM   9117 C  CD   . LYS B 1 288 ? -19.112 -18.733 1.338   1.00 67.14  ? 649 LYS B CD   1 
ATOM   9118 C  CE   . LYS B 1 288 ? -20.200 -17.711 1.049   1.00 86.52  ? 649 LYS B CE   1 
ATOM   9119 N  NZ   . LYS B 1 288 ? -19.694 -16.313 1.156   1.00 95.57  ? 649 LYS B NZ   1 
ATOM   9120 H  H    . LYS B 1 288 ? -17.299 -23.469 1.906   1.00 53.49  ? 649 LYS B H    1 
ATOM   9121 H  HA   . LYS B 1 288 ? -19.932 -22.769 1.903   1.00 56.06  ? 649 LYS B HA   1 
ATOM   9122 H  HB2  . LYS B 1 288 ? -18.620 -20.995 2.729   1.00 57.72  ? 649 LYS B HB2  1 
ATOM   9123 H  HB3  . LYS B 1 288 ? -17.781 -21.007 1.383   1.00 57.72  ? 649 LYS B HB3  1 
ATOM   9124 H  HG2  . LYS B 1 288 ? -19.712 -20.335 0.216   1.00 61.66  ? 649 LYS B HG2  1 
ATOM   9125 H  HG3  . LYS B 1 288 ? -20.480 -20.229 1.607   1.00 61.66  ? 649 LYS B HG3  1 
ATOM   9126 H  HD2  . LYS B 1 288 ? -18.814 -18.608 2.252   1.00 80.57  ? 649 LYS B HD2  1 
ATOM   9127 H  HD3  . LYS B 1 288 ? -18.379 -18.578 0.722   1.00 80.57  ? 649 LYS B HD3  1 
ATOM   9128 H  HE2  . LYS B 1 288 ? -20.531 -17.844 0.147   1.00 103.83 ? 649 LYS B HE2  1 
ATOM   9129 H  HE3  . LYS B 1 288 ? -20.920 -17.822 1.689   1.00 103.83 ? 649 LYS B HE3  1 
ATOM   9130 H  HZ1  . LYS B 1 288 ? -20.350 -15.738 0.983   1.00 114.68 ? 649 LYS B HZ1  1 
ATOM   9131 H  HZ2  . LYS B 1 288 ? -19.387 -16.164 1.979   1.00 114.68 ? 649 LYS B HZ2  1 
ATOM   9132 H  HZ3  . LYS B 1 288 ? -19.033 -16.184 0.574   1.00 114.68 ? 649 LYS B HZ3  1 
ATOM   9133 N  N    . ILE B 1 289 ? -20.224 -23.347 -0.438  1.00 44.60  ? 650 ILE B N    1 
ATOM   9134 C  CA   . ILE B 1 289 ? -20.377 -23.844 -1.799  1.00 48.50  ? 650 ILE B CA   1 
ATOM   9135 C  C    . ILE B 1 289 ? -21.359 -22.978 -2.552  1.00 64.13  ? 650 ILE B C    1 
ATOM   9136 O  O    . ILE B 1 289 ? -22.467 -22.748 -2.077  1.00 50.32  ? 650 ILE B O    1 
ATOM   9137 C  CB   . ILE B 1 289 ? -20.883 -25.293 -1.826  1.00 53.01  ? 650 ILE B CB   1 
ATOM   9138 C  CG1  . ILE B 1 289 ? -19.929 -26.204 -1.060  1.00 61.72  ? 650 ILE B CG1  1 
ATOM   9139 C  CG2  . ILE B 1 289 ? -21.029 -25.768 -3.264  1.00 52.37  ? 650 ILE B CG2  1 
ATOM   9140 C  CD1  . ILE B 1 289 ? -20.453 -27.607 -0.864  1.00 76.17  ? 650 ILE B CD1  1 
ATOM   9141 H  H    . ILE B 1 289 ? -20.962 -23.320 0.003   1.00 53.52  ? 650 ILE B H    1 
ATOM   9142 H  HA   . ILE B 1 289 ? -19.522 -23.808 -2.254  1.00 58.20  ? 650 ILE B HA   1 
ATOM   9143 H  HB   . ILE B 1 289 ? -21.753 -25.325 -1.399  1.00 63.61  ? 650 ILE B HB   1 
ATOM   9144 H  HG12 . ILE B 1 289 ? -19.093 -26.265 -1.549  1.00 74.06  ? 650 ILE B HG12 1 
ATOM   9145 H  HG13 . ILE B 1 289 ? -19.769 -25.822 -0.182  1.00 74.06  ? 650 ILE B HG13 1 
ATOM   9146 H  HG21 . ILE B 1 289 ? -21.349 -26.684 -3.262  1.00 62.84  ? 650 ILE B HG21 1 
ATOM   9147 H  HG22 . ILE B 1 289 ? -21.664 -25.196 -3.722  1.00 62.84  ? 650 ILE B HG22 1 
ATOM   9148 H  HG23 . ILE B 1 289 ? -20.165 -25.721 -3.701  1.00 62.84  ? 650 ILE B HG23 1 
ATOM   9149 H  HD11 . ILE B 1 289 ? -19.796 -28.124 -0.372  1.00 91.41  ? 650 ILE B HD11 1 
ATOM   9150 H  HD12 . ILE B 1 289 ? -21.284 -27.567 -0.365  1.00 91.41  ? 650 ILE B HD12 1 
ATOM   9151 H  HD13 . ILE B 1 289 ? -20.608 -28.010 -1.733  1.00 91.41  ? 650 ILE B HD13 1 
ATOM   9152 N  N    . ALA B 1 290 ? -20.946 -22.512 -3.727  1.00 39.32  ? 651 ALA B N    1 
ATOM   9153 C  CA   . ALA B 1 290 ? -21.789 -21.678 -4.574  1.00 41.90  ? 651 ALA B CA   1 
ATOM   9154 C  C    . ALA B 1 290 ? -21.810 -22.220 -5.995  1.00 44.92  ? 651 ALA B C    1 
ATOM   9155 O  O    . ALA B 1 290 ? -20.766 -22.504 -6.578  1.00 43.63  ? 651 ALA B O    1 
ATOM   9156 C  CB   . ALA B 1 290 ? -21.300 -20.241 -4.563  1.00 46.57  ? 651 ALA B CB   1 
ATOM   9157 H  H    . ALA B 1 290 ? -20.168 -22.669 -4.060  1.00 47.19  ? 651 ALA B H    1 
ATOM   9158 H  HA   . ALA B 1 290 ? -22.697 -21.692 -4.232  1.00 50.28  ? 651 ALA B HA   1 
ATOM   9159 H  HB1  . ALA B 1 290 ? -21.876 -19.707 -5.132  1.00 55.88  ? 651 ALA B HB1  1 
ATOM   9160 H  HB2  . ALA B 1 290 ? -21.329 -19.905 -3.653  1.00 55.88  ? 651 ALA B HB2  1 
ATOM   9161 H  HB3  . ALA B 1 290 ? -20.389 -20.216 -4.896  1.00 55.88  ? 651 ALA B HB3  1 
ATOM   9162 N  N    . LEU B 1 291 ? -23.017 -22.369 -6.533  1.00 46.58  ? 652 LEU B N    1 
ATOM   9163 C  CA   . LEU B 1 291 ? -23.218 -22.839 -7.892  1.00 52.40  ? 652 LEU B CA   1 
ATOM   9164 C  C    . LEU B 1 291 ? -23.585 -21.657 -8.777  1.00 45.22  ? 652 LEU B C    1 
ATOM   9165 O  O    . LEU B 1 291 ? -24.267 -20.735 -8.332  1.00 56.31  ? 652 LEU B O    1 
ATOM   9166 C  CB   . LEU B 1 291 ? -24.313 -23.908 -7.932  1.00 49.00  ? 652 LEU B CB   1 
ATOM   9167 C  CG   . LEU B 1 291 ? -24.555 -24.596 -9.276  1.00 51.32  ? 652 LEU B CG   1 
ATOM   9168 C  CD1  . LEU B 1 291 ? -23.375 -25.476 -9.657  1.00 54.06  ? 652 LEU B CD1  1 
ATOM   9169 C  CD2  . LEU B 1 291 ? -25.834 -25.408 -9.225  1.00 55.99  ? 652 LEU B CD2  1 
ATOM   9170 H  H    . LEU B 1 291 ? -23.751 -22.199 -6.117  1.00 55.90  ? 652 LEU B H    1 
ATOM   9171 H  HA   . LEU B 1 291 ? -22.394 -23.230 -8.225  1.00 62.87  ? 652 LEU B HA   1 
ATOM   9172 H  HB2  . LEU B 1 291 ? -24.084 -24.600 -7.292  1.00 58.80  ? 652 LEU B HB2  1 
ATOM   9173 H  HB3  . LEU B 1 291 ? -25.149 -23.493 -7.668  1.00 58.80  ? 652 LEU B HB3  1 
ATOM   9174 H  HG   . LEU B 1 291 ? -24.657 -23.919 -9.963  1.00 61.59  ? 652 LEU B HG   1 
ATOM   9175 H  HD11 . LEU B 1 291 ? -23.558 -25.897 -10.511 1.00 64.88  ? 652 LEU B HD11 1 
ATOM   9176 H  HD12 . LEU B 1 291 ? -22.579 -24.925 -9.723  1.00 64.88  ? 652 LEU B HD12 1 
ATOM   9177 H  HD13 . LEU B 1 291 ? -23.253 -26.153 -8.973  1.00 64.88  ? 652 LEU B HD13 1 
ATOM   9178 H  HD21 . LEU B 1 291 ? -25.971 -25.836 -10.084 1.00 67.19  ? 652 LEU B HD21 1 
ATOM   9179 H  HD22 . LEU B 1 291 ? -25.754 -26.079 -8.529  1.00 67.19  ? 652 LEU B HD22 1 
ATOM   9180 H  HD23 . LEU B 1 291 ? -26.576 -24.815 -9.029  1.00 67.19  ? 652 LEU B HD23 1 
ATOM   9181 N  N    . ARG B 1 292 ? -23.115 -21.681 -10.020 1.00 50.80  ? 653 ARG B N    1 
ATOM   9182 C  CA   . ARG B 1 292 ? -23.464 -20.654 -10.995 1.00 49.99  ? 653 ARG B CA   1 
ATOM   9183 C  C    . ARG B 1 292 ? -23.729 -21.281 -12.354 1.00 46.46  ? 653 ARG B C    1 
ATOM   9184 O  O    . ARG B 1 292 ? -22.849 -21.918 -12.934 1.00 46.33  ? 653 ARG B O    1 
ATOM   9185 C  CB   . ARG B 1 292 ? -22.356 -19.603 -11.110 1.00 50.27  ? 653 ARG B CB   1 
ATOM   9186 C  CG   . ARG B 1 292 ? -22.177 -18.755 -9.873  1.00 60.84  ? 653 ARG B CG   1 
ATOM   9187 C  CD   . ARG B 1 292 ? -23.418 -17.937 -9.588  1.00 73.80  ? 653 ARG B CD   1 
ATOM   9188 N  NE   . ARG B 1 292 ? -23.602 -17.684 -8.164  1.00 78.40  ? 653 ARG B NE   1 
ATOM   9189 C  CZ   . ARG B 1 292 ? -23.131 -16.620 -7.529  1.00 61.42  ? 653 ARG B CZ   1 
ATOM   9190 N  NH1  . ARG B 1 292 ? -22.431 -15.699 -8.183  1.00 80.32  ? 653 ARG B NH1  1 
ATOM   9191 N  NH2  . ARG B 1 292 ? -23.365 -16.477 -6.238  1.00 58.68  ? 653 ARG B NH2  1 
ATOM   9192 H  H    . ARG B 1 292 ? -22.587 -22.288 -10.326 1.00 60.96  ? 653 ARG B H    1 
ATOM   9193 H  HA   . ARG B 1 292 ? -24.275 -20.206 -10.707 1.00 59.99  ? 653 ARG B HA   1 
ATOM   9194 H  HB2  . ARG B 1 292 ? -21.515 -20.055 -11.282 1.00 60.32  ? 653 ARG B HB2  1 
ATOM   9195 H  HB3  . ARG B 1 292 ? -22.565 -19.009 -11.847 1.00 60.32  ? 653 ARG B HB3  1 
ATOM   9196 H  HG2  . ARG B 1 292 ? -22.008 -19.330 -9.111  1.00 73.01  ? 653 ARG B HG2  1 
ATOM   9197 H  HG3  . ARG B 1 292 ? -21.434 -18.145 -10.006 1.00 73.01  ? 653 ARG B HG3  1 
ATOM   9198 H  HD2  . ARG B 1 292 ? -23.344 -17.081 -10.038 1.00 88.56  ? 653 ARG B HD2  1 
ATOM   9199 H  HD3  . ARG B 1 292 ? -24.196 -18.417 -9.911  1.00 88.56  ? 653 ARG B HD3  1 
ATOM   9200 H  HE   . ARG B 1 292 ? -24.044 -18.263 -7.707  1.00 94.08  ? 653 ARG B HE   1 
ATOM   9201 H  HH11 . ARG B 1 292 ? -22.282 -15.790 -9.025  1.00 96.39  ? 653 ARG B HH11 1 
ATOM   9202 H  HH12 . ARG B 1 292 ? -22.127 -15.012 -7.764  1.00 96.39  ? 653 ARG B HH12 1 
ATOM   9203 H  HH21 . ARG B 1 292 ? -23.816 -17.074 -5.814  1.00 70.42  ? 653 ARG B HH21 1 
ATOM   9204 H  HH22 . ARG B 1 292 ? -23.058 -15.792 -5.819  1.00 70.42  ? 653 ARG B HH22 1 
ATOM   9205 N  N    . VAL B 1 293 ? -24.953 -21.105 -12.840 1.00 53.00  ? 654 VAL B N    1 
ATOM   9206 C  CA   . VAL B 1 293 ? -25.351 -21.620 -14.142 1.00 50.28  ? 654 VAL B CA   1 
ATOM   9207 C  C    . VAL B 1 293 ? -24.769 -20.746 -15.244 1.00 55.30  ? 654 VAL B C    1 
ATOM   9208 O  O    . VAL B 1 293 ? -24.725 -19.521 -15.123 1.00 55.87  ? 654 VAL B O    1 
ATOM   9209 C  CB   . VAL B 1 293 ? -26.887 -21.689 -14.263 1.00 49.49  ? 654 VAL B CB   1 
ATOM   9210 C  CG1  . VAL B 1 293 ? -27.330 -21.890 -15.718 1.00 54.91  ? 654 VAL B CG1  1 
ATOM   9211 C  CG2  . VAL B 1 293 ? -27.415 -22.797 -13.380 1.00 62.32  ? 654 VAL B CG2  1 
ATOM   9212 H  H    . VAL B 1 293 ? -25.580 -20.685 -12.427 1.00 63.60  ? 654 VAL B H    1 
ATOM   9213 H  HA   . VAL B 1 293 ? -24.999 -22.517 -14.250 1.00 60.34  ? 654 VAL B HA   1 
ATOM   9214 H  HB   . VAL B 1 293 ? -27.265 -20.852 -13.949 1.00 59.39  ? 654 VAL B HB   1 
ATOM   9215 H  HG11 . VAL B 1 293 ? -28.299 -21.928 -15.750 1.00 65.90  ? 654 VAL B HG11 1 
ATOM   9216 H  HG12 . VAL B 1 293 ? -27.010 -21.145 -16.250 1.00 65.90  ? 654 VAL B HG12 1 
ATOM   9217 H  HG13 . VAL B 1 293 ? -26.955 -22.721 -16.049 1.00 65.90  ? 654 VAL B HG13 1 
ATOM   9218 H  HG21 . VAL B 1 293 ? -28.381 -22.833 -13.463 1.00 74.79  ? 654 VAL B HG21 1 
ATOM   9219 H  HG22 . VAL B 1 293 ? -27.027 -23.639 -13.665 1.00 74.79  ? 654 VAL B HG22 1 
ATOM   9220 H  HG23 . VAL B 1 293 ? -27.168 -22.613 -12.461 1.00 74.79  ? 654 VAL B HG23 1 
ATOM   9221 N  N    . LEU B 1 294 ? -24.311 -21.391 -16.312 1.00 54.41  ? 655 LEU B N    1 
ATOM   9222 C  CA   . LEU B 1 294 ? -23.666 -20.699 -17.420 1.00 58.88  ? 655 LEU B CA   1 
ATOM   9223 C  C    . LEU B 1 294 ? -24.672 -20.444 -18.534 1.00 58.98  ? 655 LEU B C    1 
ATOM   9224 O  O    . LEU B 1 294 ? -25.349 -21.360 -18.997 1.00 66.91  ? 655 LEU B O    1 
ATOM   9225 C  CB   . LEU B 1 294 ? -22.477 -21.511 -17.933 1.00 55.16  ? 655 LEU B CB   1 
ATOM   9226 C  CG   . LEU B 1 294 ? -21.362 -21.645 -16.896 1.00 62.23  ? 655 LEU B CG   1 
ATOM   9227 C  CD1  . LEU B 1 294 ? -20.385 -22.746 -17.283 1.00 61.54  ? 655 LEU B CD1  1 
ATOM   9228 C  CD2  . LEU B 1 294 ? -20.638 -20.315 -16.707 1.00 54.27  ? 655 LEU B CD2  1 
ATOM   9229 H  H    . LEU B 1 294 ? -24.364 -22.242 -16.419 1.00 65.30  ? 655 LEU B H    1 
ATOM   9230 H  HA   . LEU B 1 294 ? -23.334 -19.842 -17.111 1.00 70.66  ? 655 LEU B HA   1 
ATOM   9231 H  HB2  . LEU B 1 294 ? -22.780 -22.403 -18.164 1.00 66.19  ? 655 LEU B HB2  1 
ATOM   9232 H  HB3  . LEU B 1 294 ? -22.108 -21.073 -18.715 1.00 66.19  ? 655 LEU B HB3  1 
ATOM   9233 H  HG   . LEU B 1 294 ? -21.757 -21.888 -16.045 1.00 74.68  ? 655 LEU B HG   1 
ATOM   9234 H  HD11 . LEU B 1 294 ? -19.692 -22.804 -16.606 1.00 73.85  ? 655 LEU B HD11 1 
ATOM   9235 H  HD12 . LEU B 1 294 ? -20.864 -23.587 -17.339 1.00 73.85  ? 655 LEU B HD12 1 
ATOM   9236 H  HD13 . LEU B 1 294 ? -19.991 -22.530 -18.143 1.00 73.85  ? 655 LEU B HD13 1 
ATOM   9237 H  HD21 . LEU B 1 294 ? -19.937 -20.428 -16.046 1.00 65.12  ? 655 LEU B HD21 1 
ATOM   9238 H  HD22 . LEU B 1 294 ? -20.252 -20.042 -17.555 1.00 65.12  ? 655 LEU B HD22 1 
ATOM   9239 H  HD23 . LEU B 1 294 ? -21.275 -19.649 -16.404 1.00 65.12  ? 655 LEU B HD23 1 
ATOM   9240 N  N    . HIS B 1 295 ? -24.755 -19.189 -18.961 1.00 59.10  ? 656 HIS B N    1 
ATOM   9241 C  CA   . HIS B 1 295 ? -25.838 -18.746 -19.825 1.00 78.38  ? 656 HIS B CA   1 
ATOM   9242 C  C    . HIS B 1 295 ? -25.389 -17.657 -20.797 1.00 63.41  ? 656 HIS B C    1 
ATOM   9243 O  O    . HIS B 1 295 ? -24.642 -16.749 -20.429 1.00 59.92  ? 656 HIS B O    1 
ATOM   9244 C  CB   . HIS B 1 295 ? -26.996 -18.243 -18.963 1.00 90.43  ? 656 HIS B CB   1 
ATOM   9245 C  CG   . HIS B 1 295 ? -28.069 -17.542 -19.732 1.00 110.91 ? 656 HIS B CG   1 
ATOM   9246 N  ND1  . HIS B 1 295 ? -28.102 -16.173 -19.877 1.00 123.56 ? 656 HIS B ND1  1 
ATOM   9247 C  CD2  . HIS B 1 295 ? -29.153 -18.018 -20.390 1.00 114.92 ? 656 HIS B CD2  1 
ATOM   9248 C  CE1  . HIS B 1 295 ? -29.158 -15.834 -20.596 1.00 124.71 ? 656 HIS B CE1  1 
ATOM   9249 N  NE2  . HIS B 1 295 ? -29.811 -16.934 -20.919 1.00 122.35 ? 656 HIS B NE2  1 
ATOM   9250 H  H    . HIS B 1 295 ? -24.191 -18.571 -18.762 1.00 70.91  ? 656 HIS B H    1 
ATOM   9251 H  HA   . HIS B 1 295 ? -26.156 -19.500 -20.346 1.00 94.05  ? 656 HIS B HA   1 
ATOM   9252 H  HB2  . HIS B 1 295 ? -27.402 -19.001 -18.514 1.00 108.51 ? 656 HIS B HB2  1 
ATOM   9253 H  HB3  . HIS B 1 295 ? -26.648 -17.620 -18.306 1.00 108.51 ? 656 HIS B HB3  1 
ATOM   9254 H  HD1  . HIS B 1 295 ? -27.525 -15.624 -19.552 1.00 148.27 ? 656 HIS B HD1  1 
ATOM   9255 H  HD2  . HIS B 1 295 ? -29.403 -18.910 -20.471 1.00 137.91 ? 656 HIS B HD2  1 
ATOM   9256 H  HE1  . HIS B 1 295 ? -29.399 -14.968 -20.833 1.00 149.66 ? 656 HIS B HE1  1 
ATOM   9257 H  HE2  . HIS B 1 295 ? -30.532 -16.968 -21.386 1.00 146.82 ? 656 HIS B HE2  1 
ATOM   9258 N  N    . LEU B 1 296 ? -25.862 -17.759 -22.036 1.00 86.82  ? 657 LEU B N    1 
ATOM   9259 C  CA   . LEU B 1 296 ? -25.520 -16.812 -23.091 1.00 68.71  ? 657 LEU B CA   1 
ATOM   9260 C  C    . LEU B 1 296 ? -26.551 -15.687 -23.169 1.00 79.62  ? 657 LEU B C    1 
ATOM   9261 O  O    . LEU B 1 296 ? -27.707 -15.921 -23.522 1.00 96.18  ? 657 LEU B O    1 
ATOM   9262 C  CB   . LEU B 1 296 ? -25.422 -17.543 -24.438 1.00 83.00  ? 657 LEU B CB   1 
ATOM   9263 C  CG   . LEU B 1 296 ? -25.306 -16.726 -25.729 1.00 82.17  ? 657 LEU B CG   1 
ATOM   9264 C  CD1  . LEU B 1 296 ? -24.153 -15.740 -25.682 1.00 85.21  ? 657 LEU B CD1  1 
ATOM   9265 C  CD2  . LEU B 1 296 ? -25.139 -17.668 -26.909 1.00 95.48  ? 657 LEU B CD2  1 
ATOM   9266 H  H    . LEU B 1 296 ? -26.394 -18.383 -22.295 1.00 104.19 ? 657 LEU B H    1 
ATOM   9267 H  HA   . LEU B 1 296 ? -24.656 -16.417 -22.897 1.00 82.45  ? 657 LEU B HA   1 
ATOM   9268 H  HB2  . LEU B 1 296 ? -24.642 -18.119 -24.403 1.00 99.60  ? 657 LEU B HB2  1 
ATOM   9269 H  HB3  . LEU B 1 296 ? -26.214 -18.096 -24.530 1.00 99.60  ? 657 LEU B HB3  1 
ATOM   9270 H  HG   . LEU B 1 296 ? -26.125 -16.223 -25.859 1.00 98.60  ? 657 LEU B HG   1 
ATOM   9271 H  HD11 . LEU B 1 296 ? -24.123 -15.250 -26.518 1.00 102.25 ? 657 LEU B HD11 1 
ATOM   9272 H  HD12 . LEU B 1 296 ? -24.292 -15.127 -24.943 1.00 102.25 ? 657 LEU B HD12 1 
ATOM   9273 H  HD13 . LEU B 1 296 ? -23.325 -16.229 -25.554 1.00 102.25 ? 657 LEU B HD13 1 
ATOM   9274 H  HD21 . LEU B 1 296 ? -25.066 -17.144 -27.722 1.00 114.57 ? 657 LEU B HD21 1 
ATOM   9275 H  HD22 . LEU B 1 296 ? -24.335 -18.194 -26.781 1.00 114.57 ? 657 LEU B HD22 1 
ATOM   9276 H  HD23 . LEU B 1 296 ? -25.913 -18.251 -26.959 1.00 114.57 ? 657 LEU B HD23 1 
ATOM   9277 N  N    . GLU B 1 297 ? -26.122 -14.473 -22.833 1.00 75.03  ? 658 GLU B N    1 
ATOM   9278 C  CA   . GLU B 1 297 ? -26.971 -13.285 -22.935 1.00 85.70  ? 658 GLU B CA   1 
ATOM   9279 C  C    . GLU B 1 297 ? -26.624 -12.491 -24.187 1.00 106.17 ? 658 GLU B C    1 
ATOM   9280 O  O    . GLU B 1 297 ? -25.497 -12.559 -24.666 1.00 121.04 ? 658 GLU B O    1 
ATOM   9281 C  CB   . GLU B 1 297 ? -26.813 -12.404 -21.696 1.00 98.17  ? 658 GLU B CB   1 
ATOM   9282 C  CG   . GLU B 1 297 ? -27.671 -12.832 -20.522 1.00 112.05 ? 658 GLU B CG   1 
ATOM   9283 C  CD   . GLU B 1 297 ? -27.578 -11.869 -19.357 1.00 126.50 ? 658 GLU B CD   1 
ATOM   9284 O  OE1  . GLU B 1 297 ? -26.457 -11.671 -18.842 1.00 104.29 ? 658 GLU B OE1  1 
ATOM   9285 O  OE2  . GLU B 1 297 ? -28.622 -11.306 -18.963 1.00 137.83 ? 658 GLU B OE2  1 
ATOM   9286 H  H    . GLU B 1 297 ? -25.331 -14.307 -22.539 1.00 90.03  ? 658 GLU B H    1 
ATOM   9287 H  HA   . GLU B 1 297 ? -27.899 -13.560 -22.997 1.00 102.85 ? 658 GLU B HA   1 
ATOM   9288 H  HB2  . GLU B 1 297 ? -25.887 -12.430 -21.411 1.00 117.81 ? 658 GLU B HB2  1 
ATOM   9289 H  HB3  . GLU B 1 297 ? -27.060 -11.495 -21.927 1.00 117.81 ? 658 GLU B HB3  1 
ATOM   9290 H  HG2  . GLU B 1 297 ? -28.598 -12.874 -20.805 1.00 134.46 ? 658 GLU B HG2  1 
ATOM   9291 H  HG3  . GLU B 1 297 ? -27.377 -13.704 -20.216 1.00 134.46 ? 658 GLU B HG3  1 
ATOM   9292 N  N    . LYS B 1 298 ? -27.590 -11.743 -24.716 1.00 137.22 ? 659 LYS B N    1 
ATOM   9293 C  CA   . LYS B 1 298 ? -27.365 -10.934 -25.914 1.00 140.67 ? 659 LYS B CA   1 
ATOM   9294 C  C    . LYS B 1 298 ? -27.928 -9.527  -25.751 1.00 143.01 ? 659 LYS B C    1 
ATOM   9295 O  O    . LYS B 1 298 ? -27.638 -8.638  -26.553 1.00 140.32 ? 659 LYS B O    1 
ATOM   9296 C  CB   . LYS B 1 298 ? -27.993 -11.602 -27.140 1.00 122.37 ? 659 LYS B CB   1 
ATOM   9297 C  CG   . LYS B 1 298 ? -27.568 -13.046 -27.348 1.00 117.25 ? 659 LYS B CG   1 
ATOM   9298 C  CD   . LYS B 1 298 ? -28.011 -13.562 -28.709 1.00 130.70 ? 659 LYS B CD   1 
ATOM   9299 C  CE   . LYS B 1 298 ? -27.700 -15.041 -28.872 1.00 127.16 ? 659 LYS B CE   1 
ATOM   9300 N  NZ   . LYS B 1 298 ? -28.847 -15.788 -29.457 1.00 136.87 ? 659 LYS B NZ   1 
ATOM   9301 H  H    . LYS B 1 298 ? -28.387 -11.685 -24.398 1.00 164.66 ? 659 LYS B H    1 
ATOM   9302 H  HA   . LYS B 1 298 ? -26.411 -10.859 -26.069 1.00 168.80 ? 659 LYS B HA   1 
ATOM   9303 H  HB2  . LYS B 1 298 ? -28.958 -11.589 -27.041 1.00 146.84 ? 659 LYS B HB2  1 
ATOM   9304 H  HB3  . LYS B 1 298 ? -27.737 -11.102 -27.931 1.00 146.84 ? 659 LYS B HB3  1 
ATOM   9305 H  HG2  . LYS B 1 298 ? -26.601 -13.106 -27.299 1.00 140.70 ? 659 LYS B HG2  1 
ATOM   9306 H  HG3  . LYS B 1 298 ? -27.975 -13.601 -26.665 1.00 140.70 ? 659 LYS B HG3  1 
ATOM   9307 H  HD2  . LYS B 1 298 ? -28.969 -13.441 -28.801 1.00 156.84 ? 659 LYS B HD2  1 
ATOM   9308 H  HD3  . LYS B 1 298 ? -27.542 -13.075 -29.404 1.00 156.84 ? 659 LYS B HD3  1 
ATOM   9309 H  HE2  . LYS B 1 298 ? -26.938 -15.144 -29.463 1.00 152.59 ? 659 LYS B HE2  1 
ATOM   9310 H  HE3  . LYS B 1 298 ? -27.503 -15.423 -28.002 1.00 152.59 ? 659 LYS B HE3  1 
ATOM   9311 H  HZ1  . LYS B 1 298 ? -28.637 -16.649 -29.541 1.00 164.25 ? 659 LYS B HZ1  1 
ATOM   9312 H  HZ2  . LYS B 1 298 ? -29.559 -15.714 -28.929 1.00 164.25 ? 659 LYS B HZ2  1 
ATOM   9313 H  HZ3  . LYS B 1 298 ? -29.045 -15.460 -30.260 1.00 164.25 ? 659 LYS B HZ3  1 
HETATM 9314 CL CL   . CL  C 2 .   ? -6.258  -15.590 7.409   1.00 79.57  ? 801 CL  A CL   1 
HETATM 9315 CL CL   . CL  D 2 .   ? 6.889   -27.294 -3.919  1.00 80.00  ? 802 CL  A CL   1 
HETATM 9316 NA NA   . NA  E 3 .   ? 6.840   -32.403 -35.091 1.00 91.85  ? 701 NA  B NA   1 
HETATM 9317 CL CL   . CL  F 2 .   ? -12.999 -28.634 -13.459 1.00 52.81  ? 702 CL  B CL   1 
HETATM 9318 C  C    . ACT G 4 .   ? 4.533   -26.782 -31.580 1.00 102.84 ? 703 ACT B C    1 
HETATM 9319 O  O    . ACT G 4 .   ? 4.813   -26.329 -30.446 1.00 110.63 ? 703 ACT B O    1 
HETATM 9320 O  OXT  . ACT G 4 .   ? 4.606   -28.025 -31.713 1.00 96.81  ? 703 ACT B OXT  1 
HETATM 9321 C  CH3  . ACT G 4 .   ? 4.133   -25.887 -32.715 1.00 63.52  ? 703 ACT B CH3  1 
HETATM 9322 H  H1   . ACT G 4 .   ? 3.936   -26.489 -33.601 1.00 76.22  ? 703 ACT B H1   1 
HETATM 9323 H  H2   . ACT G 4 .   ? 4.939   -25.184 -32.925 1.00 76.22  ? 703 ACT B H2   1 
HETATM 9324 H  H3   . ACT G 4 .   ? 3.232   -25.336 -32.443 1.00 76.22  ? 703 ACT B H3   1 
HETATM 9325 C  C    . ACT H 4 .   ? -14.441 -28.397 -19.321 1.00 128.85 ? 704 ACT B C    1 
HETATM 9326 O  O    . ACT H 4 .   ? -14.955 -28.164 -20.435 1.00 145.45 ? 704 ACT B O    1 
HETATM 9327 O  OXT  . ACT H 4 .   ? -13.544 -27.605 -18.962 1.00 159.42 ? 704 ACT B OXT  1 
HETATM 9328 C  CH3  . ACT H 4 .   ? -14.873 -29.555 -18.472 1.00 100.86 ? 704 ACT B CH3  1 
HETATM 9329 H  H1   . ACT H 4 .   ? -14.292 -29.565 -17.550 1.00 121.03 ? 704 ACT B H1   1 
HETATM 9330 H  H2   . ACT H 4 .   ? -14.708 -30.485 -19.016 1.00 121.03 ? 704 ACT B H2   1 
HETATM 9331 H  H3   . ACT H 4 .   ? -15.932 -29.456 -18.234 1.00 121.03 ? 704 ACT B H3   1 
HETATM 9332 O  O    . HOH I 5 .   ? -1.614  -27.182 -21.058 1.00 36.37  ? 901 HOH A O    1 
HETATM 9333 O  O    . HOH I 5 .   ? 0.967   -22.765 -16.641 1.00 32.17  ? 902 HOH A O    1 
HETATM 9334 O  O    . HOH I 5 .   ? -2.590  -22.947 1.770   1.00 39.44  ? 903 HOH A O    1 
HETATM 9335 O  O    . HOH I 5 .   ? -6.882  -15.662 -4.133  1.00 49.41  ? 904 HOH A O    1 
HETATM 9336 O  O    . HOH I 5 .   ? 1.223   -21.216 -14.641 1.00 46.23  ? 905 HOH A O    1 
HETATM 9337 O  O    . HOH I 5 .   ? 11.292  -10.433 -62.124 1.00 49.58  ? 906 HOH A O    1 
HETATM 9338 O  O    . HOH I 5 .   ? 2.223   -27.468 12.356  1.00 53.61  ? 907 HOH A O    1 
HETATM 9339 O  O    . HOH I 5 .   ? -4.159  -12.613 23.854  1.00 52.06  ? 908 HOH A O    1 
HETATM 9340 O  O    . HOH I 5 .   ? -5.962  -32.318 -26.624 1.00 49.04  ? 909 HOH A O    1 
HETATM 9341 O  O    . HOH I 5 .   ? -1.852  -28.311 -14.719 1.00 49.32  ? 910 HOH A O    1 
HETATM 9342 O  O    . HOH I 5 .   ? 15.808  -15.354 -45.716 1.00 60.90  ? 911 HOH A O    1 
HETATM 9343 O  O    . HOH I 5 .   ? 22.362  -24.261 -20.555 1.00 44.63  ? 912 HOH A O    1 
HETATM 9344 O  O    . HOH I 5 .   ? -13.236 -12.621 42.659  1.00 57.64  ? 913 HOH A O    1 
HETATM 9345 O  O    . HOH I 5 .   ? 21.572  -20.406 -19.910 1.00 62.30  ? 914 HOH A O    1 
HETATM 9346 O  O    . HOH I 5 .   ? -6.767  -31.634 -18.106 1.00 47.56  ? 915 HOH A O    1 
HETATM 9347 O  O    . HOH I 5 .   ? 4.760   -24.331 -27.971 1.00 44.78  ? 916 HOH A O    1 
HETATM 9348 O  O    . HOH I 5 .   ? 15.659  -14.783 -37.973 1.00 56.34  ? 917 HOH A O    1 
HETATM 9349 O  O    . HOH I 5 .   ? -13.675 -11.389 37.846  1.00 53.34  ? 918 HOH A O    1 
HETATM 9350 O  O    . HOH I 5 .   ? 7.934   -25.366 -29.513 1.00 54.73  ? 919 HOH A O    1 
HETATM 9351 O  O    . HOH I 5 .   ? 5.799   -19.260 -9.753  1.00 54.62  ? 920 HOH A O    1 
HETATM 9352 O  O    . HOH I 5 .   ? -0.718  -29.932 -10.154 1.00 48.82  ? 921 HOH A O    1 
HETATM 9353 O  O    . HOH I 5 .   ? 4.953   -28.989 -5.370  1.00 44.32  ? 922 HOH A O    1 
HETATM 9354 O  O    . HOH I 5 .   ? 14.901  -19.369 -23.675 1.00 61.56  ? 923 HOH A O    1 
HETATM 9355 O  O    . HOH I 5 .   ? 0.623   -27.090 -10.459 1.00 58.08  ? 924 HOH A O    1 
HETATM 9356 O  O    . HOH I 5 .   ? 5.066   -36.591 -32.954 1.00 60.28  ? 925 HOH A O    1 
HETATM 9357 O  O    . HOH I 5 .   ? -7.480  -17.654 26.619  1.00 72.89  ? 926 HOH A O    1 
HETATM 9358 O  O    . HOH I 5 .   ? -18.131 -17.292 35.752  1.00 63.01  ? 927 HOH A O    1 
HETATM 9359 O  O    . HOH I 5 .   ? 2.292   -30.960 -31.806 1.00 59.27  ? 928 HOH A O    1 
HETATM 9360 O  O    . HOH I 5 .   ? -9.166  -32.618 -19.604 1.00 56.20  ? 929 HOH A O    1 
HETATM 9361 O  O    . HOH I 5 .   ? 13.078  -25.484 -24.757 1.00 50.45  ? 930 HOH A O    1 
HETATM 9362 O  O    . HOH I 5 .   ? 25.826  -33.143 -6.524  1.00 59.81  ? 931 HOH A O    1 
HETATM 9363 O  O    . HOH I 5 .   ? 28.118  -27.131 -0.518  1.00 70.05  ? 932 HOH A O    1 
HETATM 9364 O  O    . HOH I 5 .   ? 17.407  -10.824 0.760   1.00 61.03  ? 933 HOH A O    1 
HETATM 9365 O  O    . HOH I 5 .   ? 11.744  -21.616 23.387  1.00 65.62  ? 934 HOH A O    1 
HETATM 9366 O  O    . HOH I 5 .   ? 10.846  -24.475 -24.884 1.00 47.98  ? 935 HOH A O    1 
HETATM 9367 O  O    . HOH I 5 .   ? 16.674  -39.682 -17.769 1.00 54.17  ? 936 HOH A O    1 
HETATM 9368 O  O    . HOH I 5 .   ? -11.357 -14.324 12.751  1.00 50.87  ? 937 HOH A O    1 
HETATM 9369 O  O    . HOH I 5 .   ? 7.767   -14.705 27.354  1.00 65.01  ? 938 HOH A O    1 
HETATM 9370 O  O    . HOH I 5 .   ? 15.423  -36.257 -5.617  1.00 65.39  ? 939 HOH A O    1 
HETATM 9371 O  O    . HOH I 5 .   ? -4.708  -32.984 -29.027 1.00 62.71  ? 940 HOH A O    1 
HETATM 9372 O  O    . HOH I 5 .   ? -9.858  -39.948 -26.171 1.00 67.58  ? 941 HOH A O    1 
HETATM 9373 O  O    . HOH I 5 .   ? 11.263  -18.774 -63.672 1.00 71.46  ? 942 HOH A O    1 
HETATM 9374 O  O    . HOH I 5 .   ? -5.736  -26.985 15.746  1.00 62.36  ? 943 HOH A O    1 
HETATM 9375 O  O    . HOH I 5 .   ? -13.207 -17.492 16.304  1.00 59.38  ? 944 HOH A O    1 
HETATM 9376 O  O    . HOH I 5 .   ? 4.107   -7.808  -2.076  1.00 73.03  ? 945 HOH A O    1 
HETATM 9377 O  O    . HOH I 5 .   ? 3.679   -48.377 -28.538 1.00 71.64  ? 946 HOH A O    1 
HETATM 9378 O  O    . HOH I 5 .   ? 21.901  -30.512 -17.902 1.00 67.62  ? 947 HOH A O    1 
HETATM 9379 O  O    . HOH I 5 .   ? 5.523   -31.484 -30.159 1.00 54.59  ? 948 HOH A O    1 
HETATM 9380 O  O    . HOH I 5 .   ? 11.972  -19.490 22.173  1.00 70.14  ? 949 HOH A O    1 
HETATM 9381 O  O    . HOH I 5 .   ? 20.402  -32.273 2.456   1.00 63.21  ? 950 HOH A O    1 
HETATM 9382 O  O    . HOH I 5 .   ? 4.762   -11.630 -11.148 1.00 72.85  ? 951 HOH A O    1 
HETATM 9383 O  O    . HOH I 5 .   ? 0.435   -23.876 2.685   1.00 54.48  ? 952 HOH A O    1 
HETATM 9384 O  O    . HOH I 5 .   ? 24.222  -36.206 -13.551 1.00 75.53  ? 953 HOH A O    1 
HETATM 9385 O  O    . HOH I 5 .   ? 16.483  -20.600 8.643   1.00 71.49  ? 954 HOH A O    1 
HETATM 9386 O  O    . HOH I 5 .   ? -4.216  -22.318 30.609  1.00 69.27  ? 955 HOH A O    1 
HETATM 9387 O  O    . HOH I 5 .   ? 18.592  -35.765 -23.135 1.00 52.84  ? 956 HOH A O    1 
HETATM 9388 O  O    . HOH I 5 .   ? 7.968   -30.905 -28.959 1.00 57.45  ? 957 HOH A O    1 
HETATM 9389 O  O    . HOH I 5 .   ? 15.297  -28.204 6.992   1.00 58.58  ? 958 HOH A O    1 
HETATM 9390 O  O    . HOH I 5 .   ? 14.313  -19.242 -58.044 1.00 52.84  ? 959 HOH A O    1 
HETATM 9391 O  O    . HOH I 5 .   ? 25.239  -19.039 -13.222 1.00 58.78  ? 960 HOH A O    1 
HETATM 9392 O  O    . HOH I 5 .   ? 20.218  -24.095 -22.906 1.00 63.63  ? 961 HOH A O    1 
HETATM 9393 O  O    . HOH I 5 .   ? 5.961   -26.254 11.863  1.00 58.99  ? 962 HOH A O    1 
HETATM 9394 O  O    . HOH I 5 .   ? 6.951   -37.542 -11.317 1.00 50.55  ? 963 HOH A O    1 
HETATM 9395 O  O    . HOH I 5 .   ? -14.118 -12.825 27.459  1.00 56.29  ? 964 HOH A O    1 
HETATM 9396 O  O    . HOH I 5 .   ? -13.629 -15.575 28.067  1.00 57.56  ? 965 HOH A O    1 
HETATM 9397 O  O    . HOH I 5 .   ? -12.357 -16.953 12.246  1.00 70.30  ? 966 HOH A O    1 
HETATM 9398 O  O    . HOH I 5 .   ? 14.801  -12.166 -5.804  1.00 68.57  ? 967 HOH A O    1 
HETATM 9399 O  O    . HOH I 5 .   ? 6.554   -30.744 -33.283 1.00 65.91  ? 968 HOH A O    1 
HETATM 9400 O  O    . HOH I 5 .   ? -11.174 -39.652 -23.965 1.00 68.20  ? 969 HOH A O    1 
HETATM 9401 O  O    . HOH I 5 .   ? 26.787  -26.652 2.683   1.00 70.78  ? 970 HOH A O    1 
HETATM 9402 O  O    . HOH J 5 .   ? -21.838 -7.586  17.850  1.00 31.68  ? 801 HOH B O    1 
HETATM 9403 O  O    . HOH J 5 .   ? -6.025  -19.827 0.380   1.00 38.63  ? 802 HOH B O    1 
HETATM 9404 O  O    . HOH J 5 .   ? -0.100  -22.443 -19.413 1.00 28.14  ? 803 HOH B O    1 
HETATM 9405 O  O    . HOH J 5 .   ? 0.411   -16.021 -21.033 1.00 49.17  ? 804 HOH B O    1 
HETATM 9406 O  O    . HOH J 5 .   ? -3.689  -25.433 -19.976 1.00 44.67  ? 805 HOH B O    1 
HETATM 9407 O  O    . HOH J 5 .   ? -20.539 -6.134  15.464  1.00 46.22  ? 806 HOH B O    1 
HETATM 9408 O  O    . HOH J 5 .   ? -12.572 -18.934 -9.660  1.00 47.36  ? 807 HOH B O    1 
HETATM 9409 O  O    . HOH J 5 .   ? -7.029  -20.866 -2.207  1.00 31.83  ? 808 HOH B O    1 
HETATM 9410 O  O    . HOH J 5 .   ? -20.753 -13.132 -15.345 1.00 57.86  ? 809 HOH B O    1 
HETATM 9411 O  O    . HOH J 5 .   ? 2.980   -32.523 -42.858 1.00 61.60  ? 810 HOH B O    1 
HETATM 9412 O  O    . HOH J 5 .   ? -29.972 -19.659 -14.575 1.00 46.49  ? 811 HOH B O    1 
HETATM 9413 O  O    . HOH J 5 .   ? 0.962   -29.156 1.018   1.00 42.03  ? 812 HOH B O    1 
HETATM 9414 O  O    . HOH J 5 .   ? -7.228  -29.975 -25.432 1.00 28.81  ? 813 HOH B O    1 
HETATM 9415 O  O    . HOH J 5 .   ? -11.989 -31.367 -28.737 1.00 60.03  ? 814 HOH B O    1 
HETATM 9416 O  O    . HOH J 5 .   ? 10.754  -21.297 -35.791 1.00 66.15  ? 815 HOH B O    1 
HETATM 9417 O  O    . HOH J 5 .   ? -14.647 -25.136 12.008  1.00 61.33  ? 816 HOH B O    1 
HETATM 9418 O  O    . HOH J 5 .   ? 4.285   -17.063 -41.913 1.00 47.44  ? 817 HOH B O    1 
HETATM 9419 O  O    . HOH J 5 .   ? -8.340  -32.295 -29.162 1.00 52.07  ? 818 HOH B O    1 
HETATM 9420 O  O    . HOH J 5 .   ? 4.789   -19.592 -32.958 1.00 47.61  ? 819 HOH B O    1 
HETATM 9421 O  O    . HOH J 5 .   ? -4.422  -26.976 -2.772  1.00 46.72  ? 820 HOH B O    1 
HETATM 9422 O  O    . HOH J 5 .   ? -7.326  -20.310 -4.706  1.00 48.64  ? 821 HOH B O    1 
HETATM 9423 O  O    . HOH J 5 .   ? -13.086 -31.591 -45.681 1.00 47.74  ? 822 HOH B O    1 
HETATM 9424 O  O    . HOH J 5 .   ? -9.579  -24.328 -8.648  1.00 34.53  ? 823 HOH B O    1 
HETATM 9425 O  O    . HOH J 5 .   ? -16.348 -38.691 15.335  1.00 51.40  ? 824 HOH B O    1 
HETATM 9426 O  O    . HOH J 5 .   ? -5.379  -29.643 -7.000  1.00 47.15  ? 825 HOH B O    1 
HETATM 9427 O  O    . HOH J 5 .   ? -21.210 -32.387 -23.654 1.00 52.45  ? 826 HOH B O    1 
HETATM 9428 O  O    . HOH J 5 .   ? -27.373 -33.250 -8.133  1.00 56.38  ? 827 HOH B O    1 
HETATM 9429 O  O    . HOH J 5 .   ? -10.539 -18.570 -6.758  1.00 47.11  ? 828 HOH B O    1 
HETATM 9430 O  O    . HOH J 5 .   ? -4.716  -15.261 -44.541 1.00 53.60  ? 829 HOH B O    1 
HETATM 9431 O  O    . HOH J 5 .   ? -20.816 -14.595 -9.554  1.00 52.95  ? 830 HOH B O    1 
HETATM 9432 O  O    . HOH J 5 .   ? -12.765 -27.643 -22.822 1.00 42.91  ? 831 HOH B O    1 
HETATM 9433 O  O    . HOH J 5 .   ? -8.654  -14.385 -17.524 1.00 45.81  ? 832 HOH B O    1 
HETATM 9434 O  O    . HOH J 5 .   ? -11.843 -32.481 -42.513 1.00 55.86  ? 833 HOH B O    1 
HETATM 9435 O  O    . HOH J 5 .   ? -8.297  -8.686  5.467   1.00 56.10  ? 834 HOH B O    1 
HETATM 9436 O  O    . HOH J 5 .   ? -9.937  -30.006 -24.496 1.00 47.21  ? 835 HOH B O    1 
HETATM 9437 O  O    . HOH J 5 .   ? -23.683 -13.604 -22.046 1.00 57.93  ? 836 HOH B O    1 
HETATM 9438 O  O    . HOH J 5 .   ? -1.946  -20.857 -44.033 1.00 45.48  ? 837 HOH B O    1 
HETATM 9439 O  O    . HOH J 5 .   ? -7.648  -36.756 -40.995 1.00 66.19  ? 838 HOH B O    1 
HETATM 9440 O  O    . HOH J 5 .   ? -11.497 -32.861 -34.602 1.00 57.82  ? 839 HOH B O    1 
HETATM 9441 O  O    . HOH J 5 .   ? -30.827 -17.689 -6.445  1.00 60.16  ? 840 HOH B O    1 
HETATM 9442 O  O    . HOH J 5 .   ? -5.773  -11.297 -35.476 1.00 54.82  ? 841 HOH B O    1 
HETATM 9443 O  O    . HOH J 5 .   ? -11.154 -25.907 -19.612 1.00 55.76  ? 842 HOH B O    1 
HETATM 9444 O  O    . HOH J 5 .   ? -13.327 -25.395 -44.404 1.00 68.03  ? 843 HOH B O    1 
HETATM 9445 O  O    . HOH J 5 .   ? -7.790  -16.519 -18.249 1.00 60.21  ? 844 HOH B O    1 
HETATM 9446 O  O    . HOH J 5 .   ? -8.324  -10.065 1.429   1.00 78.09  ? 845 HOH B O    1 
HETATM 9447 O  O    . HOH J 5 .   ? -4.513  -35.717 -33.851 1.00 54.16  ? 846 HOH B O    1 
HETATM 9448 O  O    . HOH J 5 .   ? -10.702 -20.935 -7.147  1.00 63.83  ? 847 HOH B O    1 
HETATM 9449 O  O    . HOH J 5 .   ? -7.997  -11.174 -39.447 1.00 76.35  ? 848 HOH B O    1 
HETATM 9450 O  O    . HOH J 5 .   ? -6.541  -40.542 16.089  1.00 69.07  ? 849 HOH B O    1 
HETATM 9451 O  O    . HOH J 5 .   ? -21.993 -38.262 2.520   1.00 71.37  ? 850 HOH B O    1 
HETATM 9452 O  O    . HOH J 5 .   ? -20.521 -8.528  26.077  1.00 58.74  ? 851 HOH B O    1 
HETATM 9453 O  O    . HOH J 5 .   ? -1.411  -31.089 -1.447  1.00 64.38  ? 852 HOH B O    1 
HETATM 9454 O  O    . HOH J 5 .   ? -9.464  -23.151 -11.479 1.00 56.71  ? 853 HOH B O    1 
HETATM 9455 O  O    . HOH J 5 .   ? -17.119 -35.644 -23.709 1.00 72.70  ? 854 HOH B O    1 
HETATM 9456 O  O    . HOH J 5 .   ? -6.505  -23.607 -5.071  1.00 60.94  ? 855 HOH B O    1 
HETATM 9457 O  O    . HOH J 5 .   ? -18.076 -31.930 -14.446 1.00 50.97  ? 856 HOH B O    1 
HETATM 9458 O  O    . HOH J 5 .   ? -5.452  -23.311 -2.625  1.00 62.46  ? 857 HOH B O    1 
HETATM 9459 O  O    . HOH J 5 .   ? -8.312  -22.610 -7.333  1.00 50.64  ? 858 HOH B O    1 
HETATM 9460 O  O    . HOH J 5 .   ? -4.386  -24.305 3.262   1.00 36.38  ? 859 HOH B O    1 
HETATM 9461 O  O    . HOH J 5 .   ? -26.196 -21.248 4.334   1.00 58.22  ? 860 HOH B O    1 
HETATM 9462 O  O    . HOH J 5 .   ? -5.651  -18.259 -17.189 1.00 40.38  ? 861 HOH B O    1 
HETATM 9463 O  O    . HOH J 5 .   ? -6.211  -26.660 -20.607 1.00 42.61  ? 862 HOH B O    1 
HETATM 9464 O  O    . HOH J 5 .   ? -13.132 -12.018 -12.511 1.00 48.50  ? 863 HOH B O    1 
HETATM 9465 O  O    . HOH J 5 .   ? 7.432   -28.325 -33.785 1.00 54.78  ? 864 HOH B O    1 
HETATM 9466 O  O    . HOH J 5 .   ? -15.949 -5.209  12.222  1.00 52.49  ? 865 HOH B O    1 
HETATM 9467 O  O    . HOH J 5 .   ? -7.758  -17.945 -6.094  1.00 61.87  ? 866 HOH B O    1 
HETATM 9468 O  O    . HOH J 5 .   ? -10.935 -20.475 9.275   1.00 65.64  ? 867 HOH B O    1 
HETATM 9469 O  O    . HOH J 5 .   ? -16.475 -38.830 18.152  1.00 64.26  ? 868 HOH B O    1 
HETATM 9470 O  O    . HOH J 5 .   ? -8.955  -20.748 -11.704 1.00 57.59  ? 869 HOH B O    1 
HETATM 9471 O  O    . HOH J 5 .   ? 1.699   -36.278 17.077  1.00 61.13  ? 870 HOH B O    1 
HETATM 9472 O  O    . HOH J 5 .   ? -0.890  -31.864 -33.073 1.00 58.61  ? 871 HOH B O    1 
HETATM 9473 O  O    . HOH J 5 .   ? -17.560 -11.640 34.061  1.00 60.21  ? 872 HOH B O    1 
HETATM 9474 O  O    . HOH J 5 .   ? -12.795 -37.165 -4.454  1.00 67.42  ? 873 HOH B O    1 
HETATM 9475 O  O    . HOH J 5 .   ? -14.040 -29.863 -23.860 1.00 85.07  ? 874 HOH B O    1 
HETATM 9476 O  O    . HOH J 5 .   ? -9.919  -7.870  -31.721 1.00 61.96  ? 875 HOH B O    1 
HETATM 9477 O  O    . HOH J 5 .   ? -27.356 -28.611 0.910   1.00 64.15  ? 876 HOH B O    1 
HETATM 9478 O  O    . HOH J 5 .   ? -5.109  -31.300 17.234  1.00 64.67  ? 877 HOH B O    1 
HETATM 9479 O  O    . HOH J 5 .   ? -11.116 -11.257 -40.229 1.00 61.81  ? 878 HOH B O    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ASN A 2   ? 1.4387 0.8263 0.5215 -0.4746 0.1478  -0.1617 363 ASN A N   
2    C CA  . ASN A 2   ? 1.5215 0.9163 0.6548 -0.4764 0.1578  -0.1635 363 ASN A CA  
3    C C   . ASN A 2   ? 1.5548 0.9022 0.6738 -0.4600 0.1615  -0.1504 363 ASN A C   
4    O O   . ASN A 2   ? 1.4404 0.7433 0.5184 -0.4564 0.1634  -0.1416 363 ASN A O   
5    C CB  . ASN A 2   ? 1.6086 1.0279 0.7696 -0.4915 0.1675  -0.1709 363 ASN A CB  
6    C CG  . ASN A 2   ? 1.7830 1.2548 0.9701 -0.5089 0.1673  -0.1854 363 ASN A CG  
7    O OD1 . ASN A 2   ? 1.9398 1.4235 1.1003 -0.5204 0.1616  -0.1893 363 ASN A OD1 
8    N ND2 . ASN A 2   ? 1.8765 1.3825 1.1152 -0.5094 0.1739  -0.1937 363 ASN A ND2 
14   N N   . ARG A 3   ? 1.4509 0.8107 0.6049 -0.4507 0.1632  -0.1495 364 ARG A N   
15   C CA  . ARG A 3   ? 1.5254 0.8503 0.6691 -0.4353 0.1659  -0.1379 364 ARG A CA  
16   C C   . ARG A 3   ? 1.4335 0.7931 0.6320 -0.4300 0.1716  -0.1408 364 ARG A C   
17   O O   . ARG A 3   ? 1.4759 0.8794 0.7193 -0.4329 0.1715  -0.1510 364 ARG A O   
18   C CB  . ARG A 3   ? 1.5505 0.8463 0.6623 -0.4208 0.1571  -0.1316 364 ARG A CB  
19   C CG  . ARG A 3   ? 1.9917 1.2306 1.0370 -0.4109 0.1543  -0.1222 364 ARG A CG  
20   C CD  . ARG A 3   ? 2.2022 1.4396 1.2154 -0.3935 0.1430  -0.1203 364 ARG A CD  
21   N NE  . ARG A 3   ? 2.3585 1.5431 1.3093 -0.3702 0.1428  -0.1074 364 ARG A NE  
22   C CZ  . ARG A 3   ? 2.2432 1.4311 1.1581 -0.3419 0.1358  -0.0970 364 ARG A CZ  
23   N NH1 . ARG A 3   ? 2.1738 1.4150 1.1065 -0.3376 0.1267  -0.0983 364 ARG A NH1 
24   N NH2 . ARG A 3   ? 2.1362 1.2798 0.9997 -0.3154 0.1397  -0.0818 364 ARG A NH2 
38   N N   . ILE A 4   ? 1.4142 0.7546 0.6074 -0.4217 0.1767  -0.1322 365 ILE A N   
39   C CA  . ILE A 4   ? 1.3435 0.7124 0.5804 -0.4121 0.1793  -0.1336 365 ILE A CA  
40   C C   . ILE A 4   ? 1.3164 0.6543 0.5307 -0.3997 0.1760  -0.1238 365 ILE A C   
41   O O   . ILE A 4   ? 1.3318 0.6234 0.4996 -0.3973 0.1781  -0.1135 365 ILE A O   
42   C CB  . ILE A 4   ? 1.2960 0.6788 0.5494 -0.4140 0.1879  -0.1339 365 ILE A CB  
43   C CG1 . ILE A 4   ? 1.5954 1.0053 0.8890 -0.4035 0.1896  -0.1352 365 ILE A CG1 
44   C CG2 . ILE A 4   ? 1.3107 0.6493 0.5145 -0.4172 0.1922  -0.1232 365 ILE A CG2 
45   C CD1 . ILE A 4   ? 1.5164 0.9504 0.8334 -0.4073 0.1985  -0.1394 365 ILE A CD1 
57   N N   . THR A 5   ? 1.2376 0.5993 0.4842 -0.3918 0.1714  -0.1273 366 THR A N   
58   C CA  . THR A 5   ? 1.2700 0.6053 0.4966 -0.3798 0.1669  -0.1195 366 THR A CA  
59   C C   . THR A 5   ? 1.2575 0.6154 0.5194 -0.3718 0.1702  -0.1188 366 THR A C   
60   O O   . THR A 5   ? 1.2110 0.6140 0.5257 -0.3718 0.1714  -0.1271 366 THR A O   
61   C CB  . THR A 5   ? 1.4413 0.7843 0.6709 -0.3779 0.1574  -0.1238 366 THR A CB  
62   O OG1 . THR A 5   ? 1.5601 0.8792 0.7467 -0.3844 0.1531  -0.1240 366 THR A OG1 
63   C CG2 . THR A 5   ? 1.7064 1.0267 0.9208 -0.3634 0.1523  -0.1166 366 THR A CG2 
71   N N   . VAL A 6   ? 1.2518 0.5760 0.4821 -0.3651 0.1722  -0.1091 367 VAL A N   
72   C CA  . VAL A 6   ? 1.2270 0.5698 0.4830 -0.3589 0.1749  -0.1081 367 VAL A CA  
73   C C   . VAL A 6   ? 1.1952 0.5134 0.4327 -0.3475 0.1698  -0.1018 367 VAL A C   
74   O O   . VAL A 6   ? 1.2772 0.5470 0.4649 -0.3434 0.1720  -0.0923 367 VAL A O   
75   C CB  . VAL A 6   ? 1.3551 0.6849 0.5911 -0.3643 0.1841  -0.1033 367 VAL A CB  
76   C CG1 . VAL A 6   ? 1.1811 0.5372 0.4457 -0.3610 0.1872  -0.1043 367 VAL A CG1 
77   C CG2 . VAL A 6   ? 1.1948 0.5413 0.4398 -0.3751 0.1890  -0.1083 367 VAL A CG2 
87   N N   . PRO A 7   ? 1.1530 0.5019 0.4297 -0.3417 0.1636  -0.1069 368 PRO A N   
88   C CA  . PRO A 7   ? 1.2387 0.5641 0.4967 -0.3302 0.1585  -0.1009 368 PRO A CA  
89   C C   . PRO A 7   ? 1.2116 0.5328 0.4674 -0.3267 0.1642  -0.0961 368 PRO A C   
90   O O   . PRO A 7   ? 1.3261 0.6862 0.6219 -0.3313 0.1686  -0.1011 368 PRO A O   
91   C CB  . PRO A 7   ? 1.1223 0.4882 0.4296 -0.3280 0.1512  -0.1086 368 PRO A CB  
92   C CG  . PRO A 7   ? 1.3631 0.7779 0.7252 -0.3357 0.1560  -0.1178 368 PRO A CG  
93   C CD  . PRO A 7   ? 1.2216 0.6226 0.5582 -0.3447 0.1618  -0.1177 368 PRO A CD  
101  N N   . LEU A 8   ? 1.2029 0.4748 0.4092 -0.3187 0.1648  -0.0866 369 LEU A N   
102  C CA  . LEU A 8   ? 1.2588 0.5241 0.4583 -0.3174 0.1708  -0.0825 369 LEU A CA  
103  C C   . LEU A 8   ? 1.2105 0.4836 0.4258 -0.3060 0.1642  -0.0823 369 LEU A C   
104  O O   . LEU A 8   ? 1.3223 0.5520 0.4978 -0.2930 0.1605  -0.0754 369 LEU A O   
105  C CB  . LEU A 8   ? 1.2679 0.4709 0.4029 -0.3166 0.1782  -0.0722 369 LEU A CB  
106  C CG  . LEU A 8   ? 1.5400 0.7310 0.6555 -0.3289 0.1852  -0.0715 369 LEU A CG  
107  C CD1 . LEU A 8   ? 1.3527 0.4843 0.4128 -0.3259 0.1918  -0.0632 369 LEU A CD1 
108  C CD2 . LEU A 8   ? 1.2475 0.4906 0.4052 -0.3423 0.1904  -0.0791 369 LEU A CD2 
120  N N   . VAL A 9   ? 1.2189 0.5457 0.4918 -0.3093 0.1630  -0.0896 370 VAL A N   
121  C CA  . VAL A 9   ? 1.1984 0.5406 0.4961 -0.3005 0.1565  -0.0904 370 VAL A CA  
122  C C   . VAL A 9   ? 1.2406 0.5965 0.5492 -0.3031 0.1623  -0.0898 370 VAL A C   
123  O O   . VAL A 9   ? 1.1657 0.5490 0.4942 -0.3138 0.1698  -0.0937 370 VAL A O   
124  C CB  . VAL A 9   ? 1.0818 0.4744 0.4419 -0.3023 0.1507  -0.0987 370 VAL A CB  
125  C CG1 . VAL A 9   ? 1.1334 0.5377 0.5176 -0.2941 0.1434  -0.0980 370 VAL A CG1 
126  C CG2 . VAL A 9   ? 1.0670 0.4518 0.4175 -0.3047 0.1463  -0.1013 370 VAL A CG2 
136  N N   . SER A 10  ? 1.2084 0.5445 0.5009 -0.2933 0.1588  -0.0855 371 SER A N   
137  C CA  . SER A 10  ? 1.2440 0.5933 0.5454 -0.2971 0.1639  -0.0855 371 SER A CA  
138  C C   . SER A 10  ? 1.2358 0.5927 0.5554 -0.2864 0.1559  -0.0850 371 SER A C   
139  O O   . SER A 10  ? 1.1358 0.4730 0.4437 -0.2735 0.1467  -0.0827 371 SER A O   
140  C CB  . SER A 10  ? 1.4126 0.7135 0.6560 -0.2995 0.1729  -0.0784 371 SER A CB  
141  O OG  . SER A 10  ? 1.2996 0.6026 0.5337 -0.3140 0.1821  -0.0794 371 SER A OG  
147  N N   . GLU A 11  ? 1.2796 0.6652 0.6254 -0.2926 0.1595  -0.0873 372 GLU A N   
148  C CA  . GLU A 11  ? 1.3015 0.6962 0.6671 -0.2847 0.1528  -0.0862 372 GLU A CA  
149  C C   . GLU A 11  ? 1.3354 0.6727 0.6372 -0.2706 0.1522  -0.0799 372 GLU A C   
150  O O   . GLU A 11  ? 1.3024 0.6178 0.5712 -0.2762 0.1614  -0.0776 372 GLU A O   
151  C CB  . GLU A 11  ? 1.1725 0.6195 0.5887 -0.2973 0.1578  -0.0899 372 GLU A CB  
152  C CG  . GLU A 11  ? 1.0756 0.5785 0.5555 -0.3053 0.1598  -0.0948 372 GLU A CG  
153  C CD  . GLU A 11  ? 1.4866 1.0221 1.0290 -0.2982 0.1515  -0.0916 372 GLU A CD  
154  O OE1 . GLU A 11  ? 1.7292 1.3076 1.3261 -0.3009 0.1539  -0.0941 372 GLU A OE1 
155  O OE2 . GLU A 11  ? 1.3643 0.8807 0.8999 -0.2895 0.1434  -0.0856 372 GLU A OE2 
162  N N   . VAL A 12  ? 1.1697 0.4830 0.4535 -0.2505 0.1417  -0.0771 373 VAL A N   
163  C CA  . VAL A 12  ? 1.1437 0.4069 0.3644 -0.2256 0.1406  -0.0702 373 VAL A CA  
164  C C   . VAL A 12  ? 1.2302 0.5385 0.4864 -0.2029 0.1314  -0.0591 373 VAL A C   
165  O O   . VAL A 12  ? 1.0849 0.4563 0.4101 -0.1928 0.1193  -0.0492 373 VAL A O   
166  C CB  . VAL A 12  ? 1.3897 0.6150 0.5652 -0.2040 0.1350  -0.0634 373 VAL A CB  
167  C CG1 . VAL A 12  ? 1.2529 0.4462 0.3767 -0.1676 0.1331  -0.0495 373 VAL A CG1 
168  C CG2 . VAL A 12  ? 1.3671 0.5658 0.5255 -0.2188 0.1430  -0.0622 373 VAL A CG2 
178  N N   . GLN A 13  ? 1.2475 0.5327 0.4666 -0.1933 0.1369  -0.0567 374 GLN A N   
179  C CA  . GLN A 13  ? 1.2320 0.5680 0.4904 -0.1673 0.1273  -0.0410 374 GLN A CA  
180  C C   . GLN A 13  ? 1.1741 0.5095 0.4192 -0.1269 0.1148  -0.0222 374 GLN A C   
181  O O   . GLN A 13  ? 1.2560 0.5330 0.4293 -0.1065 0.1199  -0.0175 374 GLN A O   
182  C CB  . GLN A 13  ? 1.2825 0.5927 0.5008 -0.1704 0.1383  -0.0455 374 GLN A CB  
183  C CG  . GLN A 13  ? 1.3198 0.6919 0.5866 -0.1469 0.1284  -0.0302 374 GLN A CG  
184  C CD  . GLN A 13  ? 1.3683 0.7136 0.5905 -0.1494 0.1399  -0.0356 374 GLN A CD  
185  O OE1 . GLN A 13  ? 1.3030 0.6314 0.4945 -0.1186 0.1378  -0.0248 374 GLN A OE1 
186  N NE2 . GLN A 13  ? 1.2644 0.6081 0.4821 -0.1868 0.1528  -0.0523 374 GLN A NE2 
195  N N   . ILE A 14  ? 1.1048 0.5061 0.4185 -0.1156 0.0997  -0.0107 375 ILE A N   
196  C CA  . ILE A 14  ? 1.1348 0.5517 0.4451 -0.0791 0.0861  0.0087  375 ILE A CA  
197  C C   . ILE A 14  ? 1.2560 0.6890 0.5626 -0.0473 0.0811  0.0247  375 ILE A C   
198  O O   . ILE A 14  ? 1.1440 0.5519 0.4035 -0.0146 0.0781  0.0390  375 ILE A O   
199  C CB  . ILE A 14  ? 1.0593 0.5466 0.4473 -0.0808 0.0723  0.0148  375 ILE A CB  
200  C CG1 . ILE A 14  ? 1.1735 0.6469 0.5686 -0.1137 0.0786  -0.0025 375 ILE A CG1 
201  C CG2 . ILE A 14  ? 0.9865 0.4941 0.3672 -0.0461 0.0580  0.0349  375 ILE A CG2 
202  C CD1 . ILE A 14  ? 1.1907 0.5964 0.5075 -0.1142 0.0846  -0.0080 375 ILE A CD1 
214  N N   . ALA A 15  ? 0.9997 0.4783 0.3576 -0.0560 0.0807  0.0236  376 ALA A N   
215  C CA  . ALA A 15  ? 1.1453 0.6484 0.5086 -0.0285 0.0755  0.0378  376 ALA A CA  
216  C C   . ALA A 15  ? 0.9589 0.4924 0.3574 -0.0501 0.0823  0.0293  376 ALA A C   
217  O O   . ALA A 15  ? 1.0571 0.5882 0.4688 -0.0851 0.0920  0.0133  376 ALA A O   
218  C CB  . ALA A 15  ? 0.9737 0.5468 0.3956 -0.0002 0.0560  0.0591  376 ALA A CB  
224  N N   . GLN A 16  ? 1.0592 0.6267 0.4740 -0.0286 0.0770  0.0412  377 GLN A N   
225  C CA  . GLN A 16  ? 1.0354 0.6343 0.4763 -0.0464 0.0839  0.0349  377 GLN A CA  
226  C C   . GLN A 16  ? 0.8721 0.5426 0.3678 -0.0193 0.0706  0.0541  377 GLN A C   
227  O O   . GLN A 16  ? 1.0227 0.6806 0.4880 0.0149  0.0641  0.0672  377 GLN A O   
228  C CB  . GLN A 16  ? 1.2026 0.7253 0.5567 -0.0578 0.1020  0.0195  377 GLN A CB  
229  C CG  . GLN A 16  ? 1.3428 0.8920 0.7127 -0.0869 0.1125  0.0079  377 GLN A CG  
230  C CD  . GLN A 16  ? 1.5724 1.0552 0.8580 -0.0884 0.1281  -0.0030 377 GLN A CD  
231  O OE1 . GLN A 16  ? 1.8095 1.2735 1.0635 -0.0556 0.1258  0.0074  377 GLN A OE1 
232  N NE2 . GLN A 16  ? 1.3025 0.7481 0.5491 -0.1270 0.1454  -0.0243 377 GLN A NE2 
241  N N   . LEU A 17  ? 0.8552 0.6027 0.4326 -0.0332 0.0672  0.0575  378 LEU A N   
242  C CA  . LEU A 17  ? 0.8429 0.6635 0.4763 -0.0116 0.0562  0.0750  378 LEU A CA  
243  C C   . LEU A 17  ? 0.7962 0.6152 0.4048 -0.0224 0.0673  0.0670  378 LEU A C   
244  O O   . LEU A 17  ? 0.9376 0.7448 0.5353 -0.0569 0.0816  0.0505  378 LEU A O   
245  C CB  . LEU A 17  ? 0.7481 0.6553 0.4847 -0.0194 0.0487  0.0850  378 LEU A CB  
246  C CG  . LEU A 17  ? 0.8798 0.7956 0.6492 -0.0148 0.0395  0.0907  378 LEU A CG  
247  C CD1 . LEU A 17  ? 0.9549 0.9480 0.8227 -0.0267 0.0380  0.0982  378 LEU A CD1 
248  C CD2 . LEU A 17  ? 0.9625 0.8801 0.7179 0.0226  0.0234  0.1075  378 LEU A CD2 
260  N N   . ARG A 18  ? 0.8225 0.6557 0.4212 0.0061  0.0611  0.0787  379 ARG A N   
261  C CA  . ARG A 18  ? 1.0218 0.8652 0.6040 -0.0032 0.0707  0.0720  379 ARG A CA  
262  C C   . ARG A 18  ? 0.9027 0.8436 0.5642 0.0144  0.0576  0.0913  379 ARG A C   
263  O O   . ARG A 18  ? 0.7385 0.7055 0.4225 0.0496  0.0420  0.1104  379 ARG A O   
264  C CB  . ARG A 18  ? 1.0080 0.7660 0.4905 0.0120  0.0806  0.0646  379 ARG A CB  
265  C CG  . ARG A 18  ? 1.2513 0.9125 0.6512 -0.0133 0.0989  0.0425  379 ARG A CG  
266  C CD  . ARG A 18  ? 1.5388 1.1131 0.8396 -0.0004 0.1134  0.0346  379 ARG A CD  
267  N NE  . ARG A 18  ? 1.6785 1.2417 0.9625 0.0483  0.1030  0.0550  379 ARG A NE  
268  C CZ  . ARG A 18  ? 1.9642 1.4932 1.2270 0.0708  0.0968  0.0652  379 ARG A CZ  
269  N NH1 . ARG A 18  ? 1.9221 1.4220 1.1781 0.0486  0.0998  0.0556  379 ARG A NH1 
270  N NH2 . ARG A 18  ? 2.1363 1.6647 1.3848 0.1155  0.0877  0.0859  379 ARG A NH2 
284  N N   . PHE A 19  ? 0.6832 0.6823 0.3884 -0.0106 0.0641  0.0875  380 PHE A N   
285  C CA  . PHE A 19  ? 0.6869 0.7835 0.4682 0.0032  0.0539  0.1058  380 PHE A CA  
286  C C   . PHE A 19  ? 0.6286 0.7381 0.3833 -0.0099 0.0646  0.0968  380 PHE A C   
287  O O   . PHE A 19  ? 0.7163 0.7962 0.4316 -0.0450 0.0814  0.0767  380 PHE A O   
288  C CB  . PHE A 19  ? 0.5506 0.7291 0.4297 -0.0122 0.0513  0.1157  380 PHE A CB  
289  C CG  . PHE A 19  ? 0.5415 0.7103 0.4505 -0.0052 0.0434  0.1219  380 PHE A CG  
290  C CD1 . PHE A 19  ? 0.6444 0.8385 0.5865 0.0283  0.0258  0.1411  380 PHE A CD1 
291  C CD2 . PHE A 19  ? 0.5862 0.7224 0.4888 -0.0337 0.0540  0.1081  380 PHE A CD2 
292  C CE1 . PHE A 19  ? 0.5969 0.7837 0.5640 0.0310  0.0196  0.1450  380 PHE A CE1 
293  C CE2 . PHE A 19  ? 0.5688 0.6958 0.4971 -0.0295 0.0480  0.1119  380 PHE A CE2 
294  C CZ  . PHE A 19  ? 0.6494 0.8017 0.6095 0.0017  0.0311  0.1297  380 PHE A CZ  
304  N N   . PRO A 20  ? 0.7133 0.8726 0.4914 0.0164  0.0550  0.1114  381 PRO A N   
305  C CA  . PRO A 20  ? 0.8530 1.0281 0.6054 0.0018  0.0659  0.1014  381 PRO A CA  
306  C C   . PRO A 20  ? 0.6680 0.9287 0.4865 -0.0318 0.0723  0.1012  381 PRO A C   
307  O O   . PRO A 20  ? 0.6472 0.9800 0.5529 -0.0284 0.0634  0.1185  381 PRO A O   
308  C CB  . PRO A 20  ? 0.8471 1.0639 0.6204 0.0417  0.0515  0.1206  381 PRO A CB  
309  C CG  . PRO A 20  ? 0.8211 1.0989 0.6791 0.0653  0.0320  0.1452  381 PRO A CG  
310  C CD  . PRO A 20  ? 0.6831 0.9020 0.5236 0.0549  0.0342  0.1378  381 PRO A CD  
318  N N   . VAL A 21  ? 0.8560 1.1092 0.6321 -0.0641 0.0889  0.0824  382 VAL A N   
319  C CA  . VAL A 21  ? 0.6953 1.0359 0.5281 -0.0971 0.0965  0.0830  382 VAL A CA  
320  C C   . VAL A 21  ? 0.8682 1.2515 0.6862 -0.1061 0.1027  0.0780  382 VAL A C   
321  O O   . VAL A 21  ? 0.6235 0.9356 0.3576 -0.1044 0.1103  0.0615  382 VAL A O   
322  C CB  . VAL A 21  ? 0.8948 1.1919 0.6921 -0.1397 0.1133  0.0625  382 VAL A CB  
323  C CG1 . VAL A 21  ? 0.9159 1.1075 0.5975 -0.1597 0.1294  0.0336  382 VAL A CG1 
324  C CG2 . VAL A 21  ? 0.7172 1.1139 0.5786 -0.1717 0.1214  0.0671  382 VAL A CG2 
334  N N   . PRO A 22  ? 0.6287 1.1294 0.5283 -0.1144 0.1004  0.0931  383 PRO A N   
335  C CA  . PRO A 22  ? 0.7049 1.2507 0.5900 -0.1231 0.1057  0.0881  383 PRO A CA  
336  C C   . PRO A 22  ? 0.6675 1.1628 0.4700 -0.1691 0.1274  0.0566  383 PRO A C   
337  O O   . PRO A 22  ? 0.6073 1.0865 0.4131 -0.1986 0.1331  0.0449  383 PRO A O   
338  C CB  . PRO A 22  ? 0.4200 1.0788 0.4165 -0.1180 0.0899  0.1077  383 PRO A CB  
339  C CG  . PRO A 22  ? 0.6378 1.3062 0.7000 -0.0948 0.0764  0.1278  383 PRO A CG  
340  C CD  . PRO A 22  ? 0.4448 1.0426 0.4511 -0.1133 0.0942  0.1166  383 PRO A CD  
348  N N   . LYS A 23  ? 0.7700 1.2242 0.5050 -0.1693 0.1342  0.0407  384 LYS A N   
349  C CA  . LYS A 23  ? 0.9727 1.3728 0.6465 -0.2071 0.1485  0.0096  384 LYS A CA  
350  C C   . LYS A 23  ? 0.8773 1.3777 0.6256 -0.2294 0.1409  0.0113  384 LYS A C   
351  O O   . LYS A 23  ? 0.7778 1.2617 0.5025 -0.2658 0.1481  -0.0097 384 LYS A O   
352  C CB  . LYS A 23  ? 1.0005 1.3229 0.5870 -0.1955 0.1578  -0.0063 384 LYS A CB  
353  C CG  . LYS A 23  ? 1.3377 1.6116 0.8710 -0.2316 0.1720  -0.0361 384 LYS A CG  
354  C CD  . LYS A 23  ? 1.4497 1.6169 0.8879 -0.2157 0.1841  -0.0525 384 LYS A CD  
355  C CE  . LYS A 23  ? 1.5402 1.7454 0.9878 -0.1775 0.1770  -0.0369 384 LYS A CE  
356  N NZ  . LYS A 23  ? 1.6143 1.7171 0.9707 -0.1610 0.1903  -0.0531 384 LYS A NZ  
370  N N   . GLY A 24  ? 0.4643 1.3031 0.5762 -0.0771 -0.0380 -0.1193 385 GLY A N   
371  C CA  . GLY A 24  ? 0.5452 1.4140 0.6521 -0.0701 -0.0401 -0.1223 385 GLY A CA  
372  C C   . GLY A 24  ? 0.3360 1.1976 0.4394 -0.0590 -0.0428 -0.1168 385 GLY A C   
373  O O   . GLY A 24  ? 0.5274 1.3599 0.6332 -0.0566 -0.0432 -0.1107 385 GLY A O   
377  N N   . VAL A 25  ? 0.4050 1.2937 0.5032 -0.0515 -0.0445 -0.1196 386 VAL A N   
378  C CA  . VAL A 25  ? 0.4432 1.3288 0.5373 -0.0394 -0.0469 -0.1147 386 VAL A CA  
379  C C   . VAL A 25  ? 0.5368 1.4382 0.6284 -0.0429 -0.0474 -0.1215 386 VAL A C   
380  O O   . VAL A 25  ? 0.4443 1.3768 0.5344 -0.0449 -0.0472 -0.1300 386 VAL A O   
381  C CB  . VAL A 25  ? 0.5825 1.4860 0.6706 -0.0219 -0.0484 -0.1100 386 VAL A CB  
382  C CG1 . VAL A 25  ? 0.4961 1.3972 0.5794 -0.0081 -0.0502 -0.1049 386 VAL A CG1 
383  C CG2 . VAL A 25  ? 0.5578 1.4446 0.6484 -0.0181 -0.0480 -0.1033 386 VAL A CG2 
393  N N   . LEU A 26  ? 0.4663 1.3489 0.5581 -0.0436 -0.0477 -0.1187 387 LEU A N   
394  C CA  . LEU A 26  ? 0.5293 1.4321 0.6171 -0.0458 -0.0474 -0.1255 387 LEU A CA  
395  C C   . LEU A 26  ? 0.3551 1.2821 0.4343 -0.0267 -0.0489 -0.1230 387 LEU A C   
396  O O   . LEU A 26  ? 0.3477 1.2600 0.4255 -0.0177 -0.0490 -0.1155 387 LEU A O   
397  C CB  . LEU A 26  ? 0.3880 1.2620 0.4794 -0.0585 -0.0458 -0.1253 387 LEU A CB  
398  C CG  . LEU A 26  ? 0.3836 1.2758 0.4709 -0.0615 -0.0455 -0.1321 387 LEU A CG  
399  C CD1 . LEU A 26  ? 0.3620 1.2792 0.4504 -0.0705 -0.0446 -0.1432 387 LEU A CD1 
400  C CD2 . LEU A 26  ? 0.5606 1.4207 0.6507 -0.0727 -0.0437 -0.1302 387 LEU A CD2 
412  N N   . ARG A 27  ? 0.3697 1.3349 0.4436 -0.0194 -0.0497 -0.1297 388 ARG A N   
413  C CA  . ARG A 27  ? 0.3789 1.3712 0.4432 0.0010  -0.0505 -0.1282 388 ARG A CA  
414  C C   . ARG A 27  ? 0.3849 1.3879 0.4466 -0.0010 -0.0507 -0.1338 388 ARG A C   
415  O O   . ARG A 27  ? 0.4155 1.4341 0.4796 -0.0112 -0.0509 -0.1441 388 ARG A O   
416  C CB  . ARG A 27  ? 0.4754 1.5040 0.5351 0.0126  -0.0512 -0.1328 388 ARG A CB  
417  C CG  . ARG A 27  ? 0.5955 1.6463 0.6443 0.0380  -0.0509 -0.1276 388 ARG A CG  
418  C CD  . ARG A 27  ? 0.6814 1.7630 0.7265 0.0487  -0.0512 -0.1314 388 ARG A CD  
419  N NE  . ARG A 27  ? 0.5301 1.5953 0.5758 0.0516  -0.0504 -0.1230 388 ARG A NE  
420  C CZ  . ARG A 27  ? 0.6850 1.7635 0.7318 0.0517  -0.0508 -0.1258 388 ARG A CZ  
421  N NH1 . ARG A 27  ? 0.4687 1.5781 0.5168 0.0491  -0.0521 -0.1378 388 ARG A NH1 
422  N NH2 . ARG A 27  ? 0.4988 1.5594 0.5459 0.0545  -0.0501 -0.1173 388 ARG A NH2 
436  N N   . ILE A 28  ? 0.4262 1.4205 0.4836 0.0091  -0.0505 -0.1272 389 ILE A N   
437  C CA  . ILE A 28  ? 0.4262 1.4246 0.4810 0.0070  -0.0509 -0.1308 389 ILE A CA  
438  C C   . ILE A 28  ? 0.3994 1.4324 0.4424 0.0324  -0.0517 -0.1305 389 ILE A C   
439  O O   . ILE A 28  ? 0.4393 1.4708 0.4757 0.0515  -0.0506 -0.1213 389 ILE A O   
440  C CB  . ILE A 28  ? 0.4116 1.3720 0.4708 -0.0009 -0.0499 -0.1241 389 ILE A CB  
441  C CG1 . ILE A 28  ? 0.4059 1.3291 0.4758 -0.0197 -0.0487 -0.1221 389 ILE A CG1 
442  C CG2 . ILE A 28  ? 0.3723 1.3322 0.4304 -0.0093 -0.0501 -0.1291 389 ILE A CG2 
443  C CD1 . ILE A 28  ? 0.3707 1.2558 0.4464 -0.0252 -0.0478 -0.1160 389 ILE A CD1 
455  N N   . HIS A 29  ? 0.4144 1.4783 0.4544 0.0343  -0.0532 -0.1407 390 HIS A N   
456  C CA  . HIS A 29  ? 0.5495 1.6460 0.5775 0.0604  -0.0541 -0.1411 390 HIS A CA  
457  C C   . HIS A 29  ? 0.4311 1.5189 0.4553 0.0609  -0.0549 -0.1402 390 HIS A C   
458  O O   . HIS A 29  ? 0.4332 1.5217 0.4617 0.0448  -0.0562 -0.1491 390 HIS A O   
459  C CB  . HIS A 29  ? 0.4487 1.5850 0.4757 0.0653  -0.0560 -0.1538 390 HIS A CB  
460  C CG  . HIS A 29  ? 0.6247 1.7725 0.6542 0.0668  -0.0554 -0.1552 390 HIS A CG  
461  N ND1 . HIS A 29  ? 0.5985 1.7608 0.6194 0.0908  -0.0541 -0.1483 390 HIS A ND1 
462  C CD2 . HIS A 29  ? 0.7422 1.8884 0.7814 0.0481  -0.0555 -0.1624 390 HIS A CD2 
463  C CE1 . HIS A 29  ? 0.4618 1.6307 0.4873 0.0853  -0.0540 -0.1514 390 HIS A CE1 
464  N NE2 . HIS A 29  ? 0.8138 1.9734 0.8503 0.0601  -0.0551 -0.1599 390 HIS A NE2 
473  N N   . PHE A 30  ? 0.4291 1.5075 0.4450 0.0796  -0.0535 -0.1291 391 PHE A N   
474  C CA  . PHE A 30  ? 0.4306 1.4999 0.4403 0.0845  -0.0541 -0.1264 391 PHE A CA  
475  C C   . PHE A 30  ? 0.4550 1.5582 0.4488 0.1147  -0.0552 -0.1275 391 PHE A C   
476  O O   . PHE A 30  ? 0.5693 1.6789 0.5499 0.1452  -0.0526 -0.1175 391 PHE A O   
477  C CB  . PHE A 30  ? 0.4167 1.4568 0.4260 0.0908  -0.0515 -0.1138 391 PHE A CB  
478  C CG  . PHE A 30  ? 0.4987 1.5206 0.5050 0.0881  -0.0522 -0.1115 391 PHE A CG  
479  C CD1 . PHE A 30  ? 0.4024 1.4033 0.4195 0.0572  -0.0537 -0.1185 391 PHE A CD1 
480  C CD2 . PHE A 30  ? 0.5055 1.5278 0.4965 0.1180  -0.0502 -0.1011 391 PHE A CD2 
481  C CE1 . PHE A 30  ? 0.4217 1.4043 0.4359 0.0533  -0.0542 -0.1166 391 PHE A CE1 
482  C CE2 . PHE A 30  ? 0.5499 1.5528 0.5355 0.1163  -0.0509 -0.0985 391 PHE A CE2 
483  C CZ  . PHE A 30  ? 0.4074 1.3917 0.4058 0.0824  -0.0535 -0.1070 391 PHE A CZ  
493  N N   . ILE A 31  ? 0.4666 1.5902 0.4613 0.1078  -0.0585 -0.1398 392 ILE A N   
494  C CA  . ILE A 31  ? 0.5637 1.7238 0.5454 0.1360  -0.0602 -0.1441 392 ILE A CA  
495  C C   . ILE A 31  ? 0.5058 1.6607 0.4712 0.1559  -0.0611 -0.1387 392 ILE A C   
496  O O   . ILE A 31  ? 0.5771 1.7335 0.5253 0.1895  -0.0584 -0.1275 392 ILE A O   
497  C CB  . ILE A 31  ? 0.5007 1.6887 0.4912 0.1218  -0.0635 -0.1616 392 ILE A CB  
498  C CG1 . ILE A 31  ? 0.6369 1.8239 0.6416 0.1009  -0.0621 -0.1663 392 ILE A CG1 
499  C CG2 . ILE A 31  ? 0.5277 1.7562 0.5061 0.1531  -0.0655 -0.1672 392 ILE A CG2 
500  C CD1 . ILE A 31  ? 0.4931 1.6978 0.5088 0.0806  -0.0638 -0.1832 392 ILE A CD1 
512  N N   . GLU A 32  ? 0.5030 1.6478 0.4720 0.1361  -0.0640 -0.1456 393 GLU A N   
513  C CA  . GLU A 32  ? 0.5197 1.6592 0.4708 0.1538  -0.0654 -0.1423 393 GLU A CA  
514  C C   . GLU A 32  ? 0.5494 1.6664 0.5078 0.1237  -0.0674 -0.1478 393 GLU A C   
515  O O   . GLU A 32  ? 0.4916 1.6040 0.4696 0.0904  -0.0675 -0.1570 393 GLU A O   
516  C CB  . GLU A 32  ? 0.5486 1.7262 0.4886 0.1797  -0.0683 -0.1504 393 GLU A CB  
517  C CG  . GLU A 32  ? 0.5475 1.7524 0.5047 0.1565  -0.0719 -0.1696 393 GLU A CG  
518  C CD  . GLU A 32  ? 0.8268 2.0726 0.7746 0.1827  -0.0752 -0.1797 393 GLU A CD  
519  O OE1 . GLU A 32  ? 1.0085 2.2712 0.9435 0.2159  -0.0738 -0.1738 393 GLU A OE1 
520  O OE2 . GLU A 32  ? 0.6356 1.8966 0.5893 0.1709  -0.0787 -0.1939 393 GLU A OE2 
527  N N   . ALA A 33  ? 0.5200 1.6196 0.4598 0.1372  -0.0678 -0.1415 394 ALA A N   
528  C CA  . ALA A 33  ? 0.5141 1.5949 0.4571 0.1125  -0.0697 -0.1473 394 ALA A CA  
529  C C   . ALA A 33  ? 0.5437 1.6359 0.4647 0.1369  -0.0723 -0.1494 394 ALA A C   
530  O O   . ALA A 33  ? 0.6357 1.7375 0.5346 0.1755  -0.0709 -0.1418 394 ALA A O   
531  C CB  . ALA A 33  ? 0.4968 1.5337 0.4374 0.0995  -0.0667 -0.1368 394 ALA A CB  
537  N N   . GLN A 34  ? 0.5610 1.6498 0.4875 0.1154  -0.0751 -0.1591 395 GLN A N   
538  C CA  . GLN A 34  ? 0.6942 1.7900 0.6000 0.1362  -0.0777 -0.1615 395 GLN A CA  
539  C C   . GLN A 34  ? 0.7021 1.7621 0.6034 0.1145  -0.0774 -0.1605 395 GLN A C   
540  O O   . GLN A 34  ? 0.6016 1.6435 0.5244 0.0768  -0.0763 -0.1641 395 GLN A O   
541  C CB  . GLN A 34  ? 0.8587 2.0013 0.7767 0.1365  -0.0823 -0.1794 395 GLN A CB  
542  C CG  . GLN A 34  ? 0.8361 1.9823 0.7804 0.0952  -0.0830 -0.1944 395 GLN A CG  
543  C CD  . GLN A 34  ? 0.9482 2.1407 0.9020 0.0989  -0.0863 -0.2129 395 GLN A CD  
544  O OE1 . GLN A 34  ? 0.9530 2.1790 0.8979 0.1296  -0.0885 -0.2159 395 GLN A OE1 
545  N NE2 . GLN A 34  ? 0.7429 1.9368 0.7146 0.0683  -0.0856 -0.2257 395 GLN A NE2 
554  N N   . ASP A 35  ? 0.7457 1.7921 0.6172 0.1398  -0.0768 -0.1547 396 ASP A N   
555  C CA  . ASP A 35  ? 0.5891 1.6038 0.4523 0.1226  -0.0763 -0.1549 396 ASP A CA  
556  C C   . ASP A 35  ? 0.6193 1.5869 0.4837 0.0978  -0.0710 -0.1460 396 ASP A C   
557  O O   . ASP A 35  ? 0.6085 1.5595 0.4888 0.0621  -0.0720 -0.1522 396 ASP A O   
558  C CB  . ASP A 35  ? 0.7997 1.8401 0.6895 0.0925  -0.0818 -0.1733 396 ASP A CB  
559  C CG  . ASP A 35  ? 1.0214 2.1099 0.9097 0.1164  -0.0867 -0.1849 396 ASP A CG  
560  O OD1 . ASP A 35  ? 0.9714 2.0651 0.8319 0.1577  -0.0865 -0.1776 396 ASP A OD1 
561  O OD2 . ASP A 35  ? 1.2209 2.3399 1.1348 0.0951  -0.0891 -0.2014 396 ASP A OD2 
566  N N   . LEU A 36  ? 0.6898 1.6351 0.5378 0.1171  -0.0640 -0.1318 397 LEU A N   
567  C CA  . LEU A 36  ? 0.6901 1.5916 0.5373 0.0968  -0.0573 -0.1246 397 LEU A CA  
568  C C   . LEU A 36  ? 0.6260 1.4786 0.4426 0.1005  -0.0476 -0.1176 397 LEU A C   
569  O O   . LEU A 36  ? 0.6718 1.5238 0.4616 0.1269  -0.0457 -0.1150 397 LEU A O   
570  C CB  . LEU A 36  ? 0.5500 1.4398 0.3864 0.1198  -0.0485 -0.1117 397 LEU A CB  
571  C CG  . LEU A 36  ? 0.6930 1.6230 0.5608 0.1144  -0.0559 -0.1165 397 LEU A CG  
572  C CD1 . LEU A 36  ? 0.5292 1.4414 0.3856 0.1351  -0.0464 -0.1030 397 LEU A CD1 
573  C CD2 . LEU A 36  ? 0.4932 1.4328 0.4031 0.0671  -0.0628 -0.1294 397 LEU A CD2 
585  N N   . GLN A 37  ? 0.5992 1.3914 0.4366 0.0731  -0.0370 -0.1111 398 GLN A N   
586  C CA  . GLN A 37  ? 0.5624 1.2874 0.3881 0.0711  -0.0231 -0.1016 398 GLN A CA  
587  C C   . GLN A 37  ? 0.7702 1.4420 0.5694 0.1136  -0.0017 -0.0815 398 GLN A C   
588  O O   . GLN A 37  ? 0.5922 1.2345 0.4022 0.1217  0.0103  -0.0716 398 GLN A O   
589  C CB  . GLN A 37  ? 0.5740 1.2534 0.4318 0.0279  -0.0188 -0.1027 398 GLN A CB  
590  C CG  . GLN A 37  ? 0.8720 1.4776 0.7210 0.0227  -0.0039 -0.0931 398 GLN A CG  
591  C CD  . GLN A 37  ? 1.0557 1.6761 0.8841 0.0224  -0.0109 -0.0993 398 GLN A CD  
592  O OE1 . GLN A 37  ? 0.9962 1.6824 0.8273 0.0118  -0.0289 -0.1151 398 GLN A OE1 
593  N NE2 . GLN A 37  ? 1.1488 1.7080 0.9575 0.0343  0.0038  -0.0876 398 GLN A NE2 
602  N N   . GLY A 38  ? 0.6320 1.2921 0.3971 0.1415  0.0038  -0.0759 399 GLY A N   
603  C CA  . GLY A 38  ? 0.8094 1.4149 0.5468 0.1833  0.0270  -0.0563 399 GLY A CA  
604  C C   . GLY A 38  ? 0.7238 1.2426 0.4721 0.1682  0.0466  -0.0456 399 GLY A C   
605  O O   . GLY A 38  ? 0.7448 1.2484 0.5196 0.1260  0.0408  -0.0534 399 GLY A O   
609  N N   . LYS A 39  ? 0.9017 1.3630 0.6299 0.2031  0.0710  -0.0280 400 LYS A N   
610  C CA  . LYS A 39  ? 0.8587 1.2347 0.5980 0.1920  0.0920  -0.0183 400 LYS A CA  
611  C C   . LYS A 39  ? 0.9375 1.2798 0.6557 0.1907  0.0958  -0.0159 400 LYS A C   
612  O O   . LYS A 39  ? 0.8031 1.1587 0.4851 0.2240  0.0972  -0.0112 400 LYS A O   
613  C CB  . LYS A 39  ? 0.9265 1.2532 0.6593 0.2285  0.1192  -0.0016 400 LYS A CB  
614  C CG  . LYS A 39  ? 0.8068 1.1313 0.5766 0.2122  0.1211  -0.0042 400 LYS A CG  
615  C CD  . LYS A 39  ? 1.1749 1.4742 0.9380 0.2521  0.1441  0.0097  400 LYS A CD  
616  C CE  . LYS A 39  ? 1.2076 1.5135 1.0087 0.2352  0.1429  0.0052  400 LYS A CE  
617  N NZ  . LYS A 39  ? 1.3531 1.6473 1.1486 0.2742  0.1629  0.0172  400 LYS A NZ  
631  N N   . ASP A 40  ? 0.8446 1.1439 0.5854 0.1525  0.0971  -0.0194 401 ASP A N   
632  C CA  . ASP A 40  ? 0.7847 1.0540 0.5105 0.1433  0.0982  -0.0187 401 ASP A CA  
633  C C   . ASP A 40  ? 0.8406 1.0343 0.5420 0.1766  0.1261  -0.0007 401 ASP A C   
634  O O   . ASP A 40  ? 0.7734 0.9178 0.4828 0.1922  0.1480  0.0098  401 ASP A O   
635  C CB  . ASP A 40  ? 0.9017 1.1492 0.6601 0.0904  0.0909  -0.0283 401 ASP A CB  
636  C CG  . ASP A 40  ? 1.0784 1.2844 0.8231 0.0797  0.0947  -0.0259 401 ASP A CG  
637  O OD1 . ASP A 40  ? 1.0009 1.2516 0.7347 0.0699  0.0773  -0.0353 401 ASP A OD1 
638  O OD2 . ASP A 40  ? 0.8918 1.0209 0.6376 0.0814  0.1155  -0.0153 401 ASP A OD2 
643  N N   . THR A 41  ? 0.7740 0.9595 0.4466 0.1876  0.1257  0.0019  402 THR A N   
644  C CA  . THR A 41  ? 0.8099 0.9183 0.4605 0.2125  0.1516  0.0180  402 THR A CA  
645  C C   . THR A 41  ? 1.0783 1.1691 0.7228 0.1876  0.1440  0.0139  402 THR A C   
646  O O   . THR A 41  ? 0.7852 0.9330 0.4355 0.1610  0.1190  -0.0009 402 THR A O   
647  C CB  . THR A 41  ? 1.1757 1.2904 0.7836 0.2721  0.1649  0.0311  402 THR A CB  
648  O OG1 . THR A 41  ? 1.2116 1.2478 0.7978 0.2963  0.1921  0.0473  402 THR A OG1 
649  C CG2 . THR A 41  ? 1.0222 1.2154 0.6030 0.2852  0.1411  0.0215  402 THR A CG2 
657  N N   . TYR A 42  ? 0.8288 0.8402 0.4639 0.1953  0.1664  0.0263  403 TYR A N   
658  C CA  . TYR A 42  ? 0.8287 0.8153 0.4567 0.1739  0.1617  0.0245  403 TYR A CA  
659  C C   . TYR A 42  ? 0.9598 0.9888 0.5471 0.2037  0.1516  0.0247  403 TYR A C   
660  O O   . TYR A 42  ? 0.9168 1.0025 0.5064 0.1806  0.1268  0.0102  403 TYR A O   
661  C CB  . TYR A 42  ? 0.8451 0.7325 0.4743 0.1767  0.1902  0.0381  403 TYR A CB  
662  C CG  . TYR A 42  ? 0.8433 0.6972 0.4674 0.1519  0.1869  0.0372  403 TYR A CG  
663  C CD1 . TYR A 42  ? 0.8024 0.6869 0.4501 0.1017  0.1638  0.0220  403 TYR A CD1 
664  C CD2 . TYR A 42  ? 0.9583 0.7483 0.5543 0.1790  0.2082  0.0520  403 TYR A CD2 
665  C CE1 . TYR A 42  ? 0.7997 0.6541 0.4433 0.0784  0.1611  0.0213  403 TYR A CE1 
666  C CE2 . TYR A 42  ? 0.9463 0.7049 0.5376 0.1561  0.2050  0.0515  403 TYR A CE2 
667  C CZ  . TYR A 42  ? 0.8380 0.6298 0.4534 0.1052  0.1810  0.0360  403 TYR A CZ  
668  O OH  . TYR A 42  ? 0.8346 0.5965 0.4459 0.0814  0.1777  0.0356  403 TYR A OH  
678  N N   . LEU A 43  ? 0.9079 0.9101 0.4588 0.2559  0.1715  0.0403  404 LEU A N   
679  C CA  . LEU A 43  ? 0.9419 0.9901 0.4511 0.2931  0.1625  0.0404  404 LEU A CA  
680  C C   . LEU A 43  ? 0.9581 1.0631 0.4517 0.3320  0.1599  0.0407  404 LEU A C   
681  O O   . LEU A 43  ? 0.9962 1.0839 0.5030 0.3414  0.1740  0.0474  404 LEU A O   
682  C CB  . LEU A 43  ? 1.0403 1.0208 0.5130 0.3294  0.1867  0.0583  404 LEU A CB  
683  C CG  . LEU A 43  ? 0.9814 0.8935 0.4642 0.2983  0.1942  0.0615  404 LEU A CG  
684  C CD1 . LEU A 43  ? 1.0340 0.8808 0.4774 0.3421  0.2206  0.0808  404 LEU A CD1 
685  C CD2 . LEU A 43  ? 1.0047 0.9659 0.4982 0.2569  0.1644  0.0440  404 LEU A CD2 
697  N N   . LYS A 44  ? 1.2848 1.4586 0.7507 0.3548  0.1416  0.0325  405 LYS A N   
698  C CA  . LYS A 44  ? 1.3061 1.5319 0.7494 0.3986  0.1402  0.0338  405 LYS A CA  
699  C C   . LYS A 44  ? 1.3871 1.5478 0.7971 0.4524  0.1745  0.0577  405 LYS A C   
700  O O   . LYS A 44  ? 1.3105 1.4104 0.7027 0.4658  0.1904  0.0699  405 LYS A O   
701  C CB  . LYS A 44  ? 1.5817 1.8912 1.0035 0.4131  0.1136  0.0186  405 LYS A CB  
702  C CG  . LYS A 44  ? 1.7537 2.1306 1.2073 0.3619  0.0822  -0.0066 405 LYS A CG  
703  C CD  . LYS A 44  ? 1.8629 2.3041 1.3092 0.3699  0.0575  -0.0218 405 LYS A CD  
704  C CE  . LYS A 44  ? 1.7863 2.2837 1.2636 0.3169  0.0312  -0.0465 405 LYS A CE  
705  N NZ  . LYS A 44  ? 1.5049 2.0628 0.9889 0.3216  0.0082  -0.0629 405 LYS A NZ  
719  N N   . GLY A 45  ? 1.4982 1.6664 0.9153 0.4757  0.1818  0.0649  406 GLY A N   
720  C CA  . GLY A 45  ? 1.7074 1.8124 1.1126 0.5180  0.2082  0.0882  406 GLY A CA  
721  C C   . GLY A 45  ? 1.6775 1.8239 1.0811 0.5506  0.2023  0.0929  406 GLY A C   
722  O O   . GLY A 45  ? 1.5748 1.8032 0.9810 0.5491  0.1756  0.0779  406 GLY A O   
726  N N   . LEU A 46  ? 1.8302 1.9179 1.2311 0.5783  0.2268  0.1141  407 LEU A N   
727  C CA  . LEU A 46  ? 2.0230 2.1392 1.4238 0.6054  0.2247  0.1212  407 LEU A CA  
728  C C   . LEU A 46  ? 1.9827 2.1366 1.4157 0.5734  0.2176  0.1071  407 LEU A C   
729  O O   . LEU A 46  ? 2.1157 2.2437 1.5712 0.5371  0.2253  0.0998  407 LEU A O   
730  C CB  . LEU A 46  ? 2.0477 2.0842 1.4376 0.6345  0.2530  0.1489  407 LEU A CB  
731  C CG  . LEU A 46  ? 1.9950 2.0509 1.3674 0.6742  0.2517  0.1630  407 LEU A CG  
732  C CD1 . LEU A 46  ? 1.8743 1.9771 1.2156 0.7103  0.2334  0.1625  407 LEU A CD1 
733  C CD2 . LEU A 46  ? 1.9082 1.8778 1.2715 0.6875  0.2816  0.1905  407 LEU A CD2 
745  N N   . VAL A 47  ? 1.8495 2.0642 1.2853 0.5869  0.2026  0.1031  408 VAL A N   
746  C CA  . VAL A 47  ? 1.6346 1.8921 1.1001 0.5586  0.1931  0.0899  408 VAL A CA  
747  C C   . VAL A 47  ? 1.6956 2.0091 1.1740 0.5161  0.1690  0.0657  408 VAL A C   
748  O O   . VAL A 47  ? 1.7814 2.0855 1.2488 0.5043  0.1647  0.0605  408 VAL A O   
749  C CB  . VAL A 47  ? 1.7170 1.9056 1.2076 0.5451  0.2206  0.0999  408 VAL A CB  
750  C CG1 . VAL A 47  ? 1.7376 1.9666 1.2616 0.5107  0.2114  0.0843  408 VAL A CG1 
751  C CG2 . VAL A 47  ? 1.6671 1.8131 1.1484 0.5808  0.2388  0.1225  408 VAL A CG2 
761  N N   . LYS A 48  ? 1.9568 2.3295 1.4581 0.4924  0.1517  0.0513  409 LYS A N   
762  C CA  . LYS A 48  ? 1.9557 2.3801 1.4736 0.4473  0.1279  0.0291  409 LYS A CA  
763  C C   . LYS A 48  ? 1.8271 2.2360 1.3848 0.4071  0.1311  0.0246  409 LYS A C   
764  O O   . LYS A 48  ? 1.8838 2.3024 1.4716 0.3590  0.1141  0.0110  409 LYS A O   
765  C CB  . LYS A 48  ? 1.9001 2.4159 1.4235 0.4473  0.0950  0.0129  409 LYS A CB  
766  C CG  . LYS A 48  ? 1.8769 2.4521 1.4284 0.3978  0.0688  -0.0105 409 LYS A CG  
767  C CD  . LYS A 48  ? 1.8552 2.4123 1.4061 0.3645  0.0652  -0.0189 409 LYS A CD  
768  C CE  . LYS A 48  ? 1.8181 2.3988 1.4161 0.3062  0.0473  -0.0351 409 LYS A CE  
769  N NZ  . LYS A 48  ? 1.7286 2.2669 1.3432 0.2668  0.0470  -0.0384 409 LYS A NZ  
783  N N   . GLY A 49  ? 1.6878 2.0676 1.2539 0.4243  0.1510  0.0363  410 GLY A N   
784  C CA  . GLY A 49  ? 1.6137 1.9741 1.2257 0.3879  0.1522  0.0328  410 GLY A CA  
785  C C   . GLY A 49  ? 1.4571 1.8752 1.0793 0.3950  0.1421  0.0287  410 GLY A C   
786  O O   . GLY A 49  ? 1.4947 1.9887 1.1164 0.3858  0.1154  0.0147  410 GLY A O   
790  N N   . LYS A 50  ? 1.4215 1.8032 1.0545 0.4114  0.1641  0.0404  411 LYS A N   
791  C CA  . LYS A 50  ? 1.4529 1.8829 1.0922 0.4243  0.1585  0.0396  411 LYS A CA  
792  C C   . LYS A 50  ? 1.1780 1.6310 0.8644 0.3775  0.1410  0.0262  411 LYS A C   
793  O O   . LYS A 50  ? 1.2947 1.6995 1.0121 0.3613  0.1549  0.0292  411 LYS A O   
794  C CB  . LYS A 50  ? 1.5609 1.9366 1.1964 0.4597  0.1863  0.0592  411 LYS A CB  
795  C CG  . LYS A 50  ? 1.7601 2.1055 1.3592 0.4979  0.1940  0.0750  411 LYS A CG  
796  C CD  . LYS A 50  ? 1.8091 2.0914 1.4064 0.5248  0.2181  0.0963  411 LYS A CD  
797  C CE  . LYS A 50  ? 1.7595 2.0155 1.3175 0.5621  0.2241  0.1125  411 LYS A CE  
798  N NZ  . LYS A 50  ? 1.7092 1.9059 1.2596 0.5863  0.2461  0.1347  411 LYS A NZ  
812  N N   . SER A 51  ? 0.7691 1.2966 0.4606 0.3570  0.1108  0.0104  412 SER A N   
813  C CA  . SER A 51  ? 0.8904 1.4481 0.6230 0.3143  0.0924  -0.0030 412 SER A CA  
814  C C   . SER A 51  ? 0.8818 1.4860 0.6205 0.3294  0.0875  -0.0025 412 SER A C   
815  O O   . SER A 51  ? 0.9592 1.6134 0.6700 0.3598  0.0805  -0.0021 412 SER A O   
816  C CB  . SER A 51  ? 0.9813 1.5913 0.7198 0.2805  0.0643  -0.0213 412 SER A CB  
817  O OG  . SER A 51  ? 0.9912 1.5618 0.7208 0.2691  0.0684  -0.0212 412 SER A OG  
823  N N   . ASP A 52  ? 0.8450 1.4333 0.6198 0.3088  0.0906  -0.0032 413 ASP A N   
824  C CA  . ASP A 52  ? 0.6642 1.2895 0.4479 0.3221  0.0880  -0.0015 413 ASP A CA  
825  C C   . ASP A 52  ? 0.8626 1.5230 0.6856 0.2800  0.0672  -0.0156 413 ASP A C   
826  O O   . ASP A 52  ? 0.5942 1.2221 0.4481 0.2650  0.0755  -0.0142 413 ASP A O   
827  C CB  . ASP A 52  ? 0.6804 1.2472 0.4678 0.3488  0.1181  0.0145  413 ASP A CB  
828  C CG  . ASP A 52  ? 0.9879 1.5095 0.7381 0.3895  0.1430  0.0296  413 ASP A CG  
829  O OD1 . ASP A 52  ? 1.0536 1.6126 0.7661 0.4178  0.1369  0.0316  413 ASP A OD1 
830  O OD2 . ASP A 52  ? 0.7401 1.1890 0.4988 0.3940  0.1689  0.0386  413 ASP A OD2 
835  N N   . PRO A 53  ? 0.5441 1.5656 0.4397 0.3139  0.0523  0.0992  414 PRO A N   
836  C CA  . PRO A 53  ? 0.5073 1.5221 0.4200 0.2931  0.0396  0.0772  414 PRO A CA  
837  C C   . PRO A 53  ? 0.4909 1.4830 0.4152 0.2848  0.0430  0.0867  414 PRO A C   
838  O O   . PRO A 53  ? 0.5036 1.5035 0.4252 0.2994  0.0478  0.1066  414 PRO A O   
839  C CB  . PRO A 53  ? 0.5001 1.5677 0.4177 0.2971  0.0203  0.0554  414 PRO A CB  
840  C CG  . PRO A 53  ? 0.5473 1.6469 0.4518 0.3166  0.0228  0.0606  414 PRO A CG  
841  C CD  . PRO A 53  ? 0.6519 1.7297 0.5423 0.3329  0.0400  0.0948  414 PRO A CD  
849  N N   . TYR A 54  ? 0.4657 1.4297 0.4027 0.2626  0.0413  0.0719  415 TYR A N   
850  C CA  . TYR A 54  ? 0.4470 1.3915 0.3976 0.2496  0.0421  0.0734  415 TYR A CA  
851  C C   . TYR A 54  ? 0.4546 1.3892 0.4137 0.2298  0.0321  0.0498  415 TYR A C   
852  O O   . TYR A 54  ? 0.4225 1.3587 0.3779 0.2282  0.0283  0.0355  415 TYR A O   
853  C CB  . TYR A 54  ? 0.4530 1.3550 0.4145 0.2447  0.0644  0.0905  415 TYR A CB  
854  C CG  . TYR A 54  ? 0.4783 1.3480 0.4493 0.2279  0.0742  0.0805  415 TYR A CG  
855  C CD1 . TYR A 54  ? 0.4639 1.3328 0.4251 0.2327  0.0822  0.0802  415 TYR A CD1 
856  C CD2 . TYR A 54  ? 0.5520 1.3964 0.5420 0.2076  0.0754  0.0701  415 TYR A CD2 
857  C CE1 . TYR A 54  ? 0.4590 1.3059 0.4299 0.2180  0.0907  0.0685  415 TYR A CE1 
858  C CE2 . TYR A 54  ? 0.5416 1.3660 0.5406 0.1947  0.0828  0.0594  415 TYR A CE2 
859  C CZ  . TYR A 54  ? 0.5766 1.4038 0.5667 0.2001  0.0902  0.0581  415 TYR A CZ  
860  O OH  . TYR A 54  ? 0.5103 1.3247 0.5101 0.1881  0.0972  0.0452  415 TYR A OH  
870  N N   . GLY A 55  ? 0.4331 1.3573 0.4031 0.2165  0.0295  0.0460  416 GLY A N   
871  C CA  . GLY A 55  ? 0.3887 1.3065 0.3644 0.2004  0.0216  0.0260  416 GLY A CA  
872  C C   . GLY A 55  ? 0.3956 1.2772 0.3884 0.1838  0.0288  0.0279  416 GLY A C   
873  O O   . GLY A 55  ? 0.4072 1.2732 0.4108 0.1809  0.0378  0.0407  416 GLY A O   
877  N N   . ILE A 56  ? 0.4263 1.2974 0.4217 0.1753  0.0256  0.0145  417 ILE A N   
878  C CA  . ILE A 56  ? 0.3921 1.2386 0.4015 0.1600  0.0288  0.0129  417 ILE A CA  
879  C C   . ILE A 56  ? 0.3414 1.1985 0.3508 0.1518  0.0205  -0.0002 417 ILE A C   
880  O O   . ILE A 56  ? 0.4123 1.2834 0.4133 0.1574  0.0155  -0.0129 417 ILE A O   
881  C CB  . ILE A 56  ? 0.3484 1.1792 0.3606 0.1597  0.0332  0.0095  417 ILE A CB  
882  C CG1 . ILE A 56  ? 0.4647 1.2866 0.4799 0.1640  0.0453  0.0193  417 ILE A CG1 
883  C CG2 . ILE A 56  ? 0.3354 1.1490 0.3603 0.1454  0.0349  0.0066  417 ILE A CG2 
884  C CD1 . ILE A 56  ? 0.3578 1.1615 0.3876 0.1561  0.0583  0.0314  417 ILE A CD1 
896  N N   . ILE A 57  ? 0.3315 1.1821 0.3518 0.1383  0.0213  0.0017  418 ILE A N   
897  C CA  . ILE A 57  ? 0.3732 1.2354 0.3968 0.1265  0.0163  -0.0104 418 ILE A CA  
898  C C   . ILE A 57  ? 0.3795 1.2218 0.4126 0.1136  0.0194  -0.0097 418 ILE A C   
899  O O   . ILE A 57  ? 0.3090 1.1323 0.3522 0.1061  0.0245  -0.0018 418 ILE A O   
900  C CB  . ILE A 57  ? 0.3765 1.2560 0.4050 0.1200  0.0137  -0.0118 418 ILE A CB  
901  C CG1 . ILE A 57  ? 0.4825 1.3893 0.4986 0.1357  0.0099  -0.0115 418 ILE A CG1 
902  C CG2 . ILE A 57  ? 0.3230 1.2182 0.3579 0.1031  0.0102  -0.0279 418 ILE A CG2 
903  C CD1 . ILE A 57  ? 0.6590 1.5571 0.6738 0.1492  0.0158  0.0083  418 ILE A CD1 
915  N N   . ARG A 58  ? 0.3981 1.2478 0.4281 0.1125  0.0179  -0.0187 419 ARG A N   
916  C CA  . ARG A 58  ? 0.3126 1.1513 0.3473 0.1039  0.0204  -0.0169 419 ARG A CA  
917  C C   . ARG A 58  ? 0.3145 1.1667 0.3511 0.0899  0.0223  -0.0249 419 ARG A C   
918  O O   . ARG A 58  ? 0.3715 1.1990 0.3855 0.0879  0.0166  -0.0341 419 ARG A O   
919  C CB  . ARG A 58  ? 0.5025 1.3384 0.5289 0.1199  0.0205  -0.0168 419 ARG A CB  
920  C CG  . ARG A 58  ? 0.5337 1.3676 0.5618 0.1149  0.0220  -0.0143 419 ARG A CG  
921  C CD  . ARG A 58  ? 0.4121 1.2495 0.4317 0.1349  0.0204  -0.0145 419 ARG A CD  
922  N NE  . ARG A 58  ? 0.5922 1.4192 0.6165 0.1347  0.0203  -0.0132 419 ARG A NE  
923  C CZ  . ARG A 58  ? 0.5954 1.4153 0.6287 0.1225  0.0226  -0.0122 419 ARG A CZ  
924  N NH1 . ARG A 58  ? 0.7168 1.5391 0.7538 0.1105  0.0226  -0.0110 419 ARG A NH1 
925  N NH2 . ARG A 58  ? 0.5493 1.3619 0.5891 0.1209  0.0264  -0.0140 419 ARG A NH2 
939  N N   . VAL A 59  ? 0.3334 1.1771 0.3788 0.0729  0.0241  -0.0212 420 VAL A N   
940  C CA  . VAL A 59  ? 0.3752 1.2031 0.4101 0.0543  0.0248  -0.0255 420 VAL A CA  
941  C C   . VAL A 59  ? 0.3203 1.1471 0.3578 0.0522  0.0286  -0.0177 420 VAL A C   
942  O O   . VAL A 59  ? 0.3717 1.2000 0.4257 0.0422  0.0299  -0.0151 420 VAL A O   
943  C CB  . VAL A 59  ? 0.4218 1.2654 0.4713 0.0323  0.0264  -0.0332 420 VAL A CB  
944  C CG1 . VAL A 59  ? 0.3534 1.1641 0.3841 0.0083  0.0279  -0.0385 420 VAL A CG1 
945  C CG2 . VAL A 59  ? 0.4089 1.2687 0.4586 0.0365  0.0215  -0.0430 420 VAL A CG2 
955  N N   . GLY A 60  ? 0.4172 1.2134 0.4269 0.0621  0.0247  -0.0139 421 GLY A N   
956  C CA  . GLY A 60  ? 0.4530 1.2559 0.4613 0.0651  0.0260  -0.0069 421 GLY A CA  
957  C C   . GLY A 60  ? 0.3602 1.1989 0.3952 0.0757  0.0282  -0.0067 421 GLY A C   
958  O O   . GLY A 60  ? 0.4149 1.2528 0.4474 0.0936  0.0250  -0.0076 421 GLY A O   
962  N N   . ASN A 61  ? 0.3082 1.1370 0.3537 0.0589  0.0280  -0.0069 422 ASN A N   
963  C CA  . ASN A 61  ? 0.4410 1.2558 0.4945 0.0595  0.0278  -0.0091 422 ASN A CA  
964  C C   . ASN A 61  ? 0.2869 1.0787 0.3528 0.0526  0.0320  -0.0095 422 ASN A C   
965  O O   . ASN A 61  ? 0.3481 1.1266 0.4224 0.0532  0.0366  -0.0107 422 ASN A O   
966  C CB  . ASN A 61  ? 0.4839 1.3009 0.5412 0.0468  0.0289  -0.0121 422 ASN A CB  
967  C CG  . ASN A 61  ? 0.6225 1.4688 0.6668 0.0612  0.0243  -0.0107 422 ASN A CG  
968  O OD1 . ASN A 61  ? 0.4529 1.3112 0.4886 0.0833  0.0208  -0.0096 422 ASN A OD1 
969  N ND2 . ASN A 61  ? 0.5672 1.4278 0.6089 0.0514  0.0241  -0.0110 422 ASN A ND2 
976  N N   . GLN A 62  ? 0.2850 1.0760 0.3530 0.0463  0.0319  -0.0089 423 GLN A N   
977  C CA  . GLN A 62  ? 0.2816 1.0586 0.3600 0.0450  0.0356  -0.0072 423 GLN A CA  
978  C C   . GLN A 62  ? 0.3457 1.1277 0.4173 0.0624  0.0340  -0.0039 423 GLN A C   
979  O O   . GLN A 62  ? 0.3741 1.1731 0.4347 0.0707  0.0287  -0.0061 423 GLN A O   
980  C CB  . GLN A 62  ? 0.2801 1.0623 0.3633 0.0330  0.0348  -0.0102 423 GLN A CB  
981  C CG  . GLN A 62  ? 0.3028 1.0790 0.3923 0.0145  0.0375  -0.0142 423 GLN A CG  
982  C CD  . GLN A 62  ? 0.2803 1.0700 0.3695 0.0002  0.0358  -0.0201 423 GLN A CD  
983  O OE1 . GLN A 62  ? 0.3436 1.1292 0.4436 -0.0075 0.0377  -0.0238 423 GLN A OE1 
984  N NE2 . GLN A 62  ? 0.3239 1.1322 0.4019 -0.0036 0.0343  -0.0222 423 GLN A NE2 
993  N N   . ILE A 63  ? 0.2874 1.0555 0.3667 0.0674  0.0407  0.0006  424 ILE A N   
994  C CA  . ILE A 63  ? 0.2946 1.0676 0.3670 0.0832  0.0411  0.0053  424 ILE A CA  
995  C C   . ILE A 63  ? 0.3422 1.1116 0.4225 0.0869  0.0473  0.0132  424 ILE A C   
996  O O   . ILE A 63  ? 0.2969 1.0506 0.3933 0.0796  0.0570  0.0157  424 ILE A O   
997  C CB  . ILE A 63  ? 0.3933 1.1590 0.4666 0.0883  0.0464  0.0047  424 ILE A CB  
998  C CG1 . ILE A 63  ? 0.4732 1.2535 0.5336 0.0956  0.0380  -0.0016 424 ILE A CG1 
999  C CG2 . ILE A 63  ? 0.4272 1.1931 0.4978 0.1010  0.0520  0.0115  424 ILE A CG2 
1000 C CD1 . ILE A 63  ? 0.8067 1.6027 0.8517 0.1116  0.0314  -0.0023 424 ILE A CD1 
1012 N N   . PHE A 64  ? 0.3156 1.1029 0.3843 0.1004  0.0424  0.0166  425 PHE A N   
1013 C CA  . PHE A 64  ? 0.3143 1.1083 0.3855 0.1110  0.0469  0.0266  425 PHE A CA  
1014 C C   . PHE A 64  ? 0.4352 1.2378 0.4936 0.1288  0.0489  0.0341  425 PHE A C   
1015 O O   . PHE A 64  ? 0.3363 1.1518 0.3806 0.1341  0.0409  0.0276  425 PHE A O   
1016 C CB  . PHE A 64  ? 0.3143 1.1332 0.3820 0.1105  0.0374  0.0217  425 PHE A CB  
1017 C CG  . PHE A 64  ? 0.5104 1.3239 0.5892 0.0914  0.0356  0.0126  425 PHE A CG  
1018 C CD1 . PHE A 64  ? 0.3104 1.1119 0.4065 0.0856  0.0430  0.0159  425 PHE A CD1 
1019 C CD2 . PHE A 64  ? 0.3320 1.1540 0.4047 0.0798  0.0284  0.0006  425 PHE A CD2 
1020 C CE1 . PHE A 64  ? 0.4457 1.2432 0.5510 0.0674  0.0416  0.0066  425 PHE A CE1 
1021 C CE2 . PHE A 64  ? 0.4079 1.2267 0.4893 0.0613  0.0283  -0.0068 425 PHE A CE2 
1022 C CZ  . PHE A 64  ? 0.2890 1.0953 0.3856 0.0546  0.0341  -0.0042 425 PHE A CZ  
1032 N N   . GLN A 65  ? 0.3401 1.1358 0.4038 0.1388  0.0617  0.0477  426 GLN A N   
1033 C CA  . GLN A 65  ? 0.3575 1.1608 0.4083 0.1560  0.0669  0.0575  426 GLN A CA  
1034 C C   . GLN A 65  ? 0.4318 1.2578 0.4745 0.1760  0.0675  0.0721  426 GLN A C   
1035 O O   . GLN A 65  ? 0.4101 1.2282 0.4648 0.1794  0.0779  0.0821  426 GLN A O   
1036 C CB  . GLN A 65  ? 0.3657 1.1404 0.4279 0.1510  0.0869  0.0615  426 GLN A CB  
1037 C CG  . GLN A 65  ? 0.3865 1.1651 0.4354 0.1649  0.0954  0.0698  426 GLN A CG  
1038 C CD  . GLN A 65  ? 0.5080 1.2571 0.5700 0.1555  0.1205  0.0707  426 GLN A CD  
1039 O OE1 . GLN A 65  ? 0.3918 1.1195 0.4740 0.1382  0.1305  0.0627  426 GLN A OE1 
1040 N NE2 . GLN A 65  ? 0.4230 1.1717 0.4735 0.1652  0.1327  0.0781  426 GLN A NE2 
1049 N N   . SER A 66  ? 0.4387 1.2963 0.4608 0.1910  0.0563  0.0722  427 SER A N   
1050 C CA  . SER A 66  ? 0.4817 1.3708 0.4913 0.2140  0.0544  0.0857  427 SER A CA  
1051 C C   . SER A 66  ? 0.4838 1.3634 0.4872 0.2341  0.0724  0.1087  427 SER A C   
1052 O O   . SER A 66  ? 0.4346 1.2863 0.4412 0.2272  0.0856  0.1097  427 SER A O   
1053 C CB  . SER A 66  ? 0.4080 1.3401 0.3966 0.2215  0.0363  0.0733  427 SER A CB  
1054 O OG  . SER A 66  ? 0.4187 1.3557 0.3941 0.2313  0.0371  0.0753  427 SER A OG  
1060 N N   . ARG A 67  ? 0.4547 1.3591 0.4471 0.2598  0.0744  0.1268  428 ARG A N   
1061 C CA  . ARG A 67  ? 0.4901 1.3878 0.4697 0.2844  0.0933  0.1524  428 ARG A CA  
1062 C C   . ARG A 67  ? 0.4994 1.4151 0.4591 0.2914  0.0868  0.1495  428 ARG A C   
1063 O O   . ARG A 67  ? 0.4828 1.4293 0.4362 0.2855  0.0651  0.1298  428 ARG A O   
1064 C CB  . ARG A 67  ? 0.6067 1.5335 0.5745 0.3173  0.0949  0.1748  428 ARG A CB  
1065 C CG  . ARG A 67  ? 0.8401 1.7453 0.8296 0.3145  0.1064  0.1803  428 ARG A CG  
1066 C CD  . ARG A 67  ? 1.0266 1.9611 1.0018 0.3531  0.1094  0.2046  428 ARG A CD  
1067 N NE  . ARG A 67  ? 1.2975 2.2104 1.2974 0.3505  0.1211  0.2074  428 ARG A NE  
1068 C CZ  . ARG A 67  ? 1.3447 2.2089 1.3583 0.3534  0.1523  0.2238  428 ARG A CZ  
1069 N NH1 . ARG A 67  ? 1.3388 2.1674 1.3414 0.3564  0.1764  0.2384  428 ARG A NH1 
1070 N NH2 . ARG A 67  ? 1.2967 2.1456 1.3348 0.3505  0.1614  0.2225  428 ARG A NH2 
1084 N N   . VAL A 68  ? 0.5298 1.4229 0.4798 0.3021  0.1083  0.1669  429 VAL A N   
1085 C CA  . VAL A 68  ? 0.5475 1.4590 0.4769 0.3129  0.1049  0.1672  429 VAL A CA  
1086 C C   . VAL A 68  ? 0.5818 1.5342 0.4892 0.3502  0.1016  0.1890  429 VAL A C   
1087 O O   . VAL A 68  ? 0.7986 1.7341 0.6970 0.3718  0.1221  0.2171  429 VAL A O   
1088 C CB  . VAL A 68  ? 0.5695 1.4360 0.4961 0.3029  0.1318  0.1726  429 VAL A CB  
1089 C CG1 . VAL A 68  ? 0.5961 1.4825 0.4981 0.3170  0.1305  0.1759  429 VAL A CG1 
1090 C CG2 . VAL A 68  ? 0.5367 1.3753 0.4857 0.2692  0.1322  0.1478  429 VAL A CG2 
1100 N N   . ILE A 69  ? 0.5744 1.5815 0.4750 0.3593  0.0775  0.1752  430 ILE A N   
1101 C CA  . ILE A 69  ? 0.6070 1.6627 0.4932 0.3956  0.0742  0.1909  430 ILE A CA  
1102 C C   . ILE A 69  ? 0.8022 1.8534 0.6706 0.3985  0.0816  0.1910  430 ILE A C   
1103 O O   . ILE A 69  ? 0.7602 1.8149 0.6330 0.3779  0.0713  0.1657  430 ILE A O   
1104 C CB  . ILE A 69  ? 0.8677 1.9817 0.7656 0.3963  0.0520  0.1662  430 ILE A CB  
1105 C CG1 . ILE A 69  ? 0.6951 1.8252 0.6006 0.3719  0.0378  0.1298  430 ILE A CG1 
1106 C CG2 . ILE A 69  ? 0.5732 1.6706 0.4776 0.3802  0.0470  0.1596  430 ILE A CG2 
1107 C CD1 . ILE A 69  ? 0.9711 2.1478 0.8682 0.3904  0.0373  0.1246  430 ILE A CD1 
1119 N N   . LYS A 70  ? 0.6915 1.7305 0.5363 0.4247  0.1012  0.2206  431 LYS A N   
1120 C CA  . LYS A 70  ? 0.8571 1.8742 0.6789 0.4233  0.1151  0.2255  431 LYS A CA  
1121 C C   . LYS A 70  ? 0.7335 1.8071 0.5442 0.4383  0.0992  0.2146  431 LYS A C   
1122 O O   . LYS A 70  ? 0.7402 1.8669 0.5540 0.4614  0.0876  0.2148  431 LYS A O   
1123 C CB  . LYS A 70  ? 0.7775 1.7443 0.5748 0.4407  0.1489  0.2628  431 LYS A CB  
1124 C CG  . LYS A 70  ? 1.0808 1.9903 0.8931 0.4240  0.1705  0.2707  431 LYS A CG  
1125 C CD  . LYS A 70  ? 1.1581 2.0062 0.9476 0.4318  0.2111  0.3009  431 LYS A CD  
1126 C CE  . LYS A 70  ? 1.2150 2.0053 1.0275 0.4043  0.2358  0.2976  431 LYS A CE  
1127 N NZ  . LYS A 70  ? 1.3594 2.0849 1.1521 0.4033  0.2799  0.3200  431 LYS A NZ  
1141 N N   . GLU A 71  ? 0.8182 1.8819 0.6187 0.4226  0.1008  0.2010  432 GLU A N   
1142 C CA  . GLU A 71  ? 0.8649 1.9718 0.6498 0.4337  0.0915  0.1917  432 GLU A CA  
1143 C C   . GLU A 71  ? 0.8374 2.0124 0.6413 0.4384  0.0665  0.1662  432 GLU A C   
1144 O O   . GLU A 71  ? 0.7698 1.9880 0.5631 0.4637  0.0640  0.1736  432 GLU A O   
1145 C CB  . GLU A 71  ? 0.8305 1.9307 0.5806 0.4643  0.1103  0.2264  432 GLU A CB  
1146 C CG  . GLU A 71  ? 1.1617 2.1956 0.8875 0.4559  0.1410  0.2471  432 GLU A CG  
1147 C CD  . GLU A 71  ? 1.3703 2.4036 1.0556 0.4820  0.1569  0.2738  432 GLU A CD  
1148 O OE1 . GLU A 71  ? 1.3403 2.4036 1.0139 0.5161  0.1531  0.2932  432 GLU A OE1 
1149 O OE2 . GLU A 71  ? 1.4380 2.4429 1.1027 0.4686  0.1737  0.2742  432 GLU A OE2 
1156 N N   . ASN A 72  ? 0.6887 1.8721 0.5190 0.4131  0.0512  0.1346  433 ASN A N   
1157 C CA  . ASN A 72  ? 0.6697 1.9099 0.5188 0.4111  0.0341  0.1067  433 ASN A CA  
1158 C C   . ASN A 72  ? 0.6273 1.8625 0.4972 0.3797  0.0218  0.0708  433 ASN A C   
1159 O O   . ASN A 72  ? 0.6177 1.8175 0.5015 0.3636  0.0219  0.0699  433 ASN A O   
1160 C CB  . ASN A 72  ? 0.6656 1.9242 0.5265 0.4268  0.0363  0.1193  433 ASN A CB  
1161 C CG  . ASN A 72  ? 0.6600 1.9786 0.5330 0.4246  0.0253  0.0902  433 ASN A CG  
1162 O OD1 . ASN A 72  ? 0.6501 1.9902 0.5288 0.4053  0.0142  0.0573  433 ASN A OD1 
1163 N ND2 . ASN A 72  ? 0.6723 2.0146 0.5456 0.4433  0.0302  0.1011  433 ASN A ND2 
1170 N N   . LEU A 73  ? 0.6331 1.9022 0.5023 0.3718  0.0119  0.0414  434 LEU A N   
1171 C CA  . LEU A 73  ? 0.6718 1.9329 0.5544 0.3445  0.0025  0.0065  434 LEU A CA  
1172 C C   . LEU A 73  ? 0.6312 1.9235 0.5312 0.3327  -0.0059 -0.0186 434 LEU A C   
1173 O O   . LEU A 73  ? 0.5851 1.8702 0.4924 0.3098  -0.0129 -0.0488 434 LEU A O   
1174 C CB  . LEU A 73  ? 0.6279 1.9001 0.4966 0.3399  -0.0011 -0.0136 434 LEU A CB  
1175 C CG  . LEU A 73  ? 0.6802 1.9149 0.5323 0.3423  0.0088  0.0013  434 LEU A CG  
1176 C CD1 . LEU A 73  ? 0.7761 2.0357 0.6122 0.3436  0.0066  -0.0157 434 LEU A CD1 
1177 C CD2 . LEU A 73  ? 0.6376 1.8232 0.4996 0.3236  0.0106  -0.0067 434 LEU A CD2 
1189 N N   . SER A 74  ? 0.6378 1.9624 0.5405 0.3483  -0.0034 -0.0068 435 SER A N   
1190 C CA  . SER A 74  ? 0.7092 2.0589 0.6261 0.3356  -0.0080 -0.0287 435 SER A CA  
1191 C C   . SER A 74  ? 0.6181 1.9424 0.5362 0.3422  -0.0006 -0.0042 435 SER A C   
1192 O O   . SER A 74  ? 0.5985 1.9543 0.5122 0.3558  0.0007  0.0002  435 SER A O   
1193 C CB  . SER A 74  ? 0.7296 2.1436 0.6412 0.3435  -0.0143 -0.0467 435 SER A CB  
1194 O OG  . SER A 74  ? 0.7422 2.1700 0.6508 0.3290  -0.0226 -0.0752 435 SER A OG  
1200 N N   . PRO A 75  ? 0.5579 1.8224 0.4791 0.3317  0.0034  0.0107  436 PRO A N   
1201 C CA  . PRO A 75  ? 0.5545 1.7848 0.4743 0.3367  0.0109  0.0365  436 PRO A CA  
1202 C C   . PRO A 75  ? 0.5518 1.7984 0.4752 0.3271  0.0081  0.0221  436 PRO A C   
1203 O O   . PRO A 75  ? 0.5395 1.8041 0.4723 0.3052  -0.0001 -0.0102 436 PRO A O   
1204 C CB  . PRO A 75  ? 0.5257 1.6991 0.4530 0.3176  0.0111  0.0408  436 PRO A CB  
1205 C CG  . PRO A 75  ? 0.5119 1.6902 0.4451 0.2987  0.0029  0.0105  436 PRO A CG  
1206 C CD  . PRO A 75  ? 0.5353 1.7656 0.4625 0.3131  0.0002  -0.0003 436 PRO A CD  
1214 N N   . LYS A 76  ? 0.6579 1.9015 0.5731 0.3448  0.0152  0.0456  437 LYS A N   
1215 C CA  . LYS A 76  ? 0.5655 1.8249 0.4819 0.3379  0.0118  0.0345  437 LYS A CA  
1216 C C   . LYS A 76  ? 0.5571 1.7687 0.4702 0.3380  0.0190  0.0598  437 LYS A C   
1217 O O   . LYS A 76  ? 0.6400 1.8471 0.5419 0.3660  0.0290  0.0910  437 LYS A O   
1218 C CB  . LYS A 76  ? 0.6007 1.9228 0.5078 0.3652  0.0112  0.0345  437 LYS A CB  
1219 C CG  . LYS A 76  ? 0.7892 2.1597 0.6939 0.3768  0.0076  0.0227  437 LYS A CG  
1220 C CD  . LYS A 76  ? 1.0143 2.4555 0.9232 0.3748  -0.0014 -0.0094 437 LYS A CD  
1221 C CE  . LYS A 76  ? 1.0754 2.5563 0.9899 0.3683  -0.0077 -0.0345 437 LYS A CE  
1222 N NZ  . LYS A 76  ? 0.8734 2.4181 0.7982 0.3550  -0.0172 -0.0736 437 LYS A NZ  
1236 N N   . TRP A 77  ? 0.5258 1.7034 0.4485 0.3081  0.0143  0.0470  438 TRP A N   
1237 C CA  . TRP A 77  ? 0.5131 1.6499 0.4365 0.3043  0.0180  0.0673  438 TRP A CA  
1238 C C   . TRP A 77  ? 0.5125 1.6703 0.4401 0.3029  0.0153  0.0613  438 TRP A C   
1239 O O   . TRP A 77  ? 0.5372 1.6830 0.4644 0.3198  0.0217  0.0863  438 TRP A O   
1240 C CB  . TRP A 77  ? 0.4797 1.5756 0.4138 0.2754  0.0139  0.0574  438 TRP A CB  
1241 C CG  . TRP A 77  ? 0.4782 1.5507 0.4094 0.2776  0.0153  0.0659  438 TRP A CG  
1242 C CD1 . TRP A 77  ? 0.4829 1.5336 0.4128 0.2929  0.0237  0.0951  438 TRP A CD1 
1243 C CD2 . TRP A 77  ? 0.4715 1.5459 0.4041 0.2651  0.0092  0.0437  438 TRP A CD2 
1244 N NE1 . TRP A 77  ? 0.4773 1.5202 0.4087 0.2898  0.0225  0.0908  438 TRP A NE1 
1245 C CE2 . TRP A 77  ? 0.5105 1.5670 0.4448 0.2741  0.0120  0.0601  438 TRP A CE2 
1246 C CE3 . TRP A 77  ? 0.4651 1.5628 0.4055 0.2494  0.0052  0.0104  438 TRP A CE3 
1247 C CZ2 . TRP A 77  ? 0.5478 1.6067 0.4859 0.2686  0.0080  0.0446  438 TRP A CZ2 
1248 C CZ3 . TRP A 77  ? 0.4570 1.5576 0.4088 0.2455  0.0031  -0.0037 438 TRP A CZ3 
1249 C CH2 . TRP A 77  ? 0.4670 1.5468 0.4145 0.2555  0.0003  0.0141  438 TRP A CH2 
1260 N N   . ASN A 78  ? 0.5021 1.6893 0.4390 0.2822  0.0062  0.0275  439 ASN A N   
1261 C CA  . ASN A 78  ? 0.5005 1.6996 0.4540 0.2736  -0.0006 0.0164  439 ASN A CA  
1262 C C   . ASN A 78  ? 0.5590 1.7083 0.5314 0.2630  0.0021  0.0318  439 ASN A C   
1263 O O   . ASN A 78  ? 0.4917 1.6405 0.4714 0.2794  0.0056  0.0481  439 ASN A O   
1264 C CB  . ASN A 78  ? 0.5363 1.7811 0.4798 0.3061  0.0003  0.0258  439 ASN A CB  
1265 C CG  . ASN A 78  ? 0.5573 1.8584 0.4903 0.3162  -0.0020 0.0074  439 ASN A CG  
1266 O OD1 . ASN A 78  ? 0.5465 1.8711 0.4908 0.2914  -0.0095 -0.0271 439 ASN A OD1 
1267 N ND2 . ASN A 78  ? 0.5895 1.9130 0.5041 0.3527  0.0058  0.0302  439 ASN A ND2 
1274 N N   . GLU A 79  ? 0.4514 1.5603 0.4346 0.2376  0.0024  0.0261  440 GLU A N   
1275 C CA  . GLU A 79  ? 0.4299 1.4929 0.4370 0.2235  0.0076  0.0354  440 GLU A CA  
1276 C C   . GLU A 79  ? 0.4070 1.4634 0.4325 0.1894  0.0013  0.0083  440 GLU A C   
1277 O O   . GLU A 79  ? 0.4056 1.4835 0.4257 0.1745  -0.0056 -0.0159 440 GLU A O   
1278 C CB  . GLU A 79  ? 0.4217 1.4414 0.4287 0.2237  0.0169  0.0533  440 GLU A CB  
1279 C CG  . GLU A 79  ? 0.4660 1.4835 0.4609 0.2561  0.0283  0.0846  440 GLU A CG  
1280 C CD  . GLU A 79  ? 0.5481 1.5194 0.5514 0.2511  0.0414  0.0981  440 GLU A CD  
1281 O OE1 . GLU A 79  ? 0.6259 1.5599 0.6522 0.2280  0.0472  0.0914  440 GLU A OE1 
1282 O OE2 . GLU A 79  ? 0.4943 1.4680 0.4811 0.2691  0.0471  0.1133  440 GLU A OE2 
1289 N N   . VAL A 80  ? 0.3921 1.4195 0.4403 0.1769  0.0062  0.0119  441 VAL A N   
1290 C CA  . VAL A 80  ? 0.4766 1.4963 0.5404 0.1453  0.0027  -0.0106 441 VAL A CA  
1291 C C   . VAL A 80  ? 0.3543 1.3244 0.4348 0.1304  0.0117  -0.0020 441 VAL A C   
1292 O O   . VAL A 80  ? 0.4850 1.4351 0.5777 0.1409  0.0212  0.0149  441 VAL A O   
1293 C CB  . VAL A 80  ? 0.4350 1.4890 0.5101 0.1420  -0.0022 -0.0254 441 VAL A CB  
1294 C CG1 . VAL A 80  ? 0.3895 1.4362 0.4787 0.1609  0.0045  -0.0062 441 VAL A CG1 
1295 C CG2 . VAL A 80  ? 0.3685 1.4173 0.4571 0.1071  -0.0041 -0.0498 441 VAL A CG2 
1305 N N   . TYR A 81  ? 0.3394 1.2920 0.4204 0.1069  0.0104  -0.0146 442 TYR A N   
1306 C CA  . TYR A 81  ? 0.4241 1.3349 0.5170 0.0917  0.0181  -0.0099 442 TYR A CA  
1307 C C   . TYR A 81  ? 0.3599 1.2711 0.4612 0.0642  0.0159  -0.0282 442 TYR A C   
1308 O O   . TYR A 81  ? 0.3728 1.3125 0.4696 0.0535  0.0094  -0.0462 442 TYR A O   
1309 C CB  . TYR A 81  ? 0.3850 1.2733 0.4669 0.0937  0.0204  -0.0035 442 TYR A CB  
1310 C CG  . TYR A 81  ? 0.3712 1.2668 0.4398 0.1184  0.0217  0.0105  442 TYR A CG  
1311 C CD1 . TYR A 81  ? 0.4321 1.3108 0.5072 0.1333  0.0326  0.0296  442 TYR A CD1 
1312 C CD2 . TYR A 81  ? 0.4149 1.3354 0.4653 0.1261  0.0142  0.0035  442 TYR A CD2 
1313 C CE1 . TYR A 81  ? 0.4289 1.3153 0.4904 0.1557  0.0359  0.0441  442 TYR A CE1 
1314 C CE2 . TYR A 81  ? 0.5617 1.4910 0.5975 0.1485  0.0157  0.0164  442 TYR A CE2 
1315 C CZ  . TYR A 81  ? 0.5657 1.4779 0.6061 0.1635  0.0264  0.0380  442 TYR A CZ  
1316 O OH  . TYR A 81  ? 0.5846 1.5067 0.6094 0.1859  0.0298  0.0524  442 TYR A OH  
1326 N N   . GLU A 82  ? 0.3323 1.2129 0.4457 0.0515  0.0229  -0.0250 443 GLU A N   
1327 C CA  . GLU A 82  ? 0.3008 1.1785 0.4201 0.0254  0.0231  -0.0393 443 GLU A CA  
1328 C C   . GLU A 82  ? 0.3711 1.2197 0.4858 0.0145  0.0272  -0.0354 443 GLU A C   
1329 O O   . GLU A 82  ? 0.3989 1.2207 0.5184 0.0201  0.0333  -0.0245 443 GLU A O   
1330 C CB  . GLU A 82  ? 0.3011 1.1767 0.4386 0.0210  0.0275  -0.0413 443 GLU A CB  
1331 C CG  . GLU A 82  ? 0.3122 1.2275 0.4542 0.0228  0.0216  -0.0541 443 GLU A CG  
1332 C CD  . GLU A 82  ? 0.3144 1.2318 0.4767 0.0249  0.0262  -0.0546 443 GLU A CD  
1333 O OE1 . GLU A 82  ? 0.4000 1.2882 0.5747 0.0302  0.0354  -0.0423 443 GLU A OE1 
1334 O OE2 . GLU A 82  ? 0.3240 1.2747 0.4916 0.0209  0.0217  -0.0697 443 GLU A OE2 
1341 N N   . ALA A 83  ? 0.2944 1.1522 0.4004 -0.0010 0.0249  -0.0455 444 ALA A N   
1342 C CA  . ALA A 83  ? 0.2906 1.1304 0.3900 -0.0081 0.0281  -0.0411 444 ALA A CA  
1343 C C   . ALA A 83  ? 0.2950 1.1361 0.3951 -0.0349 0.0319  -0.0504 444 ALA A C   
1344 O O   . ALA A 83  ? 0.3042 1.1659 0.4048 -0.0518 0.0320  -0.0646 444 ALA A O   
1345 C CB  . ALA A 83  ? 0.2938 1.1450 0.3810 0.0022  0.0254  -0.0404 444 ALA A CB  
1351 N N   . LEU A 84  ? 0.2919 1.1127 0.3912 -0.0407 0.0360  -0.0442 445 LEU A N   
1352 C CA  . LEU A 84  ? 0.3100 1.1320 0.4041 -0.0652 0.0410  -0.0497 445 LEU A CA  
1353 C C   . LEU A 84  ? 0.3816 1.2165 0.4600 -0.0685 0.0449  -0.0478 445 LEU A C   
1354 O O   . LEU A 84  ? 0.3082 1.1431 0.3797 -0.0477 0.0431  -0.0387 445 LEU A O   
1355 C CB  . LEU A 84  ? 0.3708 1.1725 0.4663 -0.0683 0.0439  -0.0442 445 LEU A CB  
1356 C CG  . LEU A 84  ? 0.3279 1.1134 0.4397 -0.0668 0.0458  -0.0469 445 LEU A CG  
1357 C CD1 . LEU A 84  ? 0.3634 1.1317 0.4759 -0.0698 0.0496  -0.0441 445 LEU A CD1 
1358 C CD2 . LEU A 84  ? 0.2981 1.0926 0.4169 -0.0837 0.0475  -0.0593 445 LEU A CD2 
1370 N N   . VAL A 85  ? 0.3323 1.1714 0.4000 -0.0946 0.0538  -0.0567 446 VAL A N   
1371 C CA  . VAL A 85  ? 0.4767 1.2588 0.4998 -0.0943 0.0528  -0.0522 446 VAL A CA  
1372 C C   . VAL A 85  ? 0.4149 1.1646 0.4118 -0.1135 0.0610  -0.0460 446 VAL A C   
1373 O O   . VAL A 85  ? 0.4451 1.2033 0.4487 -0.1420 0.0690  -0.0559 446 VAL A O   
1374 C CB  . VAL A 85  ? 0.4135 1.1784 0.4236 -0.1059 0.0524  -0.0684 446 VAL A CB  
1375 C CG1 . VAL A 85  ? 0.6350 1.3303 0.5970 -0.1048 0.0554  -0.0636 446 VAL A CG1 
1376 C CG2 . VAL A 85  ? 0.3936 1.1960 0.4260 -0.0848 0.0434  -0.0736 446 VAL A CG2 
1386 N N   . TYR A 86  ? 0.5576 1.2736 0.5235 -0.0959 0.0589  -0.0298 447 TYR A N   
1387 C CA  . TYR A 86  ? 0.7080 1.3911 0.6405 -0.1069 0.0656  -0.0190 447 TYR A CA  
1388 C C   . TYR A 86  ? 0.8640 1.4727 0.7431 -0.1034 0.0692  -0.0115 447 TYR A C   
1389 O O   . TYR A 86  ? 0.9100 1.4968 0.7813 -0.0892 0.0652  -0.0153 447 TYR A O   
1390 C CB  . TYR A 86  ? 0.5000 1.2100 0.4374 -0.0863 0.0609  -0.0055 447 TYR A CB  
1391 C CG  . TYR A 86  ? 0.4831 1.2573 0.4697 -0.0935 0.0628  -0.0136 447 TYR A CG  
1392 C CD1 . TYR A 86  ? 0.5535 1.3463 0.5481 -0.1181 0.0712  -0.0175 447 TYR A CD1 
1393 C CD2 . TYR A 86  ? 0.6229 1.4356 0.6463 -0.0758 0.0586  -0.0174 447 TYR A CD2 
1394 C CE1 . TYR A 86  ? 0.4309 1.2407 0.4629 -0.1191 0.0647  -0.0269 447 TYR A CE1 
1395 C CE2 . TYR A 86  ? 0.3619 1.1761 0.4143 -0.0776 0.0524  -0.0242 447 TYR A CE2 
1396 C CZ  . TYR A 86  ? 0.4673 1.2751 0.5216 -0.0978 0.0552  -0.0295 447 TYR A CZ  
1397 O OH  . TYR A 86  ? 0.8049 1.5974 0.8767 -0.0968 0.0525  -0.0369 447 TYR A OH  
1407 N N   . GLU A 87  ? 0.8272 1.3947 0.6678 -0.1158 0.0785  -0.0006 448 GLU A N   
1408 C CA  . GLU A 87  ? 0.7477 1.2343 0.5309 -0.1079 0.0851  0.0117  448 GLU A CA  
1409 C C   . GLU A 87  ? 0.8366 1.3157 0.6047 -0.0627 0.0727  0.0284  448 GLU A C   
1410 O O   . GLU A 87  ? 0.9685 1.4768 0.7361 -0.0434 0.0657  0.0420  448 GLU A O   
1411 C CB  . GLU A 87  ? 0.9877 1.4325 0.7290 -0.1278 0.0991  0.0243  448 GLU A CB  
1412 C CG  . GLU A 87  ? 1.2352 1.5863 0.9103 -0.1156 0.1091  0.0421  448 GLU A CG  
1413 C CD  . GLU A 87  ? 1.5120 1.8116 1.1775 -0.1275 0.1184  0.0258  448 GLU A CD  
1414 O OE1 . GLU A 87  ? 1.4930 1.8018 1.1779 -0.1670 0.1290  0.0023  448 GLU A OE1 
1415 O OE2 . GLU A 87  ? 1.5405 1.7954 1.1809 -0.0973 0.1154  0.0339  448 GLU A OE2 
1422 N N   . HIS A 88  ? 0.9661 1.4118 0.7237 -0.0467 0.0706  0.0241  449 HIS A N   
1423 C CA  . HIS A 88  ? 1.0071 1.4506 0.7553 -0.0034 0.0591  0.0355  449 HIS A CA  
1424 C C   . HIS A 88  ? 1.1810 1.5620 0.9032 0.0043  0.0640  0.0292  449 HIS A C   
1425 O O   . HIS A 88  ? 1.1178 1.5222 0.8679 0.0016  0.0601  0.0113  449 HIS A O   
1426 C CB  . HIS A 88  ? 1.1403 1.6652 0.9414 0.0107  0.0459  0.0278  449 HIS A CB  
1427 C CG  . HIS A 88  ? 1.3599 1.9003 1.1568 0.0523  0.0348  0.0383  449 HIS A CG  
1428 N ND1 . HIS A 88  ? 1.4280 1.9135 1.1835 0.0811  0.0337  0.0487  449 HIS A ND1 
1429 C CD2 . HIS A 88  ? 1.2780 1.8845 1.1083 0.0692  0.0260  0.0375  449 HIS A CD2 
1430 C CE1 . HIS A 88  ? 1.2791 1.8030 1.0444 0.1156  0.0225  0.0535  449 HIS A CE1 
1431 N NE2 . HIS A 88  ? 1.2139 1.8120 1.0246 0.1069  0.0184  0.0459  449 HIS A NE2 
1440 N N   . PRO A 89  ? 1.2845 1.5837 0.9508 0.0138  0.0743  0.0438  450 PRO A N   
1441 C CA  . PRO A 89  ? 1.2091 1.4381 0.8477 0.0172  0.0839  0.0354  450 PRO A CA  
1442 C C   . PRO A 89  ? 1.0792 1.3340 0.7375 0.0511  0.0705  0.0286  450 PRO A C   
1443 O O   . PRO A 89  ? 1.0654 1.3629 0.7353 0.0851  0.0561  0.0404  450 PRO A O   
1444 C CB  . PRO A 89  ? 1.2714 1.4110 0.8445 0.0341  0.0962  0.0604  450 PRO A CB  
1445 C CG  . PRO A 89  ? 1.1539 1.3118 0.7188 0.0195  0.0983  0.0758  450 PRO A CG  
1446 C CD  . PRO A 89  ? 1.1786 1.4433 0.8015 0.0222  0.0795  0.0690  450 PRO A CD  
1454 N N   . GLY A 90  ? 1.1177 1.3517 0.7804 0.0395  0.0762  0.0069  451 GLY A N   
1455 C CA  . GLY A 90  ? 1.0086 1.2622 0.6860 0.0684  0.0661  -0.0020 451 GLY A CA  
1456 C C   . GLY A 90  ? 1.0459 1.3960 0.7776 0.0726  0.0500  -0.0099 451 GLY A C   
1457 O O   . GLY A 90  ? 1.0315 1.4080 0.7764 0.1003  0.0407  -0.0130 451 GLY A O   
1461 N N   . GLN A 91  ? 0.9929 1.3931 0.7550 0.0454  0.0487  -0.0132 452 GLN A N   
1462 C CA  . GLN A 91  ? 0.8802 1.3638 0.6911 0.0487  0.0373  -0.0186 452 GLN A CA  
1463 C C   . GLN A 91  ? 0.8626 1.3677 0.6932 0.0370  0.0367  -0.0409 452 GLN A C   
1464 O O   . GLN A 91  ? 0.8861 1.3641 0.7065 0.0097  0.0455  -0.0570 452 GLN A O   
1465 C CB  . GLN A 91  ? 1.0184 1.5448 0.8542 0.0268  0.0378  -0.0143 452 GLN A CB  
1466 C CG  . GLN A 91  ? 1.0023 1.6040 0.8827 0.0374  0.0293  -0.0134 452 GLN A CG  
1467 C CD  . GLN A 91  ? 0.9542 1.5931 0.8591 0.0158  0.0323  -0.0111 452 GLN A CD  
1468 O OE1 . GLN A 91  ? 1.1056 1.7223 0.9985 -0.0105 0.0398  -0.0131 452 GLN A OE1 
1469 N NE2 . GLN A 91  ? 0.8889 1.5835 0.8284 0.0253  0.0289  -0.0086 452 GLN A NE2 
1478 N N   . GLU A 92  ? 0.7345 1.2916 0.5923 0.0567  0.0273  -0.0427 453 GLU A N   
1479 C CA  . GLU A 92  ? 0.7425 1.3236 0.6136 0.0534  0.0250  -0.0613 453 GLU A CA  
1480 C C   . GLU A 92  ? 0.6999 1.3548 0.6112 0.0563  0.0185  -0.0604 453 GLU A C   
1481 O O   . GLU A 92  ? 0.6408 1.3245 0.5695 0.0691  0.0161  -0.0461 453 GLU A O   
1482 C CB  . GLU A 92  ? 0.6983 1.2537 0.5503 0.0805  0.0233  -0.0651 453 GLU A CB  
1483 C CG  . GLU A 92  ? 0.9786 1.4520 0.7882 0.0797  0.0329  -0.0683 453 GLU A CG  
1484 C CD  . GLU A 92  ? 1.3577 1.8068 1.1506 0.1110  0.0315  -0.0718 453 GLU A CD  
1485 O OE1 . GLU A 92  ? 1.2686 1.7678 1.0826 0.1331  0.0225  -0.0706 453 GLU A OE1 
1486 O OE2 . GLU A 92  ? 1.5298 1.9071 1.2875 0.1132  0.0415  -0.0764 453 GLU A OE2 
1493 N N   . LEU A 93  ? 0.5882 1.2735 0.5129 0.0444  0.0170  -0.0764 454 LEU A N   
1494 C CA  . LEU A 93  ? 0.4496 1.1977 0.4046 0.0547  0.0118  -0.0738 454 LEU A CA  
1495 C C   . LEU A 93  ? 0.4507 1.2053 0.3995 0.0821  0.0083  -0.0731 454 LEU A C   
1496 O O   . LEU A 93  ? 0.5673 1.3046 0.4981 0.0837  0.0076  -0.0881 454 LEU A O   
1497 C CB  . LEU A 93  ? 0.4419 1.2266 0.4109 0.0359  0.0101  -0.0904 454 LEU A CB  
1498 C CG  . LEU A 93  ? 0.5297 1.3755 0.5222 0.0520  0.0050  -0.0865 454 LEU A CG  
1499 C CD1 . LEU A 93  ? 0.4881 1.3562 0.5053 0.0598  0.0081  -0.0664 454 LEU A CD1 
1500 C CD2 . LEU A 93  ? 0.5326 1.4193 0.5346 0.0376  0.0011  -0.1055 454 LEU A CD2 
1512 N N   . GLU A 94  ? 0.4579 1.2377 0.4220 0.1014  0.0082  -0.0581 455 GLU A N   
1513 C CA  . GLU A 94  ? 0.4451 1.2346 0.4051 0.1264  0.0071  -0.0573 455 GLU A CA  
1514 C C   . GLU A 94  ? 0.4927 1.3327 0.4722 0.1341  0.0080  -0.0534 455 GLU A C   
1515 O O   . GLU A 94  ? 0.4225 1.2881 0.4243 0.1312  0.0123  -0.0418 455 GLU A O   
1516 C CB  . GLU A 94  ? 0.4979 1.2791 0.4581 0.1432  0.0088  -0.0457 455 GLU A CB  
1517 C CG  . GLU A 94  ? 0.8275 1.5575 0.7622 0.1446  0.0077  -0.0450 455 GLU A CG  
1518 C CD  . GLU A 94  ? 1.0229 1.7583 0.9582 0.1665  0.0069  -0.0352 455 GLU A CD  
1519 O OE1 . GLU A 94  ? 1.0184 1.7988 0.9792 0.1718  0.0095  -0.0304 455 GLU A OE1 
1520 O OE2 . GLU A 94  ? 0.9188 1.6141 0.8285 0.1790  0.0050  -0.0330 455 GLU A OE2 
1527 N N   . ILE A 95  ? 0.4166 1.2683 0.3854 0.1446  0.0056  -0.0627 456 ILE A N   
1528 C CA  . ILE A 95  ? 0.4603 1.3566 0.4394 0.1555  0.0072  -0.0567 456 ILE A CA  
1529 C C   . ILE A 95  ? 0.4489 1.3506 0.4170 0.1761  0.0096  -0.0581 456 ILE A C   
1530 O O   . ILE A 95  ? 0.4502 1.3335 0.3992 0.1797  0.0058  -0.0734 456 ILE A O   
1531 C CB  . ILE A 95  ? 0.5960 1.5187 0.5726 0.1464  0.0010  -0.0684 456 ILE A CB  
1532 C CG1 . ILE A 95  ? 0.4451 1.3729 0.4378 0.1265  0.0001  -0.0676 456 ILE A CG1 
1533 C CG2 . ILE A 95  ? 0.4015 1.3644 0.3801 0.1635  0.0006  -0.0590 456 ILE A CG2 
1534 C CD1 . ILE A 95  ? 0.4629 1.4181 0.4541 0.1134  -0.0068 -0.0861 456 ILE A CD1 
1546 N N   . GLU A 96  ? 0.4842 1.3833 0.4607 0.1825  0.0102  -0.0412 457 GLU A N   
1547 C CA  . GLU A 96  ? 0.4033 1.3029 0.3714 0.1969  0.0108  -0.0406 457 GLU A CA  
1548 C C   . GLU A 96  ? 0.4320 1.3443 0.3984 0.2000  0.0109  -0.0269 457 GLU A C   
1549 O O   . GLU A 96  ? 0.4825 1.3851 0.4559 0.1936  0.0147  -0.0112 457 GLU A O   
1550 C CB  . GLU A 96  ? 0.5820 1.4600 0.5547 0.2002  0.0147  -0.0352 457 GLU A CB  
1551 C CG  . GLU A 96  ? 0.5481 1.4193 0.5156 0.2097  0.0143  -0.0485 457 GLU A CG  
1552 C CD  . GLU A 96  ? 0.6662 1.5290 0.6366 0.2184  0.0155  -0.0468 457 GLU A CD  
1553 O OE1 . GLU A 96  ? 0.5794 1.4340 0.5569 0.2151  0.0156  -0.0429 457 GLU A OE1 
1554 O OE2 . GLU A 96  ? 0.6012 1.4696 0.5667 0.2278  0.0161  -0.0509 457 GLU A OE2 
1561 N N   . LEU A 97  ? 0.4072 1.3398 0.3633 0.2114  0.0085  -0.0331 458 LEU A N   
1562 C CA  . LEU A 97  ? 0.4155 1.3645 0.3671 0.2199  0.0099  -0.0184 458 LEU A CA  
1563 C C   . LEU A 97  ? 0.5615 1.4984 0.5090 0.2273  0.0181  -0.0116 458 LEU A C   
1564 O O   . LEU A 97  ? 0.4936 1.4287 0.4371 0.2316  0.0174  -0.0258 458 LEU A O   
1565 C CB  . LEU A 97  ? 0.4278 1.4168 0.3736 0.2265  0.0019  -0.0306 458 LEU A CB  
1566 C CG  . LEU A 97  ? 0.5415 1.5550 0.4948 0.2178  -0.0049 -0.0396 458 LEU A CG  
1567 C CD1 . LEU A 97  ? 0.5685 1.6242 0.5200 0.2237  -0.0092 -0.0542 458 LEU A CD1 
1568 C CD2 . LEU A 97  ? 0.5013 1.5095 0.4575 0.2155  -0.0038 -0.0183 458 LEU A CD2 
1580 N N   . PHE A 98  ? 0.4307 1.3583 0.3796 0.2289  0.0281  0.0089  459 PHE A N   
1581 C CA  . PHE A 98  ? 0.4444 1.3601 0.3911 0.2319  0.0403  0.0147  459 PHE A CA  
1582 C C   . PHE A 98  ? 0.5412 1.4700 0.4767 0.2442  0.0484  0.0323  459 PHE A C   
1583 O O   . PHE A 98  ? 0.4700 1.4128 0.4026 0.2514  0.0460  0.0449  459 PHE A O   
1584 C CB  . PHE A 98  ? 0.5933 1.4765 0.5553 0.2185  0.0526  0.0203  459 PHE A CB  
1585 C CG  . PHE A 98  ? 0.5302 1.4032 0.5016 0.2099  0.0455  0.0051  459 PHE A CG  
1586 C CD1 . PHE A 98  ? 0.4956 1.3700 0.4667 0.2130  0.0446  -0.0088 459 PHE A CD1 
1587 C CD2 . PHE A 98  ? 0.4976 1.3615 0.4772 0.2007  0.0405  0.0054  459 PHE A CD2 
1588 C CE1 . PHE A 98  ? 0.5013 1.3695 0.4784 0.2108  0.0383  -0.0203 459 PHE A CE1 
1589 C CE2 . PHE A 98  ? 0.4433 1.2993 0.4287 0.1956  0.0353  -0.0060 459 PHE A CE2 
1590 C CZ  . PHE A 98  ? 0.4115 1.2705 0.3947 0.2026  0.0340  -0.0179 459 PHE A CZ  
1600 N N   . ASP A 99  ? 0.4864 1.4123 0.4147 0.2478  0.0588  0.0330  460 ASP A N   
1601 C CA  . ASP A 99  ? 0.5666 1.4962 0.4811 0.2588  0.0726  0.0523  460 ASP A CA  
1602 C C   . ASP A 99  ? 0.7144 1.6067 0.6373 0.2479  0.0967  0.0649  460 ASP A C   
1603 O O   . ASP A 99  ? 0.6394 1.5168 0.5714 0.2354  0.1050  0.0528  460 ASP A O   
1604 C CB  . ASP A 99  ? 0.7203 1.6697 0.6201 0.2667  0.0719  0.0426  460 ASP A CB  
1605 C CG  . ASP A 99  ? 0.9007 1.8658 0.7801 0.2830  0.0802  0.0618  460 ASP A CG  
1606 O OD1 . ASP A 99  ? 0.9960 1.9394 0.8701 0.2859  0.0989  0.0852  460 ASP A OD1 
1607 O OD2 . ASP A 99  ? 1.1929 2.1911 1.0606 0.2933  0.0694  0.0526  460 ASP A OD2 
1612 N N   . GLU A 100 ? 0.5471 1.4257 0.4689 0.2524  0.1093  0.0867  461 GLU A N   
1613 C CA  . GLU A 100 ? 0.5518 1.3921 0.4814 0.2404  0.1377  0.0960  461 GLU A CA  
1614 C C   . GLU A 100 ? 0.6142 1.4491 0.5266 0.2428  0.1574  0.1005  461 GLU A C   
1615 O O   . GLU A 100 ? 0.6812 1.5234 0.5698 0.2611  0.1647  0.1200  461 GLU A O   
1616 C CB  . GLU A 100 ? 0.5641 1.3877 0.4944 0.2474  0.1503  0.1189  461 GLU A CB  
1617 C CG  . GLU A 100 ? 0.6991 1.4788 0.6392 0.2316  0.1844  0.1246  461 GLU A CG  
1618 C CD  . GLU A 100 ? 1.0159 1.7754 0.9533 0.2426  0.2017  0.1493  461 GLU A CD  
1619 O OE1 . GLU A 100 ? 1.2748 2.0015 1.2321 0.2246  0.2214  0.1458  461 GLU A OE1 
1620 O OE2 . GLU A 100 ? 1.2107 1.9892 1.1264 0.2704  0.1964  0.1713  461 GLU A OE2 
1627 N N   . ASP A 101 ? 0.7446 1.5693 0.6686 0.2252  0.1659  0.0817  462 ASP A N   
1628 C CA  . ASP A 101 ? 0.7544 1.5731 0.6654 0.2216  0.1874  0.0808  462 ASP A CA  
1629 C C   . ASP A 101 ? 0.7552 1.5369 0.6813 0.1987  0.2204  0.0778  462 ASP A C   
1630 O O   . ASP A 101 ? 0.7228 1.4896 0.6731 0.1849  0.2213  0.0706  462 ASP A O   
1631 C CB  . ASP A 101 ? 1.0108 1.8558 0.9237 0.2205  0.1714  0.0569  462 ASP A CB  
1632 C CG  . ASP A 101 ? 1.1199 1.9998 1.0214 0.2388  0.1414  0.0530  462 ASP A CG  
1633 O OD1 . ASP A 101 ? 1.1407 2.0332 1.0240 0.2553  0.1373  0.0704  462 ASP A OD1 
1634 O OD2 . ASP A 101 ? 0.6814 1.5772 0.5923 0.2373  0.1231  0.0314  462 ASP A OD2 
1639 N N   . PRO A 102 ? 0.8594 1.6264 0.7709 0.1925  0.2495  0.0811  463 PRO A N   
1640 C CA  . PRO A 102 ? 0.9765 1.7078 0.9026 0.1668  0.2861  0.0741  463 PRO A CA  
1641 C C   . PRO A 102 ? 0.9321 1.6725 0.8903 0.1462  0.2819  0.0427  463 PRO A C   
1642 O O   . PRO A 102 ? 1.0200 1.7372 1.0005 0.1244  0.3041  0.0321  463 PRO A O   
1643 C CB  . PRO A 102 ? 1.0271 1.7442 0.9237 0.1662  0.3173  0.0846  463 PRO A CB  
1644 C CG  . PRO A 102 ? 0.8267 1.5693 0.6912 0.1964  0.2959  0.1047  463 PRO A CG  
1645 C CD  . PRO A 102 ? 0.8441 1.6251 0.7239 0.2068  0.2533  0.0906  463 PRO A CD  
1653 N N   . ASP A 103 ? 0.9893 1.7648 0.9493 0.1548  0.2542  0.0280  464 ASP A N   
1654 C CA  . ASP A 103 ? 0.9891 1.7812 0.9761 0.1433  0.2436  0.0012  464 ASP A CA  
1655 C C   . ASP A 103 ? 0.9537 1.7637 0.9503 0.1538  0.2064  -0.0028 464 ASP A C   
1656 O O   . ASP A 103 ? 0.9719 1.7673 0.9719 0.1543  0.2018  0.0089  464 ASP A O   
1657 C CB  . ASP A 103 ? 1.0535 1.8705 1.0345 0.1456  0.2436  -0.0140 464 ASP A CB  
1658 C CG  . ASP A 103 ? 1.4046 2.2434 1.3584 0.1680  0.2243  -0.0053 464 ASP A CG  
1659 O OD1 . ASP A 103 ? 1.4137 2.2471 1.3499 0.1814  0.2168  0.0154  464 ASP A OD1 
1660 O OD2 . ASP A 103 ? 1.4792 2.3432 1.4300 0.1728  0.2173  -0.0205 464 ASP A OD2 
1665 N N   . LYS A 104 ? 0.9223 1.7617 0.9217 0.1623  0.1824  -0.0194 465 LYS A N   
1666 C CA  . LYS A 104 ? 0.8019 1.6539 0.8041 0.1728  0.1513  -0.0230 465 LYS A CA  
1667 C C   . LYS A 104 ? 0.9403 1.7958 0.9215 0.1895  0.1373  -0.0067 465 LYS A C   
1668 O O   . LYS A 104 ? 0.8139 1.6832 0.7760 0.2014  0.1361  -0.0036 465 LYS A O   
1669 C CB  . LYS A 104 ? 0.8557 1.7356 0.8618 0.1811  0.1330  -0.0443 465 LYS A CB  
1670 C CG  . LYS A 104 ? 0.7937 1.6807 0.8012 0.1910  0.1065  -0.0493 465 LYS A CG  
1671 C CD  . LYS A 104 ? 1.0274 1.9383 1.0382 0.2016  0.0929  -0.0700 465 LYS A CD  
1672 C CE  . LYS A 104 ? 1.2079 2.1202 1.2156 0.2132  0.0714  -0.0734 465 LYS A CE  
1673 N NZ  . LYS A 104 ? 1.1697 2.1030 1.1782 0.2283  0.0601  -0.0919 465 LYS A NZ  
1687 N N   . ASP A 105 ? 0.4992 1.3454 0.4843 0.1898  0.1269  0.0020  466 ASP A N   
1688 C CA  . ASP A 105 ? 0.6025 1.4579 0.5710 0.2046  0.1124  0.0144  466 ASP A CA  
1689 C C   . ASP A 105 ? 0.7062 1.5865 0.6661 0.2171  0.0895  -0.0007 466 ASP A C   
1690 O O   . ASP A 105 ? 0.6577 1.5396 0.6265 0.2156  0.0779  -0.0149 466 ASP A O   
1691 C CB  . ASP A 105 ? 0.4998 1.3412 0.4776 0.1997  0.1079  0.0242  466 ASP A CB  
1692 C CG  . ASP A 105 ? 0.6715 1.4862 0.6559 0.1906  0.1329  0.0400  466 ASP A CG  
1693 O OD1 . ASP A 105 ? 0.5211 1.3267 0.4984 0.1894  0.1551  0.0461  466 ASP A OD1 
1694 O OD2 . ASP A 105 ? 0.5628 1.3638 0.5585 0.1845  0.1325  0.0457  466 ASP A OD2 
1699 N N   . ASP A 106 ? 0.6647 1.5639 0.6060 0.2303  0.0849  0.0017  467 ASP A N   
1700 C CA  . ASP A 106 ? 0.5036 1.4246 0.4369 0.2412  0.0676  -0.0160 467 ASP A CA  
1701 C C   . ASP A 106 ? 0.5841 1.5088 0.5183 0.2436  0.0509  -0.0199 467 ASP A C   
1702 O O   . ASP A 106 ? 0.4774 1.4005 0.4119 0.2417  0.0498  -0.0061 467 ASP A O   
1703 C CB  . ASP A 106 ? 0.7755 1.7183 0.6898 0.2523  0.0689  -0.0148 467 ASP A CB  
1704 C CG  . ASP A 106 ? 0.9011 1.8467 0.8127 0.2511  0.0816  -0.0225 467 ASP A CG  
1705 O OD1 . ASP A 106 ? 0.7640 1.6939 0.6888 0.2398  0.0945  -0.0235 467 ASP A OD1 
1706 O OD2 . ASP A 106 ? 0.9999 1.9660 0.8969 0.2600  0.0792  -0.0297 467 ASP A OD2 
1711 N N   . PHE A 107 ? 0.4816 1.4109 0.4157 0.2485  0.0402  -0.0397 468 PHE A N   
1712 C CA  . PHE A 107 ? 0.4993 1.4290 0.4332 0.2492  0.0285  -0.0479 468 PHE A CA  
1713 C C   . PHE A 107 ? 0.6577 1.6106 0.5795 0.2550  0.0216  -0.0556 468 PHE A C   
1714 O O   . PHE A 107 ? 0.5031 1.4692 0.4152 0.2626  0.0210  -0.0689 468 PHE A O   
1715 C CB  . PHE A 107 ? 0.4719 1.3923 0.4079 0.2551  0.0243  -0.0659 468 PHE A CB  
1716 C CG  . PHE A 107 ? 0.4703 1.3856 0.4025 0.2566  0.0174  -0.0767 468 PHE A CG  
1717 C CD1 . PHE A 107 ? 0.4679 1.3730 0.4082 0.2465  0.0161  -0.0672 468 PHE A CD1 
1718 C CD2 . PHE A 107 ? 0.5787 1.4953 0.4975 0.2663  0.0148  -0.0985 468 PHE A CD2 
1719 C CE1 . PHE A 107 ? 0.4537 1.3528 0.3887 0.2455  0.0131  -0.0780 468 PHE A CE1 
1720 C CE2 . PHE A 107 ? 0.5320 1.4352 0.4414 0.2647  0.0130  -0.1110 468 PHE A CE2 
1721 C CZ  . PHE A 107 ? 0.4818 1.3772 0.3988 0.2540  0.0125  -0.1002 468 PHE A CZ  
1731 N N   . LEU A 108 ? 0.4729 1.4336 0.3966 0.2501  0.0164  -0.0501 469 LEU A N   
1732 C CA  . LEU A 108 ? 0.4855 1.4755 0.4013 0.2531  0.0098  -0.0594 469 LEU A CA  
1733 C C   . LEU A 108 ? 0.5334 1.5221 0.4475 0.2452  0.0033  -0.0817 469 LEU A C   
1734 O O   . LEU A 108 ? 0.5128 1.5251 0.4214 0.2420  -0.0020 -0.0946 469 LEU A O   
1735 C CB  . LEU A 108 ? 0.4817 1.4910 0.3997 0.2555  0.0099  -0.0375 469 LEU A CB  
1736 C CG  . LEU A 108 ? 0.4960 1.5049 0.4068 0.2646  0.0201  -0.0156 469 LEU A CG  
1737 C CD1 . LEU A 108 ? 0.5002 1.5286 0.4098 0.2729  0.0206  0.0055  469 LEU A CD1 
1738 C CD2 . LEU A 108 ? 0.5236 1.5479 0.4215 0.2724  0.0219  -0.0264 469 LEU A CD2 
1750 N N   . GLY A 109 ? 0.4794 1.4399 0.3959 0.2413  0.0051  -0.0876 470 GLY A N   
1751 C CA  . GLY A 109 ? 0.5363 1.4833 0.4422 0.2332  0.0029  -0.1094 470 GLY A CA  
1752 C C   . GLY A 109 ? 0.4734 1.4036 0.3869 0.2230  0.0040  -0.1016 470 GLY A C   
1753 O O   . GLY A 109 ? 0.4466 1.3830 0.3776 0.2197  0.0047  -0.0801 470 GLY A O   
1757 N N   . SER A 110 ? 0.4941 1.3971 0.3911 0.2166  0.0047  -0.1196 471 SER A N   
1758 C CA  . SER A 110 ? 0.5437 1.4162 0.4509 0.2038  0.0036  -0.1102 471 SER A CA  
1759 C C   . SER A 110 ? 0.5498 1.3946 0.4473 0.1818  -0.0002 -0.1273 471 SER A C   
1760 O O   . SER A 110 ? 0.5578 1.3987 0.4402 0.1763  -0.0011 -0.1503 471 SER A O   
1761 C CB  . SER A 110 ? 0.6852 1.5239 0.5923 0.2164  0.0066  -0.1046 471 SER A CB  
1762 O OG  . SER A 110 ? 0.7473 1.5440 0.6337 0.2214  0.0060  -0.1224 471 SER A OG  
1768 N N   . LEU A 111 ? 0.5004 1.3262 0.4070 0.1671  -0.0003 -0.1178 472 LEU A N   
1769 C CA  . LEU A 111 ? 0.5245 1.3253 0.4245 0.1414  -0.0007 -0.1325 472 LEU A CA  
1770 C C   . LEU A 111 ? 0.5266 1.2839 0.4272 0.1333  0.0025  -0.1193 472 LEU A C   
1771 O O   . LEU A 111 ? 0.5744 1.3474 0.4916 0.1395  0.0023  -0.0990 472 LEU A O   
1772 C CB  . LEU A 111 ? 0.5025 1.3560 0.4168 0.1274  -0.0053 -0.1367 472 LEU A CB  
1773 C CG  . LEU A 111 ? 0.6832 1.5361 0.5924 0.0994  -0.0058 -0.1631 472 LEU A CG  
1774 C CD1 . LEU A 111 ? 0.8304 1.6588 0.7171 0.0953  -0.0024 -0.1915 472 LEU A CD1 
1775 C CD2 . LEU A 111 ? 0.6113 1.5357 0.5375 0.0961  -0.0131 -0.1655 472 LEU A CD2 
1787 N N   . MET A 112 ? 0.7106 1.4119 0.5907 0.1194  0.0073  -0.1314 473 MET A N   
1788 C CA  . MET A 112 ? 0.5877 1.2427 0.4606 0.1114  0.0114  -0.1185 473 MET A CA  
1789 C C   . MET A 112 ? 0.7316 1.3567 0.5938 0.0779  0.0180  -0.1352 473 MET A C   
1790 O O   . MET A 112 ? 0.7895 1.3665 0.6278 0.0696  0.0260  -0.1536 473 MET A O   
1791 C CB  . MET A 112 ? 0.6940 1.2954 0.5439 0.1350  0.0145  -0.1113 473 MET A CB  
1792 C CG  . MET A 112 ? 0.9521 1.5847 0.8108 0.1672  0.0098  -0.1039 473 MET A CG  
1793 S SD  . MET A 112 ? 1.2521 1.9296 1.1379 0.1784  0.0060  -0.0789 473 MET A SD  
1794 C CE  . MET A 112 ? 1.2681 1.8922 1.1314 0.1944  0.0068  -0.0665 473 MET A CE  
1804 N N   . ILE A 113 ? 0.5919 1.2453 0.4727 0.0572  0.0170  -0.1311 474 ILE A N   
1805 C CA  . ILE A 113 ? 0.6209 1.2567 0.4962 0.0216  0.0245  -0.1497 474 ILE A CA  
1806 C C   . ILE A 113 ? 0.6397 1.2269 0.5032 0.0083  0.0324  -0.1352 474 ILE A C   
1807 O O   . ILE A 113 ? 0.6372 1.2430 0.5150 0.0168  0.0282  -0.1134 474 ILE A O   
1808 C CB  . ILE A 113 ? 0.5902 1.3005 0.4951 0.0059  0.0182  -0.1609 474 ILE A CB  
1809 C CG1 . ILE A 113 ? 0.5665 1.3292 0.4782 0.0212  0.0100  -0.1734 474 ILE A CG1 
1810 C CG2 . ILE A 113 ? 0.6266 1.3266 0.5288 -0.0337 0.0270  -0.1851 474 ILE A CG2 
1811 C CD1 . ILE A 113 ? 1.0775 1.8096 0.9656 0.0152  0.0156  -0.2005 474 ILE A CD1 
1823 N N   . ASP A 114 ? 0.7135 1.2374 0.5494 -0.0142 0.0459  -0.1487 475 ASP A N   
1824 C CA  . ASP A 114 ? 0.8253 1.2946 0.6415 -0.0297 0.0567  -0.1360 475 ASP A CA  
1825 C C   . ASP A 114 ? 1.0007 1.5120 0.8408 -0.0620 0.0580  -0.1423 475 ASP A C   
1826 O O   . ASP A 114 ? 0.9688 1.5096 0.8215 -0.0892 0.0612  -0.1695 475 ASP A O   
1827 C CB  . ASP A 114 ? 0.9924 1.3726 0.7674 -0.0441 0.0753  -0.1490 475 ASP A CB  
1828 C CG  . ASP A 114 ? 1.3231 1.6404 1.0708 -0.0619 0.0897  -0.1347 475 ASP A CG  
1829 O OD1 . ASP A 114 ? 1.3951 1.7057 1.1365 -0.0399 0.0840  -0.1051 475 ASP A OD1 
1830 O OD2 . ASP A 114 ? 1.2151 1.4922 0.9468 -0.0991 0.1080  -0.1545 475 ASP A OD2 
1835 N N   . LEU A 115 ? 0.7406 1.2599 0.5883 -0.0590 0.0558  -0.1196 476 LEU A N   
1836 C CA  . LEU A 115 ? 0.6669 1.2317 0.5413 -0.0856 0.0565  -0.1245 476 LEU A CA  
1837 C C   . LEU A 115 ? 0.6966 1.2198 0.5521 -0.1272 0.0740  -0.1419 476 LEU A C   
1838 O O   . LEU A 115 ? 0.8073 1.3744 0.6851 -0.1553 0.0762  -0.1661 476 LEU A O   
1839 C CB  . LEU A 115 ? 0.6027 1.1850 0.4892 -0.0721 0.0515  -0.0979 476 LEU A CB  
1840 C CG  . LEU A 115 ? 0.6984 1.3344 0.6124 -0.0393 0.0379  -0.0851 476 LEU A CG  
1841 C CD1 . LEU A 115 ? 0.7743 1.4179 0.6952 -0.0282 0.0365  -0.0625 476 LEU A CD1 
1842 C CD2 . LEU A 115 ? 0.5920 1.2995 0.5435 -0.0438 0.0314  -0.0978 476 LEU A CD2 
1854 N N   . ILE A 116 ? 0.8825 1.3221 0.6959 -0.1305 0.0877  -0.1303 477 ILE A N   
1855 C CA  . ILE A 116 ? 0.8598 1.2475 0.6489 -0.1722 0.1095  -0.1448 477 ILE A CA  
1856 C C   . ILE A 116 ? 0.9909 1.3800 0.7824 -0.1999 0.1190  -0.1836 477 ILE A C   
1857 O O   . ILE A 116 ? 1.0320 1.4056 0.8180 -0.2427 0.1370  -0.2063 477 ILE A O   
1858 C CB  . ILE A 116 ? 1.0001 1.2854 0.7344 -0.1644 0.1248  -0.1217 477 ILE A CB  
1859 C CG1 . ILE A 116 ? 1.2404 1.4759 0.9489 -0.1300 0.1231  -0.1163 477 ILE A CG1 
1860 C CG2 . ILE A 116 ? 1.1205 1.4163 0.8531 -0.1471 0.1173  -0.0891 477 ILE A CG2 
1861 C CD1 . ILE A 116 ? 1.3065 1.4493 0.9620 -0.1074 0.1335  -0.0874 477 ILE A CD1 
1873 N N   . GLU A 117 ? 0.8412 1.2541 0.6419 -0.1775 0.1080  -0.1937 478 GLU A N   
1874 C CA  . GLU A 117 ? 0.9400 1.3821 0.7521 -0.2017 0.1124  -0.2340 478 GLU A CA  
1875 C C   . GLU A 117 ? 0.8069 1.3573 0.6670 -0.2130 0.0984  -0.2500 478 GLU A C   
1876 O O   . GLU A 117 ? 0.8702 1.4512 0.7428 -0.2503 0.1071  -0.2839 478 GLU A O   
1877 C CB  . GLU A 117 ? 1.1043 1.5400 0.9086 -0.1728 0.1052  -0.2398 478 GLU A CB  
1878 C CG  . GLU A 117 ? 1.2679 1.7452 1.0850 -0.1962 0.1080  -0.2840 478 GLU A CG  
1879 C CD  . GLU A 117 ? 1.4758 1.9606 1.2887 -0.1653 0.0986  -0.2891 478 GLU A CD  
1880 O OE1 . GLU A 117 ? 1.2853 1.8251 1.1129 -0.1771 0.0954  -0.3228 478 GLU A OE1 
1881 O OE2 . GLU A 117 ? 1.4524 1.8935 1.2475 -0.1290 0.0944  -0.2611 478 GLU A OE2 
1888 N N   . VAL A 118 ? 0.8732 1.4819 0.7601 -0.1800 0.0782  -0.2264 479 VAL A N   
1889 C CA  . VAL A 118 ? 0.7714 1.4779 0.7018 -0.1822 0.0652  -0.2353 479 VAL A CA  
1890 C C   . VAL A 118 ? 0.8422 1.5620 0.7856 -0.2173 0.0751  -0.2434 479 VAL A C   
1891 O O   . VAL A 118 ? 0.8746 1.6612 0.8453 -0.2387 0.0737  -0.2710 479 VAL A O   
1892 C CB  . VAL A 118 ? 0.7596 1.5075 0.7111 -0.1406 0.0476  -0.2040 479 VAL A CB  
1893 C CG1 . VAL A 118 ? 0.6489 1.4847 0.6420 -0.1412 0.0380  -0.2080 479 VAL A CG1 
1894 C CG2 . VAL A 118 ? 0.7366 1.4893 0.6809 -0.1083 0.0378  -0.2004 479 VAL A CG2 
1904 N N   . GLU A 119 ? 0.7353 1.3971 0.6590 -0.2214 0.0845  -0.2200 480 GLU A N   
1905 C CA  . GLU A 119 ? 0.8186 1.4849 0.7493 -0.2559 0.0965  -0.2260 480 GLU A CA  
1906 C C   . GLU A 119 ? 0.9124 1.5672 0.8347 -0.3025 0.1149  -0.2655 480 GLU A C   
1907 O O   . GLU A 119 ? 0.8987 1.6159 0.8505 -0.3306 0.1172  -0.2912 480 GLU A O   
1908 C CB  . GLU A 119 ? 0.8013 1.3943 0.6997 -0.2533 0.1063  -0.1950 480 GLU A CB  
1909 C CG  . GLU A 119 ? 0.7687 1.3723 0.6738 -0.2101 0.0904  -0.1599 480 GLU A CG  
1910 C CD  . GLU A 119 ? 1.1349 1.6674 1.0018 -0.2033 0.0987  -0.1315 480 GLU A CD  
1911 O OE1 . GLU A 119 ? 1.2119 1.6941 1.0510 -0.2341 0.1171  -0.1348 480 GLU A OE1 
1912 O OE2 . GLU A 119 ? 1.1241 1.6535 0.9874 -0.1671 0.0876  -0.1064 480 GLU A OE2 
1919 N N   . LYS A 120 ? 0.8089 1.3848 0.6920 -0.3101 0.1293  -0.2722 481 LYS A N   
1920 C CA  . LYS A 120 ? 0.8629 1.4119 0.7321 -0.3569 0.1523  -0.3118 481 LYS A CA  
1921 C C   . LYS A 120 ? 0.9563 1.6068 0.8661 -0.3717 0.1429  -0.3541 481 LYS A C   
1922 O O   . LYS A 120 ? 0.8597 1.5316 0.7785 -0.4177 0.1590  -0.3920 481 LYS A O   
1923 C CB  . LYS A 120 ? 1.1684 1.6154 0.9901 -0.3514 0.1674  -0.3095 481 LYS A CB  
1924 C CG  . LYS A 120 ? 1.4346 1.8443 1.2397 -0.3984 0.1944  -0.3536 481 LYS A CG  
1925 C CD  . LYS A 120 ? 1.4996 1.8102 1.2606 -0.3829 0.2071  -0.3486 481 LYS A CD  
1926 C CE  . LYS A 120 ? 1.4488 1.7189 1.1939 -0.4307 0.2370  -0.3964 481 LYS A CE  
1927 N NZ  . LYS A 120 ? 1.4653 1.6373 1.1690 -0.4122 0.2502  -0.3924 481 LYS A NZ  
1941 N N   . GLU A 121 ? 0.7745 1.4909 0.7079 -0.3329 0.1178  -0.3482 482 GLU A N   
1942 C CA  . GLU A 121 ? 0.9034 1.7197 0.8701 -0.3391 0.1064  -0.3853 482 GLU A CA  
1943 C C   . GLU A 121 ? 0.8618 1.7820 0.8743 -0.3328 0.0904  -0.3856 482 GLU A C   
1944 O O   . GLU A 121 ? 0.6671 1.6774 0.7086 -0.3447 0.0837  -0.4202 482 GLU A O   
1945 C CB  . GLU A 121 ? 0.8782 1.7125 0.8417 -0.2996 0.0892  -0.3797 482 GLU A CB  
1946 C CG  . GLU A 121 ? 1.0326 1.7633 0.9526 -0.2915 0.1014  -0.3703 482 GLU A CG  
1947 C CD  . GLU A 121 ? 1.2306 1.9761 1.1442 -0.2940 0.1019  -0.4040 482 GLU A CD  
1948 O OE1 . GLU A 121 ? 1.2125 2.0356 1.1487 -0.3183 0.1005  -0.4452 482 GLU A OE1 
1949 O OE2 . GLU A 121 ? 1.4042 2.0874 1.2905 -0.2708 0.1038  -0.3909 482 GLU A OE2 
1956 N N   . ARG A 122 ? 0.9191 1.8296 0.9385 -0.3123 0.0845  -0.3483 483 ARG A N   
1957 C CA  . ARG A 122 ? 0.7589 1.7559 0.8206 -0.3024 0.0718  -0.3442 483 ARG A CA  
1958 C C   . ARG A 122 ? 0.6896 1.7703 0.7777 -0.2598 0.0476  -0.3388 483 ARG A C   
1959 O O   . ARG A 122 ? 0.6148 1.7219 0.7217 -0.2273 0.0361  -0.3096 483 ARG A O   
1960 C CB  . ARG A 122 ? 0.7364 1.7841 0.8200 -0.3487 0.0836  -0.3847 483 ARG A CB  
1961 C CG  . ARG A 122 ? 0.9788 1.9473 1.0361 -0.3938 0.1107  -0.3895 483 ARG A CG  
1962 C CD  . ARG A 122 ? 1.2180 2.1630 1.2773 -0.3834 0.1112  -0.3538 483 ARG A CD  
1963 N NE  . ARG A 122 ? 1.3227 2.1965 1.3537 -0.4260 0.1376  -0.3566 483 ARG A NE  
1964 C CZ  . ARG A 122 ? 1.2529 2.0944 1.2758 -0.4253 0.1430  -0.3287 483 ARG A CZ  
1965 N NH1 . ARG A 122 ? 1.0817 1.9557 1.1260 -0.3863 0.1248  -0.2989 483 ARG A NH1 
1966 N NH2 . ARG A 122 ? 1.3253 2.1010 1.3170 -0.4646 0.1686  -0.3314 483 ARG A NH2 
1980 N N   . LEU A 123 ? 0.5472 1.6687 0.6351 -0.2604 0.0418  -0.3672 484 LEU A N   
1981 C CA  . LEU A 123 ? 0.6111 1.7901 0.7108 -0.2134 0.0257  -0.3554 484 LEU A CA  
1982 C C   . LEU A 123 ? 0.7081 1.8915 0.7911 -0.2069 0.0191  -0.3707 484 LEU A C   
1983 O O   . LEU A 123 ? 0.7815 1.9690 0.8589 -0.2377 0.0294  -0.4089 484 LEU A O   
1984 C CB  . LEU A 123 ? 0.6259 1.8597 0.7406 -0.2069 0.0294  -0.3707 484 LEU A CB  
1985 C CG  . LEU A 123 ? 0.7280 2.0123 0.8443 -0.1585 0.0160  -0.3585 484 LEU A CG  
1986 C CD1 . LEU A 123 ? 0.7568 2.0177 0.8680 -0.1160 0.0049  -0.3125 484 LEU A CD1 
1987 C CD2 . LEU A 123 ? 0.7490 2.0914 0.8753 -0.1580 0.0191  -0.3821 484 LEU A CD2 
1999 N N   . LEU A 124 ? 0.8586 2.0358 0.9320 -0.1665 0.0051  -0.3410 485 LEU A N   
2000 C CA  . LEU A 124 ? 0.7468 1.9273 0.8012 -0.1508 -0.0010 -0.3499 485 LEU A CA  
2001 C C   . LEU A 124 ? 0.6362 1.8719 0.7062 -0.1036 -0.0100 -0.3287 485 LEU A C   
2002 O O   . LEU A 124 ? 0.6897 1.9298 0.7672 -0.0740 -0.0131 -0.2960 485 LEU A O   
2003 C CB  . LEU A 124 ? 0.8292 1.9139 0.8520 -0.1356 0.0052  -0.3227 485 LEU A CB  
2004 C CG  . LEU A 124 ? 0.8053 1.7910 0.7990 -0.1676 0.0257  -0.3326 485 LEU A CG  
2005 C CD1 . LEU A 124 ? 0.7461 1.6614 0.7110 -0.1404 0.0267  -0.3091 485 LEU A CD1 
2006 C CD2 . LEU A 124 ? 1.1071 2.1017 1.0953 -0.2093 0.0379  -0.3829 485 LEU A CD2 
2018 N N   . ASP A 125 ? 0.5689 1.8373 0.6361 -0.0981 -0.0117 -0.3487 486 ASP A N   
2019 C CA  . ASP A 125 ? 0.6029 1.9152 0.6723 -0.0541 -0.0189 -0.3298 486 ASP A CA  
2020 C C   . ASP A 125 ? 0.6887 2.0030 0.7451 -0.0537 -0.0219 -0.3472 486 ASP A C   
2021 O O   . ASP A 125 ? 0.7664 2.1195 0.8304 -0.0725 -0.0180 -0.3828 486 ASP A O   
2022 C CB  . ASP A 125 ? 0.7950 2.1720 0.8791 -0.0464 -0.0163 -0.3413 486 ASP A CB  
2023 C CG  . ASP A 125 ? 0.9013 2.3146 0.9767 0.0013  -0.0228 -0.3178 486 ASP A CG  
2024 O OD1 . ASP A 125 ? 0.8965 2.3418 0.9693 0.0101  -0.0253 -0.3298 486 ASP A OD1 
2025 O OD2 . ASP A 125 ? 0.7312 2.1377 0.8001 0.0284  -0.0248 -0.2878 486 ASP A OD2 
2030 N N   . GLU A 126 ? 0.7150 1.9862 0.7507 -0.0330 -0.0272 -0.3239 487 GLU A N   
2031 C CA  . GLU A 126 ? 0.8160 2.0676 0.8302 -0.0366 -0.0276 -0.3424 487 GLU A CA  
2032 C C   . GLU A 126 ? 0.8485 2.0871 0.8485 0.0034  -0.0337 -0.3108 487 GLU A C   
2033 O O   . GLU A 126 ? 0.5724 1.7937 0.5728 0.0288  -0.0356 -0.2731 487 GLU A O   
2034 C CB  . GLU A 126 ? 0.8384 2.0143 0.8229 -0.0720 -0.0177 -0.3648 487 GLU A CB  
2035 C CG  . GLU A 126 ? 1.0135 2.1915 1.0054 -0.1207 -0.0053 -0.4075 487 GLU A CG  
2036 C CD  . GLU A 126 ? 1.2796 2.3603 1.2363 -0.1521 0.0136  -0.4263 487 GLU A CD  
2037 O OE1 . GLU A 126 ? 1.3691 2.3753 1.3054 -0.1296 0.0169  -0.3968 487 GLU A OE1 
2038 O OE2 . GLU A 126 ? 1.3387 2.4065 1.2952 -0.1965 0.0292  -0.4642 487 GLU A OE2 
2045 N N   . TRP A 127 ? 0.5791 1.8253 0.5675 0.0057  -0.0343 -0.3292 488 TRP A N   
2046 C CA  . TRP A 127 ? 0.5768 1.8023 0.5475 0.0360  -0.0372 -0.3077 488 TRP A CA  
2047 C C   . TRP A 127 ? 0.6008 1.7482 0.5384 0.0246  -0.0301 -0.3166 488 TRP A C   
2048 O O   . TRP A 127 ? 0.7034 1.8224 0.6258 -0.0065 -0.0213 -0.3539 488 TRP A O   
2049 C CB  . TRP A 127 ? 0.5974 1.8748 0.5717 0.0460  -0.0401 -0.3235 488 TRP A CB  
2050 C CG  . TRP A 127 ? 0.5811 1.9294 0.5764 0.0707  -0.0436 -0.3071 488 TRP A CG  
2051 C CD1 . TRP A 127 ? 0.5872 1.9952 0.6027 0.0604  -0.0427 -0.3263 488 TRP A CD1 
2052 C CD2 . TRP A 127 ? 0.5649 1.9273 0.5571 0.1112  -0.0446 -0.2692 488 TRP A CD2 
2053 N NE1 . TRP A 127 ? 0.5792 2.0353 0.5987 0.0957  -0.0436 -0.3019 488 TRP A NE1 
2054 C CE2 . TRP A 127 ? 0.5673 1.9933 0.5717 0.1261  -0.0439 -0.2664 488 TRP A CE2 
2055 C CE3 . TRP A 127 ? 0.5542 1.8798 0.5319 0.1358  -0.0436 -0.2388 488 TRP A CE3 
2056 C CZ2 . TRP A 127 ? 0.5648 2.0112 0.5617 0.1647  -0.0417 -0.2331 488 TRP A CZ2 
2057 C CZ3 . TRP A 127 ? 0.5475 1.8969 0.5240 0.1703  -0.0408 -0.2069 488 TRP A CZ3 
2058 C CH2 . TRP A 127 ? 0.5552 1.9612 0.5387 0.1847  -0.0396 -0.2036 488 TRP A CH2 
2069 N N   . PHE A 128 ? 0.5810 1.6916 0.5064 0.0507  -0.0301 -0.2836 489 PHE A N   
2070 C CA  . PHE A 128 ? 0.6052 1.6420 0.5010 0.0504  -0.0206 -0.2864 489 PHE A CA  
2071 C C   . PHE A 128 ? 0.6074 1.6459 0.4915 0.0796  -0.0221 -0.2764 489 PHE A C   
2072 O O   . PHE A 128 ? 0.6105 1.6776 0.5102 0.1056  -0.0278 -0.2452 489 PHE A O   
2073 C CB  . PHE A 128 ? 0.5829 1.5639 0.4866 0.0540  -0.0160 -0.2533 489 PHE A CB  
2074 C CG  . PHE A 128 ? 0.6439 1.6106 0.5594 0.0232  -0.0117 -0.2611 489 PHE A CG  
2075 C CD1 . PHE A 128 ? 0.7031 1.7282 0.6423 0.0210  -0.0193 -0.2531 489 PHE A CD1 
2076 C CD2 . PHE A 128 ? 0.8576 1.7503 0.7590 -0.0023 0.0017  -0.2758 489 PHE A CD2 
2077 C CE1 . PHE A 128 ? 0.6172 1.6331 0.5685 -0.0086 -0.0143 -0.2625 489 PHE A CE1 
2078 C CE2 . PHE A 128 ? 0.7239 1.6022 0.6335 -0.0330 0.0082  -0.2829 489 PHE A CE2 
2079 C CZ  . PHE A 128 ? 0.6165 1.5596 0.5526 -0.0372 -0.0002 -0.2776 489 PHE A CZ  
2089 N N   . THR A 129 ? 0.6494 1.6482 0.5117 0.0741  -0.0139 -0.3014 490 THR A N   
2090 C CA  . THR A 129 ? 0.8751 1.8723 0.7257 0.1005  -0.0136 -0.2952 490 THR A CA  
2091 C C   . THR A 129 ? 0.8224 1.7690 0.6722 0.1221  -0.0096 -0.2616 490 THR A C   
2092 O O   . THR A 129 ? 0.6977 1.5754 0.5441 0.1146  -0.0020 -0.2589 490 THR A O   
2093 C CB  . THR A 129 ? 0.9286 1.9001 0.7583 0.0886  -0.0045 -0.3361 490 THR A CB  
2094 O OG1 . THR A 129 ? 1.3229 2.2058 1.1453 0.0713  0.0087  -0.3442 490 THR A OG1 
2095 C CG2 . THR A 129 ? 0.7501 1.7748 0.5931 0.0651  -0.0087 -0.3669 490 THR A CG2 
2103 N N   . LEU A 130 ? 0.6824 1.6609 0.5399 0.1481  -0.0139 -0.2338 491 LEU A N   
2104 C CA  . LEU A 130 ? 0.6165 1.5645 0.4757 0.1679  -0.0095 -0.2055 491 LEU A CA  
2105 C C   . LEU A 130 ? 0.6138 1.5080 0.4593 0.1775  -0.0022 -0.2159 491 LEU A C   
2106 O O   . LEU A 130 ? 0.6438 1.5437 0.4749 0.1813  0.0000  -0.2393 491 LEU A O   
2107 C CB  . LEU A 130 ? 0.5496 1.5335 0.4281 0.1879  -0.0125 -0.1757 491 LEU A CB  
2108 C CG  . LEU A 130 ? 0.5173 1.5349 0.4185 0.1854  -0.0170 -0.1538 491 LEU A CG  
2109 C CD1 . LEU A 130 ? 0.5079 1.5552 0.4212 0.2056  -0.0164 -0.1287 491 LEU A CD1 
2110 C CD2 . LEU A 130 ? 0.4931 1.4841 0.4014 0.1801  -0.0134 -0.1375 491 LEU A CD2 
2122 N N   . ASP A 131 ? 0.6088 1.4546 0.4588 0.1835  0.0013  -0.1984 492 ASP A N   
2123 C CA  . ASP A 131 ? 0.6410 1.4339 0.4788 0.1982  0.0073  -0.2037 492 ASP A CA  
2124 C C   . ASP A 131 ? 0.6192 1.4397 0.4624 0.2259  0.0082  -0.1906 492 ASP A C   
2125 O O   . ASP A 131 ? 0.5778 1.4408 0.4354 0.2311  0.0067  -0.1699 492 ASP A O   
2126 C CB  . ASP A 131 ? 0.6499 1.3843 0.4875 0.1943  0.0098  -0.1900 492 ASP A CB  
2127 C CG  . ASP A 131 ? 1.0393 1.7009 0.8537 0.1914  0.0180  -0.2086 492 ASP A CG  
2128 O OD1 . ASP A 131 ? 1.0893 1.7232 0.8950 0.1642  0.0228  -0.2249 492 ASP A OD1 
2129 O OD2 . ASP A 131 ? 1.1074 1.7385 0.9123 0.2165  0.0214  -0.2074 492 ASP A OD2 
2134 N N   . GLU A 132 ? 0.6550 1.4503 0.4867 0.2430  0.0128  -0.2040 493 GLU A N   
2135 C CA  . GLU A 132 ? 0.6394 1.4580 0.4775 0.2689  0.0154  -0.1953 493 GLU A CA  
2136 C C   . GLU A 132 ? 0.7343 1.6110 0.5795 0.2702  0.0146  -0.1918 493 GLU A C   
2137 O O   . GLU A 132 ? 0.5941 1.4872 0.4569 0.2797  0.0145  -0.1734 493 GLU A O   
2138 C CB  . GLU A 132 ? 0.7160 1.5314 0.5712 0.2769  0.0147  -0.1689 493 GLU A CB  
2139 C CG  . GLU A 132 ? 0.9088 1.6632 0.7571 0.2790  0.0138  -0.1659 493 GLU A CG  
2140 C CD  . GLU A 132 ? 1.1476 1.8642 0.9806 0.3026  0.0173  -0.1808 493 GLU A CD  
2141 O OE1 . GLU A 132 ? 1.0861 1.8348 0.9244 0.3227  0.0195  -0.1868 493 GLU A OE1 
2142 O OE2 . GLU A 132 ? 1.2221 1.8751 1.0367 0.3014  0.0197  -0.1868 493 GLU A OE2 
2149 N N   . VAL A 133 ? 0.6458 1.5423 0.4843 0.2556  0.0109  -0.2056 494 VAL A N   
2150 C CA  . VAL A 133 ? 0.6185 1.5565 0.4659 0.2561  0.0071  -0.1991 494 VAL A CA  
2151 C C   . VAL A 133 ? 0.6682 1.6169 0.5005 0.2476  0.0060  -0.2303 494 VAL A C   
2152 O O   . VAL A 133 ? 0.6801 1.6104 0.4994 0.2332  0.0069  -0.2541 494 VAL A O   
2153 C CB  . VAL A 133 ? 0.7117 1.6820 0.5757 0.2484  0.0017  -0.1723 494 VAL A CB  
2154 C CG1 . VAL A 133 ? 0.7013 1.6666 0.5819 0.2565  0.0050  -0.1426 494 VAL A CG1 
2155 C CG2 . VAL A 133 ? 0.5802 1.5492 0.4433 0.2308  -0.0026 -0.1781 494 VAL A CG2 
2165 N N   . PRO A 134 ? 0.6641 1.6429 0.4976 0.2538  0.0052  -0.2320 495 PRO A N   
2166 C CA  . PRO A 134 ? 0.7010 1.6958 0.5223 0.2449  0.0044  -0.2633 495 PRO A CA  
2167 C C   . PRO A 134 ? 0.7919 1.8198 0.6165 0.2260  -0.0032 -0.2694 495 PRO A C   
2168 O O   . PRO A 134 ? 0.9057 1.9351 0.7207 0.2105  -0.0026 -0.3030 495 PRO A O   
2169 C CB  . PRO A 134 ? 0.7032 1.7300 0.5273 0.2569  0.0050  -0.2553 495 PRO A CB  
2170 C CG  . PRO A 134 ? 0.6928 1.7097 0.5282 0.2709  0.0083  -0.2255 495 PRO A CG  
2171 C CD  . PRO A 134 ? 0.6433 1.6438 0.4883 0.2663  0.0062  -0.2059 495 PRO A CD  
2179 N N   . LYS A 135 ? 0.6645 1.7195 0.5042 0.2275  -0.0090 -0.2392 496 LYS A N   
2180 C CA  . LYS A 135 ? 0.6610 1.7570 0.5087 0.2149  -0.0168 -0.2420 496 LYS A CA  
2181 C C   . LYS A 135 ? 0.6225 1.7219 0.4860 0.2172  -0.0193 -0.2104 496 LYS A C   
2182 O O   . LYS A 135 ? 0.5989 1.6781 0.4678 0.2295  -0.0151 -0.1834 496 LYS A O   
2183 C CB  . LYS A 135 ? 0.6731 1.8241 0.5222 0.2225  -0.0207 -0.2408 496 LYS A CB  
2184 C CG  . LYS A 135 ? 0.6550 1.8177 0.5077 0.2439  -0.0180 -0.2039 496 LYS A CG  
2185 C CD  . LYS A 135 ? 0.6767 1.8891 0.5237 0.2533  -0.0198 -0.2032 496 LYS A CD  
2186 C CE  . LYS A 135 ? 0.7096 1.9724 0.5655 0.2567  -0.0259 -0.1919 496 LYS A CE  
2187 N NZ  . LYS A 135 ? 1.1263 2.4355 0.9735 0.2722  -0.0259 -0.1823 496 LYS A NZ  
2201 N N   . GLY A 136 ? 0.6180 1.7452 0.4909 0.2045  -0.0252 -0.2160 497 GLY A N   
2202 C CA  . GLY A 136 ? 0.8402 1.9731 0.7294 0.2065  -0.0266 -0.1892 497 GLY A CA  
2203 C C   . GLY A 136 ? 0.7562 1.8796 0.6492 0.1835  -0.0291 -0.2067 497 GLY A C   
2204 O O   . GLY A 136 ? 0.6010 1.6830 0.4799 0.1684  -0.0256 -0.2289 497 GLY A O   
2208 N N   . LYS A 137 ? 0.5884 1.7495 0.4990 0.1820  -0.0331 -0.1967 498 LYS A N   
2209 C CA  . LYS A 137 ? 0.5631 1.7256 0.4818 0.1588  -0.0355 -0.2125 498 LYS A CA  
2210 C C   . LYS A 137 ? 0.5440 1.7188 0.4814 0.1683  -0.0347 -0.1818 498 LYS A C   
2211 O O   . LYS A 137 ? 0.5215 1.7241 0.4661 0.1913  -0.0325 -0.1569 498 LYS A O   
2212 C CB  . LYS A 137 ? 0.5884 1.8000 0.5127 0.1423  -0.0401 -0.2459 498 LYS A CB  
2213 C CG  . LYS A 137 ? 0.7812 1.9698 0.6872 0.1207  -0.0373 -0.2867 498 LYS A CG  
2214 C CD  . LYS A 137 ? 0.8031 2.0503 0.7197 0.1042  -0.0406 -0.3203 498 LYS A CD  
2215 C CE  . LYS A 137 ? 0.8120 2.0324 0.7107 0.0810  -0.0340 -0.3637 498 LYS A CE  
2216 N NZ  . LYS A 137 ? 0.9230 2.2086 0.8347 0.0665  -0.0363 -0.3966 498 LYS A NZ  
2230 N N   . LEU A 138 ? 0.5973 1.7478 0.5391 0.1506  -0.0341 -0.1844 499 LEU A N   
2231 C CA  . LEU A 138 ? 0.4856 1.6434 0.4449 0.1564  -0.0316 -0.1589 499 LEU A CA  
2232 C C   . LEU A 138 ? 0.4869 1.6696 0.4589 0.1332  -0.0346 -0.1793 499 LEU A C   
2233 O O   . LEU A 138 ? 0.5036 1.6682 0.4685 0.1051  -0.0365 -0.2079 499 LEU A O   
2234 C CB  . LEU A 138 ? 0.4660 1.5729 0.4217 0.1578  -0.0268 -0.1388 499 LEU A CB  
2235 C CG  . LEU A 138 ? 0.4350 1.5420 0.4077 0.1597  -0.0222 -0.1154 499 LEU A CG  
2236 C CD1 . LEU A 138 ? 0.5123 1.6384 0.4892 0.1860  -0.0139 -0.0871 499 LEU A CD1 
2237 C CD2 . LEU A 138 ? 0.4208 1.4804 0.3890 0.1537  -0.0190 -0.1053 499 LEU A CD2 
2249 N N   . HIS A 139 ? 0.5502 1.7698 0.5357 0.1453  -0.0318 -0.1657 500 HIS A N   
2250 C CA  . HIS A 139 ? 0.4798 1.7316 0.4784 0.1270  -0.0331 -0.1850 500 HIS A CA  
2251 C C   . HIS A 139 ? 0.4565 1.6810 0.4618 0.1202  -0.0289 -0.1685 500 HIS A C   
2252 O O   . HIS A 139 ? 0.5340 1.7473 0.5335 0.1418  -0.0230 -0.1382 500 HIS A O   
2253 C CB  . HIS A 139 ? 0.4952 1.8053 0.4951 0.1477  -0.0320 -0.1837 500 HIS A CB  
2254 C CG  . HIS A 139 ? 0.5643 1.9177 0.5769 0.1301  -0.0335 -0.2099 500 HIS A CG  
2255 N ND1 . HIS A 139 ? 0.6497 1.9957 0.6743 0.0923  -0.0349 -0.2401 500 HIS A ND1 
2256 C CD2 . HIS A 139 ? 0.6529 2.0585 0.6662 0.1453  -0.0329 -0.2113 500 HIS A CD2 
2257 C CE1 . HIS A 139 ? 0.6403 2.0344 0.6764 0.0831  -0.0339 -0.2604 500 HIS A CE1 
2258 N NE2 . HIS A 139 ? 0.7360 2.1682 0.7649 0.1166  -0.0339 -0.2436 500 HIS A NE2 
2267 N N   . LEU A 140 ? 0.4549 1.6638 0.4675 0.0881  -0.0314 -0.1893 501 LEU A N   
2268 C CA  . LEU A 140 ? 0.4341 1.6185 0.4556 0.0774  -0.0282 -0.1767 501 LEU A CA  
2269 C C   . LEU A 140 ? 0.4418 1.6528 0.4779 0.0497  -0.0279 -0.2027 501 LEU A C   
2270 O O   . LEU A 140 ? 0.4772 1.7117 0.5163 0.0261  -0.0295 -0.2373 501 LEU A O   
2271 C CB  . LEU A 140 ? 0.4248 1.5591 0.4395 0.0644  -0.0296 -0.1722 501 LEU A CB  
2272 C CG  . LEU A 140 ? 0.4168 1.5210 0.4177 0.0903  -0.0279 -0.1470 501 LEU A CG  
2273 C CD1 . LEU A 140 ? 0.5312 1.5666 0.5202 0.0771  -0.0220 -0.1454 501 LEU A CD1 
2274 C CD2 . LEU A 140 ? 0.3972 1.4961 0.4033 0.1148  -0.0197 -0.1128 501 LEU A CD2 
2286 N N   . ARG A 141 ? 0.4613 1.6637 0.5047 0.0507  -0.0248 -0.1876 502 ARG A N   
2287 C CA  . ARG A 141 ? 0.5943 1.8135 0.6523 0.0224  -0.0228 -0.2104 502 ARG A CA  
2288 C C   . ARG A 141 ? 0.4829 1.6573 0.5488 0.0078  -0.0192 -0.1954 502 ARG A C   
2289 O O   . ARG A 141 ? 0.4234 1.5707 0.4874 0.0281  -0.0181 -0.1649 502 ARG A O   
2290 C CB  . ARG A 141 ? 0.5592 1.8202 0.6178 0.0401  -0.0237 -0.2106 502 ARG A CB  
2291 C CG  . ARG A 141 ? 0.7055 1.9912 0.7791 0.0133  -0.0210 -0.2370 502 ARG A CG  
2292 C CD  . ARG A 141 ? 0.7195 2.0502 0.7915 0.0385  -0.0244 -0.2346 502 ARG A CD  
2293 N NE  . ARG A 141 ? 0.9398 2.2968 1.0266 0.0158  -0.0218 -0.2597 502 ARG A NE  
2294 C CZ  . ARG A 141 ? 1.1277 2.5324 1.2164 0.0330  -0.0251 -0.2655 502 ARG A CZ  
2295 N NH1 . ARG A 141 ? 1.2176 2.6482 1.2932 0.0733  -0.0310 -0.2461 502 ARG A NH1 
2296 N NH2 . ARG A 141 ? 1.0093 2.4377 1.1122 0.0104  -0.0218 -0.2907 502 ARG A NH2 
2310 N N   . LEU A 142 ? 0.5805 1.7452 0.6544 -0.0297 -0.0163 -0.2181 503 LEU A N   
2311 C CA  . LEU A 142 ? 0.5310 1.6572 0.6134 -0.0464 -0.0110 -0.2054 503 LEU A CA  
2312 C C   . LEU A 142 ? 0.5725 1.7056 0.6670 -0.0796 -0.0035 -0.2256 503 LEU A C   
2313 O O   . LEU A 142 ? 0.6203 1.7723 0.7157 -0.1117 0.0000  -0.2603 503 LEU A O   
2314 C CB  . LEU A 142 ? 0.4774 1.5350 0.5348 -0.0586 -0.0049 -0.2048 503 LEU A CB  
2315 C CG  . LEU A 142 ? 0.6756 1.7125 0.7143 -0.0272 -0.0094 -0.1879 503 LEU A CG  
2316 C CD1 . LEU A 142 ? 0.4634 1.4190 0.4713 -0.0374 -0.0004 -0.1893 503 LEU A CD1 
2317 C CD2 . LEU A 142 ? 0.4142 1.4577 0.4656 0.0044  -0.0115 -0.1529 503 LEU A CD2 
2329 N N   . GLU A 143 ? 0.4320 1.5444 0.5329 -0.0734 0.0000  -0.2056 504 GLU A N   
2330 C CA  . GLU A 143 ? 0.4047 1.5175 0.5150 -0.1025 0.0076  -0.2215 504 GLU A CA  
2331 C C   . GLU A 143 ? 0.6223 1.6909 0.7351 -0.1216 0.0164  -0.2077 504 GLU A C   
2332 O O   . GLU A 143 ? 0.4193 1.4589 0.5314 -0.0995 0.0153  -0.1781 504 GLU A O   
2333 C CB  . GLU A 143 ? 0.4023 1.5318 0.5178 -0.0802 0.0036  -0.2135 504 GLU A CB  
2334 C CG  . GLU A 143 ? 0.4119 1.5845 0.5218 -0.0500 -0.0050 -0.2156 504 GLU A CG  
2335 C CD  . GLU A 143 ? 0.7320 1.9267 0.8487 -0.0300 -0.0084 -0.2099 504 GLU A CD  
2336 O OE1 . GLU A 143 ? 0.8314 2.0059 0.9589 -0.0397 -0.0045 -0.2053 504 GLU A OE1 
2337 O OE2 . GLU A 143 ? 1.0461 2.2806 1.1571 -0.0037 -0.0148 -0.2102 504 GLU A OE2 
2344 N N   . TRP A 144 ? 0.4137 1.4754 0.5273 -0.1646 0.0277  -0.2300 505 TRP A N   
2345 C CA  . TRP A 144 ? 0.4165 1.4310 0.5241 -0.1850 0.0402  -0.2169 505 TRP A CA  
2346 C C   . TRP A 144 ? 0.4206 1.4372 0.5359 -0.2014 0.0454  -0.2244 505 TRP A C   
2347 O O   . TRP A 144 ? 0.4483 1.4787 0.5636 -0.2320 0.0528  -0.2539 505 TRP A O   
2348 C CB  . TRP A 144 ? 0.5701 1.5067 0.6365 -0.2122 0.0533  -0.2261 505 TRP A CB  
2349 C CG  . TRP A 144 ? 0.5873 1.4621 0.6334 -0.2317 0.0674  -0.2118 505 TRP A CG  
2350 C CD1 . TRP A 144 ? 0.6212 1.4842 0.6634 -0.2728 0.0832  -0.2285 505 TRP A CD1 
2351 C CD2 . TRP A 144 ? 0.4969 1.3176 0.5219 -0.2109 0.0677  -0.1784 505 TRP A CD2 
2352 N NE1 . TRP A 144 ? 0.7355 1.5372 0.7520 -0.2774 0.0930  -0.2050 505 TRP A NE1 
2353 C CE2 . TRP A 144 ? 0.6591 1.4373 0.6654 -0.2388 0.0826  -0.1747 505 TRP A CE2 
2354 C CE3 . TRP A 144 ? 0.5242 1.3330 0.5441 -0.1721 0.0573  -0.1530 505 TRP A CE3 
2355 C CZ2 . TRP A 144 ? 0.6580 1.3867 0.6401 -0.2261 0.0853  -0.1457 505 TRP A CZ2 
2356 C CZ3 . TRP A 144 ? 0.8296 1.5920 0.8293 -0.1616 0.0605  -0.1273 505 TRP A CZ3 
2357 C CH2 . TRP A 144 ? 0.7917 1.5166 0.7723 -0.1871 0.0733  -0.1235 505 TRP A CH2 
2368 N N   . LEU A 145 ? 0.5007 1.4959 0.6188 -0.1805 0.0423  -0.1994 506 LEU A N   
2369 C CA  . LEU A 145 ? 0.5472 1.5395 0.6713 -0.1889 0.0454  -0.2049 506 LEU A CA  
2370 C C   . LEU A 145 ? 0.4631 1.4171 0.5790 -0.2155 0.0578  -0.1982 506 LEU A C   
2371 O O   . LEU A 145 ? 0.4222 1.3493 0.5318 -0.2065 0.0589  -0.1749 506 LEU A O   
2372 C CB  . LEU A 145 ? 0.5222 1.5175 0.6567 -0.1499 0.0353  -0.1854 506 LEU A CB  
2373 C CG  . LEU A 145 ? 0.5771 1.6062 0.7143 -0.1185 0.0242  -0.1844 506 LEU A CG  
2374 C CD1 . LEU A 145 ? 0.4697 1.4919 0.6156 -0.0838 0.0189  -0.1613 506 LEU A CD1 
2375 C CD2 . LEU A 145 ? 0.5084 1.5845 0.6488 -0.1307 0.0234  -0.2158 506 LEU A CD2 
2387 N N   . THR A 146 ? 0.4386 1.3919 0.5521 -0.2471 0.0678  -0.2190 507 THR A N   
2388 C CA  . THR A 146 ? 0.5909 1.5073 0.6914 -0.2746 0.0811  -0.2135 507 THR A CA  
2389 C C   . THR A 146 ? 0.5722 1.4843 0.6813 -0.2646 0.0786  -0.2089 507 THR A C   
2390 O O   . THR A 146 ? 0.4343 1.3737 0.5599 -0.2449 0.0705  -0.2159 507 THR A O   
2391 C CB  . THR A 146 ? 0.7174 1.6228 0.8022 -0.3240 0.0997  -0.2397 507 THR A CB  
2392 O OG1 . THR A 146 ? 0.6046 1.5483 0.6996 -0.3298 0.0977  -0.2708 507 THR A OG1 
2393 C CG2 . THR A 146 ? 0.5808 1.4631 0.6484 -0.3429 0.1122  -0.2349 507 THR A CG2 
2401 N N   . LEU A 147 ? 0.6156 1.4948 0.7127 -0.2784 0.0866  -0.1969 508 LEU A N   
2402 C CA  . LEU A 147 ? 0.6762 1.5480 0.7806 -0.2711 0.0857  -0.1928 508 LEU A CA  
2403 C C   . LEU A 147 ? 0.5149 1.3915 0.6150 -0.3023 0.0966  -0.2173 508 LEU A C   
2404 O O   . LEU A 147 ? 0.8043 1.6592 0.8828 -0.3378 0.1108  -0.2242 508 LEU A O   
2405 C CB  . LEU A 147 ? 0.5248 1.3644 0.6170 -0.2692 0.0882  -0.1697 508 LEU A CB  
2406 C CG  . LEU A 147 ? 0.5635 1.3970 0.6637 -0.2335 0.0779  -0.1461 508 LEU A CG  
2407 C CD1 . LEU A 147 ? 0.6044 1.4521 0.7072 -0.2168 0.0712  -0.1415 508 LEU A CD1 
2408 C CD2 . LEU A 147 ? 0.4442 1.2536 0.5276 -0.2384 0.0824  -0.1287 508 LEU A CD2 
2420 N N   . MET A 148 ? 0.4692 1.3729 0.5884 -0.2896 0.0920  -0.2300 509 MET A N   
2421 C CA  . MET A 148 ? 0.4986 1.4131 0.6160 -0.3156 0.1022  -0.2549 509 MET A CA  
2422 C C   . MET A 148 ? 0.4928 1.3936 0.6146 -0.3115 0.1040  -0.2479 509 MET A C   
2423 O O   . MET A 148 ? 0.5664 1.4681 0.7056 -0.2808 0.0948  -0.2328 509 MET A O   
2424 C CB  . MET A 148 ? 0.5374 1.5013 0.6737 -0.3062 0.0974  -0.2782 509 MET A CB  
2425 C CG  . MET A 148 ? 0.7639 1.7481 0.8943 -0.3187 0.0990  -0.2955 509 MET A CG  
2426 S SD  . MET A 148 ? 0.7695 1.8201 0.9183 -0.3147 0.0967  -0.3300 509 MET A SD  
2427 C CE  . MET A 148 ? 1.1673 2.2125 1.3046 -0.3595 0.1173  -0.3590 509 MET A CE  
2437 N N   . PRO A 149 ? 0.5293 1.4162 0.6345 -0.3440 0.1174  -0.2603 510 PRO A N   
2438 C CA  . PRO A 149 ? 0.5779 1.4521 0.6846 -0.3418 0.1195  -0.2543 510 PRO A CA  
2439 C C   . PRO A 149 ? 0.5255 1.4321 0.6527 -0.3380 0.1202  -0.2754 510 PRO A C   
2440 O O   . PRO A 149 ? 0.5392 1.4393 0.6623 -0.3505 0.1274  -0.2815 510 PRO A O   
2441 C CB  . PRO A 149 ? 0.5824 1.4247 0.6563 -0.3796 0.1342  -0.2548 510 PRO A CB  
2442 C CG  . PRO A 149 ? 0.6573 1.5022 0.7175 -0.4094 0.1449  -0.2744 510 PRO A CG  
2443 C CD  . PRO A 149 ? 0.6126 1.4925 0.6957 -0.3858 0.1333  -0.2814 510 PRO A CD  
2451 N N   . ASN A 150 ? 0.5152 1.4601 0.6638 -0.3205 0.1127  -0.2866 511 ASN A N   
2452 C CA  . ASN A 150 ? 0.5170 1.5013 0.6892 -0.3114 0.1115  -0.3053 511 ASN A CA  
2453 C C   . ASN A 150 ? 0.5788 1.5994 0.7762 -0.2771 0.0978  -0.3024 511 ASN A C   
2454 O O   . ASN A 150 ? 0.4832 1.5017 0.6758 -0.2669 0.0912  -0.2921 511 ASN A O   
2455 C CB  . ASN A 150 ? 0.5748 1.5821 0.7373 -0.3455 0.1243  -0.3385 511 ASN A CB  
2456 C CG  . ASN A 150 ? 0.6655 1.6958 0.8222 -0.3570 0.1257  -0.3554 511 ASN A CG  
2457 O OD1 . ASN A 150 ? 0.7498 1.8246 0.9262 -0.3360 0.1161  -0.3648 511 ASN A OD1 
2458 N ND2 . ASN A 150 ? 0.7058 1.7062 0.8347 -0.3912 0.1387  -0.3601 511 ASN A ND2 
2465 N N   . ALA A 151 ? 0.4904 1.5457 0.7137 -0.2592 0.0940  -0.3113 512 ALA A N   
2466 C CA  . ALA A 151 ? 0.4726 1.5623 0.7201 -0.2230 0.0813  -0.3044 512 ALA A CA  
2467 C C   . ALA A 151 ? 0.4920 1.6421 0.7455 -0.2242 0.0779  -0.3321 512 ALA A C   
2468 O O   . ALA A 151 ? 0.5775 1.7687 0.8520 -0.1940 0.0676  -0.3314 512 ALA A O   
2469 C CB  . ALA A 151 ? 0.4602 1.5544 0.7355 -0.1993 0.0798  -0.2956 512 ALA A CB  
2475 N N   . SER A 152 ? 0.5196 1.6762 0.7540 -0.2591 0.0876  -0.3569 513 SER A N   
2476 C CA  . SER A 152 ? 0.7688 1.9868 1.0087 -0.2667 0.0882  -0.3908 513 SER A CA  
2477 C C   . SER A 152 ? 0.8670 2.1210 1.1124 -0.2403 0.0749  -0.3879 513 SER A C   
2478 O O   . SER A 152 ? 0.8134 2.1306 1.0710 -0.2305 0.0700  -0.4111 513 SER A O   
2479 C CB  . SER A 152 ? 0.6339 1.8427 0.8498 -0.3135 0.1058  -0.4173 513 SER A CB  
2480 O OG  . SER A 152 ? 0.8689 2.0399 1.0635 -0.3260 0.1086  -0.4051 513 SER A OG  
2486 N N   . ASN A 153 ? 0.5142 1.7318 0.7496 -0.2281 0.0691  -0.3607 514 ASN A N   
2487 C CA  . ASN A 153 ? 0.5085 1.7558 0.7436 -0.2057 0.0578  -0.3575 514 ASN A CA  
2488 C C   . ASN A 153 ? 0.4793 1.7174 0.7259 -0.1617 0.0443  -0.3230 514 ASN A C   
2489 O O   . ASN A 153 ? 0.4739 1.7280 0.7160 -0.1406 0.0351  -0.3144 514 ASN A O   
2490 C CB  . ASN A 153 ? 0.6880 1.9074 0.8997 -0.2307 0.0642  -0.3596 514 ASN A CB  
2491 C CG  . ASN A 153 ? 0.9606 2.1975 1.1615 -0.2734 0.0799  -0.3977 514 ASN A CG  
2492 O OD1 . ASN A 153 ? 1.0514 2.2837 1.2515 -0.2976 0.0917  -0.4134 514 ASN A OD1 
2493 N ND2 . ASN A 153 ? 1.0090 2.2662 1.2013 -0.2838 0.0820  -0.4142 514 ASN A ND2 
2500 N N   . LEU A 154 ? 0.4646 1.6773 0.7256 -0.1489 0.0453  -0.3047 515 LEU A N   
2501 C CA  . LEU A 154 ? 0.4417 1.6380 0.7150 -0.1110 0.0379  -0.2721 515 LEU A CA  
2502 C C   . LEU A 154 ? 0.4489 1.7011 0.7351 -0.0737 0.0262  -0.2712 515 LEU A C   
2503 O O   . LEU A 154 ? 0.4385 1.6838 0.7215 -0.0456 0.0196  -0.2477 515 LEU A O   
2504 C CB  . LEU A 154 ? 0.4318 1.5985 0.7228 -0.1077 0.0447  -0.2603 515 LEU A CB  
2505 C CG  . LEU A 154 ? 0.4145 1.5646 0.7242 -0.0710 0.0427  -0.2301 515 LEU A CG  
2506 C CD1 . LEU A 154 ? 0.3968 1.5071 0.6901 -0.0626 0.0409  -0.2050 515 LEU A CD1 
2507 C CD2 . LEU A 154 ? 0.4087 1.5292 0.7364 -0.0753 0.0532  -0.2247 515 LEU A CD2 
2519 N N   . ASP A 155 ? 0.4704 1.7796 0.7692 -0.0723 0.0241  -0.2968 516 ASP A N   
2520 C CA  . ASP A 155 ? 0.4836 1.8525 0.7949 -0.0335 0.0127  -0.2964 516 ASP A CA  
2521 C C   . ASP A 155 ? 0.4892 1.8818 0.7807 -0.0194 0.0034  -0.2942 516 ASP A C   
2522 O O   . ASP A 155 ? 0.4927 1.9054 0.7862 0.0207  -0.0055 -0.2746 516 ASP A O   
2523 C CB  . ASP A 155 ? 0.5603 1.9933 0.8849 -0.0402 0.0122  -0.3312 516 ASP A CB  
2524 C CG  . ASP A 155 ? 0.9218 2.3842 1.2288 -0.0764 0.0163  -0.3685 516 ASP A CG  
2525 O OD1 . ASP A 155 ? 0.5224 1.9390 0.8101 -0.1077 0.0246  -0.3687 516 ASP A OD1 
2526 O OD2 . ASP A 155 ? 1.0461 2.5788 1.3594 -0.0735 0.0129  -0.3986 516 ASP A OD2 
2531 N N   . LYS A 156 ? 0.4938 1.8830 0.7656 -0.0519 0.0072  -0.3140 517 LYS A N   
2532 C CA  . LYS A 156 ? 0.5016 1.9172 0.7557 -0.0424 0.0002  -0.3174 517 LYS A CA  
2533 C C   . LYS A 156 ? 0.4782 1.8417 0.7194 -0.0277 -0.0022 -0.2824 517 LYS A C   
2534 O O   . LYS A 156 ? 0.4830 1.8686 0.7137 -0.0005 -0.0107 -0.2721 517 LYS A O   
2535 C CB  . LYS A 156 ? 0.5196 1.9529 0.7613 -0.0844 0.0087  -0.3548 517 LYS A CB  
2536 C CG  . LYS A 156 ? 0.7194 2.0869 0.9481 -0.1225 0.0210  -0.3516 517 LYS A CG  
2537 C CD  . LYS A 156 ? 0.7716 2.1490 0.9837 -0.1455 0.0259  -0.3720 517 LYS A CD  
2538 C CE  . LYS A 156 ? 1.0496 2.3579 1.2475 -0.1687 0.0337  -0.3557 517 LYS A CE  
2539 N NZ  . LYS A 156 ? 1.0498 2.3652 1.2346 -0.1943 0.0409  -0.3774 517 LYS A NZ  
2553 N N   . VAL A 157 ? 0.4560 1.7534 0.6961 -0.0446 0.0057  -0.2650 518 VAL A N   
2554 C CA  . VAL A 157 ? 0.4358 1.6875 0.6636 -0.0325 0.0043  -0.2353 518 VAL A CA  
2555 C C   . VAL A 157 ? 0.6477 1.8962 0.8865 0.0103  -0.0002 -0.2048 518 VAL A C   
2556 O O   . VAL A 157 ? 0.4245 1.6613 0.6519 0.0332  -0.0039 -0.1828 518 VAL A O   
2557 C CB  . VAL A 157 ? 0.4772 1.6631 0.6993 -0.0608 0.0142  -0.2256 518 VAL A CB  
2558 C CG1 . VAL A 157 ? 0.4664 1.6530 0.6822 -0.1044 0.0232  -0.2555 518 VAL A CG1 
2559 C CG2 . VAL A 157 ? 0.5358 1.6846 0.7743 -0.0499 0.0192  -0.2039 518 VAL A CG2 
2569 N N   . LEU A 158 ? 0.4340 1.6936 0.6953 0.0211  0.0021  -0.2043 519 LEU A N   
2570 C CA  . LEU A 158 ? 0.4351 1.6929 0.7104 0.0620  0.0015  -0.1767 519 LEU A CA  
2571 C C   . LEU A 158 ? 0.5289 1.8417 0.7945 0.0988  -0.0096 -0.1734 519 LEU A C   
2572 O O   . LEU A 158 ? 0.4626 1.7638 0.7230 0.1325  -0.0100 -0.1446 519 LEU A O   
2573 C CB  . LEU A 158 ? 0.4383 1.7000 0.7429 0.0644  0.0080  -0.1805 519 LEU A CB  
2574 C CG  . LEU A 158 ? 0.4666 1.6684 0.7813 0.0385  0.0209  -0.1750 519 LEU A CG  
2575 C CD1 . LEU A 158 ? 0.4245 1.6415 0.7663 0.0350  0.0270  -0.1878 519 LEU A CD1 
2576 C CD2 . LEU A 158 ? 0.4014 1.5521 0.7186 0.0563  0.0287  -0.1425 519 LEU A CD2 
2588 N N   . THR A 159 ? 0.4802 1.8538 0.7416 0.0921  -0.0170 -0.2037 520 THR A N   
2589 C CA  . THR A 159 ? 0.5534 1.9866 0.8020 0.1263  -0.0278 -0.2045 520 THR A CA  
2590 C C   . THR A 159 ? 0.5048 1.9279 0.7252 0.1268  -0.0310 -0.1971 520 THR A C   
2591 O O   . THR A 159 ? 0.5207 1.9605 0.7263 0.1634  -0.0363 -0.1773 520 THR A O   
2592 C CB  . THR A 159 ? 0.5825 2.0907 0.8355 0.1169  -0.0334 -0.2443 520 THR A CB  
2593 O OG1 . THR A 159 ? 0.7349 2.2397 0.9808 0.0693  -0.0281 -0.2761 520 THR A OG1 
2594 C CG2 . THR A 159 ? 0.5422 2.0685 0.8236 0.1236  -0.0314 -0.2505 520 THR A CG2 
2602 N N   . ASP A 160 ? 0.5837 1.9786 0.7957 0.0873  -0.0265 -0.2123 521 ASP A N   
2603 C CA  . ASP A 160 ? 0.5148 1.8941 0.7037 0.0853  -0.0278 -0.2055 521 ASP A CA  
2604 C C   . ASP A 160 ? 0.5458 1.8746 0.7283 0.1112  -0.0259 -0.1645 521 ASP A C   
2605 O O   . ASP A 160 ? 0.5049 1.8417 0.6679 0.1345  -0.0297 -0.1503 521 ASP A O   
2606 C CB  . ASP A 160 ? 0.6279 1.9781 0.8126 0.0387  -0.0208 -0.2262 521 ASP A CB  
2607 C CG  . ASP A 160 ? 0.4988 1.9011 0.6846 0.0112  -0.0192 -0.2694 521 ASP A CG  
2608 O OD1 . ASP A 160 ? 0.6261 2.0880 0.8190 0.0263  -0.0242 -0.2853 521 ASP A OD1 
2609 O OD2 . ASP A 160 ? 0.8385 2.2234 1.0187 -0.0256 -0.0116 -0.2884 521 ASP A OD2 
2614 N N   . ILE A 161 ? 0.4474 1.7255 0.6463 0.1058  -0.0179 -0.1474 522 ILE A N   
2615 C CA  . ILE A 161 ? 0.4785 1.7099 0.6758 0.1284  -0.0122 -0.1113 522 ILE A CA  
2616 C C   . ILE A 161 ? 0.6392 1.9005 0.8326 0.1760  -0.0151 -0.0903 522 ILE A C   
2617 O O   . ILE A 161 ? 0.7398 1.9829 0.9172 0.1997  -0.0127 -0.0643 522 ILE A O   
2618 C CB  . ILE A 161 ? 0.4332 1.6140 0.6538 0.1145  -0.0007 -0.1020 522 ILE A CB  
2619 C CG1 . ILE A 161 ? 0.5308 1.6683 0.7446 0.0755  0.0036  -0.1104 522 ILE A CG1 
2620 C CG2 . ILE A 161 ? 0.4159 1.5638 0.6432 0.1453  0.0087  -0.0680 522 ILE A CG2 
2621 C CD1 . ILE A 161 ? 0.5342 1.6238 0.7663 0.0585  0.0153  -0.1045 522 ILE A CD1 
2633 N N   . LYS A 162 ? 0.4848 1.7928 0.6910 0.1909  -0.0193 -0.1012 523 LYS A N   
2634 C CA  . LYS A 162 ? 0.5182 1.8577 0.7195 0.2399  -0.0216 -0.0807 523 LYS A CA  
2635 C C   . LYS A 162 ? 0.5429 1.9265 0.7118 0.2590  -0.0312 -0.0826 523 LYS A C   
2636 O O   . LYS A 162 ? 0.6832 2.0671 0.8338 0.2978  -0.0295 -0.0541 523 LYS A O   
2637 C CB  . LYS A 162 ? 0.5378 1.9212 0.7621 0.2514  -0.0243 -0.0948 523 LYS A CB  
2638 C CG  . LYS A 162 ? 0.6786 2.0925 0.8982 0.3067  -0.0254 -0.0710 523 LYS A CG  
2639 C CD  . LYS A 162 ? 0.8988 2.3631 1.1414 0.3179  -0.0298 -0.0890 523 LYS A CD  
2640 C CE  . LYS A 162 ? 1.0215 2.5180 1.2557 0.3774  -0.0310 -0.0644 523 LYS A CE  
2641 N NZ  . LYS A 162 ? 0.9340 2.4775 1.1941 0.3916  -0.0345 -0.0803 523 LYS A NZ  
2655 N N   . ALA A 163 ? 0.5411 1.9613 0.7024 0.2312  -0.0386 -0.1171 524 ALA A N   
2656 C CA  . ALA A 163 ? 0.5846 2.0552 0.7192 0.2453  -0.0460 -0.1268 524 ALA A CA  
2657 C C   . ALA A 163 ? 0.5636 1.9960 0.6761 0.2417  -0.0427 -0.1111 524 ALA A C   
2658 O O   . ALA A 163 ? 0.5753 2.0336 0.6635 0.2680  -0.0451 -0.1016 524 ALA A O   
2659 C CB  . ALA A 163 ? 0.5715 2.0969 0.7107 0.2145  -0.0511 -0.1734 524 ALA A CB  
2665 N N   . ASP A 164 ? 0.5174 1.8908 0.6378 0.2097  -0.0366 -0.1092 525 ASP A N   
2666 C CA  . ASP A 164 ? 0.6626 1.9972 0.7648 0.2065  -0.0331 -0.0939 525 ASP A CA  
2667 C C   . ASP A 164 ? 0.5158 1.8263 0.6061 0.2466  -0.0275 -0.0527 525 ASP A C   
2668 O O   . ASP A 164 ? 0.7498 2.0260 0.8564 0.2562  -0.0199 -0.0317 525 ASP A O   
2669 C CB  . ASP A 164 ? 0.6796 1.9572 0.7939 0.1679  -0.0273 -0.0985 525 ASP A CB  
2670 C CG  . ASP A 164 ? 0.9176 2.1720 1.0138 0.1567  -0.0262 -0.0971 525 ASP A CG  
2671 O OD1 . ASP A 164 ? 0.8360 2.0489 0.9247 0.1699  -0.0210 -0.0691 525 ASP A OD1 
2672 O OD2 . ASP A 164 ? 1.0076 2.2868 1.0990 0.1344  -0.0292 -0.1257 525 ASP A OD2 
2677 N N   . LYS A 165 ? 0.5354 1.8644 0.5983 0.2691  -0.0285 -0.0424 526 LYS A N   
2678 C CA  . LYS A 165 ? 0.6550 1.9674 0.7012 0.3101  -0.0207 -0.0029 526 LYS A CA  
2679 C C   . LYS A 165 ? 0.5529 1.8203 0.5834 0.3064  -0.0132 0.0155  526 LYS A C   
2680 O O   . LYS A 165 ? 0.5644 1.8190 0.5771 0.3383  -0.0043 0.0473  526 LYS A O   
2681 C CB  . LYS A 165 ? 0.6038 1.9785 0.6272 0.3480  -0.0253 -0.0004 526 LYS A CB  
2682 C CG  . LYS A 165 ? 0.6315 2.0541 0.6681 0.3636  -0.0318 -0.0117 526 LYS A CG  
2683 C CD  . LYS A 165 ? 0.7795 2.1627 0.8434 0.3664  -0.0251 0.0044  526 LYS A CD  
2684 C CE  . LYS A 165 ? 0.9259 2.3572 0.9999 0.3937  -0.0300 0.0005  526 LYS A CE  
2685 N NZ  . LYS A 165 ? 1.1639 2.6094 1.2127 0.4497  -0.0246 0.0350  526 LYS A NZ  
2699 N N   . ASP A 166 ? 0.5104 1.7549 0.5468 0.2690  -0.0154 -0.0040 527 ASP A N   
2700 C CA  . ASP A 166 ? 0.5555 1.7554 0.5817 0.2632  -0.0086 0.0114  527 ASP A CA  
2701 C C   . ASP A 166 ? 0.5892 1.7355 0.6302 0.2692  0.0037  0.0399  527 ASP A C   
2702 O O   . ASP A 166 ? 0.6358 1.7700 0.7019 0.2623  0.0063  0.0382  527 ASP A O   
2703 C CB  . ASP A 166 ? 0.4859 1.6718 0.5180 0.2235  -0.0131 -0.0157 527 ASP A CB  
2704 C CG  . ASP A 166 ? 0.6267 1.8617 0.6466 0.2167  -0.0204 -0.0444 527 ASP A CG  
2705 O OD1 . ASP A 166 ? 0.8399 2.1250 0.8490 0.2402  -0.0234 -0.0470 527 ASP A OD1 
2706 O OD2 . ASP A 166 ? 0.6672 1.8925 0.6902 0.1883  -0.0219 -0.0653 527 ASP A OD2 
2711 N N   . GLN A 167 ? 0.6486 1.7649 0.6767 0.2808  0.0132  0.0634  528 GLN A N   
2712 C CA  . GLN A 167 ? 0.7619 1.8296 0.8059 0.2873  0.0295  0.0890  528 GLN A CA  
2713 C C   . GLN A 167 ? 0.5404 1.5642 0.6091 0.2491  0.0324  0.0750  528 GLN A C   
2714 O O   . GLN A 167 ? 0.4483 1.4588 0.5099 0.2283  0.0279  0.0637  528 GLN A O   
2715 C CB  . GLN A 167 ? 0.6853 1.7386 0.7070 0.3121  0.0413  0.1176  528 GLN A CB  
2716 C CG  . GLN A 167 ? 0.8863 1.8902 0.9254 0.3207  0.0646  0.1434  528 GLN A CG  
2717 C CD  . GLN A 167 ? 1.1080 2.1149 1.1581 0.3484  0.0757  0.1605  528 GLN A CD  
2718 O OE1 . GLN A 167 ? 1.1859 2.2273 1.2135 0.3845  0.0736  0.1756  528 GLN A OE1 
2719 N NE2 . GLN A 167 ? 1.0189 1.9904 1.1026 0.3327  0.0886  0.1570  528 GLN A NE2 
2728 N N   . ALA A 168 ? 0.4793 1.4824 0.5761 0.2421  0.0408  0.0755  529 ALA A N   
2729 C CA  . ALA A 168 ? 0.4031 1.3646 0.5220 0.2084  0.0465  0.0636  529 ALA A CA  
2730 C C   . ALA A 168 ? 0.6025 1.5213 0.7391 0.2147  0.0694  0.0823  529 ALA A C   
2731 O O   . ALA A 168 ? 0.7153 1.6335 0.8683 0.2311  0.0810  0.0921  529 ALA A O   
2732 C CB  . ALA A 168 ? 0.5024 1.4766 0.6401 0.1873  0.0389  0.0410  529 ALA A CB  
2738 N N   . ASN A 169 ? 0.4439 1.3275 0.5779 0.2010  0.0777  0.0846  530 ASN A N   
2739 C CA  . ASN A 169 ? 0.4027 1.2443 0.5521 0.2018  0.1031  0.0970  530 ASN A CA  
2740 C C   . ASN A 169 ? 0.6002 1.4223 0.7812 0.1896  0.1164  0.0893  530 ASN A C   
2741 O O   . ASN A 169 ? 0.5959 1.3947 0.7908 0.2012  0.1413  0.1018  530 ASN A O   
2742 C CB  . ASN A 169 ? 0.4993 1.3105 0.6440 0.1793  0.1058  0.0896  530 ASN A CB  
2743 C CG  . ASN A 169 ? 0.5232 1.3433 0.6416 0.1959  0.1036  0.1022  530 ASN A CG  
2744 O OD1 . ASN A 169 ? 0.5308 1.3796 0.6316 0.2247  0.1005  0.1178  530 ASN A OD1 
2745 N ND2 . ASN A 169 ? 0.4130 1.2111 0.5275 0.1790  0.1051  0.0947  530 ASN A ND2 
2752 N N   . ASP A 170 ? 0.5212 1.3514 0.7124 0.1661  0.1025  0.0681  531 ASP A N   
2753 C CA  . ASP A 170 ? 0.6927 1.5057 0.9134 0.1507  0.1138  0.0573  531 ASP A CA  
2754 C C   . ASP A 170 ? 0.6713 1.5177 0.8986 0.1470  0.0980  0.0436  531 ASP A C   
2755 O O   . ASP A 170 ? 0.4798 1.3158 0.7240 0.1237  0.0988  0.0276  531 ASP A O   
2756 C CB  . ASP A 170 ? 0.7198 1.4965 0.9472 0.1176  0.1183  0.0426  531 ASP A CB  
2757 C CG  . ASP A 170 ? 0.9376 1.7237 1.1455 0.0983  0.0959  0.0296  531 ASP A CG  
2758 O OD1 . ASP A 170 ? 1.0777 1.8933 1.2656 0.1086  0.0801  0.0314  531 ASP A OD1 
2759 O OD2 . ASP A 170 ? 0.8816 1.6463 1.0929 0.0740  0.0957  0.0175  531 ASP A OD2 
2764 N N   . GLY A 171 ? 0.3984 1.2865 0.6108 0.1694  0.0842  0.0486  532 GLY A N   
2765 C CA  . GLY A 171 ? 0.5269 1.4528 0.7446 0.1660  0.0696  0.0324  532 GLY A CA  
2766 C C   . GLY A 171 ? 0.5667 1.4956 0.7746 0.1325  0.0548  0.0097  532 GLY A C   
2767 O O   . GLY A 171 ? 0.4205 1.3203 0.6192 0.1138  0.0556  0.0079  532 GLY A O   
2771 N N   . LEU A 172 ? 0.3595 1.3250 0.5691 0.1259  0.0429  -0.0081 533 LEU A N   
2772 C CA  . LEU A 172 ? 0.4712 1.4409 0.6719 0.0940  0.0330  -0.0307 533 LEU A CA  
2773 C C   . LEU A 172 ? 0.4096 1.3672 0.6308 0.0704  0.0383  -0.0448 533 LEU A C   
2774 O O   . LEU A 172 ? 0.3442 1.3005 0.5884 0.0807  0.0471  -0.0406 533 LEU A O   
2775 C CB  . LEU A 172 ? 0.5573 1.5781 0.7434 0.0980  0.0187  -0.0456 533 LEU A CB  
2776 C CG  . LEU A 172 ? 0.3703 1.4065 0.5319 0.1188  0.0127  -0.0351 533 LEU A CG  
2777 C CD1 . LEU A 172 ? 0.4577 1.5521 0.6092 0.1288  0.0011  -0.0507 533 LEU A CD1 
2778 C CD2 . LEU A 172 ? 0.3554 1.3657 0.5013 0.0995  0.0117  -0.0381 533 LEU A CD2 
2790 N N   . SER A 173 ? 0.3295 1.2795 0.5416 0.0399  0.0343  -0.0614 534 SER A N   
2791 C CA  . SER A 173 ? 0.4030 1.3372 0.6280 0.0155  0.0402  -0.0736 534 SER A CA  
2792 C C   . SER A 173 ? 0.3331 1.2992 0.5545 -0.0053 0.0336  -0.0982 534 SER A C   
2793 O O   . SER A 173 ? 0.4003 1.3823 0.6041 -0.0165 0.0270  -0.1091 534 SER A O   
2794 C CB  . SER A 173 ? 0.3115 1.2012 0.5268 -0.0034 0.0457  -0.0692 534 SER A CB  
2795 O OG  . SER A 173 ? 0.4063 1.2674 0.6274 0.0122  0.0542  -0.0508 534 SER A OG  
2801 N N   . SER A 174 ? 0.3383 1.3142 0.5780 -0.0118 0.0376  -0.1088 535 SER A N   
2802 C CA  . SER A 174 ? 0.4119 1.4158 0.6498 -0.0350 0.0347  -0.1346 535 SER A CA  
2803 C C   . SER A 174 ? 0.4843 1.4552 0.7154 -0.0678 0.0422  -0.1427 535 SER A C   
2804 O O   . SER A 174 ? 0.3596 1.3458 0.5846 -0.0928 0.0431  -0.1640 535 SER A O   
2805 C CB  . SER A 174 ? 0.3929 1.4347 0.6538 -0.0211 0.0342  -0.1436 535 SER A CB  
2806 O OG  . SER A 174 ? 0.3558 1.3725 0.6386 -0.0134 0.0442  -0.1322 535 SER A OG  
2812 N N   . ALA A 175 ? 0.2824 1.1063 0.5070 0.0316  0.0300  -0.0203 536 ALA A N   
2813 C CA  . ALA A 175 ? 0.2682 1.0462 0.5035 0.0127  0.0378  -0.0272 536 ALA A CA  
2814 C C   . ALA A 175 ? 0.2906 1.0045 0.5290 0.0150  0.0437  -0.0130 536 ALA A C   
2815 O O   . ALA A 175 ? 0.2466 0.9490 0.4819 0.0334  0.0425  0.0050  536 ALA A O   
2816 C CB  . ALA A 175 ? 0.2726 1.0611 0.5197 0.0219  0.0390  -0.0265 536 ALA A CB  
2822 N N   . LEU A 176 ? 0.2689 0.9457 0.5119 -0.0051 0.0503  -0.0215 537 LEU A N   
2823 C CA  . LEU A 176 ? 0.2228 0.8425 0.4707 -0.0027 0.0560  -0.0103 537 LEU A CA  
2824 C C   . LEU A 176 ? 0.2971 0.8968 0.5554 0.0000  0.0607  -0.0069 537 LEU A C   
2825 O O   . LEU A 176 ? 0.2983 0.9191 0.5581 -0.0117 0.0624  -0.0185 537 LEU A O   
2826 C CB  . LEU A 176 ? 0.2876 0.8834 0.5310 -0.0245 0.0599  -0.0218 537 LEU A CB  
2827 C CG  . LEU A 176 ? 0.3883 0.9987 0.6230 -0.0266 0.0569  -0.0282 537 LEU A CG  
2828 C CD1 . LEU A 176 ? 0.3797 0.9659 0.6131 -0.0465 0.0619  -0.0419 537 LEU A CD1 
2829 C CD2 . LEU A 176 ? 0.3997 1.0022 0.6331 -0.0038 0.0550  -0.0095 537 LEU A CD2 
2841 N N   . LEU A 177 ? 0.3094 0.8732 0.5743 0.0141  0.0632  0.0074  538 LEU A N   
2842 C CA  . LEU A 177 ? 0.2465 0.7881 0.5207 0.0161  0.0685  0.0087  538 LEU A CA  
2843 C C   . LEU A 177 ? 0.3333 0.8301 0.6069 0.0037  0.0735  0.0088  538 LEU A C   
2844 O O   . LEU A 177 ? 0.2112 0.6853 0.4847 0.0097  0.0727  0.0169  538 LEU A O   
2845 C CB  . LEU A 177 ? 0.2511 0.7919 0.5339 0.0423  0.0672  0.0226  538 LEU A CB  
2846 C CG  . LEU A 177 ? 0.2310 0.7544 0.5245 0.0468  0.0727  0.0210  538 LEU A CG  
2847 C CD1 . LEU A 177 ? 0.2672 0.8271 0.5635 0.0443  0.0736  0.0087  538 LEU A CD1 
2848 C CD2 . LEU A 177 ? 0.4013 0.9144 0.7027 0.0726  0.0719  0.0360  538 LEU A CD2 
2860 N N   . ILE A 178 ? 0.3455 0.8349 0.6168 -0.0140 0.0786  -0.0001 539 ILE A N   
2861 C CA  . ILE A 178 ? 0.3280 0.7810 0.5966 -0.0249 0.0829  0.0005  539 ILE A CA  
2862 C C   . ILE A 178 ? 0.3386 0.7792 0.6118 -0.0231 0.0882  0.0019  539 ILE A C   
2863 O O   . ILE A 178 ? 0.2494 0.7113 0.5210 -0.0291 0.0914  -0.0047 539 ILE A O   
2864 C CB  . ILE A 178 ? 0.3730 0.8290 0.6292 -0.0514 0.0851  -0.0111 539 ILE A CB  
2865 C CG1 . ILE A 178 ? 0.3818 0.8578 0.6344 -0.0527 0.0800  -0.0168 539 ILE A CG1 
2866 C CG2 . ILE A 178 ? 0.3002 0.7229 0.5527 -0.0607 0.0887  -0.0095 539 ILE A CG2 
2867 C CD1 . ILE A 178 ? 0.3440 0.8277 0.5848 -0.0825 0.0828  -0.0339 539 ILE A CD1 
2879 N N   . LEU A 179 ? 0.2337 0.6455 0.5127 -0.0150 0.0892  0.0087  540 LEU A N   
2880 C CA  . LEU A 179 ? 0.5693 0.9741 0.8527 -0.0117 0.0942  0.0083  540 LEU A CA  
2881 C C   . LEU A 179 ? 0.3332 0.7105 0.6151 -0.0172 0.0958  0.0110  540 LEU A C   
2882 O O   . LEU A 179 ? 0.2753 0.6372 0.5587 -0.0154 0.0915  0.0152  540 LEU A O   
2883 C CB  . LEU A 179 ? 0.4223 0.8349 0.7192 0.0115  0.0926  0.0124  540 LEU A CB  
2884 C CG  . LEU A 179 ? 0.2582 0.6523 0.5612 0.0253  0.0884  0.0225  540 LEU A CG  
2885 C CD1 . LEU A 179 ? 0.6343 1.0051 0.9417 0.0258  0.0908  0.0240  540 LEU A CD1 
2886 C CD2 . LEU A 179 ? 0.5497 0.9618 0.8601 0.0476  0.0859  0.0306  540 LEU A CD2 
2898 N N   . TYR A 180 ? 0.3192 0.6964 0.5971 -0.0235 0.1017  0.0077  541 TYR A N   
2899 C CA  . TYR A 180 ? 0.2662 0.6258 0.5398 -0.0302 0.1031  0.0093  541 TYR A CA  
2900 C C   . TYR A 180 ? 0.1761 0.5356 0.4621 -0.0151 0.1055  0.0094  541 TYR A C   
2901 O O   . TYR A 180 ? 0.2053 0.5810 0.4910 -0.0118 0.1113  0.0023  541 TYR A O   
2902 C CB  . TYR A 180 ? 0.3100 0.6618 0.5567 -0.0565 0.1082  0.0029  541 TYR A CB  
2903 C CG  . TYR A 180 ? 0.3175 0.6195 0.5395 -0.0588 0.1032  0.0045  541 TYR A CG  
2904 C CD1 . TYR A 180 ? 0.2425 0.5048 0.4557 -0.0531 0.0917  0.0095  541 TYR A CD1 
2905 C CD2 . TYR A 180 ? 0.3693 0.6705 0.5765 -0.0654 0.1094  -0.0005 541 TYR A CD2 
2906 C CE1 . TYR A 180 ? 0.2863 0.5094 0.4769 -0.0525 0.0846  0.0105  541 TYR A CE1 
2907 C CE2 . TYR A 180 ? 0.2624 0.5212 0.4434 -0.0668 0.1033  0.0010  541 TYR A CE2 
2908 C CZ  . TYR A 180 ? 0.3654 0.5854 0.5384 -0.0598 0.0900  0.0069  541 TYR A CZ  
2909 O OH  . TYR A 180 ? 0.3743 0.5581 0.5220 -0.0580 0.0812  0.0080  541 TYR A OH  
2919 N N   . LEU A 181 ? 0.1708 0.5001 0.4625 -0.0052 0.0987  0.0156  542 LEU A N   
2920 C CA  . LEU A 181 ? 0.2559 0.5672 0.5534 0.0063  0.0984  0.0135  542 LEU A CA  
2921 C C   . LEU A 181 ? 0.3149 0.5940 0.5893 -0.0043 0.0942  0.0068  542 LEU A C   
2922 O O   . LEU A 181 ? 0.3159 0.5708 0.5844 -0.0076 0.0853  0.0098  542 LEU A O   
2923 C CB  . LEU A 181 ? 0.2301 0.5274 0.5461 0.0182  0.0940  0.0235  542 LEU A CB  
2924 C CG  . LEU A 181 ? 0.3864 0.6540 0.7061 0.0251  0.0926  0.0200  542 LEU A CG  
2925 C CD1 . LEU A 181 ? 0.2780 0.5544 0.6028 0.0412  0.0992  0.0149  542 LEU A CD1 
2926 C CD2 . LEU A 181 ? 0.3041 0.5543 0.6378 0.0264  0.0887  0.0303  542 LEU A CD2 
2938 N N   . ASP A 182 ? 0.2066 0.4910 0.4676 -0.0080 0.1004  -0.0029 543 ASP A N   
2939 C CA  . ASP A 182 ? 0.4406 0.6980 0.6735 -0.0180 0.0967  -0.0086 543 ASP A CA  
2940 C C   . ASP A 182 ? 0.2583 0.4936 0.4973 -0.0076 0.0908  -0.0147 543 ASP A C   
2941 O O   . ASP A 182 ? 0.2887 0.5008 0.5251 -0.0088 0.0800  -0.0126 543 ASP A O   
2942 C CB  . ASP A 182 ? 0.4055 0.6829 0.6178 -0.0297 0.1078  -0.0170 543 ASP A CB  
2943 C CG  . ASP A 182 ? 0.4859 0.7342 0.6588 -0.0440 0.1043  -0.0182 543 ASP A CG  
2944 O OD1 . ASP A 182 ? 0.8760 1.1145 1.0216 -0.0626 0.1058  -0.0122 543 ASP A OD1 
2945 O OD2 . ASP A 182 ? 0.5488 0.7810 0.7146 -0.0370 0.0994  -0.0252 543 ASP A OD2 
2950 N N   . SER A 183 ? 0.2815 0.5260 0.5297 0.0032  0.0976  -0.0244 544 SER A N   
2951 C CA  . SER A 183 ? 0.3320 0.5516 0.5802 0.0095  0.0931  -0.0350 544 SER A CA  
2952 C C   . SER A 183 ? 0.4305 0.6560 0.6925 0.0272  0.1009  -0.0452 544 SER A C   
2953 O O   . SER A 183 ? 0.4432 0.6999 0.7149 0.0368  0.1095  -0.0442 544 SER A O   
2954 C CB  . SER A 183 ? 0.3971 0.6072 0.6126 -0.0017 0.0900  -0.0446 544 SER A CB  
2955 O OG  . SER A 183 ? 0.3717 0.6074 0.5693 -0.0073 0.1017  -0.0500 544 SER A OG  
2961 N N   . ALA A 184 ? 0.3118 0.5080 0.5741 0.0326  0.0971  -0.0569 545 ALA A N   
2962 C CA  . ALA A 184 ? 0.4212 0.6116 0.6903 0.0524  0.1034  -0.0707 545 ALA A CA  
2963 C C   . ALA A 184 ? 0.4441 0.6203 0.6933 0.0503  0.1026  -0.0939 545 ALA A C   
2964 O O   . ALA A 184 ? 0.4957 0.6568 0.7309 0.0345  0.0939  -0.0970 545 ALA A O   
2965 C CB  . ALA A 184 ? 0.4148 0.5712 0.7039 0.0635  0.1002  -0.0622 545 ALA A CB  
2971 N N   . ARG A 185 ? 0.5117 0.6969 0.7596 0.0688  0.1110  -0.1116 546 ARG A N   
2972 C CA  . ARG A 185 ? 0.4435 0.6199 0.6713 0.0700  0.1121  -0.1377 546 ARG A CA  
2973 C C   . ARG A 185 ? 0.4807 0.6187 0.7178 0.0923  0.1121  -0.1547 546 ARG A C   
2974 O O   . ARG A 185 ? 0.5521 0.6868 0.8068 0.1152  0.1160  -0.1492 546 ARG A O   
2975 C CB  . ARG A 185 ? 0.5537 0.7815 0.7649 0.0712  0.1245  -0.1495 546 ARG A CB  
2976 C CG  . ARG A 185 ? 0.7867 1.0314 0.9674 0.0446  0.1238  -0.1445 546 ARG A CG  
2977 C CD  . ARG A 185 ? 0.7722 1.0549 0.9291 0.0448  0.1367  -0.1649 546 ARG A CD  
2978 N NE  . ARG A 185 ? 0.9454 1.2515 1.0710 0.0186  0.1410  -0.1535 546 ARG A NE  
2979 C CZ  . ARG A 185 ? 1.0212 1.3777 1.1389 0.0099  0.1569  -0.1539 546 ARG A CZ  
2980 N NH1 . ARG A 185 ? 0.9240 1.3247 1.0671 0.0287  0.1693  -0.1672 546 ARG A NH1 
2981 N NH2 . ARG A 185 ? 0.9850 1.3480 1.0679 -0.0182 0.1602  -0.1408 546 ARG A NH2 
2995 N N   . ASN A 186 ? 0.5993 0.7065 0.8216 0.0863  0.1068  -0.1761 547 ASN A N   
2996 C CA  . ASN A 186 ? 0.6069 0.6719 0.8298 0.1062  0.1076  -0.1995 547 ASN A CA  
2997 C C   . ASN A 186 ? 0.5722 0.5878 0.8155 0.1187  0.1050  -0.1847 547 ASN A C   
2998 O O   . ASN A 186 ? 0.6967 0.6963 0.9446 0.1493  0.1099  -0.1920 547 ASN A O   
2999 C CB  . ASN A 186 ? 0.6818 0.7821 0.8981 0.1333  0.1198  -0.2218 547 ASN A CB  
3000 C CG  . ASN A 186 ? 0.5677 0.7183 0.7586 0.1190  0.1255  -0.2356 547 ASN A CG  
3001 O OD1 . ASN A 186 ? 0.6339 0.8417 0.8233 0.1260  0.1374  -0.2367 547 ASN A OD1 
3002 N ND2 . ASN A 186 ? 0.8018 0.9342 0.9712 0.0977  0.1170  -0.2458 547 ASN A ND2 
3009 N N   . LEU A 187 ? 0.5610 0.5537 0.8144 0.0967  0.0972  -0.1637 548 LEU A N   
3010 C CA  . LEU A 187 ? 0.6225 0.5644 0.8896 0.1026  0.0957  -0.1470 548 LEU A CA  
3011 C C   . LEU A 187 ? 0.7907 0.6617 1.0487 0.1023  0.0926  -0.1691 548 LEU A C   
3012 O O   . LEU A 187 ? 0.9032 0.7701 1.1486 0.0883  0.0887  -0.1951 548 LEU A O   
3013 C CB  . LEU A 187 ? 0.5466 0.4940 0.8268 0.0762  0.0905  -0.1198 548 LEU A CB  
3014 C CG  . LEU A 187 ? 0.4873 0.4908 0.7766 0.0783  0.0933  -0.0962 548 LEU A CG  
3015 C CD1 . LEU A 187 ? 0.5336 0.5429 0.8338 0.0531  0.0876  -0.0760 548 LEU A CD1 
3016 C CD2 . LEU A 187 ? 0.7352 0.7427 1.0329 0.1073  0.0994  -0.0822 548 LEU A CD2 
3028 N N   . PRO A 188 ? 0.8443 0.6561 1.1053 0.1174  0.0937  -0.1587 549 PRO A N   
3029 C CA  . PRO A 188 ? 0.9431 0.6724 1.1915 0.1192  0.0917  -0.1790 549 PRO A CA  
3030 C C   . PRO A 188 ? 1.1481 0.8513 1.3935 0.0775  0.0847  -0.1941 549 PRO A C   
3031 O O   . PRO A 188 ? 1.1335 0.8734 1.3907 0.0472  0.0805  -0.1801 549 PRO A O   
3032 C CB  . PRO A 188 ? 0.8910 0.5638 1.1420 0.1317  0.0931  -0.1500 549 PRO A CB  
3033 C CG  . PRO A 188 ? 0.8621 0.5957 1.1243 0.1572  0.0969  -0.1269 549 PRO A CG  
3034 C CD  . PRO A 188 ? 0.7347 0.5508 1.0069 0.1347  0.0967  -0.1260 549 PRO A CD  
3042 N N   . SER A 189 ? 1.5582 1.1992 1.7882 0.0780  0.0830  -0.2245 550 SER A N   
3043 C CA  . SER A 189 ? 1.7233 1.3398 1.9490 0.0393  0.0756  -0.2475 550 SER A CA  
3044 C C   . SER A 189 ? 1.6470 1.3362 1.8688 0.0272  0.0702  -0.2679 550 SER A C   
3045 O O   . SER A 189 ? 1.4895 1.2480 1.7174 0.0316  0.0711  -0.2508 550 SER A O   
3046 C CB  . SER A 189 ? 1.7110 1.3096 1.9527 0.0004  0.0730  -0.2222 550 SER A CB  
3047 O OG  . SER A 189 ? 1.7604 1.3326 1.9997 -0.0373 0.0661  -0.2480 550 SER A OG  
3053 N N   . GLY A 190 ? 1.5599 1.2289 1.7678 0.0114  0.0640  -0.3045 551 GLY A N   
3054 C CA  . GLY A 190 ? 1.4513 1.1829 1.6483 0.0012  0.0573  -0.3252 551 GLY A CA  
3055 C C   . GLY A 190 ? 1.4896 1.1998 1.6799 -0.0316 0.0462  -0.3572 551 GLY A C   
3056 O O   . GLY A 190 ? 1.6394 1.2930 1.8147 -0.0286 0.0466  -0.3900 551 GLY A O   
3060 N N   . ASN A 196 ? 1.1404 0.9410 1.4316 -0.1289 0.0353  -0.2441 557 ASN A N   
3061 C CA  . ASN A 196 ? 1.2113 1.0397 1.5048 -0.1004 0.0425  -0.2121 557 ASN A CA  
3062 C C   . ASN A 196 ? 1.0484 0.8708 1.3631 -0.1107 0.0495  -0.1778 557 ASN A C   
3063 O O   . ASN A 196 ? 1.3151 1.1312 1.6457 -0.1440 0.0479  -0.1770 557 ASN A O   
3064 C CB  . ASN A 196 ? 1.2327 1.1357 1.5228 -0.0929 0.0339  -0.2102 557 ASN A CB  
3065 C CG  . ASN A 196 ? 1.2382 1.1509 1.5003 -0.0682 0.0345  -0.2277 557 ASN A CG  
3066 O OD1 . ASN A 196 ? 1.3162 1.1931 1.5667 -0.0473 0.0440  -0.2349 557 ASN A OD1 
3067 N ND2 . ASN A 196 ? 1.1418 1.1052 1.3913 -0.0692 0.0245  -0.2339 557 ASN A ND2 
3073 N N   . PRO A 197 ? 0.8304 0.6598 1.1447 -0.0838 0.0577  -0.1503 558 PRO A N   
3074 C CA  . PRO A 197 ? 0.7139 0.5451 1.0441 -0.0894 0.0645  -0.1164 558 PRO A CA  
3075 C C   . PRO A 197 ? 0.7123 0.6178 1.0585 -0.0937 0.0601  -0.1013 558 PRO A C   
3076 O O   . PRO A 197 ? 0.6585 0.6077 1.0009 -0.0904 0.0511  -0.1150 558 PRO A O   
3077 C CB  . PRO A 197 ? 0.7045 0.5082 1.0228 -0.0534 0.0734  -0.1002 558 PRO A CB  
3078 C CG  . PRO A 197 ? 0.8113 0.6487 1.1171 -0.0290 0.0708  -0.1182 558 PRO A CG  
3079 C CD  . PRO A 197 ? 0.9354 0.7727 1.2334 -0.0470 0.0620  -0.1520 558 PRO A CD  
3087 N N   . ASN A 198 ? 0.6559 0.5716 1.0161 -0.0995 0.0664  -0.0735 559 ASN A N   
3088 C CA  . ASN A 198 ? 0.4865 0.4674 0.8609 -0.0990 0.0636  -0.0589 559 ASN A CA  
3089 C C   . ASN A 198 ? 0.4923 0.4811 0.8623 -0.0732 0.0713  -0.0336 559 ASN A C   
3090 O O   . ASN A 198 ? 0.5025 0.4905 0.8807 -0.0779 0.0784  -0.0106 559 ASN A O   
3091 C CB  . ASN A 198 ? 0.5207 0.5229 0.9180 -0.1306 0.0644  -0.0519 559 ASN A CB  
3092 C CG  . ASN A 198 ? 0.6630 0.6806 1.0705 -0.1579 0.0543  -0.0794 559 ASN A CG  
3093 O OD1 . ASN A 198 ? 0.6400 0.6502 1.0346 -0.1524 0.0457  -0.1035 559 ASN A OD1 
3094 N ND2 . ASN A 198 ? 0.6736 0.7188 1.1044 -0.1885 0.0557  -0.0771 559 ASN A ND2 
3101 N N   . PRO A 199 ? 0.4999 0.5014 0.8560 -0.0479 0.0702  -0.0383 560 PRO A N   
3102 C CA  . PRO A 199 ? 0.4742 0.4824 0.8259 -0.0235 0.0775  -0.0193 560 PRO A CA  
3103 C C   . PRO A 199 ? 0.6124 0.6638 0.9753 -0.0251 0.0786  0.0016  560 PRO A C   
3104 O O   . PRO A 199 ? 0.3846 0.4740 0.7526 -0.0329 0.0721  -0.0028 560 PRO A O   
3105 C CB  . PRO A 199 ? 0.5325 0.5579 0.8690 -0.0054 0.0757  -0.0347 560 PRO A CB  
3106 C CG  . PRO A 199 ? 0.5584 0.5692 0.8864 -0.0167 0.0690  -0.0610 560 PRO A CG  
3107 C CD  . PRO A 199 ? 0.5798 0.5969 0.9226 -0.0433 0.0624  -0.0614 560 PRO A CD  
3115 N N   . VAL A 200 ? 0.5445 0.5887 0.9088 -0.0150 0.0860  0.0234  561 VAL A N   
3116 C CA  . VAL A 200 ? 0.3430 0.4290 0.7144 -0.0126 0.0880  0.0414  561 VAL A CA  
3117 C C   . VAL A 200 ? 0.3783 0.4648 0.7418 0.0128  0.0932  0.0550  561 VAL A C   
3118 O O   . VAL A 200 ? 0.4542 0.5007 0.8100 0.0256  0.0964  0.0592  561 VAL A O   
3119 C CB  . VAL A 200 ? 0.4498 0.5395 0.8338 -0.0338 0.0916  0.0561  561 VAL A CB  
3120 C CG1 . VAL A 200 ? 0.5185 0.5569 0.8949 -0.0349 0.0993  0.0732  561 VAL A CG1 
3121 C CG2 . VAL A 200 ? 0.4188 0.5592 0.8095 -0.0308 0.0928  0.0687  561 VAL A CG2 
3131 N N   . VAL A 201 ? 0.4219 0.5533 0.7862 0.0211  0.0929  0.0597  562 VAL A N   
3132 C CA  . VAL A 201 ? 0.2928 0.4396 0.6524 0.0441  0.0963  0.0692  562 VAL A CA  
3133 C C   . VAL A 201 ? 0.4580 0.6268 0.8209 0.0450  0.0991  0.0916  562 VAL A C   
3134 O O   . VAL A 201 ? 0.3901 0.5864 0.7593 0.0308  0.0983  0.0939  562 VAL A O   
3135 C CB  . VAL A 201 ? 0.4008 0.5855 0.7566 0.0502  0.0949  0.0558  562 VAL A CB  
3136 C CG1 . VAL A 201 ? 0.3595 0.5720 0.7148 0.0719  0.0982  0.0626  562 VAL A CG1 
3137 C CG2 . VAL A 201 ? 0.3640 0.5314 0.7120 0.0491  0.0934  0.0345  562 VAL A CG2 
3147 N N   . GLN A 202 ? 0.4685 0.6260 0.8252 0.0646  0.1017  0.1073  563 GLN A N   
3148 C CA  . GLN A 202 ? 0.3098 0.4924 0.6643 0.0698  0.1038  0.1293  563 GLN A CA  
3149 C C   . GLN A 202 ? 0.2989 0.5192 0.6509 0.0959  0.1018  0.1296  563 GLN A C   
3150 O O   . GLN A 202 ? 0.4306 0.6342 0.7779 0.1197  0.1008  0.1286  563 GLN A O   
3151 C CB  . GLN A 202 ? 0.4932 0.6280 0.8375 0.0685  0.1077  0.1525  563 GLN A CB  
3152 C CG  . GLN A 202 ? 0.9241 1.0830 1.2603 0.0730  0.1104  0.1784  563 GLN A CG  
3153 C CD  . GLN A 202 ? 1.1345 1.2464 1.4583 0.0577  0.1167  0.2024  563 GLN A CD  
3154 O OE1 . GLN A 202 ? 1.0837 1.1737 1.4147 0.0292  0.1205  0.1968  563 GLN A OE1 
3155 N NE2 . GLN A 202 ? 0.9741 1.0717 1.2775 0.0754  0.1178  0.2297  563 GLN A NE2 
3164 N N   . MET A 203 ? 0.4688 0.7427 0.8249 0.0917  0.1009  0.1279  564 MET A N   
3165 C CA  . MET A 203 ? 0.4442 0.7657 0.8006 0.1107  0.0988  0.1258  564 MET A CA  
3166 C C   . MET A 203 ? 0.3191 0.6676 0.6694 0.1197  0.0981  0.1467  564 MET A C   
3167 O O   . MET A 203 ? 0.2390 0.5933 0.5875 0.1034  0.1002  0.1554  564 MET A O   
3168 C CB  . MET A 203 ? 0.2230 0.5692 0.5694 0.0923  0.0939  0.1000  564 MET A CB  
3169 C CG  . MET A 203 ? 0.5935 0.9287 0.9445 0.0888  0.0958  0.0817  564 MET A CG  
3170 S SD  . MET A 203 ? 0.8747 1.2064 1.2109 0.0592  0.0915  0.0626  564 MET A SD  
3171 C CE  . MET A 203 ? 0.6114 0.9158 0.9595 0.0490  0.0926  0.0745  564 MET A CE  
3181 N N   . SER A 204 ? 0.3488 0.7199 0.6956 0.1474  0.0946  0.1534  565 SER A N   
3182 C CA  . SER A 204 ? 0.5048 0.9062 0.8416 0.1597  0.0919  0.1734  565 SER A CA  
3183 C C   . SER A 204 ? 0.4847 0.9223 0.8060 0.1750  0.0816  0.1594  565 SER A C   
3184 O O   . SER A 204 ? 0.4250 0.8610 0.7494 0.1902  0.0786  0.1454  565 SER A O   
3185 C CB  . SER A 204 ? 0.4121 0.7578 0.7308 0.1721  0.0930  0.2029  565 SER A CB  
3186 O OG  . SER A 204 ? 0.5582 0.8544 0.8741 0.1925  0.0914  0.2011  565 SER A OG  
3192 N N   . VAL A 205 ? 0.4250 0.8991 0.7316 0.1693  0.0766  0.1606  566 VAL A N   
3193 C CA  . VAL A 205 ? 0.3451 0.86